data_4KPE
# 
_entry.id   4KPE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4KPE         
NDB   NA2497       
RCSB  RCSB079627   
WWPDB D_1000079627 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3FOE 'Clinafloxacin-stabilised cleavage complex of topo IV from S. pneumoniae'                   unspecified 
PDB 3FOF 'Moxifloxacin-stabilised cleavage complex of topo IV from S. pneumoniae'                    unspecified 
PDB 2NOV 'Crystal structure of ParC55 from S. pneumoniae'                                            unspecified 
PDB 3K9F 'Levofloxacin-stabilised cleavage complex of topo IV from S. pneumoniae (soaked)'           unspecified 
PDB 3KSA 'Drug-free cleavage complex of topo IV from S. pneumoniae (cleaved form)'                   unspecified 
PDB 3KSB 'Drug-free cleavage complex of topo IV from S. pneumoniae (resealed form)'                  unspecified 
PDB 3LTN 'PD0305970-stabilised cleavage complex of topo IV from S. pneumoniae'                       unspecified 
PDB 3RAD 'Quinolone(Clinafloxacin)-DNA cleavage complex of type IV topoisomerase from S. pneumoniae' unspecified 
PDB 3RAE 'Quinolone(Levofloxacin)-DNA cleavage complex of type IV topoisomerase from S. pneumoniae'  unspecified 
PDB 3RAF 'Quinazolinedione-DNA cleavage complex of type IV topoisomerase from S. pneumoniae'         unspecified 
PDB 4KOE .                                                                                           unspecified 
PDB 4KPF .                                                                                           unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4KPE 
_pdbx_database_status.recvd_initial_deposition_date   2013-05-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Laponogov, I.'   1 
'Pan, X.-S.'      2 
'Vesekov, D.A.'   3 
'Cirz, R.T.'      4 
'Wagman, A.S.'    5 
'Moser, H.E.'     6 
'Fisher, L.M.'    7 
'Sanderson, M.R.' 8 
# 
_citation.id                        primary 
_citation.title                     
;Exploring the active site of the Streptococcus pneumoniae topoisomerase IV-DNA cleavage complex with novel 7,8-bridged fluoroquinolones.
;
_citation.journal_abbrev            'Open Biol' 
_citation.journal_volume            6 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2016 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2046-2441 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   27655731 
_citation.pdbx_database_id_DOI      10.1098/rsob.160157 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Laponogov, I.'   1 ?                   
primary 'Pan, X.S.'       2 ?                   
primary 'Veselkov, D.A.'  3 ?                   
primary 'Cirz, R.T.'      4 ?                   
primary 'Wagman, A.'      5 ?                   
primary 'Moser, H.E.'     6 ?                   
primary 'Fisher, L.M.'    7 0000-0002-2172-3369 
primary 'Sanderson, M.R.' 8 0000-0003-4235-7780 
# 
_cell.entry_id           4KPE 
_cell.length_a           157.830 
_cell.length_b           157.830 
_cell.length_c           210.710 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4KPE 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA topoisomerase 4 subunit A' 56455.434 2  5.99.1.3 I257T          'ParC55, UNP residues 1-488'   ? 
2 polymer     man 'DNA topoisomerase 4 subunit B' 30415.703 2  5.99.1.3 'V460I, T644A' 'ParE30, UNP residues 404-647' ? 
3 polymer     syn 'E-site DNA1' 2121.436  1  ?        ?              ?                              ? 
4 polymer     syn 'E-site DNA2' 3348.209  1  ?        ?              ?                              ? 
5 polymer     syn 'E-site DNA3' 2113.410  1  ?        ?              ?                              ? 
6 polymer     syn 'E-site DNA4' 3358.211  1  ?        ?              ?                              ? 
7 non-polymer syn 'MAGNESIUM ION' 24.305    6  ?        ?              ?                              ? 
8 non-polymer syn 
;(7aR,8R)-8-amino-4-cyclopropyl-12-fluoro-1-oxo-4,7,7a,8,9,10-hexahydro-1H-pyrrolo[1',2':1,7]azepino[2,3-h]quinoline-2-carboxylic acid
;
369.390   2  ?        ?              ?                              ? 
9 water       nat water 18.015    24 ?        ?              ?                              ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Topoisomerase IV subunit A' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MSNIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFHPHGDSS
IYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTVLPAAFP
NLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRS
KTEIEKLKGGKEQIVITEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNYLFKYTD
LQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKAD
AKENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKFATPRLS
SLEDTAKALEHHHHHH
;
;MSNIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFHPHGDSS
IYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTVLPAAFP
NLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRS
KTEIEKLKGGKEQIVITEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNYLFKYTD
LQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKAD
AKENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKFATPRLS
SLEDTAKALEHHHHHH
;
A,B ? 
2 'polypeptide(L)'        no no 
;MGHHHHHHHHHHSSGHIDDDDKHMKNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKV
INTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIAL
PPLYKMSKGKGKKEEVAYAWTDGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVN
VLMGDKVEPRRKWIEDNVKFTLEEATVF
;
;MGHHHHHHHHHHSSGHIDDDDKHMKNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKV
INTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIAL
PPLYKMSKGKGKKEEVAYAWTDGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVN
VLMGDKVEPRRKWIEDNVKFTLEEATVF
;
C,D ? 
3 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DG)(DA)(DA)(DT)' CATGAAT E   ? 
4 polydeoxyribonucleotide no no '(DA)(DG)(DT)(DC)(DA)(DT)(DT)(DC)(DA)(DT)(DG)' AGTCATTCATG F   ? 
5 polydeoxyribonucleotide no no '(DC)(DG)(DT)(DG)(DC)(DA)(DT)' CGTGCAT G   ? 
6 polydeoxyribonucleotide no no '(DG)(DA)(DC)(DT)(DA)(DT)(DG)(DC)(DA)(DC)(DG)' GACTATGCACG H   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ASN n 
1 4   ILE n 
1 5   GLN n 
1 6   ASN n 
1 7   MET n 
1 8   SER n 
1 9   LEU n 
1 10  GLU n 
1 11  ASP n 
1 12  ILE n 
1 13  MET n 
1 14  GLY n 
1 15  GLU n 
1 16  ARG n 
1 17  PHE n 
1 18  GLY n 
1 19  ARG n 
1 20  TYR n 
1 21  SER n 
1 22  LYS n 
1 23  TYR n 
1 24  ILE n 
1 25  ILE n 
1 26  GLN n 
1 27  ASP n 
1 28  ARG n 
1 29  ALA n 
1 30  LEU n 
1 31  PRO n 
1 32  ASP n 
1 33  ILE n 
1 34  ARG n 
1 35  ASP n 
1 36  GLY n 
1 37  LEU n 
1 38  LYS n 
1 39  PRO n 
1 40  VAL n 
1 41  GLN n 
1 42  ARG n 
1 43  ARG n 
1 44  ILE n 
1 45  LEU n 
1 46  TYR n 
1 47  SER n 
1 48  MET n 
1 49  ASN n 
1 50  LYS n 
1 51  ASP n 
1 52  SER n 
1 53  ASN n 
1 54  THR n 
1 55  PHE n 
1 56  ASP n 
1 57  LYS n 
1 58  SER n 
1 59  TYR n 
1 60  ARG n 
1 61  LYS n 
1 62  SER n 
1 63  ALA n 
1 64  LYS n 
1 65  SER n 
1 66  VAL n 
1 67  GLY n 
1 68  ASN n 
1 69  ILE n 
1 70  MET n 
1 71  GLY n 
1 72  ASN n 
1 73  PHE n 
1 74  HIS n 
1 75  PRO n 
1 76  HIS n 
1 77  GLY n 
1 78  ASP n 
1 79  SER n 
1 80  SER n 
1 81  ILE n 
1 82  TYR n 
1 83  ASP n 
1 84  ALA n 
1 85  MET n 
1 86  VAL n 
1 87  ARG n 
1 88  MET n 
1 89  SER n 
1 90  GLN n 
1 91  ASN n 
1 92  TRP n 
1 93  LYS n 
1 94  ASN n 
1 95  ARG n 
1 96  GLU n 
1 97  ILE n 
1 98  LEU n 
1 99  VAL n 
1 100 GLU n 
1 101 MET n 
1 102 HIS n 
1 103 GLY n 
1 104 ASN n 
1 105 ASN n 
1 106 GLY n 
1 107 SER n 
1 108 MET n 
1 109 ASP n 
1 110 GLY n 
1 111 ASP n 
1 112 PRO n 
1 113 PRO n 
1 114 ALA n 
1 115 ALA n 
1 116 MET n 
1 117 ARG n 
1 118 TYR n 
1 119 THR n 
1 120 GLU n 
1 121 ALA n 
1 122 ARG n 
1 123 LEU n 
1 124 SER n 
1 125 GLU n 
1 126 ILE n 
1 127 ALA n 
1 128 GLY n 
1 129 TYR n 
1 130 LEU n 
1 131 LEU n 
1 132 GLN n 
1 133 ASP n 
1 134 ILE n 
1 135 GLU n 
1 136 LYS n 
1 137 LYS n 
1 138 THR n 
1 139 VAL n 
1 140 PRO n 
1 141 PHE n 
1 142 ALA n 
1 143 TRP n 
1 144 ASN n 
1 145 PHE n 
1 146 ASP n 
1 147 ASP n 
1 148 THR n 
1 149 GLU n 
1 150 LYS n 
1 151 GLU n 
1 152 PRO n 
1 153 THR n 
1 154 VAL n 
1 155 LEU n 
1 156 PRO n 
1 157 ALA n 
1 158 ALA n 
1 159 PHE n 
1 160 PRO n 
1 161 ASN n 
1 162 LEU n 
1 163 LEU n 
1 164 VAL n 
1 165 ASN n 
1 166 GLY n 
1 167 SER n 
1 168 THR n 
1 169 GLY n 
1 170 ILE n 
1 171 SER n 
1 172 ALA n 
1 173 GLY n 
1 174 TYR n 
1 175 ALA n 
1 176 THR n 
1 177 ASP n 
1 178 ILE n 
1 179 PRO n 
1 180 PRO n 
1 181 HIS n 
1 182 ASN n 
1 183 LEU n 
1 184 ALA n 
1 185 GLU n 
1 186 VAL n 
1 187 ILE n 
1 188 ASP n 
1 189 ALA n 
1 190 ALA n 
1 191 VAL n 
1 192 TYR n 
1 193 MET n 
1 194 ILE n 
1 195 ASP n 
1 196 HIS n 
1 197 PRO n 
1 198 THR n 
1 199 ALA n 
1 200 LYS n 
1 201 ILE n 
1 202 ASP n 
1 203 LYS n 
1 204 LEU n 
1 205 MET n 
1 206 GLU n 
1 207 PHE n 
1 208 LEU n 
1 209 PRO n 
1 210 GLY n 
1 211 PRO n 
1 212 ASP n 
1 213 PHE n 
1 214 PRO n 
1 215 THR n 
1 216 GLY n 
1 217 ALA n 
1 218 ILE n 
1 219 ILE n 
1 220 GLN n 
1 221 GLY n 
1 222 ARG n 
1 223 ASP n 
1 224 GLU n 
1 225 ILE n 
1 226 LYS n 
1 227 LYS n 
1 228 ALA n 
1 229 TYR n 
1 230 GLU n 
1 231 THR n 
1 232 GLY n 
1 233 LYS n 
1 234 GLY n 
1 235 ARG n 
1 236 VAL n 
1 237 VAL n 
1 238 VAL n 
1 239 ARG n 
1 240 SER n 
1 241 LYS n 
1 242 THR n 
1 243 GLU n 
1 244 ILE n 
1 245 GLU n 
1 246 LYS n 
1 247 LEU n 
1 248 LYS n 
1 249 GLY n 
1 250 GLY n 
1 251 LYS n 
1 252 GLU n 
1 253 GLN n 
1 254 ILE n 
1 255 VAL n 
1 256 ILE n 
1 257 THR n 
1 258 GLU n 
1 259 ILE n 
1 260 PRO n 
1 261 TYR n 
1 262 GLU n 
1 263 ILE n 
1 264 ASN n 
1 265 LYS n 
1 266 ALA n 
1 267 ASN n 
1 268 LEU n 
1 269 VAL n 
1 270 LYS n 
1 271 LYS n 
1 272 ILE n 
1 273 ASP n 
1 274 ASP n 
1 275 VAL n 
1 276 ARG n 
1 277 VAL n 
1 278 ASN n 
1 279 ASN n 
1 280 LYS n 
1 281 VAL n 
1 282 ALA n 
1 283 GLY n 
1 284 ILE n 
1 285 ALA n 
1 286 GLU n 
1 287 VAL n 
1 288 ARG n 
1 289 ASP n 
1 290 GLU n 
1 291 SER n 
1 292 ASP n 
1 293 ARG n 
1 294 ASP n 
1 295 GLY n 
1 296 LEU n 
1 297 ARG n 
1 298 ILE n 
1 299 ALA n 
1 300 ILE n 
1 301 GLU n 
1 302 LEU n 
1 303 LYS n 
1 304 LYS n 
1 305 ASP n 
1 306 ALA n 
1 307 ASN n 
1 308 THR n 
1 309 GLU n 
1 310 LEU n 
1 311 VAL n 
1 312 LEU n 
1 313 ASN n 
1 314 TYR n 
1 315 LEU n 
1 316 PHE n 
1 317 LYS n 
1 318 TYR n 
1 319 THR n 
1 320 ASP n 
1 321 LEU n 
1 322 GLN n 
1 323 ILE n 
1 324 ASN n 
1 325 TYR n 
1 326 ASN n 
1 327 PHE n 
1 328 ASN n 
1 329 MET n 
1 330 VAL n 
1 331 ALA n 
1 332 ILE n 
1 333 ASP n 
1 334 ASN n 
1 335 PHE n 
1 336 THR n 
1 337 PRO n 
1 338 ARG n 
1 339 GLN n 
1 340 VAL n 
1 341 GLY n 
1 342 ILE n 
1 343 VAL n 
1 344 PRO n 
1 345 ILE n 
1 346 LEU n 
1 347 SER n 
1 348 SER n 
1 349 TYR n 
1 350 ILE n 
1 351 ALA n 
1 352 HIS n 
1 353 ARG n 
1 354 ARG n 
1 355 GLU n 
1 356 VAL n 
1 357 ILE n 
1 358 LEU n 
1 359 ALA n 
1 360 ARG n 
1 361 SER n 
1 362 ARG n 
1 363 PHE n 
1 364 ASP n 
1 365 LYS n 
1 366 GLU n 
1 367 LYS n 
1 368 ALA n 
1 369 GLU n 
1 370 LYS n 
1 371 ARG n 
1 372 LEU n 
1 373 HIS n 
1 374 ILE n 
1 375 VAL n 
1 376 GLU n 
1 377 GLY n 
1 378 LEU n 
1 379 ILE n 
1 380 ARG n 
1 381 VAL n 
1 382 ILE n 
1 383 SER n 
1 384 ILE n 
1 385 LEU n 
1 386 ASP n 
1 387 GLU n 
1 388 VAL n 
1 389 ILE n 
1 390 ALA n 
1 391 LEU n 
1 392 ILE n 
1 393 ARG n 
1 394 ALA n 
1 395 SER n 
1 396 GLU n 
1 397 ASN n 
1 398 LYS n 
1 399 ALA n 
1 400 ASP n 
1 401 ALA n 
1 402 LYS n 
1 403 GLU n 
1 404 ASN n 
1 405 LEU n 
1 406 LYS n 
1 407 VAL n 
1 408 SER n 
1 409 TYR n 
1 410 ASP n 
1 411 PHE n 
1 412 THR n 
1 413 GLU n 
1 414 GLU n 
1 415 GLN n 
1 416 ALA n 
1 417 GLU n 
1 418 ALA n 
1 419 ILE n 
1 420 VAL n 
1 421 THR n 
1 422 LEU n 
1 423 GLN n 
1 424 LEU n 
1 425 TYR n 
1 426 ARG n 
1 427 LEU n 
1 428 THR n 
1 429 ASN n 
1 430 THR n 
1 431 ASP n 
1 432 VAL n 
1 433 VAL n 
1 434 VAL n 
1 435 LEU n 
1 436 GLN n 
1 437 GLU n 
1 438 GLU n 
1 439 GLU n 
1 440 ALA n 
1 441 GLU n 
1 442 LEU n 
1 443 ARG n 
1 444 GLU n 
1 445 LYS n 
1 446 ILE n 
1 447 ALA n 
1 448 MET n 
1 449 LEU n 
1 450 ALA n 
1 451 ALA n 
1 452 ILE n 
1 453 ILE n 
1 454 GLY n 
1 455 ASP n 
1 456 GLU n 
1 457 ARG n 
1 458 THR n 
1 459 MET n 
1 460 TYR n 
1 461 ASN n 
1 462 LEU n 
1 463 MET n 
1 464 LYS n 
1 465 LYS n 
1 466 GLU n 
1 467 LEU n 
1 468 ARG n 
1 469 GLU n 
1 470 VAL n 
1 471 LYS n 
1 472 LYS n 
1 473 LYS n 
1 474 PHE n 
1 475 ALA n 
1 476 THR n 
1 477 PRO n 
1 478 ARG n 
1 479 LEU n 
1 480 SER n 
1 481 SER n 
1 482 LEU n 
1 483 GLU n 
1 484 ASP n 
1 485 THR n 
1 486 ALA n 
1 487 LYS n 
1 488 ALA n 
1 489 LEU n 
1 490 GLU n 
1 491 HIS n 
1 492 HIS n 
1 493 HIS n 
1 494 HIS n 
1 495 HIS n 
1 496 HIS n 
2 1   MET n 
2 2   GLY n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   HIS n 
2 10  HIS n 
2 11  HIS n 
2 12  HIS n 
2 13  SER n 
2 14  SER n 
2 15  GLY n 
2 16  HIS n 
2 17  ILE n 
2 18  ASP n 
2 19  ASP n 
2 20  ASP n 
2 21  ASP n 
2 22  LYS n 
2 23  HIS n 
2 24  MET n 
2 25  LYS n 
2 26  ASN n 
2 27  LYS n 
2 28  LYS n 
2 29  ASP n 
2 30  LYS n 
2 31  GLY n 
2 32  LEU n 
2 33  LEU n 
2 34  SER n 
2 35  GLY n 
2 36  LYS n 
2 37  LEU n 
2 38  THR n 
2 39  PRO n 
2 40  ALA n 
2 41  GLN n 
2 42  SER n 
2 43  LYS n 
2 44  ASN n 
2 45  PRO n 
2 46  ALA n 
2 47  LYS n 
2 48  ASN n 
2 49  GLU n 
2 50  LEU n 
2 51  TYR n 
2 52  LEU n 
2 53  VAL n 
2 54  GLU n 
2 55  GLY n 
2 56  ASP n 
2 57  SER n 
2 58  ALA n 
2 59  GLY n 
2 60  GLY n 
2 61  SER n 
2 62  ALA n 
2 63  LYS n 
2 64  GLN n 
2 65  GLY n 
2 66  ARG n 
2 67  ASP n 
2 68  ARG n 
2 69  LYS n 
2 70  PHE n 
2 71  GLN n 
2 72  ALA n 
2 73  ILE n 
2 74  LEU n 
2 75  PRO n 
2 76  LEU n 
2 77  ARG n 
2 78  GLY n 
2 79  LYS n 
2 80  VAL n 
2 81  ILE n 
2 82  ASN n 
2 83  THR n 
2 84  ALA n 
2 85  LYS n 
2 86  ALA n 
2 87  LYS n 
2 88  MET n 
2 89  ALA n 
2 90  ASP n 
2 91  ILE n 
2 92  LEU n 
2 93  LYS n 
2 94  ASN n 
2 95  GLU n 
2 96  GLU n 
2 97  ILE n 
2 98  ASN n 
2 99  THR n 
2 100 MET n 
2 101 ILE n 
2 102 TYR n 
2 103 THR n 
2 104 ILE n 
2 105 GLY n 
2 106 ALA n 
2 107 GLY n 
2 108 VAL n 
2 109 GLY n 
2 110 ALA n 
2 111 ASP n 
2 112 PHE n 
2 113 SER n 
2 114 ILE n 
2 115 GLU n 
2 116 ASP n 
2 117 ALA n 
2 118 ASN n 
2 119 TYR n 
2 120 ASP n 
2 121 LYS n 
2 122 ILE n 
2 123 ILE n 
2 124 ILE n 
2 125 MET n 
2 126 THR n 
2 127 ASP n 
2 128 ALA n 
2 129 ASP n 
2 130 THR n 
2 131 ASP n 
2 132 GLY n 
2 133 ALA n 
2 134 HIS n 
2 135 ILE n 
2 136 GLN n 
2 137 THR n 
2 138 LEU n 
2 139 LEU n 
2 140 LEU n 
2 141 THR n 
2 142 PHE n 
2 143 PHE n 
2 144 TYR n 
2 145 ARG n 
2 146 TYR n 
2 147 MET n 
2 148 ARG n 
2 149 PRO n 
2 150 LEU n 
2 151 VAL n 
2 152 GLU n 
2 153 ALA n 
2 154 GLY n 
2 155 HIS n 
2 156 VAL n 
2 157 TYR n 
2 158 ILE n 
2 159 ALA n 
2 160 LEU n 
2 161 PRO n 
2 162 PRO n 
2 163 LEU n 
2 164 TYR n 
2 165 LYS n 
2 166 MET n 
2 167 SER n 
2 168 LYS n 
2 169 GLY n 
2 170 LYS n 
2 171 GLY n 
2 172 LYS n 
2 173 LYS n 
2 174 GLU n 
2 175 GLU n 
2 176 VAL n 
2 177 ALA n 
2 178 TYR n 
2 179 ALA n 
2 180 TRP n 
2 181 THR n 
2 182 ASP n 
2 183 GLY n 
2 184 GLU n 
2 185 LEU n 
2 186 GLU n 
2 187 GLU n 
2 188 LEU n 
2 189 ARG n 
2 190 LYS n 
2 191 GLN n 
2 192 PHE n 
2 193 GLY n 
2 194 LYS n 
2 195 GLY n 
2 196 ALA n 
2 197 THR n 
2 198 LEU n 
2 199 GLN n 
2 200 ARG n 
2 201 TYR n 
2 202 LYS n 
2 203 GLY n 
2 204 LEU n 
2 205 GLY n 
2 206 GLU n 
2 207 MET n 
2 208 ASN n 
2 209 ALA n 
2 210 ASP n 
2 211 GLN n 
2 212 LEU n 
2 213 TRP n 
2 214 GLU n 
2 215 THR n 
2 216 THR n 
2 217 MET n 
2 218 ASN n 
2 219 PRO n 
2 220 GLU n 
2 221 THR n 
2 222 ARG n 
2 223 THR n 
2 224 LEU n 
2 225 ILE n 
2 226 ARG n 
2 227 VAL n 
2 228 THR n 
2 229 ILE n 
2 230 GLU n 
2 231 ASP n 
2 232 LEU n 
2 233 ALA n 
2 234 ARG n 
2 235 ALA n 
2 236 GLU n 
2 237 ARG n 
2 238 ARG n 
2 239 VAL n 
2 240 ASN n 
2 241 VAL n 
2 242 LEU n 
2 243 MET n 
2 244 GLY n 
2 245 ASP n 
2 246 LYS n 
2 247 VAL n 
2 248 GLU n 
2 249 PRO n 
2 250 ARG n 
2 251 ARG n 
2 252 LYS n 
2 253 TRP n 
2 254 ILE n 
2 255 GLU n 
2 256 ASP n 
2 257 ASN n 
2 258 VAL n 
2 259 LYS n 
2 260 PHE n 
2 261 THR n 
2 262 LEU n 
2 263 GLU n 
2 264 GLU n 
2 265 ALA n 
2 266 THR n 
2 267 VAL n 
2 268 PHE n 
3 1   DC  n 
3 2   DA  n 
3 3   DT  n 
3 4   DG  n 
3 5   DA  n 
3 6   DA  n 
3 7   DT  n 
4 1   DA  n 
4 2   DG  n 
4 3   DT  n 
4 4   DC  n 
4 5   DA  n 
4 6   DT  n 
4 7   DT  n 
4 8   DC  n 
4 9   DA  n 
4 10  DT  n 
4 11  DG  n 
5 1   DC  n 
5 2   DG  n 
5 3   DT  n 
5 4   DG  n 
5 5   DC  n 
5 6   DA  n 
5 7   DT  n 
6 1   DG  n 
6 2   DA  n 
6 3   DC  n 
6 4   DT  n 
6 5   DA  n 
6 6   DT  n 
6 7   DG  n 
6 8   DC  n 
6 9   DA  n 
6 10  DC  n 
6 11  DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? 'parC, SP_0855' ? 'ATCC BAA-334 / TIGR4' ? ? ? ? 'Streptococcus pneumoniae'            170187 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? ? ? parE            ? 'ATCC BAA-334 / TIGR4' ? ? ? ? 'Streptococcus pneumoniae serotype 4' 170187 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample ? ? 'synthetic construct' ? 32630 ? 
4 1 sample ? ? 'synthetic construct' ? 32630 ? 
5 1 sample ? ? 'synthetic construct' ? 32630 ? 
6 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP PARC_STRPN P72525 1 
;MSNIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFHPHGDSS
IYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTVLPAAFP
NLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRS
KTEIEKLKGGKEQIVIIEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNYLFKYTD
LQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKAD
AKENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKFATPRLS
SLEDTAKA
;
1   ? 
2 UNP PARE_STRPN Q59961 2 
;KNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVVNTAKAKMADILKNEEINTMIYTI
GAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKGKGKKEEVAYAWTDGE
LEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFTLEE
TTVF
;
404 ? 
3 PDB 4KPE       4KPE   3 CATGAAT ?   ? 
4 PDB 4KPE       4KPE   4 AGTCATTCATG ?   ? 
5 PDB 4KPE       4KPE   5 CGTGCAT ?   ? 
6 PDB 4KPE       4KPE   6 GACTATGCACG ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4KPE A 1  ? 488 ? P72525 1   ? 488 ? 1   488 
2 1 4KPE B 1  ? 488 ? P72525 1   ? 488 ? 1   488 
3 2 4KPE C 25 ? 268 ? Q59961 404 ? 647 ? 404 647 
4 2 4KPE D 25 ? 268 ? Q59961 404 ? 647 ? 404 647 
5 3 4KPE E 1  ? 7   ? 4KPE   9   ? 15  ? 9   15  
6 4 4KPE F 1  ? 11  ? 4KPE   1   ? 11  ? 1   11  
7 5 4KPE G 1  ? 7   ? 4KPE   9   ? 15  ? 9   15  
8 6 4KPE H 1  ? 11  ? 4KPE   1   ? 11  ? 1   11  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4KPE THR A 257 ? UNP P72525 ILE 257 'engineered mutation' 257 1  
1 4KPE LEU A 489 ? UNP P72525 ?   ?   'expression tag'      489 2  
1 4KPE GLU A 490 ? UNP P72525 ?   ?   'expression tag'      490 3  
1 4KPE HIS A 491 ? UNP P72525 ?   ?   'expression tag'      491 4  
1 4KPE HIS A 492 ? UNP P72525 ?   ?   'expression tag'      492 5  
1 4KPE HIS A 493 ? UNP P72525 ?   ?   'expression tag'      493 6  
1 4KPE HIS A 494 ? UNP P72525 ?   ?   'expression tag'      494 7  
1 4KPE HIS A 495 ? UNP P72525 ?   ?   'expression tag'      495 8  
1 4KPE HIS A 496 ? UNP P72525 ?   ?   'expression tag'      496 9  
2 4KPE THR B 257 ? UNP P72525 ILE 257 'engineered mutation' 257 10 
2 4KPE LEU B 489 ? UNP P72525 ?   ?   'expression tag'      489 11 
2 4KPE GLU B 490 ? UNP P72525 ?   ?   'expression tag'      490 12 
2 4KPE HIS B 491 ? UNP P72525 ?   ?   'expression tag'      491 13 
2 4KPE HIS B 492 ? UNP P72525 ?   ?   'expression tag'      492 14 
2 4KPE HIS B 493 ? UNP P72525 ?   ?   'expression tag'      493 15 
2 4KPE HIS B 494 ? UNP P72525 ?   ?   'expression tag'      494 16 
2 4KPE HIS B 495 ? UNP P72525 ?   ?   'expression tag'      495 17 
2 4KPE HIS B 496 ? UNP P72525 ?   ?   'expression tag'      496 18 
3 4KPE MET C 1   ? UNP Q59961 ?   ?   'expression tag'      380 19 
3 4KPE GLY C 2   ? UNP Q59961 ?   ?   'expression tag'      381 20 
3 4KPE HIS C 3   ? UNP Q59961 ?   ?   'expression tag'      382 21 
3 4KPE HIS C 4   ? UNP Q59961 ?   ?   'expression tag'      383 22 
3 4KPE HIS C 5   ? UNP Q59961 ?   ?   'expression tag'      384 23 
3 4KPE HIS C 6   ? UNP Q59961 ?   ?   'expression tag'      385 24 
3 4KPE HIS C 7   ? UNP Q59961 ?   ?   'expression tag'      386 25 
3 4KPE HIS C 8   ? UNP Q59961 ?   ?   'expression tag'      387 26 
3 4KPE HIS C 9   ? UNP Q59961 ?   ?   'expression tag'      388 27 
3 4KPE HIS C 10  ? UNP Q59961 ?   ?   'expression tag'      389 28 
3 4KPE HIS C 11  ? UNP Q59961 ?   ?   'expression tag'      390 29 
3 4KPE HIS C 12  ? UNP Q59961 ?   ?   'expression tag'      391 30 
3 4KPE SER C 13  ? UNP Q59961 ?   ?   'expression tag'      392 31 
3 4KPE SER C 14  ? UNP Q59961 ?   ?   'expression tag'      393 32 
3 4KPE GLY C 15  ? UNP Q59961 ?   ?   'expression tag'      394 33 
3 4KPE HIS C 16  ? UNP Q59961 ?   ?   'expression tag'      395 34 
3 4KPE ILE C 17  ? UNP Q59961 ?   ?   'expression tag'      396 35 
3 4KPE ASP C 18  ? UNP Q59961 ?   ?   'expression tag'      397 36 
3 4KPE ASP C 19  ? UNP Q59961 ?   ?   'expression tag'      398 37 
3 4KPE ASP C 20  ? UNP Q59961 ?   ?   'expression tag'      399 38 
3 4KPE ASP C 21  ? UNP Q59961 ?   ?   'expression tag'      400 39 
3 4KPE LYS C 22  ? UNP Q59961 ?   ?   'expression tag'      401 40 
3 4KPE HIS C 23  ? UNP Q59961 ?   ?   'expression tag'      402 41 
3 4KPE MET C 24  ? UNP Q59961 ?   ?   'expression tag'      403 42 
3 4KPE ILE C 81  ? UNP Q59961 VAL 460 'engineered mutation' 460 43 
3 4KPE ALA C 265 ? UNP Q59961 THR 644 'engineered mutation' 644 44 
4 4KPE MET D 1   ? UNP Q59961 ?   ?   'expression tag'      380 45 
4 4KPE GLY D 2   ? UNP Q59961 ?   ?   'expression tag'      381 46 
4 4KPE HIS D 3   ? UNP Q59961 ?   ?   'expression tag'      382 47 
4 4KPE HIS D 4   ? UNP Q59961 ?   ?   'expression tag'      383 48 
4 4KPE HIS D 5   ? UNP Q59961 ?   ?   'expression tag'      384 49 
4 4KPE HIS D 6   ? UNP Q59961 ?   ?   'expression tag'      385 50 
4 4KPE HIS D 7   ? UNP Q59961 ?   ?   'expression tag'      386 51 
4 4KPE HIS D 8   ? UNP Q59961 ?   ?   'expression tag'      387 52 
4 4KPE HIS D 9   ? UNP Q59961 ?   ?   'expression tag'      388 53 
4 4KPE HIS D 10  ? UNP Q59961 ?   ?   'expression tag'      389 54 
4 4KPE HIS D 11  ? UNP Q59961 ?   ?   'expression tag'      390 55 
4 4KPE HIS D 12  ? UNP Q59961 ?   ?   'expression tag'      391 56 
4 4KPE SER D 13  ? UNP Q59961 ?   ?   'expression tag'      392 57 
4 4KPE SER D 14  ? UNP Q59961 ?   ?   'expression tag'      393 58 
4 4KPE GLY D 15  ? UNP Q59961 ?   ?   'expression tag'      394 59 
4 4KPE HIS D 16  ? UNP Q59961 ?   ?   'expression tag'      395 60 
4 4KPE ILE D 17  ? UNP Q59961 ?   ?   'expression tag'      396 61 
4 4KPE ASP D 18  ? UNP Q59961 ?   ?   'expression tag'      397 62 
4 4KPE ASP D 19  ? UNP Q59961 ?   ?   'expression tag'      398 63 
4 4KPE ASP D 20  ? UNP Q59961 ?   ?   'expression tag'      399 64 
4 4KPE ASP D 21  ? UNP Q59961 ?   ?   'expression tag'      400 65 
4 4KPE LYS D 22  ? UNP Q59961 ?   ?   'expression tag'      401 66 
4 4KPE HIS D 23  ? UNP Q59961 ?   ?   'expression tag'      402 67 
4 4KPE MET D 24  ? UNP Q59961 ?   ?   'expression tag'      403 68 
4 4KPE ILE D 81  ? UNP Q59961 VAL 460 'engineered mutation' 460 69 
4 4KPE ALA D 265 ? UNP Q59961 THR 644 'engineered mutation' 644 70 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
AF5 non-polymer         . 
;(7aR,8R)-8-amino-4-cyclopropyl-12-fluoro-1-oxo-4,7,7a,8,9,10-hexahydro-1H-pyrrolo[1',2':1,7]azepino[2,3-h]quinoline-2-carboxylic acid
;
? 'C20 H20 F N3 O3' 369.390 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4KPE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.10 
_exptl_crystal.density_percent_sol   70.02 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'50 mM Na Cacodylate, 4-7% isopropanol, optimized mixture of salts, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2011-05-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I02 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
# 
_reflns.entry_id                     4KPE 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             41.819 
_reflns.d_resolution_high            3.43 
_reflns.number_obs                   40043 
_reflns.number_all                   41232 
_reflns.percent_possible_obs         97.1 
_reflns.pdbx_Rmerge_I_obs            0.122 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.38 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.16 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.d_res_high             3.43 
_reflns_shell.d_res_low              3.52 
_reflns_shell.percent_possible_all   98.20 
_reflns_shell.Rmerge_I_obs           0.398 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    6.37 
_reflns_shell.pdbx_redundancy        5.22 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_CC_half           ? 
_reflns_shell.pdbx_Rpim_I_all        ? 
_reflns_shell.pdbx_Rrim_I_all        ? 
# 
_refine.entry_id                                 4KPE 
_refine.ls_number_reflns_obs                     40016 
_refine.ls_number_reflns_all                     40043 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.01 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             41.819 
_refine.ls_d_res_high                            3.430 
_refine.ls_percent_reflns_obs                    97.13 
_refine.ls_R_factor_obs                          0.1562 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1541 
_refine.ls_R_factor_R_free                       0.1947 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.01 
_refine.ls_number_reflns_R_free                  2003 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.28 
_refine.pdbx_overall_phase_error                 18.46 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10388 
_refine_hist.pdbx_number_atoms_nucleic_acid   730 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             24 
_refine_hist.number_atoms_total               11202 
_refine_hist.d_res_high                       3.430 
_refine_hist.d_res_low                        41.819 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.009  ? ? 11462 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.240  ? ? 15726 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 18.567 ? ? 4216  ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.077  ? ? 1810  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.004  ? ? 1922  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_obs 
. 3.4300 3.5157  2722 0.1825 98.00 0.2386 . . 134 . . . . 'X-RAY DIFFRACTION' . 
. 3.5157 3.6107  2688 0.1795 99.00 0.1905 . . 144 . . . . 'X-RAY DIFFRACTION' . 
. 3.6107 3.7169  2719 0.1676 98.00 0.2267 . . 140 . . . . 'X-RAY DIFFRACTION' . 
. 3.7169 3.8368  2721 0.1557 98.00 0.2249 . . 145 . . . . 'X-RAY DIFFRACTION' . 
. 3.8368 3.9739  2688 0.1456 98.00 0.1672 . . 148 . . . . 'X-RAY DIFFRACTION' . 
. 3.9739 4.1328  2723 0.1388 98.00 0.1796 . . 134 . . . . 'X-RAY DIFFRACTION' . 
. 4.1328 4.3207  2719 0.1314 98.00 0.1677 . . 147 . . . . 'X-RAY DIFFRACTION' . 
. 4.3207 4.5483  2710 0.1274 97.00 0.1542 . . 144 . . . . 'X-RAY DIFFRACTION' . 
. 4.5483 4.8329  2698 0.1342 98.00 0.1987 . . 140 . . . . 'X-RAY DIFFRACTION' . 
. 4.8329 5.2054  2723 0.1479 97.00 0.2107 . . 147 . . . . 'X-RAY DIFFRACTION' . 
. 5.2054 5.7280  2728 0.1602 97.00 0.2076 . . 145 . . . . 'X-RAY DIFFRACTION' . 
. 5.7280 6.5541  2724 0.1731 97.00 0.2202 . . 144 . . . . 'X-RAY DIFFRACTION' . 
. 6.5541 8.2471  2740 0.1556 96.00 0.1796 . . 148 . . . . 'X-RAY DIFFRACTION' . 
. 8.2471 41.8217 2710 0.1697 91.00 0.1942 . . 143 . . . . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  4KPE 
_struct.title                     'Novel fluoroquinolones in complex with topoisomerase IV from S. pneumoniae and E-site G-gate' 
_struct.pdbx_descriptor           'DNA topoisomerase 4 subunit A (E.C.5.99.1.3), DNA topoisomerase 4 subunit B (E.C.5.99.1.3)/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4KPE 
_struct_keywords.pdbx_keywords   ISOMERASE/DNA/INHIBITOR 
_struct_keywords.text            
'PROTEIN-DNA CLEAVAGE COMPLEX, ISOMERASE-DNA-INHIBITOR COMPLEX, TOPOISOMERASE IIA, Quinolone, ACHN-245' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 7 ? 
J N N 7 ? 
K N N 7 ? 
L N N 7 ? 
M N N 7 ? 
N N N 7 ? 
O N N 8 ? 
P N N 8 ? 
Q N N 9 ? 
R N N 9 ? 
S N N 9 ? 
T N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 9   ? ASP A 27  ? LEU A 9   ASP A 27  1 ? 19 
HELX_P HELX_P2  2  LYS A 38  ? ASP A 51  ? LYS A 38  ASP A 51  1 ? 14 
HELX_P HELX_P3  3  SER A 62  ? PHE A 73  ? SER A 62  PHE A 73  1 ? 12 
HELX_P HELX_P4  4  GLY A 77  ? MET A 88  ? GLY A 77  MET A 88  1 ? 12 
HELX_P HELX_P5  5  SER A 124 ? GLN A 132 ? SER A 124 GLN A 132 1 ? 9  
HELX_P HELX_P6  6  ASP A 133 ? LYS A 137 ? ASP A 133 LYS A 137 5 ? 5  
HELX_P HELX_P7  7  PRO A 160 ? GLY A 166 ? PRO A 160 GLY A 166 1 ? 7  
HELX_P HELX_P8  8  ASN A 182 ? HIS A 196 ? ASN A 182 HIS A 196 1 ? 15 
HELX_P HELX_P9  9  LYS A 200 ? MET A 205 ? LYS A 200 MET A 205 1 ? 6  
HELX_P HELX_P10 10 GLY A 221 ? GLY A 232 ? GLY A 221 GLY A 232 1 ? 12 
HELX_P HELX_P11 11 ASN A 264 ? ASN A 279 ? ASN A 264 ASN A 279 1 ? 16 
HELX_P HELX_P12 12 ASN A 307 ? THR A 319 ? ASN A 307 THR A 319 1 ? 13 
HELX_P HELX_P13 13 GLY A 341 ? ILE A 384 ? GLY A 341 ILE A 384 1 ? 44 
HELX_P HELX_P14 14 ILE A 384 ? SER A 395 ? ILE A 384 SER A 395 1 ? 12 
HELX_P HELX_P15 15 ASN A 397 ? ASP A 410 ? ASN A 397 ASP A 410 1 ? 14 
HELX_P HELX_P16 16 THR A 412 ? THR A 421 ? THR A 412 THR A 421 1 ? 10 
HELX_P HELX_P17 17 LEU A 422 ? ASN A 429 ? LEU A 422 ASN A 429 5 ? 8  
HELX_P HELX_P18 18 ASP A 431 ? ASP A 455 ? ASP A 431 ASP A 455 1 ? 25 
HELX_P HELX_P19 19 ASP A 455 ? ALA A 475 ? ASP A 455 ALA A 475 1 ? 21 
HELX_P HELX_P20 20 LEU B 9   ? ASP B 27  ? LEU B 9   ASP B 27  1 ? 19 
HELX_P HELX_P21 21 LYS B 38  ? ASP B 51  ? LYS B 38  ASP B 51  1 ? 14 
HELX_P HELX_P22 22 SER B 62  ? PHE B 73  ? SER B 62  PHE B 73  1 ? 12 
HELX_P HELX_P23 23 GLY B 77  ? MET B 88  ? GLY B 77  MET B 88  1 ? 12 
HELX_P HELX_P24 24 ILE B 126 ? GLN B 132 ? ILE B 126 GLN B 132 1 ? 7  
HELX_P HELX_P25 25 ASP B 133 ? LYS B 137 ? ASP B 133 LYS B 137 5 ? 5  
HELX_P HELX_P26 26 PRO B 160 ? GLY B 166 ? PRO B 160 GLY B 166 1 ? 7  
HELX_P HELX_P27 27 ASN B 182 ? HIS B 196 ? ASN B 182 HIS B 196 1 ? 15 
HELX_P HELX_P28 28 LYS B 200 ? MET B 205 ? LYS B 200 MET B 205 1 ? 6  
HELX_P HELX_P29 29 GLY B 221 ? GLY B 232 ? GLY B 221 GLY B 232 1 ? 12 
HELX_P HELX_P30 30 LYS B 248 ? GLY B 250 ? LYS B 248 GLY B 250 5 ? 3  
HELX_P HELX_P31 31 ASN B 264 ? ASN B 278 ? ASN B 264 ASN B 278 1 ? 15 
HELX_P HELX_P32 32 ASN B 307 ? THR B 319 ? ASN B 307 THR B 319 1 ? 13 
HELX_P HELX_P33 33 GLY B 341 ? ILE B 384 ? GLY B 341 ILE B 384 1 ? 44 
HELX_P HELX_P34 34 ILE B 384 ? SER B 395 ? ILE B 384 SER B 395 1 ? 12 
HELX_P HELX_P35 35 ASN B 397 ? ASP B 410 ? ASN B 397 ASP B 410 1 ? 14 
HELX_P HELX_P36 36 THR B 412 ? THR B 421 ? THR B 412 THR B 421 1 ? 10 
HELX_P HELX_P37 37 GLN B 423 ? ASN B 429 ? GLN B 423 ASN B 429 5 ? 7  
HELX_P HELX_P38 38 ASP B 431 ? GLY B 454 ? ASP B 431 GLY B 454 1 ? 24 
HELX_P HELX_P39 39 ASP B 455 ? ALA B 475 ? ASP B 455 ALA B 475 1 ? 21 
HELX_P HELX_P40 40 GLY C 55  ? ARG C 66  ? GLY C 434 ARG C 445 1 ? 12 
HELX_P HELX_P41 41 LYS C 87  ? LYS C 93  ? LYS C 466 LYS C 472 1 ? 7  
HELX_P HELX_P42 42 ASN C 94  ? TYR C 102 ? ASN C 473 TYR C 481 1 ? 9  
HELX_P HELX_P43 43 SER C 113 ? ALA C 117 ? SER C 492 ALA C 496 5 ? 5  
HELX_P HELX_P44 44 ASP C 129 ? MET C 147 ? ASP C 508 MET C 526 1 ? 19 
HELX_P HELX_P45 45 MET C 147 ? ALA C 153 ? MET C 526 ALA C 532 1 ? 7  
HELX_P HELX_P46 46 THR C 181 ? GLU C 187 ? THR C 560 GLU C 566 1 ? 7  
HELX_P HELX_P47 47 ASN C 208 ? MET C 217 ? ASN C 587 MET C 596 1 ? 10 
HELX_P HELX_P48 48 ASP C 231 ? GLY C 244 ? ASP C 610 GLY C 623 1 ? 14 
HELX_P HELX_P49 49 LYS C 246 ? VAL C 258 ? LYS C 625 VAL C 637 1 ? 13 
HELX_P HELX_P50 50 GLY D 55  ? ARG D 66  ? GLY D 434 ARG D 445 1 ? 12 
HELX_P HELX_P51 51 LYS D 87  ? LYS D 93  ? LYS D 466 LYS D 472 1 ? 7  
HELX_P HELX_P52 52 ASN D 94  ? GLY D 105 ? ASN D 473 GLY D 484 1 ? 12 
HELX_P HELX_P53 53 VAL D 108 ? PHE D 112 ? VAL D 487 PHE D 491 5 ? 5  
HELX_P HELX_P54 54 SER D 113 ? ALA D 117 ? SER D 492 ALA D 496 5 ? 5  
HELX_P HELX_P55 55 ASP D 129 ? MET D 147 ? ASP D 508 MET D 526 1 ? 19 
HELX_P HELX_P56 56 MET D 147 ? GLU D 152 ? MET D 526 GLU D 531 1 ? 6  
HELX_P HELX_P57 57 THR D 181 ? GLU D 187 ? THR D 560 GLU D 566 1 ? 7  
HELX_P HELX_P58 58 GLY D 203 ? MET D 207 ? GLY D 582 MET D 586 5 ? 5  
HELX_P HELX_P59 59 ASN D 208 ? THR D 216 ? ASN D 587 THR D 595 1 ? 9  
HELX_P HELX_P60 60 ALA D 233 ? GLY D 244 ? ALA D 612 GLY D 623 1 ? 12 
HELX_P HELX_P61 61 LYS D 246 ? VAL D 258 ? LYS D 625 VAL D 637 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?   ? J MG  .   MG  ? ? ? 1_555 O AF5 .  O08 ? ? A MG  502 F AF5 101 1_555 ? ? ? ? ? ? ?            2.016 ? 
metalc2  metalc ?   ? L MG  .   MG  ? ? ? 1_555 P AF5 .  O09 ? ? B MG  502 H AF5 101 1_555 ? ? ? ? ? ? ?            2.022 ? 
metalc3  metalc ?   ? D ASP 129 OD2 ? ? ? 1_555 N MG  .  MG  ? ? D ASP 508 D MG  701 1_555 ? ? ? ? ? ? ?            2.027 ? 
metalc4  metalc ?   ? C ASP 129 OD2 ? ? ? 1_555 M MG  .  MG  ? ? C ASP 508 C MG  701 1_555 ? ? ? ? ? ? ?            2.029 ? 
metalc5  metalc ?   ? J MG  .   MG  ? ? ? 1_555 O AF5 .  O11 ? ? A MG  502 F AF5 101 1_555 ? ? ? ? ? ? ?            2.035 ? 
metalc6  metalc ?   ? A GLN 322 O   ? ? ? 1_555 I MG  .  MG  ? ? A GLN 322 A MG  501 1_555 ? ? ? ? ? ? ?            2.037 ? 
metalc7  metalc ?   ? A THR 319 O   ? ? ? 1_555 I MG  .  MG  ? ? A THR 319 A MG  501 1_555 ? ? ? ? ? ? ?            2.041 ? 
metalc8  metalc ?   ? L MG  .   MG  ? ? ? 1_555 P AF5 .  O11 ? ? B MG  502 H AF5 101 1_555 ? ? ? ? ? ? ?            2.042 ? 
metalc9  metalc ?   ? B THR 319 O   ? ? ? 1_555 K MG  .  MG  ? ? B THR 319 B MG  501 1_555 ? ? ? ? ? ? ?            2.047 ? 
metalc10 metalc ?   ? B GLN 322 O   ? ? ? 1_555 K MG  .  MG  ? ? B GLN 322 B MG  501 1_555 ? ? ? ? ? ? ?            2.049 ? 
metalc11 metalc ?   ? C ASP 127 OD2 ? ? ? 1_555 M MG  .  MG  ? ? C ASP 506 C MG  701 1_555 ? ? ? ? ? ? ?            2.798 ? 
metalc12 metalc ?   ? D ASP 127 OD2 ? ? ? 1_555 N MG  .  MG  ? ? D ASP 506 D MG  701 1_555 ? ? ? ? ? ? ?            2.852 ? 
metalc13 metalc ?   ? A PHE 316 O   ? ? ? 1_555 I MG  .  MG  ? ? A PHE 316 A MG  501 1_555 ? ? ? ? ? ? ?            2.927 ? 
metalc14 metalc ?   ? B PHE 316 O   ? ? ? 1_555 K MG  .  MG  ? ? B PHE 316 B MG  501 1_555 ? ? ? ? ? ? ?            2.966 ? 
covale1  covale one ? A TYR 118 OH  ? ? ? 1_555 F DA  1  P   ? ? A TYR 118 F DA  1   1_555 ? ? ? ? ? ? ?            1.587 ? 
covale2  covale one ? B TYR 118 OH  ? ? ? 1_555 H DG  1  P   ? ? B TYR 118 H DG  1   1_555 ? ? ? ? ? ? ?            1.596 ? 
hydrog1  hydrog ?   ? E DC  1   N3  ? ? ? 1_555 F DG  11 N1  ? ? E DC  9   F DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?   ? E DC  1   N4  ? ? ? 1_555 F DG  11 O6  ? ? E DC  9   F DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?   ? E DC  1   O2  ? ? ? 1_555 F DG  11 N2  ? ? E DC  9   F DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?   ? E DA  2   N1  ? ? ? 1_555 F DT  10 N3  ? ? E DA  10  F DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?   ? E DA  2   N6  ? ? ? 1_555 F DT  10 O4  ? ? E DA  10  F DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?   ? E DT  3   N3  ? ? ? 1_555 F DA  9  N1  ? ? E DT  11  F DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?   ? E DT  3   O4  ? ? ? 1_555 F DA  9  N6  ? ? E DT  11  F DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?   ? E DG  4   N1  ? ? ? 1_555 F DC  8  N3  ? ? E DG  12  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?   ? E DG  4   N2  ? ? ? 1_555 F DC  8  O2  ? ? E DG  12  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?   ? E DG  4   O6  ? ? ? 1_555 F DC  8  N4  ? ? E DG  12  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?   ? E DA  5   N1  ? ? ? 1_555 F DT  7  N3  ? ? E DA  13  F DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?   ? E DA  5   N6  ? ? ? 1_555 F DT  7  O4  ? ? E DA  13  F DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?   ? E DA  6   N1  ? ? ? 1_555 F DT  6  N3  ? ? E DA  14  F DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?   ? E DA  6   N6  ? ? ? 1_555 F DT  6  O4  ? ? E DA  14  F DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?   ? E DT  7   N3  ? ? ? 1_555 F DA  5  N1  ? ? E DT  15  F DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?   ? E DT  7   O4  ? ? ? 1_555 F DA  5  N6  ? ? E DT  15  F DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?   ? F DA  1   N1  ? ? ? 1_555 H DT  4  N3  ? ? F DA  1   H DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?   ? F DA  1   N6  ? ? ? 1_555 H DT  4  O4  ? ? F DA  1   H DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?   ? F DG  2   N1  ? ? ? 1_555 H DC  3  N3  ? ? F DG  2   H DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?   ? F DG  2   N2  ? ? ? 1_555 H DC  3  O2  ? ? F DG  2   H DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?   ? F DG  2   O6  ? ? ? 1_555 H DC  3  N4  ? ? F DG  2   H DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?   ? F DT  3   N3  ? ? ? 1_555 H DA  2  N1  ? ? F DT  3   H DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?   ? F DT  3   O4  ? ? ? 1_555 H DA  2  N6  ? ? F DT  3   H DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?   ? F DC  4   N3  ? ? ? 1_555 H DG  1  N1  ? ? F DC  4   H DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?   ? F DC  4   N4  ? ? ? 1_555 H DG  1  O6  ? ? F DC  4   H DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?   ? F DC  4   O2  ? ? ? 1_555 H DG  1  N2  ? ? F DC  4   H DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?   ? G DC  1   N3  ? ? ? 1_555 H DG  11 N1  ? ? G DC  9   H DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?   ? G DC  1   N4  ? ? ? 1_555 H DG  11 O6  ? ? G DC  9   H DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?   ? G DC  1   O2  ? ? ? 1_555 H DG  11 N2  ? ? G DC  9   H DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?   ? G DG  2   N1  ? ? ? 1_555 H DC  10 N3  ? ? G DG  10  H DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?   ? G DG  2   N2  ? ? ? 1_555 H DC  10 O2  ? ? G DG  10  H DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?   ? G DG  2   O6  ? ? ? 1_555 H DC  10 N4  ? ? G DG  10  H DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?   ? G DT  3   N3  ? ? ? 1_555 H DA  9  N1  ? ? G DT  11  H DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?   ? G DT  3   O4  ? ? ? 1_555 H DA  9  N6  ? ? G DT  11  H DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?   ? G DG  4   N1  ? ? ? 1_555 H DC  8  N3  ? ? G DG  12  H DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?   ? G DG  4   N2  ? ? ? 1_555 H DC  8  O2  ? ? G DG  12  H DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?   ? G DG  4   O6  ? ? ? 1_555 H DC  8  N4  ? ? G DG  12  H DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?   ? G DC  5   N3  ? ? ? 1_555 H DG  7  N1  ? ? G DC  13  H DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?   ? G DC  5   N4  ? ? ? 1_555 H DG  7  O6  ? ? G DC  13  H DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?   ? G DC  5   O2  ? ? ? 1_555 H DG  7  N2  ? ? G DC  13  H DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?   ? G DA  6   N1  ? ? ? 1_555 H DT  6  N3  ? ? G DA  14  H DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?   ? G DA  6   N6  ? ? ? 1_555 H DT  6  O4  ? ? G DA  14  H DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?   ? G DT  7   N3  ? ? ? 1_555 H DA  5  N1  ? ? G DT  15  H DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?   ? G DT  7   O4  ? ? ? 1_555 H DA  5  N6  ? ? G DT  15  H DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 168 A . ? THR 168 A GLY 169 A ? GLY 169 A 1 -4.78  
2 THR 168 B . ? THR 168 B GLY 169 B ? GLY 169 B 1 -10.60 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 4 ? 
F ? 4 ? 
G ? 2 ? 
H ? 6 ? 
I ? 3 ? 
J ? 2 ? 
K ? 2 ? 
L ? 4 ? 
M ? 4 ? 
N ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? parallel      
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? parallel      
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 5   ? SER A 8   ? GLN A 5   SER A 8   
A 2 LEU C 224 ? THR C 228 ? LEU C 603 THR C 607 
A 3 VAL C 156 ? ALA C 159 ? VAL C 535 ALA C 538 
A 4 LYS C 121 ? MET C 125 ? LYS C 500 MET C 504 
A 5 GLU C 49  ? GLU C 54  ? GLU C 428 GLU C 433 
A 6 GLN C 71  ? LEU C 76  ? GLN C 450 LEU C 455 
B 1 ARG A 60  ? LYS A 61  ? ARG A 60  LYS A 61  
B 2 GLU A 120 ? LEU A 123 ? GLU A 120 LEU A 123 
B 3 VAL A 99  ? HIS A 102 ? VAL A 99  HIS A 102 
C 1 PHE A 141 ? TRP A 143 ? PHE A 141 TRP A 143 
C 2 LYS A 150 ? PRO A 152 ? LYS A 150 PRO A 152 
D 1 SER A 167 ? ILE A 170 ? SER A 167 ILE A 170 
D 2 ALA A 175 ? ILE A 178 ? ALA A 175 ILE A 178 
E 1 GLN A 322 ? ASN A 328 ? GLN A 322 ASN A 328 
E 2 LYS A 233 ? ARG A 239 ? LYS A 233 ARG A 239 
E 3 ALA A 217 ? GLN A 220 ? ALA A 217 GLN A 220 
E 4 SER A 480 ? GLU A 483 ? SER A 480 GLU A 483 
F 1 LYS A 241 ? LYS A 246 ? LYS A 241 LYS A 246 
F 2 GLU A 252 ? GLU A 258 ? GLU A 252 GLU A 258 
F 3 ILE A 298 ? LEU A 302 ? ILE A 298 LEU A 302 
F 4 ILE A 284 ? ASP A 289 ? ILE A 284 ASP A 289 
G 1 VAL A 330 ? ASP A 333 ? VAL A 330 ASP A 333 
G 2 THR A 336 ? GLN A 339 ? THR A 336 GLN A 339 
H 1 GLN B 5   ? SER B 8   ? GLN B 5   SER B 8   
H 2 LEU D 224 ? THR D 228 ? LEU D 603 THR D 607 
H 3 VAL D 156 ? ALA D 159 ? VAL D 535 ALA D 538 
H 4 LYS D 121 ? MET D 125 ? LYS D 500 MET D 504 
H 5 GLU D 49  ? GLU D 54  ? GLU D 428 GLU D 433 
H 6 GLN D 71  ? LEU D 76  ? GLN D 450 LEU D 455 
I 1 ARG B 60  ? LYS B 61  ? ARG B 60  LYS B 61  
I 2 GLU B 120 ? LEU B 123 ? GLU B 120 LEU B 123 
I 3 VAL B 99  ? HIS B 102 ? VAL B 99  HIS B 102 
J 1 PHE B 141 ? TRP B 143 ? PHE B 141 TRP B 143 
J 2 LYS B 150 ? PRO B 152 ? LYS B 150 PRO B 152 
K 1 SER B 167 ? ILE B 170 ? SER B 167 ILE B 170 
K 2 ALA B 175 ? ILE B 178 ? ALA B 175 ILE B 178 
L 1 GLN B 322 ? ASN B 328 ? GLN B 322 ASN B 328 
L 2 LYS B 233 ? ARG B 239 ? LYS B 233 ARG B 239 
L 3 ILE B 218 ? GLN B 220 ? ILE B 218 GLN B 220 
L 4 SER B 481 ? GLU B 483 ? SER B 481 GLU B 483 
M 1 LYS B 241 ? LYS B 246 ? LYS B 241 LYS B 246 
M 2 GLU B 252 ? GLU B 258 ? GLU B 252 GLU B 258 
M 3 ILE B 298 ? LEU B 302 ? ILE B 298 LEU B 302 
M 4 ILE B 284 ? ASP B 289 ? ILE B 284 ASP B 289 
N 1 VAL B 330 ? ASP B 333 ? VAL B 330 ASP B 333 
N 2 THR B 336 ? GLN B 339 ? THR B 336 GLN B 339 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 5   ? N GLN A 5   O ARG C 226 ? O ARG C 605 
A 2 3 O VAL C 227 ? O VAL C 606 N VAL C 156 ? N VAL C 535 
A 3 4 O TYR C 157 ? O TYR C 536 N ILE C 122 ? N ILE C 501 
A 4 5 O ILE C 123 ? O ILE C 502 N LEU C 50  ? N LEU C 429 
A 5 6 N VAL C 53  ? N VAL C 432 O LEU C 76  ? O LEU C 455 
B 1 2 N ARG A 60  ? N ARG A 60  O ALA A 121 ? O ALA A 121 
B 2 3 O ARG A 122 ? O ARG A 122 N GLU A 100 ? N GLU A 100 
C 1 2 N ALA A 142 ? N ALA A 142 O GLU A 151 ? O GLU A 151 
D 1 2 N SER A 167 ? N SER A 167 O ILE A 178 ? O ILE A 178 
E 1 2 O TYR A 325 ? O TYR A 325 N VAL A 236 ? N VAL A 236 
E 2 3 O ARG A 239 ? O ARG A 239 N ILE A 218 ? N ILE A 218 
E 3 4 N ILE A 219 ? N ILE A 219 O SER A 481 ? O SER A 481 
F 1 2 N GLU A 245 ? N GLU A 245 O GLN A 253 ? O GLN A 253 
F 2 3 N ILE A 254 ? N ILE A 254 O ILE A 300 ? O ILE A 300 
F 3 4 O ALA A 299 ? O ALA A 299 N ARG A 288 ? N ARG A 288 
G 1 2 N ASP A 333 ? N ASP A 333 O THR A 336 ? O THR A 336 
H 1 2 N MET B 7   ? N MET B 7   O ARG D 226 ? O ARG D 605 
H 2 3 O ILE D 225 ? O ILE D 604 N ILE D 158 ? N ILE D 537 
H 3 4 O TYR D 157 ? O TYR D 536 N ILE D 122 ? N ILE D 501 
H 4 5 O ILE D 123 ? O ILE D 502 N LEU D 50  ? N LEU D 429 
H 5 6 N VAL D 53  ? N VAL D 432 O LEU D 76  ? O LEU D 455 
I 1 2 N ARG B 60  ? N ARG B 60  O ALA B 121 ? O ALA B 121 
I 2 3 O ARG B 122 ? O ARG B 122 N GLU B 100 ? N GLU B 100 
J 1 2 N ALA B 142 ? N ALA B 142 O GLU B 151 ? O GLU B 151 
K 1 2 N SER B 167 ? N SER B 167 O ILE B 178 ? O ILE B 178 
L 1 2 O ILE B 323 ? O ILE B 323 N VAL B 238 ? N VAL B 238 
L 2 3 O VAL B 237 ? O VAL B 237 N GLN B 220 ? N GLN B 220 
L 3 4 N ILE B 219 ? N ILE B 219 O SER B 481 ? O SER B 481 
M 1 2 N GLU B 245 ? N GLU B 245 O GLN B 253 ? O GLN B 253 
M 2 3 N ILE B 254 ? N ILE B 254 O ILE B 300 ? O ILE B 300 
M 3 4 O ALA B 299 ? O ALA B 299 N ARG B 288 ? N ARG B 288 
N 1 2 N ALA B 331 ? N ALA B 331 O ARG B 338 ? O ARG B 338 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 501'  
AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MG A 502'  
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG B 501'  
AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MG B 502'  
AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG C 701'  
AC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG D 701'  
AC7 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE AF5 F 101' 
AC8 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE AF5 H 101' 
1   ?        ? ? ? ? ? ?                                    
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 PHE A 316 ? PHE A 316 . ? 1_555 ? 
2  AC1 4 LYS A 317 ? LYS A 317 . ? 1_555 ? 
3  AC1 4 THR A 319 ? THR A 319 . ? 1_555 ? 
4  AC1 4 GLN A 322 ? GLN A 322 . ? 1_555 ? 
5  AC2 1 AF5 O .   ? AF5 F 101 . ? 1_555 ? 
6  AC3 4 PHE B 316 ? PHE B 316 . ? 1_555 ? 
7  AC3 4 LYS B 317 ? LYS B 317 . ? 1_555 ? 
8  AC3 4 THR B 319 ? THR B 319 . ? 1_555 ? 
9  AC3 4 GLN B 322 ? GLN B 322 . ? 1_555 ? 
10 AC4 1 AF5 P .   ? AF5 H 101 . ? 1_555 ? 
11 AC5 2 ASP C 127 ? ASP C 506 . ? 1_555 ? 
12 AC5 2 ASP C 129 ? ASP C 508 . ? 1_555 ? 
13 AC6 3 ASP D 127 ? ASP D 506 . ? 1_555 ? 
14 AC6 3 ASP D 129 ? ASP D 508 . ? 1_555 ? 
15 AC6 3 DT  G 7   ? DT  G 15  . ? 1_555 ? 
16 AC7 9 SER A 79  ? SER A 79  . ? 1_555 ? 
17 AC7 9 MG  J .   ? MG  A 502 . ? 1_555 ? 
18 AC7 9 ARG B 117 ? ARG B 117 . ? 1_555 ? 
19 AC7 9 ARG C 77  ? ARG C 456 . ? 1_555 ? 
20 AC7 9 GLU C 96  ? GLU C 475 . ? 1_555 ? 
21 AC7 9 DT  E 7   ? DT  E 15  . ? 1_555 ? 
22 AC7 9 DC  F 4   ? DC  F 4   . ? 1_555 ? 
23 AC7 9 DA  F 5   ? DA  F 5   . ? 1_555 ? 
24 AC7 9 DG  H 1   ? DG  H 1   . ? 1_555 ? 
25 AC8 9 ARG A 117 ? ARG A 117 . ? 1_555 ? 
26 AC8 9 SER B 79  ? SER B 79  . ? 1_555 ? 
27 AC8 9 MG  L .   ? MG  B 502 . ? 1_555 ? 
28 AC8 9 ARG D 77  ? ARG D 456 . ? 1_555 ? 
29 AC8 9 GLU D 96  ? GLU D 475 . ? 1_555 ? 
30 AC8 9 DA  F 1   ? DA  F 1   . ? 1_555 ? 
31 AC8 9 DT  G 7   ? DT  G 15  . ? 1_555 ? 
32 AC8 9 DT  H 4   ? DT  H 4   . ? 1_555 ? 
33 AC8 9 DA  H 5   ? DA  H 5   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4KPE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4KPE 
_atom_sites.fract_transf_matrix[1][1]   0.006336 
_atom_sites.fract_transf_matrix[1][2]   0.003658 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007316 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004746 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
F  
H  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ASN A 1 3   ? 41.759  -2.923  22.835  1.00 100.57 ?  3   ASN A N     1 
ATOM   2     C  CA    . ASN A 1 3   ? 42.515  -1.955  22.047  1.00 101.04 ?  3   ASN A CA    1 
ATOM   3     C  C     . ASN A 1 3   ? 43.260  -0.936  22.915  1.00 101.99 ?  3   ASN A C     1 
ATOM   4     O  O     . ASN A 1 3   ? 44.208  -0.300  22.454  1.00 103.57 ?  3   ASN A O     1 
ATOM   5     C  CB    . ASN A 1 3   ? 41.606  -1.238  21.036  1.00 100.66 ?  3   ASN A CB    1 
ATOM   6     N  N     . ILE A 1 4   ? 42.834  -0.786  24.168  1.00 99.81  ?  4   ILE A N     1 
ATOM   7     C  CA    . ILE A 1 4   ? 43.486  0.148   25.093  1.00 93.83  ?  4   ILE A CA    1 
ATOM   8     C  C     . ILE A 1 4   ? 43.060  -0.022  26.559  1.00 92.31  ?  4   ILE A C     1 
ATOM   9     O  O     . ILE A 1 4   ? 41.876  -0.025  26.874  1.00 94.58  ?  4   ILE A O     1 
ATOM   10    C  CB    . ILE A 1 4   ? 43.264  1.615   24.675  1.00 92.47  ?  4   ILE A CB    1 
ATOM   11    C  CG1   . ILE A 1 4   ? 43.745  2.545   25.791  1.00 90.82  ?  4   ILE A CG1   1 
ATOM   12    C  CG2   . ILE A 1 4   ? 41.789  1.862   24.350  1.00 96.88  ?  4   ILE A CG2   1 
ATOM   13    C  CD1   . ILE A 1 4   ? 43.673  4.006   25.446  1.00 92.22  ?  4   ILE A CD1   1 
ATOM   14    N  N     . GLN A 1 5   ? 44.043  -0.148  27.446  1.00 90.28  ?  5   GLN A N     1 
ATOM   15    C  CA    . GLN A 1 5   ? 43.799  -0.384  28.870  1.00 91.68  ?  5   GLN A CA    1 
ATOM   16    C  C     . GLN A 1 5   ? 44.458  0.697   29.729  1.00 93.72  ?  5   GLN A C     1 
ATOM   17    O  O     . GLN A 1 5   ? 45.646  0.992   29.560  1.00 94.12  ?  5   GLN A O     1 
ATOM   18    C  CB    . GLN A 1 5   ? 44.324  -1.768  29.280  1.00 84.83  ?  5   GLN A CB    1 
ATOM   19    N  N     . ASN A 1 6   ? 43.691  1.289   30.644  1.00 92.08  ?  6   ASN A N     1 
ATOM   20    C  CA    . ASN A 1 6   ? 44.246  2.288   31.554  1.00 90.33  ?  6   ASN A CA    1 
ATOM   21    C  C     . ASN A 1 6   ? 44.958  1.631   32.721  1.00 89.33  ?  6   ASN A C     1 
ATOM   22    O  O     . ASN A 1 6   ? 44.573  0.552   33.161  1.00 90.74  ?  6   ASN A O     1 
ATOM   23    C  CB    . ASN A 1 6   ? 43.162  3.222   32.089  1.00 94.19  ?  6   ASN A CB    1 
ATOM   24    C  CG    . ASN A 1 6   ? 42.356  3.868   30.989  1.00 98.40  ?  6   ASN A CG    1 
ATOM   25    O  OD1   . ASN A 1 6   ? 41.818  3.185   30.120  1.00 102.67 ?  6   ASN A OD1   1 
ATOM   26    N  ND2   . ASN A 1 6   ? 42.273  5.195   31.013  1.00 97.78  ?  6   ASN A ND2   1 
ATOM   27    N  N     . MET A 1 7   ? 46.004  2.285   33.210  1.00 87.72  ?  7   MET A N     1 
ATOM   28    C  CA    . MET A 1 7   ? 46.706  1.844   34.408  1.00 83.49  ?  7   MET A CA    1 
ATOM   29    C  C     . MET A 1 7   ? 47.166  3.095   35.162  1.00 81.11  ?  7   MET A C     1 
ATOM   30    O  O     . MET A 1 7   ? 47.431  4.132   34.544  1.00 81.74  ?  7   MET A O     1 
ATOM   31    C  CB    . MET A 1 7   ? 47.883  0.923   34.047  1.00 78.72  ?  7   MET A CB    1 
ATOM   32    N  N     . SER A 1 8   ? 47.232  3.016   36.489  1.00 77.30  ?  8   SER A N     1 
ATOM   33    C  CA    . SER A 1 8   ? 47.637  4.175   37.282  1.00 76.23  ?  8   SER A CA    1 
ATOM   34    C  C     . SER A 1 8   ? 49.131  4.445   37.126  1.00 73.74  ?  8   SER A C     1 
ATOM   35    O  O     . SER A 1 8   ? 49.925  3.515   36.986  1.00 72.87  ?  8   SER A O     1 
ATOM   36    C  CB    . SER A 1 8   ? 47.290  3.976   38.762  1.00 78.37  ?  8   SER A CB    1 
ATOM   37    O  OG    . SER A 1 8   ? 47.792  5.040   39.563  1.00 79.61  ?  8   SER A OG    1 
ATOM   38    N  N     . LEU A 1 9   ? 49.514  5.718   37.139  1.00 74.19  ?  9   LEU A N     1 
ATOM   39    C  CA    . LEU A 1 9   ? 50.925  6.066   37.188  1.00 74.87  ?  9   LEU A CA    1 
ATOM   40    C  C     . LEU A 1 9   ? 51.567  5.349   38.385  1.00 81.33  ?  9   LEU A C     1 
ATOM   41    O  O     . LEU A 1 9   ? 52.657  4.782   38.269  1.00 80.26  ?  9   LEU A O     1 
ATOM   42    C  CB    . LEU A 1 9   ? 51.096  7.580   37.317  1.00 73.65  ?  9   LEU A CB    1 
ATOM   43    C  CG    . LEU A 1 9   ? 52.363  8.190   36.714  1.00 57.40  ?  9   LEU A CG    1 
ATOM   44    C  CD1   . LEU A 1 9   ? 52.988  9.223   37.641  1.00 56.65  ?  9   LEU A CD1   1 
ATOM   45    C  CD2   . LEU A 1 9   ? 53.352  7.109   36.367  1.00 71.45  ?  9   LEU A CD2   1 
ATOM   46    N  N     . GLU A 1 10  ? 50.879  5.363   39.530  1.00 85.42  ?  10  GLU A N     1 
ATOM   47    C  CA    . GLU A 1 10  ? 51.378  4.704   40.743  1.00 80.96  ?  10  GLU A CA    1 
ATOM   48    C  C     . GLU A 1 10  ? 51.560  3.199   40.529  1.00 79.39  ?  10  GLU A C     1 
ATOM   49    O  O     . GLU A 1 10  ? 52.539  2.614   40.986  1.00 76.23  ?  10  GLU A O     1 
ATOM   50    C  CB    . GLU A 1 10  ? 50.459  4.979   41.942  1.00 77.26  ?  10  GLU A CB    1 
ATOM   51    N  N     . ASP A 1 11  ? 50.616  2.581   39.826  1.00 80.58  ?  11  ASP A N     1 
ATOM   52    C  CA    . ASP A 1 11  ? 50.701  1.159   39.505  1.00 81.52  ?  11  ASP A CA    1 
ATOM   53    C  C     . ASP A 1 11  ? 51.748  0.857   38.421  1.00 77.51  ?  11  ASP A C     1 
ATOM   54    O  O     . ASP A 1 11  ? 52.520  -0.097  38.547  1.00 72.35  ?  11  ASP A O     1 
ATOM   55    C  CB    . ASP A 1 11  ? 49.334  0.616   39.069  1.00 88.44  ?  11  ASP A CB    1 
ATOM   56    C  CG    . ASP A 1 11  ? 48.358  0.476   40.222  1.00 95.17  ?  11  ASP A CG    1 
ATOM   57    O  OD1   . ASP A 1 11  ? 47.606  1.439   40.494  1.00 101.62 ?  11  ASP A OD1   1 
ATOM   58    O  OD2   . ASP A 1 11  ? 48.329  -0.604  40.848  1.00 95.02  ?  11  ASP A OD2   1 
ATOM   59    N  N     . ILE A 1 12  ? 51.760  1.652   37.351  1.00 81.11  ?  12  ILE A N     1 
ATOM   60    C  CA    . ILE A 1 12  ? 52.692  1.412   36.248  1.00 84.17  ?  12  ILE A CA    1 
ATOM   61    C  C     . ILE A 1 12  ? 54.140  1.551   36.738  1.00 81.51  ?  12  ILE A C     1 
ATOM   62    O  O     . ILE A 1 12  ? 54.989  0.714   36.415  1.00 77.95  ?  12  ILE A O     1 
ATOM   63    C  CB    . ILE A 1 12  ? 52.414  2.316   35.007  1.00 56.23  ?  12  ILE A CB    1 
ATOM   64    N  N     . MET A 1 13  ? 54.412  2.586   37.537  1.00 78.87  ?  13  MET A N     1 
ATOM   65    C  CA    . MET A 1 13  ? 55.750  2.787   38.100  1.00 73.22  ?  13  MET A CA    1 
ATOM   66    C  C     . MET A 1 13  ? 56.089  1.704   39.116  1.00 74.48  ?  13  MET A C     1 
ATOM   67    O  O     . MET A 1 13  ? 57.245  1.502   39.454  1.00 70.28  ?  13  MET A O     1 
ATOM   68    C  CB    . MET A 1 13  ? 55.878  4.169   38.745  1.00 69.14  ?  13  MET A CB    1 
ATOM   69    C  CG    . MET A 1 13  ? 56.004  5.311   37.747  1.00 69.91  ?  13  MET A CG    1 
ATOM   70    S  SD    . MET A 1 13  ? 57.708  5.736   37.350  1.00 85.74  ?  13  MET A SD    1 
ATOM   71    C  CE    . MET A 1 13  ? 58.261  6.346   38.936  1.00 148.99 ?  13  MET A CE    1 
ATOM   72    N  N     . GLY A 1 14  ? 55.068  1.008   39.605  1.00 78.22  ?  14  GLY A N     1 
ATOM   73    C  CA    . GLY A 1 14  ? 55.264  -0.069  40.557  1.00 77.28  ?  14  GLY A CA    1 
ATOM   74    C  C     . GLY A 1 14  ? 55.819  -1.311  39.889  1.00 76.89  ?  14  GLY A C     1 
ATOM   75    O  O     . GLY A 1 14  ? 56.954  -1.691  40.173  1.00 73.65  ?  14  GLY A O     1 
ATOM   76    N  N     . GLU A 1 15  ? 55.028  -1.935  39.006  1.00 81.31  ?  15  GLU A N     1 
ATOM   77    C  CA    . GLU A 1 15  ? 55.471  -3.122  38.262  1.00 77.75  ?  15  GLU A CA    1 
ATOM   78    C  C     . GLU A 1 15  ? 56.799  -2.887  37.534  1.00 72.53  ?  15  GLU A C     1 
ATOM   79    O  O     . GLU A 1 15  ? 57.651  -3.772  37.495  1.00 69.18  ?  15  GLU A O     1 
ATOM   80    C  CB    . GLU A 1 15  ? 54.401  -3.615  37.274  1.00 52.72  ?  15  GLU A CB    1 
ATOM   81    N  N     . ARG A 1 16  ? 56.986  -1.700  36.966  1.00 67.82  ?  16  ARG A N     1 
ATOM   82    C  CA    . ARG A 1 16  ? 58.230  -1.421  36.258  1.00 65.84  ?  16  ARG A CA    1 
ATOM   83    C  C     . ARG A 1 16  ? 59.449  -1.430  37.164  1.00 64.98  ?  16  ARG A C     1 
ATOM   84    O  O     . ARG A 1 16  ? 60.384  -2.193  36.930  1.00 64.92  ?  16  ARG A O     1 
ATOM   85    C  CB    . ARG A 1 16  ? 58.149  -0.126  35.451  1.00 68.77  ?  16  ARG A CB    1 
ATOM   86    C  CG    . ARG A 1 16  ? 57.680  -0.368  34.027  1.00 70.94  ?  16  ARG A CG    1 
ATOM   87    C  CD    . ARG A 1 16  ? 56.666  -1.493  34.035  1.00 72.19  ?  16  ARG A CD    1 
ATOM   88    N  NE    . ARG A 1 16  ? 55.954  -1.660  32.774  1.00 72.65  ?  16  ARG A NE    1 
ATOM   89    C  CZ    . ARG A 1 16  ? 54.783  -2.284  32.676  1.00 71.93  ?  16  ARG A CZ    1 
ATOM   90    N  NH1   . ARG A 1 16  ? 54.208  -2.782  33.769  1.00 74.46  ?  16  ARG A NH1   1 
ATOM   91    N  NH2   . ARG A 1 16  ? 54.182  -2.409  31.498  1.00 68.41  ?  16  ARG A NH2   1 
ATOM   92    N  N     . PHE A 1 17  ? 59.445  -0.602  38.203  1.00 64.86  ?  17  PHE A N     1 
ATOM   93    C  CA    . PHE A 1 17  ? 60.623  -0.498  39.060  1.00 62.41  ?  17  PHE A CA    1 
ATOM   94    C  C     . PHE A 1 17  ? 60.917  -1.758  39.883  1.00 58.80  ?  17  PHE A C     1 
ATOM   95    O  O     . PHE A 1 17  ? 62.076  -2.126  40.087  1.00 57.66  ?  17  PHE A O     1 
ATOM   96    C  CB    . PHE A 1 17  ? 60.544  0.717   39.969  1.00 62.68  ?  17  PHE A CB    1 
ATOM   97    C  CG    . PHE A 1 17  ? 61.874  1.153   40.481  1.00 61.20  ?  17  PHE A CG    1 
ATOM   98    C  CD1   . PHE A 1 17  ? 62.363  0.659   41.685  1.00 62.87  ?  17  PHE A CD1   1 
ATOM   99    C  CD2   . PHE A 1 17  ? 62.656  2.036   39.742  1.00 59.00  ?  17  PHE A CD2   1 
ATOM   100   C  CE1   . PHE A 1 17  ? 63.603  1.054   42.154  1.00 63.43  ?  17  PHE A CE1   1 
ATOM   101   C  CE2   . PHE A 1 17  ? 63.898  2.436   40.202  1.00 58.21  ?  17  PHE A CE2   1 
ATOM   102   C  CZ    . PHE A 1 17  ? 64.374  1.948   41.411  1.00 60.74  ?  17  PHE A CZ    1 
ATOM   103   N  N     . GLY A 1 18  ? 59.870  -2.412  40.360  1.00 58.18  ?  18  GLY A N     1 
ATOM   104   C  CA    . GLY A 1 18  ? 60.040  -3.684  41.029  1.00 61.70  ?  18  GLY A CA    1 
ATOM   105   C  C     . GLY A 1 18  ? 60.669  -4.715  40.114  1.00 64.36  ?  18  GLY A C     1 
ATOM   106   O  O     . GLY A 1 18  ? 61.591  -5.423  40.510  1.00 66.11  ?  18  GLY A O     1 
ATOM   107   N  N     . ARG A 1 19  ? 60.169  -4.794  38.884  1.00 65.57  ?  19  ARG A N     1 
ATOM   108   C  CA    . ARG A 1 19  ? 60.681  -5.748  37.907  1.00 61.51  ?  19  ARG A CA    1 
ATOM   109   C  C     . ARG A 1 19  ? 62.189  -5.570  37.729  1.00 52.87  ?  19  ARG A C     1 
ATOM   110   O  O     . ARG A 1 19  ? 62.949  -6.544  37.798  1.00 46.66  ?  19  ARG A O     1 
ATOM   111   C  CB    . ARG A 1 19  ? 59.938  -5.610  36.572  1.00 42.56  ?  19  ARG A CB    1 
ATOM   112   N  N     . TYR A 1 20  ? 62.609  -4.318  37.539  1.00 50.34  ?  20  TYR A N     1 
ATOM   113   C  CA    . TYR A 1 20  ? 64.007  -3.972  37.258  1.00 40.17  ?  20  TYR A CA    1 
ATOM   114   C  C     . TYR A 1 20  ? 64.874  -4.035  38.499  1.00 47.73  ?  20  TYR A C     1 
ATOM   115   O  O     . TYR A 1 20  ? 65.942  -4.616  38.474  1.00 46.55  ?  20  TYR A O     1 
ATOM   116   C  CB    . TYR A 1 20  ? 64.081  -2.576  36.626  1.00 47.83  ?  20  TYR A CB    1 
ATOM   117   C  CG    . TYR A 1 20  ? 65.467  -1.984  36.403  1.00 48.49  ?  20  TYR A CG    1 
ATOM   118   C  CD1   . TYR A 1 20  ? 66.281  -2.417  35.371  1.00 56.07  ?  20  TYR A CD1   1 
ATOM   119   C  CD2   . TYR A 1 20  ? 65.919  -0.936  37.185  1.00 48.60  ?  20  TYR A CD2   1 
ATOM   120   C  CE1   . TYR A 1 20  ? 67.533  -1.850  35.161  1.00 64.04  ?  20  TYR A CE1   1 
ATOM   121   C  CE2   . TYR A 1 20  ? 67.158  -0.370  36.990  1.00 54.51  ?  20  TYR A CE2   1 
ATOM   122   C  CZ    . TYR A 1 20  ? 67.967  -0.822  35.981  1.00 63.91  ?  20  TYR A CZ    1 
ATOM   123   O  OH    . TYR A 1 20  ? 69.209  -0.234  35.797  1.00 69.85  ?  20  TYR A OH    1 
ATOM   124   N  N     . SER A 1 21  ? 64.408  -3.435  39.587  1.00 47.16  ?  21  SER A N     1 
ATOM   125   C  CA    . SER A 1 21  ? 65.133  -3.502  40.848  1.00 46.71  ?  21  SER A CA    1 
ATOM   126   C  C     . SER A 1 21  ? 65.526  -4.965  41.145  1.00 45.20  ?  21  SER A C     1 
ATOM   127   O  O     . SER A 1 21  ? 66.711  -5.302  41.229  1.00 42.39  ?  21  SER A O     1 
ATOM   128   C  CB    . SER A 1 21  ? 64.306  -2.884  41.984  1.00 39.59  ?  21  SER A CB    1 
ATOM   129   N  N     . LYS A 1 22  ? 64.536  -5.841  41.270  1.00 48.25  ?  22  LYS A N     1 
ATOM   130   C  CA    . LYS A 1 22  ? 64.815  -7.245  41.563  1.00 47.83  ?  22  LYS A CA    1 
ATOM   131   C  C     . LYS A 1 22  ? 65.871  -7.863  40.649  1.00 52.23  ?  22  LYS A C     1 
ATOM   132   O  O     . LYS A 1 22  ? 66.673  -8.683  41.095  1.00 57.79  ?  22  LYS A O     1 
ATOM   133   C  CB    . LYS A 1 22  ? 63.539  -8.078  41.476  1.00 42.27  ?  22  LYS A CB    1 
ATOM   134   C  CG    . LYS A 1 22  ? 63.759  -9.552  41.709  1.00 40.60  ?  22  LYS A CG    1 
ATOM   135   C  CD    . LYS A 1 22  ? 62.512  -10.335 41.360  1.00 48.72  ?  22  LYS A CD    1 
ATOM   136   C  CE    . LYS A 1 22  ? 62.513  -11.685 42.054  1.00 57.01  ?  22  LYS A CE    1 
ATOM   137   N  NZ    . LYS A 1 22  ? 61.241  -12.413 41.829  1.00 62.87  ?  22  LYS A NZ    1 
ATOM   138   N  N     . TYR A 1 23  ? 65.862  -7.486  39.371  1.00 48.69  ?  23  TYR A N     1 
ATOM   139   C  CA    . TYR A 1 23  ? 66.704  -8.163  38.386  1.00 48.39  ?  23  TYR A CA    1 
ATOM   140   C  C     . TYR A 1 23  ? 68.142  -7.688  38.491  1.00 48.97  ?  23  TYR A C     1 
ATOM   141   O  O     . TYR A 1 23  ? 69.076  -8.494  38.571  1.00 48.16  ?  23  TYR A O     1 
ATOM   142   C  CB    . TYR A 1 23  ? 66.168  -7.971  36.954  1.00 45.38  ?  23  TYR A CB    1 
ATOM   143   C  CG    . TYR A 1 23  ? 67.036  -8.607  35.871  1.00 43.89  ?  23  TYR A CG    1 
ATOM   144   C  CD1   . TYR A 1 23  ? 68.059  -7.895  35.264  1.00 47.12  ?  23  TYR A CD1   1 
ATOM   145   C  CD2   . TYR A 1 23  ? 66.839  -9.919  35.471  1.00 44.41  ?  23  TYR A CD2   1 
ATOM   146   C  CE1   . TYR A 1 23  ? 68.862  -8.466  34.290  1.00 54.88  ?  23  TYR A CE1   1 
ATOM   147   C  CE2   . TYR A 1 23  ? 67.639  -10.502 34.502  1.00 50.39  ?  23  TYR A CE2   1 
ATOM   148   C  CZ    . TYR A 1 23  ? 68.652  -9.772  33.906  1.00 56.35  ?  23  TYR A CZ    1 
ATOM   149   O  OH    . TYR A 1 23  ? 69.453  -10.344 32.923  1.00 57.54  ?  23  TYR A OH    1 
ATOM   150   N  N     . ILE A 1 24  ? 68.305  -6.371  38.480  1.00 48.41  ?  24  ILE A N     1 
ATOM   151   C  CA    . ILE A 1 24  ? 69.610  -5.732  38.562  1.00 47.36  ?  24  ILE A CA    1 
ATOM   152   C  C     . ILE A 1 24  ? 70.297  -6.068  39.917  1.00 47.36  ?  24  ILE A C     1 
ATOM   153   O  O     . ILE A 1 24  ? 71.527  -6.028  40.030  1.00 52.45  ?  24  ILE A O     1 
ATOM   154   C  CB    . ILE A 1 24  ? 69.456  -4.206  38.316  1.00 54.84  ?  24  ILE A CB    1 
ATOM   155   C  CG1   . ILE A 1 24  ? 70.789  -3.477  38.283  1.00 60.69  ?  24  ILE A CG1   1 
ATOM   156   C  CG2   . ILE A 1 24  ? 68.637  -3.566  39.403  1.00 54.38  ?  24  ILE A CG2   1 
ATOM   157   C  CD1   . ILE A 1 24  ? 70.661  -2.010  38.742  1.00 63.10  ?  24  ILE A CD1   1 
ATOM   158   N  N     . ILE A 1 25  ? 69.506  -6.430  40.930  1.00 40.63  ?  25  ILE A N     1 
ATOM   159   C  CA    . ILE A 1 25  ? 70.057  -6.865  42.223  1.00 41.45  ?  25  ILE A CA    1 
ATOM   160   C  C     . ILE A 1 25  ? 70.465  -8.344  42.222  1.00 44.48  ?  25  ILE A C     1 
ATOM   161   O  O     . ILE A 1 25  ? 71.630  -8.687  42.429  1.00 44.87  ?  25  ILE A O     1 
ATOM   162   C  CB    . ILE A 1 25  ? 69.051  -6.675  43.373  1.00 43.31  ?  25  ILE A CB    1 
ATOM   163   C  CG1   . ILE A 1 25  ? 68.900  -5.205  43.762  1.00 46.88  ?  25  ILE A CG1   1 
ATOM   164   C  CG2   . ILE A 1 25  ? 69.506  -7.430  44.579  1.00 40.77  ?  25  ILE A CG2   1 
ATOM   165   C  CD1   . ILE A 1 25  ? 67.672  -4.946  44.615  1.00 36.27  ?  25  ILE A CD1   1 
ATOM   166   N  N     . GLN A 1 26  ? 69.487  -9.213  41.990  1.00 46.26  ?  26  GLN A N     1 
ATOM   167   C  CA    . GLN A 1 26  ? 69.709  -10.652 41.935  1.00 48.78  ?  26  GLN A CA    1 
ATOM   168   C  C     . GLN A 1 26  ? 70.592  -11.124 40.781  1.00 53.42  ?  26  GLN A C     1 
ATOM   169   O  O     . GLN A 1 26  ? 71.284  -12.134 40.911  1.00 50.97  ?  26  GLN A O     1 
ATOM   170   C  CB    . GLN A 1 26  ? 68.372  -11.376 41.800  1.00 50.52  ?  26  GLN A CB    1 
ATOM   171   C  CG    . GLN A 1 26  ? 67.555  -11.471 43.060  1.00 52.16  ?  26  GLN A CG    1 
ATOM   172   C  CD    . GLN A 1 26  ? 66.304  -12.283 42.852  1.00 55.29  ?  26  GLN A CD    1 
ATOM   173   O  OE1   . GLN A 1 26  ? 65.784  -12.364 41.737  1.00 60.19  ?  26  GLN A OE1   1 
ATOM   174   N  NE2   . GLN A 1 26  ? 65.826  -12.916 43.914  1.00 56.61  ?  26  GLN A NE2   1 
ATOM   175   N  N     . ASP A 1 27  ? 70.542  -10.416 39.651  1.00 57.06  ?  27  ASP A N     1 
ATOM   176   C  CA    . ASP A 1 27  ? 71.023  -10.964 38.383  1.00 56.79  ?  27  ASP A CA    1 
ATOM   177   C  C     . ASP A 1 27  ? 71.950  -10.061 37.583  1.00 54.19  ?  27  ASP A C     1 
ATOM   178   O  O     . ASP A 1 27  ? 72.018  -10.177 36.355  1.00 54.84  ?  27  ASP A O     1 
ATOM   179   C  CB    . ASP A 1 27  ? 69.835  -11.343 37.497  1.00 66.58  ?  27  ASP A CB    1 
ATOM   180   C  CG    . ASP A 1 27  ? 69.159  -12.629 37.936  1.00 76.82  ?  27  ASP A CG    1 
ATOM   181   O  OD1   . ASP A 1 27  ? 69.873  -13.559 38.385  1.00 80.96  ?  27  ASP A OD1   1 
ATOM   182   O  OD2   . ASP A 1 27  ? 67.913  -12.709 37.823  1.00 78.38  ?  27  ASP A OD2   1 
ATOM   183   N  N     . ARG A 1 28  ? 72.673  -9.173  38.257  1.00 53.69  ?  28  ARG A N     1 
ATOM   184   C  CA    . ARG A 1 28  ? 73.582  -8.291  37.531  1.00 50.48  ?  28  ARG A CA    1 
ATOM   185   C  C     . ARG A 1 28  ? 74.739  -7.702  38.326  1.00 45.33  ?  28  ARG A C     1 
ATOM   186   O  O     . ARG A 1 28  ? 75.894  -8.067  38.116  1.00 42.70  ?  28  ARG A O     1 
ATOM   187   C  CB    . ARG A 1 28  ? 72.813  -7.154  36.868  1.00 47.42  ?  28  ARG A CB    1 
ATOM   188   C  CG    . ARG A 1 28  ? 73.715  -6.269  36.050  1.00 50.03  ?  28  ARG A CG    1 
ATOM   189   C  CD    . ARG A 1 28  ? 72.935  -5.204  35.346  1.00 55.38  ?  28  ARG A CD    1 
ATOM   190   N  NE    . ARG A 1 28  ? 72.055  -5.741  34.320  1.00 56.44  ?  28  ARG A NE    1 
ATOM   191   C  CZ    . ARG A 1 28  ? 71.234  -4.984  33.601  1.00 56.47  ?  28  ARG A CZ    1 
ATOM   192   N  NH1   . ARG A 1 28  ? 70.452  -5.530  32.677  1.00 57.87  ?  28  ARG A NH1   1 
ATOM   193   N  NH2   . ARG A 1 28  ? 71.198  -3.673  33.816  1.00 54.92  ?  28  ARG A NH2   1 
ATOM   194   N  N     . ALA A 1 29  ? 74.421  -6.782  39.228  1.00 42.56  ?  29  ALA A N     1 
ATOM   195   C  CA    . ALA A 1 29  ? 75.438  -5.942  39.848  1.00 44.87  ?  29  ALA A CA    1 
ATOM   196   C  C     . ALA A 1 29  ? 76.139  -6.570  41.037  1.00 48.14  ?  29  ALA A C     1 
ATOM   197   O  O     . ALA A 1 29  ? 77.281  -6.234  41.316  1.00 52.93  ?  29  ALA A O     1 
ATOM   198   C  CB    . ALA A 1 29  ? 74.838  -4.610  40.252  1.00 46.73  ?  29  ALA A CB    1 
ATOM   199   N  N     . LEU A 1 30  ? 75.460  -7.470  41.743  1.00 45.44  ?  30  LEU A N     1 
ATOM   200   C  CA    . LEU A 1 30  ? 76.007  -8.011  42.979  1.00 39.38  ?  30  LEU A CA    1 
ATOM   201   C  C     . LEU A 1 30  ? 76.345  -9.477  42.814  1.00 41.34  ?  30  LEU A C     1 
ATOM   202   O  O     . LEU A 1 30  ? 75.575  -10.228 42.201  1.00 38.74  ?  30  LEU A O     1 
ATOM   203   C  CB    . LEU A 1 30  ? 75.010  -7.838  44.120  1.00 34.29  ?  30  LEU A CB    1 
ATOM   204   C  CG    . LEU A 1 30  ? 74.337  -6.466  44.137  1.00 34.75  ?  30  LEU A CG    1 
ATOM   205   C  CD1   . LEU A 1 30  ? 73.049  -6.470  44.946  1.00 34.16  ?  30  LEU A CD1   1 
ATOM   206   C  CD2   . LEU A 1 30  ? 75.298  -5.408  44.638  1.00 41.38  ?  30  LEU A CD2   1 
ATOM   207   N  N     . PRO A 1 31  ? 77.490  -9.886  43.391  1.00 38.62  ?  31  PRO A N     1 
ATOM   208   C  CA    . PRO A 1 31  ? 78.081  -11.230 43.364  1.00 26.42  ?  31  PRO A CA    1 
ATOM   209   C  C     . PRO A 1 31  ? 77.320  -12.220 44.236  1.00 41.32  ?  31  PRO A C     1 
ATOM   210   O  O     . PRO A 1 31  ? 76.810  -11.822 45.281  1.00 42.69  ?  31  PRO A O     1 
ATOM   211   C  CB    . PRO A 1 31  ? 79.451  -11.005 44.007  1.00 28.90  ?  31  PRO A CB    1 
ATOM   212   C  CG    . PRO A 1 31  ? 79.230  -9.871  44.947  1.00 27.62  ?  31  PRO A CG    1 
ATOM   213   C  CD    . PRO A 1 31  ? 78.267  -8.960  44.239  1.00 28.28  ?  31  PRO A CD    1 
ATOM   214   N  N     . ASP A 1 32  ? 77.249  -13.485 43.823  1.00 37.41  ?  32  ASP A N     1 
ATOM   215   C  CA    . ASP A 1 32  ? 76.830  -14.558 44.723  1.00 38.74  ?  32  ASP A CA    1 
ATOM   216   C  C     . ASP A 1 32  ? 77.892  -14.642 45.833  1.00 46.61  ?  32  ASP A C     1 
ATOM   217   O  O     . ASP A 1 32  ? 79.089  -14.455 45.582  1.00 47.98  ?  32  ASP A O     1 
ATOM   218   C  CB    . ASP A 1 32  ? 76.689  -15.897 43.973  1.00 39.08  ?  32  ASP A CB    1 
ATOM   219   C  CG    . ASP A 1 32  ? 76.244  -17.059 44.886  1.00 47.60  ?  32  ASP A CG    1 
ATOM   220   O  OD1   . ASP A 1 32  ? 75.026  -17.331 44.982  1.00 50.22  ?  32  ASP A OD1   1 
ATOM   221   O  OD2   . ASP A 1 32  ? 77.115  -17.715 45.508  1.00 52.11  ?  32  ASP A OD2   1 
ATOM   222   N  N     . ILE A 1 33  ? 77.449  -14.911 47.059  1.00 48.13  ?  33  ILE A N     1 
ATOM   223   C  CA    . ILE A 1 33  ? 78.327  -14.908 48.225  1.00 41.96  ?  33  ILE A CA    1 
ATOM   224   C  C     . ILE A 1 33  ? 79.244  -16.136 48.292  1.00 39.70  ?  33  ILE A C     1 
ATOM   225   O  O     . ILE A 1 33  ? 80.256  -16.119 48.995  1.00 45.03  ?  33  ILE A O     1 
ATOM   226   C  CB    . ILE A 1 33  ? 77.507  -14.782 49.528  1.00 38.92  ?  33  ILE A CB    1 
ATOM   227   C  CG1   . ILE A 1 33  ? 78.409  -14.387 50.697  1.00 40.72  ?  33  ILE A CG1   1 
ATOM   228   C  CG2   . ILE A 1 33  ? 76.750  -16.076 49.817  1.00 35.19  ?  33  ILE A CG2   1 
ATOM   229   C  CD1   . ILE A 1 33  ? 77.659  -14.114 51.968  1.00 29.98  ?  33  ILE A CD1   1 
ATOM   230   N  N     . ARG A 1 34  ? 78.900  -17.189 47.555  1.00 33.38  ?  34  ARG A N     1 
ATOM   231   C  CA    . ARG A 1 34  ? 79.699  -18.416 47.553  1.00 33.81  ?  34  ARG A CA    1 
ATOM   232   C  C     . ARG A 1 34  ? 80.844  -18.452 46.518  1.00 35.23  ?  34  ARG A C     1 
ATOM   233   O  O     . ARG A 1 34  ? 82.000  -18.673 46.884  1.00 42.05  ?  34  ARG A O     1 
ATOM   234   C  CB    . ARG A 1 34  ? 78.795  -19.618 47.372  1.00 24.96  ?  34  ARG A CB    1 
ATOM   235   C  CG    . ARG A 1 34  ? 77.532  -19.523 48.159  1.00 25.74  ?  34  ARG A CG    1 
ATOM   236   C  CD    . ARG A 1 34  ? 76.540  -20.571 47.696  1.00 32.25  ?  34  ARG A CD    1 
ATOM   237   N  NE    . ARG A 1 34  ? 75.642  -20.066 46.661  1.00 29.92  ?  34  ARG A NE    1 
ATOM   238   C  CZ    . ARG A 1 34  ? 74.694  -20.808 46.087  1.00 32.30  ?  34  ARG A CZ    1 
ATOM   239   N  NH1   . ARG A 1 34  ? 74.545  -22.072 46.468  1.00 36.28  ?  34  ARG A NH1   1 
ATOM   240   N  NH2   . ARG A 1 34  ? 73.906  -20.309 45.129  1.00 31.58  ?  34  ARG A NH2   1 
ATOM   241   N  N     . ASP A 1 35  ? 80.541  -18.248 45.235  1.00 28.10  ?  35  ASP A N     1 
ATOM   242   C  CA    . ASP A 1 35  ? 81.605  -18.241 44.223  1.00 30.13  ?  35  ASP A CA    1 
ATOM   243   C  C     . ASP A 1 35  ? 82.160  -16.849 43.907  1.00 32.96  ?  35  ASP A C     1 
ATOM   244   O  O     . ASP A 1 35  ? 83.219  -16.714 43.279  1.00 35.44  ?  35  ASP A O     1 
ATOM   245   C  CB    . ASP A 1 35  ? 81.206  -18.993 42.943  1.00 33.21  ?  35  ASP A CB    1 
ATOM   246   C  CG    . ASP A 1 35  ? 80.103  -18.293 42.143  1.00 38.91  ?  35  ASP A CG    1 
ATOM   247   O  OD1   . ASP A 1 35  ? 79.861  -17.076 42.355  1.00 40.15  ?  35  ASP A OD1   1 
ATOM   248   O  OD2   . ASP A 1 35  ? 79.482  -18.980 41.286  1.00 40.90  ?  35  ASP A OD2   1 
ATOM   249   N  N     . GLY A 1 36  ? 81.444  -15.821 44.351  1.00 32.00  ?  36  GLY A N     1 
ATOM   250   C  CA    . GLY A 1 36  ? 81.941  -14.457 44.291  1.00 34.38  ?  36  GLY A CA    1 
ATOM   251   C  C     . GLY A 1 36  ? 81.789  -13.795 42.941  1.00 36.44  ?  36  GLY A C     1 
ATOM   252   O  O     . GLY A 1 36  ? 82.322  -12.711 42.702  1.00 40.46  ?  36  GLY A O     1 
ATOM   253   N  N     . LEU A 1 37  ? 81.040  -14.450 42.062  1.00 35.66  ?  37  LEU A N     1 
ATOM   254   C  CA    . LEU A 1 37  ? 80.856  -13.989 40.698  1.00 31.95  ?  37  LEU A CA    1 
ATOM   255   C  C     . LEU A 1 37  ? 79.537  -13.253 40.530  1.00 35.75  ?  37  LEU A C     1 
ATOM   256   O  O     . LEU A 1 37  ? 78.568  -13.524 41.245  1.00 37.67  ?  37  LEU A O     1 
ATOM   257   C  CB    . LEU A 1 37  ? 80.907  -15.186 39.749  1.00 30.35  ?  37  LEU A CB    1 
ATOM   258   C  CG    . LEU A 1 37  ? 82.219  -15.959 39.863  1.00 28.29  ?  37  LEU A CG    1 
ATOM   259   C  CD1   . LEU A 1 37  ? 82.145  -17.253 39.072  1.00 30.47  ?  37  LEU A CD1   1 
ATOM   260   C  CD2   . LEU A 1 37  ? 83.408  -15.093 39.421  1.00 22.80  ?  37  LEU A CD2   1 
ATOM   261   N  N     . LYS A 1 38  ? 79.518  -12.300 39.598  1.00 38.16  ?  38  LYS A N     1 
ATOM   262   C  CA    . LYS A 1 38  ? 78.270  -11.731 39.093  1.00 39.83  ?  38  LYS A CA    1 
ATOM   263   C  C     . LYS A 1 38  ? 77.922  -12.600 37.917  1.00 43.28  ?  38  LYS A C     1 
ATOM   264   O  O     . LYS A 1 38  ? 78.823  -13.165 37.291  1.00 46.32  ?  38  LYS A O     1 
ATOM   265   C  CB    . LYS A 1 38  ? 78.465  -10.303 38.604  1.00 25.63  ?  38  LYS A CB    1 
ATOM   266   C  CG    . LYS A 1 38  ? 79.214  -9.404  39.548  1.00 26.06  ?  38  LYS A CG    1 
ATOM   267   C  CD    . LYS A 1 38  ? 79.679  -8.156  38.837  1.00 33.84  ?  38  LYS A CD    1 
ATOM   268   C  CE    . LYS A 1 38  ? 80.005  -7.045  39.828  1.00 33.34  ?  38  LYS A CE    1 
ATOM   269   N  NZ    . LYS A 1 38  ? 80.398  -5.769  39.154  1.00 35.98  ?  38  LYS A NZ    1 
ATOM   270   N  N     . PRO A 1 39  ? 76.628  -12.698 37.582  1.00 41.35  ?  39  PRO A N     1 
ATOM   271   C  CA    . PRO A 1 39  ? 76.178  -13.612 36.513  1.00 43.07  ?  39  PRO A CA    1 
ATOM   272   C  C     . PRO A 1 39  ? 76.979  -13.478 35.188  1.00 39.27  ?  39  PRO A C     1 
ATOM   273   O  O     . PRO A 1 39  ? 77.321  -14.494 34.588  1.00 36.16  ?  39  PRO A O     1 
ATOM   274   C  CB    . PRO A 1 39  ? 74.705  -13.229 36.307  1.00 41.13  ?  39  PRO A CB    1 
ATOM   275   C  CG    . PRO A 1 39  ? 74.346  -12.395 37.474  1.00 39.89  ?  39  PRO A CG    1 
ATOM   276   C  CD    . PRO A 1 39  ? 75.596  -11.721 37.942  1.00 39.72  ?  39  PRO A CD    1 
ATOM   277   N  N     . VAL A 1 40  ? 77.290  -12.258 34.752  1.00 39.37  ?  40  VAL A N     1 
ATOM   278   C  CA    . VAL A 1 40  ? 78.116  -12.101 33.565  1.00 35.03  ?  40  VAL A CA    1 
ATOM   279   C  C     . VAL A 1 40  ? 79.448  -12.844 33.678  1.00 33.94  ?  40  VAL A C     1 
ATOM   280   O  O     . VAL A 1 40  ? 79.850  -13.549 32.751  1.00 33.44  ?  40  VAL A O     1 
ATOM   281   C  CB    . VAL A 1 40  ? 78.383  -10.628 33.216  1.00 33.68  ?  40  VAL A CB    1 
ATOM   282   C  CG1   . VAL A 1 40  ? 79.487  -10.049 34.099  1.00 30.34  ?  40  VAL A CG1   1 
ATOM   283   C  CG2   . VAL A 1 40  ? 78.747  -10.519 31.737  1.00 30.89  ?  40  VAL A CG2   1 
ATOM   284   N  N     . GLN A 1 41  ? 80.135  -12.694 34.805  1.00 23.94  ?  41  GLN A N     1 
ATOM   285   C  CA    . GLN A 1 41  ? 81.413  -13.376 34.969  1.00 32.00  ?  41  GLN A CA    1 
ATOM   286   C  C     . GLN A 1 41  ? 81.260  -14.911 34.963  1.00 49.00  ?  41  GLN A C     1 
ATOM   287   O  O     . GLN A 1 41  ? 82.080  -15.619 34.348  1.00 22.91  ?  41  GLN A O     1 
ATOM   288   C  CB    . GLN A 1 41  ? 82.157  -12.891 36.222  1.00 23.35  ?  41  GLN A CB    1 
ATOM   289   C  CG    . GLN A 1 41  ? 82.494  -11.412 36.224  1.00 36.78  ?  41  GLN A CG    1 
ATOM   290   C  CD    . GLN A 1 41  ? 82.585  -10.821 37.626  1.00 41.69  ?  41  GLN A CD    1 
ATOM   291   O  OE1   . GLN A 1 41  ? 81.971  -11.316 38.576  1.00 42.39  ?  41  GLN A OE1   1 
ATOM   292   N  NE2   . GLN A 1 41  ? 83.357  -9.752  37.759  1.00 46.69  ?  41  GLN A NE2   1 
ATOM   293   N  N     . ARG A 1 42  ? 80.218  -15.422 35.625  1.00 23.12  ?  42  ARG A N     1 
ATOM   294   C  CA    . ARG A 1 42  ? 79.978  -16.868 35.650  1.00 23.02  ?  42  ARG A CA    1 
ATOM   295   C  C     . ARG A 1 42  ? 79.833  -17.419 34.243  1.00 32.83  ?  42  ARG A C     1 
ATOM   296   O  O     . ARG A 1 42  ? 80.477  -18.404 33.882  1.00 32.27  ?  42  ARG A O     1 
ATOM   297   C  CB    . ARG A 1 42  ? 78.749  -17.228 36.479  1.00 30.64  ?  42  ARG A CB    1 
ATOM   298   C  CG    . ARG A 1 42  ? 78.808  -18.641 37.102  1.00 31.28  ?  42  ARG A CG    1 
ATOM   299   C  CD    . ARG A 1 42  ? 77.662  -18.887 38.096  1.00 35.46  ?  42  ARG A CD    1 
ATOM   300   N  NE    . ARG A 1 42  ? 77.752  -17.989 39.250  1.00 39.17  ?  42  ARG A NE    1 
ATOM   301   C  CZ    . ARG A 1 42  ? 77.080  -16.844 39.367  1.00 44.27  ?  42  ARG A CZ    1 
ATOM   302   N  NH1   . ARG A 1 42  ? 76.242  -16.458 38.408  1.00 51.00  ?  42  ARG A NH1   1 
ATOM   303   N  NH2   . ARG A 1 42  ? 77.246  -16.086 40.444  1.00 42.17  ?  42  ARG A NH2   1 
ATOM   304   N  N     . ARG A 1 43  ? 78.986  -16.768 33.453  1.00 32.22  ?  43  ARG A N     1 
ATOM   305   C  CA    . ARG A 1 43  ? 78.775  -17.132 32.053  1.00 33.70  ?  43  ARG A CA    1 
ATOM   306   C  C     . ARG A 1 43  ? 80.039  -17.091 31.213  1.00 42.15  ?  43  ARG A C     1 
ATOM   307   O  O     . ARG A 1 43  ? 80.312  -18.008 30.445  1.00 46.55  ?  43  ARG A O     1 
ATOM   308   C  CB    . ARG A 1 43  ? 77.736  -16.223 31.436  1.00 25.05  ?  43  ARG A CB    1 
ATOM   309   C  CG    . ARG A 1 43  ? 76.359  -16.647 31.829  1.00 38.25  ?  43  ARG A CG    1 
ATOM   310   C  CD    . ARG A 1 43  ? 75.394  -15.500 31.877  1.00 34.22  ?  43  ARG A CD    1 
ATOM   311   N  NE    . ARG A 1 43  ? 74.092  -16.021 32.262  1.00 33.25  ?  43  ARG A NE    1 
ATOM   312   C  CZ    . ARG A 1 43  ? 73.019  -15.276 32.466  1.00 35.64  ?  43  ARG A CZ    1 
ATOM   313   N  NH1   . ARG A 1 43  ? 73.089  -13.958 32.320  1.00 35.68  ?  43  ARG A NH1   1 
ATOM   314   N  NH2   . ARG A 1 43  ? 71.882  -15.861 32.813  1.00 37.38  ?  43  ARG A NH2   1 
ATOM   315   N  N     . ILE A 1 44  ? 80.812  -16.027 31.344  1.00 23.94  ?  44  ILE A N     1 
ATOM   316   C  CA    . ILE A 1 44  ? 82.109  -16.020 30.712  1.00 34.20  ?  44  ILE A CA    1 
ATOM   317   C  C     . ILE A 1 44  ? 82.918  -17.278 31.062  1.00 33.86  ?  44  ILE A C     1 
ATOM   318   O  O     . ILE A 1 44  ? 83.337  -18.008 30.163  1.00 34.66  ?  44  ILE A O     1 
ATOM   319   C  CB    . ILE A 1 44  ? 82.871  -14.751 31.043  1.00 33.77  ?  44  ILE A CB    1 
ATOM   320   C  CG1   . ILE A 1 44  ? 82.053  -13.549 30.546  1.00 31.37  ?  44  ILE A CG1   1 
ATOM   321   C  CG2   . ILE A 1 44  ? 84.282  -14.797 30.433  1.00 34.12  ?  44  ILE A CG2   1 
ATOM   322   C  CD1   . ILE A 1 44  ? 82.786  -12.230 30.526  1.00 27.88  ?  44  ILE A CD1   1 
ATOM   323   N  N     . LEU A 1 45  ? 83.124  -17.551 32.352  1.00 30.90  ?  45  LEU A N     1 
ATOM   324   C  CA    . LEU A 1 45  ? 83.937  -18.711 32.739  1.00 32.62  ?  45  LEU A CA    1 
ATOM   325   C  C     . LEU A 1 45  ? 83.318  -20.039 32.321  1.00 36.39  ?  45  LEU A C     1 
ATOM   326   O  O     . LEU A 1 45  ? 84.004  -20.942 31.832  1.00 38.76  ?  45  LEU A O     1 
ATOM   327   C  CB    . LEU A 1 45  ? 84.195  -18.737 34.237  1.00 26.51  ?  45  LEU A CB    1 
ATOM   328   C  CG    . LEU A 1 45  ? 84.896  -17.527 34.829  1.00 30.53  ?  45  LEU A CG    1 
ATOM   329   C  CD1   . LEU A 1 45  ? 85.329  -17.852 36.232  1.00 36.60  ?  45  LEU A CD1   1 
ATOM   330   C  CD2   . LEU A 1 45  ? 86.081  -17.138 34.006  1.00 33.85  ?  45  LEU A CD2   1 
ATOM   331   N  N     . TYR A 1 46  ? 82.018  -20.170 32.531  1.00 33.63  ?  46  TYR A N     1 
ATOM   332   C  CA    . TYR A 1 46  ? 81.370  -21.416 32.196  1.00 34.57  ?  46  TYR A CA    1 
ATOM   333   C  C     . TYR A 1 46  ? 81.419  -21.667 30.681  1.00 35.23  ?  46  TYR A C     1 
ATOM   334   O  O     . TYR A 1 46  ? 81.712  -22.781 30.237  1.00 35.74  ?  46  TYR A O     1 
ATOM   335   C  CB    . TYR A 1 46  ? 79.948  -21.450 32.732  1.00 24.34  ?  46  TYR A CB    1 
ATOM   336   C  CG    . TYR A 1 46  ? 79.209  -22.670 32.273  1.00 31.37  ?  46  TYR A CG    1 
ATOM   337   C  CD1   . TYR A 1 46  ? 78.183  -22.570 31.336  1.00 31.36  ?  46  TYR A CD1   1 
ATOM   338   C  CD2   . TYR A 1 46  ? 79.560  -23.929 32.736  1.00 31.11  ?  46  TYR A CD2   1 
ATOM   339   C  CE1   . TYR A 1 46  ? 77.512  -23.681 30.899  1.00 36.78  ?  46  TYR A CE1   1 
ATOM   340   C  CE2   . TYR A 1 46  ? 78.897  -25.054 32.306  1.00 33.60  ?  46  TYR A CE2   1 
ATOM   341   C  CZ    . TYR A 1 46  ? 77.869  -24.933 31.386  1.00 37.19  ?  46  TYR A CZ    1 
ATOM   342   O  OH    . TYR A 1 46  ? 77.191  -26.054 30.930  1.00 37.85  ?  46  TYR A OH    1 
ATOM   343   N  N     . SER A 1 47  ? 81.154  -20.632 29.888  1.00 36.15  ?  47  SER A N     1 
ATOM   344   C  CA    . SER A 1 47  ? 81.200  -20.787 28.441  1.00 36.07  ?  47  SER A CA    1 
ATOM   345   C  C     . SER A 1 47  ? 82.607  -21.137 27.973  1.00 34.37  ?  47  SER A C     1 
ATOM   346   O  O     . SER A 1 47  ? 82.814  -22.183 27.366  1.00 33.52  ?  47  SER A O     1 
ATOM   347   C  CB    . SER A 1 47  ? 80.659  -19.555 27.702  1.00 38.60  ?  47  SER A CB    1 
ATOM   348   O  OG    . SER A 1 47  ? 80.745  -19.726 26.286  1.00 41.23  ?  47  SER A OG    1 
ATOM   349   N  N     . MET A 1 48  ? 83.579  -20.278 28.254  1.00 25.56  ?  48  MET A N     1 
ATOM   350   C  CA    . MET A 1 48  ? 84.943  -20.578 27.844  1.00 29.89  ?  48  MET A CA    1 
ATOM   351   C  C     . MET A 1 48  ? 85.319  -21.995 28.275  1.00 32.53  ?  48  MET A C     1 
ATOM   352   O  O     . MET A 1 48  ? 85.967  -22.735 27.526  1.00 32.29  ?  48  MET A O     1 
ATOM   353   C  CB    . MET A 1 48  ? 85.919  -19.556 28.405  1.00 25.38  ?  48  MET A CB    1 
ATOM   354   C  CG    . MET A 1 48  ? 85.618  -18.143 27.963  1.00 25.27  ?  48  MET A CG    1 
ATOM   355   S  SD    . MET A 1 48  ? 86.931  -16.966 28.331  1.00 44.50  ?  48  MET A SD    1 
ATOM   356   C  CE    . MET A 1 48  ? 88.378  -17.893 27.846  1.00 68.91  ?  48  MET A CE    1 
ATOM   357   N  N     . ASN A 1 49  ? 84.891  -22.389 29.471  1.00 34.49  ?  49  ASN A N     1 
ATOM   358   C  CA    . ASN A 1 49  ? 85.200  -23.719 29.946  1.00 33.49  ?  49  ASN A CA    1 
ATOM   359   C  C     . ASN A 1 49  ? 84.485  -24.801 29.139  1.00 36.27  ?  49  ASN A C     1 
ATOM   360   O  O     . ASN A 1 49  ? 85.092  -25.810 28.782  1.00 33.94  ?  49  ASN A O     1 
ATOM   361   C  CB    . ASN A 1 49  ? 84.885  -23.842 31.424  1.00 35.60  ?  49  ASN A CB    1 
ATOM   362   C  CG    . ASN A 1 49  ? 85.403  -25.147 32.030  1.00 39.06  ?  49  ASN A CG    1 
ATOM   363   O  OD1   . ASN A 1 49  ? 86.614  -25.351 32.174  1.00 34.62  ?  49  ASN A OD1   1 
ATOM   364   N  ND2   . ASN A 1 49  ? 84.477  -26.028 32.404  1.00 44.29  ?  49  ASN A ND2   1 
ATOM   365   N  N     . LYS A 1 50  ? 83.201  -24.591 28.845  1.00 42.70  ?  50  LYS A N     1 
ATOM   366   C  CA    . LYS A 1 50  ? 82.444  -25.547 28.024  1.00 40.53  ?  50  LYS A CA    1 
ATOM   367   C  C     . LYS A 1 50  ? 83.176  -25.748 26.723  1.00 43.49  ?  50  LYS A C     1 
ATOM   368   O  O     . LYS A 1 50  ? 83.235  -26.862 26.208  1.00 47.58  ?  50  LYS A O     1 
ATOM   369   C  CB    . LYS A 1 50  ? 81.009  -25.065 27.727  1.00 36.55  ?  50  LYS A CB    1 
ATOM   370   C  CG    . LYS A 1 50  ? 80.023  -26.197 27.357  1.00 38.25  ?  50  LYS A CG    1 
ATOM   371   C  CD    . LYS A 1 50  ? 78.728  -25.686 26.699  1.00 37.19  ?  50  LYS A CD    1 
ATOM   372   N  N     . ASP A 1 51  ? 83.739  -24.656 26.206  1.00 43.44  ?  51  ASP A N     1 
ATOM   373   C  CA    . ASP A 1 51  ? 84.381  -24.643 24.897  1.00 49.18  ?  51  ASP A CA    1 
ATOM   374   C  C     . ASP A 1 51  ? 85.841  -25.116 24.922  1.00 46.64  ?  51  ASP A C     1 
ATOM   375   O  O     . ASP A 1 51  ? 86.498  -25.178 23.885  1.00 54.05  ?  51  ASP A O     1 
ATOM   376   C  CB    . ASP A 1 51  ? 84.260  -23.258 24.244  1.00 58.03  ?  51  ASP A CB    1 
ATOM   377   C  CG    . ASP A 1 51  ? 82.819  -22.912 23.843  1.00 65.42  ?  51  ASP A CG    1 
ATOM   378   O  OD1   . ASP A 1 51  ? 82.017  -23.849 23.588  1.00 69.25  ?  51  ASP A OD1   1 
ATOM   379   O  OD2   . ASP A 1 51  ? 82.498  -21.698 23.779  1.00 64.06  ?  51  ASP A OD2   1 
ATOM   380   N  N     . SER A 1 52  ? 86.348  -25.457 26.098  1.00 41.53  ?  52  SER A N     1 
ATOM   381   C  CA    . SER A 1 52  ? 87.665  -26.085 26.205  1.00 43.67  ?  52  SER A CA    1 
ATOM   382   C  C     . SER A 1 52  ? 88.780  -25.086 26.010  1.00 43.85  ?  52  SER A C     1 
ATOM   383   O  O     . SER A 1 52  ? 89.915  -25.456 25.723  1.00 51.76  ?  52  SER A O     1 
ATOM   384   C  CB    . SER A 1 52  ? 87.798  -27.218 25.204  1.00 49.24  ?  52  SER A CB    1 
ATOM   385   O  OG    . SER A 1 52  ? 86.860  -28.240 25.497  1.00 52.62  ?  52  SER A OG    1 
ATOM   386   N  N     . ASN A 1 53  ? 88.428  -23.817 26.196  1.00 38.53  ?  53  ASN A N     1 
ATOM   387   C  CA    . ASN A 1 53  ? 89.323  -22.679 26.047  1.00 38.71  ?  53  ASN A CA    1 
ATOM   388   C  C     . ASN A 1 53  ? 90.083  -22.465 27.366  1.00 41.02  ?  53  ASN A C     1 
ATOM   389   O  O     . ASN A 1 53  ? 89.850  -21.504 28.108  1.00 39.40  ?  53  ASN A O     1 
ATOM   390   C  CB    . ASN A 1 53  ? 88.455  -21.465 25.687  1.00 37.16  ?  53  ASN A CB    1 
ATOM   391   C  CG    . ASN A 1 53  ? 89.246  -20.273 25.181  1.00 36.70  ?  53  ASN A CG    1 
ATOM   392   O  OD1   . ASN A 1 53  ? 90.484  -20.237 25.230  1.00 36.41  ?  53  ASN A OD1   1 
ATOM   393   N  ND2   . ASN A 1 53  ? 88.517  -19.266 24.710  1.00 36.63  ?  53  ASN A ND2   1 
ATOM   394   N  N     . THR A 1 54  ? 90.999  -23.373 27.670  1.00 44.96  ?  54  THR A N     1 
ATOM   395   C  CA    . THR A 1 54  ? 91.543  -23.412 29.025  1.00 44.43  ?  54  THR A CA    1 
ATOM   396   C  C     . THR A 1 54  ? 93.053  -23.260 29.074  1.00 49.86  ?  54  THR A C     1 
ATOM   397   O  O     . THR A 1 54  ? 93.726  -23.375 28.062  1.00 55.55  ?  54  THR A O     1 
ATOM   398   C  CB    . THR A 1 54  ? 91.066  -24.667 29.766  1.00 39.46  ?  54  THR A CB    1 
ATOM   399   O  OG1   . THR A 1 54  ? 91.480  -25.850 29.064  1.00 36.26  ?  54  THR A OG1   1 
ATOM   400   C  CG2   . THR A 1 54  ? 89.531  -24.650 29.858  1.00 38.21  ?  54  THR A CG2   1 
ATOM   401   N  N     . PHE A 1 55  ? 93.577  -22.983 30.257  1.00 47.72  ?  55  PHE A N     1 
ATOM   402   C  CA    . PHE A 1 55  ? 94.965  -22.537 30.388  1.00 45.32  ?  55  PHE A CA    1 
ATOM   403   C  C     . PHE A 1 55  ? 95.973  -23.404 29.634  1.00 44.60  ?  55  PHE A C     1 
ATOM   404   O  O     . PHE A 1 55  ? 97.062  -22.936 29.312  1.00 47.48  ?  55  PHE A O     1 
ATOM   405   C  CB    . PHE A 1 55  ? 95.370  -22.450 31.865  1.00 44.51  ?  55  PHE A CB    1 
ATOM   406   C  CG    . PHE A 1 55  ? 95.788  -23.766 32.447  1.00 45.05  ?  55  PHE A CG    1 
ATOM   407   C  CD1   . PHE A 1 55  ? 94.845  -24.701 32.821  1.00 48.06  ?  55  PHE A CD1   1 
ATOM   408   C  CD2   . PHE A 1 55  ? 97.129  -24.076 32.607  1.00 32.23  ?  55  PHE A CD2   1 
ATOM   409   C  CE1   . PHE A 1 55  ? 95.232  -25.919 33.339  1.00 51.59  ?  55  PHE A CE1   1 
ATOM   410   C  CE2   . PHE A 1 55  ? 97.522  -25.289 33.135  1.00 33.21  ?  55  PHE A CE2   1 
ATOM   411   C  CZ    . PHE A 1 55  ? 96.574  -26.210 33.495  1.00 53.52  ?  55  PHE A CZ    1 
ATOM   412   N  N     . ASP A 1 56  ? 95.611  -24.655 29.353  1.00 41.23  ?  56  ASP A N     1 
ATOM   413   C  CA    . ASP A 1 56  ? 96.560  -25.629 28.796  1.00 44.69  ?  56  ASP A CA    1 
ATOM   414   C  C     . ASP A 1 56  ? 96.482  -25.809 27.272  1.00 42.78  ?  56  ASP A C     1 
ATOM   415   O  O     . ASP A 1 56  ? 97.107  -26.716 26.699  1.00 46.46  ?  56  ASP A O     1 
ATOM   416   C  CB    . ASP A 1 56  ? 96.388  -26.989 29.483  1.00 53.58  ?  56  ASP A CB    1 
ATOM   417   C  CG    . ASP A 1 56  ? 94.952  -27.489 29.448  1.00 60.30  ?  56  ASP A CG    1 
ATOM   418   O  OD1   . ASP A 1 56  ? 94.020  -26.669 29.626  1.00 56.97  ?  56  ASP A OD1   1 
ATOM   419   O  OD2   . ASP A 1 56  ? 94.760  -28.709 29.243  1.00 68.72  ?  56  ASP A OD2   1 
ATOM   420   N  N     . LYS A 1 57  ? 95.713  -24.941 26.629  1.00 39.33  ?  57  LYS A N     1 
ATOM   421   C  CA    . LYS A 1 57  ? 95.400  -25.076 25.226  1.00 40.11  ?  57  LYS A CA    1 
ATOM   422   C  C     . LYS A 1 57  ? 95.530  -23.707 24.567  1.00 42.47  ?  57  LYS A C     1 
ATOM   423   O  O     . LYS A 1 57  ? 95.567  -22.696 25.255  1.00 44.59  ?  57  LYS A O     1 
ATOM   424   C  CB    . LYS A 1 57  ? 93.996  -25.652 25.090  1.00 37.52  ?  57  LYS A CB    1 
ATOM   425   C  CG    . LYS A 1 57  ? 93.826  -26.960 25.835  1.00 39.82  ?  57  LYS A CG    1 
ATOM   426   C  CD    . LYS A 1 57  ? 92.489  -27.608 25.562  1.00 47.88  ?  57  LYS A CD    1 
ATOM   427   C  CE    . LYS A 1 57  ? 92.347  -28.910 26.334  1.00 57.95  ?  57  LYS A CE    1 
ATOM   428   N  NZ    . LYS A 1 57  ? 90.920  -29.277 26.549  1.00 64.10  ?  57  LYS A NZ    1 
ATOM   429   N  N     . SER A 1 58  ? 95.624  -23.660 23.243  1.00 42.83  ?  58  SER A N     1 
ATOM   430   C  CA    . SER A 1 58  ? 95.914  -22.386 22.588  1.00 46.79  ?  58  SER A CA    1 
ATOM   431   C  C     . SER A 1 58  ? 94.898  -21.348 23.005  1.00 46.77  ?  58  SER A C     1 
ATOM   432   O  O     . SER A 1 58  ? 93.814  -21.696 23.482  1.00 51.95  ?  58  SER A O     1 
ATOM   433   C  CB    . SER A 1 58  ? 95.904  -22.542 21.077  1.00 58.13  ?  58  SER A CB    1 
ATOM   434   O  OG    . SER A 1 58  ? 96.572  -23.735 20.707  1.00 69.56  ?  58  SER A OG    1 
ATOM   435   N  N     . TYR A 1 59  ? 95.259  -20.077 22.857  1.00 45.89  ?  59  TYR A N     1 
ATOM   436   C  CA    . TYR A 1 59  ? 94.292  -19.001 23.031  1.00 48.99  ?  59  TYR A CA    1 
ATOM   437   C  C     . TYR A 1 59  ? 93.313  -18.997 21.844  1.00 51.25  ?  59  TYR A C     1 
ATOM   438   O  O     . TYR A 1 59  ? 93.701  -19.285 20.697  1.00 50.99  ?  59  TYR A O     1 
ATOM   439   C  CB    . TYR A 1 59  ? 94.982  -17.634 23.118  1.00 51.38  ?  59  TYR A CB    1 
ATOM   440   C  CG    . TYR A 1 59  ? 95.948  -17.437 24.266  1.00 54.75  ?  59  TYR A CG    1 
ATOM   441   C  CD1   . TYR A 1 59  ? 97.239  -17.943 24.210  1.00 58.83  ?  59  TYR A CD1   1 
ATOM   442   C  CD2   . TYR A 1 59  ? 95.584  -16.696 25.387  1.00 57.91  ?  59  TYR A CD2   1 
ATOM   443   C  CE1   . TYR A 1 59  ? 98.138  -17.744 25.257  1.00 63.11  ?  59  TYR A CE1   1 
ATOM   444   C  CE2   . TYR A 1 59  ? 96.469  -16.494 26.442  1.00 62.09  ?  59  TYR A CE2   1 
ATOM   445   C  CZ    . TYR A 1 59  ? 97.751  -17.019 26.379  1.00 63.39  ?  59  TYR A CZ    1 
ATOM   446   O  OH    . TYR A 1 59  ? 98.643  -16.826 27.432  1.00 61.61  ?  59  TYR A OH    1 
ATOM   447   N  N     . ARG A 1 60  ? 92.049  -18.682 22.133  1.00 51.58  ?  60  ARG A N     1 
ATOM   448   C  CA    . ARG A 1 60  ? 91.048  -18.404 21.108  1.00 52.21  ?  60  ARG A CA    1 
ATOM   449   C  C     . ARG A 1 60  ? 90.936  -16.901 20.892  1.00 51.94  ?  60  ARG A C     1 
ATOM   450   O  O     . ARG A 1 60  ? 91.238  -16.107 21.778  1.00 51.15  ?  60  ARG A O     1 
ATOM   451   C  CB    . ARG A 1 60  ? 89.667  -18.931 21.514  1.00 58.52  ?  60  ARG A CB    1 
ATOM   452   C  CG    . ARG A 1 60  ? 89.414  -20.413 21.285  1.00 70.60  ?  60  ARG A CG    1 
ATOM   453   C  CD    . ARG A 1 60  ? 87.914  -20.735 21.430  1.00 78.64  ?  60  ARG A CD    1 
ATOM   454   N  NE    . ARG A 1 60  ? 87.626  -22.135 21.757  1.00 86.24  ?  60  ARG A NE    1 
ATOM   455   C  CZ    . ARG A 1 60  ? 88.540  -23.092 21.935  1.00 93.30  ?  60  ARG A CZ    1 
ATOM   456   N  NH1   . ARG A 1 60  ? 89.840  -22.835 21.817  1.00 94.75  ?  60  ARG A NH1   1 
ATOM   457   N  NH2   . ARG A 1 60  ? 88.153  -24.325 22.235  1.00 96.17  ?  60  ARG A NH2   1 
ATOM   458   N  N     . LYS A 1 61  ? 90.485  -16.513 19.710  1.00 54.33  ?  61  LYS A N     1 
ATOM   459   C  CA    . LYS A 1 61  ? 90.146  -15.123 19.458  1.00 54.63  ?  61  LYS A CA    1 
ATOM   460   C  C     . LYS A 1 61  ? 89.035  -14.680 20.422  1.00 50.84  ?  61  LYS A C     1 
ATOM   461   O  O     . LYS A 1 61  ? 88.006  -15.342 20.551  1.00 30.65  ?  61  LYS A O     1 
ATOM   462   C  CB    . LYS A 1 61  ? 89.719  -14.952 17.995  1.00 66.69  ?  61  LYS A CB    1 
ATOM   463   C  CG    . LYS A 1 61  ? 89.626  -13.504 17.517  1.00 77.35  ?  61  LYS A CG    1 
ATOM   464   C  CD    . LYS A 1 61  ? 90.996  -12.839 17.414  1.00 82.75  ?  61  LYS A CD    1 
ATOM   465   C  CE    . LYS A 1 61  ? 91.891  -13.540 16.399  1.00 84.76  ?  61  LYS A CE    1 
ATOM   466   N  NZ    . LYS A 1 61  ? 93.245  -12.901 16.326  1.00 85.47  ?  61  LYS A NZ    1 
ATOM   467   N  N     . SER A 1 62  ? 89.249  -13.563 21.105  1.00 30.41  ?  62  SER A N     1 
ATOM   468   C  CA    . SER A 1 62  ? 88.246  -13.053 22.039  1.00 35.11  ?  62  SER A CA    1 
ATOM   469   C  C     . SER A 1 62  ? 86.854  -12.984 21.424  1.00 36.57  ?  62  SER A C     1 
ATOM   470   O  O     . SER A 1 62  ? 85.858  -13.273 22.088  1.00 38.72  ?  62  SER A O     1 
ATOM   471   C  CB    . SER A 1 62  ? 88.627  -11.669 22.571  1.00 35.41  ?  62  SER A CB    1 
ATOM   472   O  OG    . SER A 1 62  ? 89.738  -11.753 23.445  1.00 35.73  ?  62  SER A OG    1 
ATOM   473   N  N     . ALA A 1 63  ? 86.770  -12.595 20.158  1.00 34.69  ?  63  ALA A N     1 
ATOM   474   C  CA    . ALA A 1 63  ? 85.455  -12.458 19.564  1.00 31.19  ?  63  ALA A CA    1 
ATOM   475   C  C     . ALA A 1 63  ? 84.715  -13.805 19.469  1.00 43.58  ?  63  ALA A C     1 
ATOM   476   O  O     . ALA A 1 63  ? 83.487  -13.853 19.515  1.00 42.94  ?  63  ALA A O     1 
ATOM   477   C  CB    . ALA A 1 63  ? 85.551  -11.783 18.236  1.00 32.52  ?  63  ALA A CB    1 
ATOM   478   N  N     . LYS A 1 64  ? 85.452  -14.903 19.374  1.00 31.41  ?  64  LYS A N     1 
ATOM   479   C  CA    . LYS A 1 64  ? 84.803  -16.199 19.251  1.00 35.26  ?  64  LYS A CA    1 
ATOM   480   C  C     . LYS A 1 64  ? 84.131  -16.505 20.551  1.00 35.90  ?  64  LYS A C     1 
ATOM   481   O  O     . LYS A 1 64  ? 82.980  -16.923 20.597  1.00 40.75  ?  64  LYS A O     1 
ATOM   482   C  CB    . LYS A 1 64  ? 85.813  -17.293 18.952  1.00 32.30  ?  64  LYS A CB    1 
ATOM   483   C  CG    . LYS A 1 64  ? 85.198  -18.556 18.384  1.00 39.82  ?  64  LYS A CG    1 
ATOM   484   C  CD    . LYS A 1 64  ? 86.286  -19.483 17.905  1.00 41.53  ?  64  LYS A CD    1 
ATOM   485   C  CE    . LYS A 1 64  ? 85.901  -20.941 18.049  1.00 42.40  ?  64  LYS A CE    1 
ATOM   486   N  NZ    . LYS A 1 64  ? 87.117  -21.796 17.889  1.00 46.53  ?  64  LYS A NZ    1 
ATOM   487   N  N     . SER A 1 65  ? 84.881  -16.281 21.615  1.00 34.15  ?  65  SER A N     1 
ATOM   488   C  CA    . SER A 1 65  ? 84.408  -16.479 22.969  1.00 38.13  ?  65  SER A CA    1 
ATOM   489   C  C     . SER A 1 65  ? 83.211  -15.612 23.255  1.00 36.50  ?  65  SER A C     1 
ATOM   490   O  O     . SER A 1 65  ? 82.149  -16.116 23.627  1.00 33.21  ?  65  SER A O     1 
ATOM   491   C  CB    . SER A 1 65  ? 85.535  -16.153 23.931  1.00 44.70  ?  65  SER A CB    1 
ATOM   492   O  OG    . SER A 1 65  ? 86.590  -17.083 23.743  1.00 52.07  ?  65  SER A OG    1 
ATOM   493   N  N     . VAL A 1 66  ? 83.394  -14.305 23.084  1.00 36.09  ?  66  VAL A N     1 
ATOM   494   C  CA    . VAL A 1 66  ? 82.330  -13.339 23.322  1.00 35.36  ?  66  VAL A CA    1 
ATOM   495   C  C     . VAL A 1 66  ? 81.037  -13.730 22.608  1.00 35.11  ?  66  VAL A C     1 
ATOM   496   O  O     . VAL A 1 66  ? 79.974  -13.731 23.222  1.00 35.79  ?  66  VAL A O     1 
ATOM   497   C  CB    . VAL A 1 66  ? 82.736  -11.934 22.888  1.00 28.70  ?  66  VAL A CB    1 
ATOM   498   C  CG1   . VAL A 1 66  ? 81.532  -11.021 22.890  1.00 29.17  ?  66  VAL A CG1   1 
ATOM   499   C  CG2   . VAL A 1 66  ? 83.823  -11.405 23.784  1.00 28.01  ?  66  VAL A CG2   1 
ATOM   500   N  N     . GLY A 1 67  ? 81.132  -14.065 21.318  1.00 34.46  ?  67  GLY A N     1 
ATOM   501   C  CA    . GLY A 1 67  ? 79.973  -14.415 20.525  1.00 31.37  ?  67  GLY A CA    1 
ATOM   502   C  C     . GLY A 1 67  ? 79.269  -15.661 21.020  1.00 31.75  ?  67  GLY A C     1 
ATOM   503   O  O     . GLY A 1 67  ? 78.048  -15.768 20.939  1.00 32.01  ?  67  GLY A O     1 
ATOM   504   N  N     . ASN A 1 68  ? 80.039  -16.610 21.538  1.00 31.65  ?  68  ASN A N     1 
ATOM   505   C  CA    . ASN A 1 68  ? 79.458  -17.831 22.079  1.00 35.52  ?  68  ASN A CA    1 
ATOM   506   C  C     . ASN A 1 68  ? 78.720  -17.596 23.376  1.00 35.98  ?  68  ASN A C     1 
ATOM   507   O  O     . ASN A 1 68  ? 77.654  -18.167 23.607  1.00 37.37  ?  68  ASN A O     1 
ATOM   508   C  CB    . ASN A 1 68  ? 80.525  -18.893 22.300  1.00 41.23  ?  68  ASN A CB    1 
ATOM   509   C  CG    . ASN A 1 68  ? 80.916  -19.591 21.029  1.00 46.70  ?  68  ASN A CG    1 
ATOM   510   O  OD1   . ASN A 1 68  ? 80.164  -19.607 20.047  1.00 48.55  ?  68  ASN A OD1   1 
ATOM   511   N  ND2   . ASN A 1 68  ? 82.101  -20.185 21.036  1.00 49.21  ?  68  ASN A ND2   1 
ATOM   512   N  N     . ILE A 1 69  ? 79.311  -16.765 24.226  1.00 36.24  ?  69  ILE A N     1 
ATOM   513   C  CA    . ILE A 1 69  ? 78.700  -16.361 25.483  1.00 38.22  ?  69  ILE A CA    1 
ATOM   514   C  C     . ILE A 1 69  ? 77.373  -15.669 25.211  1.00 36.24  ?  69  ILE A C     1 
ATOM   515   O  O     . ILE A 1 69  ? 76.373  -15.897 25.883  1.00 36.73  ?  69  ILE A O     1 
ATOM   516   C  CB    . ILE A 1 69  ? 79.617  -15.378 26.210  1.00 39.11  ?  69  ILE A CB    1 
ATOM   517   C  CG1   . ILE A 1 69  ? 80.918  -16.064 26.597  1.00 26.28  ?  69  ILE A CG1   1 
ATOM   518   C  CG2   . ILE A 1 69  ? 78.935  -14.802 27.421  1.00 26.52  ?  69  ILE A CG2   1 
ATOM   519   C  CD1   . ILE A 1 69  ? 81.845  -15.154 27.309  1.00 42.11  ?  69  ILE A CD1   1 
ATOM   520   N  N     . MET A 1 70  ? 77.381  -14.826 24.193  1.00 37.23  ?  70  MET A N     1 
ATOM   521   C  CA    . MET A 1 70  ? 76.235  -14.010 23.859  1.00 39.22  ?  70  MET A CA    1 
ATOM   522   C  C     . MET A 1 70  ? 75.087  -14.839 23.281  1.00 39.64  ?  70  MET A C     1 
ATOM   523   O  O     . MET A 1 70  ? 73.920  -14.479 23.413  1.00 46.52  ?  70  MET A O     1 
ATOM   524   C  CB    . MET A 1 70  ? 76.667  -12.909 22.886  1.00 31.14  ?  70  MET A CB    1 
ATOM   525   C  CG    . MET A 1 70  ? 75.575  -11.920 22.545  1.00 38.71  ?  70  MET A CG    1 
ATOM   526   S  SD    . MET A 1 70  ? 76.172  -10.598 21.483  1.00 69.93  ?  70  MET A SD    1 
ATOM   527   C  CE    . MET A 1 70  ? 77.851  -10.463 22.078  1.00 32.46  ?  70  MET A CE    1 
ATOM   528   N  N     . GLY A 1 71  ? 75.415  -15.952 22.638  1.00 35.68  ?  71  GLY A N     1 
ATOM   529   C  CA    . GLY A 1 71  ? 74.411  -16.727 21.946  1.00 38.11  ?  71  GLY A CA    1 
ATOM   530   C  C     . GLY A 1 71  ? 73.860  -17.846 22.793  1.00 42.26  ?  71  GLY A C     1 
ATOM   531   O  O     . GLY A 1 71  ? 72.775  -18.355 22.530  1.00 51.88  ?  71  GLY A O     1 
ATOM   532   N  N     . ASN A 1 72  ? 74.600  -18.254 23.813  1.00 40.14  ?  72  ASN A N     1 
ATOM   533   C  CA    . ASN A 1 72  ? 74.144  -19.385 24.610  1.00 41.74  ?  72  ASN A CA    1 
ATOM   534   C  C     . ASN A 1 72  ? 73.642  -19.005 25.983  1.00 39.40  ?  72  ASN A C     1 
ATOM   535   O  O     . ASN A 1 72  ? 72.700  -19.614 26.490  1.00 41.57  ?  72  ASN A O     1 
ATOM   536   C  CB    . ASN A 1 72  ? 75.228  -20.448 24.718  1.00 45.69  ?  72  ASN A CB    1 
ATOM   537   C  CG    . ASN A 1 72  ? 75.761  -20.847 23.376  1.00 49.45  ?  72  ASN A CG    1 
ATOM   538   O  OD1   . ASN A 1 72  ? 75.011  -20.915 22.400  1.00 50.19  ?  72  ASN A OD1   1 
ATOM   539   N  ND2   . ASN A 1 72  ? 77.066  -21.093 23.305  1.00 51.05  ?  72  ASN A ND2   1 
ATOM   540   N  N     . PHE A 1 73  ? 74.242  -17.979 26.572  1.00 37.41  ?  73  PHE A N     1 
ATOM   541   C  CA    . PHE A 1 73  ? 74.001  -17.710 27.984  1.00 36.96  ?  73  PHE A CA    1 
ATOM   542   C  C     . PHE A 1 73  ? 73.598  -16.301 28.362  1.00 40.88  ?  73  PHE A C     1 
ATOM   543   O  O     . PHE A 1 73  ? 72.617  -16.110 29.071  1.00 46.34  ?  73  PHE A O     1 
ATOM   544   C  CB    . PHE A 1 73  ? 75.228  -18.100 28.773  1.00 35.06  ?  73  PHE A CB    1 
ATOM   545   C  CG    . PHE A 1 73  ? 75.668  -19.487 28.509  1.00 36.26  ?  73  PHE A CG    1 
ATOM   546   C  CD1   . PHE A 1 73  ? 76.907  -19.737 27.953  1.00 39.43  ?  73  PHE A CD1   1 
ATOM   547   C  CD2   . PHE A 1 73  ? 74.828  -20.546 28.789  1.00 38.59  ?  73  PHE A CD2   1 
ATOM   548   C  CE1   . PHE A 1 73  ? 77.316  -21.023 27.713  1.00 42.21  ?  73  PHE A CE1   1 
ATOM   549   C  CE2   . PHE A 1 73  ? 75.223  -21.838 28.553  1.00 38.88  ?  73  PHE A CE2   1 
ATOM   550   C  CZ    . PHE A 1 73  ? 76.472  -22.080 28.012  1.00 41.11  ?  73  PHE A CZ    1 
ATOM   551   N  N     . HIS A 1 74  ? 74.366  -15.320 27.910  1.00 38.37  ?  74  HIS A N     1 
ATOM   552   C  CA    . HIS A 1 74  ? 74.206  -13.955 28.376  1.00 39.46  ?  74  HIS A CA    1 
ATOM   553   C  C     . HIS A 1 74  ? 73.684  -13.080 27.268  1.00 48.52  ?  74  HIS A C     1 
ATOM   554   O  O     . HIS A 1 74  ? 74.436  -12.695 26.394  1.00 53.93  ?  74  HIS A O     1 
ATOM   555   C  CB    . HIS A 1 74  ? 75.562  -13.429 28.787  1.00 36.13  ?  74  HIS A CB    1 
ATOM   556   C  CG    . HIS A 1 74  ? 75.508  -12.149 29.550  1.00 36.62  ?  74  HIS A CG    1 
ATOM   557   N  ND1   . HIS A 1 74  ? 75.123  -12.090 30.870  1.00 38.09  ?  74  HIS A ND1   1 
ATOM   558   C  CD2   . HIS A 1 74  ? 75.821  -10.883 29.190  1.00 35.14  ?  74  HIS A CD2   1 
ATOM   559   C  CE1   . HIS A 1 74  ? 75.196  -10.838 31.290  1.00 36.13  ?  74  HIS A CE1   1 
ATOM   560   N  NE2   . HIS A 1 74  ? 75.615  -10.089 30.291  1.00 33.32  ?  74  HIS A NE2   1 
ATOM   561   N  N     . PRO A 1 75  ? 72.394  -12.738 27.303  1.00 50.83  ?  75  PRO A N     1 
ATOM   562   C  CA    . PRO A 1 75  ? 71.794  -12.021 26.171  1.00 51.26  ?  75  PRO A CA    1 
ATOM   563   C  C     . PRO A 1 75  ? 71.954  -10.489 26.263  1.00 50.36  ?  75  PRO A C     1 
ATOM   564   O  O     . PRO A 1 75  ? 70.993  -9.799  26.600  1.00 50.50  ?  75  PRO A O     1 
ATOM   565   C  CB    . PRO A 1 75  ? 70.325  -12.415 26.293  1.00 51.50  ?  75  PRO A CB    1 
ATOM   566   C  CG    . PRO A 1 75  ? 70.111  -12.493 27.783  1.00 50.10  ?  75  PRO A CG    1 
ATOM   567   C  CD    . PRO A 1 75  ? 71.414  -12.996 28.374  1.00 48.16  ?  75  PRO A CD    1 
ATOM   568   N  N     . HIS A 1 76  ? 73.145  -9.968  25.965  1.00 49.53  ?  76  HIS A N     1 
ATOM   569   C  CA    . HIS A 1 76  ? 73.423  -8.540  26.156  1.00 50.85  ?  76  HIS A CA    1 
ATOM   570   C  C     . HIS A 1 76  ? 74.535  -8.000  25.248  1.00 51.58  ?  76  HIS A C     1 
ATOM   571   O  O     . HIS A 1 76  ? 74.926  -8.636  24.284  1.00 51.35  ?  76  HIS A O     1 
ATOM   572   C  CB    . HIS A 1 76  ? 73.775  -8.248  27.619  1.00 49.76  ?  76  HIS A CB    1 
ATOM   573   C  CG    . HIS A 1 76  ? 72.650  -8.484  28.580  1.00 50.92  ?  76  HIS A CG    1 
ATOM   574   N  ND1   . HIS A 1 76  ? 71.672  -7.545  28.827  1.00 51.19  ?  76  HIS A ND1   1 
ATOM   575   C  CD2   . HIS A 1 76  ? 72.357  -9.546  29.368  1.00 51.30  ?  76  HIS A CD2   1 
ATOM   576   C  CE1   . HIS A 1 76  ? 70.823  -8.019  29.722  1.00 50.97  ?  76  HIS A CE1   1 
ATOM   577   N  NE2   . HIS A 1 76  ? 71.216  -9.234  30.064  1.00 50.42  ?  76  HIS A NE2   1 
ATOM   578   N  N     . GLY A 1 77  ? 75.034  -6.809  25.559  1.00 53.27  ?  77  GLY A N     1 
ATOM   579   C  CA    . GLY A 1 77  ? 76.085  -6.204  24.763  1.00 54.95  ?  77  GLY A CA    1 
ATOM   580   C  C     . GLY A 1 77  ? 77.302  -7.093  24.557  1.00 54.56  ?  77  GLY A C     1 
ATOM   581   O  O     . GLY A 1 77  ? 77.878  -7.624  25.505  1.00 54.14  ?  77  GLY A O     1 
ATOM   582   N  N     . ASP A 1 78  ? 77.718  -7.264  23.312  1.00 56.02  ?  78  ASP A N     1 
ATOM   583   C  CA    . ASP A 1 78  ? 78.973  -7.968  23.070  1.00 58.03  ?  78  ASP A CA    1 
ATOM   584   C  C     . ASP A 1 78  ? 80.119  -7.153  23.680  1.00 58.39  ?  78  ASP A C     1 
ATOM   585   O  O     . ASP A 1 78  ? 81.135  -7.699  24.066  1.00 62.48  ?  78  ASP A O     1 
ATOM   586   C  CB    . ASP A 1 78  ? 79.187  -8.223  21.574  1.00 59.90  ?  78  ASP A CB    1 
ATOM   587   C  CG    . ASP A 1 78  ? 79.369  -6.952  20.802  1.00 67.27  ?  78  ASP A CG    1 
ATOM   588   O  OD1   . ASP A 1 78  ? 80.514  -6.668  20.399  1.00 70.22  ?  78  ASP A OD1   1 
ATOM   589   O  OD2   . ASP A 1 78  ? 78.374  -6.219  20.628  1.00 70.99  ?  78  ASP A OD2   1 
ATOM   590   N  N     . SER A 1 79  ? 79.929  -5.844  23.778  1.00 57.22  ?  79  SER A N     1 
ATOM   591   C  CA    . SER A 1 79  ? 80.881  -4.953  24.435  1.00 60.64  ?  79  SER A CA    1 
ATOM   592   C  C     . SER A 1 79  ? 80.989  -5.201  25.949  1.00 62.67  ?  79  SER A C     1 
ATOM   593   O  O     . SER A 1 79  ? 82.088  -5.395  26.462  1.00 66.49  ?  79  SER A O     1 
ATOM   594   C  CB    . SER A 1 79  ? 80.469  -3.511  24.204  1.00 66.61  ?  79  SER A CB    1 
ATOM   595   O  OG    . SER A 1 79  ? 79.133  -3.339  24.648  1.00 71.90  ?  79  SER A OG    1 
ATOM   596   N  N     . SER A 1 80  ? 79.859  -5.173  26.658  1.00 60.52  ?  80  SER A N     1 
ATOM   597   C  CA    . SER A 1 80  ? 79.841  -5.452  28.099  1.00 54.04  ?  80  SER A CA    1 
ATOM   598   C  C     . SER A 1 80  ? 80.496  -6.792  28.390  1.00 48.84  ?  80  SER A C     1 
ATOM   599   O  O     . SER A 1 80  ? 81.412  -6.877  29.207  1.00 52.53  ?  80  SER A O     1 
ATOM   600   C  CB    . SER A 1 80  ? 78.418  -5.428  28.670  1.00 55.00  ?  80  SER A CB    1 
ATOM   601   O  OG    . SER A 1 80  ? 77.758  -4.221  28.323  1.00 56.96  ?  80  SER A OG    1 
ATOM   602   N  N     . ILE A 1 81  ? 80.037  -7.837  27.714  1.00 44.91  ?  81  ILE A N     1 
ATOM   603   C  CA    . ILE A 1 81  ? 80.689  -9.129  27.825  1.00 27.16  ?  81  ILE A CA    1 
ATOM   604   C  C     . ILE A 1 81  ? 82.201  -8.998  27.645  1.00 31.80  ?  81  ILE A C     1 
ATOM   605   O  O     . ILE A 1 81  ? 82.958  -9.325  28.558  1.00 31.99  ?  81  ILE A O     1 
ATOM   606   C  CB    . ILE A 1 81  ? 80.112  -10.153 26.854  1.00 40.53  ?  81  ILE A CB    1 
ATOM   607   C  CG1   . ILE A 1 81  ? 78.589  -10.173 26.966  1.00 40.70  ?  81  ILE A CG1   1 
ATOM   608   C  CG2   . ILE A 1 81  ? 80.648  -11.541 27.164  1.00 26.59  ?  81  ILE A CG2   1 
ATOM   609   C  CD1   . ILE A 1 81  ? 77.935  -11.173 26.053  1.00 43.18  ?  81  ILE A CD1   1 
ATOM   610   N  N     . TYR A 1 82  ? 82.660  -8.504  26.502  1.00 27.58  ?  82  TYR A N     1 
ATOM   611   C  CA    . TYR A 1 82  ? 84.101  -8.310  26.342  1.00 27.58  ?  82  TYR A CA    1 
ATOM   612   C  C     . TYR A 1 82  ? 84.721  -7.506  27.488  1.00 42.79  ?  82  TYR A C     1 
ATOM   613   O  O     . TYR A 1 82  ? 85.651  -7.975  28.132  1.00 46.54  ?  82  TYR A O     1 
ATOM   614   C  CB    . TYR A 1 82  ? 84.437  -7.663  25.010  1.00 28.57  ?  82  TYR A CB    1 
ATOM   615   C  CG    . TYR A 1 82  ? 85.919  -7.552  24.697  1.00 33.10  ?  82  TYR A CG    1 
ATOM   616   C  CD1   . TYR A 1 82  ? 86.713  -8.684  24.508  1.00 33.07  ?  82  TYR A CD1   1 
ATOM   617   C  CD2   . TYR A 1 82  ? 86.515  -6.313  24.553  1.00 32.54  ?  82  TYR A CD2   1 
ATOM   618   C  CE1   . TYR A 1 82  ? 88.064  -8.560  24.199  1.00 31.02  ?  82  TYR A CE1   1 
ATOM   619   C  CE2   . TYR A 1 82  ? 87.847  -6.187  24.241  1.00 31.79  ?  82  TYR A CE2   1 
ATOM   620   C  CZ    . TYR A 1 82  ? 88.615  -7.299  24.070  1.00 30.64  ?  82  TYR A CZ    1 
ATOM   621   O  OH    . TYR A 1 82  ? 89.939  -7.119  23.766  1.00 33.45  ?  82  TYR A OH    1 
ATOM   622   N  N     . ASP A 1 83  ? 84.214  -6.301  27.738  1.00 39.38  ?  83  ASP A N     1 
ATOM   623   C  CA    . ASP A 1 83  ? 84.725  -5.448  28.819  1.00 41.04  ?  83  ASP A CA    1 
ATOM   624   C  C     . ASP A 1 83  ? 84.883  -6.198  30.129  1.00 39.61  ?  83  ASP A C     1 
ATOM   625   O  O     . ASP A 1 83  ? 85.878  -6.018  30.836  1.00 43.68  ?  83  ASP A O     1 
ATOM   626   C  CB    . ASP A 1 83  ? 83.816  -4.245  29.031  1.00 50.82  ?  83  ASP A CB    1 
ATOM   627   C  CG    . ASP A 1 83  ? 84.102  -3.116  28.063  1.00 56.11  ?  83  ASP A CG    1 
ATOM   628   O  OD1   . ASP A 1 83  ? 84.820  -3.339  27.056  1.00 55.50  ?  83  ASP A OD1   1 
ATOM   629   O  OD2   . ASP A 1 83  ? 83.592  -2.004  28.311  1.00 59.24  ?  83  ASP A OD2   1 
ATOM   630   N  N     . ALA A 1 84  ? 83.894  -7.032  30.450  1.00 37.54  ?  84  ALA A N     1 
ATOM   631   C  CA    . ALA A 1 84  ? 83.945  -7.890  31.636  1.00 41.19  ?  84  ALA A CA    1 
ATOM   632   C  C     . ALA A 1 84  ? 85.060  -8.925  31.557  1.00 36.73  ?  84  ALA A C     1 
ATOM   633   O  O     . ALA A 1 84  ? 85.753  -9.192  32.536  1.00 31.87  ?  84  ALA A O     1 
ATOM   634   C  CB    . ALA A 1 84  ? 82.613  -8.585  31.834  1.00 44.82  ?  84  ALA A CB    1 
ATOM   635   N  N     . MET A 1 85  ? 85.196  -9.525  30.380  1.00 36.06  ?  85  MET A N     1 
ATOM   636   C  CA    . MET A 1 85  ? 86.223  -10.517 30.117  1.00 32.57  ?  85  MET A CA    1 
ATOM   637   C  C     . MET A 1 85  ? 87.616  -9.885  30.191  1.00 30.39  ?  85  MET A C     1 
ATOM   638   O  O     . MET A 1 85  ? 88.539  -10.471 30.752  1.00 34.45  ?  85  MET A O     1 
ATOM   639   C  CB    . MET A 1 85  ? 85.951  -11.175 28.763  1.00 32.48  ?  85  MET A CB    1 
ATOM   640   C  CG    . MET A 1 85  ? 87.066  -12.023 28.187  1.00 35.46  ?  85  MET A CG    1 
ATOM   641   S  SD    . MET A 1 85  ? 86.508  -12.852 26.684  1.00 44.00  ?  85  MET A SD    1 
ATOM   642   N  N     . VAL A 1 86  ? 87.760  -8.681  29.652  1.00 26.77  ?  86  VAL A N     1 
ATOM   643   C  CA    . VAL A 1 86  ? 89.027  -7.972  29.728  1.00 30.79  ?  86  VAL A CA    1 
ATOM   644   C  C     . VAL A 1 86  ? 89.386  -7.707  31.181  1.00 37.17  ?  86  VAL A C     1 
ATOM   645   O  O     . VAL A 1 86  ? 90.536  -7.867  31.586  1.00 43.91  ?  86  VAL A O     1 
ATOM   646   C  CB    . VAL A 1 86  ? 88.987  -6.616  28.979  1.00 34.35  ?  86  VAL A CB    1 
ATOM   647   C  CG1   . VAL A 1 86  ? 90.252  -5.794  29.263  1.00 29.18  ?  86  VAL A CG1   1 
ATOM   648   C  CG2   . VAL A 1 86  ? 88.816  -6.826  27.506  1.00 28.49  ?  86  VAL A CG2   1 
ATOM   649   N  N     . ARG A 1 87  ? 88.403  -7.294  31.971  1.00 33.73  ?  87  ARG A N     1 
ATOM   650   C  CA    . ARG A 1 87  ? 88.699  -6.944  33.343  1.00 37.56  ?  87  ARG A CA    1 
ATOM   651   C  C     . ARG A 1 87  ? 89.227  -8.147  34.109  1.00 41.14  ?  87  ARG A C     1 
ATOM   652   O  O     . ARG A 1 87  ? 90.174  -8.014  34.883  1.00 48.03  ?  87  ARG A O     1 
ATOM   653   C  CB    . ARG A 1 87  ? 87.484  -6.367  34.049  1.00 41.03  ?  87  ARG A CB    1 
ATOM   654   C  CG    . ARG A 1 87  ? 87.788  -5.885  35.466  1.00 47.84  ?  87  ARG A CG    1 
ATOM   655   C  CD    . ARG A 1 87  ? 86.535  -5.390  36.168  1.00 54.10  ?  87  ARG A CD    1 
ATOM   656   N  NE    . ARG A 1 87  ? 86.827  -4.631  37.381  1.00 56.98  ?  87  ARG A NE    1 
ATOM   657   C  CZ    . ARG A 1 87  ? 86.972  -5.174  38.582  1.00 59.57  ?  87  ARG A CZ    1 
ATOM   658   N  NH1   . ARG A 1 87  ? 86.870  -6.488  38.728  1.00 65.64  ?  87  ARG A NH1   1 
ATOM   659   N  NH2   . ARG A 1 87  ? 87.217  -4.408  39.634  1.00 56.08  ?  87  ARG A NH2   1 
ATOM   660   N  N     . MET A 1 88  ? 88.628  -9.320  33.891  1.00 37.00  ?  88  MET A N     1 
ATOM   661   C  CA    . MET A 1 88  ? 89.055  -10.515 34.616  1.00 32.65  ?  88  MET A CA    1 
ATOM   662   C  C     . MET A 1 88  ? 90.443  -10.964 34.169  1.00 35.21  ?  88  MET A C     1 
ATOM   663   O  O     . MET A 1 88  ? 90.886  -12.049 34.526  1.00 38.84  ?  88  MET A O     1 
ATOM   664   C  CB    . MET A 1 88  ? 88.068  -11.683 34.471  1.00 28.53  ?  88  MET A CB    1 
ATOM   665   C  CG    . MET A 1 88  ? 86.583  -11.323 34.352  1.00 27.88  ?  88  MET A CG    1 
ATOM   666   S  SD    . MET A 1 88  ? 85.516  -12.804 34.420  1.00 36.54  ?  88  MET A SD    1 
ATOM   667   C  CE    . MET A 1 88  ? 84.288  -12.326 33.209  1.00 95.72  ?  88  MET A CE    1 
ATOM   668   N  N     . SER A 1 89  ? 91.128  -10.129 33.395  1.00 34.10  ?  89  SER A N     1 
ATOM   669   C  CA    . SER A 1 89  ? 92.456  -10.473 32.907  1.00 33.59  ?  89  SER A CA    1 
ATOM   670   C  C     . SER A 1 89  ? 93.483  -9.425  33.305  1.00 36.58  ?  89  SER A C     1 
ATOM   671   O  O     . SER A 1 89  ? 94.679  -9.600  33.069  1.00 36.16  ?  89  SER A O     1 
ATOM   672   C  CB    . SER A 1 89  ? 92.452  -10.646 31.382  1.00 30.80  ?  89  SER A CB    1 
ATOM   673   O  OG    . SER A 1 89  ? 92.252  -9.412  30.696  1.00 29.50  ?  89  SER A OG    1 
ATOM   674   N  N     . GLN A 1 90  ? 93.020  -8.326  33.890  1.00 38.57  ?  90  GLN A N     1 
ATOM   675   C  CA    . GLN A 1 90  ? 93.939  -7.255  34.270  1.00 41.34  ?  90  GLN A CA    1 
ATOM   676   C  C     . GLN A 1 90  ? 94.483  -7.529  35.657  1.00 40.52  ?  90  GLN A C     1 
ATOM   677   O  O     . GLN A 1 90  ? 93.737  -7.567  36.619  1.00 38.66  ?  90  GLN A O     1 
ATOM   678   C  CB    . GLN A 1 90  ? 93.254  -5.890  34.247  1.00 40.80  ?  90  GLN A CB    1 
ATOM   679   C  CG    . GLN A 1 90  ? 91.913  -5.852  33.555  1.00 38.01  ?  90  GLN A CG    1 
ATOM   680   C  CD    . GLN A 1 90  ? 91.701  -4.535  32.871  1.00 40.27  ?  90  GLN A CD    1 
ATOM   681   O  OE1   . GLN A 1 90  ? 92.514  -4.144  32.037  1.00 41.14  ?  90  GLN A OE1   1 
ATOM   682   N  NE2   . GLN A 1 90  ? 90.630  -3.820  33.232  1.00 40.94  ?  90  GLN A NE2   1 
ATOM   683   N  N     . ASN A 1 91  ? 95.787  -7.719  35.765  1.00 40.79  ?  91  ASN A N     1 
ATOM   684   C  CA    . ASN A 1 91  ? 96.337  -8.207  37.017  1.00 42.73  ?  91  ASN A CA    1 
ATOM   685   C  C     . ASN A 1 91  ? 96.520  -7.107  38.063  1.00 45.89  ?  91  ASN A C     1 
ATOM   686   O  O     . ASN A 1 91  ? 97.014  -7.362  39.165  1.00 49.06  ?  91  ASN A O     1 
ATOM   687   C  CB    . ASN A 1 91  ? 97.617  -9.003  36.770  1.00 47.85  ?  91  ASN A CB    1 
ATOM   688   C  CG    . ASN A 1 91  ? 98.805  -8.127  36.474  1.00 54.44  ?  91  ASN A CG    1 
ATOM   689   O  OD1   . ASN A 1 91  ? 98.679  -6.916  36.290  1.00 57.02  ?  91  ASN A OD1   1 
ATOM   690   N  ND2   . ASN A 1 91  ? 99.977  -8.739  36.413  1.00 58.66  ?  91  ASN A ND2   1 
ATOM   691   N  N     . TRP A 1 92  ? 96.088  -5.895  37.719  1.00 44.37  ?  92  TRP A N     1 
ATOM   692   C  CA    . TRP A 1 92  ? 96.118  -4.770  38.648  1.00 45.70  ?  92  TRP A CA    1 
ATOM   693   C  C     . TRP A 1 92  ? 94.703  -4.442  39.137  1.00 44.06  ?  92  TRP A C     1 
ATOM   694   O  O     . TRP A 1 92  ? 94.492  -3.444  39.836  1.00 48.77  ?  92  TRP A O     1 
ATOM   695   C  CB    . TRP A 1 92  ? 96.751  -3.542  37.989  1.00 49.55  ?  92  TRP A CB    1 
ATOM   696   C  CG    . TRP A 1 92  ? 95.952  -3.040  36.821  1.00 52.52  ?  92  TRP A CG    1 
ATOM   697   C  CD1   . TRP A 1 92  ? 94.993  -2.070  36.837  1.00 55.63  ?  92  TRP A CD1   1 
ATOM   698   C  CD2   . TRP A 1 92  ? 96.026  -3.503  35.469  1.00 51.62  ?  92  TRP A CD2   1 
ATOM   699   N  NE1   . TRP A 1 92  ? 94.474  -1.896  35.577  1.00 52.69  ?  92  TRP A NE1   1 
ATOM   700   C  CE2   . TRP A 1 92  ? 95.095  -2.764  34.722  1.00 49.17  ?  92  TRP A CE2   1 
ATOM   701   C  CE3   . TRP A 1 92  ? 96.793  -4.468  34.819  1.00 52.18  ?  92  TRP A CE3   1 
ATOM   702   C  CZ2   . TRP A 1 92  ? 94.916  -2.958  33.366  1.00 47.82  ?  92  TRP A CZ2   1 
ATOM   703   C  CZ3   . TRP A 1 92  ? 96.613  -4.654  33.480  1.00 50.33  ?  92  TRP A CZ3   1 
ATOM   704   C  CH2   . TRP A 1 92  ? 95.683  -3.906  32.763  1.00 48.50  ?  92  TRP A CH2   1 
ATOM   705   N  N     . LYS A 1 93  ? 93.740  -5.280  38.750  1.00 38.89  ?  93  LYS A N     1 
ATOM   706   C  CA    . LYS A 1 93  ? 92.360  -5.171  39.229  1.00 38.54  ?  93  LYS A CA    1 
ATOM   707   C  C     . LYS A 1 93  ? 91.931  -6.452  39.941  1.00 40.95  ?  93  LYS A C     1 
ATOM   708   O  O     . LYS A 1 93  ? 91.092  -6.422  40.829  1.00 49.37  ?  93  LYS A O     1 
ATOM   709   C  CB    . LYS A 1 93  ? 91.376  -4.857  38.089  1.00 36.71  ?  93  LYS A CB    1 
ATOM   710   C  CG    . LYS A 1 93  ? 91.709  -3.622  37.267  1.00 39.61  ?  93  LYS A CG    1 
ATOM   711   C  CD    . LYS A 1 93  ? 90.591  -2.597  37.289  1.00 46.02  ?  93  LYS A CD    1 
ATOM   712   C  CE    . LYS A 1 93  ? 91.036  -1.306  38.002  1.00 55.62  ?  93  LYS A CE    1 
ATOM   713   N  NZ    . LYS A 1 93  ? 90.098  -0.141  37.807  1.00 60.49  ?  93  LYS A NZ    1 
ATOM   714   N  N     . ASN A 1 94  ? 92.505  -7.578  39.542  1.00 37.30  ?  94  ASN A N     1 
ATOM   715   C  CA    . ASN A 1 94  ? 92.215  -8.854  40.186  1.00 33.74  ?  94  ASN A CA    1 
ATOM   716   C  C     . ASN A 1 94  ? 93.443  -9.422  40.879  1.00 36.60  ?  94  ASN A C     1 
ATOM   717   O  O     . ASN A 1 94  ? 94.515  -9.521  40.269  1.00 38.32  ?  94  ASN A O     1 
ATOM   718   C  CB    . ASN A 1 94  ? 91.658  -9.857  39.175  1.00 36.32  ?  94  ASN A CB    1 
ATOM   719   C  CG    . ASN A 1 94  ? 90.247  -9.518  38.740  1.00 44.21  ?  94  ASN A CG    1 
ATOM   720   O  OD1   . ASN A 1 94  ? 90.043  -8.826  37.749  1.00 53.27  ?  94  ASN A OD1   1 
ATOM   721   N  ND2   . ASN A 1 94  ? 89.262  -10.000 39.486  1.00 41.72  ?  94  ASN A ND2   1 
ATOM   722   N  N     . ARG A 1 95  ? 93.289  -9.781  42.155  1.00 40.12  ?  95  ARG A N     1 
ATOM   723   C  CA    . ARG A 1 95  ? 94.409  -10.287 42.955  1.00 40.52  ?  95  ARG A CA    1 
ATOM   724   C  C     . ARG A 1 95  ? 94.918  -11.539 42.296  1.00 45.53  ?  95  ARG A C     1 
ATOM   725   O  O     . ARG A 1 95  ? 96.128  -11.727 42.109  1.00 54.27  ?  95  ARG A O     1 
ATOM   726   C  CB    . ARG A 1 95  ? 93.979  -10.611 44.384  1.00 35.71  ?  95  ARG A CB    1 
ATOM   727   C  CG    . ARG A 1 95  ? 95.114  -11.056 45.258  1.00 32.49  ?  95  ARG A CG    1 
ATOM   728   C  CD    . ARG A 1 95  ? 96.207  -10.019 45.236  1.00 34.23  ?  95  ARG A CD    1 
ATOM   729   N  NE    . ARG A 1 95  ? 97.351  -10.384 46.063  1.00 35.82  ?  95  ARG A NE    1 
ATOM   730   C  CZ    . ARG A 1 95  ? 98.241  -11.302 45.720  1.00 36.10  ?  95  ARG A CZ    1 
ATOM   731   N  NH1   . ARG A 1 95  ? 98.095  -11.947 44.583  1.00 49.23  ?  95  ARG A NH1   1 
ATOM   732   N  NH2   . ARG A 1 95  ? 99.265  -11.578 46.510  1.00 37.80  ?  95  ARG A NH2   1 
ATOM   733   N  N     . GLU A 1 96  ? 93.969  -12.389 41.923  1.00 38.74  ?  96  GLU A N     1 
ATOM   734   C  CA    . GLU A 1 96  ? 94.287  -13.581 41.166  1.00 41.15  ?  96  GLU A CA    1 
ATOM   735   C  C     . GLU A 1 96  ? 93.433  -13.683 39.881  1.00 42.33  ?  96  GLU A C     1 
ATOM   736   O  O     . GLU A 1 96  ? 92.290  -14.167 39.934  1.00 38.34  ?  96  GLU A O     1 
ATOM   737   C  CB    . GLU A 1 96  ? 94.109  -14.810 42.056  1.00 40.97  ?  96  GLU A CB    1 
ATOM   738   C  CG    . GLU A 1 96  ? 95.220  -15.841 41.904  1.00 50.28  ?  96  GLU A CG    1 
ATOM   739   C  CD    . GLU A 1 96  ? 96.365  -15.650 42.880  1.00 66.42  ?  96  GLU A CD    1 
ATOM   740   O  OE1   . GLU A 1 96  ? 96.160  -15.034 43.953  1.00 71.17  ?  96  GLU A OE1   1 
ATOM   741   O  OE2   . GLU A 1 96  ? 97.472  -16.144 42.570  1.00 72.34  ?  96  GLU A OE2   1 
ATOM   742   N  N     . ILE A 1 97  ? 93.994  -13.250 38.737  1.00 40.66  ?  97  ILE A N     1 
ATOM   743   C  CA    . ILE A 1 97  ? 93.249  -13.218 37.460  1.00 34.17  ?  97  ILE A CA    1 
ATOM   744   C  C     . ILE A 1 97  ? 92.729  -14.575 36.999  1.00 31.89  ?  97  ILE A C     1 
ATOM   745   O  O     . ILE A 1 97  ? 93.447  -15.569 37.017  1.00 32.59  ?  97  ILE A O     1 
ATOM   746   C  CB    . ILE A 1 97  ? 94.067  -12.633 36.255  1.00 27.65  ?  97  ILE A CB    1 
ATOM   747   C  CG1   . ILE A 1 97  ? 95.030  -13.673 35.698  1.00 36.54  ?  97  ILE A CG1   1 
ATOM   748   C  CG2   . ILE A 1 97  ? 94.777  -11.326 36.590  1.00 28.78  ?  97  ILE A CG2   1 
ATOM   749   C  CD1   . ILE A 1 97  ? 95.954  -13.128 34.681  1.00 29.13  ?  97  ILE A CD1   1 
ATOM   750   N  N     . LEU A 1 98  ? 91.482  -14.577 36.552  1.00 34.20  ?  98  LEU A N     1 
ATOM   751   C  CA    . LEU A 1 98  ? 90.811  -15.757 36.014  1.00 36.63  ?  98  LEU A CA    1 
ATOM   752   C  C     . LEU A 1 98  ? 90.839  -15.860 34.480  1.00 34.33  ?  98  LEU A C     1 
ATOM   753   O  O     . LEU A 1 98  ? 90.418  -16.860 33.908  1.00 33.41  ?  98  LEU A O     1 
ATOM   754   C  CB    . LEU A 1 98  ? 89.350  -15.731 36.438  1.00 36.35  ?  98  LEU A CB    1 
ATOM   755   C  CG    . LEU A 1 98  ? 89.084  -15.374 37.883  1.00 30.87  ?  98  LEU A CG    1 
ATOM   756   C  CD1   . LEU A 1 98  ? 87.616  -15.104 38.061  1.00 26.74  ?  98  LEU A CD1   1 
ATOM   757   C  CD2   . LEU A 1 98  ? 89.501  -16.555 38.688  1.00 32.38  ?  98  LEU A CD2   1 
ATOM   758   N  N     . VAL A 1 99  ? 91.294  -14.823 33.800  1.00 35.00  ?  99  VAL A N     1 
ATOM   759   C  CA    . VAL A 1 99  ? 91.385  -14.912 32.353  1.00 40.18  ?  99  VAL A CA    1 
ATOM   760   C  C     . VAL A 1 99  ? 92.749  -14.446 31.917  1.00 42.14  ?  99  VAL A C     1 
ATOM   761   O  O     . VAL A 1 99  ? 93.216  -13.402 32.362  1.00 48.00  ?  99  VAL A O     1 
ATOM   762   C  CB    . VAL A 1 99  ? 90.282  -14.088 31.635  1.00 25.17  ?  99  VAL A CB    1 
ATOM   763   C  CG1   . VAL A 1 99  ? 90.482  -14.116 30.162  1.00 25.68  ?  99  VAL A CG1   1 
ATOM   764   C  CG2   . VAL A 1 99  ? 88.932  -14.648 31.957  1.00 34.73  ?  99  VAL A CG2   1 
ATOM   765   N  N     . GLU A 1 100 ? 93.389  -15.240 31.064  1.00 37.12  ?  100 GLU A N     1 
ATOM   766   C  CA    . GLU A 1 100 ? 94.641  -14.849 30.445  1.00 40.76  ?  100 GLU A CA    1 
ATOM   767   C  C     . GLU A 1 100 ? 94.370  -14.303 29.053  1.00 40.86  ?  100 GLU A C     1 
ATOM   768   O  O     . GLU A 1 100 ? 93.702  -14.955 28.247  1.00 44.37  ?  100 GLU A O     1 
ATOM   769   C  CB    . GLU A 1 100 ? 95.591  -16.032 30.381  1.00 46.33  ?  100 GLU A CB    1 
ATOM   770   C  CG    . GLU A 1 100 ? 96.305  -16.292 31.688  1.00 55.26  ?  100 GLU A CG    1 
ATOM   771   C  CD    . GLU A 1 100 ? 96.964  -17.642 31.696  1.00 66.13  ?  100 GLU A CD    1 
ATOM   772   O  OE1   . GLU A 1 100 ? 97.169  -18.203 32.802  1.00 69.63  ?  100 GLU A OE1   1 
ATOM   773   O  OE2   . GLU A 1 100 ? 97.257  -18.140 30.583  1.00 68.70  ?  100 GLU A OE2   1 
ATOM   774   N  N     . MET A 1 101 ? 94.874  -13.099 28.784  1.00 34.33  ?  101 MET A N     1 
ATOM   775   C  CA    . MET A 1 101 ? 94.618  -12.424 27.522  1.00 36.60  ?  101 MET A CA    1 
ATOM   776   C  C     . MET A 1 101 ? 95.910  -11.992 26.820  1.00 43.57  ?  101 MET A C     1 
ATOM   777   O  O     . MET A 1 101 ? 96.743  -11.292 27.392  1.00 43.89  ?  101 MET A O     1 
ATOM   778   C  CB    . MET A 1 101 ? 93.643  -11.249 27.711  1.00 29.01  ?  101 MET A CB    1 
ATOM   779   C  CG    . MET A 1 101 ? 93.169  -10.589 26.405  1.00 31.67  ?  101 MET A CG    1 
ATOM   780   S  SD    . MET A 1 101 ? 91.882  -9.320  26.532  1.00 48.98  ?  101 MET A SD    1 
ATOM   781   C  CE    . MET A 1 101 ? 90.488  -10.254 27.144  1.00 27.69  ?  101 MET A CE    1 
ATOM   782   N  N     . HIS A 1 102 ? 96.067  -12.462 25.582  1.00 46.95  ?  102 HIS A N     1 
ATOM   783   C  CA    . HIS A 1 102 ? 97.126  -12.046 24.671  1.00 50.93  ?  102 HIS A CA    1 
ATOM   784   C  C     . HIS A 1 102 ? 96.699  -10.780 23.942  1.00 49.61  ?  102 HIS A C     1 
ATOM   785   O  O     . HIS A 1 102 ? 95.633  -10.743 23.327  1.00 50.82  ?  102 HIS A O     1 
ATOM   786   C  CB    . HIS A 1 102 ? 97.355  -13.128 23.622  1.00 62.64  ?  102 HIS A CB    1 
ATOM   787   C  CG    . HIS A 1 102 ? 98.604  -13.919 23.828  1.00 76.54  ?  102 HIS A CG    1 
ATOM   788   N  ND1   . HIS A 1 102 ? 99.386  -13.796 24.954  1.00 84.72  ?  102 HIS A ND1   1 
ATOM   789   C  CD2   . HIS A 1 102 ? 99.209  -14.845 23.046  1.00 83.55  ?  102 HIS A CD2   1 
ATOM   790   C  CE1   . HIS A 1 102 ? 100.419 -14.615 24.860  1.00 90.15  ?  102 HIS A CE1   1 
ATOM   791   N  NE2   . HIS A 1 102 ? 100.335 -15.262 23.714  1.00 89.96  ?  102 HIS A NE2   1 
ATOM   792   N  N     . GLY A 1 103 ? 97.529  -9.745  24.005  1.00 51.52  ?  103 GLY A N     1 
ATOM   793   C  CA    . GLY A 1 103 ? 97.239  -8.504  23.311  1.00 51.05  ?  103 GLY A CA    1 
ATOM   794   C  C     . GLY A 1 103 ? 97.078  -7.338  24.260  1.00 50.69  ?  103 GLY A C     1 
ATOM   795   O  O     . GLY A 1 103 ? 97.018  -7.526  25.470  1.00 52.70  ?  103 GLY A O     1 
ATOM   796   N  N     . ASN A 1 104 ? 97.023  -6.129  23.715  1.00 50.65  ?  104 ASN A N     1 
ATOM   797   C  CA    . ASN A 1 104 ? 96.771  -4.960  24.538  1.00 50.65  ?  104 ASN A CA    1 
ATOM   798   C  C     . ASN A 1 104 ? 95.453  -5.080  25.306  1.00 48.96  ?  104 ASN A C     1 
ATOM   799   O  O     . ASN A 1 104 ? 94.377  -4.944  24.744  1.00 47.24  ?  104 ASN A O     1 
ATOM   800   C  CB    . ASN A 1 104 ? 96.772  -3.694  23.684  1.00 54.52  ?  104 ASN A CB    1 
ATOM   801   C  CG    . ASN A 1 104 ? 96.447  -2.458  24.487  1.00 58.82  ?  104 ASN A CG    1 
ATOM   802   O  OD1   . ASN A 1 104 ? 96.449  -2.485  25.718  1.00 60.14  ?  104 ASN A OD1   1 
ATOM   803   N  ND2   . ASN A 1 104 ? 96.173  -1.363  23.796  1.00 61.97  ?  104 ASN A ND2   1 
ATOM   804   N  N     . ASN A 1 105 ? 95.526  -5.332  26.604  1.00 52.82  ?  105 ASN A N     1 
ATOM   805   C  CA    . ASN A 1 105 ? 94.293  -5.430  27.373  1.00 50.48  ?  105 ASN A CA    1 
ATOM   806   C  C     . ASN A 1 105 ? 94.178  -4.327  28.390  1.00 47.85  ?  105 ASN A C     1 
ATOM   807   O  O     . ASN A 1 105 ? 93.353  -4.407  29.296  1.00 44.18  ?  105 ASN A O     1 
ATOM   808   C  CB    . ASN A 1 105 ? 94.191  -6.767  28.080  1.00 47.77  ?  105 ASN A CB    1 
ATOM   809   C  CG    . ASN A 1 105 ? 95.256  -6.945  29.130  1.00 42.75  ?  105 ASN A CG    1 
ATOM   810   O  OD1   . ASN A 1 105 ? 96.377  -6.420  29.012  1.00 42.15  ?  105 ASN A OD1   1 
ATOM   811   N  ND2   . ASN A 1 105 ? 94.916  -7.690  30.173  1.00 37.40  ?  105 ASN A ND2   1 
ATOM   812   N  N     . GLY A 1 106 ? 95.017  -3.308  28.239  1.00 49.29  ?  106 GLY A N     1 
ATOM   813   C  CA    . GLY A 1 106 ? 94.991  -2.162  29.119  1.00 52.81  ?  106 GLY A CA    1 
ATOM   814   C  C     . GLY A 1 106 ? 96.274  -1.966  29.900  1.00 55.59  ?  106 GLY A C     1 
ATOM   815   O  O     . GLY A 1 106 ? 97.279  -2.646  29.681  1.00 58.81  ?  106 GLY A O     1 
ATOM   816   N  N     . SER A 1 107 ? 96.225  -1.012  30.818  1.00 53.33  ?  107 SER A N     1 
ATOM   817   C  CA    . SER A 1 107 ? 97.334  -0.730  31.702  1.00 55.59  ?  107 SER A CA    1 
ATOM   818   C  C     . SER A 1 107 ? 96.772  0.006   32.912  1.00 60.74  ?  107 SER A C     1 
ATOM   819   O  O     . SER A 1 107 ? 95.581  0.325   32.947  1.00 65.93  ?  107 SER A O     1 
ATOM   820   C  CB    . SER A 1 107 ? 98.330  0.166   30.991  1.00 56.62  ?  107 SER A CB    1 
ATOM   821   O  OG    . SER A 1 107 ? 97.724  1.410   30.688  1.00 58.29  ?  107 SER A OG    1 
ATOM   822   N  N     . MET A 1 108 ? 97.624  0.281   33.898  1.00 56.01  ?  108 MET A N     1 
ATOM   823   C  CA    . MET A 1 108 ? 97.221  1.104   35.027  1.00 50.44  ?  108 MET A CA    1 
ATOM   824   C  C     . MET A 1 108 ? 97.037  2.549   34.613  1.00 52.40  ?  108 MET A C     1 
ATOM   825   O  O     . MET A 1 108 ? 96.464  3.333   35.364  1.00 55.10  ?  108 MET A O     1 
ATOM   826   C  CB    . MET A 1 108 ? 98.264  1.054   36.123  1.00 47.93  ?  108 MET A CB    1 
ATOM   827   C  CG    . MET A 1 108 ? 98.471  -0.308  36.715  1.00 43.76  ?  108 MET A CG    1 
ATOM   828   S  SD    . MET A 1 108 ? 99.647  -0.151  38.057  1.00 68.10  ?  108 MET A SD    1 
ATOM   829   C  CE    . MET A 1 108 ? 98.614  0.547   39.356  1.00 64.65  ?  108 MET A CE    1 
ATOM   830   N  N     . ASP A 1 109 ? 97.563  2.900   33.437  1.00 51.51  ?  109 ASP A N     1 
ATOM   831   C  CA    . ASP A 1 109 ? 97.390  4.230   32.848  1.00 53.35  ?  109 ASP A CA    1 
ATOM   832   C  C     . ASP A 1 109 ? 95.966  4.356   32.310  1.00 49.92  ?  109 ASP A C     1 
ATOM   833   O  O     . ASP A 1 109 ? 95.512  5.446   31.935  1.00 50.53  ?  109 ASP A O     1 
ATOM   834   C  CB    . ASP A 1 109 ? 98.409  4.478   31.730  1.00 60.80  ?  109 ASP A CB    1 
ATOM   835   C  CG    . ASP A 1 109 ? 99.747  4.974   32.250  1.00 72.37  ?  109 ASP A CG    1 
ATOM   836   O  OD1   . ASP A 1 109 ? 100.025 4.791   33.454  1.00 76.86  ?  109 ASP A OD1   1 
ATOM   837   O  OD2   . ASP A 1 109 ? 100.525 5.550   31.452  1.00 77.99  ?  109 ASP A OD2   1 
ATOM   838   N  N     . GLY A 1 110 ? 95.268  3.225   32.275  1.00 48.50  ?  110 GLY A N     1 
ATOM   839   C  CA    . GLY A 1 110 ? 93.840  3.223   32.034  1.00 53.79  ?  110 GLY A CA    1 
ATOM   840   C  C     . GLY A 1 110 ? 93.479  3.499   30.599  1.00 61.25  ?  110 GLY A C     1 
ATOM   841   O  O     . GLY A 1 110 ? 92.377  3.964   30.309  1.00 64.90  ?  110 GLY A O     1 
ATOM   842   N  N     . ASP A 1 111 ? 94.414  3.222   29.697  1.00 65.18  ?  111 ASP A N     1 
ATOM   843   C  CA    . ASP A 1 111 ? 94.138  3.357   28.279  1.00 67.00  ?  111 ASP A CA    1 
ATOM   844   C  C     . ASP A 1 111 ? 93.317  2.154   27.832  1.00 64.68  ?  111 ASP A C     1 
ATOM   845   O  O     . ASP A 1 111 ? 93.361  1.096   28.471  1.00 66.04  ?  111 ASP A O     1 
ATOM   846   C  CB    . ASP A 1 111 ? 95.432  3.510   27.472  1.00 71.86  ?  111 ASP A CB    1 
ATOM   847   C  CG    . ASP A 1 111 ? 96.651  2.956   28.197  1.00 73.63  ?  111 ASP A CG    1 
ATOM   848   O  OD1   . ASP A 1 111 ? 97.754  3.541   28.048  1.00 74.73  ?  111 ASP A OD1   1 
ATOM   849   O  OD2   . ASP A 1 111 ? 96.506  1.938   28.907  1.00 72.03  ?  111 ASP A OD2   1 
ATOM   850   N  N     . PRO A 1 112 ? 92.546  2.322   26.746  1.00 62.22  ?  112 PRO A N     1 
ATOM   851   C  CA    . PRO A 1 112 ? 91.644  1.279   26.244  1.00 59.78  ?  112 PRO A CA    1 
ATOM   852   C  C     . PRO A 1 112 ? 92.400  0.000   25.925  1.00 57.03  ?  112 PRO A C     1 
ATOM   853   O  O     . PRO A 1 112 ? 93.546  0.059   25.475  1.00 64.48  ?  112 PRO A O     1 
ATOM   854   C  CB    . PRO A 1 112 ? 91.105  1.872   24.934  1.00 62.79  ?  112 PRO A CB    1 
ATOM   855   C  CG    . PRO A 1 112 ? 91.376  3.334   25.013  1.00 65.67  ?  112 PRO A CG    1 
ATOM   856   C  CD    . PRO A 1 112 ? 92.599  3.494   25.856  1.00 65.35  ?  112 PRO A CD    1 
ATOM   857   N  N     . PRO A 1 113 ? 91.774  -1.153  26.168  1.00 45.55  ?  113 PRO A N     1 
ATOM   858   C  CA    . PRO A 1 113 ? 92.318  -2.391  25.607  1.00 43.60  ?  113 PRO A CA    1 
ATOM   859   C  C     . PRO A 1 113 ? 92.081  -2.461  24.090  1.00 43.31  ?  113 PRO A C     1 
ATOM   860   O  O     . PRO A 1 113 ? 91.166  -1.803  23.564  1.00 43.75  ?  113 PRO A O     1 
ATOM   861   C  CB    . PRO A 1 113 ? 91.509  -3.480  26.316  1.00 40.17  ?  113 PRO A CB    1 
ATOM   862   C  CG    . PRO A 1 113 ? 90.254  -2.816  26.768  1.00 37.86  ?  113 PRO A CG    1 
ATOM   863   C  CD    . PRO A 1 113 ? 90.617  -1.388  27.049  1.00 40.05  ?  113 PRO A CD    1 
ATOM   864   N  N     . ALA A 1 114 ? 92.909  -3.238  23.395  1.00 44.15  ?  114 ALA A N     1 
ATOM   865   C  CA    . ALA A 1 114 ? 92.650  -3.567  21.993  1.00 48.72  ?  114 ALA A CA    1 
ATOM   866   C  C     . ALA A 1 114 ? 91.207  -4.035  21.863  1.00 46.89  ?  114 ALA A C     1 
ATOM   867   O  O     . ALA A 1 114 ? 90.651  -4.646  22.786  1.00 42.88  ?  114 ALA A O     1 
ATOM   868   C  CB    . ALA A 1 114 ? 93.624  -4.658  21.479  1.00 46.66  ?  114 ALA A CB    1 
ATOM   869   N  N     . ALA A 1 115 ? 90.592  -3.745  20.721  1.00 47.36  ?  115 ALA A N     1 
ATOM   870   C  CA    . ALA A 1 115 ? 89.213  -4.148  20.515  1.00 44.69  ?  115 ALA A CA    1 
ATOM   871   C  C     . ALA A 1 115 ? 89.105  -5.660  20.304  1.00 46.23  ?  115 ALA A C     1 
ATOM   872   O  O     . ALA A 1 115 ? 90.032  -6.314  19.823  1.00 50.39  ?  115 ALA A O     1 
ATOM   873   C  CB    . ALA A 1 115 ? 88.603  -3.380  19.384  1.00 35.11  ?  115 ALA A CB    1 
ATOM   874   N  N     . MET A 1 116 ? 87.968  -6.206  20.707  1.00 45.77  ?  116 MET A N     1 
ATOM   875   C  CA    . MET A 1 116 ? 87.689  -7.637  20.636  1.00 46.12  ?  116 MET A CA    1 
ATOM   876   C  C     . MET A 1 116 ? 88.284  -8.393  19.420  1.00 51.44  ?  116 MET A C     1 
ATOM   877   O  O     . MET A 1 116 ? 88.646  -9.577  19.509  1.00 50.67  ?  116 MET A O     1 
ATOM   878   C  CB    . MET A 1 116 ? 86.171  -7.797  20.706  1.00 44.86  ?  116 MET A CB    1 
ATOM   879   C  CG    . MET A 1 116 ? 85.624  -9.164  20.442  1.00 42.72  ?  116 MET A CG    1 
ATOM   880   S  SD    . MET A 1 116 ? 83.839  -9.042  20.405  1.00 38.39  ?  116 MET A SD    1 
ATOM   881   C  CE    . MET A 1 116 ? 83.570  -8.047  18.938  1.00 113.37 ?  116 MET A CE    1 
ATOM   882   N  N     . ARG A 1 117 ? 88.388  -7.713  18.286  1.00 51.51  ?  117 ARG A N     1 
ATOM   883   C  CA    A ARG A 1 117 ? 88.882  -8.334  17.061  0.47 52.96  ?  117 ARG A CA    1 
ATOM   884   C  CA    B ARG A 1 117 ? 88.878  -8.349  17.066  0.53 52.98  ?  117 ARG A CA    1 
ATOM   885   C  C     . ARG A 1 117 ? 90.376  -8.678  17.122  1.00 54.26  ?  117 ARG A C     1 
ATOM   886   O  O     . ARG A 1 117 ? 90.855  -9.500  16.354  1.00 55.05  ?  117 ARG A O     1 
ATOM   887   C  CB    A ARG A 1 117 ? 88.615  -7.409  15.877  0.47 53.70  ?  117 ARG A CB    1 
ATOM   888   C  CB    B ARG A 1 117 ? 88.525  -7.492  15.839  0.53 53.52  ?  117 ARG A CB    1 
ATOM   889   C  CG    A ARG A 1 117 ? 89.629  -6.281  15.729  0.47 53.57  ?  117 ARG A CG    1 
ATOM   890   C  CG    B ARG A 1 117 ? 89.673  -6.698  15.188  0.53 53.67  ?  117 ARG A CG    1 
ATOM   891   C  CD    A ARG A 1 117 ? 89.055  -5.110  14.953  0.47 51.34  ?  117 ARG A CD    1 
ATOM   892   C  CD    B ARG A 1 117 ? 89.120  -5.583  14.277  0.53 51.00  ?  117 ARG A CD    1 
ATOM   893   N  NE    A ARG A 1 117 ? 88.089  -4.357  15.746  0.47 48.89  ?  117 ARG A NE    1 
ATOM   894   N  NE    B ARG A 1 117 ? 89.791  -5.441  12.982  0.53 47.84  ?  117 ARG A NE    1 
ATOM   895   C  CZ    A ARG A 1 117 ? 87.382  -3.339  15.278  0.47 38.53  ?  117 ARG A CZ    1 
ATOM   896   C  CZ    B ARG A 1 117 ? 90.697  -6.283  12.496  0.53 40.83  ?  117 ARG A CZ    1 
ATOM   897   N  NH1   A ARG A 1 117 ? 87.527  -2.957  14.017  0.47 40.07  ?  117 ARG A NH1   1 
ATOM   898   N  NH1   B ARG A 1 117 ? 91.059  -7.356  13.192  0.53 39.80  ?  117 ARG A NH1   1 
ATOM   899   N  NH2   A ARG A 1 117 ? 86.529  -2.709  16.069  0.47 38.12  ?  117 ARG A NH2   1 
ATOM   900   N  NH2   B ARG A 1 117 ? 91.244  -6.053  11.307  0.53 42.53  ?  117 ARG A NH2   1 
ATOM   901   N  N     . TYR A 1 118 ? 91.108  -8.047  18.046  1.00 51.82  ?  118 TYR A N     1 
ATOM   902   C  CA    . TYR A 1 118 ? 92.567  -8.204  18.132  1.00 47.62  ?  118 TYR A CA    1 
ATOM   903   C  C     . TYR A 1 118 ? 93.051  -9.203  19.181  1.00 52.45  ?  118 TYR A C     1 
ATOM   904   O  O     . TYR A 1 118 ? 94.056  -9.890  18.998  1.00 57.55  ?  118 TYR A O     1 
ATOM   905   C  CB    . TYR A 1 118 ? 93.232  -6.857  18.414  1.00 41.69  ?  118 TYR A CB    1 
ATOM   906   C  CG    . TYR A 1 118 ? 93.023  -5.819  17.336  1.00 42.50  ?  118 TYR A CG    1 
ATOM   907   C  CD1   . TYR A 1 118 ? 93.638  -5.943  16.092  1.00 44.16  ?  118 TYR A CD1   1 
ATOM   908   C  CD2   . TYR A 1 118 ? 92.220  -4.711  17.559  1.00 44.17  ?  118 TYR A CD2   1 
ATOM   909   C  CE1   . TYR A 1 118 ? 93.450  -5.004  15.105  1.00 43.87  ?  118 TYR A CE1   1 
ATOM   910   C  CE2   . TYR A 1 118 ? 92.028  -3.769  16.578  1.00 38.35  ?  118 TYR A CE2   1 
ATOM   911   C  CZ    . TYR A 1 118 ? 92.644  -3.921  15.349  1.00 45.05  ?  118 TYR A CZ    1 
ATOM   912   O  OH    . TYR A 1 118 ? 92.450  -2.985  14.360  1.00 50.67  ?  118 TYR A OH    1 
ATOM   913   N  N     . THR A 1 119 ? 92.342  -9.277  20.294  1.00 50.29  ?  119 THR A N     1 
ATOM   914   C  CA    . THR A 1 119 ? 92.864  -9.990  21.442  1.00 46.40  ?  119 THR A CA    1 
ATOM   915   C  C     . THR A 1 119 ? 92.568  -11.491 21.412  1.00 45.16  ?  119 THR A C     1 
ATOM   916   O  O     . THR A 1 119 ? 91.750  -11.959 20.619  1.00 49.10  ?  119 THR A O     1 
ATOM   917   C  CB    . THR A 1 119 ? 92.379  -9.324  22.736  1.00 42.34  ?  119 THR A CB    1 
ATOM   918   O  OG1   . THR A 1 119 ? 90.964  -9.496  22.876  1.00 30.43  ?  119 THR A OG1   1 
ATOM   919   C  CG2   . THR A 1 119 ? 92.683  -7.838  22.671  1.00 45.13  ?  119 THR A CG2   1 
ATOM   920   N  N     . GLU A 1 120 ? 93.264  -12.237 22.267  1.00 42.25  ?  120 GLU A N     1 
ATOM   921   C  CA    . GLU A 1 120 ? 93.048  -13.669 22.427  1.00 43.96  ?  120 GLU A CA    1 
ATOM   922   C  C     . GLU A 1 120 ? 92.976  -14.007 23.909  1.00 41.33  ?  120 GLU A C     1 
ATOM   923   O  O     . GLU A 1 120 ? 93.675  -13.422 24.714  1.00 47.17  ?  120 GLU A O     1 
ATOM   924   C  CB    . GLU A 1 120 ? 94.190  -14.454 21.805  1.00 55.80  ?  120 GLU A CB    1 
ATOM   925   C  CG    . GLU A 1 120 ? 94.390  -14.184 20.339  1.00 67.49  ?  120 GLU A CG    1 
ATOM   926   C  CD    . GLU A 1 120 ? 95.135  -15.304 19.651  1.00 75.62  ?  120 GLU A CD    1 
ATOM   927   O  OE1   . GLU A 1 120 ? 95.989  -15.945 20.309  1.00 73.09  ?  120 GLU A OE1   1 
ATOM   928   O  OE2   . GLU A 1 120 ? 94.852  -15.544 18.456  1.00 82.38  ?  120 GLU A OE2   1 
ATOM   929   N  N     . ALA A 1 121 ? 92.146  -14.971 24.269  1.00 35.82  ?  121 ALA A N     1 
ATOM   930   C  CA    . ALA A 1 121 ? 91.968  -15.292 25.668  1.00 33.58  ?  121 ALA A CA    1 
ATOM   931   C  C     . ALA A 1 121 ? 91.911  -16.787 25.888  1.00 41.23  ?  121 ALA A C     1 
ATOM   932   O  O     . ALA A 1 121 ? 91.826  -17.576 24.945  1.00 29.10  ?  121 ALA A O     1 
ATOM   933   C  CB    . ALA A 1 121 ? 90.711  -14.639 26.201  1.00 27.47  ?  121 ALA A CB    1 
ATOM   934   N  N     . ARG A 1 122 ? 91.997  -17.158 27.154  1.00 27.81  ?  122 ARG A N     1 
ATOM   935   C  CA    . ARG A 1 122 ? 91.747  -18.514 27.596  1.00 31.33  ?  122 ARG A CA    1 
ATOM   936   C  C     . ARG A 1 122 ? 91.636  -18.373 29.091  1.00 32.64  ?  122 ARG A C     1 
ATOM   937   O  O     . ARG A 1 122 ? 92.047  -17.344 29.638  1.00 33.79  ?  122 ARG A O     1 
ATOM   938   C  CB    . ARG A 1 122 ? 92.895  -19.445 27.232  1.00 31.40  ?  122 ARG A CB    1 
ATOM   939   C  CG    . ARG A 1 122 ? 94.245  -19.024 27.755  1.00 32.01  ?  122 ARG A CG    1 
ATOM   940   C  CD    . ARG A 1 122 ? 95.265  -20.129 27.584  1.00 33.74  ?  122 ARG A CD    1 
ATOM   941   N  NE    . ARG A 1 122 ? 96.580  -19.690 28.027  1.00 40.36  ?  122 ARG A NE    1 
ATOM   942   C  CZ    . ARG A 1 122 ? 97.725  -20.149 27.537  1.00 49.23  ?  122 ARG A CZ    1 
ATOM   943   N  NH1   . ARG A 1 122 ? 97.716  -21.065 26.581  1.00 51.77  ?  122 ARG A NH1   1 
ATOM   944   N  NH2   . ARG A 1 122 ? 98.879  -19.681 27.996  1.00 54.17  ?  122 ARG A NH2   1 
ATOM   945   N  N     . LEU A 1 123 ? 91.056  -19.371 29.749  1.00 26.45  ?  123 LEU A N     1 
ATOM   946   C  CA    . LEU A 1 123 ? 90.963  -19.342 31.203  1.00 34.46  ?  123 LEU A CA    1 
ATOM   947   C  C     . LEU A 1 123 ? 92.358  -19.502 31.791  1.00 38.26  ?  123 LEU A C     1 
ATOM   948   O  O     . LEU A 1 123 ? 93.239  -20.091 31.168  1.00 45.29  ?  123 LEU A O     1 
ATOM   949   C  CB    . LEU A 1 123 ? 90.025  -20.435 31.729  1.00 30.51  ?  123 LEU A CB    1 
ATOM   950   C  CG    . LEU A 1 123 ? 88.593  -20.359 31.196  1.00 31.68  ?  123 LEU A CG    1 
ATOM   951   C  CD1   . LEU A 1 123 ? 87.729  -21.452 31.779  1.00 32.10  ?  123 LEU A CD1   1 
ATOM   952   C  CD2   . LEU A 1 123 ? 87.984  -18.992 31.461  1.00 31.65  ?  123 LEU A CD2   1 
ATOM   953   N  N     . SER A 1 124 ? 92.563  -18.953 32.983  1.00 34.80  ?  124 SER A N     1 
ATOM   954   C  CA    . SER A 1 124 ? 93.809  -19.142 33.697  1.00 35.63  ?  124 SER A CA    1 
ATOM   955   C  C     . SER A 1 124 ? 93.720  -20.474 34.414  1.00 36.32  ?  124 SER A C     1 
ATOM   956   O  O     . SER A 1 124 ? 92.631  -21.030 34.559  1.00 33.48  ?  124 SER A O     1 
ATOM   957   C  CB    . SER A 1 124 ? 93.952  -18.060 34.730  1.00 40.89  ?  124 SER A CB    1 
ATOM   958   O  OG    . SER A 1 124 ? 92.883  -18.176 35.640  1.00 43.18  ?  124 SER A OG    1 
ATOM   959   N  N     . GLU A 1 125 ? 94.853  -20.985 34.880  1.00 40.05  ?  125 GLU A N     1 
ATOM   960   C  CA    . GLU A 1 125 ? 94.820  -22.245 35.604  1.00 39.51  ?  125 GLU A CA    1 
ATOM   961   C  C     . GLU A 1 125 ? 93.958  -22.152 36.866  1.00 36.11  ?  125 GLU A C     1 
ATOM   962   O  O     . GLU A 1 125 ? 93.194  -23.071 37.177  1.00 36.86  ?  125 GLU A O     1 
ATOM   963   C  CB    . GLU A 1 125 ? 96.218  -22.705 35.962  1.00 38.06  ?  125 GLU A CB    1 
ATOM   964   C  CG    . GLU A 1 125 ? 96.259  -24.074 36.581  1.00 38.86  ?  125 GLU A CG    1 
ATOM   965   C  CD    . GLU A 1 125 ? 97.680  -24.566 36.700  1.00 48.16  ?  125 GLU A CD    1 
ATOM   966   O  OE1   . GLU A 1 125 ? 98.593  -23.706 36.620  1.00 49.80  ?  125 GLU A OE1   1 
ATOM   967   O  OE2   . GLU A 1 125 ? 97.881  -25.798 36.851  1.00 54.21  ?  125 GLU A OE2   1 
ATOM   968   N  N     . ILE A 1 126 ? 94.074  -21.039 37.585  1.00 33.16  ?  126 ILE A N     1 
ATOM   969   C  CA    . ILE A 1 126 ? 93.322  -20.877 38.815  1.00 32.30  ?  126 ILE A CA    1 
ATOM   970   C  C     . ILE A 1 126 ? 91.817  -20.888 38.554  1.00 31.27  ?  126 ILE A C     1 
ATOM   971   O  O     . ILE A 1 126 ? 91.050  -21.469 39.333  1.00 30.28  ?  126 ILE A O     1 
ATOM   972   C  CB    . ILE A 1 126 ? 93.729  -19.601 39.550  1.00 32.54  ?  126 ILE A CB    1 
ATOM   973   C  CG1   . ILE A 1 126 ? 93.279  -19.652 41.008  1.00 26.84  ?  126 ILE A CG1   1 
ATOM   974   C  CG2   . ILE A 1 126 ? 93.158  -18.393 38.854  1.00 32.84  ?  126 ILE A CG2   1 
ATOM   975   C  CD1   . ILE A 1 126 ? 94.256  -19.027 41.943  1.00 33.23  ?  126 ILE A CD1   1 
ATOM   976   N  N     . ALA A 1 127 ? 91.403  -20.253 37.457  1.00 31.40  ?  127 ALA A N     1 
ATOM   977   C  CA    . ALA A 1 127 ? 89.993  -20.233 37.049  1.00 31.82  ?  127 ALA A CA    1 
ATOM   978   C  C     . ALA A 1 127 ? 89.446  -21.641 36.945  1.00 28.53  ?  127 ALA A C     1 
ATOM   979   O  O     . ALA A 1 127 ? 88.278  -21.894 37.225  1.00 27.70  ?  127 ALA A O     1 
ATOM   980   C  CB    . ALA A 1 127 ? 89.832  -19.535 35.720  1.00 34.70  ?  127 ALA A CB    1 
ATOM   981   N  N     . GLY A 1 128 ? 90.302  -22.560 36.532  1.00 28.79  ?  128 GLY A N     1 
ATOM   982   C  CA    . GLY A 1 128 ? 89.891  -23.933 36.378  1.00 37.82  ?  128 GLY A CA    1 
ATOM   983   C  C     . GLY A 1 128 ? 89.431  -24.458 37.707  1.00 40.11  ?  128 GLY A C     1 
ATOM   984   O  O     . GLY A 1 128 ? 88.511  -25.270 37.798  1.00 44.83  ?  128 GLY A O     1 
ATOM   985   N  N     . TYR A 1 129 ? 90.076  -23.968 38.750  1.00 35.99  ?  129 TYR A N     1 
ATOM   986   C  CA    . TYR A 1 129 ? 89.735  -24.377 40.089  1.00 35.69  ?  129 TYR A CA    1 
ATOM   987   C  C     . TYR A 1 129 ? 88.363  -23.880 40.547  1.00 39.80  ?  129 TYR A C     1 
ATOM   988   O  O     . TYR A 1 129 ? 87.677  -24.577 41.273  1.00 43.12  ?  129 TYR A O     1 
ATOM   989   C  CB    . TYR A 1 129 ? 90.859  -24.016 41.046  1.00 37.61  ?  129 TYR A CB    1 
ATOM   990   C  CG    . TYR A 1 129 ? 91.912  -25.098 41.077  1.00 27.20  ?  129 TYR A CG    1 
ATOM   991   C  CD1   . TYR A 1 129 ? 91.886  -26.091 42.045  1.00 27.78  ?  129 TYR A CD1   1 
ATOM   992   C  CD2   . TYR A 1 129 ? 92.915  -25.143 40.126  1.00 44.83  ?  129 TYR A CD2   1 
ATOM   993   C  CE1   . TYR A 1 129 ? 92.843  -27.081 42.064  1.00 34.99  ?  129 TYR A CE1   1 
ATOM   994   C  CE2   . TYR A 1 129 ? 93.876  -26.142 40.126  1.00 29.23  ?  129 TYR A CE2   1 
ATOM   995   C  CZ    . TYR A 1 129 ? 93.839  -27.104 41.097  1.00 31.69  ?  129 TYR A CZ    1 
ATOM   996   O  OH    . TYR A 1 129 ? 94.803  -28.087 41.119  1.00 33.14  ?  129 TYR A OH    1 
ATOM   997   N  N     . LEU A 1 130 ? 87.958  -22.699 40.097  1.00 41.51  ?  130 LEU A N     1 
ATOM   998   C  CA    . LEU A 1 130 ? 86.567  -22.260 40.237  1.00 40.07  ?  130 LEU A CA    1 
ATOM   999   C  C     . LEU A 1 130 ? 85.555  -23.188 39.547  1.00 43.76  ?  130 LEU A C     1 
ATOM   1000  O  O     . LEU A 1 130 ? 84.402  -23.281 39.964  1.00 48.36  ?  130 LEU A O     1 
ATOM   1001  C  CB    . LEU A 1 130 ? 86.391  -20.847 39.678  1.00 35.78  ?  130 LEU A CB    1 
ATOM   1002  C  CG    . LEU A 1 130 ? 86.555  -19.744 40.713  1.00 38.40  ?  130 LEU A CG    1 
ATOM   1003  C  CD1   . LEU A 1 130 ? 86.112  -18.428 40.165  1.00 36.10  ?  130 LEU A CD1   1 
ATOM   1004  C  CD2   . LEU A 1 130 ? 85.744  -20.101 41.928  1.00 44.57  ?  130 LEU A CD2   1 
ATOM   1005  N  N     . LEU A 1 131 ? 85.978  -23.861 38.483  1.00 39.86  ?  131 LEU A N     1 
ATOM   1006  C  CA    . LEU A 1 131 ? 85.060  -24.685 37.706  1.00 39.50  ?  131 LEU A CA    1 
ATOM   1007  C  C     . LEU A 1 131 ? 85.131  -26.155 38.072  1.00 43.31  ?  131 LEU A C     1 
ATOM   1008  O  O     . LEU A 1 131 ? 84.293  -26.951 37.644  1.00 48.66  ?  131 LEU A O     1 
ATOM   1009  C  CB    . LEU A 1 131 ? 85.322  -24.518 36.210  1.00 40.51  ?  131 LEU A CB    1 
ATOM   1010  C  CG    . LEU A 1 131 ? 84.951  -23.173 35.608  1.00 23.65  ?  131 LEU A CG    1 
ATOM   1011  C  CD1   . LEU A 1 131 ? 85.971  -22.816 34.571  1.00 23.94  ?  131 LEU A CD1   1 
ATOM   1012  C  CD2   . LEU A 1 131 ? 83.543  -23.236 35.023  1.00 23.71  ?  131 LEU A CD2   1 
ATOM   1013  N  N     . GLN A 1 132 ? 86.126  -26.501 38.880  1.00 39.82  ?  132 GLN A N     1 
ATOM   1014  C  CA    . GLN A 1 132 ? 86.401  -27.892 39.246  1.00 37.50  ?  132 GLN A CA    1 
ATOM   1015  C  C     . GLN A 1 132 ? 85.156  -28.701 39.596  1.00 39.76  ?  132 GLN A C     1 
ATOM   1016  O  O     . GLN A 1 132 ? 84.337  -28.296 40.419  1.00 41.67  ?  132 GLN A O     1 
ATOM   1017  C  CB    . GLN A 1 132 ? 87.365  -27.919 40.416  1.00 33.28  ?  132 GLN A CB    1 
ATOM   1018  C  CG    . GLN A 1 132 ? 88.033  -29.240 40.647  1.00 38.02  ?  132 GLN A CG    1 
ATOM   1019  C  CD    . GLN A 1 132 ? 88.741  -29.269 41.987  1.00 50.48  ?  132 GLN A CD    1 
ATOM   1020  O  OE1   . GLN A 1 132 ? 88.110  -29.138 43.056  1.00 59.42  ?  132 GLN A OE1   1 
ATOM   1021  N  NE2   . GLN A 1 132 ? 90.060  -29.418 41.944  1.00 51.96  ?  132 GLN A NE2   1 
ATOM   1022  N  N     . ASP A 1 133 ? 85.016  -29.847 38.952  1.00 42.27  ?  133 ASP A N     1 
ATOM   1023  C  CA    . ASP A 1 133 ? 83.946  -30.779 39.272  1.00 45.63  ?  133 ASP A CA    1 
ATOM   1024  C  C     . ASP A 1 133 ? 82.555  -30.340 38.806  1.00 39.57  ?  133 ASP A C     1 
ATOM   1025  O  O     . ASP A 1 133 ? 81.565  -30.997 39.142  1.00 42.62  ?  133 ASP A O     1 
ATOM   1026  C  CB    . ASP A 1 133 ? 83.955  -31.096 40.768  1.00 56.90  ?  133 ASP A CB    1 
ATOM   1027  C  CG    . ASP A 1 133 ? 85.144  -31.975 41.177  1.00 68.05  ?  133 ASP A CG    1 
ATOM   1028  O  OD1   . ASP A 1 133 ? 85.521  -32.886 40.394  1.00 72.08  ?  133 ASP A OD1   1 
ATOM   1029  O  OD2   . ASP A 1 133 ? 85.697  -31.758 42.282  1.00 68.81  ?  133 ASP A OD2   1 
ATOM   1030  N  N     . ILE A 1 134 ? 82.492  -29.256 38.023  1.00 33.32  ?  134 ILE A N     1 
ATOM   1031  C  CA    . ILE A 1 134 ? 81.235  -28.775 37.424  1.00 34.29  ?  134 ILE A CA    1 
ATOM   1032  C  C     . ILE A 1 134 ? 80.473  -29.882 36.674  1.00 38.37  ?  134 ILE A C     1 
ATOM   1033  O  O     . ILE A 1 134 ? 79.236  -29.862 36.572  1.00 35.62  ?  134 ILE A O     1 
ATOM   1034  C  CB    . ILE A 1 134 ? 81.472  -27.601 36.441  1.00 42.02  ?  134 ILE A CB    1 
ATOM   1035  C  CG1   . ILE A 1 134 ? 80.155  -27.030 35.935  1.00 25.76  ?  134 ILE A CG1   1 
ATOM   1036  C  CG2   . ILE A 1 134 ? 82.257  -28.060 35.244  1.00 52.50  ?  134 ILE A CG2   1 
ATOM   1037  C  CD1   . ILE A 1 134 ? 79.578  -26.031 36.846  1.00 44.82  ?  134 ILE A CD1   1 
ATOM   1038  N  N     . GLU A 1 135 ? 81.220  -30.850 36.155  1.00 43.25  ?  135 GLU A N     1 
ATOM   1039  C  CA    . GLU A 1 135 ? 80.653  -31.879 35.292  1.00 45.57  ?  135 GLU A CA    1 
ATOM   1040  C  C     . GLU A 1 135 ? 80.112  -33.063 36.082  1.00 43.78  ?  135 GLU A C     1 
ATOM   1041  O  O     . GLU A 1 135 ? 79.652  -34.040 35.503  1.00 45.20  ?  135 GLU A O     1 
ATOM   1042  C  CB    . GLU A 1 135 ? 81.697  -32.359 34.271  1.00 51.93  ?  135 GLU A CB    1 
ATOM   1043  C  CG    . GLU A 1 135 ? 82.774  -33.299 34.830  1.00 59.76  ?  135 GLU A CG    1 
ATOM   1044  C  CD    . GLU A 1 135 ? 83.864  -32.564 35.607  1.00 69.42  ?  135 GLU A CD    1 
ATOM   1045  O  OE1   . GLU A 1 135 ? 83.833  -31.309 35.651  1.00 73.90  ?  135 GLU A OE1   1 
ATOM   1046  O  OE2   . GLU A 1 135 ? 84.752  -33.243 36.178  1.00 70.77  ?  135 GLU A OE2   1 
ATOM   1047  N  N     . LYS A 1 136 ? 80.187  -32.977 37.405  1.00 43.79  ?  136 LYS A N     1 
ATOM   1048  C  CA    . LYS A 1 136 ? 79.738  -34.062 38.268  1.00 43.94  ?  136 LYS A CA    1 
ATOM   1049  C  C     . LYS A 1 136 ? 78.467  -33.699 39.023  1.00 46.25  ?  136 LYS A C     1 
ATOM   1050  O  O     . LYS A 1 136 ? 78.261  -34.142 40.130  1.00 31.13  ?  136 LYS A O     1 
ATOM   1051  C  CB    . LYS A 1 136 ? 80.831  -34.450 39.255  1.00 31.09  ?  136 LYS A CB    1 
ATOM   1052  C  CG    . LYS A 1 136 ? 82.110  -34.905 38.602  1.00 31.67  ?  136 LYS A CG    1 
ATOM   1053  C  CD    . LYS A 1 136 ? 83.070  -35.464 39.627  1.00 35.33  ?  136 LYS A CD    1 
ATOM   1054  C  CE    . LYS A 1 136 ? 84.387  -35.848 38.996  1.00 40.21  ?  136 LYS A CE    1 
ATOM   1055  N  NZ    . LYS A 1 136 ? 84.938  -37.117 39.557  1.00 44.60  ?  136 LYS A NZ    1 
ATOM   1056  N  N     . LYS A 1 137 ? 77.611  -32.894 38.413  1.00 50.73  ?  137 LYS A N     1 
ATOM   1057  C  CA    . LYS A 1 137 ? 76.329  -32.560 39.013  1.00 46.88  ?  137 LYS A CA    1 
ATOM   1058  C  C     . LYS A 1 137 ? 76.531  -32.142 40.464  1.00 42.13  ?  137 LYS A C     1 
ATOM   1059  O  O     . LYS A 1 137 ? 75.919  -32.727 41.366  1.00 41.26  ?  137 LYS A O     1 
ATOM   1060  C  CB    . LYS A 1 137 ? 75.363  -33.753 38.928  1.00 52.88  ?  137 LYS A CB    1 
ATOM   1061  C  CG    . LYS A 1 137 ? 75.388  -34.521 37.594  1.00 67.95  ?  137 LYS A CG    1 
ATOM   1062  C  CD    . LYS A 1 137 ? 73.987  -34.852 37.032  1.00 51.06  ?  137 LYS A CD    1 
ATOM   1063  N  N     . THR A 1 138 ? 77.381  -31.130 40.674  1.00 28.55  ?  138 THR A N     1 
ATOM   1064  C  CA    . THR A 1 138 ? 77.716  -30.635 42.013  1.00 36.62  ?  138 THR A CA    1 
ATOM   1065  C  C     . THR A 1 138 ? 77.086  -29.286 42.349  1.00 37.68  ?  138 THR A C     1 
ATOM   1066  O  O     . THR A 1 138 ? 77.241  -28.777 43.456  1.00 37.88  ?  138 THR A O     1 
ATOM   1067  C  CB    . THR A 1 138 ? 79.218  -30.454 42.160  1.00 34.38  ?  138 THR A CB    1 
ATOM   1068  O  OG1   . THR A 1 138 ? 79.691  -29.672 41.063  1.00 31.93  ?  138 THR A OG1   1 
ATOM   1069  C  CG2   . THR A 1 138 ? 79.917  -31.794 42.158  1.00 36.65  ?  138 THR A CG2   1 
ATOM   1070  N  N     . VAL A 1 139 ? 76.378  -28.708 41.388  1.00 37.78  ?  139 VAL A N     1 
ATOM   1071  C  CA    . VAL A 1 139 ? 75.838  -27.362 41.518  1.00 35.75  ?  139 VAL A CA    1 
ATOM   1072  C  C     . VAL A 1 139 ? 74.534  -27.271 40.735  1.00 35.18  ?  139 VAL A C     1 
ATOM   1073  O  O     . VAL A 1 139 ? 74.421  -27.828 39.649  1.00 39.43  ?  139 VAL A O     1 
ATOM   1074  C  CB    . VAL A 1 139 ? 76.808  -26.335 40.901  1.00 38.21  ?  139 VAL A CB    1 
ATOM   1075  C  CG1   . VAL A 1 139 ? 76.076  -25.070 40.579  1.00 46.46  ?  139 VAL A CG1   1 
ATOM   1076  C  CG2   . VAL A 1 139 ? 77.979  -26.054 41.815  1.00 34.55  ?  139 VAL A CG2   1 
ATOM   1077  N  N     . PRO A 1 140 ? 73.544  -26.545 41.259  1.00 35.40  ?  140 PRO A N     1 
ATOM   1078  C  CA    . PRO A 1 140 ? 72.260  -26.404 40.566  1.00 39.82  ?  140 PRO A CA    1 
ATOM   1079  C  C     . PRO A 1 140 ? 72.319  -25.633 39.232  1.00 42.49  ?  140 PRO A C     1 
ATOM   1080  O  O     . PRO A 1 140 ? 72.851  -24.521 39.145  1.00 35.89  ?  140 PRO A O     1 
ATOM   1081  C  CB    . PRO A 1 140 ? 71.417  -25.634 41.586  1.00 35.73  ?  140 PRO A CB    1 
ATOM   1082  C  CG    . PRO A 1 140 ? 72.396  -24.814 42.278  1.00 35.22  ?  140 PRO A CG    1 
ATOM   1083  C  CD    . PRO A 1 140 ? 73.576  -25.729 42.478  1.00 36.69  ?  140 PRO A CD    1 
ATOM   1084  N  N     . PHE A 1 141 ? 71.740  -26.238 38.200  1.00 45.84  ?  141 PHE A N     1 
ATOM   1085  C  CA    . PHE A 1 141 ? 71.646  -25.619 36.880  1.00 44.78  ?  141 PHE A CA    1 
ATOM   1086  C  C     . PHE A 1 141 ? 70.236  -25.105 36.602  1.00 49.82  ?  141 PHE A C     1 
ATOM   1087  O  O     . PHE A 1 141 ? 69.256  -25.668 37.084  1.00 57.47  ?  141 PHE A O     1 
ATOM   1088  C  CB    . PHE A 1 141 ? 72.017  -26.640 35.803  1.00 44.17  ?  141 PHE A CB    1 
ATOM   1089  C  CG    . PHE A 1 141 ? 73.489  -26.718 35.512  1.00 41.85  ?  141 PHE A CG    1 
ATOM   1090  C  CD1   . PHE A 1 141 ? 74.346  -27.366 36.371  1.00 37.87  ?  141 PHE A CD1   1 
ATOM   1091  C  CD2   . PHE A 1 141 ? 74.011  -26.152 34.357  1.00 44.38  ?  141 PHE A CD2   1 
ATOM   1092  C  CE1   . PHE A 1 141 ? 75.690  -27.433 36.093  1.00 37.23  ?  141 PHE A CE1   1 
ATOM   1093  C  CE2   . PHE A 1 141 ? 75.359  -26.219 34.077  1.00 41.84  ?  141 PHE A CE2   1 
ATOM   1094  C  CZ    . PHE A 1 141 ? 76.197  -26.862 34.938  1.00 37.34  ?  141 PHE A CZ    1 
ATOM   1095  N  N     . ALA A 1 142 ? 70.129  -24.046 35.808  1.00 48.24  ?  142 ALA A N     1 
ATOM   1096  C  CA    . ALA A 1 142 ? 68.822  -23.606 35.317  1.00 50.01  ?  142 ALA A CA    1 
ATOM   1097  C  C     . ALA A 1 142 ? 68.833  -23.528 33.800  1.00 51.55  ?  142 ALA A C     1 
ATOM   1098  O  O     . ALA A 1 142 ? 69.835  -23.856 33.172  1.00 54.07  ?  142 ALA A O     1 
ATOM   1099  C  CB    . ALA A 1 142 ? 68.454  -22.279 35.900  1.00 50.53  ?  142 ALA A CB    1 
ATOM   1100  N  N     . TRP A 1 143 ? 67.721  -23.096 33.213  1.00 52.34  ?  143 TRP A N     1 
ATOM   1101  C  CA    . TRP A 1 143 ? 67.664  -22.904 31.768  1.00 53.82  ?  143 TRP A CA    1 
ATOM   1102  C  C     . TRP A 1 143 ? 68.192  -21.543 31.385  1.00 55.05  ?  143 TRP A C     1 
ATOM   1103  O  O     . TRP A 1 143 ? 68.009  -20.571 32.117  1.00 61.10  ?  143 TRP A O     1 
ATOM   1104  C  CB    . TRP A 1 143 ? 66.241  -23.052 31.256  1.00 59.87  ?  143 TRP A CB    1 
ATOM   1105  C  CG    . TRP A 1 143 ? 65.756  -24.456 31.292  1.00 66.23  ?  143 TRP A CG    1 
ATOM   1106  C  CD1   . TRP A 1 143 ? 64.817  -24.980 32.132  1.00 68.98  ?  143 TRP A CD1   1 
ATOM   1107  C  CD2   . TRP A 1 143 ? 66.190  -25.530 30.453  1.00 68.13  ?  143 TRP A CD2   1 
ATOM   1108  N  NE1   . TRP A 1 143 ? 64.634  -26.315 31.861  1.00 70.87  ?  143 TRP A NE1   1 
ATOM   1109  C  CE2   . TRP A 1 143 ? 65.467  -26.677 30.836  1.00 69.13  ?  143 TRP A CE2   1 
ATOM   1110  C  CE3   . TRP A 1 143 ? 67.116  -25.633 29.413  1.00 66.57  ?  143 TRP A CE3   1 
ATOM   1111  C  CZ2   . TRP A 1 143 ? 65.643  -27.906 30.219  1.00 69.85  ?  143 TRP A CZ2   1 
ATOM   1112  C  CZ3   . TRP A 1 143 ? 67.285  -26.858 28.795  1.00 64.89  ?  143 TRP A CZ3   1 
ATOM   1113  C  CH2   . TRP A 1 143 ? 66.554  -27.975 29.200  1.00 67.53  ?  143 TRP A CH2   1 
ATOM   1114  N  N     . ASN A 1 144 ? 68.867  -21.479 30.243  1.00 51.16  ?  144 ASN A N     1 
ATOM   1115  C  CA    . ASN A 1 144 ? 69.279  -20.200 29.687  1.00 51.08  ?  144 ASN A CA    1 
ATOM   1116  C  C     . ASN A 1 144 ? 68.064  -19.437 29.165  1.00 50.92  ?  144 ASN A C     1 
ATOM   1117  O  O     . ASN A 1 144 ? 66.974  -19.997 29.047  1.00 54.10  ?  144 ASN A O     1 
ATOM   1118  C  CB    . ASN A 1 144 ? 70.318  -20.387 28.576  1.00 52.39  ?  144 ASN A CB    1 
ATOM   1119  C  CG    . ASN A 1 144 ? 69.814  -21.259 27.434  1.00 53.00  ?  144 ASN A CG    1 
ATOM   1120  O  OD1   . ASN A 1 144 ? 68.702  -21.786 27.479  1.00 56.21  ?  144 ASN A OD1   1 
ATOM   1121  N  ND2   . ASN A 1 144 ? 70.630  -21.397 26.393  1.00 49.83  ?  144 ASN A ND2   1 
ATOM   1122  N  N     . PHE A 1 145 ? 68.251  -18.158 28.863  1.00 48.89  ?  145 PHE A N     1 
ATOM   1123  C  CA    . PHE A 1 145 ? 67.175  -17.315 28.343  1.00 55.58  ?  145 PHE A CA    1 
ATOM   1124  C  C     . PHE A 1 145 ? 66.372  -18.003 27.229  1.00 59.57  ?  145 PHE A C     1 
ATOM   1125  O  O     . PHE A 1 145 ? 65.284  -17.564 26.868  1.00 63.37  ?  145 PHE A O     1 
ATOM   1126  C  CB    . PHE A 1 145 ? 67.764  -16.003 27.820  1.00 58.77  ?  145 PHE A CB    1 
ATOM   1127  C  CG    . PHE A 1 145 ? 68.725  -16.192 26.687  1.00 62.53  ?  145 PHE A CG    1 
ATOM   1128  C  CD1   . PHE A 1 145 ? 68.273  -16.267 25.383  1.00 61.82  ?  145 PHE A CD1   1 
ATOM   1129  C  CD2   . PHE A 1 145 ? 70.076  -16.328 26.924  1.00 64.26  ?  145 PHE A CD2   1 
ATOM   1130  C  CE1   . PHE A 1 145 ? 69.149  -16.457 24.347  1.00 58.02  ?  145 PHE A CE1   1 
ATOM   1131  C  CE2   . PHE A 1 145 ? 70.956  -16.519 25.881  1.00 60.78  ?  145 PHE A CE2   1 
ATOM   1132  C  CZ    . PHE A 1 145 ? 70.488  -16.582 24.596  1.00 56.43  ?  145 PHE A CZ    1 
ATOM   1133  N  N     . ASP A 1 146 ? 66.916  -19.090 26.700  1.00 58.84  ?  146 ASP A N     1 
ATOM   1134  C  CA    . ASP A 1 146 ? 66.390  -19.742 25.510  1.00 59.51  ?  146 ASP A CA    1 
ATOM   1135  C  C     . ASP A 1 146 ? 65.465  -20.884 25.868  1.00 62.47  ?  146 ASP A C     1 
ATOM   1136  O  O     . ASP A 1 146 ? 64.584  -21.244 25.096  1.00 69.41  ?  146 ASP A O     1 
ATOM   1137  C  CB    . ASP A 1 146 ? 67.554  -20.339 24.730  1.00 66.00  ?  146 ASP A CB    1 
ATOM   1138  C  CG    . ASP A 1 146 ? 67.603  -19.866 23.316  1.00 78.26  ?  146 ASP A CG    1 
ATOM   1139  O  OD1   . ASP A 1 146 ? 66.643  -19.189 22.896  1.00 84.44  ?  146 ASP A OD1   1 
ATOM   1140  O  OD2   . ASP A 1 146 ? 68.598  -20.179 22.624  1.00 81.22  ?  146 ASP A OD2   1 
ATOM   1141  N  N     . ASP A 1 147 ? 65.688  -21.456 27.045  1.00 63.53  ?  147 ASP A N     1 
ATOM   1142  C  CA    . ASP A 1 147 ? 65.163  -22.776 27.403  1.00 66.41  ?  147 ASP A CA    1 
ATOM   1143  C  C     . ASP A 1 147 ? 65.709  -23.848 26.465  1.00 66.30  ?  147 ASP A C     1 
ATOM   1144  O  O     . ASP A 1 147 ? 65.067  -24.865 26.236  1.00 72.84  ?  147 ASP A O     1 
ATOM   1145  C  CB    . ASP A 1 147 ? 63.631  -22.809 27.463  1.00 72.97  ?  147 ASP A CB    1 
ATOM   1146  C  CG    . ASP A 1 147 ? 63.071  -21.954 28.595  1.00 83.36  ?  147 ASP A CG    1 
ATOM   1147  O  OD1   . ASP A 1 147 ? 61.880  -21.581 28.517  1.00 93.60  ?  147 ASP A OD1   1 
ATOM   1148  O  OD2   . ASP A 1 147 ? 63.814  -21.643 29.556  1.00 81.96  ?  147 ASP A OD2   1 
ATOM   1149  N  N     . THR A 1 148 ? 66.918  -23.618 25.957  1.00 60.18  ?  148 THR A N     1 
ATOM   1150  C  CA    . THR A 1 148 ? 67.565  -24.522 25.008  1.00 57.15  ?  148 THR A CA    1 
ATOM   1151  C  C     . THR A 1 148 ? 68.823  -25.175 25.580  1.00 53.28  ?  148 THR A C     1 
ATOM   1152  O  O     . THR A 1 148 ? 69.286  -26.188 25.068  1.00 55.01  ?  148 THR A O     1 
ATOM   1153  C  CB    . THR A 1 148 ? 67.961  -23.774 23.738  1.00 58.45  ?  148 THR A CB    1 
ATOM   1154  O  OG1   . THR A 1 148 ? 69.172  -23.038 23.966  1.00 54.82  ?  148 THR A OG1   1 
ATOM   1155  C  CG2   . THR A 1 148 ? 66.858  -22.809 23.359  1.00 65.83  ?  148 THR A CG2   1 
ATOM   1156  N  N     . GLU A 1 149 ? 69.388  -24.583 26.629  1.00 50.84  ?  149 GLU A N     1 
ATOM   1157  C  CA    . GLU A 1 149 ? 70.558  -25.158 27.279  1.00 50.55  ?  149 GLU A CA    1 
ATOM   1158  C  C     . GLU A 1 149 ? 70.585  -24.766 28.754  1.00 47.93  ?  149 GLU A C     1 
ATOM   1159  O  O     . GLU A 1 149 ? 70.217  -23.638 29.106  1.00 47.16  ?  149 GLU A O     1 
ATOM   1160  C  CB    . GLU A 1 149 ? 71.841  -24.701 26.584  1.00 53.40  ?  149 GLU A CB    1 
ATOM   1161  C  CG    . GLU A 1 149 ? 73.062  -25.524 26.943  1.00 62.83  ?  149 GLU A CG    1 
ATOM   1162  C  CD    . GLU A 1 149 ? 74.346  -24.976 26.334  1.00 71.07  ?  149 GLU A CD    1 
ATOM   1163  O  OE1   . GLU A 1 149 ? 74.257  -24.262 25.306  1.00 66.55  ?  149 GLU A OE1   1 
ATOM   1164  O  OE2   . GLU A 1 149 ? 75.440  -25.261 26.893  1.00 78.22  ?  149 GLU A OE2   1 
ATOM   1165  N  N     . LYS A 1 150 ? 71.005  -25.708 29.604  1.00 44.87  ?  150 LYS A N     1 
ATOM   1166  C  CA    . LYS A 1 150 ? 71.155  -25.461 31.041  1.00 45.79  ?  150 LYS A CA    1 
ATOM   1167  C  C     . LYS A 1 150 ? 72.506  -24.782 31.346  1.00 45.73  ?  150 LYS A C     1 
ATOM   1168  O  O     . LYS A 1 150 ? 73.539  -25.136 30.771  1.00 50.66  ?  150 LYS A O     1 
ATOM   1169  C  CB    . LYS A 1 150 ? 70.989  -26.764 31.854  1.00 49.41  ?  150 LYS A CB    1 
ATOM   1170  C  CG    . LYS A 1 150 ? 69.535  -27.252 32.085  1.00 34.76  ?  150 LYS A CG    1 
ATOM   1171  N  N     . GLU A 1 151 ? 72.471  -23.778 32.220  1.00 42.64  ?  151 GLU A N     1 
ATOM   1172  C  CA    . GLU A 1 151 ? 73.674  -23.107 32.710  1.00 41.44  ?  151 GLU A CA    1 
ATOM   1173  C  C     . GLU A 1 151 ? 73.710  -23.206 34.225  1.00 47.35  ?  151 GLU A C     1 
ATOM   1174  O  O     . GLU A 1 151 ? 72.663  -23.292 34.865  1.00 57.35  ?  151 GLU A O     1 
ATOM   1175  C  CB    . GLU A 1 151 ? 73.656  -21.635 32.335  1.00 40.50  ?  151 GLU A CB    1 
ATOM   1176  C  CG    . GLU A 1 151 ? 72.460  -20.908 32.896  1.00 45.78  ?  151 GLU A CG    1 
ATOM   1177  C  CD    . GLU A 1 151 ? 72.524  -19.420 32.647  1.00 51.82  ?  151 GLU A CD    1 
ATOM   1178  O  OE1   . GLU A 1 151 ? 71.456  -18.760 32.657  1.00 57.81  ?  151 GLU A OE1   1 
ATOM   1179  O  OE2   . GLU A 1 151 ? 73.648  -18.913 32.448  1.00 48.33  ?  151 GLU A OE2   1 
ATOM   1180  N  N     . PRO A 1 152 ? 74.914  -23.172 34.811  1.00 41.88  ?  152 PRO A N     1 
ATOM   1181  C  CA    . PRO A 1 152 ? 75.064  -23.240 36.265  1.00 37.76  ?  152 PRO A CA    1 
ATOM   1182  C  C     . PRO A 1 152 ? 74.681  -21.907 36.929  1.00 37.80  ?  152 PRO A C     1 
ATOM   1183  O  O     . PRO A 1 152 ? 74.907  -20.849 36.346  1.00 47.80  ?  152 PRO A O     1 
ATOM   1184  C  CB    . PRO A 1 152 ? 76.556  -23.515 36.426  1.00 25.23  ?  152 PRO A CB    1 
ATOM   1185  C  CG    . PRO A 1 152 ? 77.174  -22.796 35.276  1.00 27.74  ?  152 PRO A CG    1 
ATOM   1186  C  CD    . PRO A 1 152 ? 76.203  -22.943 34.139  1.00 34.40  ?  152 PRO A CD    1 
ATOM   1187  N  N     . THR A 1 153 ? 74.109  -21.973 38.126  1.00 30.96  ?  153 THR A N     1 
ATOM   1188  C  CA    . THR A 1 153 ? 73.691  -20.791 38.894  1.00 32.27  ?  153 THR A CA    1 
ATOM   1189  C  C     . THR A 1 153 ? 74.774  -20.304 39.851  1.00 35.27  ?  153 THR A C     1 
ATOM   1190  O  O     . THR A 1 153 ? 74.820  -19.121 40.185  1.00 39.22  ?  153 THR A O     1 
ATOM   1191  C  CB    . THR A 1 153 ? 72.459  -21.100 39.752  1.00 37.29  ?  153 THR A CB    1 
ATOM   1192  O  OG1   . THR A 1 153 ? 72.732  -22.236 40.597  1.00 40.83  ?  153 THR A OG1   1 
ATOM   1193  C  CG2   . THR A 1 153 ? 71.274  -21.409 38.874  1.00 28.08  ?  153 THR A CG2   1 
ATOM   1194  N  N     . VAL A 1 154 ? 75.607  -21.236 40.318  1.00 34.91  ?  154 VAL A N     1 
ATOM   1195  C  CA    . VAL A 1 154 ? 76.776  -20.936 41.144  1.00 34.93  ?  154 VAL A CA    1 
ATOM   1196  C  C     . VAL A 1 154 ? 77.894  -21.886 40.683  1.00 33.28  ?  154 VAL A C     1 
ATOM   1197  O  O     . VAL A 1 154 ? 77.613  -22.945 40.143  1.00 37.20  ?  154 VAL A O     1 
ATOM   1198  C  CB    . VAL A 1 154 ? 76.459  -21.139 42.655  1.00 29.43  ?  154 VAL A CB    1 
ATOM   1199  C  CG1   . VAL A 1 154 ? 75.979  -22.577 42.935  1.00 28.15  ?  154 VAL A CG1   1 
ATOM   1200  C  CG2   . VAL A 1 154 ? 77.662  -20.783 43.542  1.00 27.92  ?  154 VAL A CG2   1 
ATOM   1201  N  N     . LEU A 1 155 ? 79.158  -21.531 40.867  1.00 31.46  ?  155 LEU A N     1 
ATOM   1202  C  CA    . LEU A 1 155 ? 80.206  -22.476 40.490  1.00 29.42  ?  155 LEU A CA    1 
ATOM   1203  C  C     . LEU A 1 155 ? 80.722  -23.240 41.715  1.00 31.50  ?  155 LEU A C     1 
ATOM   1204  O  O     . LEU A 1 155 ? 80.568  -22.790 42.843  1.00 34.17  ?  155 LEU A O     1 
ATOM   1205  C  CB    . LEU A 1 155 ? 81.344  -21.772 39.737  1.00 26.13  ?  155 LEU A CB    1 
ATOM   1206  C  CG    . LEU A 1 155 ? 80.987  -20.978 38.470  1.00 26.26  ?  155 LEU A CG    1 
ATOM   1207  C  CD1   . LEU A 1 155 ? 82.203  -20.319 37.891  1.00 26.04  ?  155 LEU A CD1   1 
ATOM   1208  C  CD2   . LEU A 1 155 ? 80.337  -21.860 37.430  1.00 31.25  ?  155 LEU A CD2   1 
ATOM   1209  N  N     . PRO A 1 156 ? 81.328  -24.413 41.497  1.00 33.05  ?  156 PRO A N     1 
ATOM   1210  C  CA    . PRO A 1 156 ? 81.823  -25.235 42.606  1.00 32.16  ?  156 PRO A CA    1 
ATOM   1211  C  C     . PRO A 1 156 ? 82.839  -24.538 43.513  1.00 34.08  ?  156 PRO A C     1 
ATOM   1212  O  O     . PRO A 1 156 ? 82.986  -24.946 44.667  1.00 33.44  ?  156 PRO A O     1 
ATOM   1213  C  CB    . PRO A 1 156 ? 82.456  -26.423 41.887  1.00 30.72  ?  156 PRO A CB    1 
ATOM   1214  C  CG    . PRO A 1 156 ? 81.607  -26.578 40.701  1.00 34.58  ?  156 PRO A CG    1 
ATOM   1215  C  CD    . PRO A 1 156 ? 81.350  -25.158 40.232  1.00 35.83  ?  156 PRO A CD    1 
ATOM   1216  N  N     . ALA A 1 157 ? 83.528  -23.526 43.000  1.00 32.28  ?  157 ALA A N     1 
ATOM   1217  C  CA    . ALA A 1 157 ? 84.411  -22.682 43.815  1.00 31.95  ?  157 ALA A CA    1 
ATOM   1218  C  C     . ALA A 1 157 ? 85.342  -23.447 44.773  1.00 32.14  ?  157 ALA A C     1 
ATOM   1219  O  O     . ALA A 1 157 ? 85.185  -23.409 45.987  1.00 35.36  ?  157 ALA A O     1 
ATOM   1220  C  CB    . ALA A 1 157 ? 83.590  -21.616 44.577  1.00 30.55  ?  157 ALA A CB    1 
ATOM   1221  N  N     . ALA A 1 158 ? 86.326  -24.127 44.211  1.00 29.36  ?  158 ALA A N     1 
ATOM   1222  C  CA    . ALA A 1 158 ? 87.354  -24.791 44.987  1.00 30.59  ?  158 ALA A CA    1 
ATOM   1223  C  C     . ALA A 1 158 ? 88.286  -23.803 45.679  1.00 37.34  ?  158 ALA A C     1 
ATOM   1224  O  O     . ALA A 1 158 ? 89.252  -24.210 46.305  1.00 43.85  ?  158 ALA A O     1 
ATOM   1225  C  CB    . ALA A 1 158 ? 88.153  -25.711 44.102  1.00 32.39  ?  158 ALA A CB    1 
ATOM   1226  N  N     . PHE A 1 159 ? 88.029  -22.508 45.539  1.00 35.99  ?  159 PHE A N     1 
ATOM   1227  C  CA    . PHE A 1 159 ? 88.643  -21.523 46.432  1.00 36.39  ?  159 PHE A CA    1 
ATOM   1228  C  C     . PHE A 1 159 ? 87.689  -20.346 46.631  1.00 40.78  ?  159 PHE A C     1 
ATOM   1229  O  O     . PHE A 1 159 ? 86.809  -20.121 45.791  1.00 37.76  ?  159 PHE A O     1 
ATOM   1230  C  CB    . PHE A 1 159 ? 90.037  -21.089 45.960  1.00 36.35  ?  159 PHE A CB    1 
ATOM   1231  C  CG    . PHE A 1 159 ? 90.031  -20.142 44.797  1.00 41.84  ?  159 PHE A CG    1 
ATOM   1232  C  CD1   . PHE A 1 159 ? 90.038  -20.614 43.500  1.00 42.26  ?  159 PHE A CD1   1 
ATOM   1233  C  CD2   . PHE A 1 159 ? 90.041  -18.769 45.004  1.00 48.94  ?  159 PHE A CD2   1 
ATOM   1234  C  CE1   . PHE A 1 159 ? 90.040  -19.732 42.429  1.00 43.35  ?  159 PHE A CE1   1 
ATOM   1235  C  CE2   . PHE A 1 159 ? 90.037  -17.879 43.931  1.00 47.72  ?  159 PHE A CE2   1 
ATOM   1236  C  CZ    . PHE A 1 159 ? 90.037  -18.363 42.652  1.00 43.79  ?  159 PHE A CZ    1 
ATOM   1237  N  N     . PRO A 1 160 ? 87.834  -19.621 47.763  1.00 46.47  ?  160 PRO A N     1 
ATOM   1238  C  CA    . PRO A 1 160 ? 86.928  -18.543 48.208  1.00 45.98  ?  160 PRO A CA    1 
ATOM   1239  C  C     . PRO A 1 160 ? 87.119  -17.252 47.419  1.00 43.82  ?  160 PRO A C     1 
ATOM   1240  O  O     . PRO A 1 160 ? 87.622  -16.258 47.949  1.00 42.20  ?  160 PRO A O     1 
ATOM   1241  C  CB    . PRO A 1 160 ? 87.328  -18.317 49.675  1.00 40.64  ?  160 PRO A CB    1 
ATOM   1242  C  CG    . PRO A 1 160 ? 88.256  -19.436 50.023  1.00 40.73  ?  160 PRO A CG    1 
ATOM   1243  C  CD    . PRO A 1 160 ? 88.903  -19.857 48.744  1.00 42.78  ?  160 PRO A CD    1 
ATOM   1244  N  N     . ASN A 1 161 ? 86.687  -17.283 46.164  1.00 43.41  ?  161 ASN A N     1 
ATOM   1245  C  CA    . ASN A 1 161 ? 86.954  -16.220 45.210  1.00 42.83  ?  161 ASN A CA    1 
ATOM   1246  C  C     . ASN A 1 161 ? 86.441  -14.854 45.659  1.00 46.34  ?  161 ASN A C     1 
ATOM   1247  O  O     . ASN A 1 161 ? 87.086  -13.832 45.404  1.00 49.70  ?  161 ASN A O     1 
ATOM   1248  C  CB    . ASN A 1 161 ? 86.375  -16.601 43.838  1.00 39.86  ?  161 ASN A CB    1 
ATOM   1249  C  CG    . ASN A 1 161 ? 86.645  -15.556 42.783  1.00 40.37  ?  161 ASN A CG    1 
ATOM   1250  O  OD1   . ASN A 1 161 ? 87.789  -15.334 42.378  1.00 40.64  ?  161 ASN A OD1   1 
ATOM   1251  N  ND2   . ASN A 1 161 ? 85.591  -14.908 42.327  1.00 40.87  ?  161 ASN A ND2   1 
ATOM   1252  N  N     . LEU A 1 162 ? 85.291  -14.841 46.336  1.00 43.42  ?  162 LEU A N     1 
ATOM   1253  C  CA    . LEU A 1 162 ? 84.630  -13.592 46.713  1.00 38.95  ?  162 LEU A CA    1 
ATOM   1254  C  C     . LEU A 1 162 ? 85.560  -12.686 47.512  1.00 37.82  ?  162 LEU A C     1 
ATOM   1255  O  O     . LEU A 1 162 ? 85.545  -11.474 47.352  1.00 40.36  ?  162 LEU A O     1 
ATOM   1256  C  CB    . LEU A 1 162 ? 83.360  -13.883 47.511  1.00 40.33  ?  162 LEU A CB    1 
ATOM   1257  C  CG    . LEU A 1 162 ? 82.245  -12.835 47.680  1.00 41.97  ?  162 LEU A CG    1 
ATOM   1258  C  CD1   . LEU A 1 162 ? 82.138  -12.396 49.129  1.00 28.03  ?  162 LEU A CD1   1 
ATOM   1259  C  CD2   . LEU A 1 162 ? 82.408  -11.643 46.747  1.00 38.34  ?  162 LEU A CD2   1 
ATOM   1260  N  N     . LEU A 1 163 ? 86.376  -13.276 48.375  1.00 34.81  ?  163 LEU A N     1 
ATOM   1261  C  CA    . LEU A 1 163 ? 87.296  -12.485 49.172  1.00 36.27  ?  163 LEU A CA    1 
ATOM   1262  C  C     . LEU A 1 163 ? 88.617  -12.308 48.467  1.00 40.15  ?  163 LEU A C     1 
ATOM   1263  O  O     . LEU A 1 163 ? 89.184  -11.223 48.486  1.00 45.86  ?  163 LEU A O     1 
ATOM   1264  C  CB    . LEU A 1 163 ? 87.519  -13.141 50.523  1.00 35.68  ?  163 LEU A CB    1 
ATOM   1265  C  CG    . LEU A 1 163 ? 86.450  -12.908 51.579  1.00 28.38  ?  163 LEU A CG    1 
ATOM   1266  C  CD1   . LEU A 1 163 ? 86.870  -13.668 52.800  1.00 31.25  ?  163 LEU A CD1   1 
ATOM   1267  C  CD2   . LEU A 1 163 ? 86.330  -11.419 51.853  1.00 28.82  ?  163 LEU A CD2   1 
ATOM   1268  N  N     . VAL A 1 164 ? 89.109  -13.382 47.853  1.00 39.27  ?  164 VAL A N     1 
ATOM   1269  C  CA    . VAL A 1 164 ? 90.364  -13.335 47.113  1.00 37.28  ?  164 VAL A CA    1 
ATOM   1270  C  C     . VAL A 1 164 ? 90.347  -12.237 46.064  1.00 38.19  ?  164 VAL A C     1 
ATOM   1271  O  O     . VAL A 1 164 ? 91.315  -11.488 45.939  1.00 38.77  ?  164 VAL A O     1 
ATOM   1272  C  CB    . VAL A 1 164 ? 90.681  -14.649 46.394  1.00 26.74  ?  164 VAL A CB    1 
ATOM   1273  C  CG1   . VAL A 1 164 ? 91.890  -14.465 45.508  1.00 26.78  ?  164 VAL A CG1   1 
ATOM   1274  C  CG2   . VAL A 1 164 ? 90.946  -15.741 47.373  1.00 31.81  ?  164 VAL A CG2   1 
ATOM   1275  N  N     . ASN A 1 165 ? 89.250  -12.134 45.314  1.00 36.58  ?  165 ASN A N     1 
ATOM   1276  C  CA    . ASN A 1 165 ? 89.220  -11.229 44.161  1.00 37.45  ?  165 ASN A CA    1 
ATOM   1277  C  C     . ASN A 1 165 ? 88.421  -9.972  44.339  1.00 40.63  ?  165 ASN A C     1 
ATOM   1278  O  O     . ASN A 1 165 ? 88.701  -8.950  43.706  1.00 39.98  ?  165 ASN A O     1 
ATOM   1279  C  CB    . ASN A 1 165 ? 88.776  -11.948 42.899  1.00 35.07  ?  165 ASN A CB    1 
ATOM   1280  C  CG    . ASN A 1 165 ? 89.947  -12.499 42.129  1.00 33.68  ?  165 ASN A CG    1 
ATOM   1281  O  OD1   . ASN A 1 165 ? 91.024  -11.883 42.095  1.00 30.26  ?  165 ASN A OD1   1 
ATOM   1282  N  ND2   . ASN A 1 165 ? 89.764  -13.678 41.531  1.00 36.90  ?  165 ASN A ND2   1 
ATOM   1283  N  N     . GLY A 1 166 ? 87.430  -10.051 45.209  1.00 42.99  ?  166 GLY A N     1 
ATOM   1284  C  CA    . GLY A 1 166 ? 86.622  -8.894  45.509  1.00 42.89  ?  166 GLY A CA    1 
ATOM   1285  C  C     . GLY A 1 166 ? 85.474  -8.776  44.546  1.00 40.85  ?  166 GLY A C     1 
ATOM   1286  O  O     . GLY A 1 166 ? 85.243  -9.656  43.725  1.00 43.53  ?  166 GLY A O     1 
ATOM   1287  N  N     . SER A 1 167 ? 84.756  -7.673  44.653  1.00 37.27  ?  167 SER A N     1 
ATOM   1288  C  CA    . SER A 1 167 ? 83.571  -7.425  43.858  1.00 39.88  ?  167 SER A CA    1 
ATOM   1289  C  C     . SER A 1 167 ? 83.208  -5.968  44.067  1.00 42.02  ?  167 SER A C     1 
ATOM   1290  O  O     . SER A 1 167 ? 83.650  -5.354  45.032  1.00 43.35  ?  167 SER A O     1 
ATOM   1291  C  CB    . SER A 1 167 ? 82.433  -8.341  44.306  1.00 45.10  ?  167 SER A CB    1 
ATOM   1292  O  OG    . SER A 1 167 ? 81.239  -8.076  43.594  1.00 50.53  ?  167 SER A OG    1 
ATOM   1293  N  N     . THR A 1 168 ? 82.393  -5.421  43.173  1.00 42.02  ?  168 THR A N     1 
ATOM   1294  C  CA    . THR A 1 168 ? 82.125  -3.989  43.134  1.00 37.24  ?  168 THR A CA    1 
ATOM   1295  C  C     . THR A 1 168 ? 81.403  -3.751  41.832  1.00 39.74  ?  168 THR A C     1 
ATOM   1296  O  O     . THR A 1 168 ? 81.987  -4.011  40.790  1.00 50.78  ?  168 THR A O     1 
ATOM   1297  C  CB    . THR A 1 168 ? 83.479  -3.223  43.118  1.00 34.95  ?  168 THR A CB    1 
ATOM   1298  O  OG1   . THR A 1 168 ? 83.400  -2.074  42.273  1.00 34.64  ?  168 THR A OG1   1 
ATOM   1299  C  CG2   . THR A 1 168 ? 84.596  -4.125  42.596  1.00 35.00  ?  168 THR A CG2   1 
ATOM   1300  N  N     . GLY A 1 169 ? 80.140  -3.320  41.830  1.00 37.16  ?  169 GLY A N     1 
ATOM   1301  C  CA    . GLY A 1 169 ? 79.299  -3.128  42.988  1.00 42.46  ?  169 GLY A CA    1 
ATOM   1302  C  C     . GLY A 1 169 ? 78.347  -1.930  42.929  1.00 48.91  ?  169 GLY A C     1 
ATOM   1303  O  O     . GLY A 1 169 ? 78.400  -1.095  43.844  1.00 58.93  ?  169 GLY A O     1 
ATOM   1304  N  N     . ILE A 1 170 ? 77.500  -1.804  41.893  1.00 43.48  ?  170 ILE A N     1 
ATOM   1305  C  CA    . ILE A 1 170 ? 76.409  -0.794  41.955  1.00 33.21  ?  170 ILE A CA    1 
ATOM   1306  C  C     . ILE A 1 170 ? 75.063  -1.232  41.417  1.00 49.90  ?  170 ILE A C     1 
ATOM   1307  O  O     . ILE A 1 170 ? 74.912  -1.482  40.237  1.00 54.48  ?  170 ILE A O     1 
ATOM   1308  C  CB    . ILE A 1 170 ? 76.699  0.541   41.271  1.00 40.97  ?  170 ILE A CB    1 
ATOM   1309  C  CG1   . ILE A 1 170 ? 78.052  1.118   41.673  1.00 37.72  ?  170 ILE A CG1   1 
ATOM   1310  C  CG2   . ILE A 1 170 ? 75.624  1.506   41.654  1.00 34.94  ?  170 ILE A CG2   1 
ATOM   1311  C  CD1   . ILE A 1 170 ? 78.456  2.313   40.837  1.00 34.33  ?  170 ILE A CD1   1 
ATOM   1312  N  N     . SER A 1 171 ? 74.073  -1.252  42.296  1.00 48.08  ?  171 SER A N     1 
ATOM   1313  C  CA    . SER A 1 171 ? 72.770  -1.834  42.013  1.00 50.13  ?  171 SER A CA    1 
ATOM   1314  C  C     . SER A 1 171 ? 71.669  -0.784  42.198  1.00 59.30  ?  171 SER A C     1 
ATOM   1315  O  O     . SER A 1 171 ? 71.829  0.377   41.796  1.00 66.64  ?  171 SER A O     1 
ATOM   1316  C  CB    . SER A 1 171 ? 72.549  -3.020  42.954  1.00 50.79  ?  171 SER A CB    1 
ATOM   1317  O  OG    . SER A 1 171 ? 71.317  -3.662  42.725  1.00 55.91  ?  171 SER A OG    1 
ATOM   1318  N  N     . ALA A 1 172 ? 70.551  -1.197  42.795  1.00 56.71  ?  172 ALA A N     1 
ATOM   1319  C  CA    . ALA A 1 172 ? 69.469  -0.280  43.152  1.00 53.74  ?  172 ALA A CA    1 
ATOM   1320  C  C     . ALA A 1 172 ? 69.074  -0.606  44.571  1.00 56.21  ?  172 ALA A C     1 
ATOM   1321  O  O     . ALA A 1 172 ? 68.729  -1.753  44.866  1.00 54.51  ?  172 ALA A O     1 
ATOM   1322  C  CB    . ALA A 1 172 ? 68.274  -0.443  42.227  1.00 48.69  ?  172 ALA A CB    1 
ATOM   1323  N  N     . GLY A 1 173 ? 69.136  0.397   45.446  1.00 55.74  ?  173 GLY A N     1 
ATOM   1324  C  CA    . GLY A 1 173 ? 68.916  0.185   46.862  1.00 51.05  ?  173 GLY A CA    1 
ATOM   1325  C  C     . GLY A 1 173 ? 70.143  -0.400  47.539  1.00 52.68  ?  173 GLY A C     1 
ATOM   1326  O  O     . GLY A 1 173 ? 70.249  -0.395  48.769  1.00 57.84  ?  173 GLY A O     1 
ATOM   1327  N  N     . TYR A 1 174 ? 71.080  -0.906  46.742  1.00 51.59  ?  174 TYR A N     1 
ATOM   1328  C  CA    . TYR A 1 174 ? 72.270  -1.559  47.295  1.00 50.26  ?  174 TYR A CA    1 
ATOM   1329  C  C     . TYR A 1 174 ? 73.484  -1.345  46.413  1.00 50.48  ?  174 TYR A C     1 
ATOM   1330  O  O     . TYR A 1 174 ? 73.362  -1.274  45.197  1.00 53.56  ?  174 TYR A O     1 
ATOM   1331  C  CB    . TYR A 1 174 ? 72.054  -3.072  47.456  1.00 46.58  ?  174 TYR A CB    1 
ATOM   1332  C  CG    . TYR A 1 174 ? 70.887  -3.464  48.335  1.00 48.39  ?  174 TYR A CG    1 
ATOM   1333  C  CD1   . TYR A 1 174 ? 71.079  -3.813  49.659  1.00 52.06  ?  174 TYR A CD1   1 
ATOM   1334  C  CD2   . TYR A 1 174 ? 69.596  -3.501  47.833  1.00 52.09  ?  174 TYR A CD2   1 
ATOM   1335  C  CE1   . TYR A 1 174 ? 70.026  -4.181  50.456  1.00 59.54  ?  174 TYR A CE1   1 
ATOM   1336  C  CE2   . TYR A 1 174 ? 68.533  -3.865  48.625  1.00 56.44  ?  174 TYR A CE2   1 
ATOM   1337  C  CZ    . TYR A 1 174 ? 68.751  -4.204  49.936  1.00 63.08  ?  174 TYR A CZ    1 
ATOM   1338  O  OH    . TYR A 1 174 ? 67.687  -4.569  50.734  1.00 69.74  ?  174 TYR A OH    1 
ATOM   1339  N  N     . ALA A 1 175 ? 74.657  -1.258  47.032  1.00 47.89  ?  175 ALA A N     1 
ATOM   1340  C  CA    . ALA A 1 175 ? 75.912  -1.276  46.287  1.00 45.86  ?  175 ALA A CA    1 
ATOM   1341  C  C     . ALA A 1 175 ? 76.872  -2.271  46.945  1.00 45.77  ?  175 ALA A C     1 
ATOM   1342  O  O     . ALA A 1 175 ? 76.553  -2.859  47.979  1.00 48.75  ?  175 ALA A O     1 
ATOM   1343  C  CB    . ALA A 1 175 ? 76.519  0.112   46.230  1.00 46.18  ?  175 ALA A CB    1 
ATOM   1344  N  N     . THR A 1 176 ? 78.033  -2.485  46.344  1.00 42.23  ?  176 THR A N     1 
ATOM   1345  C  CA    . THR A 1 176 ? 79.031  -3.347  46.967  1.00 42.12  ?  176 THR A CA    1 
ATOM   1346  C  C     . THR A 1 176 ? 80.470  -2.915  46.692  1.00 45.65  ?  176 THR A C     1 
ATOM   1347  O  O     . THR A 1 176 ? 80.810  -2.487  45.584  1.00 48.30  ?  176 THR A O     1 
ATOM   1348  C  CB    . THR A 1 176 ? 78.838  -4.851  46.620  1.00 50.45  ?  176 THR A CB    1 
ATOM   1349  O  OG1   . THR A 1 176 ? 79.890  -5.615  47.214  1.00 57.42  ?  176 THR A OG1   1 
ATOM   1350  C  CG2   . THR A 1 176 ? 78.894  -5.090  45.146  1.00 46.46  ?  176 THR A CG2   1 
ATOM   1351  N  N     . ASP A 1 177 ? 81.294  -2.994  47.735  1.00 45.73  ?  177 ASP A N     1 
ATOM   1352  C  CA    . ASP A 1 177 ? 82.738  -2.896  47.598  1.00 45.83  ?  177 ASP A CA    1 
ATOM   1353  C  C     . ASP A 1 177 ? 83.406  -3.901  48.509  1.00 41.80  ?  177 ASP A C     1 
ATOM   1354  O  O     . ASP A 1 177 ? 83.380  -3.761  49.726  1.00 46.10  ?  177 ASP A O     1 
ATOM   1355  C  CB    . ASP A 1 177 ? 83.238  -1.481  47.865  1.00 53.78  ?  177 ASP A CB    1 
ATOM   1356  C  CG    . ASP A 1 177 ? 83.188  -0.607  46.619  1.00 68.29  ?  177 ASP A CG    1 
ATOM   1357  O  OD1   . ASP A 1 177 ? 84.126  -0.693  45.782  1.00 73.47  ?  177 ASP A OD1   1 
ATOM   1358  O  OD2   . ASP A 1 177 ? 82.202  0.154   46.475  1.00 75.44  ?  177 ASP A OD2   1 
ATOM   1359  N  N     . ILE A 1 178 ? 83.964  -4.947  47.912  1.00 39.26  ?  178 ILE A N     1 
ATOM   1360  C  CA    . ILE A 1 178 ? 84.729  -5.928  48.663  1.00 39.55  ?  178 ILE A CA    1 
ATOM   1361  C  C     . ILE A 1 178 ? 86.163  -5.957  48.159  1.00 29.35  ?  178 ILE A C     1 
ATOM   1362  O  O     . ILE A 1 178 ? 86.399  -6.257  47.007  1.00 41.78  ?  178 ILE A O     1 
ATOM   1363  C  CB    . ILE A 1 178 ? 84.144  -7.324  48.510  1.00 39.06  ?  178 ILE A CB    1 
ATOM   1364  C  CG1   . ILE A 1 178 ? 82.663  -7.315  48.857  1.00 37.04  ?  178 ILE A CG1   1 
ATOM   1365  C  CG2   . ILE A 1 178 ? 84.873  -8.296  49.414  1.00 38.69  ?  178 ILE A CG2   1 
ATOM   1366  C  CD1   . ILE A 1 178 ? 82.097  -8.712  49.033  1.00 38.28  ?  178 ILE A CD1   1 
ATOM   1367  N  N     . PRO A 1 179 ? 87.136  -5.647  49.020  1.00 29.71  ?  179 PRO A N     1 
ATOM   1368  C  CA    . PRO A 1 179 ? 88.487  -5.599  48.448  1.00 31.13  ?  179 PRO A CA    1 
ATOM   1369  C  C     . PRO A 1 179 ? 89.049  -7.008  48.264  1.00 29.69  ?  179 PRO A C     1 
ATOM   1370  O  O     . PRO A 1 179 ? 88.502  -7.954  48.820  1.00 31.39  ?  179 PRO A O     1 
ATOM   1371  C  CB    . PRO A 1 179 ? 89.279  -4.817  49.502  1.00 35.12  ?  179 PRO A CB    1 
ATOM   1372  C  CG    . PRO A 1 179 ? 88.581  -5.118  50.799  1.00 30.59  ?  179 PRO A CG    1 
ATOM   1373  C  CD    . PRO A 1 179 ? 87.121  -5.389  50.472  1.00 37.05  ?  179 PRO A CD    1 
ATOM   1374  N  N     . PRO A 1 180 ? 90.126  -7.153  47.485  1.00 30.85  ?  180 PRO A N     1 
ATOM   1375  C  CA    . PRO A 1 180 ? 90.738  -8.476  47.329  1.00 30.52  ?  180 PRO A CA    1 
ATOM   1376  C  C     . PRO A 1 180 ? 91.647  -8.854  48.513  1.00 31.44  ?  180 PRO A C     1 
ATOM   1377  O  O     . PRO A 1 180 ? 92.188  -7.983  49.204  1.00 29.41  ?  180 PRO A O     1 
ATOM   1378  C  CB    . PRO A 1 180 ? 91.573  -8.314  46.054  1.00 31.38  ?  180 PRO A CB    1 
ATOM   1379  C  CG    . PRO A 1 180 ? 91.962  -6.871  46.035  1.00 32.32  ?  180 PRO A CG    1 
ATOM   1380  C  CD    . PRO A 1 180 ? 90.787  -6.127  46.654  1.00 32.64  ?  180 PRO A CD    1 
ATOM   1381  N  N     . HIS A 1 181 ? 91.828  -10.153 48.731  1.00 30.72  ?  181 HIS A N     1 
ATOM   1382  C  CA    . HIS A 1 181 ? 92.711  -10.622 49.782  1.00 35.11  ?  181 HIS A CA    1 
ATOM   1383  C  C     . HIS A 1 181 ? 93.708  -11.672 49.310  1.00 41.53  ?  181 HIS A C     1 
ATOM   1384  O  O     . HIS A 1 181 ? 93.542  -12.290 48.269  1.00 47.54  ?  181 HIS A O     1 
ATOM   1385  C  CB    . HIS A 1 181 ? 91.894  -11.199 50.935  1.00 39.32  ?  181 HIS A CB    1 
ATOM   1386  C  CG    . HIS A 1 181 ? 90.898  -10.242 51.509  1.00 46.53  ?  181 HIS A CG    1 
ATOM   1387  N  ND1   . HIS A 1 181 ? 89.726  -9.916  50.865  1.00 45.94  ?  181 HIS A ND1   1 
ATOM   1388  C  CD2   . HIS A 1 181 ? 90.896  -9.550  52.672  1.00 50.85  ?  181 HIS A CD2   1 
ATOM   1389  C  CE1   . HIS A 1 181 ? 89.046  -9.059  51.604  1.00 47.64  ?  181 HIS A CE1   1 
ATOM   1390  N  NE2   . HIS A 1 181 ? 89.732  -8.822  52.706  1.00 50.59  ?  181 HIS A NE2   1 
ATOM   1391  N  N     . ASN A 1 182 ? 94.740  -11.887 50.109  1.00 40.06  ?  182 ASN A N     1 
ATOM   1392  C  CA    . ASN A 1 182 ? 95.686  -12.957 49.853  1.00 40.96  ?  182 ASN A CA    1 
ATOM   1393  C  C     . ASN A 1 182 ? 95.072  -14.367 49.908  1.00 41.61  ?  182 ASN A C     1 
ATOM   1394  O  O     . ASN A 1 182 ? 94.525  -14.772 50.924  1.00 42.15  ?  182 ASN A O     1 
ATOM   1395  C  CB    . ASN A 1 182 ? 96.820  -12.867 50.859  1.00 41.11  ?  182 ASN A CB    1 
ATOM   1396  C  CG    . ASN A 1 182 ? 98.018  -13.642 50.428  1.00 44.85  ?  182 ASN A CG    1 
ATOM   1397  O  OD1   . ASN A 1 182 ? 98.078  -14.870 50.590  1.00 49.72  ?  182 ASN A OD1   1 
ATOM   1398  N  ND2   . ASN A 1 182 ? 98.987  -12.938 49.843  1.00 42.73  ?  182 ASN A ND2   1 
ATOM   1399  N  N     . LEU A 1 183 ? 95.185  -15.116 48.815  1.00 41.89  ?  183 LEU A N     1 
ATOM   1400  C  CA    . LEU A 1 183 ? 94.643  -16.476 48.733  1.00 39.34  ?  183 LEU A CA    1 
ATOM   1401  C  C     . LEU A 1 183 ? 95.079  -17.345 49.920  1.00 38.02  ?  183 LEU A C     1 
ATOM   1402  O  O     . LEU A 1 183 ? 94.272  -18.074 50.506  1.00 37.11  ?  183 LEU A O     1 
ATOM   1403  C  CB    . LEU A 1 183 ? 95.057  -17.111 47.399  1.00 41.47  ?  183 LEU A CB    1 
ATOM   1404  C  CG    . LEU A 1 183 ? 94.466  -18.388 46.788  1.00 38.90  ?  183 LEU A CG    1 
ATOM   1405  C  CD1   . LEU A 1 183 ? 95.245  -19.607 47.210  1.00 41.67  ?  183 LEU A CD1   1 
ATOM   1406  C  CD2   . LEU A 1 183 ? 93.006  -18.550 47.134  1.00 39.80  ?  183 LEU A CD2   1 
ATOM   1407  N  N     . ALA A 1 184 ? 96.350  -17.265 50.289  1.00 39.69  ?  184 ALA A N     1 
ATOM   1408  C  CA    . ALA A 1 184 ? 96.833  -18.081 51.397  1.00 45.30  ?  184 ALA A CA    1 
ATOM   1409  C  C     . ALA A 1 184 ? 96.175  -17.707 52.744  1.00 44.01  ?  184 ALA A C     1 
ATOM   1410  O  O     . ALA A 1 184 ? 95.693  -18.573 53.473  1.00 46.23  ?  184 ALA A O     1 
ATOM   1411  C  CB    . ALA A 1 184 ? 98.339  -18.017 51.482  1.00 50.37  ?  184 ALA A CB    1 
ATOM   1412  N  N     . GLU A 1 185 ? 96.131  -16.417 53.062  1.00 38.55  ?  185 GLU A N     1 
ATOM   1413  C  CA    . GLU A 1 185 ? 95.455  -15.958 54.273  1.00 35.49  ?  185 GLU A CA    1 
ATOM   1414  C  C     . GLU A 1 185 ? 93.984  -16.389 54.322  1.00 37.24  ?  185 GLU A C     1 
ATOM   1415  O  O     . GLU A 1 185 ? 93.543  -17.001 55.281  1.00 40.73  ?  185 GLU A O     1 
ATOM   1416  C  CB    . GLU A 1 185 ? 95.606  -14.445 54.427  1.00 33.33  ?  185 GLU A CB    1 
ATOM   1417  C  CG    . GLU A 1 185 ? 97.049  -14.008 54.308  1.00 40.11  ?  185 GLU A CG    1 
ATOM   1418  C  CD    . GLU A 1 185 ? 97.243  -12.514 54.432  1.00 49.11  ?  185 GLU A CD    1 
ATOM   1419  O  OE1   . GLU A 1 185 ? 96.273  -11.753 54.204  1.00 56.59  ?  185 GLU A OE1   1 
ATOM   1420  O  OE2   . GLU A 1 185 ? 98.380  -12.099 54.746  1.00 46.71  ?  185 GLU A OE2   1 
ATOM   1421  N  N     . VAL A 1 186 ? 93.228  -16.080 53.280  1.00 39.26  ?  186 VAL A N     1 
ATOM   1422  C  CA    . VAL A 1 186 ? 91.817  -16.442 53.243  1.00 41.56  ?  186 VAL A CA    1 
ATOM   1423  C  C     . VAL A 1 186 ? 91.613  -17.918 53.539  1.00 40.20  ?  186 VAL A C     1 
ATOM   1424  O  O     . VAL A 1 186 ? 90.708  -18.290 54.280  1.00 42.18  ?  186 VAL A O     1 
ATOM   1425  C  CB    . VAL A 1 186 ? 91.166  -16.130 51.869  1.00 44.81  ?  186 VAL A CB    1 
ATOM   1426  C  CG1   . VAL A 1 186 ? 89.703  -16.558 51.871  1.00 43.58  ?  186 VAL A CG1   1 
ATOM   1427  C  CG2   . VAL A 1 186 ? 91.289  -14.652 51.539  1.00 45.32  ?  186 VAL A CG2   1 
ATOM   1428  N  N     . ILE A 1 187 ? 92.445  -18.763 52.944  1.00 35.17  ?  187 ILE A N     1 
ATOM   1429  C  CA    . ILE A 1 187 ? 92.276  -20.199 53.111  1.00 39.25  ?  187 ILE A CA    1 
ATOM   1430  C  C     . ILE A 1 187 ? 92.596  -20.632 54.541  1.00 38.30  ?  187 ILE A C     1 
ATOM   1431  O  O     . ILE A 1 187 ? 91.892  -21.456 55.135  1.00 30.03  ?  187 ILE A O     1 
ATOM   1432  C  CB    . ILE A 1 187 ? 93.109  -20.985 52.094  1.00 46.08  ?  187 ILE A CB    1 
ATOM   1433  C  CG1   . ILE A 1 187 ? 92.284  -21.212 50.832  1.00 28.07  ?  187 ILE A CG1   1 
ATOM   1434  C  CG2   . ILE A 1 187 ? 93.545  -22.326 52.675  1.00 29.25  ?  187 ILE A CG2   1 
ATOM   1435  C  CD1   . ILE A 1 187 ? 93.122  -21.439 49.619  1.00 27.83  ?  187 ILE A CD1   1 
ATOM   1436  N  N     . ASP A 1 188 ? 93.650  -20.058 55.100  1.00 36.96  ?  188 ASP A N     1 
ATOM   1437  C  CA    . ASP A 1 188 ? 93.974  -20.314 56.490  1.00 40.44  ?  188 ASP A CA    1 
ATOM   1438  C  C     . ASP A 1 188 ? 92.777  -20.066 57.431  1.00 39.84  ?  188 ASP A C     1 
ATOM   1439  O  O     . ASP A 1 188 ? 92.452  -20.908 58.263  1.00 42.62  ?  188 ASP A O     1 
ATOM   1440  C  CB    . ASP A 1 188 ? 95.209  -19.510 56.882  1.00 48.75  ?  188 ASP A CB    1 
ATOM   1441  C  CG    . ASP A 1 188 ? 96.466  -20.022 56.190  1.00 56.92  ?  188 ASP A CG    1 
ATOM   1442  O  OD1   . ASP A 1 188 ? 96.499  -21.240 55.887  1.00 61.43  ?  188 ASP A OD1   1 
ATOM   1443  O  OD2   . ASP A 1 188 ? 97.408  -19.223 55.948  1.00 57.45  ?  188 ASP A OD2   1 
ATOM   1444  N  N     . ALA A 1 189 ? 92.112  -18.930 57.273  1.00 36.48  ?  189 ALA A N     1 
ATOM   1445  C  CA    . ALA A 1 189 ? 90.895  -18.636 58.018  1.00 34.50  ?  189 ALA A CA    1 
ATOM   1446  C  C     . ALA A 1 189 ? 89.795  -19.649 57.755  1.00 38.00  ?  189 ALA A C     1 
ATOM   1447  O  O     . ALA A 1 189 ? 89.182  -20.163 58.689  1.00 42.48  ?  189 ALA A O     1 
ATOM   1448  C  CB    . ALA A 1 189 ? 90.394  -17.237 57.695  1.00 35.18  ?  189 ALA A CB    1 
ATOM   1449  N  N     . ALA A 1 190 ? 89.519  -19.921 56.487  1.00 37.57  ?  190 ALA A N     1 
ATOM   1450  C  CA    . ALA A 1 190 ? 88.481  -20.893 56.161  1.00 37.47  ?  190 ALA A CA    1 
ATOM   1451  C  C     . ALA A 1 190 ? 88.797  -22.240 56.823  1.00 39.41  ?  190 ALA A C     1 
ATOM   1452  O  O     . ALA A 1 190 ? 87.913  -22.909 57.359  1.00 45.06  ?  190 ALA A O     1 
ATOM   1453  C  CB    . ALA A 1 190 ? 88.330  -21.047 54.662  1.00 32.95  ?  190 ALA A CB    1 
ATOM   1454  N  N     . VAL A 1 191 ? 90.060  -22.636 56.792  1.00 35.88  ?  191 VAL A N     1 
ATOM   1455  C  CA    . VAL A 1 191 ? 90.444  -23.881 57.426  1.00 38.23  ?  191 VAL A CA    1 
ATOM   1456  C  C     . VAL A 1 191 ? 90.218  -23.792 58.937  1.00 43.87  ?  191 VAL A C     1 
ATOM   1457  O  O     . VAL A 1 191 ? 89.713  -24.735 59.558  1.00 50.32  ?  191 VAL A O     1 
ATOM   1458  C  CB    . VAL A 1 191 ? 91.900  -24.269 57.086  1.00 31.45  ?  191 VAL A CB    1 
ATOM   1459  C  CG1   . VAL A 1 191 ? 92.405  -25.370 58.002  1.00 32.33  ?  191 VAL A CG1   1 
ATOM   1460  C  CG2   . VAL A 1 191 ? 91.984  -24.703 55.647  1.00 30.68  ?  191 VAL A CG2   1 
ATOM   1461  N  N     . TYR A 1 192 ? 90.561  -22.652 59.527  1.00 46.28  ?  192 TYR A N     1 
ATOM   1462  C  CA    . TYR A 1 192 ? 90.406  -22.515 60.971  1.00 46.55  ?  192 TYR A CA    1 
ATOM   1463  C  C     . TYR A 1 192 ? 88.935  -22.567 61.347  1.00 46.75  ?  192 TYR A C     1 
ATOM   1464  O  O     . TYR A 1 192 ? 88.567  -23.131 62.367  1.00 49.24  ?  192 TYR A O     1 
ATOM   1465  C  CB    . TYR A 1 192 ? 91.050  -21.228 61.504  1.00 45.75  ?  192 TYR A CB    1 
ATOM   1466  C  CG    . TYR A 1 192 ? 90.913  -21.089 62.997  1.00 35.22  ?  192 TYR A CG    1 
ATOM   1467  C  CD1   . TYR A 1 192 ? 89.853  -20.378 63.555  1.00 42.73  ?  192 TYR A CD1   1 
ATOM   1468  C  CD2   . TYR A 1 192 ? 91.821  -21.691 63.852  1.00 36.18  ?  192 TYR A CD2   1 
ATOM   1469  C  CE1   . TYR A 1 192 ? 89.713  -20.258 64.926  1.00 43.12  ?  192 TYR A CE1   1 
ATOM   1470  C  CE2   . TYR A 1 192 ? 91.687  -21.583 65.235  1.00 43.09  ?  192 TYR A CE2   1 
ATOM   1471  C  CZ    . TYR A 1 192 ? 90.634  -20.862 65.766  1.00 43.56  ?  192 TYR A CZ    1 
ATOM   1472  O  OH    . TYR A 1 192 ? 90.501  -20.748 67.136  1.00 44.47  ?  192 TYR A OH    1 
ATOM   1473  N  N     . MET A 1 193 ? 88.095  -21.985 60.508  1.00 42.66  ?  193 MET A N     1 
ATOM   1474  C  CA    . MET A 1 193 ? 86.668  -21.964 60.778  1.00 41.73  ?  193 MET A CA    1 
ATOM   1475  C  C     . MET A 1 193 ? 86.012  -23.330 60.547  1.00 42.51  ?  193 MET A C     1 
ATOM   1476  O  O     . MET A 1 193 ? 85.013  -23.670 61.174  1.00 47.46  ?  193 MET A O     1 
ATOM   1477  C  CB    . MET A 1 193 ? 85.986  -20.888 59.931  1.00 39.05  ?  193 MET A CB    1 
ATOM   1478  C  CG    . MET A 1 193 ? 84.783  -20.304 60.613  1.00 35.62  ?  193 MET A CG    1 
ATOM   1479  S  SD    . MET A 1 193 ? 84.132  -18.875 59.803  1.00 58.83  ?  193 MET A SD    1 
ATOM   1480  C  CE    . MET A 1 193 ? 82.537  -19.539 59.339  1.00 54.29  ?  193 MET A CE    1 
ATOM   1481  N  N     . ILE A 1 194 ? 86.559  -24.110 59.629  1.00 38.47  ?  194 ILE A N     1 
ATOM   1482  C  CA    . ILE A 1 194 ? 86.049  -25.451 59.448  1.00 39.23  ?  194 ILE A CA    1 
ATOM   1483  C  C     . ILE A 1 194 ? 86.140  -26.160 60.792  1.00 43.97  ?  194 ILE A C     1 
ATOM   1484  O  O     . ILE A 1 194 ? 85.191  -26.831 61.212  1.00 49.14  ?  194 ILE A O     1 
ATOM   1485  C  CB    . ILE A 1 194 ? 86.828  -26.224 58.357  1.00 37.46  ?  194 ILE A CB    1 
ATOM   1486  C  CG1   . ILE A 1 194 ? 86.508  -25.645 56.988  1.00 30.95  ?  194 ILE A CG1   1 
ATOM   1487  C  CG2   . ILE A 1 194 ? 86.486  -27.722 58.359  1.00 32.24  ?  194 ILE A CG2   1 
ATOM   1488  C  CD1   . ILE A 1 194 ? 87.369  -26.241 55.919  1.00 42.52  ?  194 ILE A CD1   1 
ATOM   1489  N  N     . ASP A 1 195 ? 87.278  -25.979 61.464  1.00 43.30  ?  195 ASP A N     1 
ATOM   1490  C  CA    . ASP A 1 195 ? 87.573  -26.649 62.731  1.00 45.57  ?  195 ASP A CA    1 
ATOM   1491  C  C     . ASP A 1 195 ? 86.790  -26.019 63.868  1.00 49.50  ?  195 ASP A C     1 
ATOM   1492  O  O     . ASP A 1 195 ? 86.242  -26.716 64.713  1.00 56.61  ?  195 ASP A O     1 
ATOM   1493  C  CB    . ASP A 1 195 ? 89.079  -26.600 63.052  1.00 51.54  ?  195 ASP A CB    1 
ATOM   1494  C  CG    . ASP A 1 195 ? 89.886  -27.686 62.314  1.00 59.71  ?  195 ASP A CG    1 
ATOM   1495  O  OD1   . ASP A 1 195 ? 89.341  -28.793 62.111  1.00 66.01  ?  195 ASP A OD1   1 
ATOM   1496  O  OD2   . ASP A 1 195 ? 91.061  -27.436 61.935  1.00 58.75  ?  195 ASP A OD2   1 
ATOM   1497  N  N     . HIS A 1 196 ? 86.734  -24.694 63.872  1.00 49.97  ?  196 HIS A N     1 
ATOM   1498  C  CA    . HIS A 1 196 ? 86.106  -23.947 64.947  1.00 49.28  ?  196 HIS A CA    1 
ATOM   1499  C  C     . HIS A 1 196 ? 84.984  -23.069 64.410  1.00 42.39  ?  196 HIS A C     1 
ATOM   1500  O  O     . HIS A 1 196 ? 85.166  -21.868 64.245  1.00 42.88  ?  196 HIS A O     1 
ATOM   1501  C  CB    . HIS A 1 196 ? 87.151  -23.083 65.658  1.00 48.04  ?  196 HIS A CB    1 
ATOM   1502  C  CG    . HIS A 1 196 ? 88.368  -23.838 66.090  1.00 47.72  ?  196 HIS A CG    1 
ATOM   1503  N  ND1   . HIS A 1 196 ? 89.507  -23.924 65.320  1.00 49.80  ?  196 HIS A ND1   1 
ATOM   1504  C  CD2   . HIS A 1 196 ? 88.626  -24.543 67.217  1.00 48.03  ?  196 HIS A CD2   1 
ATOM   1505  C  CE1   . HIS A 1 196 ? 90.416  -24.645 65.953  1.00 48.03  ?  196 HIS A CE1   1 
ATOM   1506  N  NE2   . HIS A 1 196 ? 89.908  -25.031 67.104  1.00 46.85  ?  196 HIS A NE2   1 
ATOM   1507  N  N     . PRO A 1 197 ? 83.815  -23.666 64.149  1.00 39.50  ?  197 PRO A N     1 
ATOM   1508  C  CA    . PRO A 1 197 ? 82.668  -22.985 63.537  1.00 35.98  ?  197 PRO A CA    1 
ATOM   1509  C  C     . PRO A 1 197 ? 82.339  -21.657 64.199  1.00 52.26  ?  197 PRO A C     1 
ATOM   1510  O  O     . PRO A 1 197 ? 81.890  -20.717 63.545  1.00 50.36  ?  197 PRO A O     1 
ATOM   1511  C  CB    . PRO A 1 197 ? 81.524  -23.973 63.754  1.00 35.88  ?  197 PRO A CB    1 
ATOM   1512  C  CG    . PRO A 1 197 ? 82.175  -25.279 63.798  1.00 36.02  ?  197 PRO A CG    1 
ATOM   1513  C  CD    . PRO A 1 197 ? 83.547  -25.091 64.380  1.00 40.96  ?  197 PRO A CD    1 
ATOM   1514  N  N     . THR A 1 198 ? 82.594  -21.586 65.494  1.00 55.28  ?  198 THR A N     1 
ATOM   1515  C  CA    . THR A 1 198 ? 82.201  -20.453 66.320  1.00 54.69  ?  198 THR A CA    1 
ATOM   1516  C  C     . THR A 1 198 ? 83.305  -19.421 66.475  1.00 55.57  ?  198 THR A C     1 
ATOM   1517  O  O     . THR A 1 198 ? 83.300  -18.652 67.433  1.00 55.34  ?  198 THR A O     1 
ATOM   1518  C  CB    . THR A 1 198 ? 81.887  -20.948 67.713  1.00 55.10  ?  198 THR A CB    1 
ATOM   1519  O  OG1   . THR A 1 198 ? 82.856  -21.953 68.070  1.00 57.89  ?  198 THR A OG1   1 
ATOM   1520  C  CG2   . THR A 1 198 ? 80.502  -21.551 67.733  1.00 55.42  ?  198 THR A CG2   1 
ATOM   1521  N  N     . ALA A 1 199 ? 84.259  -19.418 65.553  1.00 55.79  ?  199 ALA A N     1 
ATOM   1522  C  CA    . ALA A 1 199 ? 85.417  -18.548 65.673  1.00 56.94  ?  199 ALA A CA    1 
ATOM   1523  C  C     . ALA A 1 199 ? 85.015  -17.074 65.725  1.00 60.17  ?  199 ALA A C     1 
ATOM   1524  O  O     . ALA A 1 199 ? 84.134  -16.631 64.981  1.00 62.47  ?  199 ALA A O     1 
ATOM   1525  C  CB    . ALA A 1 199 ? 86.377  -18.802 64.528  1.00 56.20  ?  199 ALA A CB    1 
ATOM   1526  N  N     . LYS A 1 200 ? 85.667  -16.319 66.604  1.00 59.80  ?  200 LYS A N     1 
ATOM   1527  C  CA    . LYS A 1 200 ? 85.407  -14.888 66.731  1.00 60.79  ?  200 LYS A CA    1 
ATOM   1528  C  C     . LYS A 1 200 ? 86.297  -14.083 65.755  1.00 61.40  ?  200 LYS A C     1 
ATOM   1529  O  O     . LYS A 1 200 ? 87.399  -14.529 65.411  1.00 60.09  ?  200 LYS A O     1 
ATOM   1530  C  CB    . LYS A 1 200 ? 85.624  -14.450 68.188  1.00 60.42  ?  200 LYS A CB    1 
ATOM   1531  N  N     . ILE A 1 201 ? 85.829  -12.908 65.315  1.00 61.48  ?  201 ILE A N     1 
ATOM   1532  C  CA    . ILE A 1 201 ? 86.586  -12.097 64.342  1.00 57.25  ?  201 ILE A CA    1 
ATOM   1533  C  C     . ILE A 1 201 ? 88.034  -11.889 64.754  1.00 58.06  ?  201 ILE A C     1 
ATOM   1534  O  O     . ILE A 1 201 ? 88.932  -11.901 63.906  1.00 59.27  ?  201 ILE A O     1 
ATOM   1535  C  CB    . ILE A 1 201 ? 85.956  -10.705 64.059  1.00 59.23  ?  201 ILE A CB    1 
ATOM   1536  C  CG1   . ILE A 1 201 ? 84.737  -10.824 63.142  1.00 58.73  ?  201 ILE A CG1   1 
ATOM   1537  C  CG2   . ILE A 1 201 ? 86.960  -9.796  63.377  1.00 36.35  ?  201 ILE A CG2   1 
ATOM   1538  C  CD1   . ILE A 1 201 ? 83.483  -11.335 63.838  1.00 59.82  ?  201 ILE A CD1   1 
ATOM   1539  N  N     . ASP A 1 202 ? 88.252  -11.703 66.056  1.00 59.10  ?  202 ASP A N     1 
ATOM   1540  C  CA    . ASP A 1 202 ? 89.578  -11.395 66.593  1.00 61.28  ?  202 ASP A CA    1 
ATOM   1541  C  C     . ASP A 1 202 ? 90.591  -12.480 66.271  1.00 61.59  ?  202 ASP A C     1 
ATOM   1542  O  O     . ASP A 1 202 ? 91.734  -12.194 65.904  1.00 62.13  ?  202 ASP A O     1 
ATOM   1543  C  CB    . ASP A 1 202 ? 89.508  -11.174 68.102  1.00 68.92  ?  202 ASP A CB    1 
ATOM   1544  C  CG    . ASP A 1 202 ? 89.357  -9.706  68.468  1.00 81.34  ?  202 ASP A CG    1 
ATOM   1545  O  OD1   . ASP A 1 202 ? 89.721  -8.845  67.629  1.00 83.45  ?  202 ASP A OD1   1 
ATOM   1546  O  OD2   . ASP A 1 202 ? 88.883  -9.413  69.594  1.00 87.16  ?  202 ASP A OD2   1 
ATOM   1547  N  N     . LYS A 1 203 ? 90.151  -13.725 66.409  1.00 60.11  ?  203 LYS A N     1 
ATOM   1548  C  CA    . LYS A 1 203 ? 90.980  -14.896 66.161  1.00 54.22  ?  203 LYS A CA    1 
ATOM   1549  C  C     . LYS A 1 203 ? 91.188  -15.090 64.651  1.00 54.61  ?  203 LYS A C     1 
ATOM   1550  O  O     . LYS A 1 203 ? 92.312  -15.296 64.193  1.00 59.78  ?  203 LYS A O     1 
ATOM   1551  C  CB    . LYS A 1 203 ? 90.318  -16.127 66.805  1.00 50.65  ?  203 LYS A CB    1 
ATOM   1552  C  CG    . LYS A 1 203 ? 91.069  -17.437 66.666  1.00 46.78  ?  203 LYS A CG    1 
ATOM   1553  C  CD    . LYS A 1 203 ? 92.485  -17.341 67.191  1.00 50.68  ?  203 LYS A CD    1 
ATOM   1554  C  CE    . LYS A 1 203 ? 93.161  -18.698 67.079  1.00 60.74  ?  203 LYS A CE    1 
ATOM   1555  N  NZ    . LYS A 1 203 ? 94.617  -18.663 67.397  1.00 69.33  ?  203 LYS A NZ    1 
ATOM   1556  N  N     . LEU A 1 204 ? 90.103  -15.011 63.883  1.00 50.17  ?  204 LEU A N     1 
ATOM   1557  C  CA    . LEU A 1 204 ? 90.184  -15.126 62.435  1.00 43.38  ?  204 LEU A CA    1 
ATOM   1558  C  C     . LEU A 1 204 ? 91.211  -14.154 61.870  1.00 45.46  ?  204 LEU A C     1 
ATOM   1559  O  O     . LEU A 1 204 ? 91.934  -14.493 60.924  1.00 47.82  ?  204 LEU A O     1 
ATOM   1560  C  CB    . LEU A 1 204 ? 88.825  -14.878 61.783  1.00 36.09  ?  204 LEU A CB    1 
ATOM   1561  C  CG    . LEU A 1 204 ? 87.690  -15.824 62.169  1.00 36.25  ?  204 LEU A CG    1 
ATOM   1562  C  CD1   . LEU A 1 204 ? 86.386  -15.250 61.708  1.00 39.81  ?  204 LEU A CD1   1 
ATOM   1563  C  CD2   . LEU A 1 204 ? 87.862  -17.209 61.594  1.00 33.70  ?  204 LEU A CD2   1 
ATOM   1564  N  N     . MET A 1 205 ? 91.283  -12.953 62.446  1.00 42.92  ?  205 MET A N     1 
ATOM   1565  C  CA    . MET A 1 205 ? 92.226  -11.945 61.951  1.00 40.91  ?  205 MET A CA    1 
ATOM   1566  C  C     . MET A 1 205 ? 93.688  -12.261 62.223  1.00 43.65  ?  205 MET A C     1 
ATOM   1567  O  O     . MET A 1 205 ? 94.568  -11.545 61.750  1.00 45.86  ?  205 MET A O     1 
ATOM   1568  C  CB    . MET A 1 205 ? 91.883  -10.540 62.445  1.00 38.89  ?  205 MET A CB    1 
ATOM   1569  C  CG    . MET A 1 205 ? 90.728  -9.933  61.697  1.00 35.39  ?  205 MET A CG    1 
ATOM   1570  S  SD    . MET A 1 205 ? 90.254  -8.299  62.246  1.00 58.30  ?  205 MET A SD    1 
ATOM   1571  C  CE    . MET A 1 205 ? 91.788  -7.411  61.993  1.00 36.62  ?  205 MET A CE    1 
ATOM   1572  N  N     . GLU A 1 206 ? 93.948  -13.315 62.991  1.00 41.87  ?  206 GLU A N     1 
ATOM   1573  C  CA    . GLU A 1 206 ? 95.319  -13.766 63.195  1.00 47.23  ?  206 GLU A CA    1 
ATOM   1574  C  C     . GLU A 1 206 ? 95.788  -14.428 61.907  1.00 48.24  ?  206 GLU A C     1 
ATOM   1575  O  O     . GLU A 1 206 ? 96.987  -14.614 61.674  1.00 51.67  ?  206 GLU A O     1 
ATOM   1576  C  CB    . GLU A 1 206 ? 95.417  -14.756 64.360  1.00 54.78  ?  206 GLU A CB    1 
ATOM   1577  C  CG    . GLU A 1 206 ? 95.318  -14.142 65.748  1.00 64.16  ?  206 GLU A CG    1 
ATOM   1578  C  CD    . GLU A 1 206 ? 95.574  -15.153 66.866  1.00 67.89  ?  206 GLU A CD    1 
ATOM   1579  O  OE1   . GLU A 1 206 ? 95.922  -16.314 66.548  1.00 70.01  ?  206 GLU A OE1   1 
ATOM   1580  O  OE2   . GLU A 1 206 ? 95.431  -14.782 68.056  1.00 68.09  ?  206 GLU A OE2   1 
ATOM   1581  N  N     . PHE A 1 207 ? 94.820  -14.781 61.069  1.00 46.78  ?  207 PHE A N     1 
ATOM   1582  C  CA    . PHE A 1 207 ? 95.096  -15.499 59.839  1.00 47.86  ?  207 PHE A CA    1 
ATOM   1583  C  C     . PHE A 1 207 ? 94.841  -14.618 58.633  1.00 50.07  ?  207 PHE A C     1 
ATOM   1584  O  O     . PHE A 1 207 ? 95.530  -14.737 57.623  1.00 51.63  ?  207 PHE A O     1 
ATOM   1585  C  CB    . PHE A 1 207 ? 94.177  -16.702 59.724  1.00 44.77  ?  207 PHE A CB    1 
ATOM   1586  C  CG    . PHE A 1 207 ? 94.288  -17.667 60.852  1.00 42.10  ?  207 PHE A CG    1 
ATOM   1587  C  CD1   . PHE A 1 207 ? 93.326  -17.702 61.848  1.00 41.70  ?  207 PHE A CD1   1 
ATOM   1588  C  CD2   . PHE A 1 207 ? 95.332  -18.567 60.905  1.00 38.06  ?  207 PHE A CD2   1 
ATOM   1589  C  CE1   . PHE A 1 207 ? 93.409  -18.611 62.885  1.00 39.15  ?  207 PHE A CE1   1 
ATOM   1590  C  CE2   . PHE A 1 207 ? 95.415  -19.475 61.930  1.00 37.46  ?  207 PHE A CE2   1 
ATOM   1591  C  CZ    . PHE A 1 207 ? 94.445  -19.498 62.920  1.00 38.23  ?  207 PHE A CZ    1 
ATOM   1592  N  N     . LEU A 1 208 ? 93.816  -13.771 58.758  1.00 45.74  ?  208 LEU A N     1 
ATOM   1593  C  CA    . LEU A 1 208 ? 93.308  -12.902 57.699  1.00 39.21  ?  208 LEU A CA    1 
ATOM   1594  C  C     . LEU A 1 208 ? 93.305  -11.490 58.239  1.00 41.12  ?  208 LEU A C     1 
ATOM   1595  O  O     . LEU A 1 208 ? 92.260  -10.969 58.633  1.00 39.59  ?  208 LEU A O     1 
ATOM   1596  C  CB    . LEU A 1 208 ? 91.874  -13.289 57.356  1.00 35.46  ?  208 LEU A CB    1 
ATOM   1597  C  CG    . LEU A 1 208 ? 91.399  -13.133 55.910  1.00 36.72  ?  208 LEU A CG    1 
ATOM   1598  C  CD1   . LEU A 1 208 ? 90.043  -12.462 55.848  1.00 35.91  ?  208 LEU A CD1   1 
ATOM   1599  C  CD2   . LEU A 1 208 ? 92.408  -12.365 55.103  1.00 42.17  ?  208 LEU A CD2   1 
ATOM   1600  N  N     . PRO A 1 209 ? 94.487  -10.873 58.284  1.00 44.15  ?  209 PRO A N     1 
ATOM   1601  C  CA    . PRO A 1 209 ? 94.745  -9.595  58.950  1.00 43.34  ?  209 PRO A CA    1 
ATOM   1602  C  C     . PRO A 1 209 ? 94.234  -8.392  58.176  1.00 45.49  ?  209 PRO A C     1 
ATOM   1603  O  O     . PRO A 1 209 ? 94.191  -7.291  58.717  1.00 50.06  ?  209 PRO A O     1 
ATOM   1604  C  CB    . PRO A 1 209 ? 96.265  -9.556  59.017  1.00 42.80  ?  209 PRO A CB    1 
ATOM   1605  C  CG    . PRO A 1 209 ? 96.701  -10.383 57.865  1.00 45.08  ?  209 PRO A CG    1 
ATOM   1606  C  CD    . PRO A 1 209 ? 95.718  -11.487 57.767  1.00 33.57  ?  209 PRO A CD    1 
ATOM   1607  N  N     . GLY A 1 210 ? 93.859  -8.587  56.921  1.00 43.61  ?  210 GLY A N     1 
ATOM   1608  C  CA    . GLY A 1 210 ? 93.323  -7.489  56.146  1.00 43.57  ?  210 GLY A CA    1 
ATOM   1609  C  C     . GLY A 1 210 ? 93.450  -7.735  54.665  1.00 44.17  ?  210 GLY A C     1 
ATOM   1610  O  O     . GLY A 1 210 ? 94.049  -8.730  54.244  1.00 45.32  ?  210 GLY A O     1 
ATOM   1611  N  N     . PRO A 1 211 ? 92.905  -6.814  53.861  1.00 40.57  ?  211 PRO A N     1 
ATOM   1612  C  CA    . PRO A 1 211 ? 92.868  -6.956  52.408  1.00 38.12  ?  211 PRO A CA    1 
ATOM   1613  C  C     . PRO A 1 211 ? 94.283  -6.965  51.859  1.00 41.86  ?  211 PRO A C     1 
ATOM   1614  O  O     . PRO A 1 211 ? 95.193  -6.520  52.542  1.00 45.09  ?  211 PRO A O     1 
ATOM   1615  C  CB    . PRO A 1 211 ? 92.133  -5.684  51.951  1.00 36.52  ?  211 PRO A CB    1 
ATOM   1616  C  CG    . PRO A 1 211 ? 91.505  -5.098  53.176  1.00 37.26  ?  211 PRO A CG    1 
ATOM   1617  C  CD    . PRO A 1 211 ? 92.414  -5.496  54.290  1.00 41.88  ?  211 PRO A CD    1 
ATOM   1618  N  N     . ASP A 1 212 ? 94.465  -7.473  50.646  1.00 42.20  ?  212 ASP A N     1 
ATOM   1619  C  CA    . ASP A 1 212 ? 95.766  -7.463  49.992  1.00 38.80  ?  212 ASP A CA    1 
ATOM   1620  C  C     . ASP A 1 212 ? 95.513  -7.070  48.556  1.00 37.43  ?  212 ASP A C     1 
ATOM   1621  O  O     . ASP A 1 212 ? 95.104  -7.884  47.740  1.00 35.51  ?  212 ASP A O     1 
ATOM   1622  C  CB    . ASP A 1 212 ? 96.422  -8.842  50.050  1.00 44.97  ?  212 ASP A CB    1 
ATOM   1623  C  CG    . ASP A 1 212 ? 97.844  -8.836  49.537  1.00 51.73  ?  212 ASP A CG    1 
ATOM   1624  O  OD1   . ASP A 1 212 ? 98.513  -7.791  49.663  1.00 54.08  ?  212 ASP A OD1   1 
ATOM   1625  O  OD2   . ASP A 1 212 ? 98.296  -9.879  49.014  1.00 56.06  ?  212 ASP A OD2   1 
ATOM   1626  N  N     . PHE A 1 213 ? 95.728  -5.798  48.266  1.00 40.37  ?  213 PHE A N     1 
ATOM   1627  C  CA    . PHE A 1 213 ? 95.584  -5.287  46.921  1.00 38.64  ?  213 PHE A CA    1 
ATOM   1628  C  C     . PHE A 1 213 ? 96.677  -5.847  46.017  1.00 38.62  ?  213 PHE A C     1 
ATOM   1629  O  O     . PHE A 1 213 ? 97.815  -6.051  46.448  1.00 34.16  ?  213 PHE A O     1 
ATOM   1630  C  CB    . PHE A 1 213 ? 95.631  -3.767  46.954  1.00 35.81  ?  213 PHE A CB    1 
ATOM   1631  C  CG    . PHE A 1 213 ? 94.530  -3.156  47.757  1.00 31.53  ?  213 PHE A CG    1 
ATOM   1632  C  CD1   . PHE A 1 213 ? 93.216  -3.495  47.515  1.00 38.07  ?  213 PHE A CD1   1 
ATOM   1633  C  CD2   . PHE A 1 213 ? 94.806  -2.254  48.760  1.00 42.11  ?  213 PHE A CD2   1 
ATOM   1634  C  CE1   . PHE A 1 213 ? 92.190  -2.935  48.243  1.00 38.22  ?  213 PHE A CE1   1 
ATOM   1635  C  CE2   . PHE A 1 213 ? 93.780  -1.688  49.501  1.00 42.28  ?  213 PHE A CE2   1 
ATOM   1636  C  CZ    . PHE A 1 213 ? 92.470  -2.029  49.242  1.00 32.03  ?  213 PHE A CZ    1 
ATOM   1637  N  N     . PRO A 1 214 ? 96.325  -6.131  44.756  1.00 38.21  ?  214 PRO A N     1 
ATOM   1638  C  CA    . PRO A 1 214 ? 97.313  -6.584  43.777  1.00 37.10  ?  214 PRO A CA    1 
ATOM   1639  C  C     . PRO A 1 214 ? 98.276  -5.451  43.433  1.00 37.23  ?  214 PRO A C     1 
ATOM   1640  O  O     . PRO A 1 214 ? 99.372  -5.696  42.946  1.00 38.89  ?  214 PRO A O     1 
ATOM   1641  C  CB    . PRO A 1 214 ? 96.452  -6.959  42.577  1.00 36.74  ?  214 PRO A CB    1 
ATOM   1642  C  CG    . PRO A 1 214 ? 95.254  -6.117  42.709  1.00 37.73  ?  214 PRO A CG    1 
ATOM   1643  C  CD    . PRO A 1 214 ? 94.977  -6.059  44.177  1.00 37.82  ?  214 PRO A CD    1 
ATOM   1644  N  N     . THR A 1 215 ? 97.869  -4.221  43.717  1.00 40.30  ?  215 THR A N     1 
ATOM   1645  C  CA    . THR A 1 215 ? 98.708  -3.049  43.492  1.00 43.79  ?  215 THR A CA    1 
ATOM   1646  C  C     . THR A 1 215 ? 99.498  -2.658  44.737  1.00 39.38  ?  215 THR A C     1 
ATOM   1647  O  O     . THR A 1 215 ? 100.035 -1.549  44.821  1.00 38.76  ?  215 THR A O     1 
ATOM   1648  C  CB    . THR A 1 215 ? 97.859  -1.831  43.068  1.00 49.32  ?  215 THR A CB    1 
ATOM   1649  O  OG1   . THR A 1 215 ? 96.670  -1.776  43.867  1.00 32.08  ?  215 THR A OG1   1 
ATOM   1650  C  CG2   . THR A 1 215 ? 97.472  -1.923  41.602  1.00 51.16  ?  215 THR A CG2   1 
ATOM   1651  N  N     . GLY A 1 216 ? 99.551  -3.564  45.706  1.00 32.71  ?  216 GLY A N     1 
ATOM   1652  C  CA    . GLY A 1 216 ? 100.257 -3.315  46.950  1.00 39.92  ?  216 GLY A CA    1 
ATOM   1653  C  C     . GLY A 1 216 ? 99.879  -2.042  47.694  1.00 38.62  ?  216 GLY A C     1 
ATOM   1654  O  O     . GLY A 1 216 ? 98.706  -1.733  47.902  1.00 37.58  ?  216 GLY A O     1 
ATOM   1655  N  N     . ALA A 1 217 ? 100.896 -1.303  48.113  1.00 41.07  ?  217 ALA A N     1 
ATOM   1656  C  CA    . ALA A 1 217 ? 100.694 -0.076  48.872  1.00 44.36  ?  217 ALA A CA    1 
ATOM   1657  C  C     . ALA A 1 217 ? 100.518 -0.324  50.378  1.00 49.83  ?  217 ALA A C     1 
ATOM   1658  O  O     . ALA A 1 217 ? 100.700 -1.442  50.870  1.00 54.21  ?  217 ALA A O     1 
ATOM   1659  C  CB    . ALA A 1 217 ? 99.527  0.704   48.323  1.00 38.55  ?  217 ALA A CB    1 
ATOM   1660  N  N     . ILE A 1 218 ? 100.169 0.738   51.096  1.00 48.40  ?  218 ILE A N     1 
ATOM   1661  C  CA    . ILE A 1 218 ? 99.994  0.677   52.535  1.00 48.53  ?  218 ILE A CA    1 
ATOM   1662  C  C     . ILE A 1 218 ? 98.528  0.827   52.962  1.00 46.73  ?  218 ILE A C     1 
ATOM   1663  O  O     . ILE A 1 218 ? 97.870  1.807   52.623  1.00 47.27  ?  218 ILE A O     1 
ATOM   1664  C  CB    . ILE A 1 218 ? 100.809 1.781   53.204  1.00 38.87  ?  218 ILE A CB    1 
ATOM   1665  C  CG1   . ILE A 1 218 ? 102.295 1.466   53.102  1.00 39.46  ?  218 ILE A CG1   1 
ATOM   1666  C  CG2   . ILE A 1 218 ? 100.398 1.930   54.630  1.00 51.95  ?  218 ILE A CG2   1 
ATOM   1667  C  CD1   . ILE A 1 218 ? 103.091 2.593   52.522  1.00 43.13  ?  218 ILE A CD1   1 
ATOM   1668  N  N     . ILE A 1 219 ? 98.027  -0.152  53.710  1.00 43.12  ?  219 ILE A N     1 
ATOM   1669  C  CA    . ILE A 1 219 ? 96.693  -0.071  54.280  1.00 45.09  ?  219 ILE A CA    1 
ATOM   1670  C  C     . ILE A 1 219 ? 96.754  0.253   55.774  1.00 48.52  ?  219 ILE A C     1 
ATOM   1671  O  O     . ILE A 1 219 ? 97.233  -0.556  56.562  1.00 51.45  ?  219 ILE A O     1 
ATOM   1672  C  CB    . ILE A 1 219 ? 95.935  -1.391  54.129  1.00 44.72  ?  219 ILE A CB    1 
ATOM   1673  C  CG1   . ILE A 1 219 ? 96.015  -1.905  52.693  1.00 46.23  ?  219 ILE A CG1   1 
ATOM   1674  C  CG2   . ILE A 1 219 ? 94.480  -1.222  54.568  1.00 43.32  ?  219 ILE A CG2   1 
ATOM   1675  C  CD1   . ILE A 1 219 ? 95.147  -3.131  52.436  1.00 33.41  ?  219 ILE A CD1   1 
ATOM   1676  N  N     . GLN A 1 220 ? 96.253  1.429   56.151  1.00 47.49  ?  220 GLN A N     1 
ATOM   1677  C  CA    . GLN A 1 220 ? 96.215  1.870   57.543  1.00 50.50  ?  220 GLN A CA    1 
ATOM   1678  C  C     . GLN A 1 220 ? 94.815  1.783   58.138  1.00 49.78  ?  220 GLN A C     1 
ATOM   1679  O  O     . GLN A 1 220 ? 93.846  2.250   57.533  1.00 46.23  ?  220 GLN A O     1 
ATOM   1680  C  CB    . GLN A 1 220 ? 96.697  3.311   57.657  1.00 55.95  ?  220 GLN A CB    1 
ATOM   1681  C  CG    . GLN A 1 220 ? 98.163  3.500   57.370  1.00 61.30  ?  220 GLN A CG    1 
ATOM   1682  C  CD    . GLN A 1 220 ? 98.521  4.958   57.140  1.00 67.37  ?  220 GLN A CD    1 
ATOM   1683  O  OE1   . GLN A 1 220 ? 97.641  5.817   57.011  1.00 66.67  ?  220 GLN A OE1   1 
ATOM   1684  N  NE2   . GLN A 1 220 ? 99.820  5.246   57.087  1.00 71.59  ?  220 GLN A NE2   1 
ATOM   1685  N  N     . GLY A 1 221 ? 94.714  1.187   59.325  1.00 51.44  ?  221 GLY A N     1 
ATOM   1686  C  CA    . GLY A 1 221 ? 93.460  1.159   60.055  1.00 51.84  ?  221 GLY A CA    1 
ATOM   1687  C  C     . GLY A 1 221 ? 93.002  -0.162  60.639  1.00 52.26  ?  221 GLY A C     1 
ATOM   1688  O  O     . GLY A 1 221 ? 91.857  -0.544  60.440  1.00 54.22  ?  221 GLY A O     1 
ATOM   1689  N  N     . ARG A 1 222 ? 93.863  -0.845  61.387  1.00 52.61  ?  222 ARG A N     1 
ATOM   1690  C  CA    . ARG A 1 222 ? 93.463  -2.099  62.030  1.00 49.63  ?  222 ARG A CA    1 
ATOM   1691  C  C     . ARG A 1 222 ? 92.073  -1.999  62.681  1.00 51.25  ?  222 ARG A C     1 
ATOM   1692  O  O     . ARG A 1 222 ? 91.248  -2.896  62.523  1.00 46.10  ?  222 ARG A O     1 
ATOM   1693  C  CB    . ARG A 1 222 ? 94.518  -2.589  63.036  1.00 44.37  ?  222 ARG A CB    1 
ATOM   1694  N  N     . ASP A 1 223 ? 91.795  -0.905  63.385  1.00 55.54  ?  223 ASP A N     1 
ATOM   1695  C  CA    . ASP A 1 223 ? 90.498  -0.779  64.055  1.00 54.87  ?  223 ASP A CA    1 
ATOM   1696  C  C     . ASP A 1 223 ? 89.332  -0.888  63.071  1.00 53.85  ?  223 ASP A C     1 
ATOM   1697  O  O     . ASP A 1 223 ? 88.350  -1.581  63.340  1.00 53.85  ?  223 ASP A O     1 
ATOM   1698  C  CB    . ASP A 1 223 ? 90.402  0.517   64.861  1.00 56.25  ?  223 ASP A CB    1 
ATOM   1699  N  N     . GLU A 1 224 ? 89.452  -0.215  61.926  1.00 55.10  ?  224 GLU A N     1 
ATOM   1700  C  CA    . GLU A 1 224 ? 88.388  -0.208  60.916  1.00 54.53  ?  224 GLU A CA    1 
ATOM   1701  C  C     . GLU A 1 224 ? 88.330  -1.488  60.074  1.00 48.06  ?  224 GLU A C     1 
ATOM   1702  O  O     . GLU A 1 224 ? 87.249  -1.932  59.671  1.00 44.38  ?  224 GLU A O     1 
ATOM   1703  C  CB    . GLU A 1 224 ? 88.505  1.028   60.025  1.00 57.68  ?  224 GLU A CB    1 
ATOM   1704  C  CG    . GLU A 1 224 ? 87.944  2.304   60.648  1.00 65.75  ?  224 GLU A CG    1 
ATOM   1705  C  CD    . GLU A 1 224 ? 86.432  2.436   60.480  1.00 70.91  ?  224 GLU A CD    1 
ATOM   1706  O  OE1   . GLU A 1 224 ? 85.898  1.936   59.465  1.00 70.79  ?  224 GLU A OE1   1 
ATOM   1707  O  OE2   . GLU A 1 224 ? 85.776  3.042   61.357  1.00 73.61  ?  224 GLU A OE2   1 
ATOM   1708  N  N     . ILE A 1 225 ? 89.489  -2.082  59.806  1.00 47.29  ?  225 ILE A N     1 
ATOM   1709  C  CA    . ILE A 1 225 ? 89.521  -3.397  59.175  1.00 45.49  ?  225 ILE A CA    1 
ATOM   1710  C  C     . ILE A 1 225 ? 88.661  -4.366  59.988  1.00 46.66  ?  225 ILE A C     1 
ATOM   1711  O  O     . ILE A 1 225 ? 87.815  -5.072  59.435  1.00 35.10  ?  225 ILE A O     1 
ATOM   1712  C  CB    . ILE A 1 225 ? 90.959  -3.933  59.020  1.00 35.69  ?  225 ILE A CB    1 
ATOM   1713  C  CG1   . ILE A 1 225 ? 91.760  -3.023  58.079  1.00 37.57  ?  225 ILE A CG1   1 
ATOM   1714  C  CG2   . ILE A 1 225 ? 90.944  -5.372  58.503  1.00 34.72  ?  225 ILE A CG2   1 
ATOM   1715  C  CD1   . ILE A 1 225 ? 93.171  -3.489  57.799  1.00 35.57  ?  225 ILE A CD1   1 
ATOM   1716  N  N     . LYS A 1 226 ? 88.869  -4.369  61.306  1.00 47.08  ?  226 LYS A N     1 
ATOM   1717  C  CA    . LYS A 1 226 ? 88.074  -5.185  62.223  1.00 47.10  ?  226 LYS A CA    1 
ATOM   1718  C  C     . LYS A 1 226 ? 86.613  -4.804  62.093  1.00 44.70  ?  226 LYS A C     1 
ATOM   1719  O  O     . LYS A 1 226 ? 85.762  -5.662  61.885  1.00 40.83  ?  226 LYS A O     1 
ATOM   1720  C  CB    . LYS A 1 226 ? 88.552  -4.991  63.673  1.00 50.26  ?  226 LYS A CB    1 
ATOM   1721  C  CG    . LYS A 1 226 ? 87.765  -5.744  64.761  1.00 38.95  ?  226 LYS A CG    1 
ATOM   1722  N  N     . LYS A 1 227 ? 86.328  -3.508  62.209  1.00 46.12  ?  227 LYS A N     1 
ATOM   1723  C  CA    . LYS A 1 227 ? 84.955  -3.020  62.140  1.00 44.39  ?  227 LYS A CA    1 
ATOM   1724  C  C     . LYS A 1 227 ? 84.309  -3.581  60.886  1.00 41.14  ?  227 LYS A C     1 
ATOM   1725  O  O     . LYS A 1 227 ? 83.173  -4.061  60.900  1.00 36.69  ?  227 LYS A O     1 
ATOM   1726  C  CB    . LYS A 1 227 ? 84.912  -1.477  62.158  1.00 38.75  ?  227 LYS A CB    1 
ATOM   1727  C  CG    . LYS A 1 227 ? 83.535  -0.871  61.817  1.00 42.60  ?  227 LYS A CG    1 
ATOM   1728  C  CD    . LYS A 1 227 ? 83.424  0.611   62.199  1.00 40.06  ?  227 LYS A CD    1 
ATOM   1729  N  N     . ALA A 1 228 ? 85.068  -3.546  59.799  1.00 42.09  ?  228 ALA A N     1 
ATOM   1730  C  CA    . ALA A 1 228 ? 84.532  -3.931  58.506  1.00 40.86  ?  228 ALA A CA    1 
ATOM   1731  C  C     . ALA A 1 228 ? 84.255  -5.428  58.457  1.00 41.13  ?  228 ALA A C     1 
ATOM   1732  O  O     . ALA A 1 228 ? 83.225  -5.856  57.942  1.00 41.40  ?  228 ALA A O     1 
ATOM   1733  C  CB    . ALA A 1 228 ? 85.472  -3.512  57.406  1.00 39.80  ?  228 ALA A CB    1 
ATOM   1734  N  N     . TYR A 1 229 ? 85.175  -6.212  59.015  1.00 34.33  ?  229 TYR A N     1 
ATOM   1735  C  CA    . TYR A 1 229 ? 85.031  -7.654  59.038  1.00 38.44  ?  229 TYR A CA    1 
ATOM   1736  C  C     . TYR A 1 229 ? 83.880  -8.074  59.944  1.00 49.25  ?  229 TYR A C     1 
ATOM   1737  O  O     . TYR A 1 229 ? 83.427  -9.222  59.883  1.00 58.42  ?  229 TYR A O     1 
ATOM   1738  C  CB    . TYR A 1 229 ? 86.334  -8.325  59.477  1.00 39.44  ?  229 TYR A CB    1 
ATOM   1739  C  CG    . TYR A 1 229 ? 87.425  -8.342  58.422  1.00 33.18  ?  229 TYR A CG    1 
ATOM   1740  C  CD1   . TYR A 1 229 ? 87.170  -7.950  57.112  1.00 41.38  ?  229 TYR A CD1   1 
ATOM   1741  C  CD2   . TYR A 1 229 ? 88.712  -8.765  58.734  1.00 43.60  ?  229 TYR A CD2   1 
ATOM   1742  C  CE1   . TYR A 1 229 ? 88.168  -7.973  56.144  1.00 39.84  ?  229 TYR A CE1   1 
ATOM   1743  C  CE2   . TYR A 1 229 ? 89.718  -8.789  57.777  1.00 42.41  ?  229 TYR A CE2   1 
ATOM   1744  C  CZ    . TYR A 1 229 ? 89.440  -8.394  56.483  1.00 42.76  ?  229 TYR A CZ    1 
ATOM   1745  O  OH    . TYR A 1 229 ? 90.438  -8.419  55.527  1.00 43.07  ?  229 TYR A OH    1 
ATOM   1746  N  N     . GLU A 1 230 ? 83.400  -7.150  60.780  1.00 52.26  ?  230 GLU A N     1 
ATOM   1747  C  CA    . GLU A 1 230 ? 82.315  -7.465  61.722  1.00 57.83  ?  230 GLU A CA    1 
ATOM   1748  C  C     . GLU A 1 230 ? 80.941  -7.124  61.170  1.00 58.64  ?  230 GLU A C     1 
ATOM   1749  O  O     . GLU A 1 230 ? 79.964  -7.812  61.457  1.00 68.16  ?  230 GLU A O     1 
ATOM   1750  C  CB    . GLU A 1 230 ? 82.486  -6.735  63.056  1.00 64.34  ?  230 GLU A CB    1 
ATOM   1751  C  CG    . GLU A 1 230 ? 83.429  -7.375  64.042  1.00 74.68  ?  230 GLU A CG    1 
ATOM   1752  C  CD    . GLU A 1 230 ? 83.757  -6.437  65.198  1.00 88.78  ?  230 GLU A CD    1 
ATOM   1753  O  OE1   . GLU A 1 230 ? 83.174  -5.328  65.239  1.00 91.96  ?  230 GLU A OE1   1 
ATOM   1754  O  OE2   . GLU A 1 230 ? 84.598  -6.800  66.058  1.00 94.72  ?  230 GLU A OE2   1 
ATOM   1755  N  N     . THR A 1 231 ? 80.873  -6.055  60.388  1.00 50.07  ?  231 THR A N     1 
ATOM   1756  C  CA    . THR A 1 231 ? 79.598  -5.516  59.945  1.00 46.42  ?  231 THR A CA    1 
ATOM   1757  C  C     . THR A 1 231 ? 79.518  -5.378  58.433  1.00 45.62  ?  231 THR A C     1 
ATOM   1758  O  O     . THR A 1 231 ? 78.453  -5.121  57.890  1.00 48.84  ?  231 THR A O     1 
ATOM   1759  C  CB    . THR A 1 231 ? 79.403  -4.126  60.519  1.00 49.11  ?  231 THR A CB    1 
ATOM   1760  O  OG1   . THR A 1 231 ? 80.388  -3.244  59.960  1.00 49.90  ?  231 THR A OG1   1 
ATOM   1761  C  CG2   . THR A 1 231 ? 79.580  -4.175  62.000  1.00 52.69  ?  231 THR A CG2   1 
ATOM   1762  N  N     . GLY A 1 232 ? 80.646  -5.523  57.755  1.00 41.71  ?  232 GLY A N     1 
ATOM   1763  C  CA    . GLY A 1 232 ? 80.653  -5.370  56.319  1.00 41.99  ?  232 GLY A CA    1 
ATOM   1764  C  C     . GLY A 1 232 ? 80.909  -3.942  55.876  1.00 46.43  ?  232 GLY A C     1 
ATOM   1765  O  O     . GLY A 1 232 ? 81.194  -3.712  54.704  1.00 53.59  ?  232 GLY A O     1 
ATOM   1766  N  N     . LYS A 1 233 ? 80.798  -2.980  56.791  1.00 41.88  ?  233 LYS A N     1 
ATOM   1767  C  CA    . LYS A 1 233 ? 81.189  -1.606  56.471  1.00 40.26  ?  233 LYS A CA    1 
ATOM   1768  C  C     . LYS A 1 233 ? 82.350  -1.148  57.340  1.00 47.26  ?  233 LYS A C     1 
ATOM   1769  O  O     . LYS A 1 233 ? 82.450  -1.522  58.500  1.00 53.53  ?  233 LYS A O     1 
ATOM   1770  C  CB    . LYS A 1 233 ? 80.034  -0.623  56.640  1.00 38.77  ?  233 LYS A CB    1 
ATOM   1771  C  CG    . LYS A 1 233 ? 78.948  -0.659  55.581  1.00 38.77  ?  233 LYS A CG    1 
ATOM   1772  C  CD    . LYS A 1 233 ? 78.094  0.622   55.681  1.00 47.97  ?  233 LYS A CD    1 
ATOM   1773  C  CE    . LYS A 1 233 ? 76.876  0.619   54.773  1.00 53.40  ?  233 LYS A CE    1 
ATOM   1774  N  NZ    . LYS A 1 233 ? 77.010  1.631   53.680  1.00 57.45  ?  233 LYS A NZ    1 
ATOM   1775  N  N     . GLY A 1 234 ? 83.216  -0.326  56.764  1.00 45.98  ?  234 GLY A N     1 
ATOM   1776  C  CA    . GLY A 1 234 ? 84.383  0.208   57.443  1.00 44.69  ?  234 GLY A CA    1 
ATOM   1777  C  C     . GLY A 1 234 ? 85.153  1.078   56.462  1.00 44.22  ?  234 GLY A C     1 
ATOM   1778  O  O     . GLY A 1 234 ? 85.047  0.870   55.255  1.00 44.17  ?  234 GLY A O     1 
ATOM   1779  N  N     . ARG A 1 235 ? 85.904  2.058   56.964  1.00 46.42  ?  235 ARG A N     1 
ATOM   1780  C  CA    . ARG A 1 235 ? 86.671  2.970   56.106  1.00 46.93  ?  235 ARG A CA    1 
ATOM   1781  C  C     . ARG A 1 235 ? 88.142  2.897   56.467  1.00 37.56  ?  235 ARG A C     1 
ATOM   1782  O  O     . ARG A 1 235 ? 88.508  2.995   57.621  1.00 66.47  ?  235 ARG A O     1 
ATOM   1783  C  CB    . ARG A 1 235 ? 86.142  4.413   56.196  1.00 51.46  ?  235 ARG A CB    1 
ATOM   1784  C  CG    . ARG A 1 235 ? 87.022  5.502   55.579  1.00 38.85  ?  235 ARG A CG    1 
ATOM   1785  N  N     . VAL A 1 236 ? 88.984  2.704   55.464  1.00 41.29  ?  236 VAL A N     1 
ATOM   1786  C  CA    . VAL A 1 236 ? 90.390  2.429   55.698  1.00 41.63  ?  236 VAL A CA    1 
ATOM   1787  C  C     . VAL A 1 236 ? 91.251  3.366   54.845  1.00 48.80  ?  236 VAL A C     1 
ATOM   1788  O  O     . VAL A 1 236 ? 90.765  3.962   53.891  1.00 53.40  ?  236 VAL A O     1 
ATOM   1789  C  CB    . VAL A 1 236 ? 90.665  0.925   55.447  1.00 36.03  ?  236 VAL A CB    1 
ATOM   1790  C  CG1   . VAL A 1 236 ? 91.606  0.694   54.274  1.00 35.44  ?  236 VAL A CG1   1 
ATOM   1791  C  CG2   . VAL A 1 236 ? 91.157  0.272   56.724  1.00 36.44  ?  236 VAL A CG2   1 
ATOM   1792  N  N     . VAL A 1 237 ? 92.511  3.556   55.201  1.00 37.91  ?  237 VAL A N     1 
ATOM   1793  C  CA    . VAL A 1 237 ? 93.347  4.417   54.376  1.00 44.78  ?  237 VAL A CA    1 
ATOM   1794  C  C     . VAL A 1 237 ? 94.299  3.574   53.545  1.00 43.30  ?  237 VAL A C     1 
ATOM   1795  O  O     . VAL A 1 237 ? 94.793  2.554   53.999  1.00 45.00  ?  237 VAL A O     1 
ATOM   1796  C  CB    . VAL A 1 237 ? 94.115  5.456   55.220  1.00 39.65  ?  237 VAL A CB    1 
ATOM   1797  C  CG1   . VAL A 1 237 ? 95.045  6.305   54.345  1.00 40.10  ?  237 VAL A CG1   1 
ATOM   1798  C  CG2   . VAL A 1 237 ? 93.139  6.336   55.923  1.00 46.16  ?  237 VAL A CG2   1 
ATOM   1799  N  N     . VAL A 1 238 ? 94.535  3.987   52.311  1.00 41.23  ?  238 VAL A N     1 
ATOM   1800  C  CA    . VAL A 1 238 ? 95.492  3.286   51.468  1.00 44.70  ?  238 VAL A CA    1 
ATOM   1801  C  C     . VAL A 1 238 ? 96.483  4.301   50.939  1.00 49.24  ?  238 VAL A C     1 
ATOM   1802  O  O     . VAL A 1 238 ? 96.099  5.275   50.292  1.00 52.24  ?  238 VAL A O     1 
ATOM   1803  C  CB    . VAL A 1 238 ? 94.807  2.577   50.313  1.00 44.04  ?  238 VAL A CB    1 
ATOM   1804  C  CG1   . VAL A 1 238 ? 95.837  1.856   49.466  1.00 35.23  ?  238 VAL A CG1   1 
ATOM   1805  C  CG2   . VAL A 1 238 ? 93.755  1.618   50.854  1.00 34.96  ?  238 VAL A CG2   1 
ATOM   1806  N  N     . ARG A 1 239 ? 97.758  4.084   51.234  1.00 41.01  ?  239 ARG A N     1 
ATOM   1807  C  CA    . ARG A 1 239 ? 98.771  5.073   50.923  1.00 42.84  ?  239 ARG A CA    1 
ATOM   1808  C  C     . ARG A 1 239 ? 99.928  4.478   50.155  1.00 42.86  ?  239 ARG A C     1 
ATOM   1809  O  O     . ARG A 1 239 ? 100.332 3.342   50.403  1.00 47.30  ?  239 ARG A O     1 
ATOM   1810  C  CB    . ARG A 1 239 ? 99.292  5.709   52.197  1.00 46.26  ?  239 ARG A CB    1 
ATOM   1811  C  CG    . ARG A 1 239 ? 100.623 6.370   51.999  1.00 52.18  ?  239 ARG A CG    1 
ATOM   1812  C  CD    . ARG A 1 239 ? 101.160 6.812   53.316  1.00 59.50  ?  239 ARG A CD    1 
ATOM   1813  N  NE    . ARG A 1 239 ? 100.206 7.693   53.963  1.00 61.33  ?  239 ARG A NE    1 
ATOM   1814  C  CZ    . ARG A 1 239 ? 100.522 8.487   54.971  1.00 68.25  ?  239 ARG A CZ    1 
ATOM   1815  N  NH1   . ARG A 1 239 ? 101.765 8.495   55.428  1.00 68.04  ?  239 ARG A NH1   1 
ATOM   1816  N  NH2   . ARG A 1 239 ? 99.603  9.270   55.511  1.00 76.94  ?  239 ARG A NH2   1 
ATOM   1817  N  N     . SER A 1 240 ? 100.481 5.272   49.248  1.00 37.66  ?  240 SER A N     1 
ATOM   1818  C  CA    . SER A 1 240 ? 101.450 4.773   48.284  1.00 41.18  ?  240 SER A CA    1 
ATOM   1819  C  C     . SER A 1 240 ? 102.801 4.466   48.912  1.00 47.41  ?  240 SER A C     1 
ATOM   1820  O  O     . SER A 1 240 ? 103.209 5.136   49.859  1.00 53.53  ?  240 SER A O     1 
ATOM   1821  C  CB    . SER A 1 240 ? 101.609 5.781   47.158  1.00 38.16  ?  240 SER A CB    1 
ATOM   1822  O  OG    . SER A 1 240 ? 100.359 6.375   46.885  1.00 38.06  ?  240 SER A OG    1 
ATOM   1823  N  N     . LYS A 1 241 ? 103.490 3.444   48.394  1.00 46.22  ?  241 LYS A N     1 
ATOM   1824  C  CA    . LYS A 1 241 ? 104.826 3.133   48.876  1.00 48.84  ?  241 LYS A CA    1 
ATOM   1825  C  C     . LYS A 1 241 ? 105.764 4.208   48.368  1.00 49.82  ?  241 LYS A C     1 
ATOM   1826  O  O     . LYS A 1 241 ? 105.835 4.454   47.168  1.00 46.23  ?  241 LYS A O     1 
ATOM   1827  C  CB    . LYS A 1 241 ? 105.302 1.735   48.454  1.00 34.13  ?  241 LYS A CB    1 
ATOM   1828  C  CG    . LYS A 1 241 ? 106.699 1.370   49.036  1.00 64.18  ?  241 LYS A CG    1 
ATOM   1829  C  CD    . LYS A 1 241 ? 107.095 -0.120  48.901  1.00 45.86  ?  241 LYS A CD    1 
ATOM   1830  N  N     . THR A 1 242 ? 106.457 4.872   49.287  1.00 53.61  ?  242 THR A N     1 
ATOM   1831  C  CA    . THR A 1 242 ? 107.372 5.939   48.904  1.00 56.76  ?  242 THR A CA    1 
ATOM   1832  C  C     . THR A 1 242 ? 108.773 5.781   49.492  1.00 58.37  ?  242 THR A C     1 
ATOM   1833  O  O     . THR A 1 242 ? 109.010 4.972   50.387  1.00 60.18  ?  242 THR A O     1 
ATOM   1834  C  CB    . THR A 1 242 ? 106.796 7.343   49.213  1.00 55.98  ?  242 THR A CB    1 
ATOM   1835  O  OG1   . THR A 1 242 ? 106.483 7.458   50.606  1.00 54.09  ?  242 THR A OG1   1 
ATOM   1836  C  CG2   . THR A 1 242 ? 105.533 7.584   48.398  1.00 55.02  ?  242 THR A CG2   1 
ATOM   1837  N  N     . GLU A 1 243 ? 109.698 6.555   48.944  1.00 59.62  ?  243 GLU A N     1 
ATOM   1838  C  CA    . GLU A 1 243 ? 111.097 6.507   49.326  1.00 63.12  ?  243 GLU A CA    1 
ATOM   1839  C  C     . GLU A 1 243 ? 111.639 7.896   49.058  1.00 64.93  ?  243 GLU A C     1 
ATOM   1840  O  O     . GLU A 1 243 ? 111.073 8.652   48.261  1.00 64.35  ?  243 GLU A O     1 
ATOM   1841  C  CB    . GLU A 1 243 ? 111.859 5.478   48.480  1.00 61.25  ?  243 GLU A CB    1 
ATOM   1842  N  N     . ILE A 1 244 ? 112.722 8.255   49.726  1.00 63.36  ?  244 ILE A N     1 
ATOM   1843  C  CA    . ILE A 1 244 ? 113.346 9.525   49.422  1.00 59.90  ?  244 ILE A CA    1 
ATOM   1844  C  C     . ILE A 1 244 ? 114.731 9.271   48.861  1.00 66.59  ?  244 ILE A C     1 
ATOM   1845  O  O     . ILE A 1 244 ? 115.521 8.541   49.458  1.00 73.27  ?  244 ILE A O     1 
ATOM   1846  C  CB    . ILE A 1 244 ? 113.429 10.439  50.659  1.00 57.87  ?  244 ILE A CB    1 
ATOM   1847  C  CG1   . ILE A 1 244 ? 112.026 10.725  51.199  1.00 46.52  ?  244 ILE A CG1   1 
ATOM   1848  C  CG2   . ILE A 1 244 ? 114.146 11.736  50.309  1.00 56.36  ?  244 ILE A CG2   1 
ATOM   1849  C  CD1   . ILE A 1 244 ? 111.083 11.267  50.150  1.00 45.01  ?  244 ILE A CD1   1 
ATOM   1850  N  N     . GLU A 1 245 ? 115.016 9.854   47.702  1.00 67.51  ?  245 GLU A N     1 
ATOM   1851  C  CA    . GLU A 1 245 ? 116.344 9.737   47.103  1.00 74.61  ?  245 GLU A CA    1 
ATOM   1852  C  C     . GLU A 1 245 ? 117.068 11.081  47.069  1.00 77.40  ?  245 GLU A C     1 
ATOM   1853  O  O     . GLU A 1 245 ? 116.556 12.063  46.526  1.00 77.89  ?  245 GLU A O     1 
ATOM   1854  C  CB    . GLU A 1 245 ? 116.258 9.139   45.697  1.00 75.81  ?  245 GLU A CB    1 
ATOM   1855  C  CG    . GLU A 1 245 ? 116.072 7.638   45.677  1.00 78.96  ?  245 GLU A CG    1 
ATOM   1856  C  CD    . GLU A 1 245 ? 115.756 7.113   44.290  1.00 82.18  ?  245 GLU A CD    1 
ATOM   1857  O  OE1   . GLU A 1 245 ? 115.544 7.949   43.379  1.00 83.72  ?  245 GLU A OE1   1 
ATOM   1858  O  OE2   . GLU A 1 245 ? 115.717 5.870   44.112  1.00 81.31  ?  245 GLU A OE2   1 
ATOM   1859  N  N     . LYS A 1 246 ? 118.255 11.124  47.662  1.00 79.43  ?  246 LYS A N     1 
ATOM   1860  C  CA    . LYS A 1 246 ? 119.041 12.352  47.673  1.00 79.45  ?  246 LYS A CA    1 
ATOM   1861  C  C     . LYS A 1 246 ? 119.699 12.521  46.298  1.00 86.06  ?  246 LYS A C     1 
ATOM   1862  O  O     . LYS A 1 246 ? 120.344 11.604  45.792  1.00 89.40  ?  246 LYS A O     1 
ATOM   1863  C  CB    . LYS A 1 246 ? 120.069 12.349  48.821  1.00 75.19  ?  246 LYS A CB    1 
ATOM   1864  N  N     . LEU A 1 247 ? 119.495 13.677  45.675  1.00 88.90  ?  247 LEU A N     1 
ATOM   1865  C  CA    . LEU A 1 247 ? 120.074 13.948  44.364  1.00 94.12  ?  247 LEU A CA    1 
ATOM   1866  C  C     . LEU A 1 247 ? 121.243 14.935  44.483  1.00 97.39  ?  247 LEU A C     1 
ATOM   1867  O  O     . LEU A 1 247 ? 121.457 15.529  45.545  1.00 95.68  ?  247 LEU A O     1 
ATOM   1868  C  CB    . LEU A 1 247 ? 119.005 14.468  43.392  1.00 94.19  ?  247 LEU A CB    1 
ATOM   1869  C  CG    . LEU A 1 247 ? 117.913 13.509  42.908  1.00 61.08  ?  247 LEU A CG    1 
ATOM   1870  N  N     . LYS A 1 248 ? 121.988 15.103  43.389  1.00 101.04 ?  248 LYS A N     1 
ATOM   1871  C  CA    . LYS A 1 248 ? 123.224 15.899  43.376  1.00 104.66 ?  248 LYS A CA    1 
ATOM   1872  C  C     . LYS A 1 248 ? 123.095 17.293  44.006  1.00 107.49 ?  248 LYS A C     1 
ATOM   1873  O  O     . LYS A 1 248 ? 122.568 18.223  43.393  1.00 106.05 ?  248 LYS A O     1 
ATOM   1874  C  CB    . LYS A 1 248 ? 123.787 16.009  41.951  1.00 103.04 ?  248 LYS A CB    1 
ATOM   1875  N  N     . GLY A 1 249 ? 123.581 17.422  45.238  1.00 111.64 ?  249 GLY A N     1 
ATOM   1876  C  CA    . GLY A 1 249 ? 123.683 18.709  45.907  1.00 113.32 ?  249 GLY A CA    1 
ATOM   1877  C  C     . GLY A 1 249 ? 122.393 19.401  46.326  1.00 108.11 ?  249 GLY A C     1 
ATOM   1878  O  O     . GLY A 1 249 ? 121.873 20.255  45.600  1.00 104.54 ?  249 GLY A O     1 
ATOM   1879  N  N     . GLY A 1 250 ? 121.883 19.037  47.502  1.00 105.18 ?  250 GLY A N     1 
ATOM   1880  C  CA    . GLY A 1 250 ? 120.805 19.776  48.138  1.00 98.74  ?  250 GLY A CA    1 
ATOM   1881  C  C     . GLY A 1 250 ? 119.390 19.309  47.849  1.00 91.27  ?  250 GLY A C     1 
ATOM   1882  O  O     . GLY A 1 250 ? 118.530 19.351  48.730  1.00 87.11  ?  250 GLY A O     1 
ATOM   1883  N  N     . LYS A 1 251 ? 119.148 18.871  46.617  1.00 89.58  ?  251 LYS A N     1 
ATOM   1884  C  CA    . LYS A 1 251 ? 117.807 18.493  46.180  1.00 83.69  ?  251 LYS A CA    1 
ATOM   1885  C  C     . LYS A 1 251 ? 117.447 17.060  46.586  1.00 82.15  ?  251 LYS A C     1 
ATOM   1886  O  O     . LYS A 1 251 ? 118.310 16.183  46.646  1.00 84.09  ?  251 LYS A O     1 
ATOM   1887  C  CB    . LYS A 1 251 ? 117.667 18.664  44.660  1.00 80.92  ?  251 LYS A CB    1 
ATOM   1888  C  CG    . LYS A 1 251 ? 117.956 20.078  44.132  1.00 78.62  ?  251 LYS A CG    1 
ATOM   1889  C  CD    . LYS A 1 251 ? 117.671 20.185  42.628  1.00 74.04  ?  251 LYS A CD    1 
ATOM   1890  N  N     . GLU A 1 252 ? 116.169 16.836  46.876  1.00 78.28  ?  252 GLU A N     1 
ATOM   1891  C  CA    . GLU A 1 252 ? 115.677 15.504  47.198  1.00 76.00  ?  252 GLU A CA    1 
ATOM   1892  C  C     . GLU A 1 252 ? 114.629 15.070  46.178  1.00 71.98  ?  252 GLU A C     1 
ATOM   1893  O  O     . GLU A 1 252 ? 114.078 15.893  45.446  1.00 73.68  ?  252 GLU A O     1 
ATOM   1894  C  CB    . GLU A 1 252 ? 115.085 15.471  48.609  1.00 78.80  ?  252 GLU A CB    1 
ATOM   1895  C  CG    . GLU A 1 252 ? 116.113 15.527  49.727  1.00 92.58  ?  252 GLU A CG    1 
ATOM   1896  C  CD    . GLU A 1 252 ? 115.521 15.219  51.105  1.00 100.87 ?  252 GLU A CD    1 
ATOM   1897  O  OE1   . GLU A 1 252 ? 114.297 15.398  51.289  1.00 100.19 ?  252 GLU A OE1   1 
ATOM   1898  O  OE2   . GLU A 1 252 ? 116.282 14.792  52.004  1.00 105.81 ?  252 GLU A OE2   1 
ATOM   1899  N  N     . GLN A 1 253 ? 114.340 13.775  46.148  1.00 66.68  ?  253 GLN A N     1 
ATOM   1900  C  CA    . GLN A 1 253 ? 113.367 13.227  45.214  1.00 58.32  ?  253 GLN A CA    1 
ATOM   1901  C  C     . GLN A 1 253 ? 112.438 12.240  45.920  1.00 53.19  ?  253 GLN A C     1 
ATOM   1902  O  O     . GLN A 1 253 ? 112.904 11.253  46.504  1.00 53.01  ?  253 GLN A O     1 
ATOM   1903  C  CB    . GLN A 1 253 ? 114.116 12.503  44.102  1.00 59.04  ?  253 GLN A CB    1 
ATOM   1904  C  CG    . GLN A 1 253 ? 113.487 12.580  42.742  1.00 61.52  ?  253 GLN A CG    1 
ATOM   1905  C  CD    . GLN A 1 253 ? 114.223 11.713  41.752  1.00 70.11  ?  253 GLN A CD    1 
ATOM   1906  O  OE1   . GLN A 1 253 ? 114.410 12.083  40.591  1.00 75.66  ?  253 GLN A OE1   1 
ATOM   1907  N  NE2   . GLN A 1 253 ? 114.649 10.540  42.207  1.00 71.03  ?  253 GLN A NE2   1 
ATOM   1908  N  N     . ILE A 1 254 ? 111.133 12.510  45.885  1.00 49.88  ?  254 ILE A N     1 
ATOM   1909  C  CA    . ILE A 1 254 ? 110.128 11.542  46.339  1.00 51.03  ?  254 ILE A CA    1 
ATOM   1910  C  C     . ILE A 1 254 ? 109.890 10.503  45.239  1.00 55.51  ?  254 ILE A C     1 
ATOM   1911  O  O     . ILE A 1 254 ? 109.542 10.855  44.108  1.00 56.39  ?  254 ILE A O     1 
ATOM   1912  C  CB    . ILE A 1 254 ? 108.784 12.218  46.640  1.00 47.75  ?  254 ILE A CB    1 
ATOM   1913  C  CG1   . ILE A 1 254 ? 108.989 13.482  47.470  1.00 49.59  ?  254 ILE A CG1   1 
ATOM   1914  C  CG2   . ILE A 1 254 ? 107.851 11.266  47.362  1.00 36.22  ?  254 ILE A CG2   1 
ATOM   1915  C  CD1   . ILE A 1 254 ? 107.698 14.191  47.813  1.00 46.75  ?  254 ILE A CD1   1 
ATOM   1916  N  N     . VAL A 1 255 ? 110.082 9.226   45.554  1.00 56.34  ?  255 VAL A N     1 
ATOM   1917  C  CA    . VAL A 1 255 ? 109.938 8.192   44.532  1.00 52.18  ?  255 VAL A CA    1 
ATOM   1918  C  C     . VAL A 1 255 ? 108.850 7.192   44.880  1.00 52.34  ?  255 VAL A C     1 
ATOM   1919  O  O     . VAL A 1 255 ? 108.940 6.473   45.872  1.00 55.85  ?  255 VAL A O     1 
ATOM   1920  C  CB    . VAL A 1 255 ? 111.268 7.457   44.233  1.00 47.26  ?  255 VAL A CB    1 
ATOM   1921  C  CG1   . VAL A 1 255 ? 111.023 6.288   43.298  1.00 46.87  ?  255 VAL A CG1   1 
ATOM   1922  C  CG2   . VAL A 1 255 ? 112.283 8.420   43.620  1.00 46.25  ?  255 VAL A CG2   1 
ATOM   1923  N  N     . ILE A 1 256 ? 107.827 7.154   44.036  1.00 50.31  ?  256 ILE A N     1 
ATOM   1924  C  CA    . ILE A 1 256 ? 106.640 6.354   44.281  1.00 52.32  ?  256 ILE A CA    1 
ATOM   1925  C  C     . ILE A 1 256 ? 106.727 5.035   43.534  1.00 56.36  ?  256 ILE A C     1 
ATOM   1926  O  O     . ILE A 1 256 ? 107.093 5.018   42.364  1.00 62.19  ?  256 ILE A O     1 
ATOM   1927  C  CB    . ILE A 1 256 ? 105.396 7.122   43.828  1.00 51.37  ?  256 ILE A CB    1 
ATOM   1928  C  CG1   . ILE A 1 256 ? 105.339 8.466   44.572  1.00 50.98  ?  256 ILE A CG1   1 
ATOM   1929  C  CG2   . ILE A 1 256 ? 104.139 6.275   44.035  1.00 48.94  ?  256 ILE A CG2   1 
ATOM   1930  C  CD1   . ILE A 1 256 ? 104.342 9.461   44.015  1.00 47.42  ?  256 ILE A CD1   1 
ATOM   1931  N  N     . THR A 1 257 ? 106.392 3.933   44.205  1.00 52.25  ?  257 THR A N     1 
ATOM   1932  C  CA    . THR A 1 257 ? 106.592 2.598   43.633  1.00 48.84  ?  257 THR A CA    1 
ATOM   1933  C  C     . THR A 1 257 ? 105.339 1.731   43.686  1.00 50.43  ?  257 THR A C     1 
ATOM   1934  O  O     . THR A 1 257 ? 105.234 0.743   42.960  1.00 55.24  ?  257 THR A O     1 
ATOM   1935  C  CB    . THR A 1 257 ? 107.756 1.845   44.319  1.00 48.16  ?  257 THR A CB    1 
ATOM   1936  O  OG1   . THR A 1 257 ? 107.401 1.530   45.669  1.00 48.72  ?  257 THR A OG1   1 
ATOM   1937  C  CG2   . THR A 1 257 ? 109.022 2.693   44.331  1.00 49.45  ?  257 THR A CG2   1 
ATOM   1938  N  N     . GLU A 1 258 ? 104.400 2.098   44.551  1.00 47.45  ?  258 GLU A N     1 
ATOM   1939  C  CA    . GLU A 1 258 ? 103.113 1.414   44.643  1.00 45.63  ?  258 GLU A CA    1 
ATOM   1940  C  C     . GLU A 1 258 ? 102.038 2.466   44.899  1.00 47.36  ?  258 GLU A C     1 
ATOM   1941  O  O     . GLU A 1 258 ? 102.222 3.357   45.720  1.00 51.45  ?  258 GLU A O     1 
ATOM   1942  C  CB    . GLU A 1 258 ? 103.128 0.366   45.771  1.00 44.33  ?  258 GLU A CB    1 
ATOM   1943  C  CG    . GLU A 1 258 ? 104.162 -0.761  45.588  1.00 52.12  ?  258 GLU A CG    1 
ATOM   1944  C  CD    . GLU A 1 258 ? 104.176 -1.789  46.729  1.00 59.86  ?  258 GLU A CD    1 
ATOM   1945  O  OE1   . GLU A 1 258 ? 103.221 -1.824  47.537  1.00 58.18  ?  258 GLU A OE1   1 
ATOM   1946  O  OE2   . GLU A 1 258 ? 105.151 -2.571  46.815  1.00 64.47  ?  258 GLU A OE2   1 
ATOM   1947  N  N     . ILE A 1 259 ? 100.921 2.386   44.189  1.00 43.41  ?  259 ILE A N     1 
ATOM   1948  C  CA    . ILE A 1 259 ? 99.837  3.343   44.407  1.00 36.67  ?  259 ILE A CA    1 
ATOM   1949  C  C     . ILE A 1 259 ? 98.543  2.626   44.779  1.00 33.71  ?  259 ILE A C     1 
ATOM   1950  O  O     . ILE A 1 259 ? 98.458  1.408   44.689  1.00 36.82  ?  259 ILE A O     1 
ATOM   1951  C  CB    . ILE A 1 259 ? 99.611  4.248   43.187  1.00 36.37  ?  259 ILE A CB    1 
ATOM   1952  C  CG1   . ILE A 1 259 ? 99.106  3.432   41.998  1.00 34.92  ?  259 ILE A CG1   1 
ATOM   1953  C  CG2   . ILE A 1 259 ? 100.892 4.947   42.829  1.00 38.15  ?  259 ILE A CG2   1 
ATOM   1954  C  CD1   . ILE A 1 259 ? 98.914  4.249   40.770  1.00 31.32  ?  259 ILE A CD1   1 
ATOM   1955  N  N     . PRO A 1 260 ? 97.535  3.378   45.225  1.00 32.73  ?  260 PRO A N     1 
ATOM   1956  C  CA    . PRO A 1 260 ? 96.324  2.761   45.773  1.00 32.85  ?  260 PRO A CA    1 
ATOM   1957  C  C     . PRO A 1 260 ? 95.465  2.070   44.726  1.00 30.89  ?  260 PRO A C     1 
ATOM   1958  O  O     . PRO A 1 260 ? 95.283  2.586   43.636  1.00 35.08  ?  260 PRO A O     1 
ATOM   1959  C  CB    . PRO A 1 260 ? 95.571  3.955   46.374  1.00 38.90  ?  260 PRO A CB    1 
ATOM   1960  C  CG    . PRO A 1 260 ? 96.626  5.008   46.599  1.00 39.70  ?  260 PRO A CG    1 
ATOM   1961  C  CD    . PRO A 1 260 ? 97.572  4.829   45.458  1.00 38.75  ?  260 PRO A CD    1 
ATOM   1962  N  N     . TYR A 1 261 ? 94.940  0.908   45.080  1.00 26.98  ?  261 TYR A N     1 
ATOM   1963  C  CA    . TYR A 1 261 ? 94.023  0.139   44.241  1.00 39.70  ?  261 TYR A CA    1 
ATOM   1964  C  C     . TYR A 1 261 ? 92.910  0.993   43.659  1.00 36.60  ?  261 TYR A C     1 
ATOM   1965  O  O     . TYR A 1 261 ? 92.379  1.882   44.335  1.00 28.92  ?  261 TYR A O     1 
ATOM   1966  C  CB    . TYR A 1 261 ? 93.417  -0.964  45.098  1.00 28.50  ?  261 TYR A CB    1 
ATOM   1967  C  CG    . TYR A 1 261 ? 92.470  -1.922  44.447  1.00 29.71  ?  261 TYR A CG    1 
ATOM   1968  C  CD1   . TYR A 1 261 ? 92.933  -2.970  43.659  1.00 44.22  ?  261 TYR A CD1   1 
ATOM   1969  C  CD2   . TYR A 1 261 ? 91.111  -1.835  44.686  1.00 40.59  ?  261 TYR A CD2   1 
ATOM   1970  C  CE1   . TYR A 1 261 ? 92.052  -3.882  43.085  1.00 44.10  ?  261 TYR A CE1   1 
ATOM   1971  C  CE2   . TYR A 1 261 ? 90.223  -2.737  44.121  1.00 42.41  ?  261 TYR A CE2   1 
ATOM   1972  C  CZ    . TYR A 1 261 ? 90.697  -3.758  43.324  1.00 43.47  ?  261 TYR A CZ    1 
ATOM   1973  O  OH    . TYR A 1 261 ? 89.802  -4.647  42.774  1.00 46.99  ?  261 TYR A OH    1 
ATOM   1974  N  N     . GLU A 1 262 ? 92.558  0.695   42.406  1.00 41.83  ?  262 GLU A N     1 
ATOM   1975  C  CA    . GLU A 1 262 ? 91.497  1.389   41.671  1.00 45.62  ?  262 GLU A CA    1 
ATOM   1976  C  C     . GLU A 1 262 ? 91.916  2.803   41.271  1.00 41.71  ?  262 GLU A C     1 
ATOM   1977  O  O     . GLU A 1 262 ? 91.072  3.640   40.958  1.00 48.13  ?  262 GLU A O     1 
ATOM   1978  C  CB    . GLU A 1 262 ? 90.171  1.405   42.452  1.00 55.21  ?  262 GLU A CB    1 
ATOM   1979  C  CG    . GLU A 1 262 ? 89.302  0.153   42.270  1.00 69.40  ?  262 GLU A CG    1 
ATOM   1980  C  CD    . GLU A 1 262 ? 88.068  0.134   43.181  1.00 82.63  ?  262 GLU A CD    1 
ATOM   1981  O  OE1   . GLU A 1 262 ? 88.167  -0.397  44.310  1.00 84.20  ?  262 GLU A OE1   1 
ATOM   1982  O  OE2   . GLU A 1 262 ? 86.993  0.631   42.768  1.00 88.77  ?  262 GLU A OE2   1 
ATOM   1983  N  N     . ILE A 1 263 ? 93.219  3.065   41.273  1.00 36.11  ?  263 ILE A N     1 
ATOM   1984  C  CA    . ILE A 1 263 ? 93.722  4.400   40.943  1.00 37.22  ?  263 ILE A CA    1 
ATOM   1985  C  C     . ILE A 1 263 ? 94.488  4.380   39.646  1.00 45.23  ?  263 ILE A C     1 
ATOM   1986  O  O     . ILE A 1 263 ? 95.382  3.547   39.464  1.00 50.40  ?  263 ILE A O     1 
ATOM   1987  C  CB    . ILE A 1 263 ? 94.638  4.990   42.046  1.00 32.49  ?  263 ILE A CB    1 
ATOM   1988  C  CG1   . ILE A 1 263 ? 93.795  5.435   43.229  1.00 29.05  ?  263 ILE A CG1   1 
ATOM   1989  C  CG2   . ILE A 1 263 ? 95.427  6.191   41.520  1.00 26.06  ?  263 ILE A CG2   1 
ATOM   1990  C  CD1   . ILE A 1 263 ? 92.905  6.557   42.871  1.00 25.91  ?  263 ILE A CD1   1 
ATOM   1991  N  N     . ASN A 1 264 ? 94.136  5.320   38.768  1.00 45.06  ?  264 ASN A N     1 
ATOM   1992  C  CA    . ASN A 1 264 ? 94.703  5.445   37.427  1.00 45.76  ?  264 ASN A CA    1 
ATOM   1993  C  C     . ASN A 1 264 ? 96.078  6.147   37.438  1.00 41.59  ?  264 ASN A C     1 
ATOM   1994  O  O     . ASN A 1 264 ? 96.170  7.333   37.751  1.00 42.39  ?  264 ASN A O     1 
ATOM   1995  C  CB    . ASN A 1 264 ? 93.684  6.211   36.578  1.00 52.27  ?  264 ASN A CB    1 
ATOM   1996  C  CG    . ASN A 1 264 ? 94.093  6.356   35.125  1.00 57.89  ?  264 ASN A CG    1 
ATOM   1997  O  OD1   . ASN A 1 264 ? 95.244  6.667   34.815  1.00 61.64  ?  264 ASN A OD1   1 
ATOM   1998  N  ND2   . ASN A 1 264 ? 93.136  6.152   34.222  1.00 58.48  ?  264 ASN A ND2   1 
ATOM   1999  N  N     . LYS A 1 265 ? 97.146  5.423   37.113  1.00 39.87  ?  265 LYS A N     1 
ATOM   2000  C  CA    . LYS A 1 265 ? 98.496  5.987   37.226  1.00 40.39  ?  265 LYS A CA    1 
ATOM   2001  C  C     . LYS A 1 265 ? 98.628  7.298   36.442  1.00 44.87  ?  265 LYS A C     1 
ATOM   2002  O  O     . LYS A 1 265 ? 99.118  8.300   36.967  1.00 48.26  ?  265 LYS A O     1 
ATOM   2003  C  CB    . LYS A 1 265 ? 99.576  4.979   36.795  1.00 39.52  ?  265 LYS A CB    1 
ATOM   2004  C  CG    . LYS A 1 265 ? 101.018 5.443   37.040  1.00 40.04  ?  265 LYS A CG    1 
ATOM   2005  C  CD    . LYS A 1 265 ? 102.049 4.404   36.574  1.00 45.94  ?  265 LYS A CD    1 
ATOM   2006  C  CE    . LYS A 1 265 ? 102.310 4.467   35.065  1.00 36.63  ?  265 LYS A CE    1 
ATOM   2007  N  N     . ALA A 1 266 ? 98.171  7.290   35.193  1.00 42.61  ?  266 ALA A N     1 
ATOM   2008  C  CA    . ALA A 1 266 ? 98.246  8.459   34.315  1.00 43.41  ?  266 ALA A CA    1 
ATOM   2009  C  C     . ALA A 1 266 ? 97.573  9.714   34.874  1.00 47.24  ?  266 ALA A C     1 
ATOM   2010  O  O     . ALA A 1 266 ? 98.186  10.792  34.907  1.00 46.53  ?  266 ALA A O     1 
ATOM   2011  C  CB    . ALA A 1 266 ? 97.672  8.118   32.959  1.00 44.49  ?  266 ALA A CB    1 
ATOM   2012  N  N     . ASN A 1 267 ? 96.315  9.571   35.299  1.00 51.27  ?  267 ASN A N     1 
ATOM   2013  C  CA    . ASN A 1 267 ? 95.556  10.671  35.913  1.00 53.70  ?  267 ASN A CA    1 
ATOM   2014  C  C     . ASN A 1 267 ? 96.151  11.159  37.238  1.00 49.17  ?  267 ASN A C     1 
ATOM   2015  O  O     . ASN A 1 267 ? 96.011  12.323  37.598  1.00 53.57  ?  267 ASN A O     1 
ATOM   2016  C  CB    . ASN A 1 267 ? 94.074  10.303  36.109  1.00 60.74  ?  267 ASN A CB    1 
ATOM   2017  C  CG    . ASN A 1 267 ? 93.346  10.042  34.788  1.00 71.23  ?  267 ASN A CG    1 
ATOM   2018  O  OD1   . ASN A 1 267 ? 93.780  10.480  33.711  1.00 75.33  ?  267 ASN A OD1   1 
ATOM   2019  N  ND2   . ASN A 1 267 ? 92.225  9.325   34.870  1.00 71.77  ?  267 ASN A ND2   1 
ATOM   2020  N  N     . LEU A 1 268 ? 96.810  10.268  37.967  1.00 45.91  ?  268 LEU A N     1 
ATOM   2021  C  CA    . LEU A 1 268 ? 97.494  10.678  39.180  1.00 45.60  ?  268 LEU A CA    1 
ATOM   2022  C  C     . LEU A 1 268 ? 98.653  11.573  38.798  1.00 49.64  ?  268 LEU A C     1 
ATOM   2023  O  O     . LEU A 1 268 ? 98.756  12.713  39.258  1.00 53.29  ?  268 LEU A O     1 
ATOM   2024  C  CB    . LEU A 1 268 ? 98.035  9.468   39.928  1.00 44.60  ?  268 LEU A CB    1 
ATOM   2025  C  CG    . LEU A 1 268 ? 98.081  9.558   41.449  1.00 45.35  ?  268 LEU A CG    1 
ATOM   2026  C  CD1   . LEU A 1 268 ? 99.211  8.715   41.996  1.00 43.15  ?  268 LEU A CD1   1 
ATOM   2027  C  CD2   . LEU A 1 268 ? 98.221  10.992  41.888  1.00 51.76  ?  268 LEU A CD2   1 
ATOM   2028  N  N     . VAL A 1 269 ? 99.525  11.047  37.943  1.00 47.34  ?  269 VAL A N     1 
ATOM   2029  C  CA    . VAL A 1 269 ? 100.721 11.768  37.544  1.00 43.05  ?  269 VAL A CA    1 
ATOM   2030  C  C     . VAL A 1 269 ? 100.358 13.148  37.023  1.00 44.12  ?  269 VAL A C     1 
ATOM   2031  O  O     . VAL A 1 269 ? 101.024 14.124  37.357  1.00 46.12  ?  269 VAL A O     1 
ATOM   2032  C  CB    . VAL A 1 269 ? 101.522 10.980  36.522  1.00 37.09  ?  269 VAL A CB    1 
ATOM   2033  C  CG1   . VAL A 1 269 ? 102.700 11.784  36.040  1.00 35.04  ?  269 VAL A CG1   1 
ATOM   2034  C  CG2   . VAL A 1 269 ? 102.002 9.692   37.145  1.00 36.69  ?  269 VAL A CG2   1 
ATOM   2035  N  N     . LYS A 1 270 ? 99.288  13.231  36.232  1.00 41.59  ?  270 LYS A N     1 
ATOM   2036  C  CA    . LYS A 1 270 ? 98.758  14.529  35.802  1.00 40.09  ?  270 LYS A CA    1 
ATOM   2037  C  C     . LYS A 1 270 ? 98.432  15.435  36.986  1.00 44.66  ?  270 LYS A C     1 
ATOM   2038  O  O     . LYS A 1 270 ? 98.895  16.567  37.046  1.00 50.50  ?  270 LYS A O     1 
ATOM   2039  C  CB    . LYS A 1 270 ? 97.511  14.365  34.933  1.00 39.37  ?  270 LYS A CB    1 
ATOM   2040  C  CG    . LYS A 1 270 ? 96.772  15.679  34.591  1.00 41.87  ?  270 LYS A CG    1 
ATOM   2041  C  CD    . LYS A 1 270 ? 97.471  16.524  33.499  1.00 43.95  ?  270 LYS A CD    1 
ATOM   2042  N  N     . LYS A 1 271 ? 97.640  14.934  37.930  1.00 43.12  ?  271 LYS A N     1 
ATOM   2043  C  CA    . LYS A 1 271 ? 97.157  15.758  39.037  1.00 46.29  ?  271 LYS A CA    1 
ATOM   2044  C  C     . LYS A 1 271 ? 98.290  16.231  39.972  1.00 51.11  ?  271 LYS A C     1 
ATOM   2045  O  O     . LYS A 1 271 ? 98.260  17.359  40.494  1.00 54.91  ?  271 LYS A O     1 
ATOM   2046  C  CB    . LYS A 1 271 ? 96.025  15.047  39.789  1.00 48.32  ?  271 LYS A CB    1 
ATOM   2047  C  CG    . LYS A 1 271 ? 95.428  15.872  40.933  1.00 59.55  ?  271 LYS A CG    1 
ATOM   2048  C  CD    . LYS A 1 271 ? 94.236  15.170  41.620  1.00 67.45  ?  271 LYS A CD    1 
ATOM   2049  C  CE    . LYS A 1 271 ? 94.596  13.762  42.163  1.00 94.55  ?  271 LYS A CE    1 
ATOM   2050  N  NZ    . LYS A 1 271 ? 93.480  13.117  42.925  1.00 89.84  ?  271 LYS A NZ    1 
ATOM   2051  N  N     . ILE A 1 272 ? 99.291  15.375  40.158  1.00 46.54  ?  272 ILE A N     1 
ATOM   2052  C  CA    . ILE A 1 272 ? 100.481 15.743  40.908  1.00 43.94  ?  272 ILE A CA    1 
ATOM   2053  C  C     . ILE A 1 272 ? 101.246 16.855  40.185  1.00 50.09  ?  272 ILE A C     1 
ATOM   2054  O  O     . ILE A 1 272 ? 101.708 17.802  40.801  1.00 56.99  ?  272 ILE A O     1 
ATOM   2055  C  CB    . ILE A 1 272 ? 101.398 14.526  41.138  1.00 39.99  ?  272 ILE A CB    1 
ATOM   2056  C  CG1   . ILE A 1 272 ? 100.704 13.506  42.043  1.00 36.75  ?  272 ILE A CG1   1 
ATOM   2057  C  CG2   . ILE A 1 272 ? 102.745 14.951  41.738  1.00 40.26  ?  272 ILE A CG2   1 
ATOM   2058  C  CD1   . ILE A 1 272 ? 101.485 12.215  42.224  1.00 34.84  ?  272 ILE A CD1   1 
ATOM   2059  N  N     . ASP A 1 273 ? 101.367 16.751  38.870  1.00 48.92  ?  273 ASP A N     1 
ATOM   2060  C  CA    . ASP A 1 273 ? 101.975 17.821  38.080  1.00 52.85  ?  273 ASP A CA    1 
ATOM   2061  C  C     . ASP A 1 273 ? 101.136 19.119  38.086  1.00 61.50  ?  273 ASP A C     1 
ATOM   2062  O  O     . ASP A 1 273 ? 101.689 20.222  38.034  1.00 66.38  ?  273 ASP A O     1 
ATOM   2063  C  CB    . ASP A 1 273 ? 102.234 17.338  36.648  1.00 55.09  ?  273 ASP A CB    1 
ATOM   2064  C  CG    . ASP A 1 273 ? 102.893 18.397  35.774  1.00 61.86  ?  273 ASP A CG    1 
ATOM   2065  O  OD1   . ASP A 1 273 ? 104.113 18.659  35.962  1.00 61.30  ?  273 ASP A OD1   1 
ATOM   2066  O  OD2   . ASP A 1 273 ? 102.188 18.948  34.886  1.00 65.17  ?  273 ASP A OD2   1 
ATOM   2067  N  N     . ASP A 1 274 ? 99.811  18.990  38.153  1.00 63.94  ?  274 ASP A N     1 
ATOM   2068  C  CA    . ASP A 1 274 ? 98.926  20.157  38.227  1.00 69.80  ?  274 ASP A CA    1 
ATOM   2069  C  C     . ASP A 1 274 ? 99.170  20.931  39.526  1.00 63.07  ?  274 ASP A C     1 
ATOM   2070  O  O     . ASP A 1 274 ? 99.012  22.156  39.592  1.00 61.18  ?  274 ASP A O     1 
ATOM   2071  C  CB    . ASP A 1 274 ? 97.449  19.741  38.105  1.00 82.85  ?  274 ASP A CB    1 
ATOM   2072  C  CG    . ASP A 1 274 ? 97.060  19.320  36.679  1.00 94.82  ?  274 ASP A CG    1 
ATOM   2073  O  OD1   . ASP A 1 274 ? 97.941  19.329  35.785  1.00 102.21 ?  274 ASP A OD1   1 
ATOM   2074  O  OD2   . ASP A 1 274 ? 95.872  18.971  36.455  1.00 94.69  ?  274 ASP A OD2   1 
ATOM   2075  N  N     . VAL A 1 275 ? 99.555  20.201  40.564  1.00 55.74  ?  275 VAL A N     1 
ATOM   2076  C  CA    . VAL A 1 275 ? 100.002 20.833  41.793  1.00 47.08  ?  275 VAL A CA    1 
ATOM   2077  C  C     . VAL A 1 275 ? 101.266 21.656  41.526  1.00 43.77  ?  275 VAL A C     1 
ATOM   2078  O  O     . VAL A 1 275 ? 101.350 22.828  41.909  1.00 40.53  ?  275 VAL A O     1 
ATOM   2079  C  CB    . VAL A 1 275 ? 100.247 19.788  42.887  1.00 40.95  ?  275 VAL A CB    1 
ATOM   2080  C  CG1   . VAL A 1 275 ? 101.046 20.376  44.034  1.00 34.93  ?  275 VAL A CG1   1 
ATOM   2081  C  CG2   . VAL A 1 275 ? 98.930  19.262  43.371  1.00 39.41  ?  275 VAL A CG2   1 
ATOM   2082  N  N     . ARG A 1 276 ? 102.239 21.050  40.852  1.00 42.79  ?  276 ARG A N     1 
ATOM   2083  C  CA    . ARG A 1 276 ? 103.457 21.764  40.498  1.00 45.06  ?  276 ARG A CA    1 
ATOM   2084  C  C     . ARG A 1 276 ? 103.170 22.997  39.643  1.00 50.50  ?  276 ARG A C     1 
ATOM   2085  O  O     . ARG A 1 276 ? 103.733 24.069  39.866  1.00 53.86  ?  276 ARG A O     1 
ATOM   2086  C  CB    . ARG A 1 276 ? 104.440 20.861  39.764  1.00 46.36  ?  276 ARG A CB    1 
ATOM   2087  C  CG    . ARG A 1 276 ? 105.728 21.582  39.381  1.00 53.87  ?  276 ARG A CG    1 
ATOM   2088  C  CD    . ARG A 1 276 ? 106.497 20.846  38.323  1.00 56.96  ?  276 ARG A CD    1 
ATOM   2089  N  NE    . ARG A 1 276 ? 105.720 20.749  37.095  1.00 58.17  ?  276 ARG A NE    1 
ATOM   2090  C  CZ    . ARG A 1 276 ? 105.936 21.497  36.024  1.00 62.37  ?  276 ARG A CZ    1 
ATOM   2091  N  NH1   . ARG A 1 276 ? 106.916 22.384  36.027  1.00 65.08  ?  276 ARG A NH1   1 
ATOM   2092  N  NH2   . ARG A 1 276 ? 105.179 21.349  34.951  1.00 64.70  ?  276 ARG A NH2   1 
ATOM   2093  N  N     . VAL A 1 277 ? 102.292 22.842  38.665  1.00 51.66  ?  277 VAL A N     1 
ATOM   2094  C  CA    . VAL A 1 277 ? 101.995 23.931  37.742  1.00 53.93  ?  277 VAL A CA    1 
ATOM   2095  C  C     . VAL A 1 277 ? 101.228 25.076  38.407  1.00 55.79  ?  277 VAL A C     1 
ATOM   2096  O  O     . VAL A 1 277 ? 101.397 26.237  38.043  1.00 46.15  ?  277 VAL A O     1 
ATOM   2097  C  CB    . VAL A 1 277 ? 101.230 23.412  36.525  1.00 42.81  ?  277 VAL A CB    1 
ATOM   2098  C  CG1   . VAL A 1 277 ? 100.768 24.557  35.669  1.00 45.14  ?  277 VAL A CG1   1 
ATOM   2099  C  CG2   . VAL A 1 277 ? 102.116 22.480  35.751  1.00 54.29  ?  277 VAL A CG2   1 
ATOM   2100  N  N     . ASN A 1 278 ? 100.393 24.744  39.385  1.00 55.24  ?  278 ASN A N     1 
ATOM   2101  C  CA    . ASN A 1 278 ? 99.623  25.753  40.099  1.00 61.31  ?  278 ASN A CA    1 
ATOM   2102  C  C     . ASN A 1 278 ? 100.339 26.295  41.327  1.00 63.20  ?  278 ASN A C     1 
ATOM   2103  O  O     . ASN A 1 278 ? 99.911  27.286  41.922  1.00 62.23  ?  278 ASN A O     1 
ATOM   2104  C  CB    . ASN A 1 278 ? 98.281  25.181  40.525  1.00 63.53  ?  278 ASN A CB    1 
ATOM   2105  C  CG    . ASN A 1 278 ? 97.358  24.960  39.363  1.00 66.19  ?  278 ASN A CG    1 
ATOM   2106  O  OD1   . ASN A 1 278 ? 97.346  25.754  38.413  1.00 71.52  ?  278 ASN A OD1   1 
ATOM   2107  N  ND2   . ASN A 1 278 ? 96.574  23.877  39.419  1.00 62.60  ?  278 ASN A ND2   1 
ATOM   2108  N  N     . ASN A 1 279 ? 101.422 25.631  41.709  1.00 62.15  ?  279 ASN A N     1 
ATOM   2109  C  CA    . ASN A 1 279 ? 102.146 26.001  42.910  1.00 62.04  ?  279 ASN A CA    1 
ATOM   2110  C  C     . ASN A 1 279 ? 101.217 26.204  44.108  1.00 59.65  ?  279 ASN A C     1 
ATOM   2111  O  O     . ASN A 1 279 ? 101.326 27.204  44.822  1.00 61.21  ?  279 ASN A O     1 
ATOM   2112  C  CB    . ASN A 1 279 ? 102.990 27.248  42.658  1.00 65.69  ?  279 ASN A CB    1 
ATOM   2113  C  CG    . ASN A 1 279 ? 104.435 27.034  43.014  1.00 73.09  ?  279 ASN A CG    1 
ATOM   2114  O  OD1   . ASN A 1 279 ? 105.138 26.270  42.348  1.00 77.61  ?  279 ASN A OD1   1 
ATOM   2115  N  ND2   . ASN A 1 279 ? 104.894 27.691  44.076  1.00 74.96  ?  279 ASN A ND2   1 
ATOM   2116  N  N     . LYS A 1 280 ? 100.300 25.253  44.299  1.00 53.98  ?  280 LYS A N     1 
ATOM   2117  C  CA    . LYS A 1 280 ? 99.381  25.223  45.436  1.00 51.18  ?  280 LYS A CA    1 
ATOM   2118  C  C     . LYS A 1 280 ? 100.193 25.041  46.690  1.00 54.98  ?  280 LYS A C     1 
ATOM   2119  O  O     . LYS A 1 280 ? 99.888  25.590  47.760  1.00 59.42  ?  280 LYS A O     1 
ATOM   2120  C  CB    . LYS A 1 280 ? 98.441  24.032  45.310  1.00 45.51  ?  280 LYS A CB    1 
ATOM   2121  C  CG    . LYS A 1 280 ? 97.637  24.031  44.043  1.00 46.07  ?  280 LYS A CG    1 
ATOM   2122  C  CD    . LYS A 1 280 ? 96.490  25.019  44.127  1.00 48.95  ?  280 LYS A CD    1 
ATOM   2123  C  CE    . LYS A 1 280 ? 95.503  24.632  45.204  1.00 48.35  ?  280 LYS A CE    1 
ATOM   2124  N  NZ    . LYS A 1 280 ? 94.270  25.431  45.067  1.00 49.63  ?  280 LYS A NZ    1 
ATOM   2125  N  N     . VAL A 1 281 ? 101.233 24.239  46.539  1.00 51.34  ?  281 VAL A N     1 
ATOM   2126  C  CA    . VAL A 1 281 ? 102.199 24.047  47.585  1.00 53.35  ?  281 VAL A CA    1 
ATOM   2127  C  C     . VAL A 1 281 ? 103.551 24.362  46.958  1.00 55.49  ?  281 VAL A C     1 
ATOM   2128  O  O     . VAL A 1 281 ? 103.762 24.100  45.771  1.00 50.43  ?  281 VAL A O     1 
ATOM   2129  C  CB    . VAL A 1 281 ? 102.126 22.614  48.111  1.00 49.24  ?  281 VAL A CB    1 
ATOM   2130  C  CG1   . VAL A 1 281 ? 103.000 21.707  47.287  1.00 38.95  ?  281 VAL A CG1   1 
ATOM   2131  C  CG2   . VAL A 1 281 ? 102.536 22.582  49.566  1.00 51.17  ?  281 VAL A CG2   1 
ATOM   2132  N  N     . ALA A 1 282 ? 104.459 24.959  47.721  1.00 45.70  ?  282 ALA A N     1 
ATOM   2133  C  CA    . ALA A 1 282 ? 105.747 25.340  47.138  1.00 54.20  ?  282 ALA A CA    1 
ATOM   2134  C  C     . ALA A 1 282 ? 106.736 24.182  47.173  1.00 54.25  ?  282 ALA A C     1 
ATOM   2135  O  O     . ALA A 1 282 ? 106.741 23.408  48.129  1.00 53.25  ?  282 ALA A O     1 
ATOM   2136  C  CB    . ALA A 1 282 ? 106.322 26.550  47.850  1.00 55.28  ?  282 ALA A CB    1 
ATOM   2137  N  N     . GLY A 1 283 ? 107.557 24.040  46.133  1.00 52.76  ?  283 GLY A N     1 
ATOM   2138  C  CA    . GLY A 1 283 ? 108.660 23.100  46.214  1.00 51.93  ?  283 GLY A CA    1 
ATOM   2139  C  C     . GLY A 1 283 ? 108.899 22.098  45.103  1.00 55.41  ?  283 GLY A C     1 
ATOM   2140  O  O     . GLY A 1 283 ? 109.996 21.542  45.021  1.00 57.65  ?  283 GLY A O     1 
ATOM   2141  N  N     . ILE A 1 284 ? 107.900 21.846  44.257  1.00 55.60  ?  284 ILE A N     1 
ATOM   2142  C  CA    . ILE A 1 284 ? 108.058 20.833  43.208  1.00 53.04  ?  284 ILE A CA    1 
ATOM   2143  C  C     . ILE A 1 284 ? 108.794 21.347  41.965  1.00 58.37  ?  284 ILE A C     1 
ATOM   2144  O  O     . ILE A 1 284 ? 108.453 22.387  41.381  1.00 56.87  ?  284 ILE A O     1 
ATOM   2145  C  CB    . ILE A 1 284 ? 106.732 20.160  42.815  1.00 46.24  ?  284 ILE A CB    1 
ATOM   2146  C  CG1   . ILE A 1 284 ? 106.007 19.671  44.070  1.00 46.67  ?  284 ILE A CG1   1 
ATOM   2147  C  CG2   . ILE A 1 284 ? 107.001 19.000  41.875  1.00 40.13  ?  284 ILE A CG2   1 
ATOM   2148  C  CD1   . ILE A 1 284 ? 104.589 19.192  43.824  1.00 43.95  ?  284 ILE A CD1   1 
ATOM   2149  N  N     . ALA A 1 285 ? 109.822 20.598  41.583  1.00 61.97  ?  285 ALA A N     1 
ATOM   2150  C  CA    . ALA A 1 285 ? 110.677 20.966  40.470  1.00 60.22  ?  285 ALA A CA    1 
ATOM   2151  C  C     . ALA A 1 285 ? 110.167 20.307  39.207  1.00 58.44  ?  285 ALA A C     1 
ATOM   2152  O  O     . ALA A 1 285 ? 109.949 20.976  38.206  1.00 62.68  ?  285 ALA A O     1 
ATOM   2153  C  CB    . ALA A 1 285 ? 112.104 20.544  40.746  1.00 59.51  ?  285 ALA A CB    1 
ATOM   2154  N  N     . GLU A 1 286 ? 109.970 18.993  39.262  1.00 53.81  ?  286 GLU A N     1 
ATOM   2155  C  CA    . GLU A 1 286 ? 109.449 18.254  38.124  1.00 56.82  ?  286 GLU A CA    1 
ATOM   2156  C  C     . GLU A 1 286 ? 108.732 16.976  38.552  1.00 57.55  ?  286 GLU A C     1 
ATOM   2157  O  O     . GLU A 1 286 ? 109.023 16.410  39.602  1.00 60.77  ?  286 GLU A O     1 
ATOM   2158  C  CB    . GLU A 1 286 ? 110.582 17.914  37.169  1.00 66.27  ?  286 GLU A CB    1 
ATOM   2159  C  CG    . GLU A 1 286 ? 110.139 17.158  35.931  1.00 76.19  ?  286 GLU A CG    1 
ATOM   2160  C  CD    . GLU A 1 286 ? 111.304 16.787  35.035  1.00 88.57  ?  286 GLU A CD    1 
ATOM   2161  O  OE1   . GLU A 1 286 ? 112.419 16.582  35.564  1.00 94.10  ?  286 GLU A OE1   1 
ATOM   2162  O  OE2   . GLU A 1 286 ? 111.108 16.712  33.805  1.00 92.60  ?  286 GLU A OE2   1 
ATOM   2163  N  N     . VAL A 1 287 ? 107.789 16.525  37.733  1.00 56.27  ?  287 VAL A N     1 
ATOM   2164  C  CA    . VAL A 1 287 ? 107.129 15.245  37.955  1.00 54.56  ?  287 VAL A CA    1 
ATOM   2165  C  C     . VAL A 1 287 ? 107.337 14.325  36.750  1.00 58.11  ?  287 VAL A C     1 
ATOM   2166  O  O     . VAL A 1 287 ? 106.977 14.679  35.633  1.00 62.92  ?  287 VAL A O     1 
ATOM   2167  C  CB    . VAL A 1 287 ? 105.637 15.441  38.160  1.00 53.03  ?  287 VAL A CB    1 
ATOM   2168  C  CG1   . VAL A 1 287 ? 104.994 14.139  38.595  1.00 53.60  ?  287 VAL A CG1   1 
ATOM   2169  C  CG2   . VAL A 1 287 ? 105.394 16.534  39.178  1.00 53.29  ?  287 VAL A CG2   1 
ATOM   2170  N  N     . ARG A 1 288 ? 107.917 13.150  36.983  1.00 56.86  ?  288 ARG A N     1 
ATOM   2171  C  CA    . ARG A 1 288 ? 108.290 12.232  35.902  1.00 58.34  ?  288 ARG A CA    1 
ATOM   2172  C  C     . ARG A 1 288 ? 107.748 10.835  36.100  1.00 59.53  ?  288 ARG A C     1 
ATOM   2173  O  O     . ARG A 1 288 ? 108.242 10.107  36.958  1.00 61.02  ?  288 ARG A O     1 
ATOM   2174  C  CB    . ARG A 1 288 ? 109.814 12.084  35.803  1.00 57.73  ?  288 ARG A CB    1 
ATOM   2175  C  CG    . ARG A 1 288 ? 110.547 13.221  35.128  1.00 61.03  ?  288 ARG A CG    1 
ATOM   2176  C  CD    . ARG A 1 288 ? 112.028 12.878  35.004  1.00 68.79  ?  288 ARG A CD    1 
ATOM   2177  N  NE    . ARG A 1 288 ? 112.824 13.431  36.098  1.00 72.01  ?  288 ARG A NE    1 
ATOM   2178  C  CZ    . ARG A 1 288 ? 113.217 12.750  37.170  1.00 72.43  ?  288 ARG A CZ    1 
ATOM   2179  N  NH1   . ARG A 1 288 ? 112.885 11.474  37.305  1.00 74.68  ?  288 ARG A NH1   1 
ATOM   2180  N  NH2   . ARG A 1 288 ? 113.945 13.348  38.107  1.00 69.91  ?  288 ARG A NH2   1 
ATOM   2181  N  N     . ASP A 1 289 ? 106.768 10.433  35.295  1.00 57.15  ?  289 ASP A N     1 
ATOM   2182  C  CA    . ASP A 1 289 ? 106.420 9.018   35.266  1.00 52.17  ?  289 ASP A CA    1 
ATOM   2183  C  C     . ASP A 1 289 ? 107.585 8.312   34.589  1.00 55.21  ?  289 ASP A C     1 
ATOM   2184  O  O     . ASP A 1 289 ? 107.965 8.661   33.468  1.00 60.95  ?  289 ASP A O     1 
ATOM   2185  C  CB    . ASP A 1 289 ? 105.106 8.755   34.536  1.00 52.20  ?  289 ASP A CB    1 
ATOM   2186  C  CG    . ASP A 1 289 ? 104.587 7.348   34.774  1.00 60.01  ?  289 ASP A CG    1 
ATOM   2187  O  OD1   . ASP A 1 289 ? 103.387 7.088   34.518  1.00 61.52  ?  289 ASP A OD1   1 
ATOM   2188  O  OD2   . ASP A 1 289 ? 105.389 6.502   35.234  1.00 63.83  ?  289 ASP A OD2   1 
ATOM   2189  N  N     . GLU A 1 290 ? 108.183 7.358   35.296  1.00 54.55  ?  290 GLU A N     1 
ATOM   2190  C  CA    . GLU A 1 290 ? 109.372 6.667   34.802  1.00 58.33  ?  290 GLU A CA    1 
ATOM   2191  C  C     . GLU A 1 290 ? 109.108 5.169   34.744  1.00 57.94  ?  290 GLU A C     1 
ATOM   2192  O  O     . GLU A 1 290 ? 110.010 4.368   34.497  1.00 61.17  ?  290 GLU A O     1 
ATOM   2193  C  CB    . GLU A 1 290 ? 110.598 6.979   35.673  1.00 62.77  ?  290 GLU A CB    1 
ATOM   2194  C  CG    . GLU A 1 290 ? 111.037 8.448   35.648  1.00 70.30  ?  290 GLU A CG    1 
ATOM   2195  C  CD    . GLU A 1 290 ? 112.362 8.701   36.377  1.00 78.81  ?  290 GLU A CD    1 
ATOM   2196  O  OE1   . GLU A 1 290 ? 112.805 7.823   37.154  1.00 80.94  ?  290 GLU A OE1   1 
ATOM   2197  O  OE2   . GLU A 1 290 ? 112.964 9.782   36.167  1.00 80.41  ?  290 GLU A OE2   1 
ATOM   2198  N  N     . SER A 1 291 ? 107.851 4.806   34.973  1.00 55.32  ?  291 SER A N     1 
ATOM   2199  C  CA    . SER A 1 291 ? 107.406 3.428   34.854  1.00 59.06  ?  291 SER A CA    1 
ATOM   2200  C  C     . SER A 1 291 ? 107.705 2.862   33.463  1.00 70.11  ?  291 SER A C     1 
ATOM   2201  O  O     . SER A 1 291 ? 107.194 3.350   32.454  1.00 69.20  ?  291 SER A O     1 
ATOM   2202  C  CB    . SER A 1 291 ? 105.904 3.348   35.115  1.00 57.09  ?  291 SER A CB    1 
ATOM   2203  O  OG    . SER A 1 291 ? 105.539 4.077   36.269  1.00 39.20  ?  291 SER A OG    1 
ATOM   2204  N  N     . ASP A 1 292 ? 108.544 1.835   33.412  1.00 81.66  ?  292 ASP A N     1 
ATOM   2205  C  CA    . ASP A 1 292 ? 108.764 1.116   32.164  1.00 90.41  ?  292 ASP A CA    1 
ATOM   2206  C  C     . ASP A 1 292 ? 107.855 -0.105  32.106  1.00 85.91  ?  292 ASP A C     1 
ATOM   2207  O  O     . ASP A 1 292 ? 106.860 -0.178  32.832  1.00 79.87  ?  292 ASP A O     1 
ATOM   2208  C  CB    . ASP A 1 292 ? 110.240 0.720   31.974  1.00 98.97  ?  292 ASP A CB    1 
ATOM   2209  C  CG    . ASP A 1 292 ? 110.819 -0.037  33.169  1.00 101.38 ?  292 ASP A CG    1 
ATOM   2210  O  OD1   . ASP A 1 292 ? 110.056 -0.438  34.077  1.00 98.34  ?  292 ASP A OD1   1 
ATOM   2211  O  OD2   . ASP A 1 292 ? 112.054 -0.239  33.186  1.00 105.87 ?  292 ASP A OD2   1 
ATOM   2212  N  N     . ARG A 1 293 ? 108.208 -1.058  31.249  1.00 87.94  ?  293 ARG A N     1 
ATOM   2213  C  CA    . ARG A 1 293 ? 107.380 -2.239  31.019  1.00 89.62  ?  293 ARG A CA    1 
ATOM   2214  C  C     . ARG A 1 293 ? 107.441 -3.277  32.156  1.00 93.56  ?  293 ARG A C     1 
ATOM   2215  O  O     . ARG A 1 293 ? 106.706 -4.273  32.132  1.00 96.53  ?  293 ARG A O     1 
ATOM   2216  C  CB    . ARG A 1 293 ? 107.739 -2.884  29.669  1.00 89.27  ?  293 ARG A CB    1 
ATOM   2217  C  CG    . ARG A 1 293 ? 108.763 -4.006  29.739  1.00 86.86  ?  293 ARG A CG    1 
ATOM   2218  C  CD    . ARG A 1 293 ? 109.398 -4.255  28.389  1.00 87.18  ?  293 ARG A CD    1 
ATOM   2219  N  NE    . ARG A 1 293 ? 110.640 -3.502  28.213  1.00 87.54  ?  293 ARG A NE    1 
ATOM   2220  C  CZ    . ARG A 1 293 ? 110.702 -2.199  27.953  1.00 88.42  ?  293 ARG A CZ    1 
ATOM   2221  N  NH1   . ARG A 1 293 ? 109.588 -1.488  27.858  1.00 88.42  ?  293 ARG A NH1   1 
ATOM   2222  N  NH2   . ARG A 1 293 ? 111.879 -1.601  27.804  1.00 89.01  ?  293 ARG A NH2   1 
ATOM   2223  N  N     . ASP A 1 294 ? 108.298 -3.035  33.150  1.00 91.21  ?  294 ASP A N     1 
ATOM   2224  C  CA    . ASP A 1 294 ? 108.522 -4.006  34.223  1.00 88.99  ?  294 ASP A CA    1 
ATOM   2225  C  C     . ASP A 1 294 ? 108.864 -3.351  35.558  1.00 82.45  ?  294 ASP A C     1 
ATOM   2226  O  O     . ASP A 1 294 ? 109.568 -3.921  36.388  1.00 83.18  ?  294 ASP A O     1 
ATOM   2227  C  CB    . ASP A 1 294 ? 109.616 -5.002  33.827  1.00 98.28  ?  294 ASP A CB    1 
ATOM   2228  C  CG    . ASP A 1 294 ? 110.835 -4.321  33.224  1.00 105.41 ?  294 ASP A CG    1 
ATOM   2229  O  OD1   . ASP A 1 294 ? 111.643 -5.017  32.570  1.00 111.42 ?  294 ASP A OD1   1 
ATOM   2230  O  OD2   . ASP A 1 294 ? 110.977 -3.090  33.399  1.00 104.00 ?  294 ASP A OD2   1 
ATOM   2231  N  N     . GLY A 1 295 ? 108.356 -2.149  35.763  1.00 76.63  ?  295 GLY A N     1 
ATOM   2232  C  CA    . GLY A 1 295 ? 108.533 -1.474  37.030  1.00 74.36  ?  295 GLY A CA    1 
ATOM   2233  C  C     . GLY A 1 295 ? 107.600 -0.291  37.081  1.00 70.46  ?  295 GLY A C     1 
ATOM   2234  O  O     . GLY A 1 295 ? 107.289 0.292   36.044  1.00 76.80  ?  295 GLY A O     1 
ATOM   2235  N  N     . LEU A 1 296 ? 107.127 0.048   38.276  1.00 59.79  ?  296 LEU A N     1 
ATOM   2236  C  CA    . LEU A 1 296 ? 106.389 1.292   38.468  1.00 51.07  ?  296 LEU A CA    1 
ATOM   2237  C  C     . LEU A 1 296 ? 107.292 2.294   39.192  1.00 49.33  ?  296 LEU A C     1 
ATOM   2238  O  O     . LEU A 1 296 ? 107.937 1.957   40.184  1.00 50.71  ?  296 LEU A O     1 
ATOM   2239  C  CB    . LEU A 1 296 ? 105.088 1.049   39.232  1.00 47.94  ?  296 LEU A CB    1 
ATOM   2240  C  CG    . LEU A 1 296 ? 104.133 2.243   39.282  1.00 35.01  ?  296 LEU A CG    1 
ATOM   2241  C  CD1   . LEU A 1 296 ? 102.783 1.844   39.838  1.00 66.14  ?  296 LEU A CD1   1 
ATOM   2242  C  CD2   . LEU A 1 296 ? 104.730 3.361   40.120  1.00 34.36  ?  296 LEU A CD2   1 
ATOM   2243  N  N     . ARG A 1 297 ? 107.368 3.513   38.670  1.00 48.00  ?  297 ARG A N     1 
ATOM   2244  C  CA    . ARG A 1 297 ? 108.260 4.520   39.231  1.00 47.57  ?  297 ARG A CA    1 
ATOM   2245  C  C     . ARG A 1 297 ? 107.874 5.934   38.833  1.00 47.97  ?  297 ARG A C     1 
ATOM   2246  O  O     . ARG A 1 297 ? 107.910 6.291   37.659  1.00 50.86  ?  297 ARG A O     1 
ATOM   2247  C  CB    . ARG A 1 297 ? 109.708 4.254   38.822  1.00 50.06  ?  297 ARG A CB    1 
ATOM   2248  C  CG    . ARG A 1 297 ? 110.641 5.427   39.074  1.00 49.17  ?  297 ARG A CG    1 
ATOM   2249  C  CD    . ARG A 1 297 ? 112.089 5.003   38.944  1.00 54.64  ?  297 ARG A CD    1 
ATOM   2250  N  NE    . ARG A 1 297 ? 112.765 5.028   40.235  1.00 57.45  ?  297 ARG A NE    1 
ATOM   2251  C  CZ    . ARG A 1 297 ? 113.656 5.948   40.588  1.00 63.79  ?  297 ARG A CZ    1 
ATOM   2252  N  NH1   . ARG A 1 297 ? 113.995 6.912   39.743  1.00 68.47  ?  297 ARG A NH1   1 
ATOM   2253  N  NH2   . ARG A 1 297 ? 114.220 5.900   41.783  1.00 64.22  ?  297 ARG A NH2   1 
ATOM   2254  N  N     . ILE A 1 298 ? 107.510 6.737   39.823  1.00 48.76  ?  298 ILE A N     1 
ATOM   2255  C  CA    . ILE A 1 298 ? 107.207 8.137   39.593  1.00 51.91  ?  298 ILE A CA    1 
ATOM   2256  C  C     . ILE A 1 298 ? 108.134 8.966   40.453  1.00 55.63  ?  298 ILE A C     1 
ATOM   2257  O  O     . ILE A 1 298 ? 108.063 8.906   41.680  1.00 56.50  ?  298 ILE A O     1 
ATOM   2258  C  CB    . ILE A 1 298 ? 105.755 8.473   39.955  1.00 48.67  ?  298 ILE A CB    1 
ATOM   2259  C  CG1   . ILE A 1 298 ? 104.808 7.407   39.399  1.00 49.27  ?  298 ILE A CG1   1 
ATOM   2260  C  CG2   . ILE A 1 298 ? 105.390 9.842   39.421  1.00 44.03  ?  298 ILE A CG2   1 
ATOM   2261  C  CD1   . ILE A 1 298 ? 103.387 7.593   39.819  1.00 44.09  ?  298 ILE A CD1   1 
ATOM   2262  N  N     . ALA A 1 299 ? 109.028 9.705   39.799  1.00 56.30  ?  299 ALA A N     1 
ATOM   2263  C  CA    . ALA A 1 299 ? 109.953 10.592  40.479  1.00 56.42  ?  299 ALA A CA    1 
ATOM   2264  C  C     . ALA A 1 299 ? 109.249 11.932  40.647  1.00 59.96  ?  299 ALA A C     1 
ATOM   2265  O  O     . ALA A 1 299 ? 108.736 12.492  39.675  1.00 63.34  ?  299 ALA A O     1 
ATOM   2266  N  N     . ILE A 1 300 ? 109.184 12.427  41.883  1.00 56.66  ?  300 ILE A N     1 
ATOM   2267  C  CA    . ILE A 1 300 ? 108.794 13.814  42.117  1.00 50.13  ?  300 ILE A CA    1 
ATOM   2268  C  C     . ILE A 1 300 ? 110.005 14.587  42.613  1.00 53.70  ?  300 ILE A C     1 
ATOM   2269  O  O     . ILE A 1 300 ? 110.290 14.630  43.813  1.00 54.33  ?  300 ILE A O     1 
ATOM   2270  C  CB    . ILE A 1 300 ? 107.657 13.958  43.125  1.00 43.26  ?  300 ILE A CB    1 
ATOM   2271  C  CG1   . ILE A 1 300 ? 106.504 13.035  42.761  1.00 40.45  ?  300 ILE A CG1   1 
ATOM   2272  C  CG2   . ILE A 1 300 ? 107.167 15.401  43.155  1.00 36.89  ?  300 ILE A CG2   1 
ATOM   2273  C  CD1   . ILE A 1 300 ? 105.342 13.171  43.701  1.00 37.68  ?  300 ILE A CD1   1 
ATOM   2274  N  N     . GLU A 1 301 ? 110.722 15.183  41.667  1.00 56.81  ?  301 GLU A N     1 
ATOM   2275  C  CA    . GLU A 1 301 ? 111.929 15.940  41.948  1.00 60.74  ?  301 GLU A CA    1 
ATOM   2276  C  C     . GLU A 1 301 ? 111.582 17.229  42.681  1.00 61.28  ?  301 GLU A C     1 
ATOM   2277  O  O     . GLU A 1 301 ? 110.739 18.002  42.219  1.00 63.56  ?  301 GLU A O     1 
ATOM   2278  C  CB    . GLU A 1 301 ? 112.638 16.247  40.633  1.00 67.28  ?  301 GLU A CB    1 
ATOM   2279  C  CG    . GLU A 1 301 ? 113.853 17.134  40.753  1.00 77.81  ?  301 GLU A CG    1 
ATOM   2280  C  CD    . GLU A 1 301 ? 114.888 16.790  39.713  1.00 89.28  ?  301 GLU A CD    1 
ATOM   2281  O  OE1   . GLU A 1 301 ? 115.274 17.682  38.929  1.00 92.44  ?  301 GLU A OE1   1 
ATOM   2282  O  OE2   . GLU A 1 301 ? 115.307 15.613  39.679  1.00 95.04  ?  301 GLU A OE2   1 
ATOM   2283  N  N     . LEU A 1 302 ? 112.213 17.452  43.832  1.00 59.35  ?  302 LEU A N     1 
ATOM   2284  C  CA    . LEU A 1 302 ? 111.963 18.671  44.600  1.00 58.43  ?  302 LEU A CA    1 
ATOM   2285  C  C     . LEU A 1 302 ? 113.038 19.723  44.370  1.00 66.46  ?  302 LEU A C     1 
ATOM   2286  O  O     . LEU A 1 302 ? 114.151 19.409  43.943  1.00 73.20  ?  302 LEU A O     1 
ATOM   2287  C  CB    . LEU A 1 302 ? 111.848 18.363  46.088  1.00 55.22  ?  302 LEU A CB    1 
ATOM   2288  C  CG    . LEU A 1 302 ? 110.696 17.423  46.405  1.00 52.38  ?  302 LEU A CG    1 
ATOM   2289  C  CD1   . LEU A 1 302 ? 110.665 17.107  47.874  1.00 52.88  ?  302 LEU A CD1   1 
ATOM   2290  C  CD2   . LEU A 1 302 ? 109.376 18.035  45.965  1.00 54.19  ?  302 LEU A CD2   1 
ATOM   2291  N  N     . LYS A 1 303 ? 112.690 20.975  44.644  1.00 66.30  ?  303 LYS A N     1 
ATOM   2292  C  CA    . LYS A 1 303 ? 113.648 22.072  44.568  1.00 70.47  ?  303 LYS A CA    1 
ATOM   2293  C  C     . LYS A 1 303 ? 114.605 22.051  45.770  1.00 75.51  ?  303 LYS A C     1 
ATOM   2294  O  O     . LYS A 1 303 ? 114.335 21.381  46.773  1.00 72.50  ?  303 LYS A O     1 
ATOM   2295  C  CB    . LYS A 1 303 ? 112.911 23.414  44.528  1.00 67.33  ?  303 LYS A CB    1 
ATOM   2296  C  CG    . LYS A 1 303 ? 112.058 23.667  43.286  1.00 62.31  ?  303 LYS A CG    1 
ATOM   2297  C  CD    . LYS A 1 303 ? 111.267 24.966  43.443  1.00 63.52  ?  303 LYS A CD    1 
ATOM   2298  C  CE    . LYS A 1 303 ? 110.512 25.364  42.183  1.00 62.94  ?  303 LYS A CE    1 
ATOM   2299  N  NZ    . LYS A 1 303 ? 109.206 25.991  42.557  1.00 60.95  ?  303 LYS A NZ    1 
ATOM   2300  N  N     . LYS A 1 304 ? 115.721 22.775  45.663  1.00 80.93  ?  304 LYS A N     1 
ATOM   2301  C  CA    . LYS A 1 304 ? 116.610 22.979  46.809  1.00 81.21  ?  304 LYS A CA    1 
ATOM   2302  C  C     . LYS A 1 304 ? 115.842 23.720  47.894  1.00 84.46  ?  304 LYS A C     1 
ATOM   2303  O  O     . LYS A 1 304 ? 115.007 24.582  47.588  1.00 84.82  ?  304 LYS A O     1 
ATOM   2304  C  CB    . LYS A 1 304 ? 117.857 23.784  46.417  1.00 78.98  ?  304 LYS A CB    1 
ATOM   2305  N  N     . ASP A 1 305 ? 116.117 23.383  49.153  1.00 85.20  ?  305 ASP A N     1 
ATOM   2306  C  CA    . ASP A 1 305 ? 115.504 24.079  50.286  1.00 85.02  ?  305 ASP A CA    1 
ATOM   2307  C  C     . ASP A 1 305 ? 113.965 23.994  50.239  1.00 83.77  ?  305 ASP A C     1 
ATOM   2308  O  O     . ASP A 1 305 ? 113.245 24.948  50.554  1.00 85.90  ?  305 ASP A O     1 
ATOM   2309  C  CB    . ASP A 1 305 ? 115.996 25.538  50.356  1.00 84.40  ?  305 ASP A CB    1 
ATOM   2310  N  N     . ALA A 1 306 ? 113.471 22.833  49.834  1.00 80.84  ?  306 ALA A N     1 
ATOM   2311  C  CA    . ALA A 1 306 ? 112.040 22.595  49.759  1.00 79.82  ?  306 ALA A CA    1 
ATOM   2312  C  C     . ALA A 1 306 ? 111.646 21.670  50.889  1.00 78.62  ?  306 ALA A C     1 
ATOM   2313  O  O     . ALA A 1 306 ? 112.240 20.601  51.058  1.00 76.55  ?  306 ALA A O     1 
ATOM   2314  C  CB    . ALA A 1 306 ? 111.682 21.973  48.422  1.00 81.17  ?  306 ALA A CB    1 
ATOM   2315  N  N     . ASN A 1 307 ? 110.647 22.079  51.664  1.00 80.32  ?  307 ASN A N     1 
ATOM   2316  C  CA    . ASN A 1 307 ? 110.216 21.280  52.807  1.00 82.02  ?  307 ASN A CA    1 
ATOM   2317  C  C     . ASN A 1 307 ? 109.567 19.975  52.352  1.00 74.51  ?  307 ASN A C     1 
ATOM   2318  O  O     . ASN A 1 307 ? 108.377 19.930  52.039  1.00 74.56  ?  307 ASN A O     1 
ATOM   2319  C  CB    . ASN A 1 307 ? 109.289 22.078  53.734  1.00 84.32  ?  307 ASN A CB    1 
ATOM   2320  C  CG    . ASN A 1 307 ? 108.824 21.267  54.932  1.00 84.11  ?  307 ASN A CG    1 
ATOM   2321  O  OD1   . ASN A 1 307 ? 109.413 20.238  55.272  1.00 86.70  ?  307 ASN A OD1   1 
ATOM   2322  N  ND2   . ASN A 1 307 ? 107.757 21.725  55.573  1.00 81.74  ?  307 ASN A ND2   1 
ATOM   2323  N  N     . THR A 1 308 ? 110.358 18.909  52.324  1.00 68.13  ?  308 THR A N     1 
ATOM   2324  C  CA    . THR A 1 308 ? 109.910 17.680  51.695  1.00 61.10  ?  308 THR A CA    1 
ATOM   2325  C  C     . THR A 1 308 ? 108.839 16.912  52.486  1.00 59.01  ?  308 THR A C     1 
ATOM   2326  O  O     . THR A 1 308 ? 108.150 16.071  51.928  1.00 43.11  ?  308 THR A O     1 
ATOM   2327  C  CB    . THR A 1 308 ? 111.107 16.799  51.206  1.00 48.49  ?  308 THR A CB    1 
ATOM   2328  O  OG1   . THR A 1 308 ? 110.923 15.429  51.588  1.00 46.82  ?  308 THR A OG1   1 
ATOM   2329  C  CG2   . THR A 1 308 ? 112.431 17.328  51.743  1.00 51.82  ?  308 THR A CG2   1 
ATOM   2330  N  N     . GLU A 1 309 ? 108.656 17.223  53.764  1.00 61.38  ?  309 GLU A N     1 
ATOM   2331  C  CA    . GLU A 1 309 ? 107.505 16.662  54.474  1.00 62.34  ?  309 GLU A CA    1 
ATOM   2332  C  C     . GLU A 1 309 ? 106.245 17.418  54.053  1.00 67.29  ?  309 GLU A C     1 
ATOM   2333  O  O     . GLU A 1 309 ? 105.210 16.808  53.774  1.00 68.85  ?  309 GLU A O     1 
ATOM   2334  C  CB    . GLU A 1 309 ? 107.682 16.716  55.994  1.00 61.44  ?  309 GLU A CB    1 
ATOM   2335  N  N     . LEU A 1 310 ? 106.348 18.746  53.987  1.00 67.70  ?  310 LEU A N     1 
ATOM   2336  C  CA    . LEU A 1 310 ? 105.204 19.595  53.646  1.00 64.23  ?  310 LEU A CA    1 
ATOM   2337  C  C     . LEU A 1 310 ? 104.578 19.152  52.331  1.00 53.32  ?  310 LEU A C     1 
ATOM   2338  O  O     . LEU A 1 310 ? 103.351 19.061  52.218  1.00 48.10  ?  310 LEU A O     1 
ATOM   2339  C  CB    . LEU A 1 310 ? 105.604 21.086  53.605  1.00 69.95  ?  310 LEU A CB    1 
ATOM   2340  C  CG    . LEU A 1 310 ? 104.637 22.287  53.428  1.00 49.48  ?  310 LEU A CG    1 
ATOM   2341  C  CD1   . LEU A 1 310 ? 104.249 22.528  51.977  1.00 45.12  ?  310 LEU A CD1   1 
ATOM   2342  C  CD2   . LEU A 1 310 ? 103.380 22.201  54.289  1.00 50.74  ?  310 LEU A CD2   1 
ATOM   2343  N  N     . VAL A 1 311 ? 105.429 18.859  51.351  1.00 52.31  ?  311 VAL A N     1 
ATOM   2344  C  CA    . VAL A 1 311 ? 104.970 18.475  50.017  1.00 55.81  ?  311 VAL A CA    1 
ATOM   2345  C  C     . VAL A 1 311 ? 104.315 17.095  50.049  1.00 57.82  ?  311 VAL A C     1 
ATOM   2346  O  O     . VAL A 1 311 ? 103.202 16.901  49.559  1.00 57.48  ?  311 VAL A O     1 
ATOM   2347  C  CB    . VAL A 1 311 ? 106.127 18.519  48.975  1.00 44.02  ?  311 VAL A CB    1 
ATOM   2348  C  CG1   . VAL A 1 311 ? 105.730 17.829  47.682  1.00 42.90  ?  311 VAL A CG1   1 
ATOM   2349  C  CG2   . VAL A 1 311 ? 106.525 19.952  48.682  1.00 41.39  ?  311 VAL A CG2   1 
ATOM   2350  N  N     . LEU A 1 312 ? 105.003 16.138  50.652  1.00 55.53  ?  312 LEU A N     1 
ATOM   2351  C  CA    . LEU A 1 312 ? 104.487 14.784  50.719  1.00 48.56  ?  312 LEU A CA    1 
ATOM   2352  C  C     . LEU A 1 312 ? 103.169 14.726  51.477  1.00 47.57  ?  312 LEU A C     1 
ATOM   2353  O  O     . LEU A 1 312 ? 102.294 13.931  51.157  1.00 47.56  ?  312 LEU A O     1 
ATOM   2354  C  CB    . LEU A 1 312 ? 105.510 13.872  51.378  1.00 44.82  ?  312 LEU A CB    1 
ATOM   2355  C  CG    . LEU A 1 312 ? 105.200 12.390  51.307  1.00 35.08  ?  312 LEU A CG    1 
ATOM   2356  C  CD1   . LEU A 1 312 ? 104.817 11.996  49.888  1.00 34.38  ?  312 LEU A CD1   1 
ATOM   2357  C  CD2   . LEU A 1 312 ? 106.427 11.646  51.761  1.00 39.00  ?  312 LEU A CD2   1 
ATOM   2358  N  N     . ASN A 1 313 ? 103.021 15.560  52.492  1.00 44.92  ?  313 ASN A N     1 
ATOM   2359  C  CA    . ASN A 1 313 ? 101.766 15.572  53.216  1.00 48.34  ?  313 ASN A CA    1 
ATOM   2360  C  C     . ASN A 1 313 ? 100.656 16.160  52.369  1.00 48.86  ?  313 ASN A C     1 
ATOM   2361  O  O     . ASN A 1 313 ? 99.523  15.669  52.375  1.00 44.74  ?  313 ASN A O     1 
ATOM   2362  C  CB    . ASN A 1 313 ? 101.895 16.347  54.519  1.00 56.29  ?  313 ASN A CB    1 
ATOM   2363  C  CG    . ASN A 1 313 ? 102.240 15.456  55.687  1.00 61.38  ?  313 ASN A CG    1 
ATOM   2364  O  OD1   . ASN A 1 313 ? 102.059 14.234  55.624  1.00 60.49  ?  313 ASN A OD1   1 
ATOM   2365  N  ND2   . ASN A 1 313 ? 102.736 16.060  56.769  1.00 66.21  ?  313 ASN A ND2   1 
ATOM   2366  N  N     . TYR A 1 314 ? 100.993 17.215  51.634  1.00 52.17  ?  314 TYR A N     1 
ATOM   2367  C  CA    . TYR A 1 314 ? 100.020 17.874  50.776  1.00 49.76  ?  314 TYR A CA    1 
ATOM   2368  C  C     . TYR A 1 314 ? 99.530  16.961  49.653  1.00 47.61  ?  314 TYR A C     1 
ATOM   2369  O  O     . TYR A 1 314 ? 98.337  16.924  49.358  1.00 51.13  ?  314 TYR A O     1 
ATOM   2370  C  CB    . TYR A 1 314 ? 100.566 19.176  50.200  1.00 48.58  ?  314 TYR A CB    1 
ATOM   2371  C  CG    . TYR A 1 314 ? 99.545  19.869  49.342  1.00 48.17  ?  314 TYR A CG    1 
ATOM   2372  C  CD1   . TYR A 1 314 ? 99.483  19.626  47.979  1.00 49.11  ?  314 TYR A CD1   1 
ATOM   2373  C  CD2   . TYR A 1 314 ? 98.612  20.733  49.897  1.00 50.15  ?  314 TYR A CD2   1 
ATOM   2374  C  CE1   . TYR A 1 314 ? 98.538  20.236  47.193  1.00 50.93  ?  314 TYR A CE1   1 
ATOM   2375  C  CE2   . TYR A 1 314 ? 97.657  21.353  49.111  1.00 52.86  ?  314 TYR A CE2   1 
ATOM   2376  C  CZ    . TYR A 1 314 ? 97.626  21.098  47.756  1.00 53.46  ?  314 TYR A CZ    1 
ATOM   2377  O  OH    . TYR A 1 314 ? 96.685  21.704  46.949  1.00 52.46  ?  314 TYR A OH    1 
ATOM   2378  N  N     . LEU A 1 315 ? 100.439 16.220  49.029  1.00 44.04  ?  315 LEU A N     1 
ATOM   2379  C  CA    . LEU A 1 315 ? 100.037 15.272  47.992  1.00 30.06  ?  315 LEU A CA    1 
ATOM   2380  C  C     . LEU A 1 315 ? 99.185  14.143  48.563  1.00 39.29  ?  315 LEU A C     1 
ATOM   2381  O  O     . LEU A 1 315 ? 98.264  13.672  47.905  1.00 40.18  ?  315 LEU A O     1 
ATOM   2382  C  CB    . LEU A 1 315 ? 101.254 14.716  47.255  1.00 30.06  ?  315 LEU A CB    1 
ATOM   2383  C  CG    . LEU A 1 315 ? 102.102 15.772  46.540  1.00 31.29  ?  315 LEU A CG    1 
ATOM   2384  C  CD1   . LEU A 1 315 ? 103.371 15.168  45.978  1.00 31.84  ?  315 LEU A CD1   1 
ATOM   2385  C  CD2   . LEU A 1 315 ? 101.294 16.443  45.439  1.00 31.01  ?  315 LEU A CD2   1 
ATOM   2386  N  N     . PHE A 1 316 ? 99.486  13.711  49.784  1.00 39.43  ?  316 PHE A N     1 
ATOM   2387  C  CA    . PHE A 1 316 ? 98.690  12.670  50.441  1.00 40.30  ?  316 PHE A CA    1 
ATOM   2388  C  C     . PHE A 1 316 ? 97.255  13.145  50.676  1.00 38.54  ?  316 PHE A C     1 
ATOM   2389  O  O     . PHE A 1 316 ? 96.295  12.373  50.534  1.00 37.86  ?  316 PHE A O     1 
ATOM   2390  C  CB    . PHE A 1 316 ? 99.317  12.237  51.780  1.00 41.04  ?  316 PHE A CB    1 
ATOM   2391  C  CG    . PHE A 1 316 ? 100.440 11.231  51.650  1.00 39.40  ?  316 PHE A CG    1 
ATOM   2392  C  CD1   . PHE A 1 316 ? 101.488 11.228  52.555  1.00 39.02  ?  316 PHE A CD1   1 
ATOM   2393  C  CD2   . PHE A 1 316 ? 100.449 10.296  50.634  1.00 42.49  ?  316 PHE A CD2   1 
ATOM   2394  C  CE1   . PHE A 1 316 ? 102.526 10.316  52.451  1.00 39.82  ?  316 PHE A CE1   1 
ATOM   2395  C  CE2   . PHE A 1 316 ? 101.486 9.378   50.519  1.00 44.44  ?  316 PHE A CE2   1 
ATOM   2396  C  CZ    . PHE A 1 316 ? 102.523 9.390   51.432  1.00 42.98  ?  316 PHE A CZ    1 
ATOM   2397  N  N     . LYS A 1 317 ? 97.107  14.415  51.046  1.00 38.59  ?  317 LYS A N     1 
ATOM   2398  C  CA    . LYS A 1 317 ? 95.785  14.937  51.370  1.00 40.19  ?  317 LYS A CA    1 
ATOM   2399  C  C     . LYS A 1 317 ? 94.979  15.240  50.111  1.00 38.63  ?  317 LYS A C     1 
ATOM   2400  O  O     . LYS A 1 317 ? 93.868  14.745  49.947  1.00 40.13  ?  317 LYS A O     1 
ATOM   2401  C  CB    . LYS A 1 317 ? 95.864  16.177  52.279  1.00 33.40  ?  317 LYS A CB    1 
ATOM   2402  C  CG    . LYS A 1 317 ? 94.483  16.731  52.653  1.00 34.69  ?  317 LYS A CG    1 
ATOM   2403  C  CD    . LYS A 1 317 ? 94.508  18.013  53.503  1.00 54.52  ?  317 LYS A CD    1 
ATOM   2404  C  CE    . LYS A 1 317 ? 93.121  18.698  53.487  1.00 59.57  ?  317 LYS A CE    1 
ATOM   2405  N  NZ    . LYS A 1 317 ? 92.860  19.682  54.597  1.00 63.63  ?  317 LYS A NZ    1 
ATOM   2406  N  N     . TYR A 1 318 ? 95.576  16.024  49.218  1.00 35.80  ?  318 TYR A N     1 
ATOM   2407  C  CA    . TYR A 1 318 ? 94.879  16.634  48.087  1.00 32.96  ?  318 TYR A CA    1 
ATOM   2408  C  C     . TYR A 1 318 ? 95.005  15.878  46.736  1.00 43.59  ?  318 TYR A C     1 
ATOM   2409  O  O     . TYR A 1 318 ? 94.495  16.328  45.706  1.00 49.41  ?  318 TYR A O     1 
ATOM   2410  C  CB    . TYR A 1 318 ? 95.326  18.098  47.952  1.00 32.02  ?  318 TYR A CB    1 
ATOM   2411  C  CG    . TYR A 1 318 ? 94.806  18.974  49.057  1.00 40.01  ?  318 TYR A CG    1 
ATOM   2412  C  CD1   . TYR A 1 318 ? 93.558  19.578  48.960  1.00 43.34  ?  318 TYR A CD1   1 
ATOM   2413  C  CD2   . TYR A 1 318 ? 95.548  19.186  50.208  1.00 41.67  ?  318 TYR A CD2   1 
ATOM   2414  C  CE1   . TYR A 1 318 ? 93.061  20.373  49.976  1.00 45.36  ?  318 TYR A CE1   1 
ATOM   2415  C  CE2   . TYR A 1 318 ? 95.057  19.977  51.241  1.00 46.98  ?  318 TYR A CE2   1 
ATOM   2416  C  CZ    . TYR A 1 318 ? 93.812  20.566  51.117  1.00 49.28  ?  318 TYR A CZ    1 
ATOM   2417  O  OH    . TYR A 1 318 ? 93.321  21.358  52.129  1.00 55.40  ?  318 TYR A OH    1 
ATOM   2418  N  N     . THR A 1 319 ? 95.685  14.740  46.736  1.00 38.91  ?  319 THR A N     1 
ATOM   2419  C  CA    . THR A 1 319 ? 95.649  13.881  45.573  1.00 43.79  ?  319 THR A CA    1 
ATOM   2420  C  C     . THR A 1 319 ? 95.282  12.466  45.962  1.00 56.05  ?  319 THR A C     1 
ATOM   2421  O  O     . THR A 1 319 ? 94.805  12.208  47.087  1.00 65.00  ?  319 THR A O     1 
ATOM   2422  C  CB    . THR A 1 319 ? 96.962  13.887  44.769  1.00 40.35  ?  319 THR A CB    1 
ATOM   2423  O  OG1   . THR A 1 319 ? 97.991  13.212  45.501  1.00 44.08  ?  319 THR A OG1   1 
ATOM   2424  C  CG2   . THR A 1 319 ? 97.382  15.315  44.439  1.00 37.63  ?  319 THR A CG2   1 
ATOM   2425  N  N     . ASP A 1 320 ? 95.450  11.561  45.004  1.00 53.76  ?  320 ASP A N     1 
ATOM   2426  C  CA    . ASP A 1 320 ? 95.105  10.167  45.213  1.00 50.42  ?  320 ASP A CA    1 
ATOM   2427  C  C     . ASP A 1 320 ? 96.355  9.381   45.537  1.00 46.05  ?  320 ASP A C     1 
ATOM   2428  O  O     . ASP A 1 320 ? 96.328  8.158   45.546  1.00 53.36  ?  320 ASP A O     1 
ATOM   2429  C  CB    . ASP A 1 320 ? 94.387  9.575   43.996  1.00 55.29  ?  320 ASP A CB    1 
ATOM   2430  C  CG    . ASP A 1 320 ? 92.896  9.906   43.966  1.00 59.97  ?  320 ASP A CG    1 
ATOM   2431  O  OD1   . ASP A 1 320 ? 92.360  10.351  44.999  1.00 58.73  ?  320 ASP A OD1   1 
ATOM   2432  O  OD2   . ASP A 1 320 ? 92.254  9.710   42.907  1.00 63.47  ?  320 ASP A OD2   1 
ATOM   2433  N  N     . LEU A 1 321 ? 97.447  10.094  45.805  1.00 37.83  ?  321 LEU A N     1 
ATOM   2434  C  CA    . LEU A 1 321 ? 98.650  9.473   46.344  1.00 36.02  ?  321 LEU A CA    1 
ATOM   2435  C  C     . LEU A 1 321 ? 98.224  8.697   47.577  1.00 35.14  ?  321 LEU A C     1 
ATOM   2436  O  O     . LEU A 1 321 ? 98.870  7.728   47.987  1.00 33.17  ?  321 LEU A O     1 
ATOM   2437  C  CB    . LEU A 1 321 ? 99.683  10.526  46.717  1.00 39.55  ?  321 LEU A CB    1 
ATOM   2438  C  CG    . LEU A 1 321 ? 101.118 10.301  46.242  1.00 43.68  ?  321 LEU A CG    1 
ATOM   2439  C  CD1   . LEU A 1 321 ? 102.113 10.591  47.355  1.00 46.34  ?  321 LEU A CD1   1 
ATOM   2440  C  CD2   . LEU A 1 321 ? 101.281 8.894   45.739  1.00 44.65  ?  321 LEU A CD2   1 
ATOM   2441  N  N     . GLN A 1 322 ? 97.102  9.131   48.145  1.00 36.70  ?  322 GLN A N     1 
ATOM   2442  C  CA    . GLN A 1 322 ? 96.453  8.446   49.255  1.00 36.43  ?  322 GLN A CA    1 
ATOM   2443  C  C     . GLN A 1 322 ? 94.965  8.729   49.246  1.00 38.99  ?  322 GLN A C     1 
ATOM   2444  O  O     . GLN A 1 322 ? 94.539  9.886   49.081  1.00 50.05  ?  322 GLN A O     1 
ATOM   2445  C  CB    . GLN A 1 322 ? 97.021  8.911   50.584  1.00 41.24  ?  322 GLN A CB    1 
ATOM   2446  C  CG    . GLN A 1 322 ? 96.196  8.478   51.752  1.00 47.84  ?  322 GLN A CG    1 
ATOM   2447  C  CD    . GLN A 1 322 ? 96.594  9.183   53.019  1.00 50.91  ?  322 GLN A CD    1 
ATOM   2448  O  OE1   . GLN A 1 322 ? 97.784  9.278   53.340  1.00 49.80  ?  322 GLN A OE1   1 
ATOM   2449  N  NE2   . GLN A 1 322 ? 95.597  9.693   53.749  1.00 50.76  ?  322 GLN A NE2   1 
ATOM   2450  N  N     . ILE A 1 323 ? 94.204  7.670   49.501  1.00 45.63  ?  323 ILE A N     1 
ATOM   2451  C  CA    . ILE A 1 323 ? 92.757  7.632   49.340  1.00 44.86  ?  323 ILE A CA    1 
ATOM   2452  C  C     . ILE A 1 323 ? 92.140  6.812   50.462  1.00 47.05  ?  323 ILE A C     1 
ATOM   2453  O  O     . ILE A 1 323 ? 92.846  6.063   51.149  1.00 47.28  ?  323 ILE A O     1 
ATOM   2454  C  CB    . ILE A 1 323 ? 92.391  6.953   48.011  1.00 46.91  ?  323 ILE A CB    1 
ATOM   2455  C  CG1   . ILE A 1 323 ? 92.885  5.498   47.994  1.00 48.58  ?  323 ILE A CG1   1 
ATOM   2456  C  CG2   . ILE A 1 323 ? 92.989  7.722   46.843  1.00 48.24  ?  323 ILE A CG2   1 
ATOM   2457  C  CD1   . ILE A 1 323 ? 91.804  4.492   48.044  1.00 35.53  ?  323 ILE A CD1   1 
ATOM   2458  N  N     . ASN A 1 324 ? 90.831  6.954   50.663  1.00 51.12  ?  324 ASN A N     1 
ATOM   2459  C  CA    . ASN A 1 324 ? 90.147  6.122   51.651  1.00 53.58  ?  324 ASN A CA    1 
ATOM   2460  C  C     . ASN A 1 324 ? 89.386  5.049   50.919  1.00 54.69  ?  324 ASN A C     1 
ATOM   2461  O  O     . ASN A 1 324 ? 88.602  5.352   50.029  1.00 60.42  ?  324 ASN A O     1 
ATOM   2462  C  CB    . ASN A 1 324 ? 89.152  6.919   52.507  1.00 51.89  ?  324 ASN A CB    1 
ATOM   2463  C  CG    . ASN A 1 324 ? 89.744  8.170   53.094  1.00 62.06  ?  324 ASN A CG    1 
ATOM   2464  O  OD1   . ASN A 1 324 ? 90.907  8.200   53.475  1.00 79.79  ?  324 ASN A OD1   1 
ATOM   2465  N  ND2   . ASN A 1 324 ? 88.943  9.219   53.167  1.00 40.69  ?  324 ASN A ND2   1 
ATOM   2466  N  N     . TYR A 1 325 ? 89.621  3.798   51.280  1.00 50.14  ?  325 TYR A N     1 
ATOM   2467  C  CA    . TYR A 1 325 ? 88.844  2.694   50.739  1.00 48.52  ?  325 TYR A CA    1 
ATOM   2468  C  C     . TYR A 1 325 ? 87.670  2.364   51.669  1.00 44.99  ?  325 TYR A C     1 
ATOM   2469  O  O     . TYR A 1 325 ? 87.852  2.216   52.880  1.00 49.10  ?  325 TYR A O     1 
ATOM   2470  C  CB    . TYR A 1 325 ? 89.729  1.457   50.517  1.00 50.05  ?  325 TYR A CB    1 
ATOM   2471  C  CG    . TYR A 1 325 ? 88.953  0.295   49.957  1.00 51.50  ?  325 TYR A CG    1 
ATOM   2472  C  CD1   . TYR A 1 325 ? 88.265  -0.573  50.796  1.00 53.36  ?  325 TYR A CD1   1 
ATOM   2473  C  CD2   . TYR A 1 325 ? 88.878  0.082   48.580  1.00 53.14  ?  325 TYR A CD2   1 
ATOM   2474  C  CE1   . TYR A 1 325 ? 87.531  -1.631  50.281  1.00 54.41  ?  325 TYR A CE1   1 
ATOM   2475  C  CE2   . TYR A 1 325 ? 88.150  -0.978  48.050  1.00 53.17  ?  325 TYR A CE2   1 
ATOM   2476  C  CZ    . TYR A 1 325 ? 87.474  -1.830  48.906  1.00 52.45  ?  325 TYR A CZ    1 
ATOM   2477  O  OH    . TYR A 1 325 ? 86.745  -2.879  48.390  1.00 47.14  ?  325 TYR A OH    1 
ATOM   2478  N  N     . ASN A 1 326 ? 86.471  2.239   51.107  1.00 39.11  ?  326 ASN A N     1 
ATOM   2479  C  CA    . ASN A 1 326 ? 85.295  1.901   51.906  1.00 43.51  ?  326 ASN A CA    1 
ATOM   2480  C  C     . ASN A 1 326 ? 84.757  0.504   51.674  1.00 40.88  ?  326 ASN A C     1 
ATOM   2481  O  O     . ASN A 1 326 ? 84.140  0.247   50.646  1.00 47.10  ?  326 ASN A O     1 
ATOM   2482  C  CB    . ASN A 1 326 ? 84.162  2.903   51.681  1.00 51.58  ?  326 ASN A CB    1 
ATOM   2483  C  CG    . ASN A 1 326 ? 84.454  4.242   52.290  1.00 60.17  ?  326 ASN A CG    1 
ATOM   2484  O  OD1   . ASN A 1 326 ? 83.995  4.548   53.392  1.00 65.37  ?  326 ASN A OD1   1 
ATOM   2485  N  ND2   . ASN A 1 326 ? 85.245  5.049   51.588  1.00 60.18  ?  326 ASN A ND2   1 
ATOM   2486  N  N     . PHE A 1 327 ? 84.986  -0.392  52.631  1.00 36.34  ?  327 PHE A N     1 
ATOM   2487  C  CA    . PHE A 1 327 ? 84.302  -1.672  52.646  1.00 37.53  ?  327 PHE A CA    1 
ATOM   2488  C  C     . PHE A 1 327 ? 82.809  -1.379  52.634  1.00 41.24  ?  327 PHE A C     1 
ATOM   2489  O  O     . PHE A 1 327 ? 82.335  -0.537  53.399  1.00 45.84  ?  327 PHE A O     1 
ATOM   2490  C  CB    . PHE A 1 327 ? 84.605  -2.442  53.929  1.00 42.19  ?  327 PHE A CB    1 
ATOM   2491  C  CG    . PHE A 1 327 ? 85.999  -3.000  54.019  1.00 42.88  ?  327 PHE A CG    1 
ATOM   2492  C  CD1   . PHE A 1 327 ? 86.226  -4.352  53.842  1.00 43.86  ?  327 PHE A CD1   1 
ATOM   2493  C  CD2   . PHE A 1 327 ? 87.070  -2.188  54.349  1.00 41.34  ?  327 PHE A CD2   1 
ATOM   2494  C  CE1   . PHE A 1 327 ? 87.508  -4.872  53.958  1.00 43.37  ?  327 PHE A CE1   1 
ATOM   2495  C  CE2   . PHE A 1 327 ? 88.347  -2.702  54.478  1.00 40.05  ?  327 PHE A CE2   1 
ATOM   2496  C  CZ    . PHE A 1 327 ? 88.573  -4.037  54.274  1.00 38.71  ?  327 PHE A CZ    1 
ATOM   2497  N  N     . ASN A 1 328 ? 82.081  -2.060  51.755  1.00 32.77  ?  328 ASN A N     1 
ATOM   2498  C  CA    . ASN A 1 328 ? 80.625  -2.126  51.814  1.00 33.07  ?  328 ASN A CA    1 
ATOM   2499  C  C     . ASN A 1 328 ? 80.202  -3.520  51.300  1.00 37.97  ?  328 ASN A C     1 
ATOM   2500  O  O     . ASN A 1 328 ? 79.481  -3.668  50.326  1.00 40.86  ?  328 ASN A O     1 
ATOM   2501  C  CB    . ASN A 1 328 ? 79.984  -0.958  51.053  1.00 33.57  ?  328 ASN A CB    1 
ATOM   2502  C  CG    . ASN A 1 328 ? 78.459  -1.047  50.993  1.00 49.26  ?  328 ASN A CG    1 
ATOM   2503  O  OD1   . ASN A 1 328 ? 77.819  -1.642  51.858  1.00 48.40  ?  328 ASN A OD1   1 
ATOM   2504  N  ND2   . ASN A 1 328 ? 77.875  -0.455  49.956  1.00 46.36  ?  328 ASN A ND2   1 
ATOM   2505  N  N     . MET A 1 329 ? 80.685  -4.548  51.981  1.00 37.54  ?  329 MET A N     1 
ATOM   2506  C  CA    . MET A 1 329 ? 80.476  -5.929  51.561  1.00 40.86  ?  329 MET A CA    1 
ATOM   2507  C  C     . MET A 1 329 ? 79.012  -6.380  51.562  1.00 43.56  ?  329 MET A C     1 
ATOM   2508  O  O     . MET A 1 329 ? 78.453  -6.782  52.572  1.00 47.38  ?  329 MET A O     1 
ATOM   2509  C  CB    . MET A 1 329 ? 81.348  -6.875  52.394  1.00 37.22  ?  329 MET A CB    1 
ATOM   2510  C  CG    . MET A 1 329 ? 82.724  -6.306  52.644  1.00 35.09  ?  329 MET A CG    1 
ATOM   2511  S  SD    . MET A 1 329 ? 83.953  -7.460  53.266  1.00 54.11  ?  329 MET A SD    1 
ATOM   2512  C  CE    . MET A 1 329 ? 83.329  -7.830  54.897  1.00 38.50  ?  329 MET A CE    1 
ATOM   2513  N  N     . VAL A 1 330 ? 78.408  -6.311  50.393  1.00 39.80  ?  330 VAL A N     1 
ATOM   2514  C  CA    . VAL A 1 330 ? 77.095  -6.862  50.170  1.00 40.46  ?  330 VAL A CA    1 
ATOM   2515  C  C     . VAL A 1 330 ? 77.170  -7.934  49.075  1.00 39.64  ?  330 VAL A C     1 
ATOM   2516  O  O     . VAL A 1 330 ? 77.760  -7.717  48.017  1.00 44.46  ?  330 VAL A O     1 
ATOM   2517  C  CB    . VAL A 1 330 ? 76.159  -5.756  49.738  1.00 32.10  ?  330 VAL A CB    1 
ATOM   2518  C  CG1   . VAL A 1 330 ? 74.776  -6.309  49.482  1.00 38.26  ?  330 VAL A CG1   1 
ATOM   2519  C  CG2   . VAL A 1 330 ? 76.134  -4.702  50.816  1.00 36.37  ?  330 VAL A CG2   1 
ATOM   2520  N  N     . ALA A 1 331 ? 76.592  -9.099  49.340  1.00 36.54  ?  331 ALA A N     1 
ATOM   2521  C  CA    . ALA A 1 331 ? 76.603  -10.182 48.377  1.00 39.71  ?  331 ALA A CA    1 
ATOM   2522  C  C     . ALA A 1 331 ? 75.210  -10.773 48.303  1.00 30.37  ?  331 ALA A C     1 
ATOM   2523  O  O     . ALA A 1 331 ? 74.342  -10.385 49.072  1.00 54.64  ?  331 ALA A O     1 
ATOM   2524  C  CB    . ALA A 1 331 ? 77.597  -11.242 48.799  1.00 46.36  ?  331 ALA A CB    1 
ATOM   2525  N  N     . ILE A 1 332 ? 74.993  -11.709 47.384  1.00 40.95  ?  332 ILE A N     1 
ATOM   2526  C  CA    . ILE A 1 332 ? 73.717  -12.412 47.315  1.00 38.71  ?  332 ILE A CA    1 
ATOM   2527  C  C     . ILE A 1 332 ? 73.780  -13.739 48.078  1.00 40.83  ?  332 ILE A C     1 
ATOM   2528  O  O     . ILE A 1 332 ? 74.533  -14.647 47.731  1.00 40.24  ?  332 ILE A O     1 
ATOM   2529  C  CB    . ILE A 1 332 ? 73.243  -12.632 45.853  1.00 30.36  ?  332 ILE A CB    1 
ATOM   2530  C  CG1   . ILE A 1 332 ? 73.093  -11.297 45.144  1.00 35.64  ?  332 ILE A CG1   1 
ATOM   2531  C  CG2   . ILE A 1 332 ? 71.890  -13.327 45.812  1.00 30.95  ?  332 ILE A CG2   1 
ATOM   2532  C  CD1   . ILE A 1 332 ? 71.883  -10.522 45.595  1.00 31.61  ?  332 ILE A CD1   1 
ATOM   2533  N  N     . ASP A 1 333 ? 72.992  -13.821 49.143  1.00 45.82  ?  333 ASP A N     1 
ATOM   2534  C  CA    . ASP A 1 333 ? 72.850  -15.037 49.926  1.00 48.68  ?  333 ASP A CA    1 
ATOM   2535  C  C     . ASP A 1 333 ? 71.360  -15.375 49.934  1.00 48.66  ?  333 ASP A C     1 
ATOM   2536  O  O     . ASP A 1 333 ? 70.515  -14.509 50.176  1.00 48.24  ?  333 ASP A O     1 
ATOM   2537  C  CB    . ASP A 1 333 ? 73.395  -14.814 51.337  1.00 55.07  ?  333 ASP A CB    1 
ATOM   2538  C  CG    . ASP A 1 333 ? 73.142  -15.987 52.258  1.00 69.42  ?  333 ASP A CG    1 
ATOM   2539  O  OD1   . ASP A 1 333 ? 72.000  -16.111 52.745  1.00 79.03  ?  333 ASP A OD1   1 
ATOM   2540  O  OD2   . ASP A 1 333 ? 74.081  -16.773 52.516  1.00 72.53  ?  333 ASP A OD2   1 
ATOM   2541  N  N     . ASN A 1 334 ? 71.036  -16.622 49.619  1.00 48.99  ?  334 ASN A N     1 
ATOM   2542  C  CA    . ASN A 1 334 ? 69.648  -17.033 49.434  1.00 48.38  ?  334 ASN A CA    1 
ATOM   2543  C  C     . ASN A 1 334 ? 68.800  -16.114 48.522  1.00 45.67  ?  334 ASN A C     1 
ATOM   2544  O  O     . ASN A 1 334 ? 67.665  -15.759 48.855  1.00 44.03  ?  334 ASN A O     1 
ATOM   2545  C  CB    . ASN A 1 334 ? 68.974  -17.223 50.789  1.00 51.23  ?  334 ASN A CB    1 
ATOM   2546  C  CG    . ASN A 1 334 ? 67.663  -17.954 50.678  1.00 55.72  ?  334 ASN A CG    1 
ATOM   2547  O  OD1   . ASN A 1 334 ? 67.479  -18.787 49.779  1.00 56.28  ?  334 ASN A OD1   1 
ATOM   2548  N  ND2   . ASN A 1 334 ? 66.732  -17.644 51.581  1.00 56.94  ?  334 ASN A ND2   1 
ATOM   2549  N  N     . PHE A 1 335 ? 69.357  -15.742 47.370  1.00 45.25  ?  335 PHE A N     1 
ATOM   2550  C  CA    . PHE A 1 335 ? 68.639  -14.951 46.368  1.00 46.04  ?  335 PHE A CA    1 
ATOM   2551  C  C     . PHE A 1 335 ? 68.372  -13.529 46.810  1.00 44.13  ?  335 PHE A C     1 
ATOM   2552  O  O     . PHE A 1 335 ? 67.663  -12.784 46.136  1.00 42.90  ?  335 PHE A O     1 
ATOM   2553  C  CB    . PHE A 1 335 ? 67.322  -15.625 46.015  1.00 49.62  ?  335 PHE A CB    1 
ATOM   2554  C  CG    . PHE A 1 335 ? 67.492  -17.011 45.506  1.00 52.92  ?  335 PHE A CG    1 
ATOM   2555  C  CD1   . PHE A 1 335 ? 67.091  -18.098 46.269  1.00 53.38  ?  335 PHE A CD1   1 
ATOM   2556  C  CD2   . PHE A 1 335 ? 68.088  -17.234 44.271  1.00 54.28  ?  335 PHE A CD2   1 
ATOM   2557  C  CE1   . PHE A 1 335 ? 67.265  -19.387 45.800  1.00 52.86  ?  335 PHE A CE1   1 
ATOM   2558  C  CE2   . PHE A 1 335 ? 68.264  -18.515 43.803  1.00 54.46  ?  335 PHE A CE2   1 
ATOM   2559  C  CZ    . PHE A 1 335 ? 67.853  -19.595 44.571  1.00 53.15  ?  335 PHE A CZ    1 
ATOM   2560  N  N     . THR A 1 336 ? 68.960  -13.160 47.940  1.00 45.13  ?  336 THR A N     1 
ATOM   2561  C  CA    . THR A 1 336 ? 68.660  -11.899 48.593  1.00 46.82  ?  336 THR A CA    1 
ATOM   2562  C  C     . THR A 1 336 ? 69.939  -11.091 48.750  1.00 48.38  ?  336 THR A C     1 
ATOM   2563  O  O     . THR A 1 336 ? 70.987  -11.644 49.068  1.00 49.85  ?  336 THR A O     1 
ATOM   2564  C  CB    . THR A 1 336 ? 68.064  -12.171 49.995  1.00 45.50  ?  336 THR A CB    1 
ATOM   2565  O  OG1   . THR A 1 336 ? 67.470  -13.477 50.009  1.00 51.84  ?  336 THR A OG1   1 
ATOM   2566  C  CG2   . THR A 1 336 ? 67.015  -11.135 50.373  1.00 40.37  ?  336 THR A CG2   1 
ATOM   2567  N  N     . PRO A 1 337 ? 69.864  -9.777  48.523  1.00 48.76  ?  337 PRO A N     1 
ATOM   2568  C  CA    . PRO A 1 337 ? 70.999  -8.935  48.903  1.00 46.95  ?  337 PRO A CA    1 
ATOM   2569  C  C     . PRO A 1 337 ? 71.204  -9.001  50.418  1.00 51.88  ?  337 PRO A C     1 
ATOM   2570  O  O     . PRO A 1 337 ? 70.241  -9.196  51.168  1.00 56.08  ?  337 PRO A O     1 
ATOM   2571  C  CB    . PRO A 1 337 ? 70.556  -7.533  48.479  1.00 44.58  ?  337 PRO A CB    1 
ATOM   2572  C  CG    . PRO A 1 337 ? 69.080  -7.587  48.468  1.00 49.25  ?  337 PRO A CG    1 
ATOM   2573  C  CD    . PRO A 1 337 ? 68.722  -8.986  48.043  1.00 52.23  ?  337 PRO A CD    1 
ATOM   2574  N  N     . ARG A 1 338 ? 72.448  -8.866  50.861  1.00 48.85  ?  338 ARG A N     1 
ATOM   2575  C  CA    . ARG A 1 338 ? 72.772  -9.031  52.273  1.00 46.43  ?  338 ARG A CA    1 
ATOM   2576  C  C     . ARG A 1 338 ? 74.123  -8.389  52.595  1.00 45.35  ?  338 ARG A C     1 
ATOM   2577  O  O     . ARG A 1 338 ? 75.126  -8.653  51.935  1.00 43.14  ?  338 ARG A O     1 
ATOM   2578  C  CB    . ARG A 1 338 ? 72.743  -10.520 52.667  1.00 45.01  ?  338 ARG A CB    1 
ATOM   2579  C  CG    . ARG A 1 338 ? 73.059  -10.798 54.144  1.00 53.29  ?  338 ARG A CG    1 
ATOM   2580  C  CD    . ARG A 1 338 ? 73.128  -12.304 54.449  1.00 62.56  ?  338 ARG A CD    1 
ATOM   2581  N  NE    . ARG A 1 338 ? 73.486  -12.598 55.844  1.00 67.01  ?  338 ARG A NE    1 
ATOM   2582  C  CZ    . ARG A 1 338 ? 73.940  -13.777 56.279  1.00 65.82  ?  338 ARG A CZ    1 
ATOM   2583  N  NH1   . ARG A 1 338 ? 74.108  -14.787 55.434  1.00 62.98  ?  338 ARG A NH1   1 
ATOM   2584  N  NH2   . ARG A 1 338 ? 74.239  -13.945 57.561  1.00 65.73  ?  338 ARG A NH2   1 
ATOM   2585  N  N     . GLN A 1 339 ? 74.146  -7.513  53.590  1.00 46.20  ?  339 GLN A N     1 
ATOM   2586  C  CA    . GLN A 1 339 ? 75.418  -6.978  54.035  1.00 42.14  ?  339 GLN A CA    1 
ATOM   2587  C  C     . GLN A 1 339 ? 75.993  -7.997  54.987  1.00 42.13  ?  339 GLN A C     1 
ATOM   2588  O  O     . GLN A 1 339 ? 75.271  -8.553  55.817  1.00 51.75  ?  339 GLN A O     1 
ATOM   2589  C  CB    . GLN A 1 339 ? 75.241  -5.644  54.721  1.00 43.32  ?  339 GLN A CB    1 
ATOM   2590  C  CG    . GLN A 1 339 ? 76.538  -4.952  55.025  1.00 45.17  ?  339 GLN A CG    1 
ATOM   2591  C  CD    . GLN A 1 339 ? 76.326  -3.527  55.503  1.00 51.33  ?  339 GLN A CD    1 
ATOM   2592  O  OE1   . GLN A 1 339 ? 75.586  -2.752  54.882  1.00 56.08  ?  339 GLN A OE1   1 
ATOM   2593  N  NE2   . GLN A 1 339 ? 76.973  -3.172  56.613  1.00 51.28  ?  339 GLN A NE2   1 
ATOM   2594  N  N     . VAL A 1 340 ? 77.282  -8.266  54.845  1.00 36.38  ?  340 VAL A N     1 
ATOM   2595  C  CA    . VAL A 1 340 ? 77.908  -9.382  55.539  1.00 37.80  ?  340 VAL A CA    1 
ATOM   2596  C  C     . VAL A 1 340 ? 79.341  -9.046  55.881  1.00 38.28  ?  340 VAL A C     1 
ATOM   2597  O  O     . VAL A 1 340 ? 79.973  -8.236  55.225  1.00 42.27  ?  340 VAL A O     1 
ATOM   2598  C  CB    . VAL A 1 340 ? 77.912  -10.648 54.674  1.00 37.22  ?  340 VAL A CB    1 
ATOM   2599  C  CG1   . VAL A 1 340 ? 76.505  -11.098 54.396  1.00 35.25  ?  340 VAL A CG1   1 
ATOM   2600  C  CG2   . VAL A 1 340 ? 78.637  -10.378 53.363  1.00 43.58  ?  340 VAL A CG2   1 
ATOM   2601  N  N     . GLY A 1 341 ? 79.853  -9.673  56.919  1.00 37.42  ?  341 GLY A N     1 
ATOM   2602  C  CA    . GLY A 1 341 ? 81.230  -9.471  57.283  1.00 41.76  ?  341 GLY A CA    1 
ATOM   2603  C  C     . GLY A 1 341 ? 81.988  -10.747 57.013  1.00 46.21  ?  341 GLY A C     1 
ATOM   2604  O  O     . GLY A 1 341 ? 81.470  -11.668 56.371  1.00 48.85  ?  341 GLY A O     1 
ATOM   2605  N  N     . ILE A 1 342 ? 83.215  -10.799 57.519  1.00 46.40  ?  342 ILE A N     1 
ATOM   2606  C  CA    . ILE A 1 342 ? 84.086  -11.941 57.313  1.00 47.01  ?  342 ILE A CA    1 
ATOM   2607  C  C     . ILE A 1 342 ? 83.437  -13.246 57.751  1.00 51.35  ?  342 ILE A C     1 
ATOM   2608  O  O     . ILE A 1 342 ? 83.650  -14.268 57.122  1.00 52.25  ?  342 ILE A O     1 
ATOM   2609  C  CB    . ILE A 1 342 ? 85.474  -11.718 57.972  1.00 47.81  ?  342 ILE A CB    1 
ATOM   2610  C  CG1   . ILE A 1 342 ? 86.493  -11.388 56.893  1.00 52.87  ?  342 ILE A CG1   1 
ATOM   2611  C  CG2   . ILE A 1 342 ? 85.945  -12.931 58.706  1.00 44.77  ?  342 ILE A CG2   1 
ATOM   2612  C  CD1   . ILE A 1 342 ? 86.002  -10.327 55.942  1.00 58.82  ?  342 ILE A CD1   1 
ATOM   2613  N  N     . VAL A 1 343 ? 82.614  -13.222 58.795  1.00 45.87  ?  343 VAL A N     1 
ATOM   2614  C  CA    . VAL A 1 343 ? 82.065  -14.483 59.298  1.00 42.21  ?  343 VAL A CA    1 
ATOM   2615  C  C     . VAL A 1 343 ? 81.039  -15.160 58.383  1.00 44.52  ?  343 VAL A C     1 
ATOM   2616  O  O     . VAL A 1 343 ? 81.331  -16.214 57.819  1.00 48.83  ?  343 VAL A O     1 
ATOM   2617  C  CB    . VAL A 1 343 ? 81.570  -14.394 60.748  1.00 35.73  ?  343 VAL A CB    1 
ATOM   2618  C  CG1   . VAL A 1 343 ? 80.513  -15.445 61.007  1.00 35.25  ?  343 VAL A CG1   1 
ATOM   2619  C  CG2   . VAL A 1 343 ? 82.750  -14.584 61.689  1.00 31.14  ?  343 VAL A CG2   1 
ATOM   2620  N  N     . PRO A 1 344 ? 79.847  -14.564 58.217  1.00 39.97  ?  344 PRO A N     1 
ATOM   2621  C  CA    . PRO A 1 344 ? 78.874  -15.200 57.313  1.00 42.96  ?  344 PRO A CA    1 
ATOM   2622  C  C     . PRO A 1 344 ? 79.465  -15.516 55.924  1.00 45.37  ?  344 PRO A C     1 
ATOM   2623  O  O     . PRO A 1 344 ? 79.037  -16.484 55.289  1.00 46.74  ?  344 PRO A O     1 
ATOM   2624  C  CB    . PRO A 1 344 ? 77.741  -14.161 57.214  1.00 38.38  ?  344 PRO A CB    1 
ATOM   2625  C  CG    . PRO A 1 344 ? 78.385  -12.876 57.526  1.00 35.93  ?  344 PRO A CG    1 
ATOM   2626  C  CD    . PRO A 1 344 ? 79.420  -13.217 58.611  1.00 36.37  ?  344 PRO A CD    1 
ATOM   2627  N  N     . ILE A 1 345 ? 80.435  -14.724 55.467  1.00 41.76  ?  345 ILE A N     1 
ATOM   2628  C  CA    . ILE A 1 345 ? 81.100  -15.003 54.194  1.00 42.17  ?  345 ILE A CA    1 
ATOM   2629  C  C     . ILE A 1 345 ? 81.773  -16.381 54.156  1.00 39.35  ?  345 ILE A C     1 
ATOM   2630  O  O     . ILE A 1 345 ? 81.544  -17.161 53.240  1.00 42.72  ?  345 ILE A O     1 
ATOM   2631  C  CB    . ILE A 1 345 ? 82.100  -13.902 53.818  1.00 41.27  ?  345 ILE A CB    1 
ATOM   2632  C  CG1   . ILE A 1 345 ? 81.365  -12.767 53.110  1.00 39.39  ?  345 ILE A CG1   1 
ATOM   2633  C  CG2   . ILE A 1 345 ? 83.176  -14.448 52.905  1.00 27.92  ?  345 ILE A CG2   1 
ATOM   2634  C  CD1   . ILE A 1 345 ? 82.177  -11.493 52.993  1.00 36.77  ?  345 ILE A CD1   1 
ATOM   2635  N  N     . LEU A 1 346 ? 82.593  -16.681 55.153  1.00 31.94  ?  346 LEU A N     1 
ATOM   2636  C  CA    . LEU A 1 346 ? 83.242  -17.985 55.233  1.00 31.69  ?  346 LEU A CA    1 
ATOM   2637  C  C     . LEU A 1 346 ? 82.279  -19.103 55.637  1.00 35.29  ?  346 LEU A C     1 
ATOM   2638  O  O     . LEU A 1 346 ? 82.507  -20.269 55.339  1.00 34.29  ?  346 LEU A O     1 
ATOM   2639  C  CB    . LEU A 1 346 ? 84.418  -17.941 56.203  1.00 32.07  ?  346 LEU A CB    1 
ATOM   2640  C  CG    . LEU A 1 346 ? 85.553  -16.977 55.871  1.00 28.76  ?  346 LEU A CG    1 
ATOM   2641  C  CD1   . LEU A 1 346 ? 86.486  -16.885 57.061  1.00 24.82  ?  346 LEU A CD1   1 
ATOM   2642  C  CD2   . LEU A 1 346 ? 86.305  -17.386 54.619  1.00 24.33  ?  346 LEU A CD2   1 
ATOM   2643  N  N     . SER A 1 347 ? 81.214  -18.756 56.340  1.00 37.54  ?  347 SER A N     1 
ATOM   2644  C  CA    . SER A 1 347 ? 80.202  -19.745 56.669  1.00 44.99  ?  347 SER A CA    1 
ATOM   2645  C  C     . SER A 1 347 ? 79.612  -20.224 55.371  1.00 48.55  ?  347 SER A C     1 
ATOM   2646  O  O     . SER A 1 347 ? 79.488  -21.426 55.137  1.00 49.33  ?  347 SER A O     1 
ATOM   2647  C  CB    . SER A 1 347 ? 79.090  -19.117 57.499  1.00 52.72  ?  347 SER A CB    1 
ATOM   2648  O  OG    . SER A 1 347 ? 79.643  -18.233 58.448  1.00 57.41  ?  347 SER A OG    1 
ATOM   2649  N  N     . SER A 1 348 ? 79.250  -19.251 54.536  1.00 48.58  ?  348 SER A N     1 
ATOM   2650  C  CA    . SER A 1 348 ? 78.590  -19.505 53.270  1.00 44.97  ?  348 SER A CA    1 
ATOM   2651  C  C     . SER A 1 348 ? 79.507  -20.303 52.382  1.00 35.26  ?  348 SER A C     1 
ATOM   2652  O  O     . SER A 1 348 ? 79.098  -21.280 51.765  1.00 35.73  ?  348 SER A O     1 
ATOM   2653  C  CB    . SER A 1 348 ? 78.219  -18.193 52.587  1.00 51.36  ?  348 SER A CB    1 
ATOM   2654  O  OG    . SER A 1 348 ? 77.050  -17.648 53.166  1.00 61.04  ?  348 SER A OG    1 
ATOM   2655  N  N     . TYR A 1 349 ? 80.760  -19.884 52.321  1.00 33.71  ?  349 TYR A N     1 
ATOM   2656  C  CA    . TYR A 1 349 ? 81.721  -20.589 51.509  1.00 35.40  ?  349 TYR A CA    1 
ATOM   2657  C  C     . TYR A 1 349 ? 81.770  -22.043 51.932  1.00 35.64  ?  349 TYR A C     1 
ATOM   2658  O  O     . TYR A 1 349 ? 81.553  -22.954 51.129  1.00 39.31  ?  349 TYR A O     1 
ATOM   2659  C  CB    . TYR A 1 349 ? 83.107  -19.968 51.621  1.00 32.00  ?  349 TYR A CB    1 
ATOM   2660  C  CG    . TYR A 1 349 ? 84.092  -20.733 50.788  1.00 33.50  ?  349 TYR A CG    1 
ATOM   2661  C  CD1   . TYR A 1 349 ? 83.992  -20.736 49.411  1.00 35.62  ?  349 TYR A CD1   1 
ATOM   2662  C  CD2   . TYR A 1 349 ? 85.093  -21.486 51.374  1.00 38.01  ?  349 TYR A CD2   1 
ATOM   2663  C  CE1   . TYR A 1 349 ? 84.864  -21.451 48.647  1.00 36.23  ?  349 TYR A CE1   1 
ATOM   2664  C  CE2   . TYR A 1 349 ? 85.979  -22.201 50.609  1.00 39.99  ?  349 TYR A CE2   1 
ATOM   2665  C  CZ    . TYR A 1 349 ? 85.853  -22.181 49.249  1.00 38.67  ?  349 TYR A CZ    1 
ATOM   2666  O  OH    . TYR A 1 349 ? 86.724  -22.892 48.475  1.00 41.13  ?  349 TYR A OH    1 
ATOM   2667  N  N     . ILE A 1 350 ? 82.053  -22.252 53.206  1.00 31.81  ?  350 ILE A N     1 
ATOM   2668  C  CA    . ILE A 1 350 ? 82.171  -23.589 53.749  1.00 30.21  ?  350 ILE A CA    1 
ATOM   2669  C  C     . ILE A 1 350 ? 80.903  -24.419 53.572  1.00 35.81  ?  350 ILE A C     1 
ATOM   2670  O  O     . ILE A 1 350 ? 80.964  -25.574 53.151  1.00 43.80  ?  350 ILE A O     1 
ATOM   2671  C  CB    . ILE A 1 350 ? 82.574  -23.541 55.209  1.00 30.95  ?  350 ILE A CB    1 
ATOM   2672  C  CG1   . ILE A 1 350 ? 83.956  -22.898 55.329  1.00 24.91  ?  350 ILE A CG1   1 
ATOM   2673  C  CG2   . ILE A 1 350 ? 82.570  -24.935 55.791  1.00 25.92  ?  350 ILE A CG2   1 
ATOM   2674  C  CD1   . ILE A 1 350 ? 84.515  -22.919 56.727  1.00 33.20  ?  350 ILE A CD1   1 
ATOM   2675  N  N     . ALA A 1 351 ? 79.754  -23.836 53.876  1.00 34.95  ?  351 ALA A N     1 
ATOM   2676  C  CA    . ALA A 1 351 ? 78.492  -24.524 53.608  1.00 37.79  ?  351 ALA A CA    1 
ATOM   2677  C  C     . ALA A 1 351 ? 78.425  -24.977 52.148  1.00 39.07  ?  351 ALA A C     1 
ATOM   2678  O  O     . ALA A 1 351 ? 78.037  -26.107 51.847  1.00 39.08  ?  351 ALA A O     1 
ATOM   2679  C  CB    . ALA A 1 351 ? 77.326  -23.625 53.932  1.00 42.48  ?  351 ALA A CB    1 
ATOM   2680  N  N     . HIS A 1 352 ? 78.815  -24.071 51.254  1.00 40.31  ?  352 HIS A N     1 
ATOM   2681  C  CA    . HIS A 1 352 ? 78.817  -24.321 49.826  1.00 35.23  ?  352 HIS A CA    1 
ATOM   2682  C  C     . HIS A 1 352 ? 79.762  -25.447 49.445  1.00 29.97  ?  352 HIS A C     1 
ATOM   2683  O  O     . HIS A 1 352 ? 79.339  -26.421 48.829  1.00 30.76  ?  352 HIS A O     1 
ATOM   2684  C  CB    . HIS A 1 352 ? 79.191  -23.056 49.062  1.00 36.00  ?  352 HIS A CB    1 
ATOM   2685  C  CG    . HIS A 1 352 ? 79.262  -23.257 47.585  1.00 39.29  ?  352 HIS A CG    1 
ATOM   2686  N  ND1   . HIS A 1 352 ? 78.144  -23.472 46.811  1.00 39.37  ?  352 HIS A ND1   1 
ATOM   2687  C  CD2   . HIS A 1 352 ? 80.322  -23.310 46.743  1.00 39.68  ?  352 HIS A CD2   1 
ATOM   2688  C  CE1   . HIS A 1 352 ? 78.511  -23.638 45.553  1.00 38.91  ?  352 HIS A CE1   1 
ATOM   2689  N  NE2   . HIS A 1 352 ? 79.825  -23.547 45.487  1.00 39.73  ?  352 HIS A NE2   1 
ATOM   2690  N  N     . ARG A 1 353 ? 81.042  -25.324 49.794  1.00 27.80  ?  353 ARG A N     1 
ATOM   2691  C  CA    . ARG A 1 353 ? 81.968  -26.429 49.542  1.00 36.67  ?  353 ARG A CA    1 
ATOM   2692  C  C     . ARG A 1 353 ? 81.446  -27.754 50.106  1.00 40.26  ?  353 ARG A C     1 
ATOM   2693  O  O     . ARG A 1 353 ? 81.633  -28.798 49.489  1.00 44.21  ?  353 ARG A O     1 
ATOM   2694  C  CB    . ARG A 1 353 ? 83.360  -26.137 50.082  1.00 30.03  ?  353 ARG A CB    1 
ATOM   2695  C  CG    . ARG A 1 353 ? 84.173  -25.152 49.259  1.00 31.65  ?  353 ARG A CG    1 
ATOM   2696  C  CD    . ARG A 1 353 ? 84.439  -25.641 47.853  1.00 39.86  ?  353 ARG A CD    1 
ATOM   2697  N  NE    . ARG A 1 353 ? 85.110  -26.939 47.755  1.00 48.67  ?  353 ARG A NE    1 
ATOM   2698  C  CZ    . ARG A 1 353 ? 85.311  -27.580 46.597  1.00 55.73  ?  353 ARG A CZ    1 
ATOM   2699  N  NH1   . ARG A 1 353 ? 84.901  -27.050 45.441  1.00 47.76  ?  353 ARG A NH1   1 
ATOM   2700  N  NH2   . ARG A 1 353 ? 85.924  -28.759 46.587  1.00 62.62  ?  353 ARG A NH2   1 
ATOM   2701  N  N     . ARG A 1 354 ? 80.797  -27.719 51.271  1.00 36.82  ?  354 ARG A N     1 
ATOM   2702  C  CA    . ARG A 1 354 ? 80.143  -28.917 51.788  1.00 37.77  ?  354 ARG A CA    1 
ATOM   2703  C  C     . ARG A 1 354 ? 79.152  -29.502 50.771  1.00 40.46  ?  354 ARG A C     1 
ATOM   2704  O  O     . ARG A 1 354 ? 79.238  -30.679 50.433  1.00 37.32  ?  354 ARG A O     1 
ATOM   2705  C  CB    . ARG A 1 354 ? 79.431  -28.649 53.115  1.00 39.93  ?  354 ARG A CB    1 
ATOM   2706  C  CG    . ARG A 1 354 ? 78.734  -29.898 53.694  1.00 42.53  ?  354 ARG A CG    1 
ATOM   2707  C  CD    . ARG A 1 354 ? 77.892  -29.628 54.937  1.00 43.53  ?  354 ARG A CD    1 
ATOM   2708  N  NE    . ARG A 1 354 ? 77.048  -30.774 55.289  1.00 48.27  ?  354 ARG A NE    1 
ATOM   2709  C  CZ    . ARG A 1 354 ? 75.815  -30.971 54.813  1.00 57.59  ?  354 ARG A CZ    1 
ATOM   2710  N  NH1   . ARG A 1 354 ? 75.280  -30.090 53.970  1.00 62.82  ?  354 ARG A NH1   1 
ATOM   2711  N  NH2   . ARG A 1 354 ? 75.111  -32.045 55.169  1.00 55.44  ?  354 ARG A NH2   1 
ATOM   2712  N  N     . GLU A 1 355 ? 78.214  -28.687 50.293  1.00 40.38  ?  355 GLU A N     1 
ATOM   2713  C  CA    . GLU A 1 355 ? 77.258  -29.129 49.264  1.00 40.13  ?  355 GLU A CA    1 
ATOM   2714  C  C     . GLU A 1 355 ? 77.975  -29.715 48.057  1.00 29.76  ?  355 GLU A C     1 
ATOM   2715  O  O     . GLU A 1 355 ? 77.691  -30.822 47.629  1.00 39.28  ?  355 GLU A O     1 
ATOM   2716  C  CB    . GLU A 1 355 ? 76.336  -27.991 48.807  1.00 42.48  ?  355 GLU A CB    1 
ATOM   2717  C  CG    . GLU A 1 355 ? 75.247  -27.639 49.791  1.00 51.96  ?  355 GLU A CG    1 
ATOM   2718  C  CD    . GLU A 1 355 ? 74.421  -28.844 50.193  1.00 60.91  ?  355 GLU A CD    1 
ATOM   2719  O  OE1   . GLU A 1 355 ? 73.298  -28.662 50.704  1.00 62.72  ?  355 GLU A OE1   1 
ATOM   2720  O  OE2   . GLU A 1 355 ? 74.896  -29.981 50.001  1.00 65.11  ?  355 GLU A OE2   1 
ATOM   2721  N  N     . VAL A 1 356 ? 78.918  -28.966 47.516  1.00 32.32  ?  356 VAL A N     1 
ATOM   2722  C  CA    . VAL A 1 356 ? 79.684  -29.436 46.383  1.00 29.52  ?  356 VAL A CA    1 
ATOM   2723  C  C     . VAL A 1 356 ? 80.319  -30.803 46.660  1.00 32.67  ?  356 VAL A C     1 
ATOM   2724  O  O     . VAL A 1 356 ? 80.110  -31.747 45.899  1.00 37.97  ?  356 VAL A O     1 
ATOM   2725  C  CB    . VAL A 1 356 ? 80.718  -28.374 45.964  1.00 28.21  ?  356 VAL A CB    1 
ATOM   2726  C  CG1   . VAL A 1 356 ? 81.773  -28.943 45.026  1.00 27.62  ?  356 VAL A CG1   1 
ATOM   2727  C  CG2   . VAL A 1 356 ? 79.992  -27.198 45.332  1.00 29.34  ?  356 VAL A CG2   1 
ATOM   2728  N  N     . ILE A 1 357 ? 81.061  -30.924 47.760  1.00 29.64  ?  357 ILE A N     1 
ATOM   2729  C  CA    . ILE A 1 357 ? 81.748  -32.181 48.082  1.00 26.80  ?  357 ILE A CA    1 
ATOM   2730  C  C     . ILE A 1 357 ? 80.761  -33.325 48.326  1.00 27.41  ?  357 ILE A C     1 
ATOM   2731  O  O     . ILE A 1 357 ? 81.002  -34.480 47.955  1.00 36.14  ?  357 ILE A O     1 
ATOM   2732  C  CB    . ILE A 1 357 ? 82.698  -32.028 49.283  1.00 35.18  ?  357 ILE A CB    1 
ATOM   2733  C  CG1   . ILE A 1 357 ? 83.819  -31.057 48.949  1.00 25.93  ?  357 ILE A CG1   1 
ATOM   2734  C  CG2   . ILE A 1 357 ? 83.317  -33.349 49.664  1.00 26.41  ?  357 ILE A CG2   1 
ATOM   2735  C  CD1   . ILE A 1 357 ? 84.828  -30.949 50.043  1.00 25.81  ?  357 ILE A CD1   1 
ATOM   2736  N  N     . LEU A 1 358 ? 79.635  -33.013 48.933  1.00 28.27  ?  358 LEU A N     1 
ATOM   2737  C  CA    . LEU A 1 358 ? 78.643  -34.045 49.105  1.00 29.15  ?  358 LEU A CA    1 
ATOM   2738  C  C     . LEU A 1 358 ? 78.129  -34.484 47.752  1.00 32.09  ?  358 LEU A C     1 
ATOM   2739  O  O     . LEU A 1 358 ? 78.134  -35.663 47.426  1.00 33.12  ?  358 LEU A O     1 
ATOM   2740  C  CB    . LEU A 1 358 ? 77.503  -33.553 49.989  1.00 30.34  ?  358 LEU A CB    1 
ATOM   2741  C  CG    . LEU A 1 358 ? 77.868  -33.677 51.461  1.00 30.52  ?  358 LEU A CG    1 
ATOM   2742  C  CD1   . LEU A 1 358 ? 76.777  -33.081 52.300  1.00 38.70  ?  358 LEU A CD1   1 
ATOM   2743  C  CD2   . LEU A 1 358 ? 78.091  -35.144 51.796  1.00 30.84  ?  358 LEU A CD2   1 
ATOM   2744  N  N     . ALA A 1 359 ? 77.699  -33.509 46.963  1.00 33.14  ?  359 ALA A N     1 
ATOM   2745  C  CA    . ALA A 1 359 ? 77.110  -33.758 45.660  1.00 39.72  ?  359 ALA A CA    1 
ATOM   2746  C  C     . ALA A 1 359 ? 78.086  -34.527 44.779  1.00 40.19  ?  359 ALA A C     1 
ATOM   2747  O  O     . ALA A 1 359 ? 77.726  -35.488 44.096  1.00 39.96  ?  359 ALA A O     1 
ATOM   2748  C  CB    . ALA A 1 359 ? 76.748  -32.442 45.011  1.00 41.50  ?  359 ALA A CB    1 
ATOM   2749  N  N     . ARG A 1 360 ? 79.329  -34.077 44.792  1.00 36.51  ?  360 ARG A N     1 
ATOM   2750  C  CA    . ARG A 1 360 ? 80.345  -34.674 43.967  1.00 34.28  ?  360 ARG A CA    1 
ATOM   2751  C  C     . ARG A 1 360 ? 80.523  -36.142 44.321  1.00 33.80  ?  360 ARG A C     1 
ATOM   2752  O  O     . ARG A 1 360 ? 80.700  -36.989 43.452  1.00 33.76  ?  360 ARG A O     1 
ATOM   2753  C  CB    . ARG A 1 360 ? 81.659  -33.921 44.147  1.00 26.43  ?  360 ARG A CB    1 
ATOM   2754  C  CG    . ARG A 1 360 ? 82.742  -34.396 43.220  1.00 36.44  ?  360 ARG A CG    1 
ATOM   2755  C  CD    . ARG A 1 360 ? 83.934  -34.773 44.018  1.00 39.25  ?  360 ARG A CD    1 
ATOM   2756  N  NE    . ARG A 1 360 ? 84.639  -33.599 44.522  1.00 44.50  ?  360 ARG A NE    1 
ATOM   2757  C  CZ    . ARG A 1 360 ? 85.396  -33.609 45.612  1.00 50.62  ?  360 ARG A CZ    1 
ATOM   2758  N  NH1   . ARG A 1 360 ? 85.508  -34.728 46.324  1.00 47.08  ?  360 ARG A NH1   1 
ATOM   2759  N  NH2   . ARG A 1 360 ? 86.021  -32.505 45.997  1.00 54.54  ?  360 ARG A NH2   1 
ATOM   2760  N  N     . SER A 1 361 ? 80.482  -36.445 45.607  1.00 36.41  ?  361 SER A N     1 
ATOM   2761  C  CA    . SER A 1 361 ? 80.762  -37.802 46.053  1.00 39.96  ?  361 SER A CA    1 
ATOM   2762  C  C     . SER A 1 361 ? 79.592  -38.727 45.749  1.00 39.34  ?  361 SER A C     1 
ATOM   2763  O  O     . SER A 1 361 ? 79.780  -39.925 45.555  1.00 36.10  ?  361 SER A O     1 
ATOM   2764  C  CB    . SER A 1 361 ? 81.147  -37.812 47.540  1.00 41.52  ?  361 SER A CB    1 
ATOM   2765  O  OG    . SER A 1 361 ? 82.320  -37.041 47.750  1.00 26.82  ?  361 SER A OG    1 
ATOM   2766  N  N     . ARG A 1 362 ? 78.389  -38.158 45.694  1.00 38.50  ?  362 ARG A N     1 
ATOM   2767  C  CA    . ARG A 1 362 ? 77.187  -38.920 45.359  1.00 40.82  ?  362 ARG A CA    1 
ATOM   2768  C  C     . ARG A 1 362 ? 77.260  -39.338 43.910  1.00 41.86  ?  362 ARG A C     1 
ATOM   2769  O  O     . ARG A 1 362 ? 76.914  -40.456 43.549  1.00 44.10  ?  362 ARG A O     1 
ATOM   2770  C  CB    . ARG A 1 362 ? 75.915  -38.099 45.595  1.00 30.58  ?  362 ARG A CB    1 
ATOM   2771  C  CG    . ARG A 1 362 ? 75.658  -37.730 47.046  1.00 39.42  ?  362 ARG A CG    1 
ATOM   2772  C  CD    . ARG A 1 362 ? 74.229  -37.239 47.252  1.00 46.77  ?  362 ARG A CD    1 
ATOM   2773  N  NE    . ARG A 1 362 ? 74.081  -36.422 48.459  1.00 57.63  ?  362 ARG A NE    1 
ATOM   2774  C  CZ    . ARG A 1 362 ? 74.129  -35.087 48.474  1.00 65.74  ?  362 ARG A CZ    1 
ATOM   2775  N  NH1   . ARG A 1 362 ? 74.319  -34.401 47.346  1.00 67.33  ?  362 ARG A NH1   1 
ATOM   2776  N  NH2   . ARG A 1 362 ? 73.980  -34.432 49.622  1.00 66.35  ?  362 ARG A NH2   1 
ATOM   2777  N  N     . PHE A 1 363 ? 77.737  -38.415 43.090  1.00 44.81  ?  363 PHE A N     1 
ATOM   2778  C  CA    . PHE A 1 363 ? 77.883  -38.618 41.661  1.00 39.35  ?  363 PHE A CA    1 
ATOM   2779  C  C     . PHE A 1 363 ? 78.873  -39.717 41.329  1.00 33.13  ?  363 PHE A C     1 
ATOM   2780  O  O     . PHE A 1 363 ? 78.560  -40.627 40.573  1.00 40.52  ?  363 PHE A O     1 
ATOM   2781  C  CB    . PHE A 1 363 ? 78.355  -37.326 41.018  1.00 38.96  ?  363 PHE A CB    1 
ATOM   2782  C  CG    . PHE A 1 363 ? 78.538  -37.427 39.544  1.00 38.73  ?  363 PHE A CG    1 
ATOM   2783  C  CD1   . PHE A 1 363 ? 77.468  -37.197 38.685  1.00 34.85  ?  363 PHE A CD1   1 
ATOM   2784  C  CD2   . PHE A 1 363 ? 79.781  -37.759 39.012  1.00 40.68  ?  363 PHE A CD2   1 
ATOM   2785  C  CE1   . PHE A 1 363 ? 77.632  -37.287 37.338  1.00 34.80  ?  363 PHE A CE1   1 
ATOM   2786  C  CE2   . PHE A 1 363 ? 79.953  -37.857 37.654  1.00 41.94  ?  363 PHE A CE2   1 
ATOM   2787  C  CZ    . PHE A 1 363 ? 78.877  -37.621 36.813  1.00 40.09  ?  363 PHE A CZ    1 
ATOM   2788  N  N     . ASP A 1 364 ? 80.074  -39.613 41.879  1.00 28.58  ?  364 ASP A N     1 
ATOM   2789  C  CA    . ASP A 1 364 ? 81.113  -40.603 41.638  1.00 32.96  ?  364 ASP A CA    1 
ATOM   2790  C  C     . ASP A 1 364 ? 80.716  -41.966 42.161  1.00 31.86  ?  364 ASP A C     1 
ATOM   2791  O  O     . ASP A 1 364 ? 81.128  -42.992 41.616  1.00 30.41  ?  364 ASP A O     1 
ATOM   2792  C  CB    . ASP A 1 364 ? 82.404  -40.188 42.325  1.00 43.46  ?  364 ASP A CB    1 
ATOM   2793  C  CG    . ASP A 1 364 ? 83.152  -39.133 41.569  1.00 54.16  ?  364 ASP A CG    1 
ATOM   2794  O  OD1   . ASP A 1 364 ? 82.801  -38.874 40.392  1.00 59.30  ?  364 ASP A OD1   1 
ATOM   2795  O  OD2   . ASP A 1 364 ? 84.105  -38.580 42.158  1.00 54.24  ?  364 ASP A OD2   1 
ATOM   2796  N  N     . LYS A 1 365 ? 79.936  -41.964 43.238  1.00 34.57  ?  365 LYS A N     1 
ATOM   2797  C  CA    . LYS A 1 365 ? 79.546  -43.193 43.891  1.00 27.20  ?  365 LYS A CA    1 
ATOM   2798  C  C     . LYS A 1 365 ? 78.499  -43.847 43.024  1.00 35.67  ?  365 LYS A C     1 
ATOM   2799  O  O     . LYS A 1 365 ? 78.462  -45.064 42.888  1.00 35.24  ?  365 LYS A O     1 
ATOM   2800  C  CB    . LYS A 1 365 ? 78.989  -42.926 45.292  1.00 47.41  ?  365 LYS A CB    1 
ATOM   2801  C  CG    . LYS A 1 365 ? 78.679  -44.211 46.090  1.00 48.36  ?  365 LYS A CG    1 
ATOM   2802  C  CD    . LYS A 1 365 ? 77.948  -43.953 47.419  1.00 31.05  ?  365 LYS A CD    1 
ATOM   2803  C  CE    . LYS A 1 365 ? 76.596  -43.331 47.184  1.00 45.54  ?  365 LYS A CE    1 
ATOM   2804  N  NZ    . LYS A 1 365 ? 75.648  -43.594 48.311  1.00 48.49  ?  365 LYS A NZ    1 
ATOM   2805  N  N     . GLU A 1 366 ? 77.643  -43.040 42.420  1.00 41.91  ?  366 GLU A N     1 
ATOM   2806  C  CA    . GLU A 1 366 ? 76.615  -43.631 41.568  1.00 48.67  ?  366 GLU A CA    1 
ATOM   2807  C  C     . GLU A 1 366 ? 77.251  -44.287 40.331  1.00 41.26  ?  366 GLU A C     1 
ATOM   2808  O  O     . GLU A 1 366 ? 76.814  -45.345 39.879  1.00 41.89  ?  366 GLU A O     1 
ATOM   2809  C  CB    . GLU A 1 366 ? 75.498  -42.639 41.198  1.00 57.13  ?  366 GLU A CB    1 
ATOM   2810  C  CG    . GLU A 1 366 ? 74.418  -43.285 40.359  1.00 69.93  ?  366 GLU A CG    1 
ATOM   2811  C  CD    . GLU A 1 366 ? 73.300  -42.335 40.002  1.00 87.73  ?  366 GLU A CD    1 
ATOM   2812  O  OE1   . GLU A 1 366 ? 72.866  -42.363 38.827  1.00 94.05  ?  366 GLU A OE1   1 
ATOM   2813  O  OE2   . GLU A 1 366 ? 72.857  -41.568 40.892  1.00 93.67  ?  366 GLU A OE2   1 
ATOM   2814  N  N     . LYS A 1 367 ? 78.299  -43.657 39.814  1.00 33.67  ?  367 LYS A N     1 
ATOM   2815  C  CA    . LYS A 1 367 ? 79.048  -44.214 38.720  1.00 31.80  ?  367 LYS A CA    1 
ATOM   2816  C  C     . LYS A 1 367 ? 79.734  -45.501 39.141  1.00 34.02  ?  367 LYS A C     1 
ATOM   2817  O  O     . LYS A 1 367 ? 79.597  -46.524 38.475  1.00 41.35  ?  367 LYS A O     1 
ATOM   2818  C  CB    . LYS A 1 367 ? 80.050  -43.200 38.184  1.00 40.25  ?  367 LYS A CB    1 
ATOM   2819  C  CG    . LYS A 1 367 ? 79.637  -42.599 36.839  1.00 57.15  ?  367 LYS A CG    1 
ATOM   2820  C  CD    . LYS A 1 367 ? 80.736  -41.715 36.236  1.00 69.94  ?  367 LYS A CD    1 
ATOM   2821  C  CE    . LYS A 1 367 ? 82.116  -42.367 36.328  1.00 76.41  ?  367 LYS A CE    1 
ATOM   2822  N  NZ    . LYS A 1 367 ? 82.642  -42.359 37.727  1.00 81.65  ?  367 LYS A NZ    1 
ATOM   2823  N  N     . ALA A 1 368 ? 80.463  -45.475 40.252  1.00 35.79  ?  368 ALA A N     1 
ATOM   2824  C  CA    . ALA A 1 368 ? 81.163  -46.688 40.685  1.00 37.64  ?  368 ALA A CA    1 
ATOM   2825  C  C     . ALA A 1 368 ? 80.170  -47.823 40.895  1.00 45.12  ?  368 ALA A C     1 
ATOM   2826  O  O     . ALA A 1 368 ? 80.459  -48.981 40.595  1.00 47.41  ?  368 ALA A O     1 
ATOM   2827  C  CB    . ALA A 1 368 ? 81.968  -46.440 41.943  1.00 35.19  ?  368 ALA A CB    1 
ATOM   2828  N  N     . GLU A 1 369 ? 78.988  -47.477 41.388  1.00 47.55  ?  369 GLU A N     1 
ATOM   2829  C  CA    . GLU A 1 369 ? 77.959  -48.462 41.650  1.00 46.71  ?  369 GLU A CA    1 
ATOM   2830  C  C     . GLU A 1 369 ? 77.368  -49.046 40.361  1.00 47.81  ?  369 GLU A C     1 
ATOM   2831  O  O     . GLU A 1 369 ? 77.303  -50.273 40.204  1.00 45.63  ?  369 GLU A O     1 
ATOM   2832  C  CB    . GLU A 1 369 ? 76.863  -47.846 42.507  1.00 51.89  ?  369 GLU A CB    1 
ATOM   2833  C  CG    . GLU A 1 369 ? 76.076  -48.869 43.301  1.00 64.12  ?  369 GLU A CG    1 
ATOM   2834  C  CD    . GLU A 1 369 ? 74.857  -48.265 43.962  1.00 73.38  ?  369 GLU A CD    1 
ATOM   2835  O  OE1   . GLU A 1 369 ? 74.914  -47.064 44.323  1.00 75.13  ?  369 GLU A OE1   1 
ATOM   2836  O  OE2   . GLU A 1 369 ? 73.844  -48.991 44.097  1.00 75.53  ?  369 GLU A OE2   1 
ATOM   2837  N  N     . LYS A 1 370 ? 76.941  -48.172 39.441  1.00 47.75  ?  370 LYS A N     1 
ATOM   2838  C  CA    . LYS A 1 370 ? 76.349  -48.624 38.174  1.00 42.81  ?  370 LYS A CA    1 
ATOM   2839  C  C     . LYS A 1 370 ? 77.271  -49.648 37.522  1.00 41.32  ?  370 LYS A C     1 
ATOM   2840  O  O     . LYS A 1 370 ? 76.825  -50.694 37.035  1.00 43.31  ?  370 LYS A O     1 
ATOM   2841  C  CB    . LYS A 1 370 ? 76.019  -47.458 37.222  1.00 48.10  ?  370 LYS A CB    1 
ATOM   2842  C  CG    . LYS A 1 370 ? 74.860  -46.584 37.710  1.00 65.41  ?  370 LYS A CG    1 
ATOM   2843  C  CD    . LYS A 1 370 ? 74.087  -45.896 36.576  1.00 49.06  ?  370 LYS A CD    1 
ATOM   2844  N  N     . ARG A 1 371 ? 78.567  -49.368 37.552  1.00 40.51  ?  371 ARG A N     1 
ATOM   2845  C  CA    . ARG A 1 371 ? 79.521  -50.301 36.981  1.00 40.21  ?  371 ARG A CA    1 
ATOM   2846  C  C     . ARG A 1 371 ? 79.707  -51.566 37.806  1.00 43.46  ?  371 ARG A C     1 
ATOM   2847  O  O     . ARG A 1 371 ? 79.649  -52.661 37.232  1.00 36.04  ?  371 ARG A O     1 
ATOM   2848  C  CB    . ARG A 1 371 ? 80.882  -49.667 36.722  1.00 36.01  ?  371 ARG A CB    1 
ATOM   2849  C  CG    . ARG A 1 371 ? 81.895  -50.730 36.434  1.00 32.84  ?  371 ARG A CG    1 
ATOM   2850  C  CD    . ARG A 1 371 ? 82.791  -50.336 35.338  1.00 41.13  ?  371 ARG A CD    1 
ATOM   2851  N  NE    . ARG A 1 371 ? 83.408  -51.509 34.730  1.00 42.98  ?  371 ARG A NE    1 
ATOM   2852  C  CZ    . ARG A 1 371 ? 82.908  -52.152 33.680  1.00 37.90  ?  371 ARG A CZ    1 
ATOM   2853  N  NH1   . ARG A 1 371 ? 81.771  -51.740 33.115  1.00 33.15  ?  371 ARG A NH1   1 
ATOM   2854  N  NH2   . ARG A 1 371 ? 83.552  -53.202 33.200  1.00 37.33  ?  371 ARG A NH2   1 
ATOM   2855  N  N     . LEU A 1 372 ? 79.962  -51.410 39.119  1.00 53.78  ?  372 LEU A N     1 
ATOM   2856  C  CA    . LEU A 1 372 ? 80.137  -52.540 40.031  1.00 25.64  ?  372 LEU A CA    1 
ATOM   2857  C  C     . LEU A 1 372 ? 78.981  -53.507 39.807  1.00 45.99  ?  372 LEU A C     1 
ATOM   2858  O  O     . LEU A 1 372 ? 79.168  -54.723 39.793  1.00 26.45  ?  372 LEU A O     1 
ATOM   2859  C  CB    . LEU A 1 372 ? 80.226  -52.075 41.495  1.00 34.20  ?  372 LEU A CB    1 
ATOM   2860  C  CG    . LEU A 1 372 ? 80.341  -52.989 42.747  1.00 28.78  ?  372 LEU A CG    1 
ATOM   2861  C  CD1   . LEU A 1 372 ? 78.962  -53.402 43.248  1.00 30.20  ?  372 LEU A CD1   1 
ATOM   2862  C  CD2   . LEU A 1 372 ? 81.244  -54.229 42.571  1.00 28.89  ?  372 LEU A CD2   1 
ATOM   2863  N  N     . HIS A 1 373 ? 77.792  -52.957 39.573  1.00 41.02  ?  373 HIS A N     1 
ATOM   2864  C  CA    . HIS A 1 373 ? 76.619  -53.770 39.260  1.00 38.59  ?  373 HIS A CA    1 
ATOM   2865  C  C     . HIS A 1 373 ? 76.792  -54.581 37.966  1.00 36.85  ?  373 HIS A C     1 
ATOM   2866  O  O     . HIS A 1 373 ? 76.548  -55.792 37.960  1.00 38.82  ?  373 HIS A O     1 
ATOM   2867  C  CB    . HIS A 1 373 ? 75.386  -52.879 39.163  1.00 41.67  ?  373 HIS A CB    1 
ATOM   2868  C  CG    . HIS A 1 373 ? 74.098  -53.636 39.078  1.00 45.45  ?  373 HIS A CG    1 
ATOM   2869  N  ND1   . HIS A 1 373 ? 73.700  -54.534 40.042  1.00 49.08  ?  373 HIS A ND1   1 
ATOM   2870  C  CD2   . HIS A 1 373 ? 73.117  -53.624 38.146  1.00 45.38  ?  373 HIS A CD2   1 
ATOM   2871  C  CE1   . HIS A 1 373 ? 72.534  -55.050 39.702  1.00 51.12  ?  373 HIS A CE1   1 
ATOM   2872  N  NE2   . HIS A 1 373 ? 72.153  -54.511 38.556  1.00 45.26  ?  373 HIS A NE2   1 
ATOM   2873  N  N     . ILE A 1 374 ? 77.203  -53.910 36.881  1.00 37.95  ?  374 ILE A N     1 
ATOM   2874  C  CA    . ILE A 1 374 ? 77.460  -54.564 35.594  1.00 36.77  ?  374 ILE A CA    1 
ATOM   2875  C  C     . ILE A 1 374 ? 78.543  -55.611 35.776  1.00 34.24  ?  374 ILE A C     1 
ATOM   2876  O  O     . ILE A 1 374 ? 78.429  -56.732 35.276  1.00 38.46  ?  374 ILE A O     1 
ATOM   2877  C  CB    . ILE A 1 374 ? 77.926  -53.548 34.500  1.00 21.44  ?  374 ILE A CB    1 
ATOM   2878  C  CG1   . ILE A 1 374 ? 76.743  -52.949 33.737  1.00 30.79  ?  374 ILE A CG1   1 
ATOM   2879  C  CG2   . ILE A 1 374 ? 78.908  -54.209 33.509  1.00 28.74  ?  374 ILE A CG2   1 
ATOM   2880  C  CD1   . ILE A 1 374 ? 75.827  -52.122 34.602  1.00 37.54  ?  374 ILE A CD1   1 
ATOM   2881  N  N     . VAL A 1 375 ? 79.587  -55.234 36.508  1.00 26.63  ?  375 VAL A N     1 
ATOM   2882  C  CA    . VAL A 1 375 ? 80.760  -56.079 36.671  1.00 27.60  ?  375 VAL A CA    1 
ATOM   2883  C  C     . VAL A 1 375 ? 80.415  -57.356 37.399  1.00 31.93  ?  375 VAL A C     1 
ATOM   2884  O  O     . VAL A 1 375 ? 80.962  -58.404 37.080  1.00 31.29  ?  375 VAL A O     1 
ATOM   2885  C  CB    . VAL A 1 375 ? 81.909  -55.346 37.387  1.00 29.83  ?  375 VAL A CB    1 
ATOM   2886  C  CG1   . VAL A 1 375 ? 83.132  -56.244 37.497  1.00 23.29  ?  375 VAL A CG1   1 
ATOM   2887  C  CG2   . VAL A 1 375 ? 82.250  -54.049 36.649  1.00 31.69  ?  375 VAL A CG2   1 
ATOM   2888  N  N     . GLU A 1 376 ? 79.500  -57.273 38.365  1.00 37.07  ?  376 GLU A N     1 
ATOM   2889  C  CA    . GLU A 1 376 ? 78.974  -58.470 39.027  1.00 43.74  ?  376 GLU A CA    1 
ATOM   2890  C  C     . GLU A 1 376 ? 78.298  -59.413 38.027  1.00 42.07  ?  376 GLU A C     1 
ATOM   2891  O  O     . GLU A 1 376 ? 78.648  -60.585 37.932  1.00 45.22  ?  376 GLU A O     1 
ATOM   2892  C  CB    . GLU A 1 376 ? 77.978  -58.101 40.128  1.00 55.23  ?  376 GLU A CB    1 
ATOM   2893  C  CG    . GLU A 1 376 ? 78.594  -57.831 41.498  1.00 68.39  ?  376 GLU A CG    1 
ATOM   2894  C  CD    . GLU A 1 376 ? 77.716  -56.934 42.359  1.00 80.66  ?  376 GLU A CD    1 
ATOM   2895  O  OE1   . GLU A 1 376 ? 76.560  -56.646 41.956  1.00 83.61  ?  376 GLU A OE1   1 
ATOM   2896  O  OE2   . GLU A 1 376 ? 78.195  -56.505 43.433  1.00 85.63  ?  376 GLU A OE2   1 
ATOM   2897  N  N     . GLY A 1 377 ? 77.325  -58.895 37.285  1.00 38.21  ?  377 GLY A N     1 
ATOM   2898  C  CA    . GLY A 1 377 ? 76.691  -59.641 36.207  1.00 39.43  ?  377 GLY A CA    1 
ATOM   2899  C  C     . GLY A 1 377 ? 77.623  -60.346 35.223  1.00 40.18  ?  377 GLY A C     1 
ATOM   2900  O  O     . GLY A 1 377 ? 77.379  -61.501 34.849  1.00 37.80  ?  377 GLY A O     1 
ATOM   2901  N  N     . LEU A 1 378 ? 78.684  -59.662 34.797  1.00 38.18  ?  378 LEU A N     1 
ATOM   2902  C  CA    . LEU A 1 378 ? 79.613  -60.245 33.832  1.00 31.12  ?  378 LEU A CA    1 
ATOM   2903  C  C     . LEU A 1 378 ? 80.315  -61.444 34.419  1.00 37.93  ?  378 LEU A C     1 
ATOM   2904  O  O     . LEU A 1 378 ? 80.498  -62.457 33.752  1.00 48.41  ?  378 LEU A O     1 
ATOM   2905  C  CB    . LEU A 1 378 ? 80.649  -59.226 33.339  1.00 24.30  ?  378 LEU A CB    1 
ATOM   2906  C  CG    . LEU A 1 378 ? 80.097  -58.123 32.426  1.00 22.88  ?  378 LEU A CG    1 
ATOM   2907  C  CD1   . LEU A 1 378 ? 81.203  -57.428 31.738  1.00 17.52  ?  378 LEU A CD1   1 
ATOM   2908  C  CD2   . LEU A 1 378 ? 79.127  -58.689 31.435  1.00 17.69  ?  378 LEU A CD2   1 
ATOM   2909  N  N     . ILE A 1 379 ? 80.702  -61.330 35.678  1.00 32.79  ?  379 ILE A N     1 
ATOM   2910  C  CA    . ILE A 1 379 ? 81.355  -62.433 36.350  1.00 32.83  ?  379 ILE A CA    1 
ATOM   2911  C  C     . ILE A 1 379 ? 80.415  -63.648 36.347  1.00 35.17  ?  379 ILE A C     1 
ATOM   2912  O  O     . ILE A 1 379 ? 80.854  -64.796 36.210  1.00 38.20  ?  379 ILE A O     1 
ATOM   2913  C  CB    . ILE A 1 379 ? 81.804  -62.018 37.771  1.00 26.18  ?  379 ILE A CB    1 
ATOM   2914  C  CG1   . ILE A 1 379 ? 82.765  -60.832 37.688  1.00 28.86  ?  379 ILE A CG1   1 
ATOM   2915  C  CG2   . ILE A 1 379 ? 82.503  -63.155 38.485  1.00 27.95  ?  379 ILE A CG2   1 
ATOM   2916  C  CD1   . ILE A 1 379 ? 83.212  -60.318 39.028  1.00 29.11  ?  379 ILE A CD1   1 
ATOM   2917  N  N     . ARG A 1 380 ? 79.116  -63.394 36.457  1.00 33.51  ?  380 ARG A N     1 
ATOM   2918  C  CA    . ARG A 1 380 ? 78.149  -64.482 36.438  1.00 41.01  ?  380 ARG A CA    1 
ATOM   2919  C  C     . ARG A 1 380 ? 78.080  -65.106 35.074  1.00 42.66  ?  380 ARG A C     1 
ATOM   2920  O  O     . ARG A 1 380 ? 78.086  -66.325 34.946  1.00 47.75  ?  380 ARG A O     1 
ATOM   2921  C  CB    . ARG A 1 380 ? 76.767  -64.000 36.830  1.00 27.29  ?  380 ARG A CB    1 
ATOM   2922  C  CG    . ARG A 1 380 ? 76.434  -64.302 38.271  1.00 56.75  ?  380 ARG A CG    1 
ATOM   2923  C  CD    . ARG A 1 380 ? 75.124  -65.036 38.380  1.00 54.45  ?  380 ARG A CD    1 
ATOM   2924  N  NE    . ARG A 1 380 ? 74.012  -64.135 38.126  1.00 56.29  ?  380 ARG A NE    1 
ATOM   2925  C  CZ    . ARG A 1 380 ? 72.839  -64.533 37.659  1.00 61.72  ?  380 ARG A CZ    1 
ATOM   2926  N  NH1   . ARG A 1 380 ? 72.637  -65.828 37.399  1.00 63.14  ?  380 ARG A NH1   1 
ATOM   2927  N  NH2   . ARG A 1 380 ? 71.878  -63.636 37.455  1.00 62.89  ?  380 ARG A NH2   1 
ATOM   2928  N  N     . VAL A 1 381 ? 78.000  -64.255 34.058  1.00 42.08  ?  381 VAL A N     1 
ATOM   2929  C  CA    . VAL A 1 381 ? 77.851  -64.712 32.690  1.00 38.35  ?  381 VAL A CA    1 
ATOM   2930  C  C     . VAL A 1 381 ? 78.913  -65.752 32.365  1.00 38.77  ?  381 VAL A C     1 
ATOM   2931  O  O     . VAL A 1 381 ? 78.607  -66.781 31.772  1.00 42.99  ?  381 VAL A O     1 
ATOM   2932  C  CB    . VAL A 1 381 ? 77.913  -63.542 31.698  1.00 31.63  ?  381 VAL A CB    1 
ATOM   2933  C  CG1   . VAL A 1 381 ? 78.088  -64.047 30.303  1.00 23.57  ?  381 VAL A CG1   1 
ATOM   2934  C  CG2   . VAL A 1 381 ? 76.651  -62.743 31.769  1.00 35.57  ?  381 VAL A CG2   1 
ATOM   2935  N  N     . ILE A 1 382 ? 80.155  -65.500 32.770  1.00 33.24  ?  382 ILE A N     1 
ATOM   2936  C  CA    . ILE A 1 382 ? 81.243  -66.417 32.439  1.00 34.13  ?  382 ILE A CA    1 
ATOM   2937  C  C     . ILE A 1 382 ? 80.961  -67.810 32.978  1.00 41.46  ?  382 ILE A C     1 
ATOM   2938  O  O     . ILE A 1 382 ? 81.232  -68.814 32.318  1.00 41.63  ?  382 ILE A O     1 
ATOM   2939  C  CB    . ILE A 1 382 ? 82.587  -65.939 32.983  1.00 35.62  ?  382 ILE A CB    1 
ATOM   2940  C  CG1   . ILE A 1 382 ? 82.827  -64.489 32.584  1.00 35.12  ?  382 ILE A CG1   1 
ATOM   2941  C  CG2   . ILE A 1 382 ? 83.698  -66.815 32.452  1.00 38.17  ?  382 ILE A CG2   1 
ATOM   2942  C  CD1   . ILE A 1 382 ? 84.195  -63.980 32.933  1.00 36.65  ?  382 ILE A CD1   1 
ATOM   2943  N  N     . SER A 1 383 ? 80.405  -67.859 34.182  1.00 51.13  ?  383 SER A N     1 
ATOM   2944  C  CA    . SER A 1 383 ? 79.989  -69.118 34.791  1.00 52.39  ?  383 SER A CA    1 
ATOM   2945  C  C     . SER A 1 383 ? 78.932  -69.848 33.960  1.00 54.71  ?  383 SER A C     1 
ATOM   2946  O  O     . SER A 1 383 ? 78.701  -71.030 34.157  1.00 60.39  ?  383 SER A O     1 
ATOM   2947  C  CB    . SER A 1 383 ? 79.441  -68.869 36.198  1.00 48.01  ?  383 SER A CB    1 
ATOM   2948  N  N     . ILE A 1 384 ? 78.282  -69.143 33.041  1.00 49.36  ?  384 ILE A N     1 
ATOM   2949  C  CA    . ILE A 1 384 ? 77.209  -69.743 32.255  1.00 45.10  ?  384 ILE A CA    1 
ATOM   2950  C  C     . ILE A 1 384 ? 77.163  -69.246 30.819  1.00 44.15  ?  384 ILE A C     1 
ATOM   2951  O  O     . ILE A 1 384 ? 76.077  -69.071 30.251  1.00 46.05  ?  384 ILE A O     1 
ATOM   2952  C  CB    . ILE A 1 384 ? 75.824  -69.510 32.898  1.00 28.14  ?  384 ILE A CB    1 
ATOM   2953  C  CG1   . ILE A 1 384 ? 75.552  -68.022 33.112  1.00 36.15  ?  384 ILE A CG1   1 
ATOM   2954  C  CG2   . ILE A 1 384 ? 75.741  -70.224 34.201  1.00 41.85  ?  384 ILE A CG2   1 
ATOM   2955  C  CD1   . ILE A 1 384 ? 74.085  -67.725 33.371  1.00 27.50  ?  384 ILE A CD1   1 
ATOM   2956  N  N     . LEU A 1 385 ? 78.338  -69.031 30.235  1.00 44.83  ?  385 LEU A N     1 
ATOM   2957  C  CA    . LEU A 1 385 ? 78.447  -68.481 28.884  1.00 41.54  ?  385 LEU A CA    1 
ATOM   2958  C  C     . LEU A 1 385 ? 77.635  -69.255 27.868  1.00 41.79  ?  385 LEU A C     1 
ATOM   2959  O  O     . LEU A 1 385 ? 76.850  -68.669 27.117  1.00 42.00  ?  385 LEU A O     1 
ATOM   2960  C  CB    . LEU A 1 385 ? 79.890  -68.495 28.426  1.00 38.75  ?  385 LEU A CB    1 
ATOM   2961  C  CG    . LEU A 1 385 ? 80.477  -67.170 27.988  1.00 34.64  ?  385 LEU A CG    1 
ATOM   2962  C  CD1   . LEU A 1 385 ? 81.661  -67.489 27.100  1.00 42.47  ?  385 LEU A CD1   1 
ATOM   2963  C  CD2   . LEU A 1 385 ? 79.442  -66.313 27.271  1.00 27.85  ?  385 LEU A CD2   1 
ATOM   2964  N  N     . ASP A 1 386 ? 77.832  -70.573 27.840  1.00 42.38  ?  386 ASP A N     1 
ATOM   2965  C  CA    . ASP A 1 386 ? 77.233  -71.393 26.790  1.00 43.56  ?  386 ASP A CA    1 
ATOM   2966  C  C     . ASP A 1 386 ? 75.711  -71.284 26.769  1.00 46.49  ?  386 ASP A C     1 
ATOM   2967  O  O     . ASP A 1 386 ? 75.100  -71.240 25.695  1.00 53.01  ?  386 ASP A O     1 
ATOM   2968  C  CB    . ASP A 1 386 ? 77.711  -72.852 26.849  1.00 46.12  ?  386 ASP A CB    1 
ATOM   2969  C  CG    . ASP A 1 386 ? 79.178  -73.001 26.482  1.00 54.81  ?  386 ASP A CG    1 
ATOM   2970  O  OD1   . ASP A 1 386 ? 79.654  -72.287 25.563  1.00 55.32  ?  386 ASP A OD1   1 
ATOM   2971  O  OD2   . ASP A 1 386 ? 79.862  -73.833 27.118  1.00 61.70  ?  386 ASP A OD2   1 
ATOM   2972  N  N     . GLU A 1 387 ? 75.101  -71.216 27.945  1.00 43.00  ?  387 GLU A N     1 
ATOM   2973  C  CA    . GLU A 1 387 ? 73.649  -71.101 28.010  1.00 44.62  ?  387 GLU A CA    1 
ATOM   2974  C  C     . GLU A 1 387 ? 73.141  -69.670 27.839  1.00 48.13  ?  387 GLU A C     1 
ATOM   2975  O  O     . GLU A 1 387 ? 71.980  -69.462 27.503  1.00 57.18  ?  387 GLU A O     1 
ATOM   2976  C  CB    . GLU A 1 387 ? 73.067  -71.741 29.278  1.00 46.28  ?  387 GLU A CB    1 
ATOM   2977  C  CG    . GLU A 1 387 ? 73.865  -71.554 30.535  1.00 49.94  ?  387 GLU A CG    1 
ATOM   2978  C  CD    . GLU A 1 387 ? 74.798  -72.721 30.801  1.00 63.48  ?  387 GLU A CD    1 
ATOM   2979  O  OE1   . GLU A 1 387 ? 74.358  -73.695 31.451  1.00 63.49  ?  387 GLU A OE1   1 
ATOM   2980  O  OE2   . GLU A 1 387 ? 75.973  -72.663 30.371  1.00 74.17  ?  387 GLU A OE2   1 
ATOM   2981  N  N     . VAL A 1 388 ? 73.993  -68.681 28.066  1.00 41.79  ?  388 VAL A N     1 
ATOM   2982  C  CA    . VAL A 1 388 ? 73.555  -67.310 27.845  1.00 38.82  ?  388 VAL A CA    1 
ATOM   2983  C  C     . VAL A 1 388 ? 73.601  -67.003 26.358  1.00 38.44  ?  388 VAL A C     1 
ATOM   2984  O  O     . VAL A 1 388 ? 72.728  -66.311 25.846  1.00 41.70  ?  388 VAL A O     1 
ATOM   2985  C  CB    . VAL A 1 388 ? 74.347  -66.272 28.690  1.00 39.63  ?  388 VAL A CB    1 
ATOM   2986  C  CG1   . VAL A 1 388 ? 74.216  -64.887 28.111  1.00 21.31  ?  388 VAL A CG1   1 
ATOM   2987  C  CG2   . VAL A 1 388 ? 73.828  -66.264 30.088  1.00 41.18  ?  388 VAL A CG2   1 
ATOM   2988  N  N     . ILE A 1 389 ? 74.610  -67.534 25.671  1.00 32.87  ?  389 ILE A N     1 
ATOM   2989  C  CA    . ILE A 1 389 ? 74.689  -67.404 24.221  1.00 34.45  ?  389 ILE A CA    1 
ATOM   2990  C  C     . ILE A 1 389 ? 73.518  -68.133 23.593  1.00 41.33  ?  389 ILE A C     1 
ATOM   2991  O  O     . ILE A 1 389 ? 72.949  -67.680 22.589  1.00 43.32  ?  389 ILE A O     1 
ATOM   2992  C  CB    . ILE A 1 389 ? 75.955  -68.046 23.653  1.00 31.60  ?  389 ILE A CB    1 
ATOM   2993  C  CG1   . ILE A 1 389 ? 77.198  -67.384 24.220  1.00 36.79  ?  389 ILE A CG1   1 
ATOM   2994  C  CG2   . ILE A 1 389 ? 75.967  -67.939 22.146  1.00 25.65  ?  389 ILE A CG2   1 
ATOM   2995  C  CD1   . ILE A 1 389 ? 78.457  -68.085 23.793  1.00 42.17  ?  389 ILE A CD1   1 
ATOM   2996  N  N     . ALA A 1 390 ? 73.177  -69.269 24.202  1.00 38.35  ?  390 ALA A N     1 
ATOM   2997  C  CA    . ALA A 1 390 ? 72.121  -70.150 23.724  1.00 38.35  ?  390 ALA A CA    1 
ATOM   2998  C  C     . ALA A 1 390 ? 70.741  -69.492 23.795  1.00 42.05  ?  390 ALA A C     1 
ATOM   2999  O  O     . ALA A 1 390 ? 69.872  -69.724 22.941  1.00 45.99  ?  390 ALA A O     1 
ATOM   3000  C  CB    . ALA A 1 390 ? 72.131  -71.425 24.517  1.00 38.98  ?  390 ALA A CB    1 
ATOM   3001  N  N     . LEU A 1 391 ? 70.566  -68.665 24.817  1.00 41.19  ?  391 LEU A N     1 
ATOM   3002  C  CA    . LEU A 1 391 ? 69.321  -67.964 25.100  1.00 42.50  ?  391 LEU A CA    1 
ATOM   3003  C  C     . LEU A 1 391 ? 69.125  -66.794 24.127  1.00 44.46  ?  391 LEU A C     1 
ATOM   3004  O  O     . LEU A 1 391 ? 68.005  -66.478 23.701  1.00 44.10  ?  391 LEU A O     1 
ATOM   3005  C  CB    . LEU A 1 391 ? 69.384  -67.467 26.549  1.00 42.46  ?  391 LEU A CB    1 
ATOM   3006  C  CG    . LEU A 1 391 ? 68.235  -66.714 27.208  1.00 49.25  ?  391 LEU A CG    1 
ATOM   3007  C  CD1   . LEU A 1 391 ? 68.058  -67.221 28.616  1.00 49.95  ?  391 LEU A CD1   1 
ATOM   3008  C  CD2   . LEU A 1 391 ? 68.551  -65.219 27.220  1.00 53.39  ?  391 LEU A CD2   1 
ATOM   3009  N  N     . ILE A 1 392 ? 70.230  -66.144 23.787  1.00 44.56  ?  392 ILE A N     1 
ATOM   3010  C  CA    . ILE A 1 392 ? 70.221  -65.056 22.830  1.00 39.02  ?  392 ILE A CA    1 
ATOM   3011  C  C     . ILE A 1 392 ? 69.966  -65.638 21.447  1.00 37.71  ?  392 ILE A C     1 
ATOM   3012  O  O     . ILE A 1 392 ? 69.127  -65.143 20.693  1.00 38.66  ?  392 ILE A O     1 
ATOM   3013  C  CB    . ILE A 1 392 ? 71.545  -64.298 22.889  1.00 35.28  ?  392 ILE A CB    1 
ATOM   3014  C  CG1   . ILE A 1 392 ? 71.550  -63.391 24.117  1.00 35.04  ?  392 ILE A CG1   1 
ATOM   3015  C  CG2   . ILE A 1 392 ? 71.730  -63.461 21.665  1.00 36.86  ?  392 ILE A CG2   1 
ATOM   3016  C  CD1   . ILE A 1 392 ? 72.840  -63.441 24.913  1.00 35.31  ?  392 ILE A CD1   1 
ATOM   3017  N  N     . ARG A 1 393 ? 70.682  -66.709 21.128  1.00 35.44  ?  393 ARG A N     1 
ATOM   3018  C  CA    . ARG A 1 393 ? 70.402  -67.476 19.928  1.00 38.10  ?  393 ARG A CA    1 
ATOM   3019  C  C     . ARG A 1 393 ? 68.901  -67.791 19.831  1.00 48.21  ?  393 ARG A C     1 
ATOM   3020  O  O     . ARG A 1 393 ? 68.302  -67.744 18.760  1.00 54.71  ?  393 ARG A O     1 
ATOM   3021  C  CB    . ARG A 1 393 ? 71.210  -68.772 19.959  1.00 34.12  ?  393 ARG A CB    1 
ATOM   3022  C  CG    . ARG A 1 393 ? 71.200  -69.550 18.649  1.00 36.90  ?  393 ARG A CG    1 
ATOM   3023  C  CD    . ARG A 1 393 ? 71.851  -68.757 17.550  1.00 45.21  ?  393 ARG A CD    1 
ATOM   3024  N  NE    . ARG A 1 393 ? 71.108  -68.842 16.297  1.00 55.87  ?  393 ARG A NE    1 
ATOM   3025  C  CZ    . ARG A 1 393 ? 71.164  -69.885 15.480  1.00 55.78  ?  393 ARG A CZ    1 
ATOM   3026  N  NH1   . ARG A 1 393 ? 71.909  -70.928 15.802  1.00 55.93  ?  393 ARG A NH1   1 
ATOM   3027  N  NH2   . ARG A 1 393 ? 70.471  -69.889 14.356  1.00 54.93  ?  393 ARG A NH2   1 
ATOM   3028  N  N     . ALA A 1 394 ? 68.298  -68.109 20.965  1.00 49.13  ?  394 ALA A N     1 
ATOM   3029  C  CA    . ALA A 1 394 ? 66.912  -68.536 20.995  1.00 51.49  ?  394 ALA A CA    1 
ATOM   3030  C  C     . ALA A 1 394 ? 65.950  -67.371 21.129  1.00 52.54  ?  394 ALA A C     1 
ATOM   3031  O  O     . ALA A 1 394 ? 64.736  -67.555 21.003  1.00 59.60  ?  394 ALA A O     1 
ATOM   3032  C  CB    . ALA A 1 394 ? 66.699  -69.504 22.137  1.00 54.17  ?  394 ALA A CB    1 
ATOM   3033  N  N     . SER A 1 395 ? 66.476  -66.179 21.400  1.00 48.56  ?  395 SER A N     1 
ATOM   3034  C  CA    . SER A 1 395 ? 65.612  -65.018 21.634  1.00 48.89  ?  395 SER A CA    1 
ATOM   3035  C  C     . SER A 1 395 ? 65.165  -64.370 20.303  1.00 48.92  ?  395 SER A C     1 
ATOM   3036  O  O     . SER A 1 395 ? 65.835  -64.528 19.284  1.00 51.77  ?  395 SER A O     1 
ATOM   3037  C  CB    . SER A 1 395 ? 66.278  -64.034 22.604  1.00 31.93  ?  395 SER A CB    1 
ATOM   3038  N  N     . GLU A 1 396 ? 64.014  -63.695 20.299  1.00 49.12  ?  396 GLU A N     1 
ATOM   3039  C  CA    . GLU A 1 396 ? 63.458  -63.133 19.058  1.00 51.70  ?  396 GLU A CA    1 
ATOM   3040  C  C     . GLU A 1 396 ? 64.123  -61.822 18.654  1.00 50.46  ?  396 GLU A C     1 
ATOM   3041  O  O     . GLU A 1 396 ? 64.250  -61.514 17.479  1.00 48.53  ?  396 GLU A O     1 
ATOM   3042  C  CB    . GLU A 1 396 ? 61.955  -62.891 19.181  1.00 55.02  ?  396 GLU A CB    1 
ATOM   3043  C  CG    . GLU A 1 396 ? 61.115  -64.126 19.490  1.00 62.78  ?  396 GLU A CG    1 
ATOM   3044  C  CD    . GLU A 1 396 ? 59.723  -63.760 20.005  1.00 72.80  ?  396 GLU A CD    1 
ATOM   3045  O  OE1   . GLU A 1 396 ? 59.356  -62.558 19.935  1.00 76.17  ?  396 GLU A OE1   1 
ATOM   3046  O  OE2   . GLU A 1 396 ? 58.998  -64.667 20.484  1.00 76.41  ?  396 GLU A OE2   1 
ATOM   3047  N  N     . ASN A 1 397 ? 64.540  -61.045 19.638  1.00 51.25  ?  397 ASN A N     1 
ATOM   3048  C  CA    . ASN A 1 397 ? 65.154  -59.758 19.366  1.00 49.97  ?  397 ASN A CA    1 
ATOM   3049  C  C     . ASN A 1 397 ? 65.867  -59.230 20.601  1.00 48.69  ?  397 ASN A C     1 
ATOM   3050  O  O     . ASN A 1 397 ? 65.986  -59.931 21.600  1.00 50.85  ?  397 ASN A O     1 
ATOM   3051  C  CB    . ASN A 1 397 ? 64.098  -58.764 18.904  1.00 54.28  ?  397 ASN A CB    1 
ATOM   3052  C  CG    . ASN A 1 397 ? 63.064  -58.493 19.965  1.00 58.74  ?  397 ASN A CG    1 
ATOM   3053  O  OD1   . ASN A 1 397 ? 63.195  -57.546 20.737  1.00 63.87  ?  397 ASN A OD1   1 
ATOM   3054  N  ND2   . ASN A 1 397 ? 62.030  -59.326 20.017  1.00 56.92  ?  397 ASN A ND2   1 
ATOM   3055  N  N     . LYS A 1 398 ? 66.350  -57.996 20.534  1.00 45.55  ?  398 LYS A N     1 
ATOM   3056  C  CA    . LYS A 1 398 ? 67.081  -57.442 21.661  1.00 42.67  ?  398 LYS A CA    1 
ATOM   3057  C  C     . LYS A 1 398 ? 66.161  -57.364 22.874  1.00 46.22  ?  398 LYS A C     1 
ATOM   3058  O  O     . LYS A 1 398 ? 66.483  -57.877 23.942  1.00 45.70  ?  398 LYS A O     1 
ATOM   3059  C  CB    . LYS A 1 398 ? 67.661  -56.075 21.311  1.00 40.28  ?  398 LYS A CB    1 
ATOM   3060  C  CG    . LYS A 1 398 ? 68.534  -55.492 22.388  1.00 35.09  ?  398 LYS A CG    1 
ATOM   3061  C  CD    . LYS A 1 398 ? 69.176  -54.198 21.966  1.00 35.34  ?  398 LYS A CD    1 
ATOM   3062  C  CE    . LYS A 1 398 ? 69.863  -53.527 23.149  1.00 38.06  ?  398 LYS A CE    1 
ATOM   3063  N  NZ    . LYS A 1 398 ? 69.947  -52.053 22.953  1.00 42.82  ?  398 LYS A NZ    1 
ATOM   3064  N  N     . ALA A 1 399 ? 65.006  -56.738 22.693  1.00 51.06  ?  399 ALA A N     1 
ATOM   3065  C  CA    . ALA A 1 399 ? 63.970  -56.718 23.719  1.00 53.27  ?  399 ALA A CA    1 
ATOM   3066  C  C     . ALA A 1 399 ? 63.786  -58.075 24.378  1.00 48.83  ?  399 ALA A C     1 
ATOM   3067  O  O     . ALA A 1 399 ? 63.914  -58.199 25.601  1.00 48.39  ?  399 ALA A O     1 
ATOM   3068  C  CB    . ALA A 1 399 ? 62.649  -56.262 23.118  1.00 61.57  ?  399 ALA A CB    1 
ATOM   3069  N  N     . ASP A 1 400 ? 63.468  -59.085 23.566  1.00 46.37  ?  400 ASP A N     1 
ATOM   3070  C  CA    . ASP A 1 400 ? 63.159  -60.425 24.076  1.00 48.92  ?  400 ASP A CA    1 
ATOM   3071  C  C     . ASP A 1 400 ? 64.345  -61.042 24.806  1.00 49.63  ?  400 ASP A C     1 
ATOM   3072  O  O     . ASP A 1 400 ? 64.205  -61.619 25.882  1.00 51.10  ?  400 ASP A O     1 
ATOM   3073  C  CB    . ASP A 1 400 ? 62.708  -61.361 22.948  1.00 49.24  ?  400 ASP A CB    1 
ATOM   3074  C  CG    . ASP A 1 400 ? 62.024  -62.622 23.472  1.00 56.84  ?  400 ASP A CG    1 
ATOM   3075  O  OD1   . ASP A 1 400 ? 62.238  -63.713 22.890  1.00 58.21  ?  400 ASP A OD1   1 
ATOM   3076  O  OD2   . ASP A 1 400 ? 61.261  -62.521 24.465  1.00 63.48  ?  400 ASP A OD2   1 
ATOM   3077  N  N     . ALA A 1 401 ? 65.517  -60.924 24.199  1.00 48.89  ?  401 ALA A N     1 
ATOM   3078  C  CA    . ALA A 1 401 ? 66.728  -61.450 24.787  1.00 44.56  ?  401 ALA A CA    1 
ATOM   3079  C  C     . ALA A 1 401 ? 66.871  -60.914 26.213  1.00 44.16  ?  401 ALA A C     1 
ATOM   3080  O  O     . ALA A 1 401 ? 67.034  -61.685 27.160  1.00 44.87  ?  401 ALA A O     1 
ATOM   3081  C  CB    . ALA A 1 401 ? 67.923  -61.074 23.929  1.00 41.09  ?  401 ALA A CB    1 
ATOM   3082  N  N     . LYS A 1 402 ? 66.798  -59.595 26.363  1.00 44.50  ?  402 LYS A N     1 
ATOM   3083  C  CA    . LYS A 1 402 ? 66.862  -58.998 27.682  1.00 41.67  ?  402 LYS A CA    1 
ATOM   3084  C  C     . LYS A 1 402 ? 65.796  -59.605 28.601  1.00 50.37  ?  402 LYS A C     1 
ATOM   3085  O  O     . LYS A 1 402 ? 66.107  -60.045 29.701  1.00 56.49  ?  402 LYS A O     1 
ATOM   3086  C  CB    . LYS A 1 402 ? 66.735  -57.481 27.609  1.00 37.57  ?  402 LYS A CB    1 
ATOM   3087  C  CG    . LYS A 1 402 ? 67.804  -56.821 26.770  1.00 37.46  ?  402 LYS A CG    1 
ATOM   3088  C  CD    . LYS A 1 402 ? 68.327  -55.500 27.365  1.00 41.40  ?  402 LYS A CD    1 
ATOM   3089  C  CE    . LYS A 1 402 ? 67.223  -54.506 27.712  1.00 44.41  ?  402 LYS A CE    1 
ATOM   3090  N  NZ    . LYS A 1 402 ? 66.262  -54.296 26.598  1.00 51.34  ?  402 LYS A NZ    1 
ATOM   3091  N  N     . GLU A 1 403 ? 64.547  -59.665 28.156  1.00 50.76  ?  403 GLU A N     1 
ATOM   3092  C  CA    . GLU A 1 403 ? 63.527  -60.292 28.993  1.00 54.71  ?  403 GLU A CA    1 
ATOM   3093  C  C     . GLU A 1 403 ? 63.929  -61.691 29.491  1.00 48.59  ?  403 GLU A C     1 
ATOM   3094  O  O     . GLU A 1 403 ? 63.842  -61.978 30.684  1.00 48.15  ?  403 GLU A O     1 
ATOM   3095  C  CB    . GLU A 1 403 ? 62.165  -60.331 28.303  1.00 64.91  ?  403 GLU A CB    1 
ATOM   3096  C  CG    . GLU A 1 403 ? 61.000  -60.352 29.290  1.00 78.52  ?  403 GLU A CG    1 
ATOM   3097  C  CD    . GLU A 1 403 ? 61.115  -59.269 30.381  1.00 87.80  ?  403 GLU A CD    1 
ATOM   3098  O  OE1   . GLU A 1 403 ? 60.478  -59.445 31.450  1.00 93.01  ?  403 GLU A OE1   1 
ATOM   3099  O  OE2   . GLU A 1 403 ? 61.836  -58.254 30.173  1.00 87.22  ?  403 GLU A OE2   1 
ATOM   3100  N  N     . ASN A 1 404 ? 64.384  -62.552 28.589  1.00 45.54  ?  404 ASN A N     1 
ATOM   3101  C  CA    . ASN A 1 404 ? 64.791  -63.901 28.974  1.00 45.36  ?  404 ASN A CA    1 
ATOM   3102  C  C     . ASN A 1 404 ? 65.955  -63.935 29.957  1.00 44.22  ?  404 ASN A C     1 
ATOM   3103  O  O     . ASN A 1 404 ? 65.992  -64.783 30.848  1.00 49.46  ?  404 ASN A O     1 
ATOM   3104  C  CB    . ASN A 1 404 ? 65.141  -64.750 27.747  1.00 46.75  ?  404 ASN A CB    1 
ATOM   3105  C  CG    . ASN A 1 404 ? 63.951  -64.995 26.845  1.00 48.72  ?  404 ASN A CG    1 
ATOM   3106  O  OD1   . ASN A 1 404 ? 63.049  -65.761 27.180  1.00 48.92  ?  404 ASN A OD1   1 
ATOM   3107  N  ND2   . ASN A 1 404 ? 63.948  -64.349 25.686  1.00 51.00  ?  404 ASN A ND2   1 
ATOM   3108  N  N     . LEU A 1 405 ? 66.916  -63.032 29.785  1.00 42.42  ?  405 LEU A N     1 
ATOM   3109  C  CA    . LEU A 1 405 ? 68.041  -62.959 30.708  1.00 42.68  ?  405 LEU A CA    1 
ATOM   3110  C  C     . LEU A 1 405 ? 67.535  -62.657 32.104  1.00 46.28  ?  405 LEU A C     1 
ATOM   3111  O  O     . LEU A 1 405 ? 67.899  -63.340 33.061  1.00 49.31  ?  405 LEU A O     1 
ATOM   3112  C  CB    . LEU A 1 405 ? 69.051  -61.909 30.267  1.00 40.28  ?  405 LEU A CB    1 
ATOM   3113  C  CG    . LEU A 1 405 ? 69.981  -62.425 29.176  1.00 38.96  ?  405 LEU A CG    1 
ATOM   3114  C  CD1   . LEU A 1 405 ? 70.917  -61.337 28.664  1.00 39.00  ?  405 LEU A CD1   1 
ATOM   3115  C  CD2   . LEU A 1 405 ? 70.755  -63.594 29.726  1.00 24.91  ?  405 LEU A CD2   1 
ATOM   3116  N  N     . LYS A 1 406 ? 66.683  -61.645 32.219  1.00 45.57  ?  406 LYS A N     1 
ATOM   3117  C  CA    . LYS A 1 406 ? 66.012  -61.367 33.486  1.00 50.04  ?  406 LYS A CA    1 
ATOM   3118  C  C     . LYS A 1 406 ? 65.295  -62.610 34.023  1.00 52.95  ?  406 LYS A C     1 
ATOM   3119  O  O     . LYS A 1 406 ? 65.642  -63.127 35.088  1.00 51.68  ?  406 LYS A O     1 
ATOM   3120  C  CB    . LYS A 1 406 ? 65.003  -60.237 33.329  1.00 51.03  ?  406 LYS A CB    1 
ATOM   3121  C  CG    . LYS A 1 406 ? 65.584  -58.902 32.901  1.00 51.59  ?  406 LYS A CG    1 
ATOM   3122  C  CD    . LYS A 1 406 ? 64.427  -57.947 32.597  1.00 58.26  ?  406 LYS A CD    1 
ATOM   3123  C  CE    . LYS A 1 406 ? 64.868  -56.595 32.071  1.00 59.74  ?  406 LYS A CE    1 
ATOM   3124  N  NZ    . LYS A 1 406 ? 63.692  -55.918 31.449  1.00 63.37  ?  406 LYS A NZ    1 
ATOM   3125  N  N     . VAL A 1 407 ? 64.305  -63.090 33.274  1.00 53.27  ?  407 VAL A N     1 
ATOM   3126  C  CA    . VAL A 1 407 ? 63.464  -64.189 33.745  1.00 51.80  ?  407 VAL A CA    1 
ATOM   3127  C  C     . VAL A 1 407 ? 64.228  -65.477 34.020  1.00 48.20  ?  407 VAL A C     1 
ATOM   3128  O  O     . VAL A 1 407 ? 64.063  -66.084 35.072  1.00 54.04  ?  407 VAL A O     1 
ATOM   3129  C  CB    . VAL A 1 407 ? 62.302  -64.522 32.778  1.00 50.84  ?  407 VAL A CB    1 
ATOM   3130  C  CG1   . VAL A 1 407 ? 61.466  -65.647 33.356  1.00 47.45  ?  407 VAL A CG1   1 
ATOM   3131  C  CG2   . VAL A 1 407 ? 61.430  -63.297 32.517  1.00 52.77  ?  407 VAL A CG2   1 
ATOM   3132  N  N     . SER A 1 408 ? 65.045  -65.919 33.077  1.00 43.69  ?  408 SER A N     1 
ATOM   3133  C  CA    . SER A 1 408 ? 65.695  -67.204 33.261  1.00 45.02  ?  408 SER A CA    1 
ATOM   3134  C  C     . SER A 1 408 ? 66.877  -67.134 34.254  1.00 40.94  ?  408 SER A C     1 
ATOM   3135  O  O     . SER A 1 408 ? 67.117  -68.081 35.005  1.00 44.53  ?  408 SER A O     1 
ATOM   3136  C  CB    . SER A 1 408 ? 66.068  -67.846 31.916  1.00 36.89  ?  408 SER A CB    1 
ATOM   3137  N  N     . TYR A 1 409 ? 67.592  -66.013 34.307  1.00 36.86  ?  409 TYR A N     1 
ATOM   3138  C  CA    . TYR A 1 409 ? 68.769  -65.970 35.179  1.00 38.67  ?  409 TYR A CA    1 
ATOM   3139  C  C     . TYR A 1 409 ? 68.853  -64.781 36.143  1.00 40.91  ?  409 TYR A C     1 
ATOM   3140  O  O     . TYR A 1 409 ? 69.900  -64.535 36.744  1.00 38.16  ?  409 TYR A O     1 
ATOM   3141  C  CB    . TYR A 1 409 ? 70.062  -66.102 34.374  1.00 34.77  ?  409 TYR A CB    1 
ATOM   3142  C  CG    . TYR A 1 409 ? 70.216  -67.399 33.604  1.00 39.62  ?  409 TYR A CG    1 
ATOM   3143  C  CD1   . TYR A 1 409 ? 70.826  -68.508 34.181  1.00 46.56  ?  409 TYR A CD1   1 
ATOM   3144  C  CD2   . TYR A 1 409 ? 69.779  -67.504 32.289  1.00 42.22  ?  409 TYR A CD2   1 
ATOM   3145  C  CE1   . TYR A 1 409 ? 70.984  -69.696 33.473  1.00 51.82  ?  409 TYR A CE1   1 
ATOM   3146  C  CE2   . TYR A 1 409 ? 69.932  -68.682 31.568  1.00 48.11  ?  409 TYR A CE2   1 
ATOM   3147  C  CZ    . TYR A 1 409 ? 70.537  -69.781 32.160  1.00 53.29  ?  409 TYR A CZ    1 
ATOM   3148  O  OH    . TYR A 1 409 ? 70.687  -70.959 31.441  1.00 53.98  ?  409 TYR A OH    1 
ATOM   3149  N  N     . ASP A 1 410 ? 67.751  -64.058 36.306  1.00 42.77  ?  410 ASP A N     1 
ATOM   3150  C  CA    . ASP A 1 410 ? 67.666  -63.025 37.341  1.00 42.94  ?  410 ASP A CA    1 
ATOM   3151  C  C     . ASP A 1 410 ? 68.654  -61.902 37.114  1.00 43.18  ?  410 ASP A C     1 
ATOM   3152  O  O     . ASP A 1 410 ? 69.082  -61.241 38.055  1.00 49.87  ?  410 ASP A O     1 
ATOM   3153  C  CB    . ASP A 1 410 ? 67.916  -63.601 38.738  1.00 45.90  ?  410 ASP A CB    1 
ATOM   3154  C  CG    . ASP A 1 410 ? 67.000  -64.744 39.075  1.00 56.40  ?  410 ASP A CG    1 
ATOM   3155  O  OD1   . ASP A 1 410 ? 65.759  -64.592 38.965  1.00 62.27  ?  410 ASP A OD1   1 
ATOM   3156  O  OD2   . ASP A 1 410 ? 67.540  -65.808 39.450  1.00 60.35  ?  410 ASP A OD2   1 
ATOM   3157  N  N     . PHE A 1 411 ? 69.045  -61.680 35.876  1.00 38.04  ?  411 PHE A N     1 
ATOM   3158  C  CA    . PHE A 1 411 ? 69.821  -60.488 35.615  1.00 39.16  ?  411 PHE A CA    1 
ATOM   3159  C  C     . PHE A 1 411 ? 68.885  -59.296 35.687  1.00 41.94  ?  411 PHE A C     1 
ATOM   3160  O  O     . PHE A 1 411 ? 67.667  -59.440 35.592  1.00 46.99  ?  411 PHE A O     1 
ATOM   3161  C  CB    . PHE A 1 411 ? 70.522  -60.571 34.270  1.00 37.06  ?  411 PHE A CB    1 
ATOM   3162  C  CG    . PHE A 1 411 ? 71.624  -61.578 34.232  1.00 32.60  ?  411 PHE A CG    1 
ATOM   3163  C  CD1   . PHE A 1 411 ? 72.851  -61.297 34.798  1.00 33.27  ?  411 PHE A CD1   1 
ATOM   3164  C  CD2   . PHE A 1 411 ? 71.438  -62.796 33.618  1.00 33.81  ?  411 PHE A CD2   1 
ATOM   3165  C  CE1   . PHE A 1 411 ? 73.866  -62.217 34.768  1.00 32.74  ?  411 PHE A CE1   1 
ATOM   3166  C  CE2   . PHE A 1 411 ? 72.452  -63.720 33.580  1.00 36.49  ?  411 PHE A CE2   1 
ATOM   3167  C  CZ    . PHE A 1 411 ? 73.668  -63.430 34.155  1.00 34.34  ?  411 PHE A CZ    1 
ATOM   3168  N  N     . THR A 1 412 ? 69.446  -58.118 35.887  1.00 39.77  ?  412 THR A N     1 
ATOM   3169  C  CA    . THR A 1 412 ? 68.619  -56.932 35.971  1.00 45.75  ?  412 THR A CA    1 
ATOM   3170  C  C     . THR A 1 412 ? 68.642  -56.250 34.616  1.00 49.35  ?  412 THR A C     1 
ATOM   3171  O  O     . THR A 1 412 ? 69.516  -56.522 33.800  1.00 52.82  ?  412 THR A O     1 
ATOM   3172  C  CB    . THR A 1 412 ? 69.107  -56.000 37.092  1.00 50.41  ?  412 THR A CB    1 
ATOM   3173  O  OG1   . THR A 1 412 ? 70.185  -55.195 36.621  1.00 51.34  ?  412 THR A OG1   1 
ATOM   3174  C  CG2   . THR A 1 412 ? 69.607  -56.823 38.264  1.00 54.23  ?  412 THR A CG2   1 
ATOM   3175  N  N     . GLU A 1 413 ? 67.668  -55.394 34.356  1.00 50.74  ?  413 GLU A N     1 
ATOM   3176  C  CA    . GLU A 1 413 ? 67.661  -54.638 33.114  1.00 47.99  ?  413 GLU A CA    1 
ATOM   3177  C  C     . GLU A 1 413 ? 69.083  -54.177 32.767  1.00 45.47  ?  413 GLU A C     1 
ATOM   3178  O  O     . GLU A 1 413 ? 69.604  -54.475 31.690  1.00 46.59  ?  413 GLU A O     1 
ATOM   3179  C  CB    . GLU A 1 413 ? 66.705  -53.448 33.235  1.00 52.07  ?  413 GLU A CB    1 
ATOM   3180  C  CG    . GLU A 1 413 ? 66.883  -52.375 32.183  1.00 57.88  ?  413 GLU A CG    1 
ATOM   3181  C  CD    . GLU A 1 413 ? 66.498  -52.838 30.793  1.00 64.48  ?  413 GLU A CD    1 
ATOM   3182  O  OE1   . GLU A 1 413 ? 66.925  -52.178 29.818  1.00 68.28  ?  413 GLU A OE1   1 
ATOM   3183  O  OE2   . GLU A 1 413 ? 65.772  -53.855 30.679  1.00 64.92  ?  413 GLU A OE2   1 
ATOM   3184  N  N     . GLU A 1 414 ? 69.724  -53.481 33.698  1.00 43.13  ?  414 GLU A N     1 
ATOM   3185  C  CA    . GLU A 1 414 ? 71.017  -52.870 33.421  1.00 44.47  ?  414 GLU A CA    1 
ATOM   3186  C  C     . GLU A 1 414 ? 72.107  -53.880 33.039  1.00 41.37  ?  414 GLU A C     1 
ATOM   3187  O  O     . GLU A 1 414 ? 72.971  -53.582 32.215  1.00 49.65  ?  414 GLU A O     1 
ATOM   3188  C  CB    . GLU A 1 414 ? 71.456  -51.950 34.569  1.00 53.39  ?  414 GLU A CB    1 
ATOM   3189  C  CG    . GLU A 1 414 ? 70.575  -52.019 35.817  1.00 65.72  ?  414 GLU A CG    1 
ATOM   3190  C  CD    . GLU A 1 414 ? 69.244  -51.298 35.660  1.00 76.38  ?  414 GLU A CD    1 
ATOM   3191  O  OE1   . GLU A 1 414 ? 68.206  -51.847 36.103  1.00 80.09  ?  414 GLU A OE1   1 
ATOM   3192  O  OE2   . GLU A 1 414 ? 69.242  -50.176 35.107  1.00 80.91  ?  414 GLU A OE2   1 
ATOM   3193  N  N     . GLN A 1 415 ? 72.059  -55.071 33.623  1.00 35.59  ?  415 GLN A N     1 
ATOM   3194  C  CA    . GLN A 1 415 ? 73.012  -56.125 33.289  1.00 39.96  ?  415 GLN A CA    1 
ATOM   3195  C  C     . GLN A 1 415 ? 72.611  -56.773 31.971  1.00 40.40  ?  415 GLN A C     1 
ATOM   3196  O  O     . GLN A 1 415 ? 73.444  -57.089 31.118  1.00 37.79  ?  415 GLN A O     1 
ATOM   3197  C  CB    . GLN A 1 415 ? 73.026  -57.190 34.386  1.00 45.87  ?  415 GLN A CB    1 
ATOM   3198  C  CG    . GLN A 1 415 ? 72.816  -56.625 35.778  1.00 50.26  ?  415 GLN A CG    1 
ATOM   3199  C  CD    . GLN A 1 415 ? 73.106  -57.628 36.871  1.00 45.96  ?  415 GLN A CD    1 
ATOM   3200  O  OE1   . GLN A 1 415 ? 72.266  -58.465 37.197  1.00 48.39  ?  415 GLN A OE1   1 
ATOM   3201  N  NE2   . GLN A 1 415 ? 74.298  -57.543 37.451  1.00 44.06  ?  415 GLN A NE2   1 
ATOM   3202  N  N     . ALA A 1 416 ? 71.314  -56.987 31.821  1.00 42.32  ?  416 ALA A N     1 
ATOM   3203  C  CA    . ALA A 1 416 ? 70.795  -57.591 30.619  1.00 41.45  ?  416 ALA A CA    1 
ATOM   3204  C  C     . ALA A 1 416 ? 71.161  -56.702 29.437  1.00 45.17  ?  416 ALA A C     1 
ATOM   3205  O  O     . ALA A 1 416 ? 71.449  -57.194 28.348  1.00 56.68  ?  416 ALA A O     1 
ATOM   3206  C  CB    . ALA A 1 416 ? 69.298  -57.761 30.730  1.00 44.89  ?  416 ALA A CB    1 
ATOM   3207  N  N     . GLU A 1 417 ? 71.168  -55.390 29.650  1.00 35.01  ?  417 GLU A N     1 
ATOM   3208  C  CA    . GLU A 1 417 ? 71.566  -54.491 28.580  1.00 34.22  ?  417 GLU A CA    1 
ATOM   3209  C  C     . GLU A 1 417 ? 73.077  -54.557 28.316  1.00 37.83  ?  417 GLU A C     1 
ATOM   3210  O  O     . GLU A 1 417 ? 73.520  -54.646 27.169  1.00 39.33  ?  417 GLU A O     1 
ATOM   3211  C  CB    . GLU A 1 417 ? 71.133  -53.065 28.869  1.00 36.87  ?  417 GLU A CB    1 
ATOM   3212  C  CG    . GLU A 1 417 ? 71.583  -52.057 27.816  1.00 44.86  ?  417 GLU A CG    1 
ATOM   3213  C  CD    . GLU A 1 417 ? 70.676  -52.017 26.593  1.00 52.63  ?  417 GLU A CD    1 
ATOM   3214  O  OE1   . GLU A 1 417 ? 69.509  -52.493 26.663  1.00 56.57  ?  417 GLU A OE1   1 
ATOM   3215  O  OE2   . GLU A 1 417 ? 71.152  -51.502 25.556  1.00 51.84  ?  417 GLU A OE2   1 
ATOM   3216  N  N     . ALA A 1 418 ? 73.878  -54.534 29.369  1.00 40.56  ?  418 ALA A N     1 
ATOM   3217  C  CA    . ALA A 1 418 ? 75.308  -54.715 29.176  1.00 41.11  ?  418 ALA A CA    1 
ATOM   3218  C  C     . ALA A 1 418 ? 75.612  -56.013 28.415  1.00 42.52  ?  418 ALA A C     1 
ATOM   3219  O  O     . ALA A 1 418 ? 76.318  -55.995 27.407  1.00 46.60  ?  418 ALA A O     1 
ATOM   3220  C  CB    . ALA A 1 418 ? 76.041  -54.683 30.507  1.00 38.98  ?  418 ALA A CB    1 
ATOM   3221  N  N     . ILE A 1 419 ? 75.075  -57.127 28.907  1.00 38.93  ?  419 ILE A N     1 
ATOM   3222  C  CA    . ILE A 1 419 ? 75.354  -58.452 28.364  1.00 35.38  ?  419 ILE A CA    1 
ATOM   3223  C  C     . ILE A 1 419 ? 75.040  -58.529 26.870  1.00 40.25  ?  419 ILE A C     1 
ATOM   3224  O  O     . ILE A 1 419 ? 75.890  -58.865 26.027  1.00 43.97  ?  419 ILE A O     1 
ATOM   3225  C  CB    . ILE A 1 419 ? 74.526  -59.506 29.117  1.00 29.67  ?  419 ILE A CB    1 
ATOM   3226  C  CG1   . ILE A 1 419 ? 75.095  -59.705 30.527  1.00 31.92  ?  419 ILE A CG1   1 
ATOM   3227  C  CG2   . ILE A 1 419 ? 74.492  -60.820 28.363  1.00 25.77  ?  419 ILE A CG2   1 
ATOM   3228  C  CD1   . ILE A 1 419 ? 74.204  -60.541 31.454  1.00 35.42  ?  419 ILE A CD1   1 
ATOM   3229  N  N     . VAL A 1 420 ? 73.798  -58.198 26.564  1.00 34.92  ?  420 VAL A N     1 
ATOM   3230  C  CA    . VAL A 1 420 ? 73.259  -58.238 25.221  1.00 30.66  ?  420 VAL A CA    1 
ATOM   3231  C  C     . VAL A 1 420 ? 73.946  -57.286 24.213  1.00 33.17  ?  420 VAL A C     1 
ATOM   3232  O  O     . VAL A 1 420 ? 73.826  -57.453 23.003  1.00 35.35  ?  420 VAL A O     1 
ATOM   3233  C  CB    . VAL A 1 420 ? 71.773  -57.922 25.329  1.00 31.30  ?  420 VAL A CB    1 
ATOM   3234  C  CG1   . VAL A 1 420 ? 71.361  -56.799 24.386  1.00 32.79  ?  420 VAL A CG1   1 
ATOM   3235  C  CG2   . VAL A 1 420 ? 70.967  -59.181 25.155  1.00 32.06  ?  420 VAL A CG2   1 
ATOM   3236  N  N     . THR A 1 421 ? 74.675  -56.291 24.699  1.00 31.78  ?  421 THR A N     1 
ATOM   3237  C  CA    . THR A 1 421 ? 75.340  -55.352 23.800  1.00 28.37  ?  421 THR A CA    1 
ATOM   3238  C  C     . THR A 1 421 ? 76.862  -55.528 23.803  1.00 33.72  ?  421 THR A C     1 
ATOM   3239  O  O     . THR A 1 421 ? 77.596  -54.659 23.321  1.00 34.95  ?  421 THR A O     1 
ATOM   3240  C  CB    . THR A 1 421 ? 74.983  -53.892 24.139  1.00 27.37  ?  421 THR A CB    1 
ATOM   3241  O  OG1   . THR A 1 421 ? 75.511  -53.545 25.427  1.00 28.86  ?  421 THR A OG1   1 
ATOM   3242  C  CG2   . THR A 1 421 ? 73.479  -53.716 24.167  1.00 29.91  ?  421 THR A CG2   1 
ATOM   3243  N  N     . LEU A 1 422 ? 77.336  -56.645 24.355  1.00 36.60  ?  422 LEU A N     1 
ATOM   3244  C  CA    . LEU A 1 422 ? 78.747  -57.002 24.245  1.00 35.43  ?  422 LEU A CA    1 
ATOM   3245  C  C     . LEU A 1 422 ? 79.053  -57.325 22.776  1.00 33.33  ?  422 LEU A C     1 
ATOM   3246  O  O     . LEU A 1 422 ? 78.221  -57.894 22.072  1.00 35.76  ?  422 LEU A O     1 
ATOM   3247  C  CB    . LEU A 1 422 ? 79.078  -58.222 25.117  1.00 33.14  ?  422 LEU A CB    1 
ATOM   3248  C  CG    . LEU A 1 422 ? 79.044  -58.211 26.651  1.00 28.63  ?  422 LEU A CG    1 
ATOM   3249  C  CD1   . LEU A 1 422 ? 79.027  -59.633 27.186  1.00 26.29  ?  422 LEU A CD1   1 
ATOM   3250  C  CD2   . LEU A 1 422 ? 80.211  -57.461 27.248  1.00 30.02  ?  422 LEU A CD2   1 
ATOM   3251  N  N     . GLN A 1 423 ? 80.245  -56.960 22.322  1.00 33.35  ?  423 GLN A N     1 
ATOM   3252  C  CA    . GLN A 1 423 ? 80.702  -57.332 20.996  1.00 35.20  ?  423 GLN A CA    1 
ATOM   3253  C  C     . GLN A 1 423 ? 81.087  -58.810 21.008  1.00 31.26  ?  423 GLN A C     1 
ATOM   3254  O  O     . GLN A 1 423 ? 81.520  -59.313 22.034  1.00 32.77  ?  423 GLN A O     1 
ATOM   3255  C  CB    . GLN A 1 423 ? 81.892  -56.466 20.579  1.00 36.83  ?  423 GLN A CB    1 
ATOM   3256  C  CG    . GLN A 1 423 ? 81.577  -54.995 20.437  1.00 34.84  ?  423 GLN A CG    1 
ATOM   3257  C  CD    . GLN A 1 423 ? 82.697  -54.239 19.800  1.00 43.20  ?  423 GLN A CD    1 
ATOM   3258  O  OE1   . GLN A 1 423 ? 83.806  -54.208 20.314  1.00 43.52  ?  423 GLN A OE1   1 
ATOM   3259  N  NE2   . GLN A 1 423 ? 82.425  -53.629 18.659  1.00 52.01  ?  423 GLN A NE2   1 
ATOM   3260  N  N     . LEU A 1 424 ? 80.926  -59.502 19.878  1.00 28.29  ?  424 LEU A N     1 
ATOM   3261  C  CA    . LEU A 1 424 ? 81.128  -60.949 19.839  1.00 27.07  ?  424 LEU A CA    1 
ATOM   3262  C  C     . LEU A 1 424 ? 82.469  -61.409 20.410  1.00 28.78  ?  424 LEU A C     1 
ATOM   3263  O  O     . LEU A 1 424 ? 82.528  -62.390 21.143  1.00 31.57  ?  424 LEU A O     1 
ATOM   3264  C  CB    . LEU A 1 424 ? 80.975  -61.478 18.421  1.00 28.45  ?  424 LEU A CB    1 
ATOM   3265  C  CG    . LEU A 1 424 ? 79.566  -61.904 18.056  1.00 30.02  ?  424 LEU A CG    1 
ATOM   3266  C  CD1   . LEU A 1 424 ? 79.525  -62.508 16.673  1.00 27.69  ?  424 LEU A CD1   1 
ATOM   3267  C  CD2   . LEU A 1 424 ? 79.124  -62.904 19.081  1.00 36.26  ?  424 LEU A CD2   1 
ATOM   3268  N  N     . TYR A 1 425 ? 83.542  -60.703 20.083  1.00 30.80  ?  425 TYR A N     1 
ATOM   3269  C  CA    . TYR A 1 425 ? 84.865  -61.146 20.484  1.00 35.34  ?  425 TYR A CA    1 
ATOM   3270  C  C     . TYR A 1 425 ? 85.033  -61.266 22.010  1.00 38.93  ?  425 TYR A C     1 
ATOM   3271  O  O     . TYR A 1 425 ? 85.999  -61.853 22.493  1.00 38.92  ?  425 TYR A O     1 
ATOM   3272  C  CB    . TYR A 1 425 ? 85.948  -60.248 19.876  1.00 35.46  ?  425 TYR A CB    1 
ATOM   3273  C  CG    . TYR A 1 425 ? 86.038  -58.888 20.506  1.00 36.94  ?  425 TYR A CG    1 
ATOM   3274  C  CD1   . TYR A 1 425 ? 85.344  -57.820 19.993  1.00 39.49  ?  425 TYR A CD1   1 
ATOM   3275  C  CD2   . TYR A 1 425 ? 86.818  -58.677 21.621  1.00 39.70  ?  425 TYR A CD2   1 
ATOM   3276  C  CE1   . TYR A 1 425 ? 85.440  -56.577 20.574  1.00 44.11  ?  425 TYR A CE1   1 
ATOM   3277  C  CE2   . TYR A 1 425 ? 86.909  -57.442 22.212  1.00 38.74  ?  425 TYR A CE2   1 
ATOM   3278  C  CZ    . TYR A 1 425 ? 86.229  -56.398 21.687  1.00 40.72  ?  425 TYR A CZ    1 
ATOM   3279  O  OH    . TYR A 1 425 ? 86.331  -55.168 22.286  1.00 40.69  ?  425 TYR A OH    1 
ATOM   3280  N  N     . ARG A 1 426 ? 84.092  -60.727 22.771  1.00 40.56  ?  426 ARG A N     1 
ATOM   3281  C  CA    . ARG A 1 426 ? 84.141  -60.872 24.224  1.00 37.72  ?  426 ARG A CA    1 
ATOM   3282  C  C     . ARG A 1 426 ? 84.009  -62.328 24.635  1.00 35.13  ?  426 ARG A C     1 
ATOM   3283  O  O     . ARG A 1 426 ? 84.480  -62.718 25.696  1.00 41.23  ?  426 ARG A O     1 
ATOM   3284  C  CB    . ARG A 1 426 ? 83.031  -60.066 24.896  1.00 39.41  ?  426 ARG A CB    1 
ATOM   3285  C  CG    . ARG A 1 426 ? 83.177  -58.572 24.763  1.00 46.23  ?  426 ARG A CG    1 
ATOM   3286  C  CD    . ARG A 1 426 ? 84.343  -58.065 25.562  1.00 56.99  ?  426 ARG A CD    1 
ATOM   3287  N  NE    . ARG A 1 426 ? 84.539  -56.643 25.330  1.00 64.01  ?  426 ARG A NE    1 
ATOM   3288  C  CZ    . ARG A 1 426 ? 85.594  -55.958 25.751  1.00 68.39  ?  426 ARG A CZ    1 
ATOM   3289  N  NH1   . ARG A 1 426 ? 86.559  -56.571 26.437  1.00 67.97  ?  426 ARG A NH1   1 
ATOM   3290  N  NH2   . ARG A 1 426 ? 85.684  -54.661 25.481  1.00 71.41  ?  426 ARG A NH2   1 
ATOM   3291  N  N     . LEU A 1 427 ? 83.346  -63.124 23.806  1.00 30.26  ?  427 LEU A N     1 
ATOM   3292  C  CA    . LEU A 1 427 ? 83.179  -64.545 24.083  1.00 37.65  ?  427 LEU A CA    1 
ATOM   3293  C  C     . LEU A 1 427 ? 84.509  -65.288 24.132  1.00 46.90  ?  427 LEU A C     1 
ATOM   3294  O  O     . LEU A 1 427 ? 84.569  -66.461 24.557  1.00 53.38  ?  427 LEU A O     1 
ATOM   3295  C  CB    . LEU A 1 427 ? 82.288  -65.195 23.031  1.00 38.92  ?  427 LEU A CB    1 
ATOM   3296  C  CG    . LEU A 1 427 ? 80.940  -64.521 22.857  1.00 40.59  ?  427 LEU A CG    1 
ATOM   3297  C  CD1   . LEU A 1 427 ? 80.008  -65.530 22.257  1.00 43.35  ?  427 LEU A CD1   1 
ATOM   3298  C  CD2   . LEU A 1 427 ? 80.396  -63.975 24.191  1.00 38.69  ?  427 LEU A CD2   1 
ATOM   3299  N  N     . THR A 1 428 ? 85.573  -64.625 23.682  1.00 44.67  ?  428 THR A N     1 
ATOM   3300  C  CA    . THR A 1 428 ? 86.888  -65.253 23.698  1.00 47.07  ?  428 THR A CA    1 
ATOM   3301  C  C     . THR A 1 428 ? 87.371  -65.370 25.128  1.00 56.38  ?  428 THR A C     1 
ATOM   3302  O  O     . THR A 1 428 ? 87.941  -66.387 25.516  1.00 62.41  ?  428 THR A O     1 
ATOM   3303  C  CB    . THR A 1 428 ? 87.914  -64.470 22.881  1.00 46.93  ?  428 THR A CB    1 
ATOM   3304  O  OG1   . THR A 1 428 ? 87.742  -63.076 23.124  1.00 43.01  ?  428 THR A OG1   1 
ATOM   3305  C  CG2   . THR A 1 428 ? 87.712  -64.719 21.418  1.00 52.18  ?  428 THR A CG2   1 
ATOM   3306  N  N     . ASN A 1 429 ? 87.109  -64.328 25.912  1.00 60.82  ?  429 ASN A N     1 
ATOM   3307  C  CA    . ASN A 1 429 ? 87.571  -64.259 27.295  1.00 65.36  ?  429 ASN A CA    1 
ATOM   3308  C  C     . ASN A 1 429 ? 86.923  -65.219 28.310  1.00 60.64  ?  429 ASN A C     1 
ATOM   3309  O  O     . ASN A 1 429 ? 85.733  -65.533 28.224  1.00 58.07  ?  429 ASN A O     1 
ATOM   3310  C  CB    . ASN A 1 429 ? 87.440  -62.841 27.825  1.00 68.66  ?  429 ASN A CB    1 
ATOM   3311  C  CG    . ASN A 1 429 ? 87.689  -62.777 29.304  1.00 75.28  ?  429 ASN A CG    1 
ATOM   3312  O  OD1   . ASN A 1 429 ? 88.837  -62.782 29.742  1.00 79.49  ?  429 ASN A OD1   1 
ATOM   3313  N  ND2   . ASN A 1 429 ? 86.616  -62.759 30.090  1.00 76.15  ?  429 ASN A ND2   1 
ATOM   3314  N  N     . THR A 1 430 ? 87.723  -65.661 29.281  1.00 80.62  ?  430 THR A N     1 
ATOM   3315  C  CA    . THR A 1 430 ? 87.238  -66.524 30.358  1.00 77.25  ?  430 THR A CA    1 
ATOM   3316  C  C     . THR A 1 430 ? 87.804  -66.080 31.707  1.00 77.15  ?  430 THR A C     1 
ATOM   3317  O  O     . THR A 1 430 ? 87.594  -66.733 32.729  1.00 79.93  ?  430 THR A O     1 
ATOM   3318  C  CB    . THR A 1 430 ? 87.641  -67.988 30.131  1.00 74.91  ?  430 THR A CB    1 
ATOM   3319  O  OG1   . THR A 1 430 ? 87.944  -68.191 28.751  1.00 78.30  ?  430 THR A OG1   1 
ATOM   3320  C  CG2   . THR A 1 430 ? 86.515  -68.912 30.524  1.00 75.38  ?  430 THR A CG2   1 
ATOM   3321  N  N     . ASP A 1 431 ? 88.525  -64.964 31.701  1.00 74.72  ?  431 ASP A N     1 
ATOM   3322  C  CA    . ASP A 1 431 ? 89.215  -64.494 32.891  1.00 71.91  ?  431 ASP A CA    1 
ATOM   3323  C  C     . ASP A 1 431 ? 88.300  -63.741 33.836  1.00 60.67  ?  431 ASP A C     1 
ATOM   3324  O  O     . ASP A 1 431 ? 87.875  -62.604 33.578  1.00 58.43  ?  431 ASP A O     1 
ATOM   3325  C  CB    . ASP A 1 431 ? 90.434  -63.637 32.534  1.00 81.31  ?  431 ASP A CB    1 
ATOM   3326  C  CG    . ASP A 1 431 ? 91.157  -63.116 33.768  1.00 87.81  ?  431 ASP A CG    1 
ATOM   3327  O  OD1   . ASP A 1 431 ? 91.152  -61.885 33.981  1.00 88.51  ?  431 ASP A OD1   1 
ATOM   3328  O  OD2   . ASP A 1 431 ? 91.713  -63.937 34.535  1.00 91.87  ?  431 ASP A OD2   1 
ATOM   3329  N  N     . VAL A 1 432 ? 88.024  -64.390 34.954  1.00 55.57  ?  432 VAL A N     1 
ATOM   3330  C  CA    . VAL A 1 432 ? 87.205  -63.798 35.982  1.00 56.18  ?  432 VAL A CA    1 
ATOM   3331  C  C     . VAL A 1 432 ? 88.047  -62.916 36.909  1.00 54.80  ?  432 VAL A C     1 
ATOM   3332  O  O     . VAL A 1 432 ? 87.523  -62.042 37.597  1.00 51.80  ?  432 VAL A O     1 
ATOM   3333  C  CB    . VAL A 1 432 ? 86.459  -64.895 36.767  1.00 42.60  ?  432 VAL A CB    1 
ATOM   3334  C  CG1   . VAL A 1 432 ? 86.291  -64.497 38.206  1.00 59.06  ?  432 VAL A CG1   1 
ATOM   3335  C  CG2   . VAL A 1 432 ? 85.113  -65.172 36.124  1.00 43.64  ?  432 VAL A CG2   1 
ATOM   3336  N  N     . VAL A 1 433 ? 89.358  -63.128 36.903  1.00 54.39  ?  433 VAL A N     1 
ATOM   3337  C  CA    . VAL A 1 433 ? 90.231  -62.468 37.869  1.00 51.06  ?  433 VAL A CA    1 
ATOM   3338  C  C     . VAL A 1 433 ? 90.306  -60.959 37.688  1.00 53.55  ?  433 VAL A C     1 
ATOM   3339  O  O     . VAL A 1 433 ? 90.085  -60.205 38.629  1.00 57.00  ?  433 VAL A O     1 
ATOM   3340  C  CB    . VAL A 1 433 ? 91.650  -63.035 37.828  1.00 48.38  ?  433 VAL A CB    1 
ATOM   3341  C  CG1   . VAL A 1 433 ? 92.635  -62.016 38.388  1.00 50.03  ?  433 VAL A CG1   1 
ATOM   3342  C  CG2   . VAL A 1 433 ? 91.706  -64.324 38.608  1.00 52.76  ?  433 VAL A CG2   1 
ATOM   3343  N  N     . VAL A 1 434 ? 90.644  -60.525 36.482  1.00 51.67  ?  434 VAL A N     1 
ATOM   3344  C  CA    . VAL A 1 434 ? 90.662  -59.107 36.167  1.00 50.85  ?  434 VAL A CA    1 
ATOM   3345  C  C     . VAL A 1 434 ? 89.355  -58.447 36.632  1.00 51.01  ?  434 VAL A C     1 
ATOM   3346  O  O     . VAL A 1 434 ? 89.367  -57.426 37.319  1.00 51.13  ?  434 VAL A O     1 
ATOM   3347  C  CB    . VAL A 1 434 ? 90.847  -58.899 34.659  1.00 54.46  ?  434 VAL A CB    1 
ATOM   3348  C  CG1   . VAL A 1 434 ? 89.679  -59.533 33.883  1.00 59.36  ?  434 VAL A CG1   1 
ATOM   3349  C  CG2   . VAL A 1 434 ? 90.974  -57.425 34.338  1.00 55.60  ?  434 VAL A CG2   1 
ATOM   3350  N  N     . LEU A 1 435 ? 88.227  -59.042 36.255  1.00 52.32  ?  435 LEU A N     1 
ATOM   3351  C  CA    . LEU A 1 435 ? 86.924  -58.571 36.700  1.00 47.87  ?  435 LEU A CA    1 
ATOM   3352  C  C     . LEU A 1 435 ? 86.829  -58.503 38.232  1.00 44.50  ?  435 LEU A C     1 
ATOM   3353  O  O     . LEU A 1 435 ? 86.352  -57.519 38.793  1.00 45.07  ?  435 LEU A O     1 
ATOM   3354  C  CB    . LEU A 1 435 ? 85.818  -59.455 36.122  1.00 47.53  ?  435 LEU A CB    1 
ATOM   3355  C  CG    . LEU A 1 435 ? 85.568  -59.203 34.640  1.00 47.39  ?  435 LEU A CG    1 
ATOM   3356  C  CD1   . LEU A 1 435 ? 84.518  -60.160 34.028  1.00 39.43  ?  435 LEU A CD1   1 
ATOM   3357  C  CD2   . LEU A 1 435 ? 85.155  -57.757 34.492  1.00 46.17  ?  435 LEU A CD2   1 
ATOM   3358  N  N     . GLN A 1 436 ? 87.286  -59.549 38.906  1.00 41.55  ?  436 GLN A N     1 
ATOM   3359  C  CA    . GLN A 1 436 ? 87.284  -59.558 40.363  1.00 41.60  ?  436 GLN A CA    1 
ATOM   3360  C  C     . GLN A 1 436 ? 88.164  -58.467 40.964  1.00 34.55  ?  436 GLN A C     1 
ATOM   3361  O  O     . GLN A 1 436 ? 87.774  -57.848 41.948  1.00 53.02  ?  436 GLN A O     1 
ATOM   3362  C  CB    . GLN A 1 436 ? 87.660  -60.934 40.904  1.00 36.97  ?  436 GLN A CB    1 
ATOM   3363  C  CG    . GLN A 1 436 ? 86.537  -61.936 40.788  1.00 38.00  ?  436 GLN A CG    1 
ATOM   3364  C  CD    . GLN A 1 436 ? 87.009  -63.339 41.011  1.00 56.96  ?  436 GLN A CD    1 
ATOM   3365  O  OE1   . GLN A 1 436 ? 88.175  -63.659 40.768  1.00 58.22  ?  436 GLN A OE1   1 
ATOM   3366  N  NE2   . GLN A 1 436 ? 86.110  -64.197 41.477  1.00 56.06  ?  436 GLN A NE2   1 
ATOM   3367  N  N     . GLU A 1 437 ? 89.338  -58.236 40.378  1.00 35.30  ?  437 GLU A N     1 
ATOM   3368  C  CA    . GLU A 1 437 ? 90.188  -57.115 40.772  1.00 38.68  ?  437 GLU A CA    1 
ATOM   3369  C  C     . GLU A 1 437 ? 89.390  -55.826 40.613  1.00 38.67  ?  437 GLU A C     1 
ATOM   3370  O  O     . GLU A 1 437 ? 89.334  -55.019 41.532  1.00 39.44  ?  437 GLU A O     1 
ATOM   3371  C  CB    . GLU A 1 437 ? 91.500  -57.043 39.957  1.00 41.70  ?  437 GLU A CB    1 
ATOM   3372  C  CG    . GLU A 1 437 ? 92.527  -58.175 40.206  1.00 40.37  ?  437 GLU A CG    1 
ATOM   3373  N  N     . GLU A 1 438 ? 88.750  -55.631 39.460  1.00 39.71  ?  438 GLU A N     1 
ATOM   3374  C  CA    . GLU A 1 438 ? 87.936  -54.426 39.274  1.00 40.45  ?  438 GLU A CA    1 
ATOM   3375  C  C     . GLU A 1 438 ? 86.800  -54.318 40.311  1.00 42.92  ?  438 GLU A C     1 
ATOM   3376  O  O     . GLU A 1 438 ? 86.506  -53.235 40.792  1.00 44.78  ?  438 GLU A O     1 
ATOM   3377  C  CB    . GLU A 1 438 ? 87.381  -54.301 37.850  1.00 46.48  ?  438 GLU A CB    1 
ATOM   3378  C  CG    . GLU A 1 438 ? 86.663  -52.959 37.641  1.00 55.35  ?  438 GLU A CG    1 
ATOM   3379  C  CD    . GLU A 1 438 ? 86.064  -52.747 36.244  1.00 64.72  ?  438 GLU A CD    1 
ATOM   3380  O  OE1   . GLU A 1 438 ? 85.651  -51.592 35.971  1.00 69.64  ?  438 GLU A OE1   1 
ATOM   3381  O  OE2   . GLU A 1 438 ? 85.999  -53.710 35.434  1.00 62.43  ?  438 GLU A OE2   1 
ATOM   3382  N  N     . GLU A 1 439 ? 86.172  -55.442 40.640  1.00 46.34  ?  439 GLU A N     1 
ATOM   3383  C  CA    . GLU A 1 439 ? 85.118  -55.501 41.649  1.00 48.31  ?  439 GLU A CA    1 
ATOM   3384  C  C     . GLU A 1 439 ? 85.657  -54.977 42.976  1.00 42.55  ?  439 GLU A C     1 
ATOM   3385  O  O     . GLU A 1 439 ? 85.022  -54.171 43.657  1.00 44.07  ?  439 GLU A O     1 
ATOM   3386  C  CB    . GLU A 1 439 ? 84.675  -56.948 41.816  1.00 56.39  ?  439 GLU A CB    1 
ATOM   3387  C  CG    . GLU A 1 439 ? 83.276  -57.171 42.313  1.00 63.79  ?  439 GLU A CG    1 
ATOM   3388  C  CD    . GLU A 1 439 ? 82.995  -58.666 42.500  1.00 76.57  ?  439 GLU A CD    1 
ATOM   3389  O  OE1   . GLU A 1 439 ? 81.817  -59.064 42.687  1.00 85.19  ?  439 GLU A OE1   1 
ATOM   3390  O  OE2   . GLU A 1 439 ? 83.972  -59.448 42.468  1.00 78.08  ?  439 GLU A OE2   1 
ATOM   3391  N  N     . ALA A 1 440 ? 86.849  -55.434 43.334  1.00 36.92  ?  440 ALA A N     1 
ATOM   3392  C  CA    . ALA A 1 440 ? 87.473  -55.005 44.569  1.00 36.49  ?  440 ALA A CA    1 
ATOM   3393  C  C     . ALA A 1 440 ? 87.780  -53.503 44.558  1.00 36.99  ?  440 ALA A C     1 
ATOM   3394  O  O     . ALA A 1 440 ? 87.326  -52.771 45.433  1.00 38.37  ?  440 ALA A O     1 
ATOM   3395  C  CB    . ALA A 1 440 ? 88.708  -55.815 44.840  1.00 33.76  ?  440 ALA A CB    1 
ATOM   3396  N  N     . GLU A 1 441 ? 88.542  -53.035 43.574  1.00 31.58  ?  441 GLU A N     1 
ATOM   3397  C  CA    . GLU A 1 441 ? 88.828  -51.608 43.492  1.00 44.28  ?  441 GLU A CA    1 
ATOM   3398  C  C     . GLU A 1 441 ? 87.527  -50.781 43.616  1.00 38.34  ?  441 GLU A C     1 
ATOM   3399  O  O     . GLU A 1 441 ? 87.525  -49.701 44.221  1.00 32.78  ?  441 GLU A O     1 
ATOM   3400  C  CB    . GLU A 1 441 ? 89.624  -51.259 42.218  1.00 32.72  ?  441 GLU A CB    1 
ATOM   3401  N  N     . LEU A 1 442 ? 86.421  -51.300 43.083  1.00 29.35  ?  442 LEU A N     1 
ATOM   3402  C  CA    . LEU A 1 442 ? 85.172  -50.533 43.041  1.00 36.91  ?  442 LEU A CA    1 
ATOM   3403  C  C     . LEU A 1 442 ? 84.505  -50.482 44.393  1.00 37.36  ?  442 LEU A C     1 
ATOM   3404  O  O     . LEU A 1 442 ? 84.003  -49.440 44.827  1.00 33.22  ?  442 LEU A O     1 
ATOM   3405  C  CB    . LEU A 1 442 ? 84.197  -51.112 42.014  1.00 34.95  ?  442 LEU A CB    1 
ATOM   3406  C  CG    . LEU A 1 442 ? 84.469  -50.691 40.563  1.00 38.64  ?  442 LEU A CG    1 
ATOM   3407  C  CD1   . LEU A 1 442 ? 83.617  -51.470 39.565  1.00 35.92  ?  442 LEU A CD1   1 
ATOM   3408  C  CD2   . LEU A 1 442 ? 84.217  -49.221 40.425  1.00 41.75  ?  442 LEU A CD2   1 
ATOM   3409  N  N     . ARG A 1 443 ? 84.491  -51.635 45.047  1.00 38.57  ?  443 ARG A N     1 
ATOM   3410  C  CA    . ARG A 1 443 ? 83.984  -51.742 46.404  1.00 40.04  ?  443 ARG A CA    1 
ATOM   3411  C  C     . ARG A 1 443 ? 84.700  -50.762 47.348  1.00 40.75  ?  443 ARG A C     1 
ATOM   3412  O  O     . ARG A 1 443 ? 84.046  -49.988 48.046  1.00 41.73  ?  443 ARG A O     1 
ATOM   3413  C  CB    . ARG A 1 443 ? 84.113  -53.182 46.898  1.00 42.41  ?  443 ARG A CB    1 
ATOM   3414  C  CG    . ARG A 1 443 ? 83.169  -54.153 46.225  1.00 46.20  ?  443 ARG A CG    1 
ATOM   3415  C  CD    . ARG A 1 443 ? 82.585  -55.171 47.189  1.00 59.95  ?  443 ARG A CD    1 
ATOM   3416  N  NE    . ARG A 1 443 ? 81.520  -55.945 46.557  1.00 72.54  ?  443 ARG A NE    1 
ATOM   3417  C  CZ    . ARG A 1 443 ? 81.736  -57.014 45.794  1.00 78.64  ?  443 ARG A CZ    1 
ATOM   3418  N  NH1   . ARG A 1 443 ? 82.984  -57.426 45.591  1.00 83.02  ?  443 ARG A NH1   1 
ATOM   3419  N  NH2   . ARG A 1 443 ? 80.715  -57.665 45.236  1.00 74.04  ?  443 ARG A NH2   1 
ATOM   3420  N  N     . GLU A 1 444 ? 86.034  -50.786 47.361  1.00 39.31  ?  444 GLU A N     1 
ATOM   3421  C  CA    . GLU A 1 444 ? 86.809  -49.853 48.181  1.00 37.11  ?  444 GLU A CA    1 
ATOM   3422  C  C     . GLU A 1 444 ? 86.427  -48.399 47.902  1.00 37.27  ?  444 GLU A C     1 
ATOM   3423  O  O     . GLU A 1 444 ? 86.210  -47.616 48.821  1.00 39.74  ?  444 GLU A O     1 
ATOM   3424  C  CB    . GLU A 1 444 ? 88.315  -50.056 47.973  1.00 37.77  ?  444 GLU A CB    1 
ATOM   3425  C  CG    . GLU A 1 444 ? 89.026  -50.804 49.105  1.00 34.08  ?  444 GLU A CG    1 
ATOM   3426  N  N     . LYS A 1 445 ? 86.342  -48.039 46.627  1.00 36.60  ?  445 LYS A N     1 
ATOM   3427  C  CA    . LYS A 1 445 ? 86.026  -46.667 46.235  1.00 34.41  ?  445 LYS A CA    1 
ATOM   3428  C  C     . LYS A 1 445 ? 84.656  -46.228 46.775  1.00 31.48  ?  445 LYS A C     1 
ATOM   3429  O  O     . LYS A 1 445 ? 84.454  -45.069 47.147  1.00 28.27  ?  445 LYS A O     1 
ATOM   3430  C  CB    . LYS A 1 445 ? 86.082  -46.529 44.704  1.00 34.34  ?  445 LYS A CB    1 
ATOM   3431  C  CG    . LYS A 1 445 ? 86.097  -45.085 44.194  1.00 40.09  ?  445 LYS A CG    1 
ATOM   3432  C  CD    . LYS A 1 445 ? 86.392  -44.995 42.694  1.00 42.63  ?  445 LYS A CD    1 
ATOM   3433  N  N     . ILE A 1 446 ? 83.711  -47.158 46.818  1.00 32.66  ?  446 ILE A N     1 
ATOM   3434  C  CA    . ILE A 1 446 ? 82.362  -46.820 47.253  1.00 33.34  ?  446 ILE A CA    1 
ATOM   3435  C  C     . ILE A 1 446 ? 82.294  -46.630 48.754  1.00 32.71  ?  446 ILE A C     1 
ATOM   3436  O  O     . ILE A 1 446 ? 81.577  -45.752 49.256  1.00 29.62  ?  446 ILE A O     1 
ATOM   3437  C  CB    . ILE A 1 446 ? 81.347  -47.879 46.832  1.00 27.70  ?  446 ILE A CB    1 
ATOM   3438  C  CG1   . ILE A 1 446 ? 81.218  -47.879 45.303  1.00 27.75  ?  446 ILE A CG1   1 
ATOM   3439  C  CG2   . ILE A 1 446 ? 80.017  -47.606 47.516  1.00 28.32  ?  446 ILE A CG2   1 
ATOM   3440  C  CD1   . ILE A 1 446 ? 80.713  -49.155 44.717  1.00 28.30  ?  446 ILE A CD1   1 
ATOM   3441  N  N     . ALA A 1 447 ? 83.043  -47.465 49.467  1.00 33.00  ?  447 ALA A N     1 
ATOM   3442  C  CA    . ALA A 1 447 ? 83.146  -47.346 50.907  1.00 32.35  ?  447 ALA A CA    1 
ATOM   3443  C  C     . ALA A 1 447 ? 83.673  -45.959 51.229  1.00 35.45  ?  447 ALA A C     1 
ATOM   3444  O  O     . ALA A 1 447 ? 83.066  -45.226 52.011  1.00 35.98  ?  447 ALA A O     1 
ATOM   3445  C  CB    . ALA A 1 447 ? 84.064  -48.406 51.456  1.00 32.93  ?  447 ALA A CB    1 
ATOM   3446  N  N     . MET A 1 448 ? 84.788  -45.584 50.602  1.00 37.54  ?  448 MET A N     1 
ATOM   3447  C  CA    . MET A 1 448 ? 85.388  -44.294 50.897  1.00 39.91  ?  448 MET A CA    1 
ATOM   3448  C  C     . MET A 1 448 ? 84.390  -43.186 50.621  1.00 37.78  ?  448 MET A C     1 
ATOM   3449  O  O     . MET A 1 448 ? 84.227  -42.274 51.420  1.00 40.35  ?  448 MET A O     1 
ATOM   3450  C  CB    . MET A 1 448 ? 86.732  -44.088 50.180  1.00 31.49  ?  448 MET A CB    1 
ATOM   3451  C  CG    . MET A 1 448 ? 87.953  -44.234 51.145  1.00 33.72  ?  448 MET A CG    1 
ATOM   3452  N  N     . LEU A 1 449 ? 83.685  -43.288 49.508  1.00 33.94  ?  449 LEU A N     1 
ATOM   3453  C  CA    . LEU A 1 449 ? 82.739  -42.251 49.147  1.00 37.16  ?  449 LEU A CA    1 
ATOM   3454  C  C     . LEU A 1 449 ? 81.546  -42.257 50.094  1.00 37.05  ?  449 LEU A C     1 
ATOM   3455  O  O     . LEU A 1 449 ? 81.072  -41.210 50.533  1.00 36.46  ?  449 LEU A O     1 
ATOM   3456  C  CB    . LEU A 1 449 ? 82.302  -42.420 47.694  1.00 38.50  ?  449 LEU A CB    1 
ATOM   3457  C  CG    . LEU A 1 449 ? 83.368  -42.148 46.627  1.00 29.19  ?  449 LEU A CG    1 
ATOM   3458  C  CD1   . LEU A 1 449 ? 82.898  -42.709 45.303  1.00 29.76  ?  449 LEU A CD1   1 
ATOM   3459  C  CD2   . LEU A 1 449 ? 83.633  -40.666 46.501  1.00 30.53  ?  449 LEU A CD2   1 
ATOM   3460  N  N     . ALA A 1 450 ? 81.063  -43.442 50.428  1.00 28.54  ?  450 ALA A N     1 
ATOM   3461  C  CA    . ALA A 1 450 ? 79.909  -43.518 51.298  1.00 38.68  ?  450 ALA A CA    1 
ATOM   3462  C  C     . ALA A 1 450 ? 80.208  -42.851 52.639  1.00 40.13  ?  450 ALA A C     1 
ATOM   3463  O  O     . ALA A 1 450 ? 79.362  -42.151 53.184  1.00 41.35  ?  450 ALA A O     1 
ATOM   3464  C  CB    . ALA A 1 450 ? 79.491  -44.948 51.485  1.00 37.64  ?  450 ALA A CB    1 
ATOM   3465  N  N     . ALA A 1 451 ? 81.420  -43.057 53.150  1.00 37.58  ?  451 ALA A N     1 
ATOM   3466  C  CA    . ALA A 1 451 ? 81.849  -42.486 54.436  1.00 35.51  ?  451 ALA A CA    1 
ATOM   3467  C  C     . ALA A 1 451 ? 81.834  -40.974 54.437  1.00 39.99  ?  451 ALA A C     1 
ATOM   3468  O  O     . ALA A 1 451 ? 81.375  -40.371 55.390  1.00 47.76  ?  451 ALA A O     1 
ATOM   3469  C  CB    . ALA A 1 451 ? 83.250  -42.975 54.814  1.00 36.51  ?  451 ALA A CB    1 
ATOM   3470  N  N     . ILE A 1 452 ? 82.373  -40.361 53.388  1.00 31.30  ?  452 ILE A N     1 
ATOM   3471  C  CA    . ILE A 1 452 ? 82.332  -38.916 53.263  1.00 41.46  ?  452 ILE A CA    1 
ATOM   3472  C  C     . ILE A 1 452 ? 80.887  -38.474 53.342  1.00 40.32  ?  452 ILE A C     1 
ATOM   3473  O  O     . ILE A 1 452 ? 80.546  -37.499 54.013  1.00 39.26  ?  452 ILE A O     1 
ATOM   3474  C  CB    . ILE A 1 452 ? 82.911  -38.455 51.926  1.00 31.86  ?  452 ILE A CB    1 
ATOM   3475  C  CG1   . ILE A 1 452 ? 84.372  -38.873 51.818  1.00 32.62  ?  452 ILE A CG1   1 
ATOM   3476  C  CG2   . ILE A 1 452 ? 82.766  -36.943 51.768  1.00 33.04  ?  452 ILE A CG2   1 
ATOM   3477  C  CD1   . ILE A 1 452 ? 84.937  -38.738 50.445  1.00 32.89  ?  452 ILE A CD1   1 
ATOM   3478  N  N     . ILE A 1 453 ? 80.026  -39.201 52.658  1.00 30.90  ?  453 ILE A N     1 
ATOM   3479  C  CA    . ILE A 1 453 ? 78.650  -38.763 52.567  1.00 39.33  ?  453 ILE A CA    1 
ATOM   3480  C  C     . ILE A 1 453 ? 77.985  -38.900 53.924  1.00 40.54  ?  453 ILE A C     1 
ATOM   3481  O  O     . ILE A 1 453 ? 77.100  -38.121 54.274  1.00 43.07  ?  453 ILE A O     1 
ATOM   3482  C  CB    . ILE A 1 453 ? 77.871  -39.546 51.485  1.00 36.37  ?  453 ILE A CB    1 
ATOM   3483  C  CG1   . ILE A 1 453 ? 78.429  -39.220 50.094  1.00 34.46  ?  453 ILE A CG1   1 
ATOM   3484  C  CG2   . ILE A 1 453 ? 76.388  -39.213 51.551  1.00 32.27  ?  453 ILE A CG2   1 
ATOM   3485  C  CD1   . ILE A 1 453 ? 78.155  -40.271 49.032  1.00 30.29  ?  453 ILE A CD1   1 
ATOM   3486  N  N     . GLY A 1 454 ? 78.436  -39.880 54.699  1.00 37.66  ?  454 GLY A N     1 
ATOM   3487  C  CA    . GLY A 1 454 ? 77.778  -40.225 55.950  1.00 35.33  ?  454 GLY A CA    1 
ATOM   3488  C  C     . GLY A 1 454 ? 78.451  -39.818 57.250  1.00 37.46  ?  454 GLY A C     1 
ATOM   3489  O  O     . GLY A 1 454 ? 77.951  -40.164 58.307  1.00 42.77  ?  454 GLY A O     1 
ATOM   3490  N  N     . ASP A 1 455 ? 79.566  -39.090 57.172  1.00 34.94  ?  455 ASP A N     1 
ATOM   3491  C  CA    . ASP A 1 455 ? 80.285  -38.600 58.347  1.00 41.69  ?  455 ASP A CA    1 
ATOM   3492  C  C     . ASP A 1 455 ? 80.732  -37.149 58.188  1.00 43.85  ?  455 ASP A C     1 
ATOM   3493  O  O     . ASP A 1 455 ? 81.704  -36.873 57.474  1.00 40.23  ?  455 ASP A O     1 
ATOM   3494  C  CB    . ASP A 1 455 ? 81.520  -39.457 58.633  1.00 41.03  ?  455 ASP A CB    1 
ATOM   3495  C  CG    . ASP A 1 455 ? 82.290  -38.980 59.866  1.00 58.87  ?  455 ASP A CG    1 
ATOM   3496  O  OD1   . ASP A 1 455 ? 81.645  -38.653 60.887  1.00 68.09  ?  455 ASP A OD1   1 
ATOM   3497  O  OD2   . ASP A 1 455 ? 83.537  -38.923 59.818  1.00 67.19  ?  455 ASP A OD2   1 
ATOM   3498  N  N     . GLU A 1 456 ? 80.054  -36.230 58.882  1.00 40.76  ?  456 GLU A N     1 
ATOM   3499  C  CA    . GLU A 1 456 ? 80.419  -34.812 58.803  1.00 44.57  ?  456 GLU A CA    1 
ATOM   3500  C  C     . GLU A 1 456 ? 81.931  -34.596 58.937  1.00 39.41  ?  456 GLU A C     1 
ATOM   3501  O  O     . GLU A 1 456 ? 82.506  -33.791 58.220  1.00 36.54  ?  456 GLU A O     1 
ATOM   3502  C  CB    . GLU A 1 456 ? 79.646  -33.938 59.805  1.00 55.73  ?  456 GLU A CB    1 
ATOM   3503  C  CG    . GLU A 1 456 ? 78.180  -33.667 59.441  1.00 73.24  ?  456 GLU A CG    1 
ATOM   3504  C  CD    . GLU A 1 456 ? 77.981  -32.956 58.089  1.00 90.00  ?  456 GLU A CD    1 
ATOM   3505  O  OE1   . GLU A 1 456 ? 77.650  -31.742 58.084  1.00 92.53  ?  456 GLU A OE1   1 
ATOM   3506  O  OE2   . GLU A 1 456 ? 78.125  -33.617 57.031  1.00 96.98  ?  456 GLU A OE2   1 
ATOM   3507  N  N     . ARG A 1 457 ? 82.581  -35.315 59.838  1.00 37.28  ?  457 ARG A N     1 
ATOM   3508  C  CA    . ARG A 1 457 ? 84.008  -35.102 60.052  1.00 33.92  ?  457 ARG A CA    1 
ATOM   3509  C  C     . ARG A 1 457 ? 84.854  -35.561 58.854  1.00 32.67  ?  457 ARG A C     1 
ATOM   3510  O  O     . ARG A 1 457 ? 85.751  -34.858 58.402  1.00 30.61  ?  457 ARG A O     1 
ATOM   3511  C  CB    . ARG A 1 457 ? 84.450  -35.787 61.346  1.00 28.79  ?  457 ARG A CB    1 
ATOM   3512  C  CG    . ARG A 1 457 ? 85.912  -35.615 61.710  1.00 28.95  ?  457 ARG A CG    1 
ATOM   3513  C  CD    . ARG A 1 457 ? 86.139  -36.047 63.147  1.00 29.99  ?  457 ARG A CD    1 
ATOM   3514  N  NE    . ARG A 1 457 ? 87.532  -36.354 63.463  1.00 46.04  ?  457 ARG A NE    1 
ATOM   3515  C  CZ    . ARG A 1 457 ? 87.903  -37.106 64.499  1.00 45.44  ?  457 ARG A CZ    1 
ATOM   3516  N  NH1   . ARG A 1 457 ? 86.981  -37.622 65.317  1.00 48.10  ?  457 ARG A NH1   1 
ATOM   3517  N  NH2   . ARG A 1 457 ? 89.190  -37.347 64.719  1.00 42.64  ?  457 ARG A NH2   1 
ATOM   3518  N  N     . THR A 1 458 ? 84.567  -36.748 58.349  1.00 35.22  ?  458 THR A N     1 
ATOM   3519  C  CA    . THR A 1 458 ? 85.299  -37.275 57.220  1.00 36.66  ?  458 THR A CA    1 
ATOM   3520  C  C     . THR A 1 458 ? 85.218  -36.256 56.087  1.00 39.50  ?  458 THR A C     1 
ATOM   3521  O  O     . THR A 1 458 ? 86.232  -35.899 55.459  1.00 40.77  ?  458 THR A O     1 
ATOM   3522  C  CB    . THR A 1 458 ? 84.706  -38.627 56.774  1.00 36.74  ?  458 THR A CB    1 
ATOM   3523  O  OG1   . THR A 1 458 ? 85.166  -39.671 57.646  1.00 32.40  ?  458 THR A OG1   1 
ATOM   3524  C  CG2   . THR A 1 458 ? 85.133  -38.953 55.364  1.00 42.52  ?  458 THR A CG2   1 
ATOM   3525  N  N     . MET A 1 459 ? 83.995  -35.786 55.848  1.00 38.76  ?  459 MET A N     1 
ATOM   3526  C  CA    . MET A 1 459 ? 83.716  -34.771 54.849  1.00 37.91  ?  459 MET A CA    1 
ATOM   3527  C  C     . MET A 1 459 ? 84.536  -33.493 55.061  1.00 39.77  ?  459 MET A C     1 
ATOM   3528  O  O     . MET A 1 459 ? 85.163  -32.995 54.132  1.00 40.27  ?  459 MET A O     1 
ATOM   3529  C  CB    . MET A 1 459 ? 82.220  -34.456 54.844  1.00 26.99  ?  459 MET A CB    1 
ATOM   3530  C  CG    . MET A 1 459 ? 81.789  -33.498 53.750  1.00 26.45  ?  459 MET A CG    1 
ATOM   3531  S  SD    . MET A 1 459 ? 82.138  -31.811 54.215  1.00 58.64  ?  459 MET A SD    1 
ATOM   3532  C  CE    . MET A 1 459 ? 80.887  -31.590 55.472  1.00 25.23  ?  459 MET A CE    1 
ATOM   3533  N  N     . TYR A 1 460 ? 84.535  -32.961 56.279  1.00 41.13  ?  460 TYR A N     1 
ATOM   3534  C  CA    . TYR A 1 460 ? 85.269  -31.736 56.562  1.00 37.80  ?  460 TYR A CA    1 
ATOM   3535  C  C     . TYR A 1 460 ? 86.778  -31.920 56.439  1.00 38.30  ?  460 TYR A C     1 
ATOM   3536  O  O     . TYR A 1 460 ? 87.491  -30.981 56.117  1.00 42.55  ?  460 TYR A O     1 
ATOM   3537  C  CB    . TYR A 1 460 ? 84.907  -31.167 57.938  1.00 36.37  ?  460 TYR A CB    1 
ATOM   3538  C  CG    . TYR A 1 460 ? 83.636  -30.363 57.934  1.00 37.27  ?  460 TYR A CG    1 
ATOM   3539  C  CD1   . TYR A 1 460 ? 83.541  -29.205 57.193  1.00 39.67  ?  460 TYR A CD1   1 
ATOM   3540  C  CD2   . TYR A 1 460 ? 82.524  -30.768 58.662  1.00 24.63  ?  460 TYR A CD2   1 
ATOM   3541  C  CE1   . TYR A 1 460 ? 82.370  -28.468 57.165  1.00 41.83  ?  460 TYR A CE1   1 
ATOM   3542  C  CE2   . TYR A 1 460 ? 81.337  -30.027 58.647  1.00 37.32  ?  460 TYR A CE2   1 
ATOM   3543  C  CZ    . TYR A 1 460 ? 81.269  -28.877 57.893  1.00 37.08  ?  460 TYR A CZ    1 
ATOM   3544  O  OH    . TYR A 1 460 ? 80.112  -28.123 57.840  1.00 30.86  ?  460 TYR A OH    1 
ATOM   3545  N  N     . ASN A 1 461 ? 87.288  -33.115 56.682  1.00 37.25  ?  461 ASN A N     1 
ATOM   3546  C  CA    . ASN A 1 461 ? 88.733  -33.263 56.572  1.00 40.16  ?  461 ASN A CA    1 
ATOM   3547  C  C     . ASN A 1 461 ? 89.128  -33.261 55.121  1.00 41.13  ?  461 ASN A C     1 
ATOM   3548  O  O     . ASN A 1 461 ? 90.216  -32.827 54.773  1.00 46.71  ?  461 ASN A O     1 
ATOM   3549  C  CB    . ASN A 1 461 ? 89.252  -34.510 57.282  1.00 49.57  ?  461 ASN A CB    1 
ATOM   3550  C  CG    . ASN A 1 461 ? 89.131  -34.413 58.773  1.00 54.49  ?  461 ASN A CG    1 
ATOM   3551  O  OD1   . ASN A 1 461 ? 88.088  -34.033 59.294  1.00 58.53  ?  461 ASN A OD1   1 
ATOM   3552  N  ND2   . ASN A 1 461 ? 90.207  -34.722 59.475  1.00 57.85  ?  461 ASN A ND2   1 
ATOM   3553  N  N     . LEU A 1 462 ? 88.225  -33.756 54.282  1.00 38.79  ?  462 LEU A N     1 
ATOM   3554  C  CA    . LEU A 1 462 ? 88.370  -33.646 52.842  1.00 36.96  ?  462 LEU A CA    1 
ATOM   3555  C  C     . LEU A 1 462 ? 88.432  -32.193 52.438  1.00 36.81  ?  462 LEU A C     1 
ATOM   3556  O  O     . LEU A 1 462 ? 89.375  -31.784 51.771  1.00 41.66  ?  462 LEU A O     1 
ATOM   3557  C  CB    . LEU A 1 462 ? 87.183  -34.287 52.144  1.00 39.28  ?  462 LEU A CB    1 
ATOM   3558  C  CG    . LEU A 1 462 ? 87.512  -35.258 51.019  1.00 40.82  ?  462 LEU A CG    1 
ATOM   3559  C  CD1   . LEU A 1 462 ? 86.407  -35.239 50.010  1.00 28.61  ?  462 LEU A CD1   1 
ATOM   3560  C  CD2   . LEU A 1 462 ? 88.827  -34.865 50.418  1.00 28.57  ?  462 LEU A CD2   1 
ATOM   3561  N  N     . MET A 1 463 ? 87.414  -31.422 52.829  1.00 24.63  ?  463 MET A N     1 
ATOM   3562  C  CA    . MET A 1 463 ? 87.392  -29.975 52.592  1.00 34.94  ?  463 MET A CA    1 
ATOM   3563  C  C     . MET A 1 463 ? 88.721  -29.318 52.940  1.00 29.58  ?  463 MET A C     1 
ATOM   3564  O  O     . MET A 1 463 ? 89.272  -28.554 52.157  1.00 30.80  ?  463 MET A O     1 
ATOM   3565  C  CB    . MET A 1 463 ? 86.327  -29.316 53.435  1.00 23.02  ?  463 MET A CB    1 
ATOM   3566  C  CG    . MET A 1 463 ? 85.088  -28.931 52.713  1.00 33.60  ?  463 MET A CG    1 
ATOM   3567  S  SD    . MET A 1 463 ? 84.303  -27.588 53.628  1.00 40.11  ?  463 MET A SD    1 
ATOM   3568  C  CE    . MET A 1 463 ? 85.769  -26.619 53.824  1.00 22.28  ?  463 MET A CE    1 
ATOM   3569  N  N     . LYS A 1 464 ? 89.219  -29.606 54.136  1.00 28.93  ?  464 LYS A N     1 
ATOM   3570  C  CA    . LYS A 1 464 ? 90.470  -29.018 54.601  1.00 30.95  ?  464 LYS A CA    1 
ATOM   3571  C  C     . LYS A 1 464 ? 91.640  -29.449 53.716  1.00 33.66  ?  464 LYS A C     1 
ATOM   3572  O  O     . LYS A 1 464 ? 92.475  -28.621 53.338  1.00 37.35  ?  464 LYS A O     1 
ATOM   3573  C  CB    . LYS A 1 464 ? 90.744  -29.387 56.074  1.00 33.41  ?  464 LYS A CB    1 
ATOM   3574  C  CG    . LYS A 1 464 ? 90.036  -28.520 57.119  1.00 33.46  ?  464 LYS A CG    1 
ATOM   3575  C  CD    . LYS A 1 464 ? 89.510  -29.354 58.285  1.00 35.31  ?  464 LYS A CD    1 
ATOM   3576  C  CE    . LYS A 1 464 ? 90.645  -30.000 59.084  1.00 40.11  ?  464 LYS A CE    1 
ATOM   3577  N  NZ    . LYS A 1 464 ? 90.268  -31.345 59.590  1.00 42.22  ?  464 LYS A NZ    1 
ATOM   3578  N  N     . LYS A 1 465 ? 91.685  -30.744 53.398  1.00 29.87  ?  465 LYS A N     1 
ATOM   3579  C  CA    . LYS A 1 465 ? 92.775  -31.328 52.621  1.00 33.41  ?  465 LYS A CA    1 
ATOM   3580  C  C     . LYS A 1 465 ? 92.892  -30.627 51.291  1.00 42.23  ?  465 LYS A C     1 
ATOM   3581  O  O     . LYS A 1 465 ? 93.982  -30.215 50.893  1.00 47.33  ?  465 LYS A O     1 
ATOM   3582  C  CB    . LYS A 1 465 ? 92.572  -32.837 52.389  1.00 31.93  ?  465 LYS A CB    1 
ATOM   3583  C  CG    . LYS A 1 465 ? 93.665  -33.494 51.537  1.00 39.38  ?  465 LYS A CG    1 
ATOM   3584  C  CD    . LYS A 1 465 ? 93.510  -35.006 51.378  1.00 52.67  ?  465 LYS A CD    1 
ATOM   3585  C  CE    . LYS A 1 465 ? 92.679  -35.398 50.138  1.00 61.17  ?  465 LYS A CE    1 
ATOM   3586  N  NZ    . LYS A 1 465 ? 93.451  -35.473 48.853  1.00 66.33  ?  465 LYS A NZ    1 
ATOM   3587  N  N     . GLU A 1 466 ? 91.751  -30.500 50.614  1.00 43.52  ?  466 GLU A N     1 
ATOM   3588  C  CA    . GLU A 1 466 ? 91.673  -29.903 49.288  1.00 45.08  ?  466 GLU A CA    1 
ATOM   3589  C  C     . GLU A 1 466 ? 92.062  -28.428 49.307  1.00 47.93  ?  466 GLU A C     1 
ATOM   3590  O  O     . GLU A 1 466 ? 92.896  -27.990 48.524  1.00 49.29  ?  466 GLU A O     1 
ATOM   3591  C  CB    . GLU A 1 466 ? 90.269  -30.097 48.718  1.00 48.64  ?  466 GLU A CB    1 
ATOM   3592  C  CG    . GLU A 1 466 ? 89.986  -31.527 48.242  1.00 61.81  ?  466 GLU A CG    1 
ATOM   3593  C  CD    . GLU A 1 466 ? 88.573  -31.711 47.675  1.00 73.74  ?  466 GLU A CD    1 
ATOM   3594  O  OE1   . GLU A 1 466 ? 88.075  -30.793 46.983  1.00 79.60  ?  466 GLU A OE1   1 
ATOM   3595  O  OE2   . GLU A 1 466 ? 87.960  -32.776 47.923  1.00 73.69  ?  466 GLU A OE2   1 
ATOM   3596  N  N     . LEU A 1 467 ? 91.460  -27.666 50.211  1.00 47.46  ?  467 LEU A N     1 
ATOM   3597  C  CA    . LEU A 1 467 ? 91.823  -26.267 50.403  1.00 43.89  ?  467 LEU A CA    1 
ATOM   3598  C  C     . LEU A 1 467 ? 93.336  -26.074 50.575  1.00 46.75  ?  467 LEU A C     1 
ATOM   3599  O  O     . LEU A 1 467 ? 93.924  -25.136 50.034  1.00 46.95  ?  467 LEU A O     1 
ATOM   3600  C  CB    . LEU A 1 467 ? 91.078  -25.705 51.611  1.00 39.82  ?  467 LEU A CB    1 
ATOM   3601  C  CG    . LEU A 1 467 ? 89.618  -25.386 51.329  1.00 42.96  ?  467 LEU A CG    1 
ATOM   3602  C  CD1   . LEU A 1 467 ? 88.854  -25.119 52.606  1.00 46.70  ?  467 LEU A CD1   1 
ATOM   3603  C  CD2   . LEU A 1 467 ? 89.536  -24.194 50.415  1.00 21.12  ?  467 LEU A CD2   1 
ATOM   3604  N  N     . ARG A 1 468 ? 93.964  -26.964 51.334  1.00 42.92  ?  468 ARG A N     1 
ATOM   3605  C  CA    . ARG A 1 468 ? 95.388  -26.831 51.610  1.00 35.39  ?  468 ARG A CA    1 
ATOM   3606  C  C     . ARG A 1 468 ? 96.197  -27.065 50.335  1.00 36.93  ?  468 ARG A C     1 
ATOM   3607  O  O     . ARG A 1 468 ? 97.209  -26.403 50.100  1.00 39.66  ?  468 ARG A O     1 
ATOM   3608  C  CB    . ARG A 1 468 ? 95.827  -27.773 52.743  1.00 32.68  ?  468 ARG A CB    1 
ATOM   3609  C  CG    . ARG A 1 468 ? 95.180  -27.484 54.096  1.00 32.96  ?  468 ARG A CG    1 
ATOM   3610  C  CD    . ARG A 1 468 ? 96.049  -28.033 55.249  1.00 43.70  ?  468 ARG A CD    1 
ATOM   3611  N  NE    . ARG A 1 468 ? 95.422  -27.946 56.577  1.00 49.56  ?  468 ARG A NE    1 
ATOM   3612  C  CZ    . ARG A 1 468 ? 94.716  -28.930 57.142  1.00 51.93  ?  468 ARG A CZ    1 
ATOM   3613  N  NH1   . ARG A 1 468 ? 94.530  -30.092 56.505  1.00 47.32  ?  468 ARG A NH1   1 
ATOM   3614  N  NH2   . ARG A 1 468 ? 94.185  -28.753 58.346  1.00 55.57  ?  468 ARG A NH2   1 
ATOM   3615  N  N     . GLU A 1 469 ? 95.745  -28.010 49.515  1.00 36.51  ?  469 GLU A N     1 
ATOM   3616  C  CA    . GLU A 1 469 ? 96.351  -28.243 48.213  1.00 37.43  ?  469 GLU A CA    1 
ATOM   3617  C  C     . GLU A 1 469 ? 96.253  -26.967 47.358  1.00 35.23  ?  469 GLU A C     1 
ATOM   3618  O  O     . GLU A 1 469 ? 97.244  -26.527 46.776  1.00 40.17  ?  469 GLU A O     1 
ATOM   3619  C  CB    . GLU A 1 469 ? 95.715  -29.457 47.520  1.00 43.33  ?  469 GLU A CB    1 
ATOM   3620  C  CG    . GLU A 1 469 ? 95.960  -30.788 48.255  1.00 57.04  ?  469 GLU A CG    1 
ATOM   3621  C  CD    . GLU A 1 469 ? 95.190  -31.992 47.679  1.00 66.03  ?  469 GLU A CD    1 
ATOM   3622  O  OE1   . GLU A 1 469 ? 94.197  -31.800 46.940  1.00 64.52  ?  469 GLU A OE1   1 
ATOM   3623  O  OE2   . GLU A 1 469 ? 95.582  -33.144 47.982  1.00 72.86  ?  469 GLU A OE2   1 
ATOM   3624  N  N     . VAL A 1 470 ? 95.069  -26.360 47.307  1.00 29.15  ?  470 VAL A N     1 
ATOM   3625  C  CA    . VAL A 1 470 ? 94.889  -25.115 46.573  1.00 27.65  ?  470 VAL A CA    1 
ATOM   3626  C  C     . VAL A 1 470 ? 95.882  -24.047 47.024  1.00 33.02  ?  470 VAL A C     1 
ATOM   3627  O  O     . VAL A 1 470 ? 96.565  -23.432 46.212  1.00 36.04  ?  470 VAL A O     1 
ATOM   3628  C  CB    . VAL A 1 470 ? 93.432  -24.604 46.664  1.00 23.63  ?  470 VAL A CB    1 
ATOM   3629  C  CG1   . VAL A 1 470 ? 93.318  -23.173 46.168  1.00 25.38  ?  470 VAL A CG1   1 
ATOM   3630  C  CG2   . VAL A 1 470 ? 92.549  -25.485 45.851  1.00 24.11  ?  470 VAL A CG2   1 
ATOM   3631  N  N     . LYS A 1 471 ? 95.960  -23.838 48.327  1.00 33.45  ?  471 LYS A N     1 
ATOM   3632  C  CA    . LYS A 1 471 ? 96.941  -22.933 48.895  1.00 30.67  ?  471 LYS A CA    1 
ATOM   3633  C  C     . LYS A 1 471 ? 98.367  -23.321 48.507  1.00 30.04  ?  471 LYS A C     1 
ATOM   3634  O  O     . LYS A 1 471 ? 99.118  -22.470 48.048  1.00 33.69  ?  471 LYS A O     1 
ATOM   3635  C  CB    . LYS A 1 471 ? 96.788  -22.904 50.418  1.00 32.90  ?  471 LYS A CB    1 
ATOM   3636  C  CG    . LYS A 1 471 ? 97.880  -22.160 51.180  1.00 34.10  ?  471 LYS A CG    1 
ATOM   3637  C  CD    . LYS A 1 471 ? 97.458  -21.927 52.634  1.00 35.53  ?  471 LYS A CD    1 
ATOM   3638  C  CE    . LYS A 1 471 ? 98.644  -21.546 53.521  1.00 36.73  ?  471 LYS A CE    1 
ATOM   3639  N  NZ    . LYS A 1 471 ? 99.013  -22.677 54.406  1.00 37.03  ?  471 LYS A NZ    1 
ATOM   3640  N  N     . LYS A 1 472 ? 98.753  -24.589 48.675  1.00 28.96  ?  472 LYS A N     1 
ATOM   3641  C  CA    . LYS A 1 472 ? 100.148 -24.943 48.414  1.00 32.18  ?  472 LYS A CA    1 
ATOM   3642  C  C     . LYS A 1 472 ? 100.525 -24.570 47.000  1.00 39.16  ?  472 LYS A C     1 
ATOM   3643  O  O     . LYS A 1 472 ? 101.683 -24.272 46.716  1.00 47.10  ?  472 LYS A O     1 
ATOM   3644  C  CB    . LYS A 1 472 ? 100.457 -26.428 48.625  1.00 29.96  ?  472 LYS A CB    1 
ATOM   3645  C  CG    . LYS A 1 472 ? 101.955 -26.740 48.338  1.00 35.85  ?  472 LYS A CG    1 
ATOM   3646  C  CD    . LYS A 1 472 ? 102.335 -28.232 48.366  1.00 33.73  ?  472 LYS A CD    1 
ATOM   3647  N  N     . LYS A 1 473 ? 99.527  -24.595 46.124  1.00 36.48  ?  473 LYS A N     1 
ATOM   3648  C  CA    . LYS A 1 473 ? 99.739  -24.484 44.692  1.00 35.39  ?  473 LYS A CA    1 
ATOM   3649  C  C     . LYS A 1 473 ? 99.704  -23.049 44.202  1.00 35.27  ?  473 LYS A C     1 
ATOM   3650  O  O     . LYS A 1 473 ? 100.499 -22.668 43.362  1.00 36.98  ?  473 LYS A O     1 
ATOM   3651  C  CB    . LYS A 1 473 ? 98.684  -25.304 43.949  1.00 35.90  ?  473 LYS A CB    1 
ATOM   3652  C  CG    . LYS A 1 473 ? 98.726  -25.143 42.444  1.00 42.37  ?  473 LYS A CG    1 
ATOM   3653  C  CD    . LYS A 1 473 ? 98.014  -26.262 41.695  1.00 46.23  ?  473 LYS A CD    1 
ATOM   3654  C  CE    . LYS A 1 473 ? 98.369  -26.195 40.198  1.00 52.62  ?  473 LYS A CE    1 
ATOM   3655  N  NZ    . LYS A 1 473 ? 97.285  -26.709 39.311  1.00 57.61  ?  473 LYS A NZ    1 
ATOM   3656  N  N     . PHE A 1 474 ? 98.785  -22.257 44.735  1.00 37.15  ?  474 PHE A N     1 
ATOM   3657  C  CA    . PHE A 1 474 ? 98.524  -20.930 44.203  1.00 36.06  ?  474 PHE A CA    1 
ATOM   3658  C  C     . PHE A 1 474 ? 98.968  -19.792 45.111  1.00 38.10  ?  474 PHE A C     1 
ATOM   3659  O  O     . PHE A 1 474 ? 98.837  -18.612 44.752  1.00 40.77  ?  474 PHE A O     1 
ATOM   3660  C  CB    . PHE A 1 474 ? 97.039  -20.792 43.865  1.00 34.14  ?  474 PHE A CB    1 
ATOM   3661  C  CG    . PHE A 1 474 ? 96.586  -21.712 42.772  1.00 36.87  ?  474 PHE A CG    1 
ATOM   3662  C  CD1   . PHE A 1 474 ? 96.974  -21.491 41.457  1.00 38.20  ?  474 PHE A CD1   1 
ATOM   3663  C  CD2   . PHE A 1 474 ? 95.778  -22.802 43.052  1.00 39.87  ?  474 PHE A CD2   1 
ATOM   3664  C  CE1   . PHE A 1 474 ? 96.569  -22.344 40.441  1.00 37.44  ?  474 PHE A CE1   1 
ATOM   3665  C  CE2   . PHE A 1 474 ? 95.360  -23.658 42.035  1.00 39.34  ?  474 PHE A CE2   1 
ATOM   3666  C  CZ    . PHE A 1 474 ? 95.758  -23.429 40.729  1.00 37.11  ?  474 PHE A CZ    1 
ATOM   3667  N  N     . ALA A 1 475 ? 99.510  -20.152 46.270  1.00 35.19  ?  475 ALA A N     1 
ATOM   3668  C  CA    . ALA A 1 475 ? 99.854  -19.184 47.308  1.00 33.52  ?  475 ALA A CA    1 
ATOM   3669  C  C     . ALA A 1 475 ? 100.907 -18.216 46.831  1.00 38.44  ?  475 ALA A C     1 
ATOM   3670  O  O     . ALA A 1 475 ? 101.868 -18.607 46.171  1.00 32.21  ?  475 ALA A O     1 
ATOM   3671  C  CB    . ALA A 1 475 ? 100.345 -19.893 48.541  1.00 32.56  ?  475 ALA A CB    1 
ATOM   3672  N  N     . THR A 1 476 ? 100.725 -16.946 47.168  1.00 48.39  ?  476 THR A N     1 
ATOM   3673  C  CA    . THR A 1 476 ? 101.707 -15.922 46.817  1.00 51.61  ?  476 THR A CA    1 
ATOM   3674  C  C     . THR A 1 476 ? 101.812 -14.882 47.929  1.00 50.45  ?  476 THR A C     1 
ATOM   3675  O  O     . THR A 1 476 ? 100.869 -14.681 48.696  1.00 49.64  ?  476 THR A O     1 
ATOM   3676  C  CB    . THR A 1 476 ? 101.425 -15.290 45.417  1.00 30.44  ?  476 THR A CB    1 
ATOM   3677  O  OG1   . THR A 1 476 ? 100.144 -14.641 45.393  1.00 32.72  ?  476 THR A OG1   1 
ATOM   3678  C  CG2   . THR A 1 476 ? 101.411 -16.381 44.371  1.00 33.99  ?  476 THR A CG2   1 
ATOM   3679  N  N     . PRO A 1 477 ? 102.981 -14.251 48.047  1.00 46.52  ?  477 PRO A N     1 
ATOM   3680  C  CA    . PRO A 1 477 ? 103.274 -13.329 49.146  1.00 45.55  ?  477 PRO A CA    1 
ATOM   3681  C  C     . PRO A 1 477 ? 102.395 -12.090 49.123  1.00 44.65  ?  477 PRO A C     1 
ATOM   3682  O  O     . PRO A 1 477 ? 101.840 -11.753 48.070  1.00 47.90  ?  477 PRO A O     1 
ATOM   3683  C  CB    . PRO A 1 477 ? 104.729 -12.947 48.884  1.00 46.54  ?  477 PRO A CB    1 
ATOM   3684  C  CG    . PRO A 1 477 ? 105.285 -14.093 48.086  1.00 47.02  ?  477 PRO A CG    1 
ATOM   3685  C  CD    . PRO A 1 477 ? 104.160 -14.492 47.201  1.00 47.34  ?  477 PRO A CD    1 
ATOM   3686  N  N     . ARG A 1 478 ? 102.277 -11.426 50.272  1.00 37.93  ?  478 ARG A N     1 
ATOM   3687  C  CA    . ARG A 1 478 ? 101.564 -10.154 50.363  1.00 36.37  ?  478 ARG A CA    1 
ATOM   3688  C  C     . ARG A 1 478 ? 102.233 -9.081  49.522  1.00 37.07  ?  478 ARG A C     1 
ATOM   3689  O  O     . ARG A 1 478 ? 103.468 -9.061  49.351  1.00 40.77  ?  478 ARG A O     1 
ATOM   3690  C  CB    . ARG A 1 478 ? 101.471 -9.640  51.806  1.00 35.48  ?  478 ARG A CB    1 
ATOM   3691  C  CG    . ARG A 1 478 ? 100.351 -10.241 52.617  1.00 36.85  ?  478 ARG A CG    1 
ATOM   3692  C  CD    . ARG A 1 478 ? 100.052 -9.439  53.884  1.00 35.77  ?  478 ARG A CD    1 
ATOM   3693  N  NE    . ARG A 1 478 ? 99.137  -8.335  53.623  1.00 37.00  ?  478 ARG A NE    1 
ATOM   3694  C  CZ    . ARG A 1 478 ? 97.821  -8.394  53.786  1.00 35.45  ?  478 ARG A CZ    1 
ATOM   3695  N  NH1   . ARG A 1 478 ? 97.235  -9.503  54.212  1.00 28.17  ?  478 ARG A NH1   1 
ATOM   3696  N  NH2   . ARG A 1 478 ? 97.090  -7.331  53.519  1.00 40.99  ?  478 ARG A NH2   1 
ATOM   3697  N  N     . LEU A 1 479 ? 101.401 -8.179  49.015  1.00 31.66  ?  479 LEU A N     1 
ATOM   3698  C  CA    . LEU A 1 479 ? 101.882 -7.055  48.257  1.00 36.11  ?  479 LEU A CA    1 
ATOM   3699  C  C     . LEU A 1 479 ? 101.620 -5.820  49.087  1.00 44.71  ?  479 LEU A C     1 
ATOM   3700  O  O     . LEU A 1 479 ? 102.451 -4.913  49.153  1.00 52.02  ?  479 LEU A O     1 
ATOM   3701  C  CB    . LEU A 1 479 ? 101.137 -6.961  46.926  1.00 36.01  ?  479 LEU A CB    1 
ATOM   3702  C  CG    . LEU A 1 479 ? 101.027 -8.244  46.116  1.00 27.10  ?  479 LEU A CG    1 
ATOM   3703  C  CD1   . LEU A 1 479 ? 100.531 -7.933  44.718  1.00 36.76  ?  479 LEU A CD1   1 
ATOM   3704  C  CD2   . LEU A 1 479 ? 102.338 -8.936  46.084  1.00 28.16  ?  479 LEU A CD2   1 
ATOM   3705  N  N     . SER A 1 480 ? 100.450 -5.794  49.717  1.00 44.85  ?  480 SER A N     1 
ATOM   3706  C  CA    . SER A 1 480 ? 100.045 -4.672  50.554  1.00 44.26  ?  480 SER A CA    1 
ATOM   3707  C  C     . SER A 1 480 ? 100.483 -4.900  51.985  1.00 45.88  ?  480 SER A C     1 
ATOM   3708  O  O     . SER A 1 480 ? 100.191 -5.946  52.560  1.00 44.67  ?  480 SER A O     1 
ATOM   3709  C  CB    . SER A 1 480 ? 98.525  -4.513  50.536  1.00 42.40  ?  480 SER A CB    1 
ATOM   3710  O  OG    . SER A 1 480 ? 98.071  -3.993  49.316  1.00 40.18  ?  480 SER A OG    1 
ATOM   3711  N  N     . SER A 1 481 ? 101.156 -3.907  52.559  1.00 49.59  ?  481 SER A N     1 
ATOM   3712  C  CA    . SER A 1 481 ? 101.569 -3.930  53.964  1.00 49.60  ?  481 SER A CA    1 
ATOM   3713  C  C     . SER A 1 481 ? 100.482 -3.354  54.877  1.00 53.21  ?  481 SER A C     1 
ATOM   3714  O  O     . SER A 1 481 ? 99.720  -2.472  54.472  1.00 58.41  ?  481 SER A O     1 
ATOM   3715  C  CB    . SER A 1 481 ? 102.839 -3.112  54.137  1.00 47.71  ?  481 SER A CB    1 
ATOM   3716  O  OG    . SER A 1 481 ? 102.533 -1.732  54.014  1.00 50.12  ?  481 SER A OG    1 
ATOM   3717  N  N     . LEU A 1 482 ? 100.429 -3.835  56.118  1.00 48.66  ?  482 LEU A N     1 
ATOM   3718  C  CA    . LEU A 1 482 ? 99.454  -3.327  57.084  1.00 43.94  ?  482 LEU A CA    1 
ATOM   3719  C  C     . LEU A 1 482 ? 100.058 -2.515  58.245  1.00 55.94  ?  482 LEU A C     1 
ATOM   3720  O  O     . LEU A 1 482 ? 101.122 -2.844  58.777  1.00 59.40  ?  482 LEU A O     1 
ATOM   3721  C  CB    . LEU A 1 482 ? 98.602  -4.467  57.610  1.00 32.12  ?  482 LEU A CB    1 
ATOM   3722  C  CG    . LEU A 1 482 ? 97.878  -5.265  56.537  1.00 31.49  ?  482 LEU A CG    1 
ATOM   3723  C  CD1   . LEU A 1 482 ? 97.446  -6.613  57.080  1.00 28.39  ?  482 LEU A CD1   1 
ATOM   3724  C  CD2   . LEU A 1 482 ? 96.686  -4.473  56.073  1.00 34.56  ?  482 LEU A CD2   1 
ATOM   3725  N  N     . GLU A 1 483 ? 99.353  -1.448  58.616  1.00 65.63  ?  483 GLU A N     1 
ATOM   3726  C  CA    . GLU A 1 483 ? 99.771  -0.517  59.657  1.00 72.02  ?  483 GLU A CA    1 
ATOM   3727  C  C     . GLU A 1 483 ? 98.557  -0.142  60.506  1.00 80.09  ?  483 GLU A C     1 
ATOM   3728  O  O     . GLU A 1 483 ? 97.434  -0.518  60.177  1.00 85.38  ?  483 GLU A O     1 
ATOM   3729  C  CB    . GLU A 1 483 ? 100.318 0.755   59.019  1.00 72.70  ?  483 GLU A CB    1 
ATOM   3730  C  CG    . GLU A 1 483 ? 101.606 0.599   58.247  1.00 76.85  ?  483 GLU A CG    1 
ATOM   3731  C  CD    . GLU A 1 483 ? 102.236 1.952   57.920  1.00 85.27  ?  483 GLU A CD    1 
ATOM   3732  O  OE1   . GLU A 1 483 ? 101.674 2.990   58.351  1.00 84.08  ?  483 GLU A OE1   1 
ATOM   3733  O  OE2   . GLU A 1 483 ? 103.286 1.979   57.231  1.00 89.94  ?  483 GLU A OE2   1 
ATOM   3734  N  N     . ASP A 1 484 ? 98.770  0.606   61.587  1.00 78.48  ?  484 ASP A N     1 
ATOM   3735  C  CA    . ASP A 1 484 ? 97.648  1.184   62.332  1.00 74.15  ?  484 ASP A CA    1 
ATOM   3736  C  C     . ASP A 1 484 ? 97.963  2.594   62.861  1.00 79.11  ?  484 ASP A C     1 
ATOM   3737  O  O     . ASP A 1 484 ? 97.687  3.606   62.195  1.00 79.77  ?  484 ASP A O     1 
ATOM   3738  C  CB    . ASP A 1 484 ? 97.198  0.246   63.456  1.00 66.84  ?  484 ASP A CB    1 
ATOM   3739  N  N     . ASN B 1 3   ? 122.015 -5.493  13.413  1.00 96.07  ?  3   ASN B N     1 
ATOM   3740  C  CA    . ASN B 1 3   ? 120.923 -4.631  13.854  1.00 95.39  ?  3   ASN B CA    1 
ATOM   3741  C  C     . ASN B 1 3   ? 120.248 -3.839  12.720  1.00 99.41  ?  3   ASN B C     1 
ATOM   3742  O  O     . ASN B 1 3   ? 119.287 -3.108  12.959  1.00 100.33 ?  3   ASN B O     1 
ATOM   3743  C  CB    . ASN B 1 3   ? 121.405 -3.678  14.954  1.00 93.61  ?  3   ASN B CB    1 
ATOM   3744  N  N     . ILE B 1 4   ? 120.748 -3.982  11.495  1.00 99.66  ?  4   ILE B N     1 
ATOM   3745  C  CA    . ILE B 1 4   ? 120.167 -3.285  10.342  1.00 94.31  ?  4   ILE B CA    1 
ATOM   3746  C  C     . ILE B 1 4   ? 120.535 -3.948  9.004   1.00 98.61  ?  4   ILE B C     1 
ATOM   3747  O  O     . ILE B 1 4   ? 121.439 -4.788  8.935   1.00 104.32 ?  4   ILE B O     1 
ATOM   3748  C  CB    . ILE B 1 4   ? 120.565 -1.788  10.305  1.00 90.12  ?  4   ILE B CB    1 
ATOM   3749  C  CG1   . ILE B 1 4   ? 119.756 -1.039  9.243   1.00 80.88  ?  4   ILE B CG1   1 
ATOM   3750  C  CG2   . ILE B 1 4   ? 122.055 -1.636  10.031  1.00 99.42  ?  4   ILE B CG2   1 
ATOM   3751  C  CD1   . ILE B 1 4   ? 120.196 0.399   9.028   1.00 79.94  ?  4   ILE B CD1   1 
ATOM   3752  N  N     . GLN B 1 5   ? 119.821 -3.562  7.950   1.00 94.75  ?  5   GLN B N     1 
ATOM   3753  C  CA    . GLN B 1 5   ? 119.999 -4.138  6.622   1.00 94.11  ?  5   GLN B CA    1 
ATOM   3754  C  C     . GLN B 1 5   ? 119.239 -3.281  5.619   1.00 92.88  ?  5   GLN B C     1 
ATOM   3755  O  O     . GLN B 1 5   ? 118.018 -3.171  5.695   1.00 90.65  ?  5   GLN B O     1 
ATOM   3756  C  CB    . GLN B 1 5   ? 119.484 -5.580  6.588   1.00 91.19  ?  5   GLN B CB    1 
ATOM   3757  N  N     . ASN B 1 6   ? 119.954 -2.666  4.682   1.00 93.76  ?  6   ASN B N     1 
ATOM   3758  C  CA    . ASN B 1 6   ? 119.338 -1.696  3.773   1.00 89.38  ?  6   ASN B CA    1 
ATOM   3759  C  C     . ASN B 1 6   ? 118.660 -2.332  2.569   1.00 84.30  ?  6   ASN B C     1 
ATOM   3760  O  O     . ASN B 1 6   ? 119.038 -3.411  2.124   1.00 85.17  ?  6   ASN B O     1 
ATOM   3761  C  CB    . ASN B 1 6   ? 120.376 -0.687  3.297   1.00 93.61  ?  6   ASN B CB    1 
ATOM   3762  C  CG    . ASN B 1 6   ? 121.568 -0.619  4.215   1.00 98.02  ?  6   ASN B CG    1 
ATOM   3763  O  OD1   . ASN B 1 6   ? 122.242 -1.626  4.433   1.00 101.49 ?  6   ASN B OD1   1 
ATOM   3764  N  ND2   . ASN B 1 6   ? 121.859 0.569   4.736   1.00 97.82  ?  6   ASN B ND2   1 
ATOM   3765  N  N     . MET B 1 7   ? 117.656 -1.645  2.042   1.00 80.53  ?  7   MET B N     1 
ATOM   3766  C  CA    . MET B 1 7   ? 116.901 -2.139  0.901   1.00 79.30  ?  7   MET B CA    1 
ATOM   3767  C  C     . MET B 1 7   ? 116.591 -0.948  -0.005  1.00 79.04  ?  7   MET B C     1 
ATOM   3768  O  O     . MET B 1 7   ? 116.385 0.164   0.480   1.00 76.03  ?  7   MET B O     1 
ATOM   3769  C  CB    . MET B 1 7   ? 115.605 -2.821  1.376   1.00 72.45  ?  7   MET B CB    1 
ATOM   3770  C  CG    . MET B 1 7   ? 115.245 -4.142  0.677   1.00 66.45  ?  7   MET B CG    1 
ATOM   3771  N  N     . SER B 1 8   ? 116.580 -1.181  -1.317  1.00 81.03  ?  8   SER B N     1 
ATOM   3772  C  CA    . SER B 1 8   ? 116.244 -0.143  -2.295  1.00 80.96  ?  8   SER B CA    1 
ATOM   3773  C  C     . SER B 1 8   ? 114.775 0.291   -2.191  1.00 78.75  ?  8   SER B C     1 
ATOM   3774  O  O     . SER B 1 8   ? 113.898 -0.526  -1.920  1.00 80.83  ?  8   SER B O     1 
ATOM   3775  C  CB    . SER B 1 8   ? 116.544 -0.639  -3.718  1.00 78.89  ?  8   SER B CB    1 
ATOM   3776  O  OG    . SER B 1 8   ? 116.262 0.362   -4.690  1.00 75.78  ?  8   SER B OG    1 
ATOM   3777  N  N     . LEU B 1 9   ? 114.504 1.575   -2.411  1.00 76.34  ?  9   LEU B N     1 
ATOM   3778  C  CA    . LEU B 1 9   ? 113.125 2.059   -2.432  1.00 71.82  ?  9   LEU B CA    1 
ATOM   3779  C  C     . LEU B 1 9   ? 112.340 1.407   -3.574  1.00 70.26  ?  9   LEU B C     1 
ATOM   3780  O  O     . LEU B 1 9   ? 111.142 1.155   -3.443  1.00 63.06  ?  9   LEU B O     1 
ATOM   3781  C  CB    . LEU B 1 9   ? 113.083 3.588   -2.538  1.00 75.19  ?  9   LEU B CB    1 
ATOM   3782  C  CG    . LEU B 1 9   ? 111.748 4.345   -2.462  1.00 53.49  ?  9   LEU B CG    1 
ATOM   3783  C  CD1   . LEU B 1 9   ? 111.085 4.469   -3.818  1.00 52.35  ?  9   LEU B CD1   1 
ATOM   3784  C  CD2   . LEU B 1 9   ? 110.798 3.693   -1.474  1.00 57.97  ?  9   LEU B CD2   1 
ATOM   3785  N  N     . GLU B 1 10  ? 113.022 1.131   -4.687  1.00 77.62  ?  10  GLU B N     1 
ATOM   3786  C  CA    . GLU B 1 10  ? 112.402 0.450   -5.823  1.00 76.21  ?  10  GLU B CA    1 
ATOM   3787  C  C     . GLU B 1 10  ? 112.172 -1.021  -5.490  1.00 79.77  ?  10  GLU B C     1 
ATOM   3788  O  O     . GLU B 1 10  ? 111.042 -1.509  -5.536  1.00 80.43  ?  10  GLU B O     1 
ATOM   3789  C  CB    . GLU B 1 10  ? 113.250 0.593   -7.097  1.00 73.47  ?  10  GLU B CB    1 
ATOM   3790  N  N     . ASP B 1 11  ? 113.239 -1.725  -5.137  1.00 81.06  ?  11  ASP B N     1 
ATOM   3791  C  CA    . ASP B 1 11  ? 113.128 -3.147  -4.847  1.00 78.07  ?  11  ASP B CA    1 
ATOM   3792  C  C     . ASP B 1 11  ? 112.191 -3.420  -3.644  1.00 79.32  ?  11  ASP B C     1 
ATOM   3793  O  O     . ASP B 1 11  ? 111.947 -4.568  -3.287  1.00 84.74  ?  11  ASP B O     1 
ATOM   3794  C  CB    . ASP B 1 11  ? 114.527 -3.777  -4.669  1.00 73.73  ?  11  ASP B CB    1 
ATOM   3795  N  N     . ILE B 1 12  ? 111.638 -2.373  -3.039  1.00 76.06  ?  12  ILE B N     1 
ATOM   3796  C  CA    . ILE B 1 12  ? 110.825 -2.559  -1.831  1.00 77.34  ?  12  ILE B CA    1 
ATOM   3797  C  C     . ILE B 1 12  ? 109.350 -2.220  -1.983  1.00 77.85  ?  12  ILE B C     1 
ATOM   3798  O  O     . ILE B 1 12  ? 108.497 -2.916  -1.433  1.00 80.02  ?  12  ILE B O     1 
ATOM   3799  C  CB    . ILE B 1 12  ? 111.386 -1.793  -0.613  1.00 77.84  ?  12  ILE B CB    1 
ATOM   3800  C  CG1   . ILE B 1 12  ? 112.220 -2.742  0.249   1.00 88.80  ?  12  ILE B CG1   1 
ATOM   3801  C  CG2   . ILE B 1 12  ? 110.254 -1.181  0.212   1.00 63.94  ?  12  ILE B CG2   1 
ATOM   3802  C  CD1   . ILE B 1 12  ? 112.625 -2.161  1.580   1.00 95.13  ?  12  ILE B CD1   1 
ATOM   3803  N  N     . MET B 1 13  ? 109.050 -1.137  -2.691  1.00 75.93  ?  13  MET B N     1 
ATOM   3804  C  CA    . MET B 1 13  ? 107.675 -0.875  -3.096  1.00 71.53  ?  13  MET B CA    1 
ATOM   3805  C  C     . MET B 1 13  ? 107.260 -1.990  -4.047  1.00 75.57  ?  13  MET B C     1 
ATOM   3806  O  O     . MET B 1 13  ? 106.103 -2.417  -4.076  1.00 76.44  ?  13  MET B O     1 
ATOM   3807  C  CB    . MET B 1 13  ? 107.561 0.474   -3.794  1.00 65.73  ?  13  MET B CB    1 
ATOM   3808  C  CG    . MET B 1 13  ? 107.848 1.664   -2.901  1.00 64.28  ?  13  MET B CG    1 
ATOM   3809  S  SD    . MET B 1 13  ? 106.361 2.407   -2.210  1.00 89.14  ?  13  MET B SD    1 
ATOM   3810  C  CE    . MET B 1 13  ? 105.407 2.718   -3.690  1.00 50.81  ?  13  MET B CE    1 
ATOM   3811  N  N     . GLY B 1 14  ? 108.228 -2.465  -4.820  1.00 76.09  ?  14  GLY B N     1 
ATOM   3812  C  CA    . GLY B 1 14  ? 108.014 -3.609  -5.676  1.00 72.69  ?  14  GLY B CA    1 
ATOM   3813  C  C     . GLY B 1 14  ? 107.454 -4.784  -4.905  1.00 67.01  ?  14  GLY B C     1 
ATOM   3814  O  O     . GLY B 1 14  ? 106.377 -5.270  -5.228  1.00 60.52  ?  14  GLY B O     1 
ATOM   3815  N  N     . GLU B 1 15  ? 108.181 -5.230  -3.881  1.00 69.65  ?  15  GLU B N     1 
ATOM   3816  C  CA    . GLU B 1 15  ? 107.812 -6.433  -3.130  1.00 71.62  ?  15  GLU B CA    1 
ATOM   3817  C  C     . GLU B 1 15  ? 106.558 -6.198  -2.294  1.00 73.02  ?  15  GLU B C     1 
ATOM   3818  O  O     . GLU B 1 15  ? 105.639 -7.022  -2.286  1.00 76.30  ?  15  GLU B O     1 
ATOM   3819  C  CB    . GLU B 1 15  ? 108.974 -6.903  -2.242  1.00 71.96  ?  15  GLU B CB    1 
ATOM   3820  C  CG    . GLU B 1 15  ? 108.822 -8.318  -1.677  1.00 79.27  ?  15  GLU B CG    1 
ATOM   3821  C  CD    . GLU B 1 15  ? 107.913 -8.392  -0.446  1.00 90.26  ?  15  GLU B CD    1 
ATOM   3822  O  OE1   . GLU B 1 15  ? 107.673 -7.342  0.199   1.00 92.46  ?  15  GLU B OE1   1 
ATOM   3823  O  OE2   . GLU B 1 15  ? 107.440 -9.509  -0.122  1.00 96.22  ?  15  GLU B OE2   1 
ATOM   3824  N  N     . ARG B 1 16  ? 106.525 -5.067  -1.597  1.00 68.84  ?  16  ARG B N     1 
ATOM   3825  C  CA    . ARG B 1 16  ? 105.381 -4.729  -0.769  1.00 62.87  ?  16  ARG B CA    1 
ATOM   3826  C  C     . ARG B 1 16  ? 104.103 -4.652  -1.589  1.00 59.22  ?  16  ARG B C     1 
ATOM   3827  O  O     . ARG B 1 16  ? 103.122 -5.298  -1.240  1.00 61.93  ?  16  ARG B O     1 
ATOM   3828  C  CB    . ARG B 1 16  ? 105.619 -3.428  0.001   1.00 62.24  ?  16  ARG B CB    1 
ATOM   3829  C  CG    . ARG B 1 16  ? 106.002 -3.645  1.463   1.00 63.40  ?  16  ARG B CG    1 
ATOM   3830  C  CD    . ARG B 1 16  ? 107.202 -4.565  1.586   1.00 66.83  ?  16  ARG B CD    1 
ATOM   3831  N  NE    . ARG B 1 16  ? 107.398 -5.030  2.956   1.00 72.17  ?  16  ARG B NE    1 
ATOM   3832  C  CZ    . ARG B 1 16  ? 108.492 -5.657  3.384   1.00 77.05  ?  16  ARG B CZ    1 
ATOM   3833  N  NH1   . ARG B 1 16  ? 109.494 -5.887  2.550   1.00 77.38  ?  16  ARG B NH1   1 
ATOM   3834  N  NH2   . ARG B 1 16  ? 108.590 -6.049  4.648   1.00 79.94  ?  16  ARG B NH2   1 
ATOM   3835  N  N     . PHE B 1 17  ? 104.111 -3.888  -2.681  1.00 55.29  ?  17  PHE B N     1 
ATOM   3836  C  CA    . PHE B 1 17  ? 102.885 -3.691  -3.467  1.00 54.44  ?  17  PHE B CA    1 
ATOM   3837  C  C     . PHE B 1 17  ? 102.429 -4.933  -4.244  1.00 53.90  ?  17  PHE B C     1 
ATOM   3838  O  O     . PHE B 1 17  ? 101.233 -5.194  -4.378  1.00 50.12  ?  17  PHE B O     1 
ATOM   3839  C  CB    . PHE B 1 17  ? 103.010 -2.489  -4.406  1.00 55.46  ?  17  PHE B CB    1 
ATOM   3840  C  CG    . PHE B 1 17  ? 101.737 -2.162  -5.140  1.00 57.50  ?  17  PHE B CG    1 
ATOM   3841  C  CD1   . PHE B 1 17  ? 101.547 -2.583  -6.455  1.00 58.67  ?  17  PHE B CD1   1 
ATOM   3842  C  CD2   . PHE B 1 17  ? 100.724 -1.446  -4.510  1.00 58.66  ?  17  PHE B CD2   1 
ATOM   3843  C  CE1   . PHE B 1 17  ? 100.368 -2.290  -7.133  1.00 59.90  ?  17  PHE B CE1   1 
ATOM   3844  C  CE2   . PHE B 1 17  ? 99.541  -1.147  -5.178  1.00 58.82  ?  17  PHE B CE2   1 
ATOM   3845  C  CZ    . PHE B 1 17  ? 99.364  -1.571  -6.494  1.00 58.91  ?  17  PHE B CZ    1 
ATOM   3846  N  N     . GLY B 1 18  ? 103.385 -5.694  -4.759  1.00 57.15  ?  18  GLY B N     1 
ATOM   3847  C  CA    . GLY B 1 18  ? 103.078 -6.964  -5.388  1.00 53.88  ?  18  GLY B CA    1 
ATOM   3848  C  C     . GLY B 1 18  ? 102.347 -7.903  -4.448  1.00 53.57  ?  18  GLY B C     1 
ATOM   3849  O  O     . GLY B 1 18  ? 101.426 -8.599  -4.861  1.00 50.36  ?  18  GLY B O     1 
ATOM   3850  N  N     . ARG B 1 19  ? 102.755 -7.921  -3.180  1.00 57.44  ?  19  ARG B N     1 
ATOM   3851  C  CA    . ARG B 1 19  ? 102.082 -8.734  -2.167  1.00 54.07  ?  19  ARG B CA    1 
ATOM   3852  C  C     . ARG B 1 19  ? 100.616 -8.293  -1.994  1.00 53.55  ?  19  ARG B C     1 
ATOM   3853  O  O     . ARG B 1 19  ? 99.698  -9.117  -2.042  1.00 57.06  ?  19  ARG B O     1 
ATOM   3854  C  CB    . ARG B 1 19  ? 102.860 -8.727  -0.833  1.00 45.59  ?  19  ARG B CB    1 
ATOM   3855  N  N     . TYR B 1 20  ? 100.398 -6.992  -1.823  1.00 49.79  ?  20  TYR B N     1 
ATOM   3856  C  CA    . TYR B 1 20  ? 99.047  -6.474  -1.597  1.00 52.33  ?  20  TYR B CA    1 
ATOM   3857  C  C     . TYR B 1 20  ? 98.208  -6.691  -2.839  1.00 56.24  ?  20  TYR B C     1 
ATOM   3858  O  O     . TYR B 1 20  ? 97.084  -7.183  -2.750  1.00 56.57  ?  20  TYR B O     1 
ATOM   3859  C  CB    . TYR B 1 20  ? 99.076  -4.988  -1.201  1.00 54.10  ?  20  TYR B CB    1 
ATOM   3860  C  CG    . TYR B 1 20  ? 97.723  -4.319  -1.089  1.00 56.34  ?  20  TYR B CG    1 
ATOM   3861  C  CD1   . TYR B 1 20  ? 96.920  -4.501  0.030   1.00 62.00  ?  20  TYR B CD1   1 
ATOM   3862  C  CD2   . TYR B 1 20  ? 97.257  -3.483  -2.091  1.00 55.24  ?  20  TYR B CD2   1 
ATOM   3863  C  CE1   . TYR B 1 20  ? 95.671  -3.875  0.140   1.00 64.62  ?  20  TYR B CE1   1 
ATOM   3864  C  CE2   . TYR B 1 20  ? 96.018  -2.856  -1.994  1.00 58.56  ?  20  TYR B CE2   1 
ATOM   3865  C  CZ    . TYR B 1 20  ? 95.225  -3.053  -0.878  1.00 62.18  ?  20  TYR B CZ    1 
ATOM   3866  O  OH    . TYR B 1 20  ? 93.990  -2.424  -0.787  1.00 61.63  ?  20  TYR B OH    1 
ATOM   3867  N  N     . SER B 1 21  ? 98.774  -6.327  -3.990  1.00 56.75  ?  21  SER B N     1 
ATOM   3868  C  CA    . SER B 1 21  ? 98.154  -6.559  -5.294  1.00 51.22  ?  21  SER B CA    1 
ATOM   3869  C  C     . SER B 1 21  ? 97.593  -7.985  -5.402  1.00 50.80  ?  21  SER B C     1 
ATOM   3870  O  O     . SER B 1 21  ? 96.378  -8.195  -5.399  1.00 47.08  ?  21  SER B O     1 
ATOM   3871  C  CB    . SER B 1 21  ? 99.164  -6.297  -6.420  1.00 47.61  ?  21  SER B CB    1 
ATOM   3872  N  N     . LYS B 1 22  ? 98.486  -8.964  -5.476  1.00 52.96  ?  22  LYS B N     1 
ATOM   3873  C  CA    . LYS B 1 22  ? 98.090  -10.359 -5.617  1.00 51.95  ?  22  LYS B CA    1 
ATOM   3874  C  C     . LYS B 1 22  ? 97.014  -10.792 -4.629  1.00 54.63  ?  22  LYS B C     1 
ATOM   3875  O  O     . LYS B 1 22  ? 95.993  -11.349 -5.031  1.00 53.45  ?  22  LYS B O     1 
ATOM   3876  C  CB    . LYS B 1 22  ? 99.309  -11.267 -5.479  1.00 53.19  ?  22  LYS B CB    1 
ATOM   3877  C  CG    . LYS B 1 22  ? 98.999  -12.748 -5.555  1.00 37.13  ?  22  LYS B CG    1 
ATOM   3878  C  CD    . LYS B 1 22  ? 100.267 -13.554 -5.381  1.00 45.95  ?  22  LYS B CD    1 
ATOM   3879  C  CE    . LYS B 1 22  ? 99.992  -15.036 -5.371  1.00 49.62  ?  22  LYS B CE    1 
ATOM   3880  N  NZ    . LYS B 1 22  ? 101.252 -15.790 -5.207  1.00 53.95  ?  22  LYS B NZ    1 
ATOM   3881  N  N     . TYR B 1 23  ? 97.246  -10.544 -3.339  1.00 56.21  ?  23  TYR B N     1 
ATOM   3882  C  CA    . TYR B 1 23  ? 96.302  -10.959 -2.299  1.00 54.94  ?  23  TYR B CA    1 
ATOM   3883  C  C     . TYR B 1 23  ? 94.923  -10.353 -2.498  1.00 51.73  ?  23  TYR B C     1 
ATOM   3884  O  O     . TYR B 1 23  ? 93.931  -11.078 -2.525  1.00 53.52  ?  23  TYR B O     1 
ATOM   3885  C  CB    . TYR B 1 23  ? 96.814  -10.634 -0.888  1.00 49.74  ?  23  TYR B CB    1 
ATOM   3886  C  CG    . TYR B 1 23  ? 95.863  -11.062 0.232   1.00 44.88  ?  23  TYR B CG    1 
ATOM   3887  C  CD1   . TYR B 1 23  ? 95.092  -10.133 0.910   1.00 49.30  ?  23  TYR B CD1   1 
ATOM   3888  C  CD2   . TYR B 1 23  ? 95.740  -12.391 0.596   1.00 47.37  ?  23  TYR B CD2   1 
ATOM   3889  C  CE1   . TYR B 1 23  ? 94.228  -10.514 1.926   1.00 54.34  ?  23  TYR B CE1   1 
ATOM   3890  C  CE2   . TYR B 1 23  ? 94.882  -12.786 1.609   1.00 53.33  ?  23  TYR B CE2   1 
ATOM   3891  C  CZ    . TYR B 1 23  ? 94.125  -11.844 2.275   1.00 57.68  ?  23  TYR B CZ    1 
ATOM   3892  O  OH    . TYR B 1 23  ? 93.264  -12.230 3.288   1.00 61.17  ?  23  TYR B OH    1 
ATOM   3893  N  N     . ILE B 1 24  ? 94.856  -9.029  -2.633  1.00 47.74  ?  24  ILE B N     1 
ATOM   3894  C  CA    . ILE B 1 24  ? 93.561  -8.361  -2.735  1.00 45.46  ?  24  ILE B CA    1 
ATOM   3895  C  C     . ILE B 1 24  ? 92.832  -8.708  -4.047  1.00 47.59  ?  24  ILE B C     1 
ATOM   3896  O  O     . ILE B 1 24  ? 91.615  -8.523  -4.147  1.00 47.15  ?  24  ILE B O     1 
ATOM   3897  C  CB    . ILE B 1 24  ? 93.639  -6.827  -2.436  1.00 66.59  ?  24  ILE B CB    1 
ATOM   3898  C  CG1   . ILE B 1 24  ? 92.319  -6.350  -1.818  1.00 64.12  ?  24  ILE B CG1   1 
ATOM   3899  C  CG2   . ILE B 1 24  ? 94.033  -6.013  -3.673  1.00 33.61  ?  24  ILE B CG2   1 
ATOM   3900  C  CD1   . ILE B 1 24  ? 92.438  -5.132  -0.891  1.00 57.07  ?  24  ILE B CD1   1 
ATOM   3901  N  N     . ILE B 1 25  ? 93.571  -9.251  -5.023  1.00 33.24  ?  25  ILE B N     1 
ATOM   3902  C  CA    . ILE B 1 25  ? 92.982  -9.728  -6.284  1.00 38.78  ?  25  ILE B CA    1 
ATOM   3903  C  C     . ILE B 1 25  ? 92.463  -11.154 -6.198  1.00 43.10  ?  25  ILE B C     1 
ATOM   3904  O  O     . ILE B 1 25  ? 91.343  -11.438 -6.605  1.00 47.27  ?  25  ILE B O     1 
ATOM   3905  C  CB    . ILE B 1 25  ? 93.981  -9.770  -7.447  1.00 41.01  ?  25  ILE B CB    1 
ATOM   3906  C  CG1   . ILE B 1 25  ? 94.434  -8.378  -7.877  1.00 42.18  ?  25  ILE B CG1   1 
ATOM   3907  C  CG2   . ILE B 1 25  ? 93.338  -10.464 -8.626  1.00 38.58  ?  25  ILE B CG2   1 
ATOM   3908  C  CD1   . ILE B 1 25  ? 95.622  -8.417  -8.792  1.00 30.98  ?  25  ILE B CD1   1 
ATOM   3909  N  N     . GLN B 1 26  ? 93.301  -12.061 -5.703  1.00 48.41  ?  26  GLN B N     1 
ATOM   3910  C  CA    . GLN B 1 26  ? 92.923  -13.472 -5.578  1.00 53.38  ?  26  GLN B CA    1 
ATOM   3911  C  C     . GLN B 1 26  ? 91.940  -13.749 -4.441  1.00 55.66  ?  26  GLN B C     1 
ATOM   3912  O  O     . GLN B 1 26  ? 90.985  -14.508 -4.620  1.00 56.44  ?  26  GLN B O     1 
ATOM   3913  C  CB    . GLN B 1 26  ? 94.155  -14.345 -5.366  1.00 52.71  ?  26  GLN B CB    1 
ATOM   3914  C  CG    . GLN B 1 26  ? 95.223  -14.201 -6.411  1.00 50.29  ?  26  GLN B CG    1 
ATOM   3915  C  CD    . GLN B 1 26  ? 96.256  -15.303 -6.310  1.00 54.47  ?  26  GLN B CD    1 
ATOM   3916  O  OE1   . GLN B 1 26  ? 96.904  -15.477 -5.272  1.00 57.50  ?  26  GLN B OE1   1 
ATOM   3917  N  NE2   . GLN B 1 26  ? 96.399  -16.073 -7.384  1.00 56.53  ?  26  GLN B NE2   1 
ATOM   3918  N  N     . ASP B 1 27  ? 92.188  -13.131 -3.283  1.00 55.26  ?  27  ASP B N     1 
ATOM   3919  C  CA    . ASP B 1 27  ? 91.526  -13.488 -2.031  1.00 57.82  ?  27  ASP B CA    1 
ATOM   3920  C  C     . ASP B 1 27  ? 90.818  -12.347 -1.316  1.00 59.48  ?  27  ASP B C     1 
ATOM   3921  O  O     . ASP B 1 27  ? 90.807  -12.311 -0.079  1.00 62.59  ?  27  ASP B O     1 
ATOM   3922  C  CB    . ASP B 1 27  ? 92.549  -14.042 -1.055  1.00 64.03  ?  27  ASP B CB    1 
ATOM   3923  C  CG    . ASP B 1 27  ? 93.158  -15.323 -1.524  1.00 72.11  ?  27  ASP B CG    1 
ATOM   3924  O  OD1   . ASP B 1 27  ? 92.411  -16.162 -2.088  1.00 74.89  ?  27  ASP B OD1   1 
ATOM   3925  O  OD2   . ASP B 1 27  ? 94.385  -15.480 -1.323  1.00 72.81  ?  27  ASP B OD2   1 
ATOM   3926  N  N     . ARG B 1 28  ? 90.234  -11.408 -2.055  1.00 58.01  ?  28  ARG B N     1 
ATOM   3927  C  CA    . ARG B 1 28  ? 89.396  -10.419 -1.384  1.00 54.99  ?  28  ARG B CA    1 
ATOM   3928  C  C     . ARG B 1 28  ? 88.252  -9.869  -2.211  1.00 57.36  ?  28  ARG B C     1 
ATOM   3929  O  O     . ARG B 1 28  ? 87.080  -10.090 -1.876  1.00 61.38  ?  28  ARG B O     1 
ATOM   3930  C  CB    . ARG B 1 28  ? 90.205  -9.259  -0.800  1.00 45.82  ?  28  ARG B CB    1 
ATOM   3931  C  CG    . ARG B 1 28  ? 89.318  -8.300  -0.017  1.00 43.98  ?  28  ARG B CG    1 
ATOM   3932  C  CD    . ARG B 1 28  ? 90.102  -7.248  0.700   1.00 44.72  ?  28  ARG B CD    1 
ATOM   3933  N  NE    . ARG B 1 28  ? 91.018  -7.837  1.666   1.00 48.11  ?  28  ARG B NE    1 
ATOM   3934  C  CZ    . ARG B 1 28  ? 91.986  -7.159  2.265   1.00 49.32  ?  28  ARG B CZ    1 
ATOM   3935  N  NH1   . ARG B 1 28  ? 92.796  -7.762  3.131   1.00 46.33  ?  28  ARG B NH1   1 
ATOM   3936  N  NH2   . ARG B 1 28  ? 92.139  -5.873  1.976   1.00 44.10  ?  28  ARG B NH2   1 
ATOM   3937  N  N     . ALA B 1 29  ? 88.593  -9.155  -3.283  1.00 52.41  ?  29  ALA B N     1 
ATOM   3938  C  CA    . ALA B 1 29  ? 87.625  -8.297  -3.960  1.00 50.40  ?  29  ALA B CA    1 
ATOM   3939  C  C     . ALA B 1 29  ? 86.922  -8.898  -5.183  1.00 48.91  ?  29  ALA B C     1 
ATOM   3940  O  O     . ALA B 1 29  ? 85.914  -8.362  -5.638  1.00 52.07  ?  29  ALA B O     1 
ATOM   3941  C  CB    . ALA B 1 29  ? 88.270  -6.983  -4.313  1.00 48.61  ?  29  ALA B CB    1 
ATOM   3942  N  N     . LEU B 1 30  ? 87.442  -10.000 -5.713  1.00 44.66  ?  30  LEU B N     1 
ATOM   3943  C  CA    . LEU B 1 30  ? 86.863  -10.596 -6.904  1.00 37.32  ?  30  LEU B CA    1 
ATOM   3944  C  C     . LEU B 1 30  ? 86.441  -12.020 -6.619  1.00 40.63  ?  30  LEU B C     1 
ATOM   3945  O  O     . LEU B 1 30  ? 87.138  -12.734 -5.894  1.00 41.94  ?  30  LEU B O     1 
ATOM   3946  C  CB    . LEU B 1 30  ? 87.879  -10.573 -8.035  1.00 34.06  ?  30  LEU B CB    1 
ATOM   3947  C  CG    . LEU B 1 30  ? 88.589  -9.221  -8.163  1.00 32.01  ?  30  LEU B CG    1 
ATOM   3948  C  CD1   . LEU B 1 30  ? 89.771  -9.313  -9.103  1.00 44.85  ?  30  LEU B CD1   1 
ATOM   3949  C  CD2   . LEU B 1 30  ? 87.621  -8.176  -8.634  1.00 31.22  ?  30  LEU B CD2   1 
ATOM   3950  N  N     . PRO B 1 31  ? 85.296  -12.432 -7.196  1.00 28.56  ?  31  PRO B N     1 
ATOM   3951  C  CA    . PRO B 1 31  ? 84.623  -13.733 -7.091  1.00 27.62  ?  31  PRO B CA    1 
ATOM   3952  C  C     . PRO B 1 31  ? 85.329  -14.851 -7.835  1.00 28.03  ?  31  PRO B C     1 
ATOM   3953  O  O     . PRO B 1 31  ? 86.016  -14.606 -8.813  1.00 34.15  ?  31  PRO B O     1 
ATOM   3954  C  CB    . PRO B 1 31  ? 83.282  -13.478 -7.773  1.00 27.48  ?  31  PRO B CB    1 
ATOM   3955  C  CG    . PRO B 1 31  ? 83.555  -12.422 -8.726  1.00 28.62  ?  31  PRO B CG    1 
ATOM   3956  C  CD    . PRO B 1 31  ? 84.543  -11.513 -8.057  1.00 29.10  ?  31  PRO B CD    1 
ATOM   3957  N  N     . ASP B 1 32  ? 85.158  -16.076 -7.370  1.00 27.37  ?  32  ASP B N     1 
ATOM   3958  C  CA    . ASP B 1 32  ? 85.639  -17.230 -8.102  1.00 44.70  ?  32  ASP B CA    1 
ATOM   3959  C  C     . ASP B 1 32  ? 84.616  -17.411 -9.206  1.00 44.92  ?  32  ASP B C     1 
ATOM   3960  O  O     . ASP B 1 32  ? 83.424  -17.214 -8.971  1.00 46.60  ?  32  ASP B O     1 
ATOM   3961  C  CB    . ASP B 1 32  ? 85.703  -18.459 -7.192  1.00 46.68  ?  32  ASP B CB    1 
ATOM   3962  C  CG    . ASP B 1 32  ? 86.198  -19.696 -7.908  1.00 50.50  ?  32  ASP B CG    1 
ATOM   3963  O  OD1   . ASP B 1 32  ? 87.402  -20.005 -7.820  1.00 51.66  ?  32  ASP B OD1   1 
ATOM   3964  O  OD2   . ASP B 1 32  ? 85.377  -20.374 -8.552  1.00 53.84  ?  32  ASP B OD2   1 
ATOM   3965  N  N     . ILE B 1 33  ? 85.083  -17.755 -10.407 1.00 40.89  ?  33  ILE B N     1 
ATOM   3966  C  CA    . ILE B 1 33  ? 84.227  -17.875 -11.578 1.00 34.92  ?  33  ILE B CA    1 
ATOM   3967  C  C     . ILE B 1 33  ? 83.169  -18.981 -11.446 1.00 34.76  ?  33  ILE B C     1 
ATOM   3968  O  O     . ILE B 1 33  ? 82.135  -18.950 -12.132 1.00 37.50  ?  33  ILE B O     1 
ATOM   3969  C  CB    . ILE B 1 33  ? 85.065  -18.182 -12.812 1.00 32.81  ?  33  ILE B CB    1 
ATOM   3970  C  CG1   . ILE B 1 33  ? 84.290  -17.858 -14.083 1.00 35.20  ?  33  ILE B CG1   1 
ATOM   3971  C  CG2   . ILE B 1 33  ? 85.448  -19.635 -12.826 1.00 34.11  ?  33  ILE B CG2   1 
ATOM   3972  C  CD1   . ILE B 1 33  ? 85.176  -17.558 -15.224 1.00 37.78  ?  33  ILE B CD1   1 
ATOM   3973  N  N     . ARG B 1 34  ? 83.418  -19.948 -10.564 1.00 29.90  ?  34  ARG B N     1 
ATOM   3974  C  CA    . ARG B 1 34  ? 82.535  -21.109 -10.420 1.00 29.36  ?  34  ARG B CA    1 
ATOM   3975  C  C     . ARG B 1 34  ? 81.455  -20.985 -9.336  1.00 32.03  ?  34  ARG B C     1 
ATOM   3976  O  O     . ARG B 1 34  ? 80.290  -21.273 -9.597  1.00 32.51  ?  34  ARG B O     1 
ATOM   3977  C  CB    . ARG B 1 34  ? 83.360  -22.371 -10.198 1.00 27.74  ?  34  ARG B CB    1 
ATOM   3978  C  CG    . ARG B 1 34  ? 84.630  -22.397 -11.000 1.00 28.77  ?  34  ARG B CG    1 
ATOM   3979  C  CD    . ARG B 1 34  ? 85.595  -23.382 -10.445 1.00 30.42  ?  34  ARG B CD    1 
ATOM   3980  N  NE    . ARG B 1 34  ? 86.457  -22.773 -9.436  1.00 29.04  ?  34  ARG B NE    1 
ATOM   3981  C  CZ    . ARG B 1 34  ? 87.420  -23.443 -8.815  1.00 49.16  ?  34  ARG B CZ    1 
ATOM   3982  N  NH1   . ARG B 1 34  ? 87.621  -24.721 -9.132  1.00 48.55  ?  34  ARG B NH1   1 
ATOM   3983  N  NH2   . ARG B 1 34  ? 88.172  -22.858 -7.892  1.00 29.63  ?  34  ARG B NH2   1 
ATOM   3984  N  N     . ASP B 1 35  ? 81.814  -20.575 -8.123  1.00 26.00  ?  35  ASP B N     1 
ATOM   3985  C  CA    . ASP B 1 35  ? 80.772  -20.459 -7.105  1.00 27.86  ?  35  ASP B CA    1 
ATOM   3986  C  C     . ASP B 1 35  ? 80.246  -19.037 -6.975  1.00 28.41  ?  35  ASP B C     1 
ATOM   3987  O  O     . ASP B 1 35  ? 79.186  -18.805 -6.374  1.00 29.06  ?  35  ASP B O     1 
ATOM   3988  C  CB    . ASP B 1 35  ? 81.153  -21.108 -5.757  1.00 30.66  ?  35  ASP B CB    1 
ATOM   3989  C  CG    . ASP B 1 35  ? 82.340  -20.438 -5.068  1.00 37.31  ?  35  ASP B CG    1 
ATOM   3990  O  OD1   . ASP B 1 35  ? 82.628  -19.253 -5.348  1.00 40.30  ?  35  ASP B OD1   1 
ATOM   3991  O  OD2   . ASP B 1 35  ? 82.974  -21.107 -4.214  1.00 39.27  ?  35  ASP B OD2   1 
ATOM   3992  N  N     . GLY B 1 36  ? 80.972  -18.099 -7.581  1.00 29.09  ?  36  GLY B N     1 
ATOM   3993  C  CA    . GLY B 1 36  ? 80.537  -16.713 -7.662  1.00 34.29  ?  36  GLY B CA    1 
ATOM   3994  C  C     . GLY B 1 36  ? 80.645  -15.983 -6.342  1.00 41.02  ?  36  GLY B C     1 
ATOM   3995  O  O     . GLY B 1 36  ? 79.941  -14.997 -6.093  1.00 51.18  ?  36  GLY B O     1 
ATOM   3996  N  N     . LEU B 1 37  ? 81.546  -16.472 -5.498  1.00 36.46  ?  37  LEU B N     1 
ATOM   3997  C  CA    . LEU B 1 37  ? 81.714  -15.965 -4.151  1.00 33.38  ?  37  LEU B CA    1 
ATOM   3998  C  C     . LEU B 1 37  ? 83.090  -15.346 -3.957  1.00 33.40  ?  37  LEU B C     1 
ATOM   3999  O  O     . LEU B 1 37  ? 84.088  -15.846 -4.505  1.00 34.40  ?  37  LEU B O     1 
ATOM   4000  C  CB    . LEU B 1 37  ? 81.555  -17.116 -3.162  1.00 32.79  ?  37  LEU B CB    1 
ATOM   4001  C  CG    . LEU B 1 37  ? 80.217  -17.839 -3.152  1.00 34.81  ?  37  LEU B CG    1 
ATOM   4002  C  CD1   . LEU B 1 37  ? 80.234  -19.004 -2.152  1.00 35.99  ?  37  LEU B CD1   1 
ATOM   4003  C  CD2   . LEU B 1 37  ? 79.118  -16.844 -2.837  1.00 35.75  ?  37  LEU B CD2   1 
ATOM   4004  N  N     . LYS B 1 38  ? 83.140  -14.263 -3.178  1.00 33.04  ?  38  LYS B N     1 
ATOM   4005  C  CA    . LYS B 1 38  ? 84.407  -13.748 -2.662  1.00 36.02  ?  38  LYS B CA    1 
ATOM   4006  C  C     . LYS B 1 38  ? 84.722  -14.548 -1.396  1.00 40.47  ?  38  LYS B C     1 
ATOM   4007  O  O     . LYS B 1 38  ? 83.803  -15.062 -0.756  1.00 39.95  ?  38  LYS B O     1 
ATOM   4008  C  CB    . LYS B 1 38  ? 84.304  -12.253 -2.362  1.00 34.66  ?  38  LYS B CB    1 
ATOM   4009  C  CG    . LYS B 1 38  ? 83.473  -11.468 -3.371  1.00 34.74  ?  38  LYS B CG    1 
ATOM   4010  C  CD    . LYS B 1 38  ? 83.660  -9.980  -3.188  1.00 40.57  ?  38  LYS B CD    1 
ATOM   4011  C  CE    . LYS B 1 38  ? 82.583  -9.177  -3.912  1.00 45.47  ?  38  LYS B CE    1 
ATOM   4012  N  NZ    . LYS B 1 38  ? 82.618  -7.707  -3.601  1.00 48.24  ?  38  LYS B NZ    1 
ATOM   4013  N  N     . PRO B 1 39  ? 86.016  -14.686 -1.040  1.00 39.60  ?  39  PRO B N     1 
ATOM   4014  C  CA    . PRO B 1 39  ? 86.437  -15.594 0.043   1.00 36.90  ?  39  PRO B CA    1 
ATOM   4015  C  C     . PRO B 1 39  ? 85.652  -15.375 1.328   1.00 31.95  ?  39  PRO B C     1 
ATOM   4016  O  O     . PRO B 1 39  ? 85.209  -16.357 1.915   1.00 36.86  ?  39  PRO B O     1 
ATOM   4017  C  CB    . PRO B 1 39  ? 87.900  -15.227 0.267   1.00 27.29  ?  39  PRO B CB    1 
ATOM   4018  C  CG    . PRO B 1 39  ? 88.339  -14.646 -1.016  1.00 40.78  ?  39  PRO B CG    1 
ATOM   4019  C  CD    . PRO B 1 39  ? 87.153  -13.949 -1.608  1.00 42.03  ?  39  PRO B CD    1 
ATOM   4020  N  N     . VAL B 1 40  ? 85.473  -14.119 1.744   1.00 26.97  ?  40  VAL B N     1 
ATOM   4021  C  CA    . VAL B 1 40  ? 84.713  -13.844 2.954   1.00 25.34  ?  40  VAL B CA    1 
ATOM   4022  C  C     . VAL B 1 40  ? 83.313  -14.439 2.836   1.00 25.75  ?  40  VAL B C     1 
ATOM   4023  O  O     . VAL B 1 40  ? 82.875  -15.174 3.722   1.00 24.38  ?  40  VAL B O     1 
ATOM   4024  C  CB    . VAL B 1 40  ? 84.632  -12.347 3.296   1.00 25.64  ?  40  VAL B CB    1 
ATOM   4025  C  CG1   . VAL B 1 40  ? 83.722  -11.643 2.359   1.00 25.37  ?  40  VAL B CG1   1 
ATOM   4026  C  CG2   . VAL B 1 40  ? 84.120  -12.172 4.718   1.00 25.56  ?  40  VAL B CG2   1 
ATOM   4027  N  N     . GLN B 1 41  ? 82.624  -14.148 1.734   1.00 24.30  ?  41  GLN B N     1 
ATOM   4028  C  CA    . GLN B 1 41  ? 81.318  -14.750 1.496   1.00 28.75  ?  41  GLN B CA    1 
ATOM   4029  C  C     . GLN B 1 41  ? 81.342  -16.274 1.626   1.00 32.92  ?  41  GLN B C     1 
ATOM   4030  O  O     . GLN B 1 41  ? 80.411  -16.856 2.188   1.00 35.27  ?  41  GLN B O     1 
ATOM   4031  C  CB    . GLN B 1 41  ? 80.761  -14.350 0.134   1.00 30.54  ?  41  GLN B CB    1 
ATOM   4032  C  CG    . GLN B 1 41  ? 80.538  -12.873 -0.040  1.00 38.30  ?  41  GLN B CG    1 
ATOM   4033  C  CD    . GLN B 1 41  ? 80.164  -12.506 -1.456  1.00 44.89  ?  41  GLN B CD    1 
ATOM   4034  O  OE1   . GLN B 1 41  ? 80.573  -13.167 -2.413  1.00 46.85  ?  41  GLN B OE1   1 
ATOM   4035  N  NE2   . GLN B 1 41  ? 79.381  -11.447 -1.599  1.00 48.90  ?  41  GLN B NE2   1 
ATOM   4036  N  N     . ARG B 1 42  ? 82.392  -16.917 1.108   1.00 32.04  ?  42  ARG B N     1 
ATOM   4037  C  CA    . ARG B 1 42  ? 82.486  -18.386 1.136   1.00 31.89  ?  42  ARG B CA    1 
ATOM   4038  C  C     . ARG B 1 42  ? 82.678  -18.892 2.555   1.00 33.54  ?  42  ARG B C     1 
ATOM   4039  O  O     . ARG B 1 42  ? 82.142  -19.927 2.935   1.00 31.62  ?  42  ARG B O     1 
ATOM   4040  C  CB    . ARG B 1 42  ? 83.612  -18.904 0.231   1.00 30.72  ?  42  ARG B CB    1 
ATOM   4041  C  CG    . ARG B 1 42  ? 83.543  -20.415 -0.084  1.00 31.51  ?  42  ARG B CG    1 
ATOM   4042  C  CD    . ARG B 1 42  ? 84.684  -20.846 -1.035  1.00 33.69  ?  42  ARG B CD    1 
ATOM   4043  N  NE    . ARG B 1 42  ? 84.616  -20.121 -2.303  1.00 32.74  ?  42  ARG B NE    1 
ATOM   4044  C  CZ    . ARG B 1 42  ? 85.353  -19.053 -2.611  1.00 35.08  ?  42  ARG B CZ    1 
ATOM   4045  N  NH1   . ARG B 1 42  ? 86.249  -18.588 -1.753  1.00 33.62  ?  42  ARG B NH1   1 
ATOM   4046  N  NH2   . ARG B 1 42  ? 85.197  -18.446 -3.786  1.00 36.31  ?  42  ARG B NH2   1 
ATOM   4047  N  N     . ARG B 1 43  ? 83.428  -18.134 3.342   1.00 33.14  ?  43  ARG B N     1 
ATOM   4048  C  CA    . ARG B 1 43  ? 83.673  -18.480 4.733   1.00 32.19  ?  43  ARG B CA    1 
ATOM   4049  C  C     . ARG B 1 43  ? 82.437  -18.368 5.599   1.00 38.95  ?  43  ARG B C     1 
ATOM   4050  O  O     . ARG B 1 43  ? 82.109  -19.300 6.325   1.00 43.54  ?  43  ARG B O     1 
ATOM   4051  C  CB    . ARG B 1 43  ? 84.801  -17.623 5.285   1.00 28.91  ?  43  ARG B CB    1 
ATOM   4052  C  CG    . ARG B 1 43  ? 86.111  -18.124 4.789   1.00 28.00  ?  43  ARG B CG    1 
ATOM   4053  C  CD    . ARG B 1 43  ? 87.213  -17.171 5.043   1.00 33.43  ?  43  ARG B CD    1 
ATOM   4054  N  NE    . ARG B 1 43  ? 88.440  -17.754 4.526   1.00 42.69  ?  43  ARG B NE    1 
ATOM   4055  C  CZ    . ARG B 1 43  ? 89.488  -17.046 4.135   1.00 46.36  ?  43  ARG B CZ    1 
ATOM   4056  N  NH1   . ARG B 1 43  ? 89.446  -15.718 4.214   1.00 44.68  ?  43  ARG B NH1   1 
ATOM   4057  N  NH2   . ARG B 1 43  ? 90.563  -17.669 3.663   1.00 51.67  ?  43  ARG B NH2   1 
ATOM   4058  N  N     . ILE B 1 44  ? 81.760  -17.227 5.531   1.00 36.71  ?  44  ILE B N     1 
ATOM   4059  C  CA    . ILE B 1 44  ? 80.446  -17.104 6.142   1.00 37.34  ?  44  ILE B CA    1 
ATOM   4060  C  C     . ILE B 1 44  ? 79.577  -18.324 5.825   1.00 39.98  ?  44  ILE B C     1 
ATOM   4061  O  O     . ILE B 1 44  ? 79.054  -18.973 6.740   1.00 38.68  ?  44  ILE B O     1 
ATOM   4062  C  CB    . ILE B 1 44  ? 79.727  -15.863 5.656   1.00 23.89  ?  44  ILE B CB    1 
ATOM   4063  C  CG1   . ILE B 1 44  ? 80.560  -14.638 5.964   1.00 30.94  ?  44  ILE B CG1   1 
ATOM   4064  C  CG2   . ILE B 1 44  ? 78.359  -15.755 6.291   1.00 27.31  ?  44  ILE B CG2   1 
ATOM   4065  C  CD1   . ILE B 1 44  ? 80.022  -13.397 5.327   1.00 43.37  ?  44  ILE B CD1   1 
ATOM   4066  N  N     . LEU B 1 45  ? 79.424  -18.644 4.539   1.00 38.19  ?  45  LEU B N     1 
ATOM   4067  C  CA    . LEU B 1 45  ? 78.605  -19.797 4.156   1.00 33.05  ?  45  LEU B CA    1 
ATOM   4068  C  C     . LEU B 1 45  ? 79.121  -21.113 4.707   1.00 32.25  ?  45  LEU B C     1 
ATOM   4069  O  O     . LEU B 1 45  ? 78.385  -21.846 5.366   1.00 36.47  ?  45  LEU B O     1 
ATOM   4070  C  CB    . LEU B 1 45  ? 78.437  -19.906 2.649   1.00 30.31  ?  45  LEU B CB    1 
ATOM   4071  C  CG    . LEU B 1 45  ? 77.513  -18.866 2.032   1.00 32.94  ?  45  LEU B CG    1 
ATOM   4072  C  CD1   . LEU B 1 45  ? 77.050  -19.340 0.663   1.00 35.74  ?  45  LEU B CD1   1 
ATOM   4073  C  CD2   . LEU B 1 45  ? 76.351  -18.612 2.948   1.00 34.65  ?  45  LEU B CD2   1 
ATOM   4074  N  N     . TYR B 1 46  ? 80.381  -21.424 4.432   1.00 29.03  ?  46  TYR B N     1 
ATOM   4075  C  CA    . TYR B 1 46  ? 80.928  -22.681 4.912   1.00 31.19  ?  46  TYR B CA    1 
ATOM   4076  C  C     . TYR B 1 46  ? 80.805  -22.762 6.451   1.00 37.15  ?  46  TYR B C     1 
ATOM   4077  O  O     . TYR B 1 46  ? 80.403  -23.798 7.006   1.00 36.11  ?  46  TYR B O     1 
ATOM   4078  C  CB    . TYR B 1 46  ? 82.369  -22.893 4.428   1.00 25.70  ?  46  TYR B CB    1 
ATOM   4079  C  CG    . TYR B 1 46  ? 82.977  -24.129 5.014   1.00 26.71  ?  46  TYR B CG    1 
ATOM   4080  C  CD1   . TYR B 1 46  ? 83.898  -24.038 6.047   1.00 40.19  ?  46  TYR B CD1   1 
ATOM   4081  C  CD2   . TYR B 1 46  ? 82.583  -25.397 4.594   1.00 27.10  ?  46  TYR B CD2   1 
ATOM   4082  C  CE1   . TYR B 1 46  ? 84.433  -25.170 6.633   1.00 42.88  ?  46  TYR B CE1   1 
ATOM   4083  C  CE2   . TYR B 1 46  ? 83.122  -26.531 5.160   1.00 38.00  ?  46  TYR B CE2   1 
ATOM   4084  C  CZ    . TYR B 1 46  ? 84.046  -26.411 6.188   1.00 41.73  ?  46  TYR B CZ    1 
ATOM   4085  O  OH    . TYR B 1 46  ? 84.599  -27.520 6.794   1.00 44.54  ?  46  TYR B OH    1 
ATOM   4086  N  N     . SER B 1 47  ? 81.115  -21.659 7.135   1.00 38.54  ?  47  SER B N     1 
ATOM   4087  C  CA    . SER B 1 47  ? 81.078  -21.644 8.597   1.00 39.59  ?  47  SER B CA    1 
ATOM   4088  C  C     . SER B 1 47  ? 79.664  -21.868 9.138   1.00 35.19  ?  47  SER B C     1 
ATOM   4089  O  O     . SER B 1 47  ? 79.435  -22.810 9.876   1.00 30.84  ?  47  SER B O     1 
ATOM   4090  C  CB    . SER B 1 47  ? 81.705  -20.367 9.179   1.00 40.62  ?  47  SER B CB    1 
ATOM   4091  O  OG    . SER B 1 47  ? 81.793  -20.442 10.597  1.00 39.70  ?  47  SER B OG    1 
ATOM   4092  N  N     . MET B 1 48  ? 78.712  -21.024 8.766   1.00 25.98  ?  48  MET B N     1 
ATOM   4093  C  CA    . MET B 1 48  ? 77.353  -21.221 9.249   1.00 30.07  ?  48  MET B CA    1 
ATOM   4094  C  C     . MET B 1 48  ? 76.905  -22.662 8.994   1.00 29.81  ?  48  MET B C     1 
ATOM   4095  O  O     . MET B 1 48  ? 76.214  -23.279 9.804   1.00 32.62  ?  48  MET B O     1 
ATOM   4096  C  CB    . MET B 1 48  ? 76.389  -20.212 8.620   1.00 25.72  ?  48  MET B CB    1 
ATOM   4097  C  CG    . MET B 1 48  ? 76.832  -18.772 8.804   1.00 25.50  ?  48  MET B CG    1 
ATOM   4098  S  SD    . MET B 1 48  ? 75.564  -17.541 8.482   1.00 35.37  ?  48  MET B SD    1 
ATOM   4099  C  CE    . MET B 1 48  ? 74.158  -18.337 9.247   1.00 128.44 ?  48  MET B CE    1 
ATOM   4100  N  N     . ASN B 1 49  ? 77.310  -23.216 7.868   1.00 33.54  ?  49  ASN B N     1 
ATOM   4101  C  CA    . ASN B 1 49  ? 76.854  -24.546 7.544   1.00 38.45  ?  49  ASN B CA    1 
ATOM   4102  C  C     . ASN B 1 49  ? 77.426  -25.578 8.528   1.00 35.88  ?  49  ASN B C     1 
ATOM   4103  O  O     . ASN B 1 49  ? 76.711  -26.447 9.019   1.00 34.79  ?  49  ASN B O     1 
ATOM   4104  C  CB    . ASN B 1 49  ? 77.184  -24.871 6.087   1.00 42.21  ?  49  ASN B CB    1 
ATOM   4105  C  CG    . ASN B 1 49  ? 76.626  -26.197 5.647   1.00 44.77  ?  49  ASN B CG    1 
ATOM   4106  O  OD1   . ASN B 1 49  ? 75.410  -26.376 5.564   1.00 43.75  ?  49  ASN B OD1   1 
ATOM   4107  N  ND2   . ASN B 1 49  ? 77.516  -27.139 5.352   1.00 46.66  ?  49  ASN B ND2   1 
ATOM   4108  N  N     . LYS B 1 50  ? 78.715  -25.462 8.821   1.00 35.56  ?  50  LYS B N     1 
ATOM   4109  C  CA    . LYS B 1 50  ? 79.385  -26.383 9.738   1.00 35.90  ?  50  LYS B CA    1 
ATOM   4110  C  C     . LYS B 1 50  ? 78.707  -26.292 11.098  1.00 37.41  ?  50  LYS B C     1 
ATOM   4111  O  O     . LYS B 1 50  ? 78.451  -27.300 11.733  1.00 39.92  ?  50  LYS B O     1 
ATOM   4112  C  CB    . LYS B 1 50  ? 80.881  -26.024 9.850   1.00 36.99  ?  50  LYS B CB    1 
ATOM   4113  C  CG    . LYS B 1 50  ? 81.844  -27.181 10.119  1.00 31.05  ?  50  LYS B CG    1 
ATOM   4114  C  CD    . LYS B 1 50  ? 83.166  -26.669 10.714  1.00 31.59  ?  50  LYS B CD    1 
ATOM   4115  N  N     . ASP B 1 51  ? 78.413  -25.066 11.529  1.00 42.04  ?  51  ASP B N     1 
ATOM   4116  C  CA    . ASP B 1 51  ? 77.758  -24.804 12.806  1.00 51.30  ?  51  ASP B CA    1 
ATOM   4117  C  C     . ASP B 1 51  ? 76.262  -25.125 12.769  1.00 50.56  ?  51  ASP B C     1 
ATOM   4118  O  O     . ASP B 1 51  ? 75.523  -24.737 13.670  1.00 57.44  ?  51  ASP B O     1 
ATOM   4119  C  CB    . ASP B 1 51  ? 77.963  -23.342 13.248  1.00 64.30  ?  51  ASP B CB    1 
ATOM   4120  C  CG    . ASP B 1 51  ? 79.443  -22.973 13.455  1.00 76.37  ?  51  ASP B CG    1 
ATOM   4121  O  OD1   . ASP B 1 51  ? 80.083  -23.526 14.378  1.00 83.96  ?  51  ASP B OD1   1 
ATOM   4122  O  OD2   . ASP B 1 51  ? 79.963  -22.109 12.710  1.00 77.44  ?  51  ASP B OD2   1 
ATOM   4123  N  N     . SER B 1 52  ? 75.826  -25.813 11.714  1.00 46.63  ?  52  SER B N     1 
ATOM   4124  C  CA    . SER B 1 52  ? 74.453  -26.314 11.567  1.00 46.07  ?  52  SER B CA    1 
ATOM   4125  C  C     . SER B 1 52  ? 73.394  -25.236 11.555  1.00 44.40  ?  52  SER B C     1 
ATOM   4126  O  O     . SER B 1 52  ? 72.251  -25.484 11.944  1.00 50.12  ?  52  SER B O     1 
ATOM   4127  C  CB    . SER B 1 52  ? 74.117  -27.309 12.666  1.00 50.19  ?  52  SER B CB    1 
ATOM   4128  O  OG    . SER B 1 52  ? 75.232  -28.131 12.941  1.00 55.63  ?  52  SER B OG    1 
ATOM   4129  N  N     . ASN B 1 53  ? 73.768  -24.051 11.087  1.00 40.22  ?  53  ASN B N     1 
ATOM   4130  C  CA    . ASN B 1 53  ? 72.899  -22.880 11.154  1.00 41.18  ?  53  ASN B CA    1 
ATOM   4131  C  C     . ASN B 1 53  ? 72.136  -22.667 9.835   1.00 45.51  ?  53  ASN B C     1 
ATOM   4132  O  O     . ASN B 1 53  ? 72.414  -21.755 9.047   1.00 48.00  ?  53  ASN B O     1 
ATOM   4133  C  CB    . ASN B 1 53  ? 73.716  -21.650 11.559  1.00 39.64  ?  53  ASN B CB    1 
ATOM   4134  C  CG    . ASN B 1 53  ? 72.848  -20.475 11.867  1.00 46.40  ?  53  ASN B CG    1 
ATOM   4135  O  OD1   . ASN B 1 53  ? 71.617  -20.627 11.960  1.00 53.65  ?  53  ASN B OD1   1 
ATOM   4136  N  ND2   . ASN B 1 53  ? 73.459  -19.284 12.019  1.00 42.94  ?  53  ASN B ND2   1 
ATOM   4137  N  N     . THR B 1 54  ? 71.156  -23.527 9.608   1.00 46.89  ?  54  THR B N     1 
ATOM   4138  C  CA    . THR B 1 54  ? 70.569  -23.664 8.288   1.00 45.30  ?  54  THR B CA    1 
ATOM   4139  C  C     . THR B 1 54  ? 69.093  -23.319 8.300   1.00 49.94  ?  54  THR B C     1 
ATOM   4140  O  O     . THR B 1 54  ? 68.529  -23.054 9.356   1.00 55.87  ?  54  THR B O     1 
ATOM   4141  C  CB    . THR B 1 54  ? 70.773  -25.082 7.771   1.00 43.19  ?  54  THR B CB    1 
ATOM   4142  O  OG1   . THR B 1 54  ? 70.238  -26.015 8.717   1.00 41.87  ?  54  THR B OG1   1 
ATOM   4143  C  CG2   . THR B 1 54  ? 72.247  -25.357 7.619   1.00 29.04  ?  54  THR B CG2   1 
ATOM   4144  N  N     . PHE B 1 55  ? 68.479  -23.327 7.120   1.00 49.51  ?  55  PHE B N     1 
ATOM   4145  C  CA    . PHE B 1 55  ? 67.112  -22.835 6.942   1.00 49.42  ?  55  PHE B CA    1 
ATOM   4146  C  C     . PHE B 1 55  ? 66.074  -23.642 7.713   1.00 51.58  ?  55  PHE B C     1 
ATOM   4147  O  O     . PHE B 1 55  ? 64.979  -23.157 7.984   1.00 52.11  ?  55  PHE B O     1 
ATOM   4148  C  CB    . PHE B 1 55  ? 66.741  -22.863 5.466   1.00 47.14  ?  55  PHE B CB    1 
ATOM   4149  C  CG    . PHE B 1 55  ? 66.336  -24.216 4.983   1.00 45.63  ?  55  PHE B CG    1 
ATOM   4150  C  CD1   . PHE B 1 55  ? 67.285  -25.196 4.757   1.00 51.37  ?  55  PHE B CD1   1 
ATOM   4151  C  CD2   . PHE B 1 55  ? 65.006  -24.515 4.763   1.00 43.30  ?  55  PHE B CD2   1 
ATOM   4152  C  CE1   . PHE B 1 55  ? 66.910  -26.445 4.333   1.00 56.21  ?  55  PHE B CE1   1 
ATOM   4153  C  CE2   . PHE B 1 55  ? 64.635  -25.756 4.330   1.00 34.30  ?  55  PHE B CE2   1 
ATOM   4154  C  CZ    . PHE B 1 55  ? 65.586  -26.719 4.117   1.00 60.36  ?  55  PHE B CZ    1 
ATOM   4155  N  N     . ASP B 1 56  ? 66.421  -24.875 8.053   1.00 53.26  ?  56  ASP B N     1 
ATOM   4156  C  CA    . ASP B 1 56  ? 65.467  -25.796 8.648   1.00 55.96  ?  56  ASP B CA    1 
ATOM   4157  C  C     . ASP B 1 56  ? 65.502  -25.725 10.164  1.00 53.36  ?  56  ASP B C     1 
ATOM   4158  O  O     . ASP B 1 56  ? 64.702  -26.366 10.847  1.00 61.48  ?  56  ASP B O     1 
ATOM   4159  C  CB    . ASP B 1 56  ? 65.773  -27.225 8.198   1.00 61.39  ?  56  ASP B CB    1 
ATOM   4160  C  CG    . ASP B 1 56  ? 67.243  -27.568 8.312   1.00 63.46  ?  56  ASP B CG    1 
ATOM   4161  O  OD1   . ASP B 1 56  ? 68.084  -26.697 8.007   1.00 62.98  ?  56  ASP B OD1   1 
ATOM   4162  O  OD2   . ASP B 1 56  ? 67.558  -28.711 8.703   1.00 65.88  ?  56  ASP B OD2   1 
ATOM   4163  N  N     . LYS B 1 57  ? 66.442  -24.946 10.682  1.00 46.02  ?  57  LYS B N     1 
ATOM   4164  C  CA    . LYS B 1 57  ? 66.709  -24.928 12.106  1.00 44.37  ?  57  LYS B CA    1 
ATOM   4165  C  C     . LYS B 1 57  ? 66.670  -23.493 12.596  1.00 49.80  ?  57  LYS B C     1 
ATOM   4166  O  O     . LYS B 1 57  ? 66.667  -22.571 11.792  1.00 56.34  ?  57  LYS B O     1 
ATOM   4167  C  CB    . LYS B 1 57  ? 68.059  -25.586 12.410  1.00 38.97  ?  57  LYS B CB    1 
ATOM   4168  C  CG    . LYS B 1 57  ? 68.173  -27.036 11.944  1.00 39.25  ?  57  LYS B CG    1 
ATOM   4169  C  CD    . LYS B 1 57  ? 69.151  -27.823 12.809  1.00 50.07  ?  57  LYS B CD    1 
ATOM   4170  C  CE    . LYS B 1 57  ? 69.586  -29.128 12.150  1.00 62.27  ?  57  LYS B CE    1 
ATOM   4171  N  NZ    . LYS B 1 57  ? 70.490  -28.865 10.983  1.00 67.84  ?  57  LYS B NZ    1 
ATOM   4172  N  N     . SER B 1 58  ? 66.629  -23.312 13.911  1.00 49.25  ?  58  SER B N     1 
ATOM   4173  C  CA    . SER B 1 58  ? 66.469  -21.991 14.511  1.00 50.04  ?  58  SER B CA    1 
ATOM   4174  C  C     . SER B 1 58  ? 67.395  -20.922 13.939  1.00 48.40  ?  58  SER B C     1 
ATOM   4175  O  O     . SER B 1 58  ? 68.427  -21.235 13.326  1.00 53.61  ?  58  SER B O     1 
ATOM   4176  C  CB    . SER B 1 58  ? 66.671  -22.080 16.022  1.00 56.80  ?  58  SER B CB    1 
ATOM   4177  O  OG    . SER B 1 58  ? 65.820  -23.069 16.571  1.00 65.01  ?  58  SER B OG    1 
ATOM   4178  N  N     . TYR B 1 59  ? 67.003  -19.662 14.126  1.00 44.29  ?  59  TYR B N     1 
ATOM   4179  C  CA    . TYR B 1 59  ? 67.917  -18.544 13.919  1.00 44.16  ?  59  TYR B CA    1 
ATOM   4180  C  C     . TYR B 1 59  ? 68.927  -18.514 15.067  1.00 50.55  ?  59  TYR B C     1 
ATOM   4181  O  O     . TYR B 1 59  ? 68.623  -18.904 16.203  1.00 57.46  ?  59  TYR B O     1 
ATOM   4182  C  CB    . TYR B 1 59  ? 67.178  -17.206 13.822  1.00 45.20  ?  59  TYR B CB    1 
ATOM   4183  C  CG    . TYR B 1 59  ? 66.408  -16.987 12.531  1.00 46.49  ?  59  TYR B CG    1 
ATOM   4184  C  CD1   . TYR B 1 59  ? 65.108  -17.435 12.395  1.00 51.07  ?  59  TYR B CD1   1 
ATOM   4185  C  CD2   . TYR B 1 59  ? 66.978  -16.309 11.461  1.00 46.68  ?  59  TYR B CD2   1 
ATOM   4186  C  CE1   . TYR B 1 59  ? 64.399  -17.237 11.229  1.00 53.64  ?  59  TYR B CE1   1 
ATOM   4187  C  CE2   . TYR B 1 59  ? 66.280  -16.102 10.295  1.00 50.07  ?  59  TYR B CE2   1 
ATOM   4188  C  CZ    . TYR B 1 59  ? 64.984  -16.572 10.177  1.00 53.16  ?  59  TYR B CZ    1 
ATOM   4189  O  OH    . TYR B 1 59  ? 64.265  -16.379 9.003   1.00 54.31  ?  59  TYR B OH    1 
ATOM   4190  N  N     . ARG B 1 60  ? 70.128  -18.046 14.761  1.00 47.41  ?  60  ARG B N     1 
ATOM   4191  C  CA    . ARG B 1 60  ? 71.232  -18.052 15.708  1.00 43.46  ?  60  ARG B CA    1 
ATOM   4192  C  C     . ARG B 1 60  ? 71.757  -16.610 15.804  1.00 41.76  ?  60  ARG B C     1 
ATOM   4193  O  O     . ARG B 1 60  ? 71.918  -15.920 14.788  1.00 40.07  ?  60  ARG B O     1 
ATOM   4194  C  CB    . ARG B 1 60  ? 72.287  -19.080 15.247  1.00 41.02  ?  60  ARG B CB    1 
ATOM   4195  C  CG    . ARG B 1 60  ? 73.629  -19.131 15.994  1.00 44.11  ?  60  ARG B CG    1 
ATOM   4196  C  CD    . ARG B 1 60  ? 74.759  -19.670 15.077  1.00 72.62  ?  60  ARG B CD    1 
ATOM   4197  N  NE    . ARG B 1 60  ? 75.366  -20.937 15.498  1.00 71.86  ?  60  ARG B NE    1 
ATOM   4198  C  CZ    . ARG B 1 60  ? 74.708  -22.089 15.654  1.00 71.31  ?  60  ARG B CZ    1 
ATOM   4199  N  NH1   . ARG B 1 60  ? 73.394  -22.156 15.448  1.00 70.23  ?  60  ARG B NH1   1 
ATOM   4200  N  NH2   . ARG B 1 60  ? 75.368  -23.181 16.037  1.00 69.67  ?  60  ARG B NH2   1 
ATOM   4201  N  N     . LYS B 1 61  ? 71.961  -16.138 17.028  1.00 38.96  ?  61  LYS B N     1 
ATOM   4202  C  CA    . LYS B 1 61  ? 72.364  -14.753 17.250  1.00 37.72  ?  61  LYS B CA    1 
ATOM   4203  C  C     . LYS B 1 61  ? 73.531  -14.419 16.326  1.00 35.47  ?  61  LYS B C     1 
ATOM   4204  O  O     . LYS B 1 61  ? 74.500  -15.176 16.244  1.00 34.96  ?  61  LYS B O     1 
ATOM   4205  C  CB    . LYS B 1 61  ? 72.724  -14.545 18.720  1.00 46.67  ?  61  LYS B CB    1 
ATOM   4206  C  CG    . LYS B 1 61  ? 73.050  -13.110 19.089  1.00 58.66  ?  61  LYS B CG    1 
ATOM   4207  C  CD    . LYS B 1 61  ? 71.793  -12.271 19.232  1.00 67.32  ?  61  LYS B CD    1 
ATOM   4208  C  CE    . LYS B 1 61  ? 70.867  -12.839 20.297  1.00 71.27  ?  61  LYS B CE    1 
ATOM   4209  N  NZ    . LYS B 1 61  ? 69.526  -12.182 20.231  1.00 73.33  ?  61  LYS B NZ    1 
ATOM   4210  N  N     . SER B 1 62  ? 73.432  -13.306 15.606  1.00 38.01  ?  62  SER B N     1 
ATOM   4211  C  CA    . SER B 1 62  ? 74.404  -12.998 14.547  1.00 43.29  ?  62  SER B CA    1 
ATOM   4212  C  C     . SER B 1 62  ? 75.840  -12.953 15.037  1.00 42.60  ?  62  SER B C     1 
ATOM   4213  O  O     . SER B 1 62  ? 76.748  -13.476 14.379  1.00 42.90  ?  62  SER B O     1 
ATOM   4214  C  CB    . SER B 1 62  ? 74.078  -11.678 13.843  1.00 46.78  ?  62  SER B CB    1 
ATOM   4215  O  OG    . SER B 1 62  ? 73.048  -11.835 12.883  1.00 45.80  ?  62  SER B OG    1 
ATOM   4216  N  N     . ALA B 1 63  ? 76.044  -12.323 16.190  1.00 37.77  ?  63  ALA B N     1 
ATOM   4217  C  CA    . ALA B 1 63  ? 77.386  -12.193 16.747  1.00 37.26  ?  63  ALA B CA    1 
ATOM   4218  C  C     . ALA B 1 63  ? 78.067  -13.542 16.969  1.00 41.21  ?  63  ALA B C     1 
ATOM   4219  O  O     . ALA B 1 63  ? 79.292  -13.637 16.939  1.00 43.68  ?  63  ALA B O     1 
ATOM   4220  C  CB    . ALA B 1 63  ? 77.344  -11.424 18.019  1.00 40.34  ?  63  ALA B CB    1 
ATOM   4221  N  N     . LYS B 1 64  ? 77.270  -14.582 17.170  1.00 30.23  ?  64  LYS B N     1 
ATOM   4222  C  CA    . LYS B 1 64  ? 77.807  -15.904 17.411  1.00 32.14  ?  64  LYS B CA    1 
ATOM   4223  C  C     . LYS B 1 64  ? 78.393  -16.477 16.125  1.00 33.14  ?  64  LYS B C     1 
ATOM   4224  O  O     . LYS B 1 64  ? 79.424  -17.157 16.152  1.00 29.94  ?  64  LYS B O     1 
ATOM   4225  C  CB    . LYS B 1 64  ? 76.725  -16.832 17.977  1.00 31.48  ?  64  LYS B CB    1 
ATOM   4226  C  CG    . LYS B 1 64  ? 77.258  -18.165 18.507  1.00 37.45  ?  64  LYS B CG    1 
ATOM   4227  C  CD    . LYS B 1 64  ? 76.145  -19.099 18.895  1.00 42.14  ?  64  LYS B CD    1 
ATOM   4228  C  CE    . LYS B 1 64  ? 76.652  -20.523 19.046  1.00 52.52  ?  64  LYS B CE    1 
ATOM   4229  N  NZ    . LYS B 1 64  ? 75.541  -21.436 19.480  1.00 59.86  ?  64  LYS B NZ    1 
ATOM   4230  N  N     . SER B 1 65  ? 77.735  -16.195 15.002  1.00 30.69  ?  65  SER B N     1 
ATOM   4231  C  CA    . SER B 1 65  ? 78.188  -16.688 13.714  1.00 33.36  ?  65  SER B CA    1 
ATOM   4232  C  C     . SER B 1 65  ? 79.429  -15.916 13.306  1.00 33.77  ?  65  SER B C     1 
ATOM   4233  O  O     . SER B 1 65  ? 80.430  -16.498 12.887  1.00 32.82  ?  65  SER B O     1 
ATOM   4234  C  CB    . SER B 1 65  ? 77.095  -16.529 12.657  1.00 40.05  ?  65  SER B CB    1 
ATOM   4235  O  OG    . SER B 1 65  ? 75.829  -17.007 13.100  1.00 46.73  ?  65  SER B OG    1 
ATOM   4236  N  N     . VAL B 1 66  ? 79.365  -14.596 13.436  1.00 34.72  ?  66  VAL B N     1 
ATOM   4237  C  CA    . VAL B 1 66  ? 80.504  -13.761 13.074  1.00 35.12  ?  66  VAL B CA    1 
ATOM   4238  C  C     . VAL B 1 66  ? 81.779  -14.159 13.812  1.00 33.92  ?  66  VAL B C     1 
ATOM   4239  O  O     . VAL B 1 66  ? 82.815  -14.364 13.187  1.00 33.38  ?  66  VAL B O     1 
ATOM   4240  C  CB    . VAL B 1 66  ? 80.234  -12.266 13.315  1.00 35.33  ?  66  VAL B CB    1 
ATOM   4241  C  CG1   . VAL B 1 66  ? 81.556  -11.511 13.445  1.00 27.99  ?  66  VAL B CG1   1 
ATOM   4242  C  CG2   . VAL B 1 66  ? 79.397  -11.696 12.184  1.00 26.75  ?  66  VAL B CG2   1 
ATOM   4243  N  N     . GLY B 1 67  ? 81.696  -14.265 15.137  1.00 29.14  ?  67  GLY B N     1 
ATOM   4244  C  CA    . GLY B 1 67  ? 82.849  -14.580 15.948  1.00 30.26  ?  67  GLY B CA    1 
ATOM   4245  C  C     . GLY B 1 67  ? 83.450  -15.927 15.623  1.00 38.27  ?  67  GLY B C     1 
ATOM   4246  O  O     . GLY B 1 67  ? 84.669  -16.084 15.614  1.00 35.49  ?  67  GLY B O     1 
ATOM   4247  N  N     . ASN B 1 68  ? 82.595  -16.908 15.365  1.00 30.06  ?  68  ASN B N     1 
ATOM   4248  C  CA    . ASN B 1 68  ? 83.058  -18.214 14.901  1.00 36.13  ?  68  ASN B CA    1 
ATOM   4249  C  C     . ASN B 1 68  ? 83.790  -18.178 13.553  1.00 39.81  ?  68  ASN B C     1 
ATOM   4250  O  O     . ASN B 1 68  ? 84.818  -18.837 13.384  1.00 47.27  ?  68  ASN B O     1 
ATOM   4251  C  CB    . ASN B 1 68  ? 81.893  -19.192 14.797  1.00 35.42  ?  68  ASN B CB    1 
ATOM   4252  C  CG    . ASN B 1 68  ? 81.526  -19.800 16.110  1.00 42.74  ?  68  ASN B CG    1 
ATOM   4253  O  OD1   . ASN B 1 68  ? 82.300  -19.773 17.054  1.00 49.79  ?  68  ASN B OD1   1 
ATOM   4254  N  ND2   . ASN B 1 68  ? 80.339  -20.377 16.177  1.00 45.92  ?  68  ASN B ND2   1 
ATOM   4255  N  N     . ILE B 1 69  ? 83.234  -17.440 12.592  1.00 34.63  ?  69  ILE B N     1 
ATOM   4256  C  CA    . ILE B 1 69  ? 83.883  -17.196 11.306  1.00 29.84  ?  69  ILE B CA    1 
ATOM   4257  C  C     . ILE B 1 69  ? 85.277  -16.588 11.486  1.00 30.56  ?  69  ILE B C     1 
ATOM   4258  O  O     . ILE B 1 69  ? 86.264  -17.051 10.916  1.00 31.72  ?  69  ILE B O     1 
ATOM   4259  C  CB    . ILE B 1 69  ? 83.052  -16.227 10.479  1.00 31.31  ?  69  ILE B CB    1 
ATOM   4260  C  CG1   . ILE B 1 69  ? 81.754  -16.893 10.026  1.00 26.11  ?  69  ILE B CG1   1 
ATOM   4261  C  CG2   . ILE B 1 69  ? 83.851  -15.743 9.297   1.00 26.48  ?  69  ILE B CG2   1 
ATOM   4262  C  CD1   . ILE B 1 69  ? 80.737  -15.928 9.517   1.00 25.47  ?  69  ILE B CD1   1 
ATOM   4263  N  N     . MET B 1 70  ? 85.336  -15.555 12.313  1.00 30.15  ?  70  MET B N     1 
ATOM   4264  C  CA    . MET B 1 70  ? 86.570  -14.860 12.637  1.00 30.93  ?  70  MET B CA    1 
ATOM   4265  C  C     . MET B 1 70  ? 87.613  -15.726 13.351  1.00 36.39  ?  70  MET B C     1 
ATOM   4266  O  O     . MET B 1 70  ? 88.813  -15.519 13.190  1.00 44.37  ?  70  MET B O     1 
ATOM   4267  C  CB    . MET B 1 70  ? 86.228  -13.645 13.486  1.00 30.26  ?  70  MET B CB    1 
ATOM   4268  C  CG    . MET B 1 70  ? 87.400  -12.809 13.918  1.00 36.44  ?  70  MET B CG    1 
ATOM   4269  S  SD    . MET B 1 70  ? 86.799  -11.337 14.770  1.00 73.88  ?  70  MET B SD    1 
ATOM   4270  C  CE    . MET B 1 70  ? 85.136  -11.256 14.089  1.00 30.11  ?  70  MET B CE    1 
ATOM   4271  N  N     . GLY B 1 71  ? 87.173  -16.694 14.142  1.00 32.88  ?  71  GLY B N     1 
ATOM   4272  C  CA    . GLY B 1 71  ? 88.105  -17.503 14.912  1.00 33.37  ?  71  GLY B CA    1 
ATOM   4273  C  C     . GLY B 1 71  ? 88.585  -18.706 14.137  1.00 43.86  ?  71  GLY B C     1 
ATOM   4274  O  O     . GLY B 1 71  ? 89.656  -19.254 14.390  1.00 49.16  ?  71  GLY B O     1 
ATOM   4275  N  N     . ASN B 1 72  ? 87.785  -19.125 13.170  1.00 40.72  ?  72  ASN B N     1 
ATOM   4276  C  CA    . ASN B 1 72  ? 88.107  -20.331 12.425  1.00 43.50  ?  72  ASN B CA    1 
ATOM   4277  C  C     . ASN B 1 72  ? 88.584  -20.120 10.994  1.00 40.33  ?  72  ASN B C     1 
ATOM   4278  O  O     . ASN B 1 72  ? 89.407  -20.895 10.528  1.00 43.93  ?  72  ASN B O     1 
ATOM   4279  C  CB    . ASN B 1 72  ? 86.940  -21.312 12.471  1.00 49.81  ?  72  ASN B CB    1 
ATOM   4280  C  CG    . ASN B 1 72  ? 86.514  -21.632 13.887  1.00 53.28  ?  72  ASN B CG    1 
ATOM   4281  O  OD1   . ASN B 1 72  ? 87.342  -21.666 14.806  1.00 50.57  ?  72  ASN B OD1   1 
ATOM   4282  N  ND2   . ASN B 1 72  ? 85.214  -21.862 14.077  1.00 55.81  ?  72  ASN B ND2   1 
ATOM   4283  N  N     . PHE B 1 73  ? 88.104  -19.086 10.301  1.00 35.72  ?  73  PHE B N     1 
ATOM   4284  C  CA    . PHE B 1 73  ? 88.404  -18.975 8.864   1.00 32.37  ?  73  PHE B CA    1 
ATOM   4285  C  C     . PHE B 1 73  ? 88.891  -17.630 8.348   1.00 35.92  ?  73  PHE B C     1 
ATOM   4286  O  O     . PHE B 1 73  ? 89.826  -17.569 7.553   1.00 43.44  ?  73  PHE B O     1 
ATOM   4287  C  CB    . PHE B 1 73  ? 87.203  -19.432 8.042   1.00 28.64  ?  73  PHE B CB    1 
ATOM   4288  C  CG    . PHE B 1 73  ? 86.676  -20.750 8.470   1.00 34.47  ?  73  PHE B CG    1 
ATOM   4289  C  CD1   . PHE B 1 73  ? 85.526  -20.832 9.254   1.00 30.84  ?  73  PHE B CD1   1 
ATOM   4290  C  CD2   . PHE B 1 73  ? 87.367  -21.911 8.157   1.00 29.69  ?  73  PHE B CD2   1 
ATOM   4291  C  CE1   . PHE B 1 73  ? 85.041  -22.055 9.677   1.00 34.46  ?  73  PHE B CE1   1 
ATOM   4292  C  CE2   . PHE B 1 73  ? 86.900  -23.131 8.580   1.00 30.14  ?  73  PHE B CE2   1 
ATOM   4293  C  CZ    . PHE B 1 73  ? 85.723  -23.205 9.341   1.00 40.76  ?  73  PHE B CZ    1 
ATOM   4294  N  N     . HIS B 1 74  ? 88.251  -16.565 8.801   1.00 34.72  ?  74  HIS B N     1 
ATOM   4295  C  CA    . HIS B 1 74  ? 88.475  -15.244 8.254   1.00 39.03  ?  74  HIS B CA    1 
ATOM   4296  C  C     . HIS B 1 74  ? 89.149  -14.369 9.276   1.00 42.18  ?  74  HIS B C     1 
ATOM   4297  O  O     . HIS B 1 74  ? 88.511  -13.876 10.200  1.00 45.46  ?  74  HIS B O     1 
ATOM   4298  C  CB    . HIS B 1 74  ? 87.144  -14.614 7.877   1.00 39.04  ?  74  HIS B CB    1 
ATOM   4299  C  CG    . HIS B 1 74  ? 87.258  -13.515 6.869   1.00 36.75  ?  74  HIS B CG    1 
ATOM   4300  N  ND1   . HIS B 1 74  ? 87.703  -13.728 5.583   1.00 35.01  ?  74  HIS B ND1   1 
ATOM   4301  C  CD2   . HIS B 1 74  ? 86.970  -12.194 6.955   1.00 35.07  ?  74  HIS B CD2   1 
ATOM   4302  C  CE1   . HIS B 1 74  ? 87.688  -12.584 4.921   1.00 33.60  ?  74  HIS B CE1   1 
ATOM   4303  N  NE2   . HIS B 1 74  ? 87.244  -11.641 5.728   1.00 32.26  ?  74  HIS B NE2   1 
ATOM   4304  N  N     . PRO B 1 75  ? 90.448  -14.154 9.103   1.00 45.22  ?  75  PRO B N     1 
ATOM   4305  C  CA    . PRO B 1 75  ? 91.274  -13.406 10.048  1.00 48.17  ?  75  PRO B CA    1 
ATOM   4306  C  C     . PRO B 1 75  ? 91.131  -11.900 9.864   1.00 47.38  ?  75  PRO B C     1 
ATOM   4307  O  O     . PRO B 1 75  ? 92.136  -11.217 9.697   1.00 51.18  ?  75  PRO B O     1 
ATOM   4308  C  CB    . PRO B 1 75  ? 92.680  -13.827 9.643   1.00 50.67  ?  75  PRO B CB    1 
ATOM   4309  C  CG    . PRO B 1 75  ? 92.565  -13.962 8.144   1.00 50.96  ?  75  PRO B CG    1 
ATOM   4310  C  CD    . PRO B 1 75  ? 91.206  -14.558 7.907   1.00 48.81  ?  75  PRO B CD    1 
ATOM   4311  N  N     . HIS B 1 76  ? 89.910  -11.385 9.890   1.00 45.34  ?  76  HIS B N     1 
ATOM   4312  C  CA    . HIS B 1 76  ? 89.721  -9.956  9.686   1.00 47.44  ?  76  HIS B CA    1 
ATOM   4313  C  C     . HIS B 1 76  ? 88.687  -9.363  10.614  1.00 52.88  ?  76  HIS B C     1 
ATOM   4314  O  O     . HIS B 1 76  ? 88.295  -9.988  11.584  1.00 57.27  ?  76  HIS B O     1 
ATOM   4315  C  CB    . HIS B 1 76  ? 89.375  -9.669  8.236   1.00 43.87  ?  76  HIS B CB    1 
ATOM   4316  C  CG    . HIS B 1 76  ? 90.464  -10.044 7.284   1.00 46.23  ?  76  HIS B CG    1 
ATOM   4317  N  ND1   . HIS B 1 76  ? 91.554  -9.235  7.048   1.00 47.60  ?  76  HIS B ND1   1 
ATOM   4318  C  CD2   . HIS B 1 76  ? 90.644  -11.149 6.523   1.00 51.73  ?  76  HIS B CD2   1 
ATOM   4319  C  CE1   . HIS B 1 76  ? 92.352  -9.821  6.174   1.00 52.21  ?  76  HIS B CE1   1 
ATOM   4320  N  NE2   . HIS B 1 76  ? 91.823  -10.985 5.838   1.00 53.77  ?  76  HIS B NE2   1 
ATOM   4321  N  N     . GLY B 1 77  ? 88.259  -8.144  10.324  1.00 53.94  ?  77  GLY B N     1 
ATOM   4322  C  CA    . GLY B 1 77  ? 87.413  -7.426  11.254  1.00 55.50  ?  77  GLY B CA    1 
ATOM   4323  C  C     . GLY B 1 77  ? 86.066  -8.084  11.462  1.00 56.62  ?  77  GLY B C     1 
ATOM   4324  O  O     . GLY B 1 77  ? 85.463  -8.596  10.517  1.00 56.40  ?  77  GLY B O     1 
ATOM   4325  N  N     . ASP B 1 78  ? 85.585  -8.078  12.703  1.00 56.27  ?  78  ASP B N     1 
ATOM   4326  C  CA    . ASP B 1 78  ? 84.220  -8.539  12.955  1.00 57.34  ?  78  ASP B CA    1 
ATOM   4327  C  C     . ASP B 1 78  ? 83.226  -7.705  12.123  1.00 59.60  ?  78  ASP B C     1 
ATOM   4328  O  O     . ASP B 1 78  ? 82.253  -8.229  11.598  1.00 60.40  ?  78  ASP B O     1 
ATOM   4329  C  CB    . ASP B 1 78  ? 83.871  -8.614  14.474  1.00 57.38  ?  78  ASP B CB    1 
ATOM   4330  C  CG    . ASP B 1 78  ? 83.874  -7.238  15.185  1.00 66.79  ?  78  ASP B CG    1 
ATOM   4331  O  OD1   . ASP B 1 78  ? 82.790  -6.615  15.341  1.00 68.40  ?  78  ASP B OD1   1 
ATOM   4332  O  OD2   . ASP B 1 78  ? 84.958  -6.793  15.631  1.00 73.57  ?  78  ASP B OD2   1 
ATOM   4333  N  N     . SER B 1 79  ? 83.510  -6.418  11.959  1.00 58.07  ?  79  SER B N     1 
ATOM   4334  C  CA    . SER B 1 79  ? 82.595  -5.540  11.256  1.00 51.25  ?  79  SER B CA    1 
ATOM   4335  C  C     . SER B 1 79  ? 82.560  -5.811  9.758   1.00 47.70  ?  79  SER B C     1 
ATOM   4336  O  O     . SER B 1 79  ? 81.495  -5.797  9.160   1.00 53.28  ?  79  SER B O     1 
ATOM   4337  C  CB    . SER B 1 79  ? 82.920  -4.079  11.511  1.00 57.49  ?  79  SER B CB    1 
ATOM   4338  O  OG    . SER B 1 79  ? 81.925  -3.273  10.903  1.00 62.18  ?  79  SER B OG    1 
ATOM   4339  N  N     . SER B 1 80  ? 83.710  -6.054  9.139   1.00 46.86  ?  80  SER B N     1 
ATOM   4340  C  CA    . SER B 1 80  ? 83.695  -6.453  7.731   1.00 47.72  ?  80  SER B CA    1 
ATOM   4341  C  C     . SER B 1 80  ? 82.827  -7.688  7.551   1.00 38.79  ?  80  SER B C     1 
ATOM   4342  O  O     . SER B 1 80  ? 81.894  -7.681  6.750   1.00 35.00  ?  80  SER B O     1 
ATOM   4343  C  CB    . SER B 1 80  ? 85.104  -6.705  7.192   1.00 54.61  ?  80  SER B CB    1 
ATOM   4344  O  OG    . SER B 1 80  ? 85.712  -5.485  6.802   1.00 61.86  ?  80  SER B OG    1 
ATOM   4345  N  N     . ILE B 1 81  ? 83.128  -8.732  8.321   1.00 33.94  ?  81  ILE B N     1 
ATOM   4346  C  CA    . ILE B 1 81  ? 82.412  -10.004 8.243   1.00 31.66  ?  81  ILE B CA    1 
ATOM   4347  C  C     . ILE B 1 81  ? 80.896  -9.841  8.387   1.00 34.37  ?  81  ILE B C     1 
ATOM   4348  O  O     . ILE B 1 81  ? 80.113  -10.454 7.657   1.00 36.86  ?  81  ILE B O     1 
ATOM   4349  C  CB    . ILE B 1 81  ? 82.922  -10.985 9.305   1.00 26.49  ?  81  ILE B CB    1 
ATOM   4350  C  CG1   . ILE B 1 81  ? 84.441  -11.077 9.229   1.00 34.81  ?  81  ILE B CG1   1 
ATOM   4351  C  CG2   . ILE B 1 81  ? 82.280  -12.350 9.141   1.00 25.91  ?  81  ILE B CG2   1 
ATOM   4352  C  CD1   . ILE B 1 81  ? 85.027  -12.112 10.134  1.00 36.24  ?  81  ILE B CD1   1 
ATOM   4353  N  N     . TYR B 1 82  ? 80.478  -9.010  9.328   1.00 34.95  ?  82  TYR B N     1 
ATOM   4354  C  CA    . TYR B 1 82  ? 79.057  -8.821  9.560   1.00 36.38  ?  82  TYR B CA    1 
ATOM   4355  C  C     . TYR B 1 82  ? 78.399  -8.081  8.388   1.00 40.91  ?  82  TYR B C     1 
ATOM   4356  O  O     . TYR B 1 82  ? 77.329  -8.457  7.915   1.00 46.80  ?  82  TYR B O     1 
ATOM   4357  C  CB    . TYR B 1 82  ? 78.829  -8.091  10.894  1.00 36.91  ?  82  TYR B CB    1 
ATOM   4358  C  CG    . TYR B 1 82  ? 77.378  -7.845  11.211  1.00 27.27  ?  82  TYR B CG    1 
ATOM   4359  C  CD1   . TYR B 1 82  ? 76.503  -8.899  11.459  1.00 37.33  ?  82  TYR B CD1   1 
ATOM   4360  C  CD2   . TYR B 1 82  ? 76.874  -6.561  11.247  1.00 46.68  ?  82  TYR B CD2   1 
ATOM   4361  C  CE1   . TYR B 1 82  ? 75.164  -8.661  11.747  1.00 37.40  ?  82  TYR B CE1   1 
ATOM   4362  C  CE2   . TYR B 1 82  ? 75.545  -6.322  11.537  1.00 42.15  ?  82  TYR B CE2   1 
ATOM   4363  C  CZ    . TYR B 1 82  ? 74.696  -7.370  11.780  1.00 37.91  ?  82  TYR B CZ    1 
ATOM   4364  O  OH    . TYR B 1 82  ? 73.381  -7.100  12.062  1.00 35.22  ?  82  TYR B OH    1 
ATOM   4365  N  N     . ASP B 1 83  ? 79.058  -7.029  7.923   1.00 39.15  ?  83  ASP B N     1 
ATOM   4366  C  CA    . ASP B 1 83  ? 78.545  -6.211  6.839   1.00 41.95  ?  83  ASP B CA    1 
ATOM   4367  C  C     . ASP B 1 83  ? 78.290  -7.075  5.606   1.00 40.39  ?  83  ASP B C     1 
ATOM   4368  O  O     . ASP B 1 83  ? 77.270  -6.930  4.903   1.00 38.84  ?  83  ASP B O     1 
ATOM   4369  C  CB    . ASP B 1 83  ? 79.556  -5.111  6.512   1.00 48.53  ?  83  ASP B CB    1 
ATOM   4370  C  CG    . ASP B 1 83  ? 79.390  -3.881  7.386   1.00 56.66  ?  83  ASP B CG    1 
ATOM   4371  O  OD1   . ASP B 1 83  ? 78.598  -3.931  8.361   1.00 59.92  ?  83  ASP B OD1   1 
ATOM   4372  O  OD2   . ASP B 1 83  ? 80.063  -2.863  7.091   1.00 58.16  ?  83  ASP B OD2   1 
ATOM   4373  N  N     . ALA B 1 84  ? 79.242  -7.967  5.349   1.00 33.51  ?  84  ALA B N     1 
ATOM   4374  C  CA    . ALA B 1 84  ? 79.145  -8.898  4.253   1.00 30.53  ?  84  ALA B CA    1 
ATOM   4375  C  C     . ALA B 1 84  ? 77.935  -9.780  4.463   1.00 36.38  ?  84  ALA B C     1 
ATOM   4376  O  O     . ALA B 1 84  ? 77.094  -9.911  3.572   1.00 43.10  ?  84  ALA B O     1 
ATOM   4377  C  CB    . ALA B 1 84  ? 80.371  -9.732  4.203   1.00 25.03  ?  84  ALA B CB    1 
ATOM   4378  N  N     . MET B 1 85  ? 77.864  -10.382 5.651   1.00 34.58  ?  85  MET B N     1 
ATOM   4379  C  CA    . MET B 1 85  ? 76.753  -11.250 6.055   1.00 32.17  ?  85  MET B CA    1 
ATOM   4380  C  C     . MET B 1 85  ? 75.394  -10.551 5.933   1.00 29.81  ?  85  MET B C     1 
ATOM   4381  O  O     . MET B 1 85  ? 74.444  -11.124 5.420   1.00 26.43  ?  85  MET B O     1 
ATOM   4382  C  CB    . MET B 1 85  ? 76.986  -11.790 7.474   1.00 28.22  ?  85  MET B CB    1 
ATOM   4383  C  CG    . MET B 1 85  ? 75.950  -12.803 7.943   1.00 28.46  ?  85  MET B CG    1 
ATOM   4384  S  SD    . MET B 1 85  ? 76.081  -13.221 9.706   1.00 35.80  ?  85  MET B SD    1 
ATOM   4385  N  N     . VAL B 1 86  ? 75.312  -9.304  6.385   1.00 29.85  ?  86  VAL B N     1 
ATOM   4386  C  CA    . VAL B 1 86  ? 74.094  -8.520  6.217   1.00 26.27  ?  86  VAL B CA    1 
ATOM   4387  C  C     . VAL B 1 86  ? 73.696  -8.393  4.757   1.00 26.35  ?  86  VAL B C     1 
ATOM   4388  O  O     . VAL B 1 86  ? 72.557  -8.674  4.402   1.00 26.70  ?  86  VAL B O     1 
ATOM   4389  C  CB    . VAL B 1 86  ? 74.205  -7.116  6.854   1.00 27.01  ?  86  VAL B CB    1 
ATOM   4390  C  CG1   . VAL B 1 86  ? 73.026  -6.263  6.466   1.00 27.90  ?  86  VAL B CG1   1 
ATOM   4391  C  CG2   . VAL B 1 86  ? 74.256  -7.227  8.351   1.00 37.21  ?  86  VAL B CG2   1 
ATOM   4392  N  N     . ARG B 1 87  ? 74.632  -7.977  3.907   1.00 26.92  ?  87  ARG B N     1 
ATOM   4393  C  CA    . ARG B 1 87  ? 74.339  -7.829  2.474   1.00 30.26  ?  87  ARG B CA    1 
ATOM   4394  C  C     . ARG B 1 87  ? 73.766  -9.106  1.875   1.00 32.11  ?  87  ARG B C     1 
ATOM   4395  O  O     . ARG B 1 87  ? 72.789  -9.047  1.142   1.00 34.49  ?  87  ARG B O     1 
ATOM   4396  C  CB    . ARG B 1 87  ? 75.573  -7.401  1.686   1.00 32.56  ?  87  ARG B CB    1 
ATOM   4397  C  CG    . ARG B 1 87  ? 75.281  -6.842  0.296   1.00 34.15  ?  87  ARG B CG    1 
ATOM   4398  C  CD    . ARG B 1 87  ? 76.576  -6.591  -0.518  1.00 43.42  ?  87  ARG B CD    1 
ATOM   4399  N  NE    . ARG B 1 87  ? 76.323  -5.992  -1.830  1.00 43.98  ?  87  ARG B NE    1 
ATOM   4400  C  CZ    . ARG B 1 87  ? 76.044  -6.679  -2.936  1.00 45.84  ?  87  ARG B CZ    1 
ATOM   4401  N  NH1   . ARG B 1 87  ? 75.980  -7.998  -2.898  1.00 47.04  ?  87  ARG B NH1   1 
ATOM   4402  N  NH2   . ARG B 1 87  ? 75.824  -6.047  -4.084  1.00 46.35  ?  87  ARG B NH2   1 
ATOM   4403  N  N     . MET B 1 88  ? 74.360  -10.258 2.190   1.00 25.31  ?  88  MET B N     1 
ATOM   4404  C  CA    . MET B 1 88  ? 73.877  -11.516 1.639   1.00 34.98  ?  88  MET B CA    1 
ATOM   4405  C  C     . MET B 1 88  ? 72.407  -11.752 1.946   1.00 32.89  ?  88  MET B C     1 
ATOM   4406  O  O     . MET B 1 88  ? 71.775  -12.611 1.322   1.00 40.16  ?  88  MET B O     1 
ATOM   4407  C  CB    . MET B 1 88  ? 74.697  -12.702 2.135   1.00 24.38  ?  88  MET B CB    1 
ATOM   4408  C  CG    . MET B 1 88  ? 76.201  -12.537 2.000   1.00 24.06  ?  88  MET B CG    1 
ATOM   4409  S  SD    . MET B 1 88  ? 77.046  -14.125 1.857   1.00 30.68  ?  88  MET B SD    1 
ATOM   4410  C  CE    . MET B 1 88  ? 78.382  -13.847 3.005   1.00 64.72  ?  88  MET B CE    1 
ATOM   4411  N  N     . SER B 1 89  ? 71.864  -10.973 2.882   1.00 32.93  ?  89  SER B N     1 
ATOM   4412  C  CA    . SER B 1 89  ? 70.504  -11.176 3.369   1.00 36.93  ?  89  SER B CA    1 
ATOM   4413  C  C     . SER B 1 89  ? 69.511  -10.144 2.883   1.00 37.32  ?  89  SER B C     1 
ATOM   4414  O  O     . SER B 1 89  ? 68.315  -10.261 3.168   1.00 35.69  ?  89  SER B O     1 
ATOM   4415  C  CB    . SER B 1 89  ? 70.483  -11.189 4.904   1.00 42.35  ?  89  SER B CB    1 
ATOM   4416  O  OG    . SER B 1 89  ? 70.435  -9.885  5.474   1.00 45.27  ?  89  SER B OG    1 
ATOM   4417  N  N     . GLN B 1 90  ? 70.001  -9.119  2.185   1.00 41.94  ?  90  GLN B N     1 
ATOM   4418  C  CA    . GLN B 1 90  ? 69.118  -8.074  1.641   1.00 44.29  ?  90  GLN B CA    1 
ATOM   4419  C  C     . GLN B 1 90  ? 68.581  -8.437  0.262   1.00 45.68  ?  90  GLN B C     1 
ATOM   4420  O  O     . GLN B 1 90  ? 69.335  -8.653  -0.686  1.00 40.78  ?  90  GLN B O     1 
ATOM   4421  C  CB    . GLN B 1 90  ? 69.799  -6.704  1.601   1.00 37.17  ?  90  GLN B CB    1 
ATOM   4422  C  CG    . GLN B 1 90  ? 71.225  -6.692  2.093   1.00 33.30  ?  90  GLN B CG    1 
ATOM   4423  C  CD    . GLN B 1 90  ? 71.581  -5.371  2.720   1.00 34.95  ?  90  GLN B CD    1 
ATOM   4424  O  OE1   . GLN B 1 90  ? 70.839  -4.874  3.562   1.00 34.40  ?  90  GLN B OE1   1 
ATOM   4425  N  NE2   . GLN B 1 90  ? 72.709  -4.782  2.307   1.00 36.25  ?  90  GLN B NE2   1 
ATOM   4426  N  N     . ASN B 1 91  ? 67.263  -8.510  0.161   1.00 46.03  ?  91  ASN B N     1 
ATOM   4427  C  CA    . ASN B 1 91  ? 66.657  -9.021  -1.051  1.00 46.39  ?  91  ASN B CA    1 
ATOM   4428  C  C     . ASN B 1 91  ? 66.519  -7.961  -2.123  1.00 45.41  ?  91  ASN B C     1 
ATOM   4429  O  O     . ASN B 1 91  ? 65.888  -8.190  -3.146  1.00 50.68  ?  91  ASN B O     1 
ATOM   4430  C  CB    . ASN B 1 91  ? 65.312  -9.666  -0.753  1.00 52.59  ?  91  ASN B CB    1 
ATOM   4431  C  CG    . ASN B 1 91  ? 64.231  -8.660  -0.515  1.00 57.63  ?  91  ASN B CG    1 
ATOM   4432  O  OD1   . ASN B 1 91  ? 64.481  -7.559  -0.022  1.00 59.13  ?  91  ASN B OD1   1 
ATOM   4433  N  ND2   . ASN B 1 91  ? 63.009  -9.026  -0.871  1.00 60.98  ?  91  ASN B ND2   1 
ATOM   4434  N  N     . TRP B 1 92  ? 67.114  -6.800  -1.882  1.00 41.49  ?  92  TRP B N     1 
ATOM   4435  C  CA    . TRP B 1 92  ? 67.199  -5.774  -2.900  1.00 34.08  ?  92  TRP B CA    1 
ATOM   4436  C  C     . TRP B 1 92  ? 68.621  -5.654  -3.441  1.00 33.15  ?  92  TRP B C     1 
ATOM   4437  O  O     . TRP B 1 92  ? 68.891  -4.802  -4.284  1.00 46.50  ?  92  TRP B O     1 
ATOM   4438  C  CB    . TRP B 1 92  ? 66.692  -4.430  -2.377  1.00 35.45  ?  92  TRP B CB    1 
ATOM   4439  C  CG    . TRP B 1 92  ? 67.525  -3.846  -1.292  1.00 49.74  ?  92  TRP B CG    1 
ATOM   4440  C  CD1   . TRP B 1 92  ? 68.571  -2.985  -1.431  1.00 51.47  ?  92  TRP B CD1   1 
ATOM   4441  C  CD2   . TRP B 1 92  ? 67.383  -4.081  0.108   1.00 46.22  ?  92  TRP B CD2   1 
ATOM   4442  N  NE1   . TRP B 1 92  ? 69.099  -2.669  -0.198  1.00 49.12  ?  92  TRP B NE1   1 
ATOM   4443  C  CE2   . TRP B 1 92  ? 68.383  -3.328  0.763   1.00 43.84  ?  92  TRP B CE2   1 
ATOM   4444  C  CE3   . TRP B 1 92  ? 66.519  -4.861  0.874   1.00 44.67  ?  92  TRP B CE3   1 
ATOM   4445  C  CZ2   . TRP B 1 92  ? 68.528  -3.329  2.136   1.00 39.66  ?  92  TRP B CZ2   1 
ATOM   4446  C  CZ3   . TRP B 1 92  ? 66.666  -4.855  2.228   1.00 43.80  ?  92  TRP B CZ3   1 
ATOM   4447  C  CH2   . TRP B 1 92  ? 67.666  -4.097  2.852   1.00 39.46  ?  92  TRP B CH2   1 
ATOM   4448  N  N     . LYS B 1 93  ? 69.526  -6.504  -2.958  1.00 35.92  ?  93  LYS B N     1 
ATOM   4449  C  CA    . LYS B 1 93  ? 70.881  -6.582  -3.517  1.00 35.64  ?  93  LYS B CA    1 
ATOM   4450  C  C     . LYS B 1 93  ? 71.133  -7.951  -4.140  1.00 35.15  ?  93  LYS B C     1 
ATOM   4451  O  O     . LYS B 1 93  ? 71.767  -8.073  -5.191  1.00 36.76  ?  93  LYS B O     1 
ATOM   4452  C  CB    . LYS B 1 93  ? 71.963  -6.248  -2.479  1.00 37.84  ?  93  LYS B CB    1 
ATOM   4453  C  CG    . LYS B 1 93  ? 71.839  -4.854  -1.862  1.00 43.40  ?  93  LYS B CG    1 
ATOM   4454  C  CD    . LYS B 1 93  ? 73.097  -4.020  -2.044  1.00 47.92  ?  93  LYS B CD    1 
ATOM   4455  C  CE    . LYS B 1 93  ? 72.742  -2.587  -2.434  1.00 56.12  ?  93  LYS B CE    1 
ATOM   4456  N  NZ    . LYS B 1 93  ? 73.927  -1.768  -2.846  1.00 59.29  ?  93  LYS B NZ    1 
ATOM   4457  N  N     . ASN B 1 94  ? 70.620  -8.994  -3.511  1.00 35.01  ?  94  ASN B N     1 
ATOM   4458  C  CA    . ASN B 1 94  ? 70.744  -10.306 -4.126  1.00 36.52  ?  94  ASN B CA    1 
ATOM   4459  C  C     . ASN B 1 94  ? 69.444  -10.750 -4.781  1.00 40.68  ?  94  ASN B C     1 
ATOM   4460  O  O     . ASN B 1 94  ? 68.360  -10.526 -4.244  1.00 43.36  ?  94  ASN B O     1 
ATOM   4461  C  CB    . ASN B 1 94  ? 71.303  -11.335 -3.137  1.00 38.20  ?  94  ASN B CB    1 
ATOM   4462  C  CG    . ASN B 1 94  ? 72.753  -11.030 -2.742  1.00 43.27  ?  94  ASN B CG    1 
ATOM   4463  O  OD1   . ASN B 1 94  ? 73.018  -10.445 -1.695  1.00 45.29  ?  94  ASN B OD1   1 
ATOM   4464  N  ND2   . ASN B 1 94  ? 73.693  -11.404 -3.602  1.00 44.28  ?  94  ASN B ND2   1 
ATOM   4465  N  N     . ARG B 1 95  ? 69.557  -11.321 -5.976  1.00 42.43  ?  95  ARG B N     1 
ATOM   4466  C  CA    . ARG B 1 95  ? 68.393  -11.848 -6.682  1.00 43.71  ?  95  ARG B CA    1 
ATOM   4467  C  C     . ARG B 1 95  ? 67.840  -12.989 -5.862  1.00 44.99  ?  95  ARG B C     1 
ATOM   4468  O  O     . ARG B 1 95  ? 66.628  -13.143 -5.709  1.00 50.13  ?  95  ARG B O     1 
ATOM   4469  C  CB    . ARG B 1 95  ? 68.779  -12.375 -8.063  1.00 44.09  ?  95  ARG B CB    1 
ATOM   4470  C  CG    . ARG B 1 95  ? 67.585  -12.829 -8.872  1.00 32.83  ?  95  ARG B CG    1 
ATOM   4471  C  CD    . ARG B 1 95  ? 66.594  -11.688 -8.980  1.00 34.45  ?  95  ARG B CD    1 
ATOM   4472  N  NE    . ARG B 1 95  ? 65.467  -12.020 -9.838  1.00 44.47  ?  95  ARG B NE    1 
ATOM   4473  C  CZ    . ARG B 1 95  ? 64.438  -12.782 -9.470  1.00 44.12  ?  95  ARG B CZ    1 
ATOM   4474  N  NH1   . ARG B 1 95  ? 64.400  -13.307 -8.261  1.00 38.25  ?  95  ARG B NH1   1 
ATOM   4475  N  NH2   . ARG B 1 95  ? 63.446  -13.027 -10.314 1.00 52.06  ?  95  ARG B NH2   1 
ATOM   4476  N  N     . GLU B 1 96  ? 68.763  -13.774 -5.319  1.00 42.45  ?  96  GLU B N     1 
ATOM   4477  C  CA    . GLU B 1 96  ? 68.435  -14.952 -4.540  1.00 44.86  ?  96  GLU B CA    1 
ATOM   4478  C  C     . GLU B 1 96  ? 69.233  -14.962 -3.210  1.00 37.61  ?  96  GLU B C     1 
ATOM   4479  O  O     . GLU B 1 96  ? 70.344  -15.491 -3.158  1.00 34.24  ?  96  GLU B O     1 
ATOM   4480  C  CB    . GLU B 1 96  ? 68.745  -16.193 -5.390  1.00 48.76  ?  96  GLU B CB    1 
ATOM   4481  C  CG    . GLU B 1 96  ? 67.633  -17.228 -5.457  1.00 60.00  ?  96  GLU B CG    1 
ATOM   4482  C  CD    . GLU B 1 96  ? 66.473  -16.815 -6.345  1.00 73.52  ?  96  GLU B CD    1 
ATOM   4483  O  OE1   . GLU B 1 96  ? 66.659  -15.899 -7.168  1.00 78.80  ?  96  GLU B OE1   1 
ATOM   4484  O  OE2   . GLU B 1 96  ? 65.377  -17.409 -6.223  1.00 77.57  ?  96  GLU B OE2   1 
ATOM   4485  N  N     . ILE B 1 97  ? 68.679  -14.390 -2.136  1.00 37.53  ?  97  ILE B N     1 
ATOM   4486  C  CA    . ILE B 1 97  ? 69.485  -14.197 -0.913  1.00 35.65  ?  97  ILE B CA    1 
ATOM   4487  C  C     . ILE B 1 97  ? 69.979  -15.493 -0.292  1.00 36.03  ?  97  ILE B C     1 
ATOM   4488  O  O     . ILE B 1 97  ? 69.240  -16.479 -0.219  1.00 33.68  ?  97  ILE B O     1 
ATOM   4489  C  CB    . ILE B 1 97  ? 68.770  -13.410 0.198   1.00 34.29  ?  97  ILE B CB    1 
ATOM   4490  C  CG1   . ILE B 1 97  ? 67.760  -14.307 0.911   1.00 35.67  ?  97  ILE B CG1   1 
ATOM   4491  C  CG2   . ILE B 1 97  ? 68.147  -12.127 -0.334  1.00 37.28  ?  97  ILE B CG2   1 
ATOM   4492  C  CD1   . ILE B 1 97  ? 66.865  -13.544 1.820   1.00 39.61  ?  97  ILE B CD1   1 
ATOM   4493  N  N     . LEU B 1 98  ? 71.227  -15.451 0.177   1.00 36.18  ?  98  LEU B N     1 
ATOM   4494  C  CA    . LEU B 1 98  ? 71.945  -16.621 0.677   1.00 36.47  ?  98  LEU B CA    1 
ATOM   4495  C  C     . LEU B 1 98  ? 71.900  -16.723 2.191   1.00 37.58  ?  98  LEU B C     1 
ATOM   4496  O  O     . LEU B 1 98  ? 72.205  -17.766 2.760   1.00 36.39  ?  98  LEU B O     1 
ATOM   4497  C  CB    . LEU B 1 98  ? 73.402  -16.580 0.223   1.00 35.00  ?  98  LEU B CB    1 
ATOM   4498  C  CG    . LEU B 1 98  ? 73.615  -16.743 -1.287  1.00 32.68  ?  98  LEU B CG    1 
ATOM   4499  C  CD1   . LEU B 1 98  ? 75.074  -16.954 -1.594  1.00 28.78  ?  98  LEU B CD1   1 
ATOM   4500  C  CD2   . LEU B 1 98  ? 72.808  -17.903 -1.822  1.00 35.26  ?  98  LEU B CD2   1 
ATOM   4501  N  N     . VAL B 1 99  ? 71.509  -15.630 2.835   1.00 36.13  ?  99  VAL B N     1 
ATOM   4502  C  CA    . VAL B 1 99  ? 71.351  -15.581 4.281   1.00 29.94  ?  99  VAL B CA    1 
ATOM   4503  C  C     . VAL B 1 99  ? 70.009  -14.967 4.613   1.00 32.49  ?  99  VAL B C     1 
ATOM   4504  O  O     . VAL B 1 99  ? 69.671  -13.925 4.079   1.00 40.32  ?  99  VAL B O     1 
ATOM   4505  C  CB    . VAL B 1 99  ? 72.439  -14.711 4.913   1.00 25.47  ?  99  VAL B CB    1 
ATOM   4506  C  CG1   . VAL B 1 99  ? 72.172  -14.515 6.369   1.00 25.55  ?  99  VAL B CG1   1 
ATOM   4507  C  CG2   . VAL B 1 99  ? 73.801  -15.343 4.694   1.00 28.08  ?  99  VAL B CG2   1 
ATOM   4508  N  N     . GLU B 1 100 ? 69.235  -15.624 5.472   1.00 32.33  ?  100 GLU B N     1 
ATOM   4509  C  CA    . GLU B 1 100 ? 68.005  -15.038 6.012   1.00 34.92  ?  100 GLU B CA    1 
ATOM   4510  C  C     . GLU B 1 100 ? 68.305  -14.441 7.386   1.00 35.92  ?  100 GLU B C     1 
ATOM   4511  O  O     . GLU B 1 100 ? 69.011  -15.041 8.197   1.00 36.68  ?  100 GLU B O     1 
ATOM   4512  C  CB    . GLU B 1 100 ? 66.893  -16.081 6.125   1.00 36.61  ?  100 GLU B CB    1 
ATOM   4513  C  CG    . GLU B 1 100 ? 66.693  -16.900 4.886   1.00 48.18  ?  100 GLU B CG    1 
ATOM   4514  C  CD    . GLU B 1 100 ? 65.631  -17.968 5.058   1.00 62.19  ?  100 GLU B CD    1 
ATOM   4515  O  OE1   . GLU B 1 100 ? 65.254  -18.600 4.039   1.00 65.32  ?  100 GLU B OE1   1 
ATOM   4516  O  OE2   . GLU B 1 100 ? 65.183  -18.177 6.210   1.00 66.47  ?  100 GLU B OE2   1 
ATOM   4517  N  N     . MET B 1 101 ? 67.772  -13.259 7.654   1.00 33.94  ?  101 MET B N     1 
ATOM   4518  C  CA    . MET B 1 101 ? 68.106  -12.579 8.889   1.00 32.43  ?  101 MET B CA    1 
ATOM   4519  C  C     . MET B 1 101 ? 66.893  -11.948 9.584   1.00 38.25  ?  101 MET B C     1 
ATOM   4520  O  O     . MET B 1 101 ? 66.113  -11.225 8.962   1.00 42.97  ?  101 MET B O     1 
ATOM   4521  C  CB    . MET B 1 101 ? 69.221  -11.556 8.638   1.00 28.48  ?  101 MET B CB    1 
ATOM   4522  C  CG    . MET B 1 101 ? 69.547  -10.643 9.817   1.00 28.86  ?  101 MET B CG    1 
ATOM   4523  S  SD    . MET B 1 101 ? 71.044  -9.665  9.541   1.00 67.07  ?  101 MET B SD    1 
ATOM   4524  C  CE    . MET B 1 101 ? 72.158  -10.911 8.899   1.00 26.86  ?  101 MET B CE    1 
ATOM   4525  N  N     . HIS B 1 102 ? 66.734  -12.262 10.873  1.00 41.26  ?  102 HIS B N     1 
ATOM   4526  C  CA    . HIS B 1 102 ? 65.732  -11.630 11.734  1.00 47.33  ?  102 HIS B CA    1 
ATOM   4527  C  C     . HIS B 1 102 ? 66.234  -10.293 12.279  1.00 44.26  ?  102 HIS B C     1 
ATOM   4528  O  O     . HIS B 1 102 ? 67.370  -10.181 12.743  1.00 42.54  ?  102 HIS B O     1 
ATOM   4529  C  CB    . HIS B 1 102 ? 65.361  -12.540 12.900  1.00 57.71  ?  102 HIS B CB    1 
ATOM   4530  C  CG    . HIS B 1 102 ? 64.187  -13.422 12.630  1.00 68.81  ?  102 HIS B CG    1 
ATOM   4531  N  ND1   . HIS B 1 102 ? 63.379  -13.269 11.523  1.00 74.70  ?  102 HIS B ND1   1 
ATOM   4532  C  CD2   . HIS B 1 102 ? 63.679  -14.467 13.326  1.00 73.31  ?  102 HIS B CD2   1 
ATOM   4533  C  CE1   . HIS B 1 102 ? 62.427  -14.182 11.547  1.00 78.75  ?  102 HIS B CE1   1 
ATOM   4534  N  NE2   . HIS B 1 102 ? 62.587  -14.923 12.629  1.00 78.99  ?  102 HIS B NE2   1 
ATOM   4535  N  N     . GLY B 1 103 ? 65.384  -9.276  12.201  1.00 46.89  ?  103 GLY B N     1 
ATOM   4536  C  CA    . GLY B 1 103 ? 65.750  -7.944  12.647  1.00 49.52  ?  103 GLY B CA    1 
ATOM   4537  C  C     . GLY B 1 103 ? 66.034  -6.950  11.538  1.00 49.73  ?  103 GLY B C     1 
ATOM   4538  O  O     . GLY B 1 103 ? 65.957  -7.270  10.355  1.00 52.41  ?  103 GLY B O     1 
ATOM   4539  N  N     . ASN B 1 104 ? 66.365  -5.730  11.934  1.00 45.63  ?  104 ASN B N     1 
ATOM   4540  C  CA    . ASN B 1 104 ? 66.701  -4.684  10.988  1.00 43.42  ?  104 ASN B CA    1 
ATOM   4541  C  C     . ASN B 1 104 ? 67.990  -4.984  10.236  1.00 42.93  ?  104 ASN B C     1 
ATOM   4542  O  O     . ASN B 1 104 ? 69.090  -4.835  10.776  1.00 42.24  ?  104 ASN B O     1 
ATOM   4543  C  CB    . ASN B 1 104 ? 66.798  -3.339  11.709  1.00 45.47  ?  104 ASN B CB    1 
ATOM   4544  C  CG    . ASN B 1 104 ? 67.079  -2.191  10.766  1.00 51.47  ?  104 ASN B CG    1 
ATOM   4545  O  OD1   . ASN B 1 104 ? 67.184  -2.374  9.554   1.00 50.03  ?  104 ASN B OD1   1 
ATOM   4546  N  ND2   . ASN B 1 104 ? 67.190  -0.989  11.320  1.00 58.77  ?  104 ASN B ND2   1 
ATOM   4547  N  N     . ASN B 1 105 ? 67.853  -5.409  8.983   1.00 47.03  ?  105 ASN B N     1 
ATOM   4548  C  CA    . ASN B 1 105 ? 69.015  -5.624  8.118   1.00 43.29  ?  105 ASN B CA    1 
ATOM   4549  C  C     . ASN B 1 105 ? 69.171  -4.534  7.066   1.00 43.44  ?  105 ASN B C     1 
ATOM   4550  O  O     . ASN B 1 105 ? 69.809  -4.734  6.046   1.00 42.29  ?  105 ASN B O     1 
ATOM   4551  C  CB    . ASN B 1 105 ? 68.970  -7.003  7.457   1.00 40.21  ?  105 ASN B CB    1 
ATOM   4552  C  CG    . ASN B 1 105 ? 67.838  -7.142  6.452   1.00 43.06  ?  105 ASN B CG    1 
ATOM   4553  O  OD1   . ASN B 1 105 ? 66.785  -6.504  6.570   1.00 48.35  ?  105 ASN B OD1   1 
ATOM   4554  N  ND2   . ASN B 1 105 ? 68.051  -7.989  5.455   1.00 41.87  ?  105 ASN B ND2   1 
ATOM   4555  N  N     . GLY B 1 106 ? 68.574  -3.380  7.321   1.00 48.54  ?  106 GLY B N     1 
ATOM   4556  C  CA    . GLY B 1 106 ? 68.663  -2.269  6.398   1.00 53.28  ?  106 GLY B CA    1 
ATOM   4557  C  C     . GLY B 1 106 ? 67.414  -2.114  5.560   1.00 55.49  ?  106 GLY B C     1 
ATOM   4558  O  O     . GLY B 1 106 ? 66.381  -2.729  5.834   1.00 56.77  ?  106 GLY B O     1 
ATOM   4559  N  N     . SER B 1 107 ? 67.524  -1.290  4.524   1.00 53.66  ?  107 SER B N     1 
ATOM   4560  C  CA    . SER B 1 107 ? 66.402  -0.970  3.667   1.00 54.11  ?  107 SER B CA    1 
ATOM   4561  C  C     . SER B 1 107 ? 66.962  -0.364  2.397   1.00 50.89  ?  107 SER B C     1 
ATOM   4562  O  O     . SER B 1 107 ? 68.154  -0.079  2.333   1.00 48.70  ?  107 SER B O     1 
ATOM   4563  C  CB    . SER B 1 107 ? 65.505  0.058   4.353   1.00 58.02  ?  107 SER B CB    1 
ATOM   4564  O  OG    . SER B 1 107 ? 66.143  1.327   4.396   1.00 59.28  ?  107 SER B OG    1 
ATOM   4565  N  N     . MET B 1 108 ? 66.103  -0.143  1.402   1.00 50.39  ?  108 MET B N     1 
ATOM   4566  C  CA    . MET B 1 108 ? 66.526  0.516   0.174   1.00 52.41  ?  108 MET B CA    1 
ATOM   4567  C  C     . MET B 1 108 ? 66.771  2.013   0.360   1.00 61.45  ?  108 MET B C     1 
ATOM   4568  O  O     . MET B 1 108 ? 67.238  2.686   -0.555  1.00 69.17  ?  108 MET B O     1 
ATOM   4569  C  CB    . MET B 1 108 ? 65.498  0.293   -0.927  1.00 50.93  ?  108 MET B CB    1 
ATOM   4570  C  CG    . MET B 1 108 ? 65.274  -1.160  -1.262  1.00 46.62  ?  108 MET B CG    1 
ATOM   4571  S  SD    . MET B 1 108 ? 63.941  -1.327  -2.455  1.00 52.63  ?  108 MET B SD    1 
ATOM   4572  C  CE    . MET B 1 108 ? 64.688  -0.566  -3.902  1.00 67.89  ?  108 MET B CE    1 
ATOM   4573  N  N     . ASP B 1 109 ? 66.440  2.531   1.539   1.00 60.41  ?  109 ASP B N     1 
ATOM   4574  C  CA    . ASP B 1 109 ? 66.712  3.924   1.891   1.00 61.97  ?  109 ASP B CA    1 
ATOM   4575  C  C     . ASP B 1 109 ? 68.154  4.113   2.389   1.00 55.57  ?  109 ASP B C     1 
ATOM   4576  O  O     . ASP B 1 109 ? 68.551  5.211   2.792   1.00 55.27  ?  109 ASP B O     1 
ATOM   4577  C  CB    . ASP B 1 109 ? 65.734  4.396   2.969   1.00 70.12  ?  109 ASP B CB    1 
ATOM   4578  C  CG    . ASP B 1 109 ? 64.383  4.778   2.409   1.00 79.10  ?  109 ASP B CG    1 
ATOM   4579  O  OD1   . ASP B 1 109 ? 64.137  4.505   1.218   1.00 84.77  ?  109 ASP B OD1   1 
ATOM   4580  O  OD2   . ASP B 1 109 ? 63.565  5.351   3.165   1.00 81.59  ?  109 ASP B OD2   1 
ATOM   4581  N  N     . GLY B 1 110 ? 68.926  3.033   2.387   1.00 52.85  ?  110 GLY B N     1 
ATOM   4582  C  CA    . GLY B 1 110 ? 70.341  3.113   2.684   1.00 56.75  ?  110 GLY B CA    1 
ATOM   4583  C  C     . GLY B 1 110 ? 70.653  3.274   4.156   1.00 63.09  ?  110 GLY B C     1 
ATOM   4584  O  O     . GLY B 1 110 ? 71.806  3.483   4.536   1.00 69.36  ?  110 GLY B O     1 
ATOM   4585  N  N     . ASP B 1 111 ? 69.637  3.177   5.001   1.00 62.75  ?  111 ASP B N     1 
ATOM   4586  C  CA    . ASP B 1 111 ? 69.881  3.364   6.419   1.00 64.27  ?  111 ASP B CA    1 
ATOM   4587  C  C     . ASP B 1 111 ? 70.540  2.124   7.040   1.00 61.04  ?  111 ASP B C     1 
ATOM   4588  O  O     . ASP B 1 111 ? 70.509  1.034   6.452   1.00 61.53  ?  111 ASP B O     1 
ATOM   4589  C  CB    . ASP B 1 111 ? 68.606  3.802   7.145   1.00 70.73  ?  111 ASP B CB    1 
ATOM   4590  C  CG    . ASP B 1 111 ? 67.437  2.899   6.864   1.00 77.13  ?  111 ASP B CG    1 
ATOM   4591  O  OD1   . ASP B 1 111 ? 66.308  3.426   6.724   1.00 81.10  ?  111 ASP B OD1   1 
ATOM   4592  O  OD2   . ASP B 1 111 ? 67.650  1.667   6.801   1.00 78.25  ?  111 ASP B OD2   1 
ATOM   4593  N  N     . PRO B 1 112 ? 71.154  2.290   8.226   1.00 57.82  ?  112 PRO B N     1 
ATOM   4594  C  CA    . PRO B 1 112 ? 72.041  1.256   8.748   1.00 52.99  ?  112 PRO B CA    1 
ATOM   4595  C  C     . PRO B 1 112 ? 71.222  0.137   9.326   1.00 50.24  ?  112 PRO B C     1 
ATOM   4596  O  O     . PRO B 1 112 ? 70.148  0.410   9.873   1.00 53.73  ?  112 PRO B O     1 
ATOM   4597  C  CB    . PRO B 1 112 ? 72.782  1.970   9.884   1.00 56.93  ?  112 PRO B CB    1 
ATOM   4598  C  CG    . PRO B 1 112 ? 72.262  3.401   9.901   1.00 59.36  ?  112 PRO B CG    1 
ATOM   4599  C  CD    . PRO B 1 112 ? 70.946  3.354   9.218   1.00 60.30  ?  112 PRO B CD    1 
ATOM   4600  N  N     . PRO B 1 113 ? 71.710  -1.107  9.194   1.00 43.54  ?  113 PRO B N     1 
ATOM   4601  C  CA    . PRO B 1 113 ? 71.099  -2.279  9.822   1.00 40.71  ?  113 PRO B CA    1 
ATOM   4602  C  C     . PRO B 1 113 ? 71.347  -2.239  11.317  1.00 46.59  ?  113 PRO B C     1 
ATOM   4603  O  O     . PRO B 1 113 ? 72.194  -1.468  11.795  1.00 47.19  ?  113 PRO B O     1 
ATOM   4604  C  CB    . PRO B 1 113 ? 71.871  -3.447  9.205   1.00 33.93  ?  113 PRO B CB    1 
ATOM   4605  C  CG    . PRO B 1 113 ? 73.172  -2.883  8.827   1.00 34.78  ?  113 PRO B CG    1 
ATOM   4606  C  CD    . PRO B 1 113 ? 72.881  -1.473  8.383   1.00 39.70  ?  113 PRO B CD    1 
ATOM   4607  N  N     . ALA B 1 114 ? 70.607  -3.059  12.054  1.00 52.48  ?  114 ALA B N     1 
ATOM   4608  C  CA    . ALA B 1 114 ? 70.800  -3.134  13.488  1.00 56.13  ?  114 ALA B CA    1 
ATOM   4609  C  C     . ALA B 1 114 ? 72.186  -3.701  13.751  1.00 49.46  ?  114 ALA B C     1 
ATOM   4610  O  O     . ALA B 1 114 ? 72.701  -4.519  12.968  1.00 43.26  ?  114 ALA B O     1 
ATOM   4611  C  CB    . ALA B 1 114 ? 69.714  -3.993  14.141  1.00 59.78  ?  114 ALA B CB    1 
ATOM   4612  N  N     . ALA B 1 115 ? 72.799  -3.253  14.843  1.00 47.35  ?  115 ALA B N     1 
ATOM   4613  C  CA    . ALA B 1 115 ? 74.110  -3.763  15.217  1.00 46.76  ?  115 ALA B CA    1 
ATOM   4614  C  C     . ALA B 1 115 ? 74.111  -5.290  15.406  1.00 43.70  ?  115 ALA B C     1 
ATOM   4615  O  O     . ALA B 1 115 ? 73.085  -5.906  15.702  1.00 41.04  ?  115 ALA B O     1 
ATOM   4616  C  CB    . ALA B 1 115 ? 74.612  -3.051  16.443  1.00 50.10  ?  115 ALA B CB    1 
ATOM   4617  N  N     . MET B 1 116 ? 75.271  -5.899  15.215  1.00 44.02  ?  116 MET B N     1 
ATOM   4618  C  CA    . MET B 1 116 ? 75.393  -7.359  15.233  1.00 43.24  ?  116 MET B CA    1 
ATOM   4619  C  C     . MET B 1 116 ? 74.841  -8.072  16.496  1.00 35.38  ?  116 MET B C     1 
ATOM   4620  O  O     . MET B 1 116 ? 74.568  -9.276  16.483  1.00 33.42  ?  116 MET B O     1 
ATOM   4621  C  CB    . MET B 1 116 ? 76.856  -7.727  14.960  1.00 38.72  ?  116 MET B CB    1 
ATOM   4622  C  CG    . MET B 1 116 ? 77.377  -8.955  15.663  1.00 35.03  ?  116 MET B CG    1 
ATOM   4623  S  SD    . MET B 1 116 ? 79.171  -9.027  15.522  1.00 34.33  ?  116 MET B SD    1 
ATOM   4624  C  CE    . MET B 1 116 ? 79.695  -8.105  16.954  1.00 53.58  ?  116 MET B CE    1 
ATOM   4625  N  N     . ARG B 1 117 ? 74.666  -7.325  17.581  1.00 40.06  ?  117 ARG B N     1 
ATOM   4626  C  CA    A ARG B 1 117 ? 74.219  -7.911  18.840  0.45 44.08  ?  117 ARG B CA    1 
ATOM   4627  C  CA    B ARG B 1 117 ? 74.220  -7.903  18.845  0.55 44.04  ?  117 ARG B CA    1 
ATOM   4628  C  C     . ARG B 1 117 ? 72.705  -8.158  18.858  1.00 47.08  ?  117 ARG B C     1 
ATOM   4629  O  O     . ARG B 1 117 ? 72.209  -8.968  19.643  1.00 45.98  ?  117 ARG B O     1 
ATOM   4630  C  CB    A ARG B 1 117 ? 74.624  -7.011  20.005  0.45 33.85  ?  117 ARG B CB    1 
ATOM   4631  C  CB    B ARG B 1 117 ? 74.677  -7.025  20.025  0.55 33.85  ?  117 ARG B CB    1 
ATOM   4632  C  CG    A ARG B 1 117 ? 73.630  -5.912  20.305  0.45 35.97  ?  117 ARG B CG    1 
ATOM   4633  C  CG    B ARG B 1 117 ? 73.678  -5.991  20.569  0.55 36.92  ?  117 ARG B CG    1 
ATOM   4634  C  CD    A ARG B 1 117 ? 74.312  -4.725  20.955  0.45 38.58  ?  117 ARG B CD    1 
ATOM   4635  C  CD    B ARG B 1 117 ? 74.419  -4.934  21.416  0.55 39.35  ?  117 ARG B CD    1 
ATOM   4636  N  NE    A ARG B 1 117 ? 75.173  -4.030  20.005  0.45 37.81  ?  117 ARG B NE    1 
ATOM   4637  N  NE    B ARG B 1 117 ? 73.746  -4.478  22.642  0.55 37.57  ?  117 ARG B NE    1 
ATOM   4638  C  CZ    A ARG B 1 117 ? 75.835  -2.912  20.273  0.45 38.95  ?  117 ARG B CZ    1 
ATOM   4639  C  CZ    B ARG B 1 117 ? 72.865  -5.182  23.348  0.55 38.35  ?  117 ARG B CZ    1 
ATOM   4640  N  NH1   A ARG B 1 117 ? 75.746  -2.354  21.475  0.45 36.99  ?  117 ARG B NH1   1 
ATOM   4641  N  NH1   B ARG B 1 117 ? 72.500  -6.401  22.976  0.55 37.71  ?  117 ARG B NH1   1 
ATOM   4642  N  NH2   A ARG B 1 117 ? 76.589  -2.361  19.334  0.45 35.05  ?  117 ARG B NH2   1 
ATOM   4643  N  NH2   B ARG B 1 117 ? 72.337  -4.657  24.437  0.55 39.96  ?  117 ARG B NH2   1 
ATOM   4644  N  N     . TYR B 1 118 ? 71.984  -7.476  17.964  1.00 47.57  ?  118 TYR B N     1 
ATOM   4645  C  CA    . TYR B 1 118 ? 70.518  -7.510  17.903  1.00 44.61  ?  118 TYR B CA    1 
ATOM   4646  C  C     . TYR B 1 118 ? 69.914  -8.531  16.945  1.00 47.63  ?  118 TYR B C     1 
ATOM   4647  O  O     . TYR B 1 118 ? 68.798  -8.995  17.146  1.00 53.21  ?  118 TYR B O     1 
ATOM   4648  C  CB    . TYR B 1 118 ? 69.992  -6.138  17.488  1.00 41.69  ?  118 TYR B CB    1 
ATOM   4649  C  CG    . TYR B 1 118 ? 70.325  -5.030  18.449  1.00 35.22  ?  118 TYR B CG    1 
ATOM   4650  C  CD1   . TYR B 1 118 ? 69.572  -4.831  19.595  1.00 44.72  ?  118 TYR B CD1   1 
ATOM   4651  C  CD2   . TYR B 1 118 ? 71.389  -4.183  18.215  1.00 58.60  ?  118 TYR B CD2   1 
ATOM   4652  C  CE1   . TYR B 1 118 ? 69.869  -3.826  20.478  1.00 44.21  ?  118 TYR B CE1   1 
ATOM   4653  C  CE2   . TYR B 1 118 ? 71.698  -3.177  19.096  1.00 53.94  ?  118 TYR B CE2   1 
ATOM   4654  C  CZ    . TYR B 1 118 ? 70.934  -2.999  20.230  1.00 46.74  ?  118 TYR B CZ    1 
ATOM   4655  O  OH    . TYR B 1 118 ? 71.227  -1.977  21.110  1.00 50.10  ?  118 TYR B OH    1 
ATOM   4656  N  N     . THR B 1 119 ? 70.633  -8.851  15.879  1.00 31.78  ?  119 THR B N     1 
ATOM   4657  C  CA    . THR B 1 119 ? 70.054  -9.628  14.799  1.00 33.57  ?  119 THR B CA    1 
ATOM   4658  C  C     . THR B 1 119 ? 70.331  -11.123 14.938  1.00 36.47  ?  119 THR B C     1 
ATOM   4659  O  O     . THR B 1 119 ? 71.282  -11.526 15.595  1.00 37.79  ?  119 THR B O     1 
ATOM   4660  C  CB    . THR B 1 119 ? 70.541  -9.122  13.424  1.00 30.24  ?  119 THR B CB    1 
ATOM   4661  O  OG1   . THR B 1 119 ? 71.953  -9.330  13.310  1.00 29.32  ?  119 THR B OG1   1 
ATOM   4662  C  CG2   . THR B 1 119 ? 70.243  -7.645  13.259  1.00 30.84  ?  119 THR B CG2   1 
ATOM   4663  N  N     . GLU B 1 120 ? 69.472  -11.930 14.320  1.00 40.36  ?  120 GLU B N     1 
ATOM   4664  C  CA    . GLU B 1 120 ? 69.612  -13.377 14.267  1.00 44.90  ?  120 GLU B CA    1 
ATOM   4665  C  C     . GLU B 1 120 ? 69.696  -13.732 12.803  1.00 43.38  ?  120 GLU B C     1 
ATOM   4666  O  O     . GLU B 1 120 ? 69.212  -12.975 11.970  1.00 48.40  ?  120 GLU B O     1 
ATOM   4667  C  CB    . GLU B 1 120 ? 68.378  -14.052 14.849  1.00 55.69  ?  120 GLU B CB    1 
ATOM   4668  C  CG    . GLU B 1 120 ? 68.151  -13.782 16.316  1.00 69.79  ?  120 GLU B CG    1 
ATOM   4669  C  CD    . GLU B 1 120 ? 67.194  -14.773 16.942  1.00 81.50  ?  120 GLU B CD    1 
ATOM   4670  O  OE1   . GLU B 1 120 ? 66.101  -14.993 16.361  1.00 86.53  ?  120 GLU B OE1   1 
ATOM   4671  O  OE2   . GLU B 1 120 ? 67.546  -15.337 18.004  1.00 84.30  ?  120 GLU B OE2   1 
ATOM   4672  N  N     . ALA B 1 121 ? 70.285  -14.880 12.481  1.00 39.59  ?  121 ALA B N     1 
ATOM   4673  C  CA    . ALA B 1 121 ? 70.445  -15.269 11.083  1.00 36.46  ?  121 ALA B CA    1 
ATOM   4674  C  C     . ALA B 1 121 ? 70.641  -16.768 10.916  1.00 37.13  ?  121 ALA B C     1 
ATOM   4675  O  O     . ALA B 1 121 ? 70.933  -17.481 11.874  1.00 39.53  ?  121 ALA B O     1 
ATOM   4676  C  CB    . ALA B 1 121 ? 71.606  -14.533 10.477  1.00 33.87  ?  121 ALA B CB    1 
ATOM   4677  N  N     . ARG B 1 122 ? 70.481  -17.227 9.678   1.00 36.04  ?  122 ARG B N     1 
ATOM   4678  C  CA    . ARG B 1 122 ? 70.718  -18.614 9.293   1.00 40.19  ?  122 ARG B CA    1 
ATOM   4679  C  C     . ARG B 1 122 ? 70.809  -18.673 7.763   1.00 43.93  ?  122 ARG B C     1 
ATOM   4680  O  O     . ARG B 1 122 ? 70.407  -17.724 7.087   1.00 49.85  ?  122 ARG B O     1 
ATOM   4681  C  CB    . ARG B 1 122 ? 69.574  -19.486 9.788   1.00 41.38  ?  122 ARG B CB    1 
ATOM   4682  C  CG    . ARG B 1 122 ? 68.228  -19.018 9.300   1.00 29.71  ?  122 ARG B CG    1 
ATOM   4683  C  CD    . ARG B 1 122 ? 67.161  -20.009 9.617   1.00 44.22  ?  122 ARG B CD    1 
ATOM   4684  N  NE    . ARG B 1 122 ? 65.845  -19.492 9.290   1.00 44.95  ?  122 ARG B NE    1 
ATOM   4685  C  CZ    . ARG B 1 122 ? 64.711  -20.088 9.630   1.00 48.40  ?  122 ARG B CZ    1 
ATOM   4686  N  NH1   . ARG B 1 122 ? 64.738  -21.224 10.305  1.00 48.86  ?  122 ARG B NH1   1 
ATOM   4687  N  NH2   . ARG B 1 122 ? 63.552  -19.544 9.299   1.00 54.42  ?  122 ARG B NH2   1 
ATOM   4688  N  N     . LEU B 1 123 ? 71.340  -19.762 7.208   1.00 40.91  ?  123 LEU B N     1 
ATOM   4689  C  CA    . LEU B 1 123 ? 71.402  -19.886 5.747   1.00 41.53  ?  123 LEU B CA    1 
ATOM   4690  C  C     . LEU B 1 123 ? 70.002  -20.004 5.166   1.00 48.37  ?  123 LEU B C     1 
ATOM   4691  O  O     . LEU B 1 123 ? 69.115  -20.602 5.777   1.00 52.21  ?  123 LEU B O     1 
ATOM   4692  C  CB    . LEU B 1 123 ? 72.248  -21.091 5.304   1.00 35.62  ?  123 LEU B CB    1 
ATOM   4693  C  CG    . LEU B 1 123 ? 73.699  -21.100 5.795   1.00 32.57  ?  123 LEU B CG    1 
ATOM   4694  C  CD1   . LEU B 1 123 ? 74.409  -22.374 5.409   1.00 30.28  ?  123 LEU B CD1   1 
ATOM   4695  C  CD2   . LEU B 1 123 ? 74.462  -19.891 5.295   1.00 29.93  ?  123 LEU B CD2   1 
ATOM   4696  N  N     . SER B 1 124 ? 69.808  -19.418 3.987   1.00 46.44  ?  124 SER B N     1 
ATOM   4697  C  CA    . SER B 1 124 ? 68.564  -19.570 3.250   1.00 45.08  ?  124 SER B CA    1 
ATOM   4698  C  C     . SER B 1 124 ? 68.537  -20.981 2.715   1.00 43.13  ?  124 SER B C     1 
ATOM   4699  O  O     . SER B 1 124 ? 69.578  -21.632 2.622   1.00 43.72  ?  124 SER B O     1 
ATOM   4700  C  CB    . SER B 1 124 ? 68.532  -18.606 2.080   1.00 51.12  ?  124 SER B CB    1 
ATOM   4701  O  OG    . SER B 1 124 ? 69.462  -18.999 1.090   1.00 54.96  ?  124 SER B OG    1 
ATOM   4702  N  N     . GLU B 1 125 ? 67.358  -21.470 2.356   1.00 42.44  ?  125 GLU B N     1 
ATOM   4703  C  CA    . GLU B 1 125 ? 67.299  -22.809 1.784   1.00 41.81  ?  125 GLU B CA    1 
ATOM   4704  C  C     . GLU B 1 125 ? 68.174  -22.943 0.528   1.00 38.98  ?  125 GLU B C     1 
ATOM   4705  O  O     . GLU B 1 125 ? 68.842  -23.964 0.339   1.00 37.68  ?  125 GLU B O     1 
ATOM   4706  C  CB    . GLU B 1 125 ? 65.863  -23.219 1.484   1.00 40.13  ?  125 GLU B CB    1 
ATOM   4707  C  CG    . GLU B 1 125 ? 65.759  -24.586 0.861   1.00 41.71  ?  125 GLU B CG    1 
ATOM   4708  C  CD    . GLU B 1 125 ? 64.342  -25.123 0.869   1.00 50.30  ?  125 GLU B CD    1 
ATOM   4709  O  OE1   . GLU B 1 125 ? 63.403  -24.307 1.044   1.00 52.21  ?  125 GLU B OE1   1 
ATOM   4710  O  OE2   . GLU B 1 125 ? 64.176  -26.361 0.708   1.00 54.06  ?  125 GLU B OE2   1 
ATOM   4711  N  N     . ILE B 1 126 ? 68.184  -21.918 -0.325  1.00 34.16  ?  126 ILE B N     1 
ATOM   4712  C  CA    . ILE B 1 126 ? 68.914  -22.031 -1.579  1.00 35.71  ?  126 ILE B CA    1 
ATOM   4713  C  C     . ILE B 1 126 ? 70.426  -22.081 -1.430  1.00 26.75  ?  126 ILE B C     1 
ATOM   4714  O  O     . ILE B 1 126 ? 71.101  -22.730 -2.227  1.00 26.57  ?  126 ILE B O     1 
ATOM   4715  C  CB    . ILE B 1 126 ? 68.553  -20.932 -2.583  1.00 44.69  ?  126 ILE B CB    1 
ATOM   4716  C  CG1   . ILE B 1 126 ? 68.793  -21.450 -4.004  1.00 28.28  ?  126 ILE B CG1   1 
ATOM   4717  C  CG2   . ILE B 1 126 ? 69.341  -19.655 -2.311  1.00 27.22  ?  126 ILE B CG2   1 
ATOM   4718  C  CD1   . ILE B 1 126 ? 68.653  -20.417 -5.025  1.00 29.88  ?  126 ILE B CD1   1 
ATOM   4719  N  N     . ALA B 1 127 ? 70.960  -21.393 -0.423  1.00 29.47  ?  127 ALA B N     1 
ATOM   4720  C  CA    . ALA B 1 127 ? 72.402  -21.423 -0.151  1.00 29.93  ?  127 ALA B CA    1 
ATOM   4721  C  C     . ALA B 1 127 ? 72.863  -22.846 0.165   1.00 30.35  ?  127 ALA B C     1 
ATOM   4722  O  O     . ALA B 1 127 ? 73.987  -23.244 -0.126  1.00 28.88  ?  127 ALA B O     1 
ATOM   4723  C  CB    . ALA B 1 127 ? 72.749  -20.481 0.985   1.00 26.46  ?  127 ALA B CB    1 
ATOM   4724  N  N     . GLY B 1 128 ? 71.968  -23.617 0.751   1.00 26.30  ?  128 GLY B N     1 
ATOM   4725  C  CA    . GLY B 1 128 ? 72.245  -25.003 1.001   1.00 31.20  ?  128 GLY B CA    1 
ATOM   4726  C  C     . GLY B 1 128 ? 72.608  -25.748 -0.254  1.00 32.54  ?  128 GLY B C     1 
ATOM   4727  O  O     . GLY B 1 128 ? 73.384  -26.708 -0.206  1.00 36.73  ?  128 GLY B O     1 
ATOM   4728  N  N     . TYR B 1 129 ? 72.047  -25.324 -1.381  1.00 29.69  ?  129 TYR B N     1 
ATOM   4729  C  CA    . TYR B 1 129 ? 72.403  -25.940 -2.654  1.00 30.78  ?  129 TYR B CA    1 
ATOM   4730  C  C     . TYR B 1 129 ? 73.801  -25.504 -3.114  1.00 37.64  ?  129 TYR B C     1 
ATOM   4731  O  O     . TYR B 1 129 ? 74.481  -26.252 -3.818  1.00 43.72  ?  129 TYR B O     1 
ATOM   4732  C  CB    . TYR B 1 129 ? 71.317  -25.730 -3.709  1.00 29.11  ?  129 TYR B CB    1 
ATOM   4733  C  CG    . TYR B 1 129 ? 70.162  -26.699 -3.549  1.00 30.57  ?  129 TYR B CG    1 
ATOM   4734  C  CD1   . TYR B 1 129 ? 70.037  -27.814 -4.364  1.00 33.20  ?  129 TYR B CD1   1 
ATOM   4735  C  CD2   . TYR B 1 129 ? 69.211  -26.510 -2.563  1.00 34.35  ?  129 TYR B CD2   1 
ATOM   4736  C  CE1   . TYR B 1 129 ? 68.978  -28.711 -4.193  1.00 39.61  ?  129 TYR B CE1   1 
ATOM   4737  C  CE2   . TYR B 1 129 ? 68.156  -27.382 -2.393  1.00 37.45  ?  129 TYR B CE2   1 
ATOM   4738  C  CZ    . TYR B 1 129 ? 68.041  -28.483 -3.197  1.00 41.13  ?  129 TYR B CZ    1 
ATOM   4739  O  OH    . TYR B 1 129 ? 66.978  -29.344 -2.991  1.00 44.19  ?  129 TYR B OH    1 
ATOM   4740  N  N     . LEU B 1 130 ? 74.254  -24.329 -2.676  1.00 33.54  ?  130 LEU B N     1 
ATOM   4741  C  CA    . LEU B 1 130 ? 75.667  -23.973 -2.837  1.00 33.20  ?  130 LEU B CA    1 
ATOM   4742  C  C     . LEU B 1 130 ? 76.626  -24.909 -2.085  1.00 40.11  ?  130 LEU B C     1 
ATOM   4743  O  O     . LEU B 1 130 ? 77.798  -25.028 -2.451  1.00 43.68  ?  130 LEU B O     1 
ATOM   4744  C  CB    . LEU B 1 130 ? 75.937  -22.543 -2.372  1.00 28.25  ?  130 LEU B CB    1 
ATOM   4745  C  CG    . LEU B 1 130 ? 75.600  -21.390 -3.308  1.00 30.48  ?  130 LEU B CG    1 
ATOM   4746  C  CD1   . LEU B 1 130 ? 76.359  -20.166 -2.846  1.00 29.50  ?  130 LEU B CD1   1 
ATOM   4747  C  CD2   . LEU B 1 130 ? 75.960  -21.755 -4.720  1.00 35.98  ?  130 LEU B CD2   1 
ATOM   4748  N  N     . LEU B 1 131 ? 76.143  -25.552 -1.023  1.00 40.13  ?  131 LEU B N     1 
ATOM   4749  C  CA    . LEU B 1 131 ? 77.007  -26.395 -0.203  1.00 37.86  ?  131 LEU B CA    1 
ATOM   4750  C  C     . LEU B 1 131 ? 76.800  -27.882 -0.422  1.00 44.69  ?  131 LEU B C     1 
ATOM   4751  O  O     . LEU B 1 131 ? 77.613  -28.703 0.005   1.00 52.23  ?  131 LEU B O     1 
ATOM   4752  C  CB    . LEU B 1 131 ? 76.830  -26.060 1.268   1.00 33.35  ?  131 LEU B CB    1 
ATOM   4753  C  CG    . LEU B 1 131 ? 77.500  -24.754 1.661   1.00 32.68  ?  131 LEU B CG    1 
ATOM   4754  C  CD1   . LEU B 1 131 ? 76.646  -24.033 2.669   1.00 32.56  ?  131 LEU B CD1   1 
ATOM   4755  C  CD2   . LEU B 1 131 ? 78.913  -25.014 2.191   1.00 35.89  ?  131 LEU B CD2   1 
ATOM   4756  N  N     . GLN B 1 132 ? 75.706  -28.222 -1.087  1.00 41.37  ?  132 GLN B N     1 
ATOM   4757  C  CA    . GLN B 1 132 ? 75.334  -29.606 -1.307  1.00 38.97  ?  132 GLN B CA    1 
ATOM   4758  C  C     . GLN B 1 132 ? 76.568  -30.432 -1.659  1.00 39.20  ?  132 GLN B C     1 
ATOM   4759  O  O     . GLN B 1 132 ? 77.352  -30.039 -2.515  1.00 39.24  ?  132 GLN B O     1 
ATOM   4760  C  CB    . GLN B 1 132 ? 74.302  -29.631 -2.422  1.00 40.94  ?  132 GLN B CB    1 
ATOM   4761  C  CG    . GLN B 1 132 ? 73.630  -30.950 -2.712  1.00 49.35  ?  132 GLN B CG    1 
ATOM   4762  C  CD    . GLN B 1 132 ? 73.049  -30.939 -4.119  1.00 61.14  ?  132 GLN B CD    1 
ATOM   4763  O  OE1   . GLN B 1 132 ? 73.790  -30.974 -5.113  1.00 68.38  ?  132 GLN B OE1   1 
ATOM   4764  N  NE2   . GLN B 1 132 ? 71.726  -30.845 -4.213  1.00 61.98  ?  132 GLN B NE2   1 
ATOM   4765  N  N     . ASP B 1 133 ? 76.760  -31.544 -0.958  1.00 44.04  ?  133 ASP B N     1 
ATOM   4766  C  CA    . ASP B 1 133 ? 77.792  -32.539 -1.285  1.00 49.78  ?  133 ASP B CA    1 
ATOM   4767  C  C     . ASP B 1 133 ? 79.199  -32.204 -0.795  1.00 45.49  ?  133 ASP B C     1 
ATOM   4768  O  O     . ASP B 1 133 ? 80.172  -32.824 -1.222  1.00 50.37  ?  133 ASP B O     1 
ATOM   4769  C  CB    . ASP B 1 133 ? 77.839  -32.824 -2.787  1.00 58.82  ?  133 ASP B CB    1 
ATOM   4770  C  CG    . ASP B 1 133 ? 76.575  -33.482 -3.304  1.00 63.50  ?  133 ASP B CG    1 
ATOM   4771  O  OD1   . ASP B 1 133 ? 76.065  -34.407 -2.623  1.00 63.39  ?  133 ASP B OD1   1 
ATOM   4772  O  OD2   . ASP B 1 133 ? 76.104  -33.057 -4.394  1.00 64.29  ?  133 ASP B OD2   1 
ATOM   4773  N  N     . ILE B 1 134 ? 79.309  -31.242 0.110   1.00 39.67  ?  134 ILE B N     1 
ATOM   4774  C  CA    . ILE B 1 134 ? 80.617  -30.820 0.600   1.00 38.58  ?  134 ILE B CA    1 
ATOM   4775  C  C     . ILE B 1 134 ? 81.236  -31.870 1.518   1.00 39.22  ?  134 ILE B C     1 
ATOM   4776  O  O     . ILE B 1 134 ? 82.454  -32.050 1.566   1.00 38.86  ?  134 ILE B O     1 
ATOM   4777  C  CB    . ILE B 1 134 ? 80.538  -29.422 1.264   1.00 28.28  ?  134 ILE B CB    1 
ATOM   4778  C  CG1   . ILE B 1 134 ? 81.920  -28.879 1.552   1.00 34.14  ?  134 ILE B CG1   1 
ATOM   4779  C  CG2   . ILE B 1 134 ? 79.664  -29.418 2.498   1.00 28.48  ?  134 ILE B CG2   1 
ATOM   4780  C  CD1   . ILE B 1 134 ? 81.954  -27.394 1.371   1.00 37.88  ?  134 ILE B CD1   1 
ATOM   4781  N  N     . GLU B 1 135 ? 80.373  -32.593 2.218   1.00 41.38  ?  135 GLU B N     1 
ATOM   4782  C  CA    . GLU B 1 135 ? 80.804  -33.650 3.117   1.00 45.40  ?  135 GLU B CA    1 
ATOM   4783  C  C     . GLU B 1 135 ? 81.382  -34.830 2.344   1.00 48.30  ?  135 GLU B C     1 
ATOM   4784  O  O     . GLU B 1 135 ? 81.866  -35.792 2.940   1.00 52.89  ?  135 GLU B O     1 
ATOM   4785  C  CB    . GLU B 1 135 ? 79.622  -34.109 3.985   1.00 51.44  ?  135 GLU B CB    1 
ATOM   4786  C  CG    . GLU B 1 135 ? 78.556  -34.974 3.286   1.00 55.69  ?  135 GLU B CG    1 
ATOM   4787  C  CD    . GLU B 1 135 ? 77.540  -34.172 2.477   1.00 59.27  ?  135 GLU B CD    1 
ATOM   4788  O  OE1   . GLU B 1 135 ? 77.679  -32.934 2.374   1.00 59.35  ?  135 GLU B OE1   1 
ATOM   4789  O  OE2   . GLU B 1 135 ? 76.598  -34.790 1.930   1.00 62.10  ?  135 GLU B OE2   1 
ATOM   4790  N  N     . LYS B 1 136 ? 81.331  -34.745 1.014   1.00 46.20  ?  136 LYS B N     1 
ATOM   4791  C  CA    . LYS B 1 136 ? 81.649  -35.885 0.151   1.00 44.10  ?  136 LYS B CA    1 
ATOM   4792  C  C     . LYS B 1 136 ? 82.934  -35.759 -0.662  1.00 48.45  ?  136 LYS B C     1 
ATOM   4793  O  O     . LYS B 1 136 ? 83.044  -36.349 -1.721  1.00 35.13  ?  136 LYS B O     1 
ATOM   4794  C  CB    . LYS B 1 136 ? 80.475  -36.200 -0.779  1.00 35.45  ?  136 LYS B CB    1 
ATOM   4795  C  CG    . LYS B 1 136 ? 79.340  -36.920 -0.088  1.00 35.31  ?  136 LYS B CG    1 
ATOM   4796  C  CD    . LYS B 1 136 ? 78.174  -37.186 -1.019  1.00 36.86  ?  136 LYS B CD    1 
ATOM   4797  C  CE    . LYS B 1 136 ? 77.179  -38.148 -0.372  1.00 43.03  ?  136 LYS B CE    1 
ATOM   4798  N  NZ    . LYS B 1 136 ? 75.910  -38.282 -1.146  1.00 46.03  ?  136 LYS B NZ    1 
ATOM   4799  N  N     . LYS B 1 137 ? 83.910  -35.017 -0.152  1.00 49.93  ?  137 LYS B N     1 
ATOM   4800  C  CA    . LYS B 1 137 ? 85.204  -34.890 -0.823  1.00 48.08  ?  137 LYS B CA    1 
ATOM   4801  C  C     . LYS B 1 137 ? 85.035  -34.562 -2.315  1.00 47.82  ?  137 LYS B C     1 
ATOM   4802  O  O     . LYS B 1 137 ? 85.609  -35.236 -3.183  1.00 47.87  ?  137 LYS B O     1 
ATOM   4803  C  CB    . LYS B 1 137 ? 86.067  -36.150 -0.602  1.00 44.87  ?  137 LYS B CB    1 
ATOM   4804  C  CG    . LYS B 1 137 ? 86.684  -36.267 0.819   1.00 49.65  ?  137 LYS B CG    1 
ATOM   4805  C  CD    . LYS B 1 137 ? 87.521  -37.551 1.046   1.00 40.05  ?  137 LYS B CD    1 
ATOM   4806  N  N     . THR B 1 138 ? 84.255  -33.511 -2.590  1.00 43.93  ?  138 THR B N     1 
ATOM   4807  C  CA    . THR B 1 138 ? 83.904  -33.123 -3.955  1.00 42.26  ?  138 THR B CA    1 
ATOM   4808  C  C     . THR B 1 138 ? 84.585  -31.846 -4.371  1.00 42.18  ?  138 THR B C     1 
ATOM   4809  O  O     . THR B 1 138 ? 84.313  -31.318 -5.444  1.00 43.34  ?  138 THR B O     1 
ATOM   4810  C  CB    . THR B 1 138 ? 82.407  -32.811 -4.098  1.00 40.43  ?  138 THR B CB    1 
ATOM   4811  O  OG1   . THR B 1 138 ? 82.035  -31.815 -3.134  1.00 42.03  ?  138 THR B OG1   1 
ATOM   4812  C  CG2   . THR B 1 138 ? 81.560  -34.059 -3.930  1.00 39.23  ?  138 THR B CG2   1 
ATOM   4813  N  N     . VAL B 1 139 ? 85.452  -31.329 -3.519  1.00 43.02  ?  139 VAL B N     1 
ATOM   4814  C  CA    . VAL B 1 139 ? 85.972  -29.987 -3.728  1.00 44.79  ?  139 VAL B CA    1 
ATOM   4815  C  C     . VAL B 1 139 ? 87.280  -29.810 -2.952  1.00 46.52  ?  139 VAL B C     1 
ATOM   4816  O  O     . VAL B 1 139 ? 87.402  -30.266 -1.813  1.00 47.24  ?  139 VAL B O     1 
ATOM   4817  C  CB    . VAL B 1 139 ? 84.890  -28.936 -3.325  1.00 30.68  ?  139 VAL B CB    1 
ATOM   4818  C  CG1   . VAL B 1 139 ? 85.309  -28.137 -2.106  1.00 28.79  ?  139 VAL B CG1   1 
ATOM   4819  C  CG2   . VAL B 1 139 ? 84.550  -28.029 -4.482  1.00 29.02  ?  139 VAL B CG2   1 
ATOM   4820  N  N     . PRO B 1 140 ? 88.267  -29.154 -3.568  1.00 43.88  ?  140 PRO B N     1 
ATOM   4821  C  CA    . PRO B 1 140 ? 89.602  -28.986 -2.975  1.00 47.05  ?  140 PRO B CA    1 
ATOM   4822  C  C     . PRO B 1 140 ? 89.617  -28.147 -1.684  1.00 52.86  ?  140 PRO B C     1 
ATOM   4823  O  O     . PRO B 1 140 ? 89.139  -27.009 -1.686  1.00 55.06  ?  140 PRO B O     1 
ATOM   4824  C  CB    . PRO B 1 140 ? 90.378  -28.251 -4.075  1.00 45.79  ?  140 PRO B CB    1 
ATOM   4825  C  CG    . PRO B 1 140 ? 89.319  -27.478 -4.815  1.00 43.79  ?  140 PRO B CG    1 
ATOM   4826  C  CD    . PRO B 1 140 ? 88.102  -28.374 -4.808  1.00 41.43  ?  140 PRO B CD    1 
ATOM   4827  N  N     . PHE B 1 141 ? 90.179  -28.697 -0.606  1.00 54.27  ?  141 PHE B N     1 
ATOM   4828  C  CA    . PHE B 1 141 ? 90.325  -27.950 0.649   1.00 48.56  ?  141 PHE B CA    1 
ATOM   4829  C  C     . PHE B 1 141 ? 91.742  -27.410 0.827   1.00 48.60  ?  141 PHE B C     1 
ATOM   4830  O  O     . PHE B 1 141 ? 92.674  -27.847 0.157   1.00 53.39  ?  141 PHE B O     1 
ATOM   4831  C  CB    . PHE B 1 141 ? 89.951  -28.817 1.859   1.00 46.85  ?  141 PHE B CB    1 
ATOM   4832  C  CG    . PHE B 1 141 ? 88.485  -28.755 2.247   1.00 48.03  ?  141 PHE B CG    1 
ATOM   4833  C  CD1   . PHE B 1 141 ? 87.508  -29.363 1.468   1.00 48.12  ?  141 PHE B CD1   1 
ATOM   4834  C  CD2   . PHE B 1 141 ? 88.087  -28.112 3.411   1.00 49.23  ?  141 PHE B CD2   1 
ATOM   4835  C  CE1   . PHE B 1 141 ? 86.160  -29.319 1.836   1.00 42.97  ?  141 PHE B CE1   1 
ATOM   4836  C  CE2   . PHE B 1 141 ? 86.737  -28.062 3.777   1.00 46.28  ?  141 PHE B CE2   1 
ATOM   4837  C  CZ    . PHE B 1 141 ? 85.776  -28.671 2.987   1.00 41.19  ?  141 PHE B CZ    1 
ATOM   4838  N  N     . ALA B 1 142 ? 91.887  -26.464 1.749   1.00 43.51  ?  142 ALA B N     1 
ATOM   4839  C  CA    . ALA B 1 142 ? 93.176  -25.876 2.094   1.00 43.05  ?  142 ALA B CA    1 
ATOM   4840  C  C     . ALA B 1 142 ? 93.233  -25.616 3.597   1.00 48.10  ?  142 ALA B C     1 
ATOM   4841  O  O     . ALA B 1 142 ? 92.221  -25.730 4.289   1.00 52.73  ?  142 ALA B O     1 
ATOM   4842  C  CB    . ALA B 1 142 ? 93.352  -24.593 1.354   1.00 40.97  ?  142 ALA B CB    1 
ATOM   4843  N  N     . TRP B 1 143 ? 94.405  -25.251 4.106   1.00 47.06  ?  143 TRP B N     1 
ATOM   4844  C  CA    . TRP B 1 143 ? 94.526  -24.909 5.523   1.00 46.99  ?  143 TRP B CA    1 
ATOM   4845  C  C     . TRP B 1 143 ? 94.176  -23.444 5.805   1.00 45.26  ?  143 TRP B C     1 
ATOM   4846  O  O     . TRP B 1 143 ? 94.455  -22.561 4.992   1.00 44.38  ?  143 TRP B O     1 
ATOM   4847  C  CB    . TRP B 1 143 ? 95.930  -25.226 6.045   1.00 52.89  ?  143 TRP B CB    1 
ATOM   4848  C  CG    . TRP B 1 143 ? 96.234  -26.695 6.149   1.00 59.57  ?  143 TRP B CG    1 
ATOM   4849  C  CD1   . TRP B 1 143 ? 97.001  -27.434 5.295   1.00 62.36  ?  143 TRP B CD1   1 
ATOM   4850  C  CD2   . TRP B 1 143 ? 95.779  -27.604 7.166   1.00 61.13  ?  143 TRP B CD2   1 
ATOM   4851  N  NE1   . TRP B 1 143 ? 97.048  -28.745 5.711   1.00 62.29  ?  143 TRP B NE1   1 
ATOM   4852  C  CE2   . TRP B 1 143 ? 96.311  -28.876 6.857   1.00 60.69  ?  143 TRP B CE2   1 
ATOM   4853  C  CE3   . TRP B 1 143 ? 94.970  -27.467 8.302   1.00 59.56  ?  143 TRP B CE3   1 
ATOM   4854  C  CZ2   . TRP B 1 143 ? 96.065  -30.001 7.642   1.00 59.97  ?  143 TRP B CZ2   1 
ATOM   4855  C  CZ3   . TRP B 1 143 ? 94.727  -28.590 9.084   1.00 58.48  ?  143 TRP B CZ3   1 
ATOM   4856  C  CH2   . TRP B 1 143 ? 95.274  -29.840 8.747   1.00 58.40  ?  143 TRP B CH2   1 
ATOM   4857  N  N     . ASN B 1 144 ? 93.550  -23.200 6.958   1.00 46.90  ?  144 ASN B N     1 
ATOM   4858  C  CA    . ASN B 1 144 ? 93.234  -21.844 7.415   1.00 49.62  ?  144 ASN B CA    1 
ATOM   4859  C  C     . ASN B 1 144 ? 94.461  -21.194 8.031   1.00 50.31  ?  144 ASN B C     1 
ATOM   4860  O  O     . ASN B 1 144 ? 95.458  -21.868 8.258   1.00 57.06  ?  144 ASN B O     1 
ATOM   4861  C  CB    . ASN B 1 144 ? 92.124  -21.894 8.455   1.00 51.64  ?  144 ASN B CB    1 
ATOM   4862  C  CG    . ASN B 1 144 ? 92.523  -22.691 9.683   1.00 55.41  ?  144 ASN B CG    1 
ATOM   4863  O  OD1   . ASN B 1 144 ? 93.436  -23.505 9.620   1.00 57.48  ?  144 ASN B OD1   1 
ATOM   4864  N  ND2   . ASN B 1 144 ? 91.844  -22.458 10.805  1.00 56.01  ?  144 ASN B ND2   1 
ATOM   4865  N  N     . PHE B 1 145 ? 94.389  -19.898 8.321   1.00 45.48  ?  145 PHE B N     1 
ATOM   4866  C  CA    . PHE B 1 145 ? 95.524  -19.182 8.924   1.00 48.31  ?  145 PHE B CA    1 
ATOM   4867  C  C     . PHE B 1 145 ? 96.153  -19.884 10.151  1.00 52.74  ?  145 PHE B C     1 
ATOM   4868  O  O     . PHE B 1 145 ? 97.365  -20.039 10.220  1.00 53.41  ?  145 PHE B O     1 
ATOM   4869  C  CB    . PHE B 1 145 ? 95.107  -17.764 9.289   1.00 50.04  ?  145 PHE B CB    1 
ATOM   4870  C  CG    . PHE B 1 145 ? 93.960  -17.711 10.249  1.00 53.90  ?  145 PHE B CG    1 
ATOM   4871  C  CD1   . PHE B 1 145 ? 94.182  -17.710 11.617  1.00 56.37  ?  145 PHE B CD1   1 
ATOM   4872  C  CD2   . PHE B 1 145 ? 92.662  -17.680 9.789   1.00 54.93  ?  145 PHE B CD2   1 
ATOM   4873  C  CE1   . PHE B 1 145 ? 93.134  -17.673 12.502  1.00 54.56  ?  145 PHE B CE1   1 
ATOM   4874  C  CE2   . PHE B 1 145 ? 91.611  -17.639 10.671  1.00 55.43  ?  145 PHE B CE2   1 
ATOM   4875  C  CZ    . PHE B 1 145 ? 91.848  -17.641 12.030  1.00 54.06  ?  145 PHE B CZ    1 
ATOM   4876  N  N     . ASP B 1 146 ? 95.324  -20.283 11.116  1.00 57.22  ?  146 ASP B N     1 
ATOM   4877  C  CA    . ASP B 1 146 ? 95.739  -21.107 12.253  1.00 63.97  ?  146 ASP B CA    1 
ATOM   4878  C  C     . ASP B 1 146 ? 96.585  -22.300 11.816  1.00 68.76  ?  146 ASP B C     1 
ATOM   4879  O  O     . ASP B 1 146 ? 97.514  -22.713 12.516  1.00 73.94  ?  146 ASP B O     1 
ATOM   4880  C  CB    . ASP B 1 146 ? 94.495  -21.687 12.930  1.00 72.79  ?  146 ASP B CB    1 
ATOM   4881  C  CG    . ASP B 1 146 ? 94.098  -20.946 14.193  1.00 82.54  ?  146 ASP B CG    1 
ATOM   4882  O  OD1   . ASP B 1 146 ? 94.953  -20.235 14.758  1.00 87.61  ?  146 ASP B OD1   1 
ATOM   4883  O  OD2   . ASP B 1 146 ? 92.930  -21.095 14.631  1.00 83.97  ?  146 ASP B OD2   1 
ATOM   4884  N  N     . ASP B 1 147 ? 96.230  -22.863 10.661  1.00 67.48  ?  147 ASP B N     1 
ATOM   4885  C  CA    . ASP B 1 147 ? 96.696  -24.187 10.240  1.00 68.18  ?  147 ASP B CA    1 
ATOM   4886  C  C     . ASP B 1 147 ? 96.081  -25.265 11.117  1.00 63.34  ?  147 ASP B C     1 
ATOM   4887  O  O     . ASP B 1 147 ? 96.646  -26.345 11.268  1.00 63.13  ?  147 ASP B O     1 
ATOM   4888  C  CB    . ASP B 1 147 ? 98.217  -24.292 10.275  1.00 78.13  ?  147 ASP B CB    1 
ATOM   4889  C  CG    . ASP B 1 147 ? 98.859  -23.784 9.006   1.00 89.91  ?  147 ASP B CG    1 
ATOM   4890  O  OD1   . ASP B 1 147 ? 99.869  -23.050 9.098   1.00 99.26  ?  147 ASP B OD1   1 
ATOM   4891  O  OD2   . ASP B 1 147 ? 98.353  -24.121 7.913   1.00 90.48  ?  147 ASP B OD2   1 
ATOM   4892  N  N     . THR B 1 148 ? 94.909  -24.963 11.670  1.00 60.45  ?  148 THR B N     1 
ATOM   4893  C  CA    . THR B 1 148 ? 94.241  -25.840 12.622  1.00 62.41  ?  148 THR B CA    1 
ATOM   4894  C  C     . THR B 1 148 ? 93.002  -26.533 12.053  1.00 62.28  ?  148 THR B C     1 
ATOM   4895  O  O     . THR B 1 148 ? 92.499  -27.497 12.618  1.00 66.36  ?  148 THR B O     1 
ATOM   4896  C  CB    . THR B 1 148 ? 93.824  -25.046 13.864  1.00 66.00  ?  148 THR B CB    1 
ATOM   4897  O  OG1   . THR B 1 148 ? 92.666  -24.250 13.570  1.00 65.08  ?  148 THR B OG1   1 
ATOM   4898  C  CG2   . THR B 1 148 ? 94.967  -24.145 14.303  1.00 66.72  ?  148 THR B CG2   1 
ATOM   4899  N  N     . GLU B 1 149 ? 92.502  -26.036 10.936  1.00 59.86  ?  149 GLU B N     1 
ATOM   4900  C  CA    . GLU B 1 149 ? 91.276  -26.566 10.369  1.00 57.52  ?  149 GLU B CA    1 
ATOM   4901  C  C     . GLU B 1 149 ? 91.341  -26.351 8.868   1.00 53.21  ?  149 GLU B C     1 
ATOM   4902  O  O     . GLU B 1 149 ? 91.910  -25.355 8.406   1.00 53.38  ?  149 GLU B O     1 
ATOM   4903  C  CB    . GLU B 1 149 ? 90.083  -25.823 10.967  1.00 62.32  ?  149 GLU B CB    1 
ATOM   4904  C  CG    . GLU B 1 149 ? 88.733  -26.494 10.798  1.00 71.50  ?  149 GLU B CG    1 
ATOM   4905  C  CD    . GLU B 1 149 ? 87.610  -25.669 11.436  1.00 80.99  ?  149 GLU B CD    1 
ATOM   4906  O  OE1   . GLU B 1 149 ? 87.907  -24.577 11.981  1.00 80.88  ?  149 GLU B OE1   1 
ATOM   4907  O  OE2   . GLU B 1 149 ? 86.434  -26.105 11.393  1.00 85.71  ?  149 GLU B OE2   1 
ATOM   4908  N  N     . LYS B 1 150 ? 90.780  -27.281 8.101   1.00 51.44  ?  150 LYS B N     1 
ATOM   4909  C  CA    . LYS B 1 150 ? 90.710  -27.094 6.653   1.00 47.87  ?  150 LYS B CA    1 
ATOM   4910  C  C     . LYS B 1 150 ? 89.416  -26.376 6.239   1.00 44.13  ?  150 LYS B C     1 
ATOM   4911  O  O     . LYS B 1 150 ? 88.368  -26.557 6.877   1.00 47.58  ?  150 LYS B O     1 
ATOM   4912  C  CB    . LYS B 1 150 ? 90.910  -28.426 5.911   1.00 49.44  ?  150 LYS B CB    1 
ATOM   4913  C  CG    . LYS B 1 150 ? 92.395  -28.813 5.725   1.00 56.42  ?  150 LYS B CG    1 
ATOM   4914  C  CD    . LYS B 1 150 ? 92.605  -29.997 4.769   1.00 59.39  ?  150 LYS B CD    1 
ATOM   4915  C  CE    . LYS B 1 150 ? 93.977  -29.931 4.068   1.00 59.64  ?  150 LYS B CE    1 
ATOM   4916  N  NZ    . LYS B 1 150 ? 93.964  -30.430 2.637   1.00 60.37  ?  150 LYS B NZ    1 
ATOM   4917  N  N     . GLU B 1 151 ? 89.514  -25.525 5.211   1.00 36.96  ?  151 GLU B N     1 
ATOM   4918  C  CA    . GLU B 1 151 ? 88.353  -24.836 4.613   1.00 32.59  ?  151 GLU B CA    1 
ATOM   4919  C  C     . GLU B 1 151 ? 88.342  -25.024 3.117   1.00 32.43  ?  151 GLU B C     1 
ATOM   4920  O  O     . GLU B 1 151 ? 89.394  -25.179 2.503   1.00 34.99  ?  151 GLU B O     1 
ATOM   4921  C  CB    . GLU B 1 151 ? 88.361  -23.331 4.894   1.00 29.71  ?  151 GLU B CB    1 
ATOM   4922  C  CG    . GLU B 1 151 ? 89.587  -22.590 4.374   1.00 66.06  ?  151 GLU B CG    1 
ATOM   4923  C  CD    . GLU B 1 151 ? 89.515  -21.082 4.620   1.00 62.12  ?  151 GLU B CD    1 
ATOM   4924  O  OE1   . GLU B 1 151 ? 90.491  -20.505 5.159   1.00 61.47  ?  151 GLU B OE1   1 
ATOM   4925  O  OE2   . GLU B 1 151 ? 88.482  -20.469 4.262   1.00 58.26  ?  151 GLU B OE2   1 
ATOM   4926  N  N     . PRO B 1 152 ? 87.145  -24.993 2.519   1.00 33.16  ?  152 PRO B N     1 
ATOM   4927  C  CA    . PRO B 1 152 ? 86.998  -25.101 1.066   1.00 37.30  ?  152 PRO B CA    1 
ATOM   4928  C  C     . PRO B 1 152 ? 87.553  -23.878 0.323   1.00 38.74  ?  152 PRO B C     1 
ATOM   4929  O  O     . PRO B 1 152 ? 87.492  -22.728 0.818   1.00 39.59  ?  152 PRO B O     1 
ATOM   4930  C  CB    . PRO B 1 152 ? 85.481  -25.206 0.877   1.00 28.78  ?  152 PRO B CB    1 
ATOM   4931  C  CG    . PRO B 1 152 ? 84.908  -24.538 2.052   1.00 27.01  ?  152 PRO B CG    1 
ATOM   4932  C  CD    . PRO B 1 152 ? 85.844  -24.862 3.194   1.00 35.13  ?  152 PRO B CD    1 
ATOM   4933  N  N     . THR B 1 153 ? 88.103  -24.147 -0.862  1.00 37.77  ?  153 THR B N     1 
ATOM   4934  C  CA    . THR B 1 153 ? 88.652  -23.108 -1.726  1.00 35.87  ?  153 THR B CA    1 
ATOM   4935  C  C     . THR B 1 153 ? 87.603  -22.677 -2.742  1.00 36.41  ?  153 THR B C     1 
ATOM   4936  O  O     . THR B 1 153 ? 87.651  -21.566 -3.263  1.00 41.80  ?  153 THR B O     1 
ATOM   4937  C  CB    . THR B 1 153 ? 89.969  -23.548 -2.419  1.00 38.07  ?  153 THR B CB    1 
ATOM   4938  O  OG1   . THR B 1 153 ? 89.805  -24.822 -3.054  1.00 37.39  ?  153 THR B OG1   1 
ATOM   4939  C  CG2   . THR B 1 153 ? 91.072  -23.666 -1.400  1.00 40.50  ?  153 THR B CG2   1 
ATOM   4940  N  N     . VAL B 1 154 ? 86.649  -23.569 -2.995  1.00 32.89  ?  154 VAL B N     1 
ATOM   4941  C  CA    . VAL B 1 154 ? 85.472  -23.265 -3.799  1.00 26.70  ?  154 VAL B CA    1 
ATOM   4942  C  C     . VAL B 1 154 ? 84.338  -24.155 -3.260  1.00 30.87  ?  154 VAL B C     1 
ATOM   4943  O  O     . VAL B 1 154 ? 84.611  -25.194 -2.679  1.00 31.51  ?  154 VAL B O     1 
ATOM   4944  C  CB    . VAL B 1 154 ? 85.742  -23.521 -5.317  1.00 38.30  ?  154 VAL B CB    1 
ATOM   4945  C  CG1   . VAL B 1 154 ? 86.163  -24.973 -5.571  1.00 28.05  ?  154 VAL B CG1   1 
ATOM   4946  C  CG2   . VAL B 1 154 ? 84.527  -23.171 -6.162  1.00 26.69  ?  154 VAL B CG2   1 
ATOM   4947  N  N     . LEU B 1 155 ? 83.076  -23.759 -3.423  1.00 29.64  ?  155 LEU B N     1 
ATOM   4948  C  CA    . LEU B 1 155 ? 81.966  -24.635 -3.026  1.00 28.48  ?  155 LEU B CA    1 
ATOM   4949  C  C     . LEU B 1 155 ? 81.412  -25.411 -4.215  1.00 33.49  ?  155 LEU B C     1 
ATOM   4950  O  O     . LEU B 1 155 ? 81.597  -25.010 -5.360  1.00 43.06  ?  155 LEU B O     1 
ATOM   4951  C  CB    . LEU B 1 155 ? 80.827  -23.843 -2.381  1.00 25.10  ?  155 LEU B CB    1 
ATOM   4952  C  CG    . LEU B 1 155 ? 81.123  -22.859 -1.257  1.00 26.10  ?  155 LEU B CG    1 
ATOM   4953  C  CD1   . LEU B 1 155 ? 79.844  -22.207 -0.854  1.00 24.83  ?  155 LEU B CD1   1 
ATOM   4954  C  CD2   . LEU B 1 155 ? 81.725  -23.595 -0.099  1.00 24.53  ?  155 LEU B CD2   1 
ATOM   4955  N  N     . PRO B 1 156 ? 80.716  -26.521 -3.942  1.00 33.18  ?  156 PRO B N     1 
ATOM   4956  C  CA    . PRO B 1 156 ? 80.115  -27.386 -4.963  1.00 36.68  ?  156 PRO B CA    1 
ATOM   4957  C  C     . PRO B 1 156 ? 79.161  -26.684 -5.927  1.00 40.27  ?  156 PRO B C     1 
ATOM   4958  O  O     . PRO B 1 156 ? 79.013  -27.167 -7.040  1.00 39.46  ?  156 PRO B O     1 
ATOM   4959  C  CB    . PRO B 1 156 ? 79.365  -28.427 -4.127  1.00 37.13  ?  156 PRO B CB    1 
ATOM   4960  C  CG    . PRO B 1 156 ? 80.189  -28.544 -2.895  1.00 36.74  ?  156 PRO B CG    1 
ATOM   4961  C  CD    . PRO B 1 156 ? 80.609  -27.121 -2.601  1.00 36.79  ?  156 PRO B CD    1 
ATOM   4962  N  N     . ALA B 1 157 ? 78.538  -25.585 -5.506  1.00 40.55  ?  157 ALA B N     1 
ATOM   4963  C  CA    . ALA B 1 157 ? 77.613  -24.795 -6.343  1.00 36.27  ?  157 ALA B CA    1 
ATOM   4964  C  C     . ALA B 1 157 ? 76.632  -25.601 -7.186  1.00 34.43  ?  157 ALA B C     1 
ATOM   4965  O  O     . ALA B 1 157 ? 76.845  -25.775 -8.384  1.00 28.27  ?  157 ALA B O     1 
ATOM   4966  C  CB    . ALA B 1 157 ? 78.384  -23.836 -7.238  1.00 29.76  ?  157 ALA B CB    1 
ATOM   4967  N  N     . ALA B 1 158 ? 75.545  -26.061 -6.580  1.00 37.54  ?  158 ALA B N     1 
ATOM   4968  C  CA    . ALA B 1 158 ? 74.508  -26.777 -7.331  1.00 40.08  ?  158 ALA B CA    1 
ATOM   4969  C  C     . ALA B 1 158 ? 73.650  -25.858 -8.235  1.00 44.33  ?  158 ALA B C     1 
ATOM   4970  O  O     . ALA B 1 158 ? 72.748  -26.331 -8.935  1.00 42.65  ?  158 ALA B O     1 
ATOM   4971  C  CB    . ALA B 1 158 ? 73.627  -27.619 -6.387  1.00 36.24  ?  158 ALA B CB    1 
ATOM   4972  N  N     . PHE B 1 159 ? 73.927  -24.553 -8.203  1.00 46.96  ?  159 PHE B N     1 
ATOM   4973  C  CA    . PHE B 1 159 ? 73.469  -23.623 -9.243  1.00 46.29  ?  159 PHE B CA    1 
ATOM   4974  C  C     . PHE B 1 159 ? 74.529  -22.552 -9.496  1.00 50.80  ?  159 PHE B C     1 
ATOM   4975  O  O     . PHE B 1 159 ? 75.421  -22.363 -8.668  1.00 53.30  ?  159 PHE B O     1 
ATOM   4976  C  CB    . PHE B 1 159 ? 72.122  -22.992 -8.886  1.00 43.06  ?  159 PHE B CB    1 
ATOM   4977  C  CG    . PHE B 1 159 ? 72.185  -22.026 -7.753  1.00 38.30  ?  159 PHE B CG    1 
ATOM   4978  C  CD1   . PHE B 1 159 ? 72.103  -22.469 -6.450  1.00 38.81  ?  159 PHE B CD1   1 
ATOM   4979  C  CD2   . PHE B 1 159 ? 72.315  -20.659 -7.992  1.00 37.36  ?  159 PHE B CD2   1 
ATOM   4980  C  CE1   . PHE B 1 159 ? 72.160  -21.557 -5.397  1.00 41.70  ?  159 PHE B CE1   1 
ATOM   4981  C  CE2   . PHE B 1 159 ? 72.377  -19.744 -6.948  1.00 36.35  ?  159 PHE B CE2   1 
ATOM   4982  C  CZ    . PHE B 1 159 ? 72.300  -20.193 -5.652  1.00 38.92  ?  159 PHE B CZ    1 
ATOM   4983  N  N     . PRO B 1 160 ? 74.438  -21.848 -10.641 1.00 54.66  ?  160 PRO B N     1 
ATOM   4984  C  CA    . PRO B 1 160 ? 75.443  -20.874 -11.117 1.00 54.35  ?  160 PRO B CA    1 
ATOM   4985  C  C     . PRO B 1 160 ? 75.310  -19.494 -10.458 1.00 51.84  ?  160 PRO B C     1 
ATOM   4986  O  O     . PRO B 1 160 ? 74.647  -18.592 -10.979 1.00 49.37  ?  160 PRO B O     1 
ATOM   4987  C  CB    . PRO B 1 160 ? 75.150  -20.764 -12.620 1.00 53.84  ?  160 PRO B CB    1 
ATOM   4988  C  CG    . PRO B 1 160 ? 73.981  -21.698 -12.897 1.00 57.67  ?  160 PRO B CG    1 
ATOM   4989  C  CD    . PRO B 1 160 ? 73.318  -21.966 -11.582 1.00 57.10  ?  160 PRO B CD    1 
ATOM   4990  N  N     . ASN B 1 161 ? 75.959  -19.345 -9.311  1.00 49.76  ?  161 ASN B N     1 
ATOM   4991  C  CA    . ASN B 1 161 ? 75.752  -18.200 -8.441  1.00 45.93  ?  161 ASN B CA    1 
ATOM   4992  C  C     . ASN B 1 161 ? 76.398  -16.920 -8.991  1.00 46.45  ?  161 ASN B C     1 
ATOM   4993  O  O     . ASN B 1 161 ? 75.982  -15.807 -8.659  1.00 50.43  ?  161 ASN B O     1 
ATOM   4994  C  CB    . ASN B 1 161 ? 76.281  -18.532 -7.028  1.00 42.59  ?  161 ASN B CB    1 
ATOM   4995  C  CG    . ASN B 1 161 ? 75.774  -17.574 -5.974  1.00 44.66  ?  161 ASN B CG    1 
ATOM   4996  O  OD1   . ASN B 1 161 ? 74.593  -17.612 -5.630  1.00 49.54  ?  161 ASN B OD1   1 
ATOM   4997  N  ND2   . ASN B 1 161 ? 76.656  -16.704 -5.455  1.00 39.43  ?  161 ASN B ND2   1 
ATOM   4998  N  N     . LEU B 1 162 ? 77.421  -17.069 -9.823  1.00 40.71  ?  162 LEU B N     1 
ATOM   4999  C  CA    . LEU B 1 162 ? 78.081  -15.894 -10.380 1.00 39.10  ?  162 LEU B CA    1 
ATOM   5000  C  C     . LEU B 1 162 ? 77.102  -15.050 -11.188 1.00 43.79  ?  162 LEU B C     1 
ATOM   5001  O  O     . LEU B 1 162 ? 77.065  -13.828 -11.065 1.00 46.70  ?  162 LEU B O     1 
ATOM   5002  C  CB    . LEU B 1 162 ? 79.248  -16.297 -11.260 1.00 27.78  ?  162 LEU B CB    1 
ATOM   5003  C  CG    . LEU B 1 162 ? 80.456  -15.391 -11.131 1.00 27.76  ?  162 LEU B CG    1 
ATOM   5004  C  CD1   . LEU B 1 162 ? 80.965  -15.031 -12.500 1.00 28.42  ?  162 LEU B CD1   1 
ATOM   5005  C  CD2   . LEU B 1 162 ? 80.063  -14.168 -10.381 1.00 43.28  ?  162 LEU B CD2   1 
ATOM   5006  N  N     . LEU B 1 163 ? 76.293  -15.707 -12.009 1.00 41.84  ?  163 LEU B N     1 
ATOM   5007  C  CA    . LEU B 1 163 ? 75.325  -14.990 -12.824 1.00 37.62  ?  163 LEU B CA    1 
ATOM   5008  C  C     . LEU B 1 163 ? 74.061  -14.634 -12.077 1.00 39.93  ?  163 LEU B C     1 
ATOM   5009  O  O     . LEU B 1 163 ? 73.526  -13.548 -12.263 1.00 46.04  ?  163 LEU B O     1 
ATOM   5010  C  CB    . LEU B 1 163 ? 74.986  -15.765 -14.101 1.00 35.02  ?  163 LEU B CB    1 
ATOM   5011  C  CG    . LEU B 1 163 ? 76.094  -15.628 -15.144 1.00 37.94  ?  163 LEU B CG    1 
ATOM   5012  C  CD1   . LEU B 1 163 ? 75.715  -16.464 -16.321 1.00 39.33  ?  163 LEU B CD1   1 
ATOM   5013  C  CD2   . LEU B 1 163 ? 76.370  -14.164 -15.541 1.00 30.26  ?  163 LEU B CD2   1 
ATOM   5014  N  N     . VAL B 1 164 ? 73.584  -15.542 -11.234 1.00 38.35  ?  164 VAL B N     1 
ATOM   5015  C  CA    . VAL B 1 164 ? 72.316  -15.330 -10.539 1.00 36.97  ?  164 VAL B CA    1 
ATOM   5016  C  C     . VAL B 1 164 ? 72.360  -14.176 -9.533  1.00 38.46  ?  164 VAL B C     1 
ATOM   5017  O  O     . VAL B 1 164 ? 71.466  -13.321 -9.496  1.00 40.03  ?  164 VAL B O     1 
ATOM   5018  C  CB    . VAL B 1 164 ? 71.834  -16.592 -9.825  1.00 31.10  ?  164 VAL B CB    1 
ATOM   5019  C  CG1   . VAL B 1 164 ? 70.816  -16.217 -8.791  1.00 31.76  ?  164 VAL B CG1   1 
ATOM   5020  C  CG2   . VAL B 1 164 ? 71.241  -17.594 -10.814 1.00 29.08  ?  164 VAL B CG2   1 
ATOM   5021  N  N     . ASN B 1 165 ? 73.403  -14.143 -8.720  1.00 34.48  ?  165 ASN B N     1 
ATOM   5022  C  CA    . ASN B 1 165 ? 73.497  -13.107 -7.704  1.00 35.91  ?  165 ASN B CA    1 
ATOM   5023  C  C     . ASN B 1 165 ? 74.385  -11.940 -8.087  1.00 40.55  ?  165 ASN B C     1 
ATOM   5024  O  O     . ASN B 1 165 ? 74.182  -10.821 -7.630  1.00 47.41  ?  165 ASN B O     1 
ATOM   5025  C  CB    . ASN B 1 165 ? 73.927  -13.701 -6.369  1.00 35.41  ?  165 ASN B CB    1 
ATOM   5026  C  CG    . ASN B 1 165 ? 72.760  -14.204 -5.564  1.00 33.20  ?  165 ASN B CG    1 
ATOM   5027  O  OD1   . ASN B 1 165 ? 71.667  -13.635 -5.611  1.00 32.90  ?  165 ASN B OD1   1 
ATOM   5028  N  ND2   . ASN B 1 165 ? 72.981  -15.277 -4.811  1.00 27.24  ?  165 ASN B ND2   1 
ATOM   5029  N  N     . GLY B 1 166 ? 75.373  -12.198 -8.923  1.00 34.58  ?  166 GLY B N     1 
ATOM   5030  C  CA    . GLY B 1 166 ? 76.189  -11.116 -9.417  1.00 34.03  ?  166 GLY B CA    1 
ATOM   5031  C  C     . GLY B 1 166 ? 77.384  -10.924 -8.531  1.00 32.43  ?  166 GLY B C     1 
ATOM   5032  O  O     . GLY B 1 166 ? 77.710  -11.808 -7.745  1.00 34.51  ?  166 GLY B O     1 
ATOM   5033  N  N     . SER B 1 167 ? 78.035  -9.774  -8.662  1.00 31.80  ?  167 SER B N     1 
ATOM   5034  C  CA    . SER B 1 167 ? 79.256  -9.499  -7.934  1.00 38.99  ?  167 SER B CA    1 
ATOM   5035  C  C     . SER B 1 167 ? 79.656  -8.087  -8.234  1.00 38.72  ?  167 SER B C     1 
ATOM   5036  O  O     . SER B 1 167 ? 79.138  -7.507  -9.168  1.00 45.12  ?  167 SER B O     1 
ATOM   5037  C  CB    . SER B 1 167 ? 80.372  -10.453 -8.347  1.00 43.78  ?  167 SER B CB    1 
ATOM   5038  O  OG    . SER B 1 167 ? 81.220  -10.732 -7.242  1.00 44.49  ?  167 SER B OG    1 
ATOM   5039  N  N     . THR B 1 168 ? 80.601  -7.552  -7.462  1.00 40.13  ?  168 THR B N     1 
ATOM   5040  C  CA    . THR B 1 168 ? 80.923  -6.125  -7.468  1.00 36.68  ?  168 THR B CA    1 
ATOM   5041  C  C     . THR B 1 168 ? 81.656  -5.836  -6.164  1.00 36.69  ?  168 THR B C     1 
ATOM   5042  O  O     . THR B 1 168 ? 81.041  -5.984  -5.116  1.00 46.59  ?  168 THR B O     1 
ATOM   5043  C  CB    . THR B 1 168 ? 79.583  -5.324  -7.513  1.00 48.50  ?  168 THR B CB    1 
ATOM   5044  O  OG1   . THR B 1 168 ? 79.707  -4.067  -6.838  1.00 29.96  ?  168 THR B OG1   1 
ATOM   5045  C  CG2   . THR B 1 168 ? 78.437  -6.140  -6.856  1.00 29.04  ?  168 THR B CG2   1 
ATOM   5046  N  N     . GLY B 1 169 ? 82.953  -5.509  -6.152  1.00 31.58  ?  169 GLY B N     1 
ATOM   5047  C  CA    . GLY B 1 169 ? 83.885  -5.583  -7.258  1.00 34.74  ?  169 GLY B CA    1 
ATOM   5048  C  C     . GLY B 1 169 ? 84.909  -4.442  -7.357  1.00 45.27  ?  169 GLY B C     1 
ATOM   5049  O  O     . GLY B 1 169 ? 84.834  -3.661  -8.319  1.00 57.43  ?  169 GLY B O     1 
ATOM   5050  N  N     . ILE B 1 170 ? 85.845  -4.315  -6.401  1.00 39.48  ?  170 ILE B N     1 
ATOM   5051  C  CA    . ILE B 1 170 ? 86.976  -3.353  -6.553  1.00 35.45  ?  170 ILE B CA    1 
ATOM   5052  C  C     . ILE B 1 170 ? 88.326  -3.789  -5.971  1.00 39.43  ?  170 ILE B C     1 
ATOM   5053  O  O     . ILE B 1 170 ? 88.502  -3.861  -4.766  1.00 46.23  ?  170 ILE B O     1 
ATOM   5054  C  CB    . ILE B 1 170 ? 86.727  -1.939  -5.971  1.00 31.26  ?  170 ILE B CB    1 
ATOM   5055  C  CG1   . ILE B 1 170 ? 85.329  -1.408  -6.274  1.00 53.23  ?  170 ILE B CG1   1 
ATOM   5056  C  CG2   . ILE B 1 170 ? 87.763  -0.997  -6.512  1.00 32.25  ?  170 ILE B CG2   1 
ATOM   5057  C  CD1   . ILE B 1 170 ? 85.139  0.030   -5.838  1.00 32.33  ?  170 ILE B CD1   1 
ATOM   5058  N  N     . SER B 1 171 ? 89.298  -4.000  -6.841  1.00 40.48  ?  171 SER B N     1 
ATOM   5059  C  CA    . SER B 1 171 ? 90.565  -4.611  -6.476  1.00 44.55  ?  171 SER B CA    1 
ATOM   5060  C  C     . SER B 1 171 ? 91.737  -3.685  -6.797  1.00 50.84  ?  171 SER B C     1 
ATOM   5061  O  O     . SER B 1 171 ? 91.631  -2.468  -6.670  1.00 56.23  ?  171 SER B O     1 
ATOM   5062  C  CB    . SER B 1 171 ? 90.711  -5.928  -7.245  1.00 47.96  ?  171 SER B CB    1 
ATOM   5063  O  OG    . SER B 1 171 ? 91.902  -6.600  -6.910  1.00 52.14  ?  171 SER B OG    1 
ATOM   5064  N  N     . ALA B 1 172 ? 92.855  -4.274  -7.210  1.00 52.67  ?  172 ALA B N     1 
ATOM   5065  C  CA    . ALA B 1 172 ? 94.027  -3.521  -7.647  1.00 54.18  ?  172 ALA B CA    1 
ATOM   5066  C  C     . ALA B 1 172 ? 94.291  -3.860  -9.096  1.00 56.72  ?  172 ALA B C     1 
ATOM   5067  O  O     . ALA B 1 172 ? 94.672  -4.984  -9.410  1.00 56.07  ?  172 ALA B O     1 
ATOM   5068  C  CB    . ALA B 1 172 ? 95.247  -3.884  -6.810  1.00 56.10  ?  172 ALA B CB    1 
ATOM   5069  N  N     . GLY B 1 173 ? 94.085  -2.893  -9.980  1.00 59.93  ?  173 GLY B N     1 
ATOM   5070  C  CA    . GLY B 1 173 ? 94.329  -3.108  -11.394 1.00 59.96  ?  173 GLY B CA    1 
ATOM   5071  C  C     . GLY B 1 173 ? 93.126  -3.693  -12.100 1.00 59.11  ?  173 GLY B C     1 
ATOM   5072  O  O     . GLY B 1 173 ? 92.990  -3.579  -13.321 1.00 63.26  ?  173 GLY B O     1 
ATOM   5073  N  N     . TYR B 1 174 ? 92.254  -4.332  -11.325 1.00 55.22  ?  174 TYR B N     1 
ATOM   5074  C  CA    . TYR B 1 174 ? 91.012  -4.882  -11.854 1.00 52.71  ?  174 TYR B CA    1 
ATOM   5075  C  C     . TYR B 1 174 ? 89.840  -4.490  -10.966 1.00 49.58  ?  174 TYR B C     1 
ATOM   5076  O  O     . TYR B 1 174 ? 90.008  -4.220  -9.786  1.00 51.26  ?  174 TYR B O     1 
ATOM   5077  C  CB    . TYR B 1 174 ? 91.081  -6.411  -11.962 1.00 51.52  ?  174 TYR B CB    1 
ATOM   5078  C  CG    . TYR B 1 174 ? 92.222  -6.942  -12.801 1.00 52.79  ?  174 TYR B CG    1 
ATOM   5079  C  CD1   . TYR B 1 174 ? 92.035  -7.275  -14.133 1.00 55.70  ?  174 TYR B CD1   1 
ATOM   5080  C  CD2   . TYR B 1 174 ? 93.485  -7.122  -12.256 1.00 53.02  ?  174 TYR B CD2   1 
ATOM   5081  C  CE1   . TYR B 1 174 ? 93.072  -7.770  -14.899 1.00 59.25  ?  174 TYR B CE1   1 
ATOM   5082  C  CE2   . TYR B 1 174 ? 94.530  -7.611  -13.015 1.00 54.88  ?  174 TYR B CE2   1 
ATOM   5083  C  CZ    . TYR B 1 174 ? 94.319  -7.935  -14.336 1.00 59.29  ?  174 TYR B CZ    1 
ATOM   5084  O  OH    . TYR B 1 174 ? 95.361  -8.429  -15.095 1.00 63.36  ?  174 TYR B OH    1 
ATOM   5085  N  N     . ALA B 1 175 ? 88.652  -4.458  -11.549 1.00 44.05  ?  175 ALA B N     1 
ATOM   5086  C  CA    . ALA B 1 175 ? 87.432  -4.272  -10.789 1.00 38.52  ?  175 ALA B CA    1 
ATOM   5087  C  C     . ALA B 1 175 ? 86.379  -5.175  -11.423 1.00 44.47  ?  175 ALA B C     1 
ATOM   5088  O  O     . ALA B 1 175 ? 86.585  -5.679  -12.528 1.00 52.25  ?  175 ALA B O     1 
ATOM   5089  C  CB    . ALA B 1 175 ? 87.010  -2.820  -10.830 1.00 35.34  ?  175 ALA B CB    1 
ATOM   5090  N  N     . THR B 1 176 ? 85.266  -5.404  -10.733 1.00 40.47  ?  176 THR B N     1 
ATOM   5091  C  CA    . THR B 1 176 ? 84.222  -6.282  -11.262 1.00 38.32  ?  176 THR B CA    1 
ATOM   5092  C  C     . THR B 1 176 ? 82.812  -5.784  -10.987 1.00 43.79  ?  176 THR B C     1 
ATOM   5093  O  O     . THR B 1 176 ? 82.491  -5.373  -9.866  1.00 45.97  ?  176 THR B O     1 
ATOM   5094  C  CB    . THR B 1 176 ? 84.350  -7.742  -10.752 1.00 38.80  ?  176 THR B CB    1 
ATOM   5095  O  OG1   . THR B 1 176 ? 83.395  -8.564  -11.426 1.00 43.94  ?  176 THR B OG1   1 
ATOM   5096  C  CG2   . THR B 1 176 ? 84.092  -7.839  -9.262  1.00 39.57  ?  176 THR B CG2   1 
ATOM   5097  N  N     . ASP B 1 177 ? 81.988  -5.810  -12.034 1.00 46.18  ?  177 ASP B N     1 
ATOM   5098  C  CA    . ASP B 1 177 ? 80.557  -5.556  -11.918 1.00 48.33  ?  177 ASP B CA    1 
ATOM   5099  C  C     . ASP B 1 177 ? 79.812  -6.563  -12.765 1.00 42.24  ?  177 ASP B C     1 
ATOM   5100  O  O     . ASP B 1 177 ? 79.907  -6.554  -13.978 1.00 43.31  ?  177 ASP B O     1 
ATOM   5101  C  CB    . ASP B 1 177 ? 80.201  -4.128  -12.332 1.00 61.18  ?  177 ASP B CB    1 
ATOM   5102  C  CG    . ASP B 1 177 ? 80.336  -3.132  -11.183 1.00 74.89  ?  177 ASP B CG    1 
ATOM   5103  O  OD1   . ASP B 1 177 ? 79.338  -2.950  -10.445 1.00 81.52  ?  177 ASP B OD1   1 
ATOM   5104  O  OD2   . ASP B 1 177 ? 81.432  -2.538  -11.017 1.00 77.73  ?  177 ASP B OD2   1 
ATOM   5105  N  N     . ILE B 1 178 ? 79.110  -7.466  -12.097 1.00 39.18  ?  178 ILE B N     1 
ATOM   5106  C  CA    . ILE B 1 178 ? 78.299  -8.470  -12.755 1.00 34.81  ?  178 ILE B CA    1 
ATOM   5107  C  C     . ILE B 1 178 ? 76.898  -8.335  -12.193 1.00 38.03  ?  178 ILE B C     1 
ATOM   5108  O  O     . ILE B 1 178 ? 76.710  -8.404  -10.983 1.00 42.97  ?  178 ILE B O     1 
ATOM   5109  C  CB    . ILE B 1 178 ? 78.819  -9.881  -12.463 1.00 31.22  ?  178 ILE B CB    1 
ATOM   5110  C  CG1   . ILE B 1 178 ? 80.305  -9.972  -12.800 1.00 32.55  ?  178 ILE B CG1   1 
ATOM   5111  C  CG2   . ILE B 1 178 ? 78.029  -10.908 -13.248 1.00 29.71  ?  178 ILE B CG2   1 
ATOM   5112  C  CD1   . ILE B 1 178 ? 80.838  -11.375 -12.858 1.00 29.35  ?  178 ILE B CD1   1 
ATOM   5113  N  N     . PRO B 1 179 ? 75.907  -8.114  -13.065 1.00 38.66  ?  179 PRO B N     1 
ATOM   5114  C  CA    . PRO B 1 179 ? 74.530  -7.912  -12.595 1.00 38.76  ?  179 PRO B CA    1 
ATOM   5115  C  C     . PRO B 1 179 ? 73.872  -9.243  -12.271 1.00 36.69  ?  179 PRO B C     1 
ATOM   5116  O  O     . PRO B 1 179 ? 74.364  -10.274 -12.719 1.00 38.40  ?  179 PRO B O     1 
ATOM   5117  C  CB    . PRO B 1 179 ? 73.847  -7.257  -13.796 1.00 40.79  ?  179 PRO B CB    1 
ATOM   5118  C  CG    . PRO B 1 179 ? 74.601  -7.781  -14.962 1.00 40.16  ?  179 PRO B CG    1 
ATOM   5119  C  CD    . PRO B 1 179 ? 76.029  -7.970  -14.523 1.00 38.39  ?  179 PRO B CD    1 
ATOM   5120  N  N     . PRO B 1 180 ? 72.790  -9.230  -11.482 1.00 36.30  ?  180 PRO B N     1 
ATOM   5121  C  CA    . PRO B 1 180 ? 72.102  -10.487 -11.171 1.00 35.36  ?  180 PRO B CA    1 
ATOM   5122  C  C     . PRO B 1 180 ? 71.290  -10.950 -12.356 1.00 37.59  ?  180 PRO B C     1 
ATOM   5123  O  O     . PRO B 1 180 ? 71.014  -10.170 -13.268 1.00 38.20  ?  180 PRO B O     1 
ATOM   5124  C  CB    . PRO B 1 180 ? 71.156  -10.114 -10.025 1.00 39.08  ?  180 PRO B CB    1 
ATOM   5125  C  CG    . PRO B 1 180 ? 71.648  -8.798  -9.519  1.00 45.15  ?  180 PRO B CG    1 
ATOM   5126  C  CD    . PRO B 1 180 ? 72.272  -8.106  -10.694 1.00 42.72  ?  180 PRO B CD    1 
ATOM   5127  N  N     . HIS B 1 181 ? 70.902  -12.216 -12.325 1.00 37.81  ?  181 HIS B N     1 
ATOM   5128  C  CA    . HIS B 1 181 ? 70.164  -12.824 -13.411 1.00 38.70  ?  181 HIS B CA    1 
ATOM   5129  C  C     . HIS B 1 181 ? 69.092  -13.746 -12.873 1.00 44.46  ?  181 HIS B C     1 
ATOM   5130  O  O     . HIS B 1 181 ? 69.198  -14.249 -11.762 1.00 46.89  ?  181 HIS B O     1 
ATOM   5131  C  CB    . HIS B 1 181 ? 71.112  -13.609 -14.316 1.00 35.04  ?  181 HIS B CB    1 
ATOM   5132  C  CG    . HIS B 1 181 ? 72.012  -12.745 -15.140 1.00 38.91  ?  181 HIS B CG    1 
ATOM   5133  N  ND1   . HIS B 1 181 ? 73.159  -12.174 -14.640 1.00 37.84  ?  181 HIS B ND1   1 
ATOM   5134  C  CD2   . HIS B 1 181 ? 71.931  -12.350 -16.431 1.00 43.29  ?  181 HIS B CD2   1 
ATOM   5135  C  CE1   . HIS B 1 181 ? 73.752  -11.471 -15.587 1.00 38.05  ?  181 HIS B CE1   1 
ATOM   5136  N  NE2   . HIS B 1 181 ? 73.027  -11.563 -16.683 1.00 42.59  ?  181 HIS B NE2   1 
ATOM   5137  N  N     . ASN B 1 182 ? 68.058  -13.974 -13.674 1.00 42.76  ?  182 ASN B N     1 
ATOM   5138  C  CA    . ASN B 1 182 ? 66.982  -14.861 -13.273 1.00 40.71  ?  182 ASN B CA    1 
ATOM   5139  C  C     . ASN B 1 182 ? 67.471  -16.310 -13.181 1.00 40.30  ?  182 ASN B C     1 
ATOM   5140  O  O     . ASN B 1 182 ? 68.008  -16.855 -14.143 1.00 35.39  ?  182 ASN B O     1 
ATOM   5141  C  CB    . ASN B 1 182 ? 65.824  -14.726 -14.248 1.00 39.00  ?  182 ASN B CB    1 
ATOM   5142  C  CG    . ASN B 1 182 ? 64.614  -15.514 -13.824 1.00 42.60  ?  182 ASN B CG    1 
ATOM   5143  O  OD1   . ASN B 1 182 ? 64.563  -16.738 -13.981 1.00 42.55  ?  182 ASN B OD1   1 
ATOM   5144  N  ND2   . ASN B 1 182 ? 63.619  -14.815 -13.290 1.00 44.14  ?  182 ASN B ND2   1 
ATOM   5145  N  N     . LEU B 1 183 ? 67.310  -16.926 -12.013 1.00 40.90  ?  183 LEU B N     1 
ATOM   5146  C  CA    . LEU B 1 183 ? 67.803  -18.289 -11.806 1.00 39.78  ?  183 LEU B CA    1 
ATOM   5147  C  C     . LEU B 1 183 ? 67.457  -19.229 -12.975 1.00 38.44  ?  183 LEU B C     1 
ATOM   5148  O  O     . LEU B 1 183 ? 68.347  -19.820 -13.588 1.00 35.41  ?  183 LEU B O     1 
ATOM   5149  C  CB    . LEU B 1 183 ? 67.262  -18.836 -10.486 1.00 42.78  ?  183 LEU B CB    1 
ATOM   5150  C  CG    . LEU B 1 183 ? 67.861  -20.068 -9.800  1.00 39.40  ?  183 LEU B CG    1 
ATOM   5151  C  CD1   . LEU B 1 183 ? 67.085  -21.298 -10.165 1.00 41.57  ?  183 LEU B CD1   1 
ATOM   5152  C  CD2   . LEU B 1 183 ? 69.314  -20.243 -10.163 1.00 39.09  ?  183 LEU B CD2   1 
ATOM   5153  N  N     . ALA B 1 184 ? 66.169  -19.355 -13.293 1.00 39.51  ?  184 ALA B N     1 
ATOM   5154  C  CA    . ALA B 1 184 ? 65.729  -20.257 -14.365 1.00 37.36  ?  184 ALA B CA    1 
ATOM   5155  C  C     . ALA B 1 184 ? 66.342  -19.953 -15.734 1.00 36.70  ?  184 ALA B C     1 
ATOM   5156  O  O     . ALA B 1 184 ? 66.788  -20.859 -16.426 1.00 38.70  ?  184 ALA B O     1 
ATOM   5157  C  CB    . ALA B 1 184 ? 64.229  -20.262 -14.465 1.00 38.34  ?  184 ALA B CB    1 
ATOM   5158  N  N     . GLU B 1 185 ? 66.352  -18.685 -16.135 1.00 37.59  ?  185 GLU B N     1 
ATOM   5159  C  CA    . GLU B 1 185 ? 67.013  -18.313 -17.379 1.00 33.00  ?  185 GLU B CA    1 
ATOM   5160  C  C     . GLU B 1 185 ? 68.461  -18.785 -17.436 1.00 43.71  ?  185 GLU B C     1 
ATOM   5161  O  O     . GLU B 1 185 ? 68.871  -19.401 -18.425 1.00 42.71  ?  185 GLU B O     1 
ATOM   5162  C  CB    . GLU B 1 185 ? 66.917  -16.821 -17.619 1.00 33.11  ?  185 GLU B CB    1 
ATOM   5163  C  CG    . GLU B 1 185 ? 65.502  -16.397 -17.922 1.00 54.94  ?  185 GLU B CG    1 
ATOM   5164  C  CD    . GLU B 1 185 ? 65.339  -14.894 -18.015 1.00 53.68  ?  185 GLU B CD    1 
ATOM   5165  O  OE1   . GLU B 1 185 ? 66.360  -14.170 -17.907 1.00 54.35  ?  185 GLU B OE1   1 
ATOM   5166  O  OE2   . GLU B 1 185 ? 64.180  -14.443 -18.173 1.00 46.94  ?  185 GLU B OE2   1 
ATOM   5167  N  N     . VAL B 1 186 ? 69.230  -18.522 -16.379 1.00 31.84  ?  186 VAL B N     1 
ATOM   5168  C  CA    . VAL B 1 186 ? 70.617  -18.973 -16.335 1.00 31.44  ?  186 VAL B CA    1 
ATOM   5169  C  C     . VAL B 1 186 ? 70.732  -20.485 -16.473 1.00 38.65  ?  186 VAL B C     1 
ATOM   5170  O  O     . VAL B 1 186 ? 71.607  -20.981 -17.168 1.00 41.43  ?  186 VAL B O     1 
ATOM   5171  C  CB    . VAL B 1 186 ? 71.347  -18.551 -15.050 1.00 41.62  ?  186 VAL B CB    1 
ATOM   5172  C  CG1   . VAL B 1 186 ? 72.806  -19.021 -15.096 1.00 30.34  ?  186 VAL B CG1   1 
ATOM   5173  C  CG2   . VAL B 1 186 ? 71.293  -17.063 -14.879 1.00 40.47  ?  186 VAL B CG2   1 
ATOM   5174  N  N     . ILE B 1 187 ? 69.860  -21.221 -15.802 1.00 35.95  ?  187 ILE B N     1 
ATOM   5175  C  CA    . ILE B 1 187 ? 69.934  -22.670 -15.861 1.00 37.24  ?  187 ILE B CA    1 
ATOM   5176  C  C     . ILE B 1 187 ? 69.565  -23.149 -17.253 1.00 41.42  ?  187 ILE B C     1 
ATOM   5177  O  O     . ILE B 1 187 ? 70.267  -23.962 -17.850 1.00 43.90  ?  187 ILE B O     1 
ATOM   5178  C  CB    . ILE B 1 187 ? 69.040  -23.319 -14.808 1.00 31.84  ?  187 ILE B CB    1 
ATOM   5179  C  CG1   . ILE B 1 187 ? 69.651  -23.126 -13.426 1.00 31.04  ?  187 ILE B CG1   1 
ATOM   5180  C  CG2   . ILE B 1 187 ? 68.901  -24.794 -15.055 1.00 32.34  ?  187 ILE B CG2   1 
ATOM   5181  C  CD1   . ILE B 1 187 ? 69.014  -23.984 -12.405 1.00 31.23  ?  187 ILE B CD1   1 
ATOM   5182  N  N     . ASP B 1 188 ? 68.471  -22.624 -17.782 1.00 41.47  ?  188 ASP B N     1 
ATOM   5183  C  CA    . ASP B 1 188 ? 68.097  -22.898 -19.162 1.00 43.63  ?  188 ASP B CA    1 
ATOM   5184  C  C     . ASP B 1 188 ? 69.281  -22.714 -20.121 1.00 44.41  ?  188 ASP B C     1 
ATOM   5185  O  O     . ASP B 1 188 ? 69.561  -23.595 -20.945 1.00 50.13  ?  188 ASP B O     1 
ATOM   5186  C  CB    . ASP B 1 188 ? 66.875  -22.068 -19.561 1.00 49.60  ?  188 ASP B CB    1 
ATOM   5187  C  CG    . ASP B 1 188 ? 65.611  -22.525 -18.833 1.00 57.45  ?  188 ASP B CG    1 
ATOM   5188  O  OD1   . ASP B 1 188 ? 65.652  -23.622 -18.213 1.00 58.40  ?  188 ASP B OD1   1 
ATOM   5189  O  OD2   . ASP B 1 188 ? 64.584  -21.805 -18.884 1.00 60.33  ?  188 ASP B OD2   1 
ATOM   5190  N  N     . ALA B 1 189 ? 69.992  -21.598 -19.996 1.00 38.41  ?  189 ALA B N     1 
ATOM   5191  C  CA    . ALA B 1 189 ? 71.228  -21.414 -20.751 1.00 35.40  ?  189 ALA B CA    1 
ATOM   5192  C  C     . ALA B 1 189 ? 72.219  -22.552 -20.494 1.00 33.73  ?  189 ALA B C     1 
ATOM   5193  O  O     . ALA B 1 189 ? 72.522  -23.329 -21.386 1.00 35.44  ?  189 ALA B O     1 
ATOM   5194  C  CB    . ALA B 1 189 ? 71.866  -20.070 -20.427 1.00 37.22  ?  189 ALA B CB    1 
ATOM   5195  N  N     . ALA B 1 190 ? 72.722  -22.642 -19.268 1.00 34.14  ?  190 ALA B N     1 
ATOM   5196  C  CA    . ALA B 1 190 ? 73.679  -23.681 -18.893 1.00 38.17  ?  190 ALA B CA    1 
ATOM   5197  C  C     . ALA B 1 190 ? 73.285  -25.064 -19.427 1.00 35.01  ?  190 ALA B C     1 
ATOM   5198  O  O     . ALA B 1 190 ? 74.121  -25.816 -19.945 1.00 33.80  ?  190 ALA B O     1 
ATOM   5199  C  CB    . ALA B 1 190 ? 73.838  -23.732 -17.376 1.00 31.85  ?  190 ALA B CB    1 
ATOM   5200  N  N     . VAL B 1 191 ? 72.015  -25.415 -19.284 1.00 33.69  ?  191 VAL B N     1 
ATOM   5201  C  CA    . VAL B 1 191 ? 71.583  -26.727 -19.723 1.00 36.43  ?  191 VAL B CA    1 
ATOM   5202  C  C     . VAL B 1 191 ? 71.781  -26.895 -21.230 1.00 41.01  ?  191 VAL B C     1 
ATOM   5203  O  O     . VAL B 1 191 ? 72.248  -27.946 -21.676 1.00 42.18  ?  191 VAL B O     1 
ATOM   5204  C  CB    . VAL B 1 191 ? 70.140  -27.024 -19.291 1.00 37.20  ?  191 VAL B CB    1 
ATOM   5205  C  CG1   . VAL B 1 191 ? 69.531  -28.136 -20.146 1.00 35.73  ?  191 VAL B CG1   1 
ATOM   5206  C  CG2   . VAL B 1 191 ? 70.125  -27.374 -17.797 1.00 33.99  ?  191 VAL B CG2   1 
ATOM   5207  N  N     . TYR B 1 192 ? 71.454  -25.851 -21.996 1.00 43.42  ?  192 TYR B N     1 
ATOM   5208  C  CA    . TYR B 1 192 ? 71.640  -25.857 -23.450 1.00 42.34  ?  192 TYR B CA    1 
ATOM   5209  C  C     . TYR B 1 192 ? 73.098  -26.037 -23.840 1.00 39.88  ?  192 TYR B C     1 
ATOM   5210  O  O     . TYR B 1 192 ? 73.421  -26.804 -24.728 1.00 39.91  ?  192 TYR B O     1 
ATOM   5211  C  CB    . TYR B 1 192 ? 71.115  -24.560 -24.075 1.00 42.96  ?  192 TYR B CB    1 
ATOM   5212  C  CG    . TYR B 1 192 ? 71.203  -24.543 -25.585 1.00 37.81  ?  192 TYR B CG    1 
ATOM   5213  C  CD1   . TYR B 1 192 ? 72.355  -24.119 -26.230 1.00 43.40  ?  192 TYR B CD1   1 
ATOM   5214  C  CD2   . TYR B 1 192 ? 70.135  -24.958 -26.365 1.00 47.05  ?  192 TYR B CD2   1 
ATOM   5215  C  CE1   . TYR B 1 192 ? 72.441  -24.109 -27.613 1.00 43.60  ?  192 TYR B CE1   1 
ATOM   5216  C  CE2   . TYR B 1 192 ? 70.212  -24.955 -27.747 1.00 46.46  ?  192 TYR B CE2   1 
ATOM   5217  C  CZ    . TYR B 1 192 ? 71.367  -24.531 -28.366 1.00 45.18  ?  192 TYR B CZ    1 
ATOM   5218  O  OH    . TYR B 1 192 ? 71.440  -24.526 -29.741 1.00 45.12  ?  192 TYR B OH    1 
ATOM   5219  N  N     . MET B 1 193 ? 73.972  -25.301 -23.174 1.00 40.23  ?  193 MET B N     1 
ATOM   5220  C  CA    . MET B 1 193 ? 75.401  -25.373 -23.428 1.00 43.28  ?  193 MET B CA    1 
ATOM   5221  C  C     . MET B 1 193 ? 75.987  -26.741 -23.063 1.00 44.90  ?  193 MET B C     1 
ATOM   5222  O  O     . MET B 1 193 ? 77.052  -27.131 -23.542 1.00 46.76  ?  193 MET B O     1 
ATOM   5223  C  CB    . MET B 1 193 ? 76.117  -24.259 -22.659 1.00 41.49  ?  193 MET B CB    1 
ATOM   5224  C  CG    . MET B 1 193 ? 77.619  -24.317 -22.765 1.00 40.22  ?  193 MET B CG    1 
ATOM   5225  S  SD    . MET B 1 193 ? 78.390  -22.701 -22.656 1.00 68.21  ?  193 MET B SD    1 
ATOM   5226  C  CE    . MET B 1 193 ? 80.080  -23.212 -22.327 1.00 76.47  ?  193 MET B CE    1 
ATOM   5227  N  N     . ILE B 1 194 ? 75.296  -27.470 -22.201 1.00 43.28  ?  194 ILE B N     1 
ATOM   5228  C  CA    . ILE B 1 194 ? 75.768  -28.784 -21.832 1.00 43.40  ?  194 ILE B CA    1 
ATOM   5229  C  C     . ILE B 1 194 ? 75.622  -29.697 -23.034 1.00 50.88  ?  194 ILE B C     1 
ATOM   5230  O  O     . ILE B 1 194 ? 76.492  -30.523 -23.296 1.00 56.25  ?  194 ILE B O     1 
ATOM   5231  C  CB    . ILE B 1 194 ? 74.996  -29.336 -20.635 1.00 39.49  ?  194 ILE B CB    1 
ATOM   5232  C  CG1   . ILE B 1 194 ? 75.360  -28.527 -19.380 1.00 34.13  ?  194 ILE B CG1   1 
ATOM   5233  C  CG2   . ILE B 1 194 ? 75.287  -30.828 -20.456 1.00 40.39  ?  194 ILE B CG2   1 
ATOM   5234  C  CD1   . ILE B 1 194 ? 74.907  -29.159 -18.062 1.00 38.99  ?  194 ILE B CD1   1 
ATOM   5235  N  N     . ASP B 1 195 ? 74.518  -29.512 -23.761 1.00 50.57  ?  195 ASP B N     1 
ATOM   5236  C  CA    . ASP B 1 195 ? 74.192  -30.252 -24.983 1.00 48.67  ?  195 ASP B CA    1 
ATOM   5237  C  C     . ASP B 1 195 ? 74.977  -29.730 -26.192 1.00 48.09  ?  195 ASP B C     1 
ATOM   5238  O  O     . ASP B 1 195 ? 75.143  -30.421 -27.198 1.00 52.59  ?  195 ASP B O     1 
ATOM   5239  C  CB    . ASP B 1 195 ? 72.690  -30.113 -25.298 1.00 53.13  ?  195 ASP B CB    1 
ATOM   5240  C  CG    . ASP B 1 195 ? 71.805  -30.976 -24.400 1.00 61.16  ?  195 ASP B CG    1 
ATOM   5241  O  OD1   . ASP B 1 195 ? 72.237  -32.078 -23.989 1.00 60.91  ?  195 ASP B OD1   1 
ATOM   5242  O  OD2   . ASP B 1 195 ? 70.663  -30.548 -24.110 1.00 68.90  ?  195 ASP B OD2   1 
ATOM   5243  N  N     . HIS B 1 196 ? 75.448  -28.497 -26.089 1.00 46.17  ?  196 HIS B N     1 
ATOM   5244  C  CA    . HIS B 1 196 ? 75.967  -27.781 -27.231 1.00 46.33  ?  196 HIS B CA    1 
ATOM   5245  C  C     . HIS B 1 196 ? 77.160  -26.942 -26.808 1.00 43.96  ?  196 HIS B C     1 
ATOM   5246  O  O     . HIS B 1 196 ? 77.067  -25.727 -26.709 1.00 45.31  ?  196 HIS B O     1 
ATOM   5247  C  CB    . HIS B 1 196 ? 74.872  -26.870 -27.797 1.00 48.67  ?  196 HIS B CB    1 
ATOM   5248  C  CG    . HIS B 1 196 ? 73.696  -27.606 -28.370 1.00 51.59  ?  196 HIS B CG    1 
ATOM   5249  N  ND1   . HIS B 1 196 ? 72.392  -27.311 -28.027 1.00 52.03  ?  196 HIS B ND1   1 
ATOM   5250  C  CD2   . HIS B 1 196 ? 73.622  -28.601 -29.285 1.00 54.81  ?  196 HIS B CD2   1 
ATOM   5251  C  CE1   . HIS B 1 196 ? 71.569  -28.103 -28.689 1.00 53.40  ?  196 HIS B CE1   1 
ATOM   5252  N  NE2   . HIS B 1 196 ? 72.292  -28.900 -29.459 1.00 56.43  ?  196 HIS B NE2   1 
ATOM   5253  N  N     . PRO B 1 197 ? 78.290  -27.596 -26.554 1.00 39.00  ?  197 PRO B N     1 
ATOM   5254  C  CA    . PRO B 1 197 ? 79.526  -26.991 -26.053 1.00 38.44  ?  197 PRO B CA    1 
ATOM   5255  C  C     . PRO B 1 197 ? 79.950  -25.748 -26.792 1.00 67.28  ?  197 PRO B C     1 
ATOM   5256  O  O     . PRO B 1 197 ? 80.594  -24.877 -26.218 1.00 66.75  ?  197 PRO B O     1 
ATOM   5257  C  CB    . PRO B 1 197 ? 80.555  -28.094 -26.280 1.00 40.78  ?  197 PRO B CB    1 
ATOM   5258  C  CG    . PRO B 1 197 ? 79.782  -29.330 -26.055 1.00 42.03  ?  197 PRO B CG    1 
ATOM   5259  C  CD    . PRO B 1 197 ? 78.387  -29.059 -26.606 1.00 43.16  ?  197 PRO B CD    1 
ATOM   5260  N  N     . THR B 1 198 ? 79.585  -25.666 -28.058 1.00 69.77  ?  198 THR B N     1 
ATOM   5261  C  CA    . THR B 1 198 ? 80.047  -24.587 -28.909 1.00 69.69  ?  198 THR B CA    1 
ATOM   5262  C  C     . THR B 1 198 ? 78.950  -23.563 -29.183 1.00 68.64  ?  198 THR B C     1 
ATOM   5263  O  O     . THR B 1 198 ? 79.033  -22.807 -30.152 1.00 68.81  ?  198 THR B O     1 
ATOM   5264  C  CB    . THR B 1 198 ? 80.568  -25.147 -30.245 1.00 71.47  ?  198 THR B CB    1 
ATOM   5265  O  OG1   . THR B 1 198 ? 79.755  -26.263 -30.635 1.00 73.62  ?  198 THR B OG1   1 
ATOM   5266  C  CG2   . THR B 1 198 ? 82.003  -25.610 -30.101 1.00 71.48  ?  198 THR B CG2   1 
ATOM   5267  N  N     . ALA B 1 199 ? 77.917  -23.545 -28.343 1.00 68.13  ?  199 ALA B N     1 
ATOM   5268  C  CA    . ALA B 1 199 ? 76.852  -22.550 -28.490 1.00 64.28  ?  199 ALA B CA    1 
ATOM   5269  C  C     . ALA B 1 199 ? 77.459  -21.160 -28.573 1.00 62.68  ?  199 ALA B C     1 
ATOM   5270  O  O     . ALA B 1 199 ? 78.491  -20.888 -27.953 1.00 61.63  ?  199 ALA B O     1 
ATOM   5271  C  CB    . ALA B 1 199 ? 75.830  -22.634 -27.344 1.00 62.02  ?  199 ALA B CB    1 
ATOM   5272  N  N     . LYS B 1 200 ? 76.830  -20.298 -29.365 1.00 64.20  ?  200 LYS B N     1 
ATOM   5273  C  CA    . LYS B 1 200 ? 77.317  -18.941 -29.563 1.00 66.45  ?  200 LYS B CA    1 
ATOM   5274  C  C     . LYS B 1 200 ? 76.334  -17.979 -28.900 1.00 65.76  ?  200 LYS B C     1 
ATOM   5275  O  O     . LYS B 1 200 ? 75.172  -18.331 -28.679 1.00 67.96  ?  200 LYS B O     1 
ATOM   5276  C  CB    . LYS B 1 200 ? 77.473  -18.644 -31.062 1.00 70.91  ?  200 LYS B CB    1 
ATOM   5277  N  N     . ILE B 1 201 ? 76.793  -16.771 -28.593 1.00 63.35  ?  201 ILE B N     1 
ATOM   5278  C  CA    . ILE B 1 201 ? 76.020  -15.856 -27.751 1.00 60.75  ?  201 ILE B CA    1 
ATOM   5279  C  C     . ILE B 1 201 ? 74.570  -15.684 -28.171 1.00 56.65  ?  201 ILE B C     1 
ATOM   5280  O  O     . ILE B 1 201 ? 73.672  -15.583 -27.321 1.00 51.07  ?  201 ILE B O     1 
ATOM   5281  C  CB    . ILE B 1 201 ? 76.659  -14.466 -27.667 1.00 60.01  ?  201 ILE B CB    1 
ATOM   5282  C  CG1   . ILE B 1 201 ? 78.032  -14.565 -27.007 1.00 66.15  ?  201 ILE B CG1   1 
ATOM   5283  C  CG2   . ILE B 1 201 ? 75.742  -13.518 -26.915 1.00 53.99  ?  201 ILE B CG2   1 
ATOM   5284  C  CD1   . ILE B 1 201 ? 79.033  -15.357 -27.845 1.00 72.94  ?  201 ILE B CD1   1 
ATOM   5285  N  N     . ASP B 1 202 ? 74.341  -15.634 -29.477 1.00 59.84  ?  202 ASP B N     1 
ATOM   5286  C  CA    . ASP B 1 202 ? 72.995  -15.412 -29.993 1.00 67.10  ?  202 ASP B CA    1 
ATOM   5287  C  C     . ASP B 1 202 ? 72.001  -16.506 -29.587 1.00 65.38  ?  202 ASP B C     1 
ATOM   5288  O  O     . ASP B 1 202 ? 70.861  -16.199 -29.241 1.00 66.74  ?  202 ASP B O     1 
ATOM   5289  C  CB    . ASP B 1 202 ? 73.020  -15.229 -31.508 1.00 79.85  ?  202 ASP B CB    1 
ATOM   5290  C  CG    . ASP B 1 202 ? 73.155  -13.777 -31.913 1.00 90.81  ?  202 ASP B CG    1 
ATOM   5291  O  OD1   . ASP B 1 202 ? 72.126  -13.072 -31.901 1.00 95.52  ?  202 ASP B OD1   1 
ATOM   5292  O  OD2   . ASP B 1 202 ? 74.280  -13.342 -32.246 1.00 94.19  ?  202 ASP B OD2   1 
ATOM   5293  N  N     . LYS B 1 203 ? 72.422  -17.773 -29.623 1.00 62.26  ?  203 LYS B N     1 
ATOM   5294  C  CA    . LYS B 1 203 ? 71.518  -18.858 -29.252 1.00 60.18  ?  203 LYS B CA    1 
ATOM   5295  C  C     . LYS B 1 203 ? 71.321  -18.815 -27.742 1.00 58.28  ?  203 LYS B C     1 
ATOM   5296  O  O     . LYS B 1 203 ? 70.194  -18.904 -27.251 1.00 54.81  ?  203 LYS B O     1 
ATOM   5297  C  CB    . LYS B 1 203 ? 72.004  -20.242 -29.749 1.00 60.11  ?  203 LYS B CB    1 
ATOM   5298  C  CG    . LYS B 1 203 ? 70.871  -21.224 -30.212 1.00 40.96  ?  203 LYS B CG    1 
ATOM   5299  N  N     . LEU B 1 204 ? 72.417  -18.641 -27.010 1.00 59.55  ?  204 LEU B N     1 
ATOM   5300  C  CA    . LEU B 1 204 ? 72.347  -18.520 -25.556 1.00 54.51  ?  204 LEU B CA    1 
ATOM   5301  C  C     . LEU B 1 204 ? 71.404  -17.407 -25.168 1.00 49.68  ?  204 LEU B C     1 
ATOM   5302  O  O     . LEU B 1 204 ? 70.667  -17.552 -24.195 1.00 52.93  ?  204 LEU B O     1 
ATOM   5303  C  CB    . LEU B 1 204 ? 73.716  -18.266 -24.938 1.00 36.17  ?  204 LEU B CB    1 
ATOM   5304  C  CG    . LEU B 1 204 ? 74.712  -19.385 -25.193 1.00 36.35  ?  204 LEU B CG    1 
ATOM   5305  C  CD1   . LEU B 1 204 ? 76.114  -18.925 -24.871 1.00 36.04  ?  204 LEU B CD1   1 
ATOM   5306  C  CD2   . LEU B 1 204 ? 74.329  -20.600 -24.391 1.00 39.03  ?  204 LEU B CD2   1 
ATOM   5307  N  N     . MET B 1 205 ? 71.411  -16.302 -25.921 1.00 42.97  ?  205 MET B N     1 
ATOM   5308  C  CA    . MET B 1 205 ? 70.504  -15.199 -25.597 1.00 37.06  ?  205 MET B CA    1 
ATOM   5309  C  C     . MET B 1 205 ? 69.028  -15.505 -25.849 1.00 45.32  ?  205 MET B C     1 
ATOM   5310  O  O     . MET B 1 205 ? 68.162  -14.754 -25.420 1.00 40.82  ?  205 MET B O     1 
ATOM   5311  C  CB    . MET B 1 205 ? 70.932  -13.883 -26.234 1.00 37.61  ?  205 MET B CB    1 
ATOM   5312  C  CG    . MET B 1 205 ? 72.176  -13.316 -25.602 1.00 37.09  ?  205 MET B CG    1 
ATOM   5313  S  SD    . MET B 1 205 ? 72.713  -11.679 -26.146 1.00 53.15  ?  205 MET B SD    1 
ATOM   5314  C  CE    . MET B 1 205 ? 71.284  -10.665 -25.782 1.00 37.79  ?  205 MET B CE    1 
ATOM   5315  N  N     . GLU B 1 206 ? 68.732  -16.617 -26.514 1.00 47.31  ?  206 GLU B N     1 
ATOM   5316  C  CA    . GLU B 1 206 ? 67.338  -17.056 -26.618 1.00 46.78  ?  206 GLU B CA    1 
ATOM   5317  C  C     . GLU B 1 206 ? 66.863  -17.633 -25.274 1.00 44.97  ?  206 GLU B C     1 
ATOM   5318  O  O     . GLU B 1 206 ? 65.669  -17.782 -25.040 1.00 45.03  ?  206 GLU B O     1 
ATOM   5319  C  CB    . GLU B 1 206 ? 67.141  -18.057 -27.769 1.00 46.67  ?  206 GLU B CB    1 
ATOM   5320  N  N     . PHE B 1 207 ? 67.814  -17.936 -24.389 1.00 45.83  ?  207 PHE B N     1 
ATOM   5321  C  CA    . PHE B 1 207 ? 67.522  -18.529 -23.087 1.00 43.42  ?  207 PHE B CA    1 
ATOM   5322  C  C     . PHE B 1 207 ? 67.827  -17.545 -21.960 1.00 47.27  ?  207 PHE B C     1 
ATOM   5323  O  O     . PHE B 1 207 ? 67.070  -17.436 -20.996 1.00 52.88  ?  207 PHE B O     1 
ATOM   5324  C  CB    . PHE B 1 207 ? 68.369  -19.777 -22.876 1.00 37.18  ?  207 PHE B CB    1 
ATOM   5325  C  CG    . PHE B 1 207 ? 68.141  -20.840 -23.876 1.00 39.15  ?  207 PHE B CG    1 
ATOM   5326  C  CD1   . PHE B 1 207 ? 68.998  -20.982 -24.968 1.00 42.06  ?  207 PHE B CD1   1 
ATOM   5327  C  CD2   . PHE B 1 207 ? 67.075  -21.712 -23.737 1.00 39.89  ?  207 PHE B CD2   1 
ATOM   5328  C  CE1   . PHE B 1 207 ? 68.795  -21.974 -25.915 1.00 37.96  ?  207 PHE B CE1   1 
ATOM   5329  C  CE2   . PHE B 1 207 ? 66.866  -22.710 -24.665 1.00 44.17  ?  207 PHE B CE2   1 
ATOM   5330  C  CZ    . PHE B 1 207 ? 67.730  -22.842 -25.761 1.00 48.84  ?  207 PHE B CZ    1 
ATOM   5331  N  N     . LEU B 1 208 ? 68.960  -16.854 -22.091 1.00 43.04  ?  208 LEU B N     1 
ATOM   5332  C  CA    . LEU B 1 208 ? 69.414  -15.850 -21.135 1.00 40.71  ?  208 LEU B CA    1 
ATOM   5333  C  C     . LEU B 1 208 ? 69.425  -14.487 -21.815 1.00 39.63  ?  208 LEU B C     1 
ATOM   5334  O  O     . LEU B 1 208 ? 70.466  -14.020 -22.267 1.00 42.95  ?  208 LEU B O     1 
ATOM   5335  C  CB    . LEU B 1 208 ? 70.828  -16.185 -20.660 1.00 42.93  ?  208 LEU B CB    1 
ATOM   5336  C  CG    . LEU B 1 208 ? 71.184  -16.020 -19.175 1.00 40.35  ?  208 LEU B CG    1 
ATOM   5337  C  CD1   . LEU B 1 208 ? 72.661  -15.704 -19.023 1.00 35.12  ?  208 LEU B CD1   1 
ATOM   5338  C  CD2   . LEU B 1 208 ? 70.323  -14.969 -18.491 1.00 42.41  ?  208 LEU B CD2   1 
ATOM   5339  N  N     . PRO B 1 209 ? 68.258  -13.845 -21.895 1.00 37.92  ?  209 PRO B N     1 
ATOM   5340  C  CA    . PRO B 1 209 ? 68.050  -12.591 -22.632 1.00 40.07  ?  209 PRO B CA    1 
ATOM   5341  C  C     . PRO B 1 209 ? 68.718  -11.392 -21.990 1.00 42.90  ?  209 PRO B C     1 
ATOM   5342  O  O     . PRO B 1 209 ? 68.975  -10.394 -22.652 1.00 44.21  ?  209 PRO B O     1 
ATOM   5343  C  CB    . PRO B 1 209 ? 66.541  -12.403 -22.564 1.00 40.91  ?  209 PRO B CB    1 
ATOM   5344  C  CG    . PRO B 1 209 ? 66.127  -13.129 -21.337 1.00 41.35  ?  209 PRO B CG    1 
ATOM   5345  C  CD    . PRO B 1 209 ? 67.026  -14.318 -21.246 1.00 38.30  ?  209 PRO B CD    1 
ATOM   5346  N  N     . GLY B 1 210 ? 68.973  -11.480 -20.694 1.00 46.08  ?  210 GLY B N     1 
ATOM   5347  C  CA    . GLY B 1 210 ? 69.631  -10.399 -19.998 1.00 47.53  ?  210 GLY B CA    1 
ATOM   5348  C  C     . GLY B 1 210 ? 69.426  -10.425 -18.503 1.00 45.73  ?  210 GLY B C     1 
ATOM   5349  O  O     . GLY B 1 210 ? 68.742  -11.296 -17.961 1.00 47.60  ?  210 GLY B O     1 
ATOM   5350  N  N     . PRO B 1 211 ? 70.016  -9.444  -17.826 1.00 41.01  ?  211 PRO B N     1 
ATOM   5351  C  CA    . PRO B 1 211 ? 70.000  -9.340  -16.369 1.00 42.95  ?  211 PRO B CA    1 
ATOM   5352  C  C     . PRO B 1 211 ? 68.568  -9.291  -15.829 1.00 46.78  ?  211 PRO B C     1 
ATOM   5353  O  O     . PRO B 1 211 ? 67.673  -8.816  -16.536 1.00 48.02  ?  211 PRO B O     1 
ATOM   5354  C  CB    . PRO B 1 211 ? 70.714  -8.010  -16.110 1.00 42.94  ?  211 PRO B CB    1 
ATOM   5355  C  CG    . PRO B 1 211 ? 71.476  -7.723  -17.374 1.00 33.40  ?  211 PRO B CG    1 
ATOM   5356  C  CD    . PRO B 1 211 ? 70.683  -8.303  -18.467 1.00 33.91  ?  211 PRO B CD    1 
ATOM   5357  N  N     . ASP B 1 212 ? 68.369  -9.796  -14.608 1.00 44.77  ?  212 ASP B N     1 
ATOM   5358  C  CA    . ASP B 1 212 ? 67.101  -9.688  -13.897 1.00 45.12  ?  212 ASP B CA    1 
ATOM   5359  C  C     . ASP B 1 212 ? 67.377  -9.124  -12.512 1.00 48.86  ?  212 ASP B C     1 
ATOM   5360  O  O     . ASP B 1 212 ? 67.799  -9.853  -11.618 1.00 55.56  ?  212 ASP B O     1 
ATOM   5361  C  CB    . ASP B 1 212 ? 66.433  -11.057 -13.779 1.00 48.37  ?  212 ASP B CB    1 
ATOM   5362  C  CG    . ASP B 1 212 ? 64.973  -10.966 -13.340 1.00 50.23  ?  212 ASP B CG    1 
ATOM   5363  O  OD1   . ASP B 1 212 ? 64.350  -9.907  -13.558 1.00 51.35  ?  212 ASP B OD1   1 
ATOM   5364  O  OD2   . ASP B 1 212 ? 64.443  -11.957 -12.788 1.00 48.97  ?  212 ASP B OD2   1 
ATOM   5365  N  N     . PHE B 1 213 ? 67.146  -7.825  -12.335 1.00 44.73  ?  213 PHE B N     1 
ATOM   5366  C  CA    . PHE B 1 213 ? 67.443  -7.151  -11.073 1.00 41.29  ?  213 PHE B CA    1 
ATOM   5367  C  C     . PHE B 1 213 ? 66.361  -7.414  -10.043 1.00 43.49  ?  213 PHE B C     1 
ATOM   5368  O  O     . PHE B 1 213 ? 65.187  -7.464  -10.376 1.00 45.91  ?  213 PHE B O     1 
ATOM   5369  C  CB    . PHE B 1 213 ? 67.542  -5.652  -11.293 1.00 41.22  ?  213 PHE B CB    1 
ATOM   5370  C  CG    . PHE B 1 213 ? 68.718  -5.221  -12.133 1.00 42.89  ?  213 PHE B CG    1 
ATOM   5371  C  CD1   . PHE B 1 213 ? 69.992  -5.646  -11.842 1.00 45.16  ?  213 PHE B CD1   1 
ATOM   5372  C  CD2   . PHE B 1 213 ? 68.544  -4.359  -13.193 1.00 43.65  ?  213 PHE B CD2   1 
ATOM   5373  C  CE1   . PHE B 1 213 ? 71.068  -5.229  -12.598 1.00 46.08  ?  213 PHE B CE1   1 
ATOM   5374  C  CE2   . PHE B 1 213 ? 69.618  -3.945  -13.950 1.00 33.85  ?  213 PHE B CE2   1 
ATOM   5375  C  CZ    . PHE B 1 213 ? 70.880  -4.385  -13.652 1.00 33.24  ?  213 PHE B CZ    1 
ATOM   5376  N  N     . PRO B 1 214 ? 66.758  -7.600  -8.775  1.00 44.87  ?  214 PRO B N     1 
ATOM   5377  C  CA    . PRO B 1 214 ? 65.803  -7.788  -7.675  1.00 41.09  ?  214 PRO B CA    1 
ATOM   5378  C  C     . PRO B 1 214 ? 64.924  -6.563  -7.483  1.00 39.47  ?  214 PRO B C     1 
ATOM   5379  O  O     . PRO B 1 214 ? 63.829  -6.635  -6.946  1.00 39.92  ?  214 PRO B O     1 
ATOM   5380  C  CB    . PRO B 1 214 ? 66.708  -7.983  -6.456  1.00 37.84  ?  214 PRO B CB    1 
ATOM   5381  C  CG    . PRO B 1 214 ? 68.033  -7.507  -6.856  1.00 42.83  ?  214 PRO B CG    1 
ATOM   5382  C  CD    . PRO B 1 214 ? 68.148  -7.755  -8.320  1.00 45.76  ?  214 PRO B CD    1 
ATOM   5383  N  N     . THR B 1 215 ? 65.413  -5.436  -7.961  1.00 36.33  ?  215 THR B N     1 
ATOM   5384  C  CA    . THR B 1 215 ? 64.732  -4.175  -7.804  1.00 39.21  ?  215 THR B CA    1 
ATOM   5385  C  C     . THR B 1 215 ? 63.743  -3.943  -8.947  1.00 42.90  ?  215 THR B C     1 
ATOM   5386  O  O     . THR B 1 215 ? 62.943  -3.013  -8.905  1.00 53.40  ?  215 THR B O     1 
ATOM   5387  C  CB    . THR B 1 215 ? 65.763  -3.049  -7.790  1.00 46.22  ?  215 THR B CB    1 
ATOM   5388  O  OG1   . THR B 1 215 ? 66.608  -3.167  -8.945  1.00 46.47  ?  215 THR B OG1   1 
ATOM   5389  C  CG2   . THR B 1 215 ? 66.617  -3.136  -6.541  1.00 48.21  ?  215 THR B CG2   1 
ATOM   5390  N  N     . GLY B 1 216 ? 63.822  -4.785  -9.970  1.00 38.55  ?  216 GLY B N     1 
ATOM   5391  C  CA    . GLY B 1 216 ? 62.909  -4.737  -11.099 1.00 38.11  ?  216 GLY B CA    1 
ATOM   5392  C  C     . GLY B 1 216 ? 63.258  -3.707  -12.157 1.00 39.04  ?  216 GLY B C     1 
ATOM   5393  O  O     . GLY B 1 216 ? 64.424  -3.522  -12.515 1.00 36.85  ?  216 GLY B O     1 
ATOM   5394  N  N     . ALA B 1 217 ? 62.225  -3.036  -12.656 1.00 45.37  ?  217 ALA B N     1 
ATOM   5395  C  CA    . ALA B 1 217 ? 62.365  -1.936  -13.607 1.00 49.76  ?  217 ALA B CA    1 
ATOM   5396  C  C     . ALA B 1 217 ? 62.646  -2.393  -15.032 1.00 48.24  ?  217 ALA B C     1 
ATOM   5397  O  O     . ALA B 1 217 ? 62.551  -3.574  -15.361 1.00 52.69  ?  217 ALA B O     1 
ATOM   5398  C  CB    . ALA B 1 217 ? 63.414  -0.932  -13.149 1.00 37.17  ?  217 ALA B CB    1 
ATOM   5399  N  N     . ILE B 1 218 ? 63.003  -1.431  -15.867 1.00 43.40  ?  218 ILE B N     1 
ATOM   5400  C  CA    . ILE B 1 218 ? 63.123  -1.649  -17.287 1.00 43.88  ?  218 ILE B CA    1 
ATOM   5401  C  C     . ILE B 1 218 ? 64.572  -1.604  -17.736 1.00 43.74  ?  218 ILE B C     1 
ATOM   5402  O  O     . ILE B 1 218 ? 65.317  -0.697  -17.370 1.00 46.32  ?  218 ILE B O     1 
ATOM   5403  C  CB    . ILE B 1 218 ? 62.347  -0.569  -18.030 1.00 39.41  ?  218 ILE B CB    1 
ATOM   5404  C  CG1   . ILE B 1 218 ? 60.874  -0.667  -17.657 1.00 48.41  ?  218 ILE B CG1   1 
ATOM   5405  C  CG2   . ILE B 1 218 ? 62.531  -0.718  -19.501 1.00 39.88  ?  218 ILE B CG2   1 
ATOM   5406  C  CD1   . ILE B 1 218 ? 60.209  0.668   -17.550 1.00 50.16  ?  218 ILE B CD1   1 
ATOM   5407  N  N     . ILE B 1 219 ? 64.969  -2.586  -18.536 1.00 40.67  ?  219 ILE B N     1 
ATOM   5408  C  CA    . ILE B 1 219 ? 66.316  -2.611  -19.074 1.00 46.75  ?  219 ILE B CA    1 
ATOM   5409  C  C     . ILE B 1 219 ? 66.283  -2.409  -20.572 1.00 53.80  ?  219 ILE B C     1 
ATOM   5410  O  O     . ILE B 1 219 ? 65.593  -3.141  -21.278 1.00 58.56  ?  219 ILE B O     1 
ATOM   5411  C  CB    . ILE B 1 219 ? 67.017  -3.935  -18.786 1.00 49.53  ?  219 ILE B CB    1 
ATOM   5412  C  CG1   . ILE B 1 219 ? 67.087  -4.179  -17.277 1.00 46.68  ?  219 ILE B CG1   1 
ATOM   5413  C  CG2   . ILE B 1 219 ? 68.411  -3.931  -19.401 1.00 51.50  ?  219 ILE B CG2   1 
ATOM   5414  C  CD1   . ILE B 1 219 ? 68.158  -5.156  -16.880 1.00 42.90  ?  219 ILE B CD1   1 
ATOM   5415  N  N     . GLN B 1 220 ? 67.038  -1.415  -21.042 1.00 56.70  ?  220 GLN B N     1 
ATOM   5416  C  CA    . GLN B 1 220 ? 67.094  -1.064  -22.456 1.00 60.50  ?  220 GLN B CA    1 
ATOM   5417  C  C     . GLN B 1 220 ? 68.496  -1.230  -23.012 1.00 57.86  ?  220 GLN B C     1 
ATOM   5418  O  O     . GLN B 1 220 ? 69.433  -0.601  -22.521 1.00 56.49  ?  220 GLN B O     1 
ATOM   5419  C  CB    . GLN B 1 220 ? 66.715  0.396   -22.651 1.00 68.66  ?  220 GLN B CB    1 
ATOM   5420  C  CG    . GLN B 1 220 ? 65.298  0.768   -22.318 1.00 79.17  ?  220 GLN B CG    1 
ATOM   5421  C  CD    . GLN B 1 220 ? 65.020  2.219   -22.659 1.00 91.75  ?  220 GLN B CD    1 
ATOM   5422  O  OE1   . GLN B 1 220 ? 65.717  2.816   -23.487 1.00 99.02  ?  220 GLN B OE1   1 
ATOM   5423  N  NE2   . GLN B 1 220 ? 64.007  2.799   -22.019 1.00 92.97  ?  220 GLN B NE2   1 
ATOM   5424  N  N     . GLY B 1 221 ? 68.641  -2.051  -24.050 1.00 57.46  ?  221 GLY B N     1 
ATOM   5425  C  CA    . GLY B 1 221 ? 69.887  -2.099  -24.793 1.00 60.45  ?  221 GLY B CA    1 
ATOM   5426  C  C     . GLY B 1 221 ? 70.334  -3.465  -25.275 1.00 62.26  ?  221 GLY B C     1 
ATOM   5427  O  O     . GLY B 1 221 ? 71.495  -3.829  -25.067 1.00 66.93  ?  221 GLY B O     1 
ATOM   5428  N  N     . ARG B 1 222 ? 69.438  -4.206  -25.932 1.00 57.64  ?  222 ARG B N     1 
ATOM   5429  C  CA    . ARG B 1 222 ? 69.763  -5.547  -26.430 1.00 55.02  ?  222 ARG B CA    1 
ATOM   5430  C  C     . ARG B 1 222 ? 71.176  -5.613  -27.034 1.00 51.78  ?  222 ARG B C     1 
ATOM   5431  O  O     . ARG B 1 222 ? 71.991  -6.449  -26.633 1.00 49.08  ?  222 ARG B O     1 
ATOM   5432  C  CB    . ARG B 1 222 ? 68.704  -6.055  -27.424 1.00 59.10  ?  222 ARG B CB    1 
ATOM   5433  C  CG    . ARG B 1 222 ? 68.713  -7.590  -27.687 1.00 40.36  ?  222 ARG B CG    1 
ATOM   5434  N  N     . ASP B 1 223 ? 71.471  -4.724  -27.979 1.00 52.42  ?  223 ASP B N     1 
ATOM   5435  C  CA    . ASP B 1 223 ? 72.804  -4.671  -28.591 1.00 53.45  ?  223 ASP B CA    1 
ATOM   5436  C  C     . ASP B 1 223 ? 73.958  -4.663  -27.556 1.00 54.16  ?  223 ASP B C     1 
ATOM   5437  O  O     . ASP B 1 223 ? 74.927  -5.417  -27.685 1.00 49.31  ?  223 ASP B O     1 
ATOM   5438  C  CB    . ASP B 1 223 ? 72.911  -3.477  -29.555 1.00 53.59  ?  223 ASP B CB    1 
ATOM   5439  N  N     . GLU B 1 224 ? 73.853  -3.823  -26.526 1.00 54.77  ?  224 GLU B N     1 
ATOM   5440  C  CA    . GLU B 1 224 ? 74.914  -3.726  -25.519 1.00 52.55  ?  224 GLU B CA    1 
ATOM   5441  C  C     . GLU B 1 224 ? 74.985  -4.950  -24.582 1.00 53.58  ?  224 GLU B C     1 
ATOM   5442  O  O     . GLU B 1 224 ? 76.075  -5.451  -24.256 1.00 53.22  ?  224 GLU B O     1 
ATOM   5443  C  CB    . GLU B 1 224 ? 74.774  -2.425  -24.733 1.00 53.45  ?  224 GLU B CB    1 
ATOM   5444  C  CG    . GLU B 1 224 ? 75.320  -1.212  -25.453 1.00 64.20  ?  224 GLU B CG    1 
ATOM   5445  C  CD    . GLU B 1 224 ? 76.845  -1.178  -25.500 1.00 73.31  ?  224 GLU B CD    1 
ATOM   5446  O  OE1   . GLU B 1 224 ? 77.471  -1.337  -24.429 1.00 74.97  ?  224 GLU B OE1   1 
ATOM   5447  O  OE2   . GLU B 1 224 ? 77.418  -0.983  -26.603 1.00 77.36  ?  224 GLU B OE2   1 
ATOM   5448  N  N     . ILE B 1 225 ? 73.824  -5.423  -24.143 1.00 52.65  ?  225 ILE B N     1 
ATOM   5449  C  CA    . ILE B 1 225 ? 73.764  -6.699  -23.459 1.00 51.98  ?  225 ILE B CA    1 
ATOM   5450  C  C     . ILE B 1 225 ? 74.588  -7.729  -24.230 1.00 47.20  ?  225 ILE B C     1 
ATOM   5451  O  O     . ILE B 1 225 ? 75.424  -8.411  -23.645 1.00 43.20  ?  225 ILE B O     1 
ATOM   5452  C  CB    . ILE B 1 225 ? 72.320  -7.172  -23.307 1.00 55.64  ?  225 ILE B CB    1 
ATOM   5453  C  CG1   . ILE B 1 225 ? 71.552  -6.197  -22.413 1.00 36.83  ?  225 ILE B CG1   1 
ATOM   5454  C  CG2   . ILE B 1 225 ? 72.270  -8.595  -22.764 1.00 36.15  ?  225 ILE B CG2   1 
ATOM   5455  C  CD1   . ILE B 1 225 ? 70.164  -6.638  -22.134 1.00 36.65  ?  225 ILE B CD1   1 
ATOM   5456  N  N     . LYS B 1 226 ? 74.378  -7.832  -25.545 1.00 47.99  ?  226 LYS B N     1 
ATOM   5457  C  CA    . LYS B 1 226 ? 75.176  -8.772  -26.342 1.00 38.65  ?  226 LYS B CA    1 
ATOM   5458  C  C     . LYS B 1 226 ? 76.659  -8.429  -26.267 1.00 38.79  ?  226 LYS B C     1 
ATOM   5459  O  O     . LYS B 1 226 ? 77.466  -9.310  -26.013 1.00 43.73  ?  226 LYS B O     1 
ATOM   5460  C  CB    . LYS B 1 226 ? 74.705  -8.888  -27.798 1.00 39.80  ?  226 LYS B CB    1 
ATOM   5461  N  N     . LYS B 1 227 ? 77.020  -7.160  -26.466 1.00 42.59  ?  227 LYS B N     1 
ATOM   5462  C  CA    . LYS B 1 227 ? 78.426  -6.768  -26.368 1.00 45.00  ?  227 LYS B CA    1 
ATOM   5463  C  C     . LYS B 1 227 ? 78.973  -7.257  -25.029 1.00 51.48  ?  227 LYS B C     1 
ATOM   5464  O  O     . LYS B 1 227 ? 80.072  -7.818  -24.956 1.00 56.05  ?  227 LYS B O     1 
ATOM   5465  C  CB    . LYS B 1 227 ? 78.614  -5.248  -26.518 1.00 46.08  ?  227 LYS B CB    1 
ATOM   5466  C  CG    . LYS B 1 227 ? 80.088  -4.782  -26.475 1.00 48.35  ?  227 LYS B CG    1 
ATOM   5467  C  CD    . LYS B 1 227 ? 80.248  -3.256  -26.388 1.00 41.68  ?  227 LYS B CD    1 
ATOM   5468  N  N     . ALA B 1 228 ? 78.182  -7.067  -23.973 1.00 52.13  ?  228 ALA B N     1 
ATOM   5469  C  CA    . ALA B 1 228 ? 78.584  -7.468  -22.628 1.00 49.23  ?  228 ALA B CA    1 
ATOM   5470  C  C     . ALA B 1 228 ? 78.704  -8.979  -22.485 1.00 46.60  ?  228 ALA B C     1 
ATOM   5471  O  O     . ALA B 1 228 ? 79.683  -9.484  -21.935 1.00 45.03  ?  228 ALA B O     1 
ATOM   5472  C  CB    . ALA B 1 228 ? 77.622  -6.933  -21.616 1.00 35.88  ?  228 ALA B CB    1 
ATOM   5473  N  N     . TYR B 1 229 ? 77.711  -9.704  -22.982 1.00 44.54  ?  229 TYR B N     1 
ATOM   5474  C  CA    . TYR B 1 229 ? 77.732  -11.155 -22.865 1.00 44.98  ?  229 TYR B CA    1 
ATOM   5475  C  C     . TYR B 1 229 ? 78.843  -11.763 -23.708 1.00 45.77  ?  229 TYR B C     1 
ATOM   5476  O  O     . TYR B 1 229 ? 79.114  -12.962 -23.628 1.00 49.47  ?  229 TYR B O     1 
ATOM   5477  C  CB    . TYR B 1 229 ? 76.385  -11.760 -23.253 1.00 47.51  ?  229 TYR B CB    1 
ATOM   5478  C  CG    . TYR B 1 229 ? 75.319  -11.647 -22.188 1.00 34.77  ?  229 TYR B CG    1 
ATOM   5479  C  CD1   . TYR B 1 229 ? 75.582  -11.043 -20.963 1.00 51.05  ?  229 TYR B CD1   1 
ATOM   5480  C  CD2   . TYR B 1 229 ? 74.054  -12.159 -22.404 1.00 42.34  ?  229 TYR B CD2   1 
ATOM   5481  C  CE1   . TYR B 1 229 ? 74.597  -10.944 -19.986 1.00 46.20  ?  229 TYR B CE1   1 
ATOM   5482  C  CE2   . TYR B 1 229 ? 73.071  -12.074 -21.442 1.00 44.04  ?  229 TYR B CE2   1 
ATOM   5483  C  CZ    . TYR B 1 229 ? 73.338  -11.469 -20.231 1.00 44.67  ?  229 TYR B CZ    1 
ATOM   5484  O  OH    . TYR B 1 229 ? 72.326  -11.398 -19.290 1.00 43.72  ?  229 TYR B OH    1 
ATOM   5485  N  N     . GLU B 1 230 ? 79.489  -10.923 -24.507 1.00 45.09  ?  230 GLU B N     1 
ATOM   5486  C  CA    . GLU B 1 230 ? 80.482  -11.392 -25.456 1.00 49.36  ?  230 GLU B CA    1 
ATOM   5487  C  C     . GLU B 1 230 ? 81.883  -11.047 -24.971 1.00 51.53  ?  230 GLU B C     1 
ATOM   5488  O  O     . GLU B 1 230 ? 82.809  -11.848 -25.085 1.00 52.95  ?  230 GLU B O     1 
ATOM   5489  C  CB    . GLU B 1 230 ? 80.225  -10.768 -26.824 1.00 56.53  ?  230 GLU B CB    1 
ATOM   5490  C  CG    . GLU B 1 230 ? 80.176  -11.744 -27.995 1.00 68.99  ?  230 GLU B CG    1 
ATOM   5491  C  CD    . GLU B 1 230 ? 79.847  -11.050 -29.322 1.00 85.81  ?  230 GLU B CD    1 
ATOM   5492  O  OE1   . GLU B 1 230 ? 80.778  -10.835 -30.134 1.00 91.68  ?  230 GLU B OE1   1 
ATOM   5493  O  OE2   . GLU B 1 230 ? 78.658  -10.718 -29.554 1.00 90.95  ?  230 GLU B OE2   1 
ATOM   5494  N  N     . THR B 1 231 ? 82.027  -9.859  -24.403 1.00 54.52  ?  231 THR B N     1 
ATOM   5495  C  CA    . THR B 1 231 ? 83.342  -9.357  -24.034 1.00 54.19  ?  231 THR B CA    1 
ATOM   5496  C  C     . THR B 1 231 ? 83.505  -9.100  -22.531 1.00 49.97  ?  231 THR B C     1 
ATOM   5497  O  O     . THR B 1 231 ? 84.620  -8.918  -22.042 1.00 48.06  ?  231 THR B O     1 
ATOM   5498  C  CB    . THR B 1 231 ? 83.643  -8.071  -24.819 1.00 57.29  ?  231 THR B CB    1 
ATOM   5499  O  OG1   . THR B 1 231 ? 82.814  -6.993  -24.350 1.00 57.52  ?  231 THR B OG1   1 
ATOM   5500  C  CG2   . THR B 1 231 ? 83.347  -8.311  -26.269 1.00 61.82  ?  231 THR B CG2   1 
ATOM   5501  N  N     . GLY B 1 232 ? 82.393  -9.085  -21.803 1.00 45.76  ?  232 GLY B N     1 
ATOM   5502  C  CA    . GLY B 1 232 ? 82.432  -8.791  -20.386 1.00 47.14  ?  232 GLY B CA    1 
ATOM   5503  C  C     . GLY B 1 232 ? 82.142  -7.331  -20.103 1.00 52.84  ?  232 GLY B C     1 
ATOM   5504  O  O     . GLY B 1 232 ? 81.787  -6.978  -18.976 1.00 59.11  ?  232 GLY B O     1 
ATOM   5505  N  N     . LYS B 1 233 ? 82.292  -6.477  -21.115 1.00 49.47  ?  233 LYS B N     1 
ATOM   5506  C  CA    . LYS B 1 233 ? 81.904  -5.069  -20.973 1.00 47.98  ?  233 LYS B CA    1 
ATOM   5507  C  C     . LYS B 1 233 ? 80.723  -4.673  -21.870 1.00 50.11  ?  233 LYS B C     1 
ATOM   5508  O  O     . LYS B 1 233 ? 80.525  -5.229  -22.955 1.00 51.49  ?  233 LYS B O     1 
ATOM   5509  C  CB    . LYS B 1 233 ? 83.080  -4.123  -21.224 1.00 48.78  ?  233 LYS B CB    1 
ATOM   5510  C  CG    . LYS B 1 233 ? 84.128  -4.055  -20.135 1.00 45.93  ?  233 LYS B CG    1 
ATOM   5511  C  CD    . LYS B 1 233 ? 85.046  -2.859  -20.405 1.00 50.03  ?  233 LYS B CD    1 
ATOM   5512  C  CE    . LYS B 1 233 ? 86.365  -2.941  -19.656 1.00 52.58  ?  233 LYS B CE    1 
ATOM   5513  N  NZ    . LYS B 1 233 ? 86.353  -2.143  -18.400 1.00 52.38  ?  233 LYS B NZ    1 
ATOM   5514  N  N     . GLY B 1 234 ? 79.958  -3.693  -21.395 1.00 48.79  ?  234 GLY B N     1 
ATOM   5515  C  CA    . GLY B 1 234 ? 78.742  -3.241  -22.048 1.00 45.81  ?  234 GLY B CA    1 
ATOM   5516  C  C     . GLY B 1 234 ? 78.075  -2.172  -21.196 1.00 47.87  ?  234 GLY B C     1 
ATOM   5517  O  O     . GLY B 1 234 ? 78.260  -2.128  -19.977 1.00 49.72  ?  234 GLY B O     1 
ATOM   5518  N  N     . ARG B 1 235 ? 77.319  -1.294  -21.846 1.00 47.56  ?  235 ARG B N     1 
ATOM   5519  C  CA    . ARG B 1 235 ? 76.632  -0.189  -21.180 1.00 47.63  ?  235 ARG B CA    1 
ATOM   5520  C  C     . ARG B 1 235 ? 75.175  -0.405  -21.496 1.00 43.58  ?  235 ARG B C     1 
ATOM   5521  O  O     . ARG B 1 235 ? 74.797  -0.551  -22.651 1.00 43.10  ?  235 ARG B O     1 
ATOM   5522  C  CB    . ARG B 1 235 ? 77.099  1.180   -21.736 1.00 54.63  ?  235 ARG B CB    1 
ATOM   5523  C  CG    . ARG B 1 235 ? 76.775  2.448   -20.898 1.00 40.62  ?  235 ARG B CG    1 
ATOM   5524  N  N     . VAL B 1 236 ? 74.348  -0.434  -20.470 1.00 43.29  ?  236 VAL B N     1 
ATOM   5525  C  CA    . VAL B 1 236 ? 72.934  -0.649  -20.682 1.00 45.60  ?  236 VAL B CA    1 
ATOM   5526  C  C     . VAL B 1 236 ? 72.123  0.388   -19.882 1.00 47.51  ?  236 VAL B C     1 
ATOM   5527  O  O     . VAL B 1 236 ? 72.634  1.017   -18.950 1.00 46.18  ?  236 VAL B O     1 
ATOM   5528  C  CB    . VAL B 1 236 ? 72.584  -2.099  -20.344 1.00 51.60  ?  236 VAL B CB    1 
ATOM   5529  C  CG1   . VAL B 1 236 ? 71.968  -2.213  -18.958 1.00 36.59  ?  236 VAL B CG1   1 
ATOM   5530  C  CG2   . VAL B 1 236 ? 71.684  -2.658  -21.394 1.00 67.43  ?  236 VAL B CG2   1 
ATOM   5531  N  N     . VAL B 1 237 ? 70.878  0.618   -20.269 1.00 50.04  ?  237 VAL B N     1 
ATOM   5532  C  CA    . VAL B 1 237 ? 70.098  1.648   -19.595 1.00 39.48  ?  237 VAL B CA    1 
ATOM   5533  C  C     . VAL B 1 237 ? 69.067  0.992   -18.724 1.00 49.14  ?  237 VAL B C     1 
ATOM   5534  O  O     . VAL B 1 237 ? 68.318  0.133   -19.183 1.00 48.19  ?  237 VAL B O     1 
ATOM   5535  C  CB    . VAL B 1 237 ? 69.367  2.583   -20.592 1.00 40.76  ?  237 VAL B CB    1 
ATOM   5536  C  CG1   . VAL B 1 237 ? 68.430  3.526   -19.860 1.00 41.17  ?  237 VAL B CG1   1 
ATOM   5537  C  CG2   . VAL B 1 237 ? 70.356  3.380   -21.388 1.00 41.66  ?  237 VAL B CG2   1 
ATOM   5538  N  N     . VAL B 1 238 ? 69.032  1.390   -17.461 1.00 38.42  ?  238 VAL B N     1 
ATOM   5539  C  CA    . VAL B 1 238 ? 67.957  0.963   -16.579 1.00 47.81  ?  238 VAL B CA    1 
ATOM   5540  C  C     . VAL B 1 238 ? 67.086  2.152   -16.226 1.00 49.37  ?  238 VAL B C     1 
ATOM   5541  O  O     . VAL B 1 238 ? 67.585  3.176   -15.775 1.00 51.03  ?  238 VAL B O     1 
ATOM   5542  C  CB    . VAL B 1 238 ? 68.494  0.376   -15.285 1.00 46.72  ?  238 VAL B CB    1 
ATOM   5543  C  CG1   . VAL B 1 238 ? 67.350  -0.164  -14.468 1.00 47.26  ?  238 VAL B CG1   1 
ATOM   5544  C  CG2   . VAL B 1 238 ? 69.506  -0.705  -15.575 1.00 44.35  ?  238 VAL B CG2   1 
ATOM   5545  N  N     . ARG B 1 239 ? 65.784  2.013   -16.429 1.00 43.50  ?  239 ARG B N     1 
ATOM   5546  C  CA    . ARG B 1 239 ? 64.855  3.102   -16.154 1.00 48.90  ?  239 ARG B CA    1 
ATOM   5547  C  C     . ARG B 1 239 ? 63.695  2.665   -15.245 1.00 46.67  ?  239 ARG B C     1 
ATOM   5548  O  O     . ARG B 1 239 ? 63.172  1.557   -15.365 1.00 45.01  ?  239 ARG B O     1 
ATOM   5549  C  CB    . ARG B 1 239 ? 64.341  3.688   -17.468 1.00 55.83  ?  239 ARG B CB    1 
ATOM   5550  C  CG    . ARG B 1 239 ? 62.887  4.078   -17.453 1.00 61.31  ?  239 ARG B CG    1 
ATOM   5551  C  CD    . ARG B 1 239 ? 62.392  4.339   -18.859 1.00 65.49  ?  239 ARG B CD    1 
ATOM   5552  N  NE    . ARG B 1 239 ? 62.999  5.536   -19.423 1.00 69.13  ?  239 ARG B NE    1 
ATOM   5553  C  CZ    . ARG B 1 239 ? 62.469  6.228   -20.422 1.00 77.94  ?  239 ARG B CZ    1 
ATOM   5554  N  NH1   . ARG B 1 239 ? 61.323  5.829   -20.956 1.00 81.19  ?  239 ARG B NH1   1 
ATOM   5555  N  NH2   . ARG B 1 239 ? 63.078  7.314   -20.884 1.00 82.50  ?  239 ARG B NH2   1 
ATOM   5556  N  N     . SER B 1 240 ? 63.308  3.544   -14.330 1.00 44.66  ?  240 SER B N     1 
ATOM   5557  C  CA    . SER B 1 240 ? 62.349  3.198   -13.289 1.00 42.99  ?  240 SER B CA    1 
ATOM   5558  C  C     . SER B 1 240 ? 61.008  2.861   -13.883 1.00 37.51  ?  240 SER B C     1 
ATOM   5559  O  O     . SER B 1 240 ? 60.647  3.376   -14.932 1.00 42.32  ?  240 SER B O     1 
ATOM   5560  C  CB    . SER B 1 240 ? 62.180  4.361   -12.315 1.00 48.25  ?  240 SER B CB    1 
ATOM   5561  O  OG    . SER B 1 240 ? 63.425  4.970   -12.036 1.00 52.81  ?  240 SER B OG    1 
ATOM   5562  N  N     . LYS B 1 241 ? 60.257  2.005   -13.202 1.00 35.73  ?  241 LYS B N     1 
ATOM   5563  C  CA    . LYS B 1 241 ? 58.901  1.681   -13.638 1.00 41.50  ?  241 LYS B CA    1 
ATOM   5564  C  C     . LYS B 1 241 ? 57.926  2.721   -13.124 1.00 44.10  ?  241 LYS B C     1 
ATOM   5565  O  O     . LYS B 1 241 ? 57.817  2.928   -11.919 1.00 41.12  ?  241 LYS B O     1 
ATOM   5566  C  CB    . LYS B 1 241 ? 58.476  0.290   -13.172 1.00 44.34  ?  241 LYS B CB    1 
ATOM   5567  C  CG    . LYS B 1 241 ? 57.059  -0.076  -13.550 1.00 51.32  ?  241 LYS B CG    1 
ATOM   5568  C  CD    . LYS B 1 241 ? 56.808  -1.551  -13.322 1.00 57.91  ?  241 LYS B CD    1 
ATOM   5569  C  CE    . LYS B 1 241 ? 55.429  -1.968  -13.798 1.00 62.15  ?  241 LYS B CE    1 
ATOM   5570  N  NZ    . LYS B 1 241 ? 55.172  -3.381  -13.418 1.00 66.14  ?  241 LYS B NZ    1 
ATOM   5571  N  N     . THR B 1 242 ? 57.226  3.377   -14.046 1.00 51.80  ?  242 THR B N     1 
ATOM   5572  C  CA    . THR B 1 242 ? 56.317  4.462   -13.681 1.00 55.56  ?  242 THR B CA    1 
ATOM   5573  C  C     . THR B 1 242 ? 54.872  4.171   -14.091 1.00 56.12  ?  242 THR B C     1 
ATOM   5574  O  O     . THR B 1 242 ? 54.607  3.229   -14.829 1.00 64.72  ?  242 THR B O     1 
ATOM   5575  C  CB    . THR B 1 242 ? 56.791  5.845   -14.242 1.00 50.36  ?  242 THR B CB    1 
ATOM   5576  O  OG1   . THR B 1 242 ? 56.827  5.823   -15.676 1.00 47.31  ?  242 THR B OG1   1 
ATOM   5577  C  CG2   . THR B 1 242 ? 58.176  6.210   -13.697 1.00 48.07  ?  242 THR B CG2   1 
ATOM   5578  N  N     . GLU B 1 243 ? 53.947  4.968   -13.568 1.00 51.58  ?  243 GLU B N     1 
ATOM   5579  C  CA    . GLU B 1 243 ? 52.529  4.900   -13.913 1.00 53.25  ?  243 GLU B CA    1 
ATOM   5580  C  C     . GLU B 1 243 ? 51.975  6.317   -13.720 1.00 52.89  ?  243 GLU B C     1 
ATOM   5581  O  O     . GLU B 1 243 ? 52.583  7.131   -13.016 1.00 55.56  ?  243 GLU B O     1 
ATOM   5582  C  CB    . GLU B 1 243 ? 51.789  3.877   -13.032 1.00 36.08  ?  243 GLU B CB    1 
ATOM   5583  N  N     . ILE B 1 244 ? 50.850  6.633   -14.358 1.00 50.99  ?  244 ILE B N     1 
ATOM   5584  C  CA    . ILE B 1 244 ? 50.228  7.942   -14.162 1.00 51.43  ?  244 ILE B CA    1 
ATOM   5585  C  C     . ILE B 1 244 ? 48.828  7.835   -13.564 1.00 57.03  ?  244 ILE B C     1 
ATOM   5586  O  O     . ILE B 1 244 ? 47.928  7.280   -14.180 1.00 65.89  ?  244 ILE B O     1 
ATOM   5587  C  CB    . ILE B 1 244 ? 50.165  8.763   -15.473 1.00 48.20  ?  244 ILE B CB    1 
ATOM   5588  C  CG1   . ILE B 1 244 ? 51.534  8.807   -16.149 1.00 47.21  ?  244 ILE B CG1   1 
ATOM   5589  C  CG2   . ILE B 1 244 ? 49.697  10.177  -15.181 1.00 47.92  ?  244 ILE B CG2   1 
ATOM   5590  C  CD1   . ILE B 1 244 ? 52.617  9.467   -15.296 1.00 46.36  ?  244 ILE B CD1   1 
ATOM   5591  N  N     . GLU B 1 245 ? 48.644  8.363   -12.362 1.00 56.55  ?  245 GLU B N     1 
ATOM   5592  C  CA    . GLU B 1 245 ? 47.322  8.364   -11.747 1.00 63.49  ?  245 GLU B CA    1 
ATOM   5593  C  C     . GLU B 1 245 ? 46.666  9.708   -11.972 1.00 66.24  ?  245 GLU B C     1 
ATOM   5594  O  O     . GLU B 1 245 ? 47.310  10.744  -11.818 1.00 67.96  ?  245 GLU B O     1 
ATOM   5595  C  CB    . GLU B 1 245 ? 47.409  8.071   -10.246 1.00 65.93  ?  245 GLU B CB    1 
ATOM   5596  C  CG    . GLU B 1 245 ? 47.782  6.635   -9.914  1.00 71.82  ?  245 GLU B CG    1 
ATOM   5597  C  CD    . GLU B 1 245 ? 47.952  6.383   -8.415  1.00 78.34  ?  245 GLU B CD    1 
ATOM   5598  O  OE1   . GLU B 1 245 ? 47.998  7.363   -7.633  1.00 81.44  ?  245 GLU B OE1   1 
ATOM   5599  O  OE2   . GLU B 1 245 ? 48.047  5.197   -8.023  1.00 79.31  ?  245 GLU B OE2   1 
ATOM   5600  N  N     . LYS B 1 246 ? 45.393  9.699   -12.352 1.00 66.27  ?  246 LYS B N     1 
ATOM   5601  C  CA    . LYS B 1 246 ? 44.655  10.951  -12.474 1.00 68.98  ?  246 LYS B CA    1 
ATOM   5602  C  C     . LYS B 1 246 ? 44.058  11.314  -11.101 1.00 69.84  ?  246 LYS B C     1 
ATOM   5603  O  O     . LYS B 1 246 ? 43.695  10.433  -10.323 1.00 68.13  ?  246 LYS B O     1 
ATOM   5604  C  CB    . LYS B 1 246 ? 43.590  10.863  -13.583 1.00 51.39  ?  246 LYS B CB    1 
ATOM   5605  N  N     . LEU B 1 247 ? 43.988  12.607  -10.792 1.00 71.83  ?  247 LEU B N     1 
ATOM   5606  C  CA    . LEU B 1 247 ? 43.471  13.065  -9.500  1.00 73.66  ?  247 LEU B CA    1 
ATOM   5607  C  C     . LEU B 1 247 ? 42.295  14.049  -9.625  1.00 82.07  ?  247 LEU B C     1 
ATOM   5608  O  O     . LEU B 1 247 ? 42.111  14.710  -10.655 1.00 83.37  ?  247 LEU B O     1 
ATOM   5609  C  CB    . LEU B 1 247 ? 44.587  13.722  -8.683  1.00 69.53  ?  247 LEU B CB    1 
ATOM   5610  C  CG    . LEU B 1 247 ? 45.905  12.970  -8.493  1.00 68.31  ?  247 LEU B CG    1 
ATOM   5611  C  CD1   . LEU B 1 247 ? 46.978  13.910  -7.938  1.00 63.49  ?  247 LEU B CD1   1 
ATOM   5612  C  CD2   . LEU B 1 247 ? 45.722  11.754  -7.587  1.00 71.45  ?  247 LEU B CD2   1 
ATOM   5613  N  N     . LYS B 1 248 ? 41.503  14.145  -8.561  1.00 86.77  ?  248 LYS B N     1 
ATOM   5614  C  CA    . LYS B 1 248 ? 40.458  15.157  -8.473  1.00 87.80  ?  248 LYS B CA    1 
ATOM   5615  C  C     . LYS B 1 248 ? 41.051  16.542  -8.732  1.00 87.70  ?  248 LYS B C     1 
ATOM   5616  O  O     . LYS B 1 248 ? 42.223  16.786  -8.449  1.00 85.56  ?  248 LYS B O     1 
ATOM   5617  C  CB    . LYS B 1 248 ? 39.798  15.116  -7.091  1.00 87.23  ?  248 LYS B CB    1 
ATOM   5618  N  N     . GLY B 1 249 ? 40.249  17.449  -9.276  1.00 91.70  ?  249 GLY B N     1 
ATOM   5619  C  CA    . GLY B 1 249 ? 40.719  18.800  -9.526  1.00 95.78  ?  249 GLY B CA    1 
ATOM   5620  C  C     . GLY B 1 249 ? 41.544  18.930  -10.796 1.00 98.25  ?  249 GLY B C     1 
ATOM   5621  O  O     . GLY B 1 249 ? 42.203  19.951  -11.017 1.00 97.89  ?  249 GLY B O     1 
ATOM   5622  N  N     . GLY B 1 250 ? 41.517  17.890  -11.627 1.00 97.94  ?  250 GLY B N     1 
ATOM   5623  C  CA    . GLY B 1 250 ? 42.128  17.941  -12.946 1.00 93.48  ?  250 GLY B CA    1 
ATOM   5624  C  C     . GLY B 1 250 ? 43.629  17.763  -12.953 1.00 86.43  ?  250 GLY B C     1 
ATOM   5625  O  O     . GLY B 1 250 ? 44.256  17.767  -14.012 1.00 85.43  ?  250 GLY B O     1 
ATOM   5626  N  N     . LYS B 1 251 ? 44.203  17.607  -11.765 1.00 82.26  ?  251 LYS B N     1 
ATOM   5627  C  CA    . LYS B 1 251 ? 45.636  17.385  -11.617 1.00 73.08  ?  251 LYS B CA    1 
ATOM   5628  C  C     . LYS B 1 251 ? 45.992  15.898  -11.857 1.00 70.93  ?  251 LYS B C     1 
ATOM   5629  O  O     . LYS B 1 251 ? 45.240  15.004  -11.473 1.00 73.39  ?  251 LYS B O     1 
ATOM   5630  C  CB    . LYS B 1 251 ? 46.098  17.878  -10.235 1.00 67.07  ?  251 LYS B CB    1 
ATOM   5631  N  N     . GLU B 1 252 ? 47.116  15.649  -12.530 1.00 65.03  ?  252 GLU B N     1 
ATOM   5632  C  CA    . GLU B 1 252 ? 47.633  14.290  -12.760 1.00 54.20  ?  252 GLU B CA    1 
ATOM   5633  C  C     . GLU B 1 252 ? 48.797  14.006  -11.781 1.00 52.15  ?  252 GLU B C     1 
ATOM   5634  O  O     . GLU B 1 252 ? 49.262  14.908  -11.085 1.00 47.94  ?  252 GLU B O     1 
ATOM   5635  C  CB    . GLU B 1 252 ? 48.055  14.099  -14.239 1.00 47.12  ?  252 GLU B CB    1 
ATOM   5636  N  N     . GLN B 1 253 ? 49.266  12.764  -11.715 1.00 56.71  ?  253 GLN B N     1 
ATOM   5637  C  CA    . GLN B 1 253 ? 50.272  12.391  -10.711 1.00 54.71  ?  253 GLN B CA    1 
ATOM   5638  C  C     . GLN B 1 253 ? 51.143  11.218  -11.154 1.00 51.27  ?  253 GLN B C     1 
ATOM   5639  O  O     . GLN B 1 253 ? 50.621  10.188  -11.578 1.00 53.72  ?  253 GLN B O     1 
ATOM   5640  C  CB    . GLN B 1 253 ? 49.572  12.037  -9.400  1.00 57.25  ?  253 GLN B CB    1 
ATOM   5641  C  CG    . GLN B 1 253 ? 50.462  11.420  -8.355  1.00 57.93  ?  253 GLN B CG    1 
ATOM   5642  C  CD    . GLN B 1 253 ? 49.693  11.038  -7.104  1.00 64.94  ?  253 GLN B CD    1 
ATOM   5643  O  OE1   . GLN B 1 253 ? 49.512  11.853  -6.204  1.00 70.43  ?  253 GLN B OE1   1 
ATOM   5644  N  NE2   . GLN B 1 253 ? 49.232  9.794   -7.047  1.00 65.72  ?  253 GLN B NE2   1 
ATOM   5645  N  N     . ILE B 1 254 ? 52.463  11.370  -11.063 1.00 48.70  ?  254 ILE B N     1 
ATOM   5646  C  CA    . ILE B 1 254 ? 53.370  10.276  -11.438 1.00 48.12  ?  254 ILE B CA    1 
ATOM   5647  C  C     . ILE B 1 254 ? 53.729  9.387   -10.249 1.00 51.36  ?  254 ILE B C     1 
ATOM   5648  O  O     . ILE B 1 254 ? 54.157  9.866   -9.197  1.00 56.06  ?  254 ILE B O     1 
ATOM   5649  C  CB    . ILE B 1 254 ? 54.688  10.769  -12.058 1.00 45.38  ?  254 ILE B CB    1 
ATOM   5650  C  CG1   . ILE B 1 254 ? 54.441  11.868  -13.086 1.00 47.01  ?  254 ILE B CG1   1 
ATOM   5651  C  CG2   . ILE B 1 254 ? 55.414  9.612   -12.698 1.00 42.56  ?  254 ILE B CG2   1 
ATOM   5652  C  CD1   . ILE B 1 254 ? 55.717  12.515  -13.582 1.00 43.88  ?  254 ILE B CD1   1 
ATOM   5653  N  N     . VAL B 1 255 ? 53.574  8.085   -10.433 1.00 48.60  ?  255 VAL B N     1 
ATOM   5654  C  CA    . VAL B 1 255 ? 53.806  7.138   -9.359  1.00 46.47  ?  255 VAL B CA    1 
ATOM   5655  C  C     . VAL B 1 255 ? 54.917  6.187   -9.765  1.00 48.78  ?  255 VAL B C     1 
ATOM   5656  O  O     . VAL B 1 255 ? 54.866  5.573   -10.834 1.00 52.04  ?  255 VAL B O     1 
ATOM   5657  C  CB    . VAL B 1 255 ? 52.532  6.342   -9.062  1.00 42.92  ?  255 VAL B CB    1 
ATOM   5658  C  CG1   . VAL B 1 255 ? 52.774  5.353   -7.955  1.00 34.67  ?  255 VAL B CG1   1 
ATOM   5659  C  CG2   . VAL B 1 255 ? 51.389  7.293   -8.720  1.00 41.91  ?  255 VAL B CG2   1 
ATOM   5660  N  N     . ILE B 1 256 ? 55.931  6.080   -8.915  1.00 45.68  ?  256 ILE B N     1 
ATOM   5661  C  CA    . ILE B 1 256 ? 57.070  5.221   -9.202  1.00 46.42  ?  256 ILE B CA    1 
ATOM   5662  C  C     . ILE B 1 256 ? 56.995  3.968   -8.353  1.00 48.33  ?  256 ILE B C     1 
ATOM   5663  O  O     . ILE B 1 256 ? 56.733  4.056   -7.156  1.00 55.18  ?  256 ILE B O     1 
ATOM   5664  C  CB    . ILE B 1 256 ? 58.348  5.935   -8.880  1.00 46.93  ?  256 ILE B CB    1 
ATOM   5665  C  CG1   . ILE B 1 256 ? 58.337  7.315   -9.540  1.00 46.40  ?  256 ILE B CG1   1 
ATOM   5666  C  CG2   . ILE B 1 256 ? 59.529  5.084   -9.303  1.00 49.52  ?  256 ILE B CG2   1 
ATOM   5667  C  CD1   . ILE B 1 256 ? 59.576  8.129   -9.250  1.00 45.64  ?  256 ILE B CD1   1 
ATOM   5668  N  N     . THR B 1 257 ? 57.216  2.802   -8.953  1.00 43.49  ?  257 THR B N     1 
ATOM   5669  C  CA    . THR B 1 257 ? 56.956  1.555   -8.239  1.00 42.79  ?  257 THR B CA    1 
ATOM   5670  C  C     . THR B 1 257 ? 58.126  0.574   -8.297  1.00 46.16  ?  257 THR B C     1 
ATOM   5671  O  O     . THR B 1 257 ? 58.180  -0.397  -7.528  1.00 48.97  ?  257 THR B O     1 
ATOM   5672  C  CB    . THR B 1 257 ? 55.682  0.869   -8.750  1.00 44.15  ?  257 THR B CB    1 
ATOM   5673  O  OG1   . THR B 1 257 ? 55.932  0.285   -10.036 1.00 52.77  ?  257 THR B OG1   1 
ATOM   5674  C  CG2   . THR B 1 257 ? 54.562  1.862   -8.865  1.00 38.36  ?  257 THR B CG2   1 
ATOM   5675  N  N     . GLU B 1 258 ? 59.046  0.824   -9.223  1.00 46.89  ?  258 GLU B N     1 
ATOM   5676  C  CA    . GLU B 1 258 ? 60.303  0.089   -9.288  1.00 48.13  ?  258 GLU B CA    1 
ATOM   5677  C  C     . GLU B 1 258 ? 61.406  1.074   -9.652  1.00 50.27  ?  258 GLU B C     1 
ATOM   5678  O  O     . GLU B 1 258 ? 61.215  1.934   -10.504 1.00 57.86  ?  258 GLU B O     1 
ATOM   5679  C  CB    . GLU B 1 258 ? 60.238  -1.039  -10.325 1.00 47.17  ?  258 GLU B CB    1 
ATOM   5680  C  CG    . GLU B 1 258 ? 59.062  -1.992  -10.175 1.00 53.06  ?  258 GLU B CG    1 
ATOM   5681  C  CD    . GLU B 1 258 ? 59.107  -3.165  -11.159 1.00 62.67  ?  258 GLU B CD    1 
ATOM   5682  O  OE1   . GLU B 1 258 ? 60.059  -3.247  -11.967 1.00 65.67  ?  258 GLU B OE1   1 
ATOM   5683  O  OE2   . GLU B 1 258 ? 58.186  -4.011  -11.125 1.00 66.58  ?  258 GLU B OE2   1 
ATOM   5684  N  N     . ILE B 1 259 ? 62.556  0.959   -9.004  1.00 46.07  ?  259 ILE B N     1 
ATOM   5685  C  CA    . ILE B 1 259 ? 63.671  1.852   -9.305  1.00 44.45  ?  259 ILE B CA    1 
ATOM   5686  C  C     . ILE B 1 259 ? 64.922  1.060   -9.722  1.00 40.53  ?  259 ILE B C     1 
ATOM   5687  O  O     . ILE B 1 259 ? 64.944  -0.181  -9.654  1.00 42.29  ?  259 ILE B O     1 
ATOM   5688  C  CB    . ILE B 1 259 ? 63.958  2.811   -8.128  1.00 47.50  ?  259 ILE B CB    1 
ATOM   5689  C  CG1   . ILE B 1 259 ? 64.307  2.025   -6.862  1.00 50.88  ?  259 ILE B CG1   1 
ATOM   5690  C  CG2   . ILE B 1 259 ? 62.742  3.669   -7.846  1.00 27.49  ?  259 ILE B CG2   1 
ATOM   5691  C  CD1   . ILE B 1 259 ? 65.081  2.822   -5.852  1.00 49.75  ?  259 ILE B CD1   1 
ATOM   5692  N  N     . PRO B 1 260 ? 65.953  1.763   -10.204 1.00 35.02  ?  260 PRO B N     1 
ATOM   5693  C  CA    . PRO B 1 260 ? 67.137  1.067   -10.728 1.00 34.69  ?  260 PRO B CA    1 
ATOM   5694  C  C     . PRO B 1 260 ? 68.030  0.427   -9.662  1.00 36.02  ?  260 PRO B C     1 
ATOM   5695  O  O     . PRO B 1 260 ? 68.234  0.990   -8.595  1.00 35.63  ?  260 PRO B O     1 
ATOM   5696  C  CB    . PRO B 1 260 ? 67.890  2.171   -11.477 1.00 31.91  ?  260 PRO B CB    1 
ATOM   5697  C  CG    . PRO B 1 260 ? 66.839  3.147   -11.837 1.00 32.88  ?  260 PRO B CG    1 
ATOM   5698  C  CD    . PRO B 1 260 ? 65.895  3.154   -10.665 1.00 33.31  ?  260 PRO B CD    1 
ATOM   5699  N  N     . TYR B 1 261 ? 68.549  -0.755  -9.978  1.00 38.10  ?  261 TYR B N     1 
ATOM   5700  C  CA    . TYR B 1 261 ? 69.455  -1.508  -9.107  1.00 38.93  ?  261 TYR B CA    1 
ATOM   5701  C  C     . TYR B 1 261 ? 70.556  -0.629  -8.532  1.00 39.21  ?  261 TYR B C     1 
ATOM   5702  O  O     . TYR B 1 261 ? 71.077  0.236   -9.230  1.00 36.68  ?  261 TYR B O     1 
ATOM   5703  C  CB    . TYR B 1 261 ? 70.074  -2.649  -9.914  1.00 33.19  ?  261 TYR B CB    1 
ATOM   5704  C  CG    . TYR B 1 261 ? 70.903  -3.644  -9.137  1.00 35.08  ?  261 TYR B CG    1 
ATOM   5705  C  CD1   . TYR B 1 261 ? 70.318  -4.510  -8.212  1.00 36.39  ?  261 TYR B CD1   1 
ATOM   5706  C  CD2   . TYR B 1 261 ? 72.267  -3.759  -9.370  1.00 36.07  ?  261 TYR B CD2   1 
ATOM   5707  C  CE1   . TYR B 1 261 ? 71.092  -5.447  -7.514  1.00 39.31  ?  261 TYR B CE1   1 
ATOM   5708  C  CE2   . TYR B 1 261 ? 73.042  -4.683  -8.684  1.00 37.89  ?  261 TYR B CE2   1 
ATOM   5709  C  CZ    . TYR B 1 261 ? 72.456  -5.524  -7.760  1.00 38.43  ?  261 TYR B CZ    1 
ATOM   5710  O  OH    . TYR B 1 261 ? 73.254  -6.429  -7.089  1.00 40.49  ?  261 TYR B OH    1 
ATOM   5711  N  N     . GLU B 1 262 ? 70.903  -0.849  -7.262  1.00 41.77  ?  262 GLU B N     1 
ATOM   5712  C  CA    . GLU B 1 262 ? 72.042  -0.160  -6.639  1.00 43.59  ?  262 GLU B CA    1 
ATOM   5713  C  C     . GLU B 1 262 ? 71.769  1.334   -6.386  1.00 39.65  ?  262 GLU B C     1 
ATOM   5714  O  O     . GLU B 1 262 ? 72.695  2.124   -6.198  1.00 39.37  ?  262 GLU B O     1 
ATOM   5715  C  CB    . GLU B 1 262 ? 73.338  -0.365  -7.469  1.00 58.36  ?  262 GLU B CB    1 
ATOM   5716  C  CG    . GLU B 1 262 ? 74.138  -1.661  -7.173  1.00 83.72  ?  262 GLU B CG    1 
ATOM   5717  C  CD    . GLU B 1 262 ? 75.292  -1.924  -8.162  1.00 87.16  ?  262 GLU B CD    1 
ATOM   5718  O  OE1   . GLU B 1 262 ? 75.998  -2.948  -8.003  1.00 92.03  ?  262 GLU B OE1   1 
ATOM   5719  O  OE2   . GLU B 1 262 ? 75.498  -1.124  -9.101  1.00 84.51  ?  262 GLU B OE2   1 
ATOM   5720  N  N     . ILE B 1 263 ? 70.495  1.713   -6.379  1.00 34.89  ?  263 ILE B N     1 
ATOM   5721  C  CA    . ILE B 1 263 ? 70.095  3.113   -6.208  1.00 34.88  ?  263 ILE B CA    1 
ATOM   5722  C  C     . ILE B 1 263 ? 69.350  3.306   -4.898  1.00 40.59  ?  263 ILE B C     1 
ATOM   5723  O  O     . ILE B 1 263 ? 68.462  2.517   -4.546  1.00 45.80  ?  263 ILE B O     1 
ATOM   5724  C  CB    . ILE B 1 263 ? 69.203  3.625   -7.388  1.00 37.95  ?  263 ILE B CB    1 
ATOM   5725  C  CG1   . ILE B 1 263 ? 70.015  3.681   -8.674  1.00 43.66  ?  263 ILE B CG1   1 
ATOM   5726  C  CG2   . ILE B 1 263 ? 68.605  5.005   -7.102  1.00 30.21  ?  263 ILE B CG2   1 
ATOM   5727  C  CD1   . ILE B 1 263 ? 71.153  4.683   -8.632  1.00 46.25  ?  263 ILE B CD1   1 
ATOM   5728  N  N     . ASN B 1 264 ? 69.712  4.377   -4.199  1.00 39.46  ?  264 ASN B N     1 
ATOM   5729  C  CA    . ASN B 1 264 ? 69.222  4.656   -2.864  1.00 40.58  ?  264 ASN B CA    1 
ATOM   5730  C  C     . ASN B 1 264 ? 67.895  5.415   -2.884  1.00 45.35  ?  264 ASN B C     1 
ATOM   5731  O  O     . ASN B 1 264 ? 67.889  6.613   -3.140  1.00 56.12  ?  264 ASN B O     1 
ATOM   5732  C  CB    . ASN B 1 264 ? 70.284  5.488   -2.156  1.00 41.74  ?  264 ASN B CB    1 
ATOM   5733  C  CG    . ASN B 1 264 ? 69.962  5.739   -0.703  1.00 46.10  ?  264 ASN B CG    1 
ATOM   5734  O  OD1   . ASN B 1 264 ? 69.046  6.506   -0.376  1.00 44.91  ?  264 ASN B OD1   1 
ATOM   5735  N  ND2   . ASN B 1 264 ? 70.734  5.118   0.186   1.00 51.43  ?  264 ASN B ND2   1 
ATOM   5736  N  N     . LYS B 1 265 ? 66.782  4.733   -2.604  1.00 41.67  ?  265 LYS B N     1 
ATOM   5737  C  CA    . LYS B 1 265 ? 65.447  5.350   -2.666  1.00 40.10  ?  265 LYS B CA    1 
ATOM   5738  C  C     . LYS B 1 265 ? 65.352  6.703   -1.952  1.00 41.58  ?  265 LYS B C     1 
ATOM   5739  O  O     . LYS B 1 265 ? 64.770  7.662   -2.467  1.00 36.51  ?  265 LYS B O     1 
ATOM   5740  C  CB    . LYS B 1 265 ? 64.378  4.405   -2.112  1.00 30.81  ?  265 LYS B CB    1 
ATOM   5741  C  CG    . LYS B 1 265 ? 62.942  4.903   -2.309  1.00 44.27  ?  265 LYS B CG    1 
ATOM   5742  C  CD    . LYS B 1 265 ? 61.901  3.902   -1.775  1.00 46.42  ?  265 LYS B CD    1 
ATOM   5743  C  CE    . LYS B 1 265 ? 61.737  3.976   -0.258  1.00 33.40  ?  265 LYS B CE    1 
ATOM   5744  N  N     . ALA B 1 266 ? 65.921  6.778   -0.758  1.00 42.56  ?  266 ALA B N     1 
ATOM   5745  C  CA    . ALA B 1 266 ? 65.854  8.001   0.022   1.00 40.53  ?  266 ALA B CA    1 
ATOM   5746  C  C     . ALA B 1 266 ? 66.497  9.148   -0.729  1.00 41.74  ?  266 ALA B C     1 
ATOM   5747  O  O     . ALA B 1 266 ? 65.884  10.216  -0.870  1.00 45.08  ?  266 ALA B O     1 
ATOM   5748  C  CB    . ALA B 1 266 ? 66.518  7.808   1.349   1.00 41.98  ?  266 ALA B CB    1 
ATOM   5749  N  N     . ASN B 1 267 ? 67.729  8.927   -1.204  1.00 42.27  ?  267 ASN B N     1 
ATOM   5750  C  CA    . ASN B 1 267 ? 68.468  9.954   -1.954  1.00 48.95  ?  267 ASN B CA    1 
ATOM   5751  C  C     . ASN B 1 267 ? 67.793  10.329  -3.260  1.00 47.96  ?  267 ASN B C     1 
ATOM   5752  O  O     . ASN B 1 267 ? 67.636  11.505  -3.566  1.00 51.16  ?  267 ASN B O     1 
ATOM   5753  C  CB    . ASN B 1 267 ? 69.916  9.539   -2.215  1.00 59.41  ?  267 ASN B CB    1 
ATOM   5754  C  CG    . ASN B 1 267 ? 70.724  9.416   -0.934  1.00 72.27  ?  267 ASN B CG    1 
ATOM   5755  O  OD1   . ASN B 1 267 ? 70.285  9.854   0.132   1.00 76.21  ?  267 ASN B OD1   1 
ATOM   5756  N  ND2   . ASN B 1 267 ? 71.911  8.821   -1.031  1.00 77.02  ?  267 ASN B ND2   1 
ATOM   5757  N  N     . LEU B 1 268 ? 67.391  9.320   -4.020  1.00 45.28  ?  268 LEU B N     1 
ATOM   5758  C  CA    . LEU B 1 268 ? 66.609  9.534   -5.223  1.00 40.68  ?  268 LEU B CA    1 
ATOM   5759  C  C     . LEU B 1 268 ? 65.436  10.457  -4.927  1.00 42.52  ?  268 LEU B C     1 
ATOM   5760  O  O     . LEU B 1 268 ? 65.233  11.437  -5.643  1.00 46.18  ?  268 LEU B O     1 
ATOM   5761  C  CB    . LEU B 1 268 ? 66.097  8.206   -5.772  1.00 35.01  ?  268 LEU B CB    1 
ATOM   5762  C  CG    . LEU B 1 268 ? 65.677  8.135   -7.239  1.00 31.15  ?  268 LEU B CG    1 
ATOM   5763  C  CD1   . LEU B 1 268 ? 64.459  7.263   -7.368  1.00 33.58  ?  268 LEU B CD1   1 
ATOM   5764  C  CD2   . LEU B 1 268 ? 65.406  9.508   -7.825  1.00 28.41  ?  268 LEU B CD2   1 
ATOM   5765  N  N     . VAL B 1 269 ? 64.662  10.159  -3.884  1.00 39.84  ?  269 VAL B N     1 
ATOM   5766  C  CA    . VAL B 1 269 ? 63.557  11.052  -3.524  1.00 38.19  ?  269 VAL B CA    1 
ATOM   5767  C  C     . VAL B 1 269 ? 64.026  12.489  -3.240  1.00 36.37  ?  269 VAL B C     1 
ATOM   5768  O  O     . VAL B 1 269 ? 63.390  13.437  -3.691  1.00 36.72  ?  269 VAL B O     1 
ATOM   5769  C  CB    . VAL B 1 269 ? 62.706  10.536  -2.337  1.00 39.01  ?  269 VAL B CB    1 
ATOM   5770  C  CG1   . VAL B 1 269 ? 61.625  11.521  -2.020  1.00 32.50  ?  269 VAL B CG1   1 
ATOM   5771  C  CG2   . VAL B 1 269 ? 62.079  9.214   -2.665  1.00 41.04  ?  269 VAL B CG2   1 
ATOM   5772  N  N     . LYS B 1 270 ? 65.130  12.668  -2.512  1.00 37.97  ?  270 LYS B N     1 
ATOM   5773  C  CA    . LYS B 1 270 ? 65.614  14.034  -2.269  1.00 44.66  ?  270 LYS B CA    1 
ATOM   5774  C  C     . LYS B 1 270 ? 65.972  14.742  -3.582  1.00 43.58  ?  270 LYS B C     1 
ATOM   5775  O  O     . LYS B 1 270 ? 65.516  15.859  -3.829  1.00 42.58  ?  270 LYS B O     1 
ATOM   5776  C  CB    . LYS B 1 270 ? 66.773  14.102  -1.255  1.00 34.62  ?  270 LYS B CB    1 
ATOM   5777  N  N     . LYS B 1 271 ? 66.759  14.087  -4.433  1.00 41.16  ?  271 LYS B N     1 
ATOM   5778  C  CA    . LYS B 1 271 ? 67.204  14.709  -5.681  1.00 40.47  ?  271 LYS B CA    1 
ATOM   5779  C  C     . LYS B 1 271 ? 66.037  15.094  -6.616  1.00 47.50  ?  271 LYS B C     1 
ATOM   5780  O  O     . LYS B 1 271 ? 66.092  16.132  -7.285  1.00 51.89  ?  271 LYS B O     1 
ATOM   5781  C  CB    . LYS B 1 271 ? 68.268  13.859  -6.384  1.00 30.84  ?  271 LYS B CB    1 
ATOM   5782  N  N     . ILE B 1 272 ? 64.977  14.282  -6.635  1.00 44.40  ?  272 ILE B N     1 
ATOM   5783  C  CA    . ILE B 1 272 ? 63.727  14.647  -7.318  1.00 39.56  ?  272 ILE B CA    1 
ATOM   5784  C  C     . ILE B 1 272 ? 63.058  15.850  -6.665  1.00 42.19  ?  272 ILE B C     1 
ATOM   5785  O  O     . ILE B 1 272 ? 62.733  16.810  -7.350  1.00 45.32  ?  272 ILE B O     1 
ATOM   5786  C  CB    . ILE B 1 272 ? 62.704  13.499  -7.324  1.00 34.79  ?  272 ILE B CB    1 
ATOM   5787  C  CG1   . ILE B 1 272 ? 63.210  12.333  -8.161  1.00 31.25  ?  272 ILE B CG1   1 
ATOM   5788  C  CG2   . ILE B 1 272 ? 61.357  13.971  -7.846  1.00 29.36  ?  272 ILE B CG2   1 
ATOM   5789  C  CD1   . ILE B 1 272 ? 62.351  11.126  -8.032  1.00 27.54  ?  272 ILE B CD1   1 
ATOM   5790  N  N     . ASP B 1 273 ? 62.846  15.806  -5.348  1.00 42.99  ?  273 ASP B N     1 
ATOM   5791  C  CA    . ASP B 1 273 ? 62.316  16.978  -4.647  1.00 49.61  ?  273 ASP B CA    1 
ATOM   5792  C  C     . ASP B 1 273 ? 63.201  18.208  -4.860  1.00 54.74  ?  273 ASP B C     1 
ATOM   5793  O  O     . ASP B 1 273 ? 62.718  19.349  -4.882  1.00 55.79  ?  273 ASP B O     1 
ATOM   5794  C  CB    . ASP B 1 273 ? 62.146  16.725  -3.151  1.00 54.75  ?  273 ASP B CB    1 
ATOM   5795  C  CG    . ASP B 1 273 ? 61.445  17.889  -2.440  1.00 64.82  ?  273 ASP B CG    1 
ATOM   5796  O  OD1   . ASP B 1 273 ? 60.259  18.161  -2.776  1.00 70.04  ?  273 ASP B OD1   1 
ATOM   5797  O  OD2   . ASP B 1 273 ? 62.075  18.526  -1.552  1.00 64.90  ?  273 ASP B OD2   1 
ATOM   5798  N  N     . ASP B 1 274 ? 64.498  17.974  -5.019  1.00 56.90  ?  274 ASP B N     1 
ATOM   5799  C  CA    . ASP B 1 274 ? 65.419  19.057  -5.309  1.00 58.55  ?  274 ASP B CA    1 
ATOM   5800  C  C     . ASP B 1 274 ? 65.129  19.724  -6.650  1.00 50.53  ?  274 ASP B C     1 
ATOM   5801  O  O     . ASP B 1 274 ? 65.271  20.944  -6.790  1.00 48.12  ?  274 ASP B O     1 
ATOM   5802  C  CB    . ASP B 1 274 ? 66.862  18.578  -5.215  1.00 68.38  ?  274 ASP B CB    1 
ATOM   5803  C  CG    . ASP B 1 274 ? 67.438  18.783  -3.827  1.00 80.58  ?  274 ASP B CG    1 
ATOM   5804  O  OD1   . ASP B 1 274 ? 67.143  19.843  -3.219  1.00 85.34  ?  274 ASP B OD1   1 
ATOM   5805  O  OD2   . ASP B 1 274 ? 68.164  17.886  -3.341  1.00 84.44  ?  274 ASP B OD2   1 
ATOM   5806  N  N     . VAL B 1 275 ? 64.708  18.924  -7.628  1.00 45.42  ?  275 VAL B N     1 
ATOM   5807  C  CA    . VAL B 1 275 ? 64.269  19.461  -8.914  1.00 41.37  ?  275 VAL B CA    1 
ATOM   5808  C  C     . VAL B 1 275 ? 63.098  20.400  -8.707  1.00 42.99  ?  275 VAL B C     1 
ATOM   5809  O  O     . VAL B 1 275 ? 63.122  21.523  -9.202  1.00 44.82  ?  275 VAL B O     1 
ATOM   5810  C  CB    . VAL B 1 275 ? 63.847  18.358  -9.882  1.00 36.61  ?  275 VAL B CB    1 
ATOM   5811  C  CG1   . VAL B 1 275 ? 63.189  18.961  -11.115 1.00 32.04  ?  275 VAL B CG1   1 
ATOM   5812  C  CG2   . VAL B 1 275 ? 65.048  17.514  -10.256 1.00 34.54  ?  275 VAL B CG2   1 
ATOM   5813  N  N     . ARG B 1 276 ? 62.078  19.948  -7.972  1.00 43.91  ?  276 ARG B N     1 
ATOM   5814  C  CA    . ARG B 1 276 ? 60.941  20.816  -7.642  1.00 47.14  ?  276 ARG B CA    1 
ATOM   5815  C  C     . ARG B 1 276 ? 61.352  22.120  -6.945  1.00 49.69  ?  276 ARG B C     1 
ATOM   5816  O  O     . ARG B 1 276 ? 60.947  23.210  -7.360  1.00 51.51  ?  276 ARG B O     1 
ATOM   5817  C  CB    . ARG B 1 276 ? 59.894  20.104  -6.788  1.00 46.50  ?  276 ARG B CB    1 
ATOM   5818  C  CG    . ARG B 1 276 ? 58.717  21.019  -6.431  1.00 51.05  ?  276 ARG B CG    1 
ATOM   5819  C  CD    . ARG B 1 276 ? 57.915  20.479  -5.283  1.00 55.44  ?  276 ARG B CD    1 
ATOM   5820  N  NE    . ARG B 1 276 ? 58.758  20.248  -4.113  1.00 56.57  ?  276 ARG B NE    1 
ATOM   5821  C  CZ    . ARG B 1 276 ? 59.059  21.188  -3.222  1.00 55.39  ?  276 ARG B CZ    1 
ATOM   5822  N  NH1   . ARG B 1 276 ? 58.586  22.423  -3.373  1.00 55.53  ?  276 ARG B NH1   1 
ATOM   5823  N  NH2   . ARG B 1 276 ? 59.831  20.893  -2.182  1.00 52.45  ?  276 ARG B NH2   1 
ATOM   5824  N  N     . VAL B 1 277 ? 62.134  22.000  -5.879  1.00 48.70  ?  277 VAL B N     1 
ATOM   5825  C  CA    . VAL B 1 277 ? 62.596  23.173  -5.144  1.00 48.61  ?  277 VAL B CA    1 
ATOM   5826  C  C     . VAL B 1 277 ? 63.260  24.182  -6.061  1.00 47.83  ?  277 VAL B C     1 
ATOM   5827  O  O     . VAL B 1 277 ? 63.060  25.390  -5.929  1.00 43.86  ?  277 VAL B O     1 
ATOM   5828  C  CB    . VAL B 1 277 ? 63.623  22.805  -4.061  1.00 49.51  ?  277 VAL B CB    1 
ATOM   5829  C  CG1   . VAL B 1 277 ? 64.453  24.010  -3.720  1.00 43.49  ?  277 VAL B CG1   1 
ATOM   5830  C  CG2   . VAL B 1 277 ? 62.930  22.289  -2.845  1.00 53.66  ?  277 VAL B CG2   1 
ATOM   5831  N  N     . ASN B 1 278 ? 64.074  23.682  -6.979  1.00 45.40  ?  278 ASN B N     1 
ATOM   5832  C  CA    . ASN B 1 278 ? 64.834  24.569  -7.831  1.00 48.46  ?  278 ASN B CA    1 
ATOM   5833  C  C     . ASN B 1 278 ? 64.077  24.883  -9.101  1.00 45.41  ?  278 ASN B C     1 
ATOM   5834  O  O     . ASN B 1 278 ? 64.593  25.537  -9.995  1.00 44.60  ?  278 ASN B O     1 
ATOM   5835  C  CB    . ASN B 1 278 ? 66.203  23.971  -8.137  1.00 52.39  ?  278 ASN B CB    1 
ATOM   5836  C  CG    . ASN B 1 278 ? 67.077  23.890  -6.910  1.00 58.68  ?  278 ASN B CG    1 
ATOM   5837  O  OD1   . ASN B 1 278 ? 67.188  24.854  -6.155  1.00 61.55  ?  278 ASN B OD1   1 
ATOM   5838  N  ND2   . ASN B 1 278 ? 67.685  22.731  -6.688  1.00 60.48  ?  278 ASN B ND2   1 
ATOM   5839  N  N     . ASN B 1 279 ? 62.843  24.410  -9.179  1.00 45.49  ?  279 ASN B N     1 
ATOM   5840  C  CA    . ASN B 1 279 ? 62.015  24.713  -10.326 1.00 44.90  ?  279 ASN B CA    1 
ATOM   5841  C  C     . ASN B 1 279 ? 62.806  24.474  -11.604 1.00 45.70  ?  279 ASN B C     1 
ATOM   5842  O  O     . ASN B 1 279 ? 62.725  25.261  -12.538 1.00 51.40  ?  279 ASN B O     1 
ATOM   5843  C  CB    . ASN B 1 279 ? 61.562  26.164  -10.256 1.00 42.92  ?  279 ASN B CB    1 
ATOM   5844  C  CG    . ASN B 1 279 ? 60.254  26.389  -10.939 1.00 59.70  ?  279 ASN B CG    1 
ATOM   5845  O  OD1   . ASN B 1 279 ? 59.832  25.580  -11.759 1.00 62.79  ?  279 ASN B OD1   1 
ATOM   5846  N  ND2   . ASN B 1 279 ? 59.595  27.499  -10.618 1.00 58.28  ?  279 ASN B ND2   1 
ATOM   5847  N  N     . LYS B 1 280 ? 63.575  23.387  -11.637 1.00 44.06  ?  280 LYS B N     1 
ATOM   5848  C  CA    . LYS B 1 280 ? 64.397  23.051  -12.801 1.00 46.79  ?  280 LYS B CA    1 
ATOM   5849  C  C     . LYS B 1 280 ? 63.525  22.601  -13.970 1.00 47.99  ?  280 LYS B C     1 
ATOM   5850  O  O     . LYS B 1 280 ? 63.866  22.804  -15.133 1.00 48.49  ?  280 LYS B O     1 
ATOM   5851  C  CB    . LYS B 1 280 ? 65.461  21.992  -12.454 1.00 42.64  ?  280 LYS B CB    1 
ATOM   5852  C  CG    . LYS B 1 280 ? 66.790  22.557  -11.916 1.00 40.45  ?  280 LYS B CG    1 
ATOM   5853  N  N     . VAL B 1 281 ? 62.391  21.992  -13.656 1.00 47.17  ?  281 VAL B N     1 
ATOM   5854  C  CA    . VAL B 1 281 ? 61.380  21.723  -14.665 1.00 45.51  ?  281 VAL B CA    1 
ATOM   5855  C  C     . VAL B 1 281 ? 60.071  22.261  -14.150 1.00 48.91  ?  281 VAL B C     1 
ATOM   5856  O  O     . VAL B 1 281 ? 59.813  22.232  -12.945 1.00 56.04  ?  281 VAL B O     1 
ATOM   5857  C  CB    . VAL B 1 281 ? 61.240  20.231  -14.956 1.00 41.69  ?  281 VAL B CB    1 
ATOM   5858  C  CG1   . VAL B 1 281 ? 59.852  19.910  -15.402 1.00 43.78  ?  281 VAL B CG1   1 
ATOM   5859  C  CG2   . VAL B 1 281 ? 62.208  19.834  -16.023 1.00 40.41  ?  281 VAL B CG2   1 
ATOM   5860  N  N     . ALA B 1 282 ? 59.238  22.755  -15.053 1.00 45.90  ?  282 ALA B N     1 
ATOM   5861  C  CA    . ALA B 1 282 ? 57.991  23.364  -14.629 1.00 50.06  ?  282 ALA B CA    1 
ATOM   5862  C  C     . ALA B 1 282 ? 56.933  22.327  -14.256 1.00 47.85  ?  282 ALA B C     1 
ATOM   5863  O  O     . ALA B 1 282 ? 56.667  21.403  -15.021 1.00 43.84  ?  282 ALA B O     1 
ATOM   5864  C  CB    . ALA B 1 282 ? 57.468  24.283  -15.714 1.00 58.25  ?  282 ALA B CB    1 
ATOM   5865  N  N     . GLY B 1 283 ? 56.337  22.477  -13.075 1.00 51.56  ?  283 GLY B N     1 
ATOM   5866  C  CA    . GLY B 1 283 ? 55.071  21.822  -12.795 1.00 57.53  ?  283 GLY B CA    1 
ATOM   5867  C  C     . GLY B 1 283 ? 55.016  20.738  -11.739 1.00 58.10  ?  283 GLY B C     1 
ATOM   5868  O  O     . GLY B 1 283 ? 54.042  19.977  -11.680 1.00 58.35  ?  283 GLY B O     1 
ATOM   5869  N  N     . ILE B 1 284 ? 56.041  20.657  -10.898 1.00 56.13  ?  284 ILE B N     1 
ATOM   5870  C  CA    . ILE B 1 284 ? 55.992  19.702  -9.803  1.00 52.85  ?  284 ILE B CA    1 
ATOM   5871  C  C     . ILE B 1 284 ? 55.382  20.315  -8.538  1.00 54.46  ?  284 ILE B C     1 
ATOM   5872  O  O     . ILE B 1 284 ? 55.867  21.321  -8.014  1.00 55.49  ?  284 ILE B O     1 
ATOM   5873  C  CB    . ILE B 1 284 ? 57.357  19.060  -9.536  1.00 49.67  ?  284 ILE B CB    1 
ATOM   5874  C  CG1   . ILE B 1 284 ? 57.740  18.154  -10.704 1.00 47.76  ?  284 ILE B CG1   1 
ATOM   5875  C  CG2   . ILE B 1 284 ? 57.299  18.214  -8.294  1.00 51.18  ?  284 ILE B CG2   1 
ATOM   5876  C  CD1   . ILE B 1 284 ? 59.109  17.531  -10.564 1.00 45.93  ?  284 ILE B CD1   1 
ATOM   5877  N  N     . ALA B 1 285 ? 54.303  19.696  -8.067  1.00 52.67  ?  285 ALA B N     1 
ATOM   5878  C  CA    . ALA B 1 285 ? 53.568  20.169  -6.900  1.00 51.00  ?  285 ALA B CA    1 
ATOM   5879  C  C     . ALA B 1 285 ? 54.239  19.774  -5.583  1.00 56.25  ?  285 ALA B C     1 
ATOM   5880  O  O     . ALA B 1 285 ? 54.563  20.627  -4.759  1.00 68.02  ?  285 ALA B O     1 
ATOM   5881  C  CB    . ALA B 1 285 ? 52.144  19.657  -6.938  1.00 45.05  ?  285 ALA B CB    1 
ATOM   5882  N  N     . GLU B 1 286 ? 54.448  18.480  -5.386  1.00 48.33  ?  286 GLU B N     1 
ATOM   5883  C  CA    . GLU B 1 286 ? 55.008  17.985  -4.140  1.00 52.45  ?  286 GLU B CA    1 
ATOM   5884  C  C     . GLU B 1 286 ? 55.581  16.595  -4.365  1.00 54.40  ?  286 GLU B C     1 
ATOM   5885  O  O     . GLU B 1 286 ? 55.028  15.821  -5.139  1.00 58.57  ?  286 GLU B O     1 
ATOM   5886  C  CB    . GLU B 1 286 ? 53.905  17.918  -3.085  1.00 61.70  ?  286 GLU B CB    1 
ATOM   5887  C  CG    . GLU B 1 286 ? 54.257  17.085  -1.862  1.00 72.25  ?  286 GLU B CG    1 
ATOM   5888  C  CD    . GLU B 1 286 ? 53.044  16.747  -0.999  1.00 82.04  ?  286 GLU B CD    1 
ATOM   5889  O  OE1   . GLU B 1 286 ? 51.897  16.884  -1.485  1.00 84.84  ?  286 GLU B OE1   1 
ATOM   5890  O  OE2   . GLU B 1 286 ? 53.240  16.340  0.169   1.00 86.62  ?  286 GLU B OE2   1 
ATOM   5891  N  N     . VAL B 1 287 ? 56.680  16.255  -3.707  1.00 51.85  ?  287 VAL B N     1 
ATOM   5892  C  CA    . VAL B 1 287 ? 57.149  14.874  -3.807  1.00 50.57  ?  287 VAL B CA    1 
ATOM   5893  C  C     . VAL B 1 287 ? 56.945  14.122  -2.507  1.00 53.03  ?  287 VAL B C     1 
ATOM   5894  O  O     . VAL B 1 287 ? 57.258  14.632  -1.440  1.00 64.35  ?  287 VAL B O     1 
ATOM   5895  C  CB    . VAL B 1 287 ? 58.621  14.777  -4.201  1.00 52.08  ?  287 VAL B CB    1 
ATOM   5896  C  CG1   . VAL B 1 287 ? 59.047  13.323  -4.202  1.00 49.27  ?  287 VAL B CG1   1 
ATOM   5897  C  CG2   . VAL B 1 287 ? 58.857  15.410  -5.571  1.00 53.26  ?  287 VAL B CG2   1 
ATOM   5898  N  N     . ARG B 1 288 ? 56.428  12.905  -2.598  1.00 47.43  ?  288 ARG B N     1 
ATOM   5899  C  CA    . ARG B 1 288 ? 56.172  12.093  -1.407  1.00 47.63  ?  288 ARG B CA    1 
ATOM   5900  C  C     . ARG B 1 288 ? 56.660  10.660  -1.551  1.00 50.98  ?  288 ARG B C     1 
ATOM   5901  O  O     . ARG B 1 288 ? 56.211  9.947   -2.453  1.00 54.64  ?  288 ARG B O     1 
ATOM   5902  C  CB    . ARG B 1 288 ? 54.672  12.005  -1.143  1.00 44.35  ?  288 ARG B CB    1 
ATOM   5903  C  CG    . ARG B 1 288 ? 53.982  13.299  -0.892  1.00 45.31  ?  288 ARG B CG    1 
ATOM   5904  C  CD    . ARG B 1 288 ? 52.512  13.028  -0.672  1.00 50.16  ?  288 ARG B CD    1 
ATOM   5905  N  NE    . ARG B 1 288 ? 51.693  13.572  -1.748  1.00 56.50  ?  288 ARG B NE    1 
ATOM   5906  C  CZ    . ARG B 1 288 ? 50.955  12.837  -2.566  1.00 63.46  ?  288 ARG B CZ    1 
ATOM   5907  N  NH1   . ARG B 1 288 ? 50.926  11.519  -2.429  1.00 65.61  ?  288 ARG B NH1   1 
ATOM   5908  N  NH2   . ARG B 1 288 ? 50.241  13.425  -3.517  1.00 66.16  ?  288 ARG B NH2   1 
ATOM   5909  N  N     . ASP B 1 289 ? 57.540  10.210  -0.658  1.00 48.39  ?  289 ASP B N     1 
ATOM   5910  C  CA    . ASP B 1 289 ? 57.763  8.770   -0.562  1.00 48.77  ?  289 ASP B CA    1 
ATOM   5911  C  C     . ASP B 1 289 ? 56.564  8.163   0.172   1.00 49.58  ?  289 ASP B C     1 
ATOM   5912  O  O     . ASP B 1 289 ? 56.294  8.483   1.329   1.00 54.08  ?  289 ASP B O     1 
ATOM   5913  C  CB    . ASP B 1 289 ? 59.081  8.426   0.125   1.00 52.19  ?  289 ASP B CB    1 
ATOM   5914  C  CG    . ASP B 1 289 ? 59.467  6.961   -0.056  1.00 53.65  ?  289 ASP B CG    1 
ATOM   5915  O  OD1   . ASP B 1 289 ? 60.645  6.592   0.203   1.00 56.34  ?  289 ASP B OD1   1 
ATOM   5916  O  OD2   . ASP B 1 289 ? 58.579  6.181   -0.461  1.00 50.07  ?  289 ASP B OD2   1 
ATOM   5917  N  N     . GLU B 1 290 ? 55.807  7.329   -0.529  1.00 45.57  ?  290 GLU B N     1 
ATOM   5918  C  CA    . GLU B 1 290 ? 54.597  6.767   0.038   1.00 47.04  ?  290 GLU B CA    1 
ATOM   5919  C  C     . GLU B 1 290 ? 54.806  5.286   0.297   1.00 52.43  ?  290 GLU B C     1 
ATOM   5920  O  O     . GLU B 1 290 ? 53.862  4.561   0.632   1.00 61.38  ?  290 GLU B O     1 
ATOM   5921  C  CB    . GLU B 1 290 ? 53.410  6.981   -0.897  1.00 47.35  ?  290 GLU B CB    1 
ATOM   5922  C  CG    . GLU B 1 290 ? 52.926  8.412   -0.995  1.00 50.60  ?  290 GLU B CG    1 
ATOM   5923  C  CD    . GLU B 1 290 ? 51.487  8.501   -1.490  1.00 60.87  ?  290 GLU B CD    1 
ATOM   5924  O  OE1   . GLU B 1 290 ? 50.925  7.447   -1.864  1.00 61.75  ?  290 GLU B OE1   1 
ATOM   5925  O  OE2   . GLU B 1 290 ? 50.915  9.617   -1.503  1.00 68.81  ?  290 GLU B OE2   1 
ATOM   5926  N  N     . SER B 1 291 ? 56.053  4.844   0.155   1.00 47.30  ?  291 SER B N     1 
ATOM   5927  C  CA    . SER B 1 291 ? 56.397  3.455   0.424   1.00 47.42  ?  291 SER B CA    1 
ATOM   5928  C  C     . SER B 1 291 ? 55.994  3.035   1.837   1.00 56.03  ?  291 SER B C     1 
ATOM   5929  O  O     . SER B 1 291 ? 56.047  3.825   2.784   1.00 62.31  ?  291 SER B O     1 
ATOM   5930  C  CB    . SER B 1 291 ? 57.891  3.219   0.225   1.00 43.93  ?  291 SER B CB    1 
ATOM   5931  O  OG    . SER B 1 291 ? 58.289  3.543   -1.089  1.00 41.96  ?  291 SER B OG    1 
ATOM   5932  N  N     . ASP B 1 292 ? 55.580  1.783   1.971   1.00 57.94  ?  292 ASP B N     1 
ATOM   5933  C  CA    . ASP B 1 292 ? 55.337  1.220   3.285   1.00 65.87  ?  292 ASP B CA    1 
ATOM   5934  C  C     . ASP B 1 292 ? 55.793  -0.243  3.350   1.00 67.28  ?  292 ASP B C     1 
ATOM   5935  O  O     . ASP B 1 292 ? 56.349  -0.778  2.386   1.00 63.58  ?  292 ASP B O     1 
ATOM   5936  C  CB    . ASP B 1 292 ? 53.874  1.406   3.722   1.00 70.27  ?  292 ASP B CB    1 
ATOM   5937  C  CG    . ASP B 1 292 ? 52.914  0.485   2.993   1.00 72.81  ?  292 ASP B CG    1 
ATOM   5938  O  OD1   . ASP B 1 292 ? 53.382  -0.387  2.229   1.00 74.68  ?  292 ASP B OD1   1 
ATOM   5939  O  OD2   . ASP B 1 292 ? 51.686  0.625   3.203   1.00 73.86  ?  292 ASP B OD2   1 
ATOM   5940  N  N     . ARG B 1 293 ? 55.564  -0.879  4.494   1.00 70.46  ?  293 ARG B N     1 
ATOM   5941  C  CA    . ARG B 1 293 ? 56.135  -2.192  4.769   1.00 68.71  ?  293 ARG B CA    1 
ATOM   5942  C  C     . ARG B 1 293 ? 55.908  -3.228  3.658   1.00 68.61  ?  293 ARG B C     1 
ATOM   5943  O  O     . ARG B 1 293 ? 56.615  -4.237  3.591   1.00 69.23  ?  293 ARG B O     1 
ATOM   5944  C  CB    . ARG B 1 293 ? 55.672  -2.711  6.143   1.00 67.63  ?  293 ARG B CB    1 
ATOM   5945  C  CG    . ARG B 1 293 ? 54.179  -2.958  6.283   1.00 65.71  ?  293 ARG B CG    1 
ATOM   5946  C  CD    . ARG B 1 293 ? 53.742  -2.855  7.735   1.00 68.70  ?  293 ARG B CD    1 
ATOM   5947  N  NE    . ARG B 1 293 ? 52.499  -2.100  7.835   1.00 73.15  ?  293 ARG B NE    1 
ATOM   5948  C  CZ    . ARG B 1 293 ? 52.414  -0.792  7.611   1.00 76.01  ?  293 ARG B CZ    1 
ATOM   5949  N  NH1   . ARG B 1 293 ? 53.509  -0.112  7.285   1.00 78.36  ?  293 ARG B NH1   1 
ATOM   5950  N  NH2   . ARG B 1 293 ? 51.245  -0.161  7.707   1.00 73.69  ?  293 ARG B NH2   1 
ATOM   5951  N  N     . ASP B 1 294 ? 54.942  -2.983  2.779   1.00 67.65  ?  294 ASP B N     1 
ATOM   5952  C  CA    . ASP B 1 294 ? 54.678  -3.942  1.706   1.00 70.07  ?  294 ASP B CA    1 
ATOM   5953  C  C     . ASP B 1 294 ? 54.410  -3.316  0.337   1.00 63.71  ?  294 ASP B C     1 
ATOM   5954  O  O     . ASP B 1 294 ? 53.423  -3.626  -0.327  1.00 62.92  ?  294 ASP B O     1 
ATOM   5955  C  CB    . ASP B 1 294 ? 53.584  -4.955  2.096   1.00 78.91  ?  294 ASP B CB    1 
ATOM   5956  C  CG    . ASP B 1 294 ? 52.388  -4.311  2.786   1.00 84.02  ?  294 ASP B CG    1 
ATOM   5957  O  OD1   . ASP B 1 294 ? 51.885  -4.909  3.763   1.00 85.88  ?  294 ASP B OD1   1 
ATOM   5958  O  OD2   . ASP B 1 294 ? 51.941  -3.225  2.352   1.00 84.43  ?  294 ASP B OD2   1 
ATOM   5959  N  N     . GLY B 1 295 ? 55.320  -2.450  -0.088  1.00 59.43  ?  295 GLY B N     1 
ATOM   5960  C  CA    . GLY B 1 295 ? 55.250  -1.874  -1.415  1.00 55.17  ?  295 GLY B CA    1 
ATOM   5961  C  C     . GLY B 1 295 ? 56.070  -0.612  -1.543  1.00 50.95  ?  295 GLY B C     1 
ATOM   5962  O  O     . GLY B 1 295 ? 56.020  0.275   -0.694  1.00 57.66  ?  295 GLY B O     1 
ATOM   5963  N  N     . LEU B 1 296 ? 56.838  -0.526  -2.616  1.00 42.40  ?  296 LEU B N     1 
ATOM   5964  C  CA    . LEU B 1 296 ? 57.528  0.715   -2.923  1.00 41.40  ?  296 LEU B CA    1 
ATOM   5965  C  C     . LEU B 1 296 ? 56.609  1.649   -3.729  1.00 47.20  ?  296 LEU B C     1 
ATOM   5966  O  O     . LEU B 1 296 ? 55.960  1.227   -4.695  1.00 53.03  ?  296 LEU B O     1 
ATOM   5967  C  CB    . LEU B 1 296 ? 58.833  0.424   -3.662  1.00 37.23  ?  296 LEU B CB    1 
ATOM   5968  C  CG    . LEU B 1 296 ? 59.672  1.632   -4.056  1.00 39.37  ?  296 LEU B CG    1 
ATOM   5969  C  CD1   . LEU B 1 296 ? 61.125  1.229   -4.226  1.00 44.76  ?  296 LEU B CD1   1 
ATOM   5970  C  CD2   . LEU B 1 296 ? 59.132  2.249   -5.337  1.00 30.68  ?  296 LEU B CD2   1 
ATOM   5971  N  N     . ARG B 1 297 ? 56.539  2.913   -3.318  1.00 45.60  ?  297 ARG B N     1 
ATOM   5972  C  CA    . ARG B 1 297 ? 55.675  3.885   -3.983  1.00 43.86  ?  297 ARG B CA    1 
ATOM   5973  C  C     . ARG B 1 297 ? 56.164  5.313   -3.790  1.00 45.08  ?  297 ARG B C     1 
ATOM   5974  O  O     . ARG B 1 297 ? 56.133  5.838   -2.683  1.00 51.84  ?  297 ARG B O     1 
ATOM   5975  C  CB    . ARG B 1 297 ? 54.233  3.763   -3.474  1.00 46.01  ?  297 ARG B CB    1 
ATOM   5976  C  CG    . ARG B 1 297 ? 53.308  4.877   -3.952  1.00 46.97  ?  297 ARG B CG    1 
ATOM   5977  C  CD    . ARG B 1 297 ? 51.852  4.596   -3.608  1.00 49.47  ?  297 ARG B CD    1 
ATOM   5978  N  NE    . ARG B 1 297 ? 50.988  4.777   -4.769  1.00 50.40  ?  297 ARG B NE    1 
ATOM   5979  C  CZ    . ARG B 1 297 ? 50.210  5.835   -4.961  1.00 54.06  ?  297 ARG B CZ    1 
ATOM   5980  N  NH1   . ARG B 1 297 ? 50.164  6.799   -4.054  1.00 56.82  ?  297 ARG B NH1   1 
ATOM   5981  N  NH2   . ARG B 1 297 ? 49.470  5.926   -6.057  1.00 54.27  ?  297 ARG B NH2   1 
ATOM   5982  N  N     . ILE B 1 298 ? 56.607  5.941   -4.873  1.00 42.80  ?  298 ILE B N     1 
ATOM   5983  C  CA    . ILE B 1 298 ? 56.951  7.363   -4.859  1.00 43.68  ?  298 ILE B CA    1 
ATOM   5984  C  C     . ILE B 1 298 ? 55.959  8.146   -5.720  1.00 48.59  ?  298 ILE B C     1 
ATOM   5985  O  O     . ILE B 1 298 ? 55.918  7.978   -6.939  1.00 46.40  ?  298 ILE B O     1 
ATOM   5986  C  CB    . ILE B 1 298 ? 58.382  7.596   -5.364  1.00 36.46  ?  298 ILE B CB    1 
ATOM   5987  C  CG1   . ILE B 1 298 ? 59.333  6.591   -4.717  1.00 38.37  ?  298 ILE B CG1   1 
ATOM   5988  C  CG2   . ILE B 1 298 ? 58.829  9.010   -5.072  1.00 30.85  ?  298 ILE B CG2   1 
ATOM   5989  C  CD1   . ILE B 1 298 ? 60.728  6.650   -5.280  1.00 39.55  ?  298 ILE B CD1   1 
ATOM   5990  N  N     . ALA B 1 299 ? 55.138  8.966   -5.064  1.00 48.51  ?  299 ALA B N     1 
ATOM   5991  C  CA    . ALA B 1 299 ? 54.125  9.783   -5.721  1.00 41.98  ?  299 ALA B CA    1 
ATOM   5992  C  C     . ALA B 1 299 ? 54.803  11.101  -6.030  1.00 42.27  ?  299 ALA B C     1 
ATOM   5993  O  O     . ALA B 1 299 ? 55.344  11.738  -5.129  1.00 47.31  ?  299 ALA B O     1 
ATOM   5994  N  N     . ILE B 1 300 ? 54.827  11.482  -7.309  1.00 41.43  ?  300 ILE B N     1 
ATOM   5995  C  CA    . ILE B 1 300 ? 55.243  12.827  -7.703  1.00 39.56  ?  300 ILE B CA    1 
ATOM   5996  C  C     . ILE B 1 300 ? 54.053  13.597  -8.266  1.00 41.14  ?  300 ILE B C     1 
ATOM   5997  O  O     . ILE B 1 300 ? 53.718  13.492  -9.447  1.00 45.10  ?  300 ILE B O     1 
ATOM   5998  C  CB    . ILE B 1 300 ? 56.331  12.802  -8.749  1.00 31.59  ?  300 ILE B CB    1 
ATOM   5999  C  CG1   . ILE B 1 300 ? 57.484  11.939  -8.280  1.00 35.47  ?  300 ILE B CG1   1 
ATOM   6000  C  CG2   . ILE B 1 300 ? 56.799  14.210  -9.031  1.00 41.35  ?  300 ILE B CG2   1 
ATOM   6001  C  CD1   . ILE B 1 300 ? 58.546  11.810  -9.308  1.00 32.48  ?  300 ILE B CD1   1 
ATOM   6002  N  N     . GLU B 1 301 ? 53.410  14.366  -7.403  1.00 41.01  ?  301 GLU B N     1 
ATOM   6003  C  CA    . GLU B 1 301 ? 52.184  15.059  -7.754  1.00 45.58  ?  301 GLU B CA    1 
ATOM   6004  C  C     . GLU B 1 301 ? 52.501  16.332  -8.515  1.00 47.32  ?  301 GLU B C     1 
ATOM   6005  O  O     . GLU B 1 301 ? 53.290  17.161  -8.065  1.00 48.26  ?  301 GLU B O     1 
ATOM   6006  C  CB    . GLU B 1 301 ? 51.396  15.371  -6.487  1.00 54.17  ?  301 GLU B CB    1 
ATOM   6007  C  CG    . GLU B 1 301 ? 50.197  16.251  -6.686  1.00 66.87  ?  301 GLU B CG    1 
ATOM   6008  C  CD    . GLU B 1 301 ? 49.356  16.346  -5.434  1.00 76.51  ?  301 GLU B CD    1 
ATOM   6009  O  OE1   . GLU B 1 301 ? 48.836  17.447  -5.144  1.00 80.99  ?  301 GLU B OE1   1 
ATOM   6010  O  OE2   . GLU B 1 301 ? 49.218  15.312  -4.742  1.00 77.23  ?  301 GLU B OE2   1 
ATOM   6011  N  N     . LEU B 1 302 ? 51.887  16.477  -9.681  1.00 50.03  ?  302 LEU B N     1 
ATOM   6012  C  CA    . LEU B 1 302 ? 52.135  17.634  -10.527 1.00 50.49  ?  302 LEU B CA    1 
ATOM   6013  C  C     . LEU B 1 302 ? 51.078  18.709  -10.309 1.00 58.29  ?  302 LEU B C     1 
ATOM   6014  O  O     . LEU B 1 302 ? 50.109  18.511  -9.578  1.00 63.49  ?  302 LEU B O     1 
ATOM   6015  C  CB    . LEU B 1 302 ? 52.163  17.203  -11.986 1.00 46.00  ?  302 LEU B CB    1 
ATOM   6016  C  CG    . LEU B 1 302 ? 53.079  16.012  -12.212 1.00 46.29  ?  302 LEU B CG    1 
ATOM   6017  C  CD1   . LEU B 1 302 ? 52.793  15.362  -13.535 1.00 47.65  ?  302 LEU B CD1   1 
ATOM   6018  C  CD2   . LEU B 1 302 ? 54.518  16.463  -12.151 1.00 50.81  ?  302 LEU B CD2   1 
ATOM   6019  N  N     . LYS B 1 303 ? 51.273  19.854  -10.943 1.00 59.04  ?  303 LYS B N     1 
ATOM   6020  C  CA    . LYS B 1 303 ? 50.331  20.950  -10.815 1.00 65.17  ?  303 LYS B CA    1 
ATOM   6021  C  C     . LYS B 1 303 ? 49.275  20.836  -11.902 1.00 74.00  ?  303 LYS B C     1 
ATOM   6022  O  O     . LYS B 1 303 ? 49.418  20.018  -12.814 1.00 74.33  ?  303 LYS B O     1 
ATOM   6023  C  CB    . LYS B 1 303 ? 51.075  22.275  -10.897 1.00 68.17  ?  303 LYS B CB    1 
ATOM   6024  C  CG    . LYS B 1 303 ? 52.158  22.427  -9.826  1.00 69.70  ?  303 LYS B CG    1 
ATOM   6025  C  CD    . LYS B 1 303 ? 53.199  23.459  -10.238 1.00 70.10  ?  303 LYS B CD    1 
ATOM   6026  C  CE    . LYS B 1 303 ? 53.934  24.067  -9.049  1.00 67.87  ?  303 LYS B CE    1 
ATOM   6027  N  NZ    . LYS B 1 303 ? 54.759  25.233  -9.490  1.00 65.38  ?  303 LYS B NZ    1 
ATOM   6028  N  N     . LYS B 1 304 ? 48.204  21.625  -11.787 1.00 80.98  ?  304 LYS B N     1 
ATOM   6029  C  CA    . LYS B 1 304 ? 47.160  21.655  -12.819 1.00 81.00  ?  304 LYS B CA    1 
ATOM   6030  C  C     . LYS B 1 304 ? 47.743  22.252  -14.097 1.00 84.40  ?  304 LYS B C     1 
ATOM   6031  O  O     . LYS B 1 304 ? 48.656  23.079  -14.043 1.00 80.67  ?  304 LYS B O     1 
ATOM   6032  C  CB    . LYS B 1 304 ? 45.924  22.446  -12.354 1.00 76.57  ?  304 LYS B CB    1 
ATOM   6033  N  N     . ASP B 1 305 ? 47.237  21.821  -15.246 1.00 90.85  ?  305 ASP B N     1 
ATOM   6034  C  CA    . ASP B 1 305 ? 47.723  22.351  -16.520 1.00 94.95  ?  305 ASP B CA    1 
ATOM   6035  C  C     . ASP B 1 305 ? 49.273  22.269  -16.600 1.00 68.00  ?  305 ASP B C     1 
ATOM   6036  O  O     . ASP B 1 305 ? 49.953  23.246  -16.923 1.00 70.22  ?  305 ASP B O     1 
ATOM   6037  C  CB    . ASP B 1 305 ? 47.170  23.787  -16.768 1.00 55.61  ?  305 ASP B CB    1 
ATOM   6038  N  N     . ALA B 1 306 ? 49.827  21.096  -16.302 1.00 64.90  ?  306 ALA B N     1 
ATOM   6039  C  CA    . ALA B 1 306 ? 51.286  20.902  -16.345 1.00 62.65  ?  306 ALA B CA    1 
ATOM   6040  C  C     . ALA B 1 306 ? 51.709  19.768  -17.291 1.00 62.93  ?  306 ALA B C     1 
ATOM   6041  O  O     . ALA B 1 306 ? 51.039  18.733  -17.362 1.00 62.05  ?  306 ALA B O     1 
ATOM   6042  C  CB    . ALA B 1 306 ? 51.834  20.671  -14.952 1.00 59.14  ?  306 ALA B CB    1 
ATOM   6043  N  N     . ASN B 1 307 ? 52.813  19.958  -18.018 1.00 65.51  ?  307 ASN B N     1 
ATOM   6044  C  CA    . ASN B 1 307 ? 53.191  18.988  -19.048 1.00 71.40  ?  307 ASN B CA    1 
ATOM   6045  C  C     . ASN B 1 307 ? 53.743  17.701  -18.461 1.00 66.95  ?  307 ASN B C     1 
ATOM   6046  O  O     . ASN B 1 307 ? 54.942  17.590  -18.212 1.00 67.96  ?  307 ASN B O     1 
ATOM   6047  C  CB    . ASN B 1 307 ? 54.179  19.573  -20.073 1.00 79.04  ?  307 ASN B CB    1 
ATOM   6048  C  CG    . ASN B 1 307 ? 54.369  18.660  -21.307 1.00 83.86  ?  307 ASN B CG    1 
ATOM   6049  O  OD1   . ASN B 1 307 ? 53.646  17.674  -21.494 1.00 84.59  ?  307 ASN B OD1   1 
ATOM   6050  N  ND2   . ASN B 1 307 ? 55.339  18.999  -22.150 1.00 86.73  ?  307 ASN B ND2   1 
ATOM   6051  N  N     . THR B 1 308 ? 52.880  16.715  -18.255 1.00 64.13  ?  308 THR B N     1 
ATOM   6052  C  CA    . THR B 1 308 ? 53.341  15.534  -17.544 1.00 61.22  ?  308 THR B CA    1 
ATOM   6053  C  C     . THR B 1 308 ? 54.462  14.771  -18.277 1.00 57.54  ?  308 THR B C     1 
ATOM   6054  O  O     . THR B 1 308 ? 55.406  14.314  -17.638 1.00 51.94  ?  308 THR B O     1 
ATOM   6055  C  CB    . THR B 1 308 ? 52.183  14.621  -17.000 1.00 52.93  ?  308 THR B CB    1 
ATOM   6056  O  OG1   . THR B 1 308 ? 52.466  13.246  -17.302 1.00 49.22  ?  308 THR B OG1   1 
ATOM   6057  C  CG2   . THR B 1 308 ? 50.792  15.049  -17.536 1.00 67.13  ?  308 THR B CG2   1 
ATOM   6058  N  N     . GLU B 1 309 ? 54.398  14.668  -19.602 1.00 60.29  ?  309 GLU B N     1 
ATOM   6059  C  CA    . GLU B 1 309 ? 55.518  14.058  -20.330 1.00 59.33  ?  309 GLU B CA    1 
ATOM   6060  C  C     . GLU B 1 309 ? 56.812  14.902  -20.226 1.00 61.82  ?  309 GLU B C     1 
ATOM   6061  O  O     . GLU B 1 309 ? 57.920  14.362  -20.215 1.00 65.75  ?  309 GLU B O     1 
ATOM   6062  C  CB    . GLU B 1 309 ? 55.155  13.762  -21.792 1.00 55.97  ?  309 GLU B CB    1 
ATOM   6063  N  N     . LEU B 1 310 ? 56.669  16.220  -20.127 1.00 58.83  ?  310 LEU B N     1 
ATOM   6064  C  CA    . LEU B 1 310 ? 57.827  17.093  -19.989 1.00 54.69  ?  310 LEU B CA    1 
ATOM   6065  C  C     . LEU B 1 310 ? 58.596  16.795  -18.705 1.00 51.85  ?  310 LEU B C     1 
ATOM   6066  O  O     . LEU B 1 310 ? 59.828  16.737  -18.707 1.00 51.65  ?  310 LEU B O     1 
ATOM   6067  C  CB    . LEU B 1 310 ? 57.399  18.561  -19.991 1.00 55.38  ?  310 LEU B CB    1 
ATOM   6068  C  CG    . LEU B 1 310 ? 58.333  19.545  -20.702 1.00 56.57  ?  310 LEU B CG    1 
ATOM   6069  C  CD1   . LEU B 1 310 ? 58.397  20.857  -19.938 1.00 38.72  ?  310 LEU B CD1   1 
ATOM   6070  C  CD2   . LEU B 1 310 ? 59.733  18.948  -20.922 1.00 56.03  ?  310 LEU B CD2   1 
ATOM   6071  N  N     . VAL B 1 311 ? 57.847  16.617  -17.617 1.00 50.71  ?  311 VAL B N     1 
ATOM   6072  C  CA    . VAL B 1 311 ? 58.389  16.383  -16.281 1.00 50.12  ?  311 VAL B CA    1 
ATOM   6073  C  C     . VAL B 1 311 ? 59.044  14.998  -16.148 1.00 51.38  ?  311 VAL B C     1 
ATOM   6074  O  O     . VAL B 1 311 ? 60.063  14.814  -15.470 1.00 47.43  ?  311 VAL B O     1 
ATOM   6075  C  CB    . VAL B 1 311 ? 57.270  16.506  -15.224 1.00 43.14  ?  311 VAL B CB    1 
ATOM   6076  C  CG1   . VAL B 1 311 ? 57.789  16.152  -13.835 1.00 40.89  ?  311 VAL B CG1   1 
ATOM   6077  C  CG2   . VAL B 1 311 ? 56.699  17.896  -15.224 1.00 42.07  ?  311 VAL B CG2   1 
ATOM   6078  N  N     . LEU B 1 312 ? 58.448  14.017  -16.807 1.00 51.20  ?  312 LEU B N     1 
ATOM   6079  C  CA    . LEU B 1 312 ? 58.939  12.661  -16.723 1.00 46.79  ?  312 LEU B CA    1 
ATOM   6080  C  C     . LEU B 1 312 ? 60.218  12.535  -17.517 1.00 47.52  ?  312 LEU B C     1 
ATOM   6081  O  O     . LEU B 1 312 ? 61.102  11.764  -17.165 1.00 53.90  ?  312 LEU B O     1 
ATOM   6082  C  CB    . LEU B 1 312 ? 57.896  11.702  -17.266 1.00 44.32  ?  312 LEU B CB    1 
ATOM   6083  C  CG    . LEU B 1 312 ? 58.046  10.245  -16.866 1.00 43.22  ?  312 LEU B CG    1 
ATOM   6084  C  CD1   . LEU B 1 312 ? 58.230  10.128  -15.362 1.00 41.08  ?  312 LEU B CD1   1 
ATOM   6085  C  CD2   . LEU B 1 312 ? 56.805  9.520   -17.299 1.00 48.23  ?  312 LEU B CD2   1 
ATOM   6086  N  N     . ASN B 1 313 ? 60.329  13.294  -18.595 1.00 43.50  ?  313 ASN B N     1 
ATOM   6087  C  CA    . ASN B 1 313 ? 61.534  13.191  -19.403 1.00 46.75  ?  313 ASN B CA    1 
ATOM   6088  C  C     . ASN B 1 313 ? 62.715  13.815  -18.704 1.00 45.04  ?  313 ASN B C     1 
ATOM   6089  O  O     . ASN B 1 313 ? 63.829  13.296  -18.766 1.00 45.38  ?  313 ASN B O     1 
ATOM   6090  C  CB    . ASN B 1 313 ? 61.321  13.780  -20.786 1.00 58.33  ?  313 ASN B CB    1 
ATOM   6091  C  CG    . ASN B 1 313 ? 60.563  12.832  -21.696 1.00 67.10  ?  313 ASN B CG    1 
ATOM   6092  O  OD1   . ASN B 1 313 ? 60.741  11.614  -21.624 1.00 69.03  ?  313 ASN B OD1   1 
ATOM   6093  N  ND2   . ASN B 1 313 ? 59.707  13.383  -22.549 1.00 71.81  ?  313 ASN B ND2   1 
ATOM   6094  N  N     . TYR B 1 314 ? 62.451  14.909  -18.001 1.00 43.93  ?  314 TYR B N     1 
ATOM   6095  C  CA    . TYR B 1 314 ? 63.481  15.586  -17.235 1.00 44.49  ?  314 TYR B CA    1 
ATOM   6096  C  C     . TYR B 1 314 ? 63.979  14.738  -16.066 1.00 47.58  ?  314 TYR B C     1 
ATOM   6097  O  O     . TYR B 1 314 ? 65.190  14.634  -15.827 1.00 53.80  ?  314 TYR B O     1 
ATOM   6098  C  CB    . TYR B 1 314 ? 62.981  16.927  -16.708 1.00 43.30  ?  314 TYR B CB    1 
ATOM   6099  C  CG    . TYR B 1 314 ? 64.098  17.740  -16.101 1.00 39.71  ?  314 TYR B CG    1 
ATOM   6100  C  CD1   . TYR B 1 314 ? 64.494  17.551  -14.771 1.00 39.77  ?  314 TYR B CD1   1 
ATOM   6101  C  CD2   . TYR B 1 314 ? 64.788  18.671  -16.863 1.00 37.64  ?  314 TYR B CD2   1 
ATOM   6102  C  CE1   . TYR B 1 314 ? 65.534  18.283  -14.229 1.00 40.50  ?  314 TYR B CE1   1 
ATOM   6103  C  CE2   . TYR B 1 314 ? 65.822  19.411  -16.324 1.00 38.02  ?  314 TYR B CE2   1 
ATOM   6104  C  CZ    . TYR B 1 314 ? 66.189  19.216  -15.013 1.00 40.09  ?  314 TYR B CZ    1 
ATOM   6105  O  OH    . TYR B 1 314 ? 67.225  19.958  -14.502 1.00 42.79  ?  314 TYR B OH    1 
ATOM   6106  N  N     . LEU B 1 315 ? 63.054  14.142  -15.325 1.00 43.23  ?  315 LEU B N     1 
ATOM   6107  C  CA    . LEU B 1 315 ? 63.462  13.287  -14.222 1.00 41.37  ?  315 LEU B CA    1 
ATOM   6108  C  C     . LEU B 1 315 ? 64.340  12.138  -14.711 1.00 46.30  ?  315 LEU B C     1 
ATOM   6109  O  O     . LEU B 1 315 ? 65.373  11.855  -14.102 1.00 50.36  ?  315 LEU B O     1 
ATOM   6110  C  CB    . LEU B 1 315 ? 62.253  12.792  -13.436 1.00 36.79  ?  315 LEU B CB    1 
ATOM   6111  C  CG    . LEU B 1 315 ? 61.454  13.983  -12.891 1.00 36.02  ?  315 LEU B CG    1 
ATOM   6112  C  CD1   . LEU B 1 315 ? 60.235  13.545  -12.123 1.00 33.44  ?  315 LEU B CD1   1 
ATOM   6113  C  CD2   . LEU B 1 315 ? 62.327  14.869  -12.024 1.00 36.17  ?  315 LEU B CD2   1 
ATOM   6114  N  N     . PHE B 1 316 ? 63.956  11.498  -15.820 1.00 46.72  ?  316 PHE B N     1 
ATOM   6115  C  CA    . PHE B 1 316 ? 64.802  10.463  -16.430 1.00 45.49  ?  316 PHE B CA    1 
ATOM   6116  C  C     . PHE B 1 316 ? 66.185  10.999  -16.814 1.00 45.85  ?  316 PHE B C     1 
ATOM   6117  O  O     . PHE B 1 316 ? 67.200  10.422  -16.414 1.00 51.31  ?  316 PHE B O     1 
ATOM   6118  C  CB    . PHE B 1 316 ? 64.152  9.832   -17.661 1.00 43.23  ?  316 PHE B CB    1 
ATOM   6119  C  CG    . PHE B 1 316 ? 63.001  8.932   -17.354 1.00 43.76  ?  316 PHE B CG    1 
ATOM   6120  C  CD1   . PHE B 1 316 ? 61.916  8.858   -18.224 1.00 42.58  ?  316 PHE B CD1   1 
ATOM   6121  C  CD2   . PHE B 1 316 ? 62.993  8.155   -16.197 1.00 47.38  ?  316 PHE B CD2   1 
ATOM   6122  C  CE1   . PHE B 1 316 ? 60.829  8.035   -17.946 1.00 41.58  ?  316 PHE B CE1   1 
ATOM   6123  C  CE2   . PHE B 1 316 ? 61.918  7.318   -15.910 1.00 46.62  ?  316 PHE B CE2   1 
ATOM   6124  C  CZ    . PHE B 1 316 ? 60.829  7.257   -16.787 1.00 44.57  ?  316 PHE B CZ    1 
ATOM   6125  N  N     . LYS B 1 317 ? 66.247  12.081  -17.595 1.00 38.05  ?  317 LYS B N     1 
ATOM   6126  C  CA    . LYS B 1 317 ? 67.563  12.559  -18.016 1.00 37.43  ?  317 LYS B CA    1 
ATOM   6127  C  C     . LYS B 1 317 ? 68.417  12.993  -16.827 1.00 39.50  ?  317 LYS B C     1 
ATOM   6128  O  O     . LYS B 1 317 ? 69.534  12.516  -16.668 1.00 38.48  ?  317 LYS B O     1 
ATOM   6129  C  CB    . LYS B 1 317 ? 67.493  13.654  -19.087 1.00 31.15  ?  317 LYS B CB    1 
ATOM   6130  C  CG    . LYS B 1 317 ? 68.870  14.221  -19.499 1.00 32.39  ?  317 LYS B CG    1 
ATOM   6131  C  CD    . LYS B 1 317 ? 68.837  14.994  -20.853 1.00 34.03  ?  317 LYS B CD    1 
ATOM   6132  N  N     . TYR B 1 318 ? 67.871  13.855  -15.970 1.00 43.83  ?  318 TYR B N     1 
ATOM   6133  C  CA    . TYR B 1 318 ? 68.682  14.539  -14.955 1.00 43.61  ?  318 TYR B CA    1 
ATOM   6134  C  C     . TYR B 1 318 ? 68.708  13.958  -13.534 1.00 45.21  ?  318 TYR B C     1 
ATOM   6135  O  O     . TYR B 1 318 ? 69.453  14.446  -12.683 1.00 46.73  ?  318 TYR B O     1 
ATOM   6136  C  CB    . TYR B 1 318 ? 68.360  16.033  -14.933 1.00 37.23  ?  318 TYR B CB    1 
ATOM   6137  C  CG    . TYR B 1 318 ? 68.685  16.674  -16.243 1.00 40.00  ?  318 TYR B CG    1 
ATOM   6138  C  CD1   . TYR B 1 318 ? 69.944  17.197  -16.487 1.00 44.59  ?  318 TYR B CD1   1 
ATOM   6139  C  CD2   . TYR B 1 318 ? 67.745  16.729  -17.258 1.00 43.69  ?  318 TYR B CD2   1 
ATOM   6140  C  CE1   . TYR B 1 318 ? 70.256  17.784  -17.705 1.00 45.61  ?  318 TYR B CE1   1 
ATOM   6141  C  CE2   . TYR B 1 318 ? 68.041  17.312  -18.472 1.00 48.86  ?  318 TYR B CE2   1 
ATOM   6142  C  CZ    . TYR B 1 318 ? 69.300  17.838  -18.695 1.00 45.48  ?  318 TYR B CZ    1 
ATOM   6143  O  OH    . TYR B 1 318 ? 69.598  18.416  -19.906 1.00 42.98  ?  318 TYR B OH    1 
ATOM   6144  N  N     . THR B 1 319 ? 67.915  12.926  -13.271 1.00 42.53  ?  319 THR B N     1 
ATOM   6145  C  CA    . THR B 1 319 ? 68.113  12.181  -12.036 1.00 40.71  ?  319 THR B CA    1 
ATOM   6146  C  C     . THR B 1 319 ? 68.450  10.713  -12.278 1.00 45.37  ?  319 THR B C     1 
ATOM   6147  O  O     . THR B 1 319 ? 68.915  10.319  -13.368 1.00 57.06  ?  319 THR B O     1 
ATOM   6148  C  CB    . THR B 1 319 ? 66.939  12.316  -11.054 1.00 37.21  ?  319 THR B CB    1 
ATOM   6149  O  OG1   . THR B 1 319 ? 65.897  11.395  -11.400 1.00 36.93  ?  319 THR B OG1   1 
ATOM   6150  C  CG2   . THR B 1 319 ? 66.413  13.724  -11.074 1.00 34.07  ?  319 THR B CG2   1 
ATOM   6151  N  N     . ASP B 1 320 ? 68.283  9.924   -11.227 1.00 39.92  ?  320 ASP B N     1 
ATOM   6152  C  CA    . ASP B 1 320 ? 68.675  8.529   -11.258 1.00 43.11  ?  320 ASP B CA    1 
ATOM   6153  C  C     . ASP B 1 320 ? 67.440  7.690   -11.420 1.00 44.47  ?  320 ASP B C     1 
ATOM   6154  O  O     . ASP B 1 320 ? 67.508  6.464   -11.323 1.00 44.85  ?  320 ASP B O     1 
ATOM   6155  C  CB    . ASP B 1 320 ? 69.422  8.122   -9.984  1.00 48.98  ?  320 ASP B CB    1 
ATOM   6156  C  CG    . ASP B 1 320 ? 70.910  8.455   -10.036 1.00 56.85  ?  320 ASP B CG    1 
ATOM   6157  O  OD1   . ASP B 1 320 ? 71.423  8.825   -11.117 1.00 59.10  ?  320 ASP B OD1   1 
ATOM   6158  O  OD2   . ASP B 1 320 ? 71.576  8.327   -8.986  1.00 60.59  ?  320 ASP B OD2   1 
ATOM   6159  N  N     . LEU B 1 321 ? 66.315  8.369   -11.645 1.00 44.19  ?  321 LEU B N     1 
ATOM   6160  C  CA    . LEU B 1 321 ? 65.073  7.715   -12.038 1.00 44.16  ?  321 LEU B CA    1 
ATOM   6161  C  C     . LEU B 1 321 ? 65.440  6.839   -13.206 1.00 41.20  ?  321 LEU B C     1 
ATOM   6162  O  O     . LEU B 1 321 ? 64.806  5.823   -13.476 1.00 37.83  ?  321 LEU B O     1 
ATOM   6163  C  CB    . LEU B 1 321 ? 64.057  8.745   -12.497 1.00 45.77  ?  321 LEU B CB    1 
ATOM   6164  C  CG    . LEU B 1 321 ? 62.689  8.771   -11.828 1.00 44.44  ?  321 LEU B CG    1 
ATOM   6165  C  CD1   . LEU B 1 321 ? 61.624  8.782   -12.910 1.00 42.64  ?  321 LEU B CD1   1 
ATOM   6166  C  CD2   . LEU B 1 321 ? 62.518  7.603   -10.867 1.00 42.94  ?  321 LEU B CD2   1 
ATOM   6167  N  N     . GLN B 1 322 ? 66.495  7.251   -13.896 1.00 40.34  ?  322 GLN B N     1 
ATOM   6168  C  CA    . GLN B 1 322 ? 67.084  6.437   -14.935 1.00 41.64  ?  322 GLN B CA    1 
ATOM   6169  C  C     . GLN B 1 322 ? 68.584  6.625   -15.005 1.00 44.73  ?  322 GLN B C     1 
ATOM   6170  O  O     . GLN B 1 322 ? 69.077  7.774   -15.030 1.00 58.76  ?  322 GLN B O     1 
ATOM   6171  C  CB    . GLN B 1 322 ? 66.492  6.791   -16.274 1.00 46.33  ?  322 GLN B CB    1 
ATOM   6172  C  CG    . GLN B 1 322 ? 66.972  5.883   -17.354 1.00 50.30  ?  322 GLN B CG    1 
ATOM   6173  C  CD    . GLN B 1 322 ? 66.962  6.567   -18.669 1.00 48.09  ?  322 GLN B CD    1 
ATOM   6174  O  OE1   . GLN B 1 322 ? 65.899  6.868   -19.216 1.00 42.02  ?  322 GLN B OE1   1 
ATOM   6175  N  NE2   . GLN B 1 322 ? 68.149  6.862   -19.182 1.00 52.97  ?  322 GLN B NE2   1 
ATOM   6176  N  N     . ILE B 1 323 ? 69.280  5.491   -15.091 1.00 48.52  ?  323 ILE B N     1 
ATOM   6177  C  CA    . ILE B 1 323 ? 70.735  5.425   -15.016 1.00 45.72  ?  323 ILE B CA    1 
ATOM   6178  C  C     . ILE B 1 323 ? 71.313  4.447   -16.029 1.00 46.59  ?  323 ILE B C     1 
ATOM   6179  O  O     . ILE B 1 323 ? 70.553  3.722   -16.684 1.00 46.35  ?  323 ILE B O     1 
ATOM   6180  C  CB    . ILE B 1 323 ? 71.221  5.011   -13.595 1.00 73.98  ?  323 ILE B CB    1 
ATOM   6181  C  CG1   . ILE B 1 323 ? 70.472  3.779   -13.078 1.00 38.05  ?  323 ILE B CG1   1 
ATOM   6182  C  CG2   . ILE B 1 323 ? 71.069  6.162   -12.622 1.00 74.50  ?  323 ILE B CG2   1 
ATOM   6183  C  CD1   . ILE B 1 323 ? 71.215  2.497   -13.237 1.00 37.04  ?  323 ILE B CD1   1 
ATOM   6184  N  N     . ASN B 1 324 ? 72.651  4.450   -16.149 1.00 48.90  ?  324 ASN B N     1 
ATOM   6185  C  CA    . ASN B 1 324 ? 73.407  3.448   -16.930 1.00 51.79  ?  324 ASN B CA    1 
ATOM   6186  C  C     . ASN B 1 324 ? 74.074  2.382   -16.059 1.00 55.45  ?  324 ASN B C     1 
ATOM   6187  O  O     . ASN B 1 324 ? 74.915  2.701   -15.218 1.00 57.13  ?  324 ASN B O     1 
ATOM   6188  C  CB    . ASN B 1 324 ? 74.535  4.079   -17.756 1.00 50.55  ?  324 ASN B CB    1 
ATOM   6189  C  CG    . ASN B 1 324 ? 74.076  5.215   -18.638 1.00 54.60  ?  324 ASN B CG    1 
ATOM   6190  O  OD1   . ASN B 1 324 ? 73.007  5.177   -19.252 1.00 55.54  ?  324 ASN B OD1   1 
ATOM   6191  N  ND2   . ASN B 1 324 ? 74.904  6.242   -18.716 1.00 59.52  ?  324 ASN B ND2   1 
ATOM   6192  N  N     . TYR B 1 325 ? 73.725  1.117   -16.279 1.00 54.51  ?  325 TYR B N     1 
ATOM   6193  C  CA    . TYR B 1 325 ? 74.455  0.022   -15.659 1.00 46.21  ?  325 TYR B CA    1 
ATOM   6194  C  C     . TYR B 1 325 ? 75.626  -0.364  -16.559 1.00 45.08  ?  325 TYR B C     1 
ATOM   6195  O  O     . TYR B 1 325 ? 75.456  -0.506  -17.768 1.00 47.06  ?  325 TYR B O     1 
ATOM   6196  C  CB    . TYR B 1 325 ? 73.555  -1.194  -15.402 1.00 39.74  ?  325 TYR B CB    1 
ATOM   6197  C  CG    . TYR B 1 325 ? 74.311  -2.271  -14.685 1.00 40.93  ?  325 TYR B CG    1 
ATOM   6198  C  CD1   . TYR B 1 325 ? 75.091  -3.173  -15.389 1.00 47.74  ?  325 TYR B CD1   1 
ATOM   6199  C  CD2   . TYR B 1 325 ? 74.297  -2.355  -13.297 1.00 40.70  ?  325 TYR B CD2   1 
ATOM   6200  C  CE1   . TYR B 1 325 ? 75.820  -4.150  -14.739 1.00 49.87  ?  325 TYR B CE1   1 
ATOM   6201  C  CE2   . TYR B 1 325 ? 75.016  -3.330  -12.634 1.00 45.05  ?  325 TYR B CE2   1 
ATOM   6202  C  CZ    . TYR B 1 325 ? 75.783  -4.225  -13.360 1.00 49.37  ?  325 TYR B CZ    1 
ATOM   6203  O  OH    . TYR B 1 325 ? 76.514  -5.200  -12.717 1.00 49.16  ?  325 TYR B OH    1 
ATOM   6204  N  N     . ASN B 1 326 ? 76.813  -0.527  -15.980 1.00 45.44  ?  326 ASN B N     1 
ATOM   6205  C  CA    . ASN B 1 326 ? 77.974  -0.936  -16.769 1.00 49.25  ?  326 ASN B CA    1 
ATOM   6206  C  C     . ASN B 1 326 ? 78.489  -2.337  -16.467 1.00 45.78  ?  326 ASN B C     1 
ATOM   6207  O  O     . ASN B 1 326 ? 79.144  -2.561  -15.445 1.00 43.48  ?  326 ASN B O     1 
ATOM   6208  C  CB    . ASN B 1 326 ? 79.124  0.054   -16.611 1.00 52.34  ?  326 ASN B CB    1 
ATOM   6209  C  CG    . ASN B 1 326 ? 78.961  1.279   -17.473 1.00 56.12  ?  326 ASN B CG    1 
ATOM   6210  O  OD1   . ASN B 1 326 ? 79.212  1.244   -18.684 1.00 55.00  ?  326 ASN B OD1   1 
ATOM   6211  N  ND2   . ASN B 1 326 ? 78.555  2.381   -16.853 1.00 59.28  ?  326 ASN B ND2   1 
ATOM   6212  N  N     . PHE B 1 327 ? 78.203  -3.278  -17.362 1.00 43.86  ?  327 PHE B N     1 
ATOM   6213  C  CA    . PHE B 1 327 ? 78.769  -4.602  -17.234 1.00 45.15  ?  327 PHE B CA    1 
ATOM   6214  C  C     . PHE B 1 327 ? 80.275  -4.452  -17.221 1.00 46.95  ?  327 PHE B C     1 
ATOM   6215  O  O     . PHE B 1 327 ? 80.846  -3.824  -18.114 1.00 48.92  ?  327 PHE B O     1 
ATOM   6216  C  CB    . PHE B 1 327 ? 78.425  -5.450  -18.433 1.00 34.48  ?  327 PHE B CB    1 
ATOM   6217  C  CG    . PHE B 1 327 ? 77.009  -5.923  -18.484 1.00 34.26  ?  327 PHE B CG    1 
ATOM   6218  C  CD1   . PHE B 1 327 ? 76.671  -7.179  -18.010 1.00 33.47  ?  327 PHE B CD1   1 
ATOM   6219  C  CD2   . PHE B 1 327 ? 76.030  -5.156  -19.093 1.00 35.54  ?  327 PHE B CD2   1 
ATOM   6220  C  CE1   . PHE B 1 327 ? 75.373  -7.640  -18.102 1.00 34.65  ?  327 PHE B CE1   1 
ATOM   6221  C  CE2   . PHE B 1 327 ? 74.726  -5.611  -19.197 1.00 37.21  ?  327 PHE B CE2   1 
ATOM   6222  C  CZ    . PHE B 1 327 ? 74.398  -6.853  -18.693 1.00 34.08  ?  327 PHE B CZ    1 
ATOM   6223  N  N     . ASN B 1 328 ? 80.915  -5.018  -16.206 1.00 33.54  ?  328 ASN B N     1 
ATOM   6224  C  CA    . ASN B 1 328 ? 82.356  -5.209  -16.223 1.00 33.62  ?  328 ASN B CA    1 
ATOM   6225  C  C     . ASN B 1 328 ? 82.702  -6.562  -15.590 1.00 50.24  ?  328 ASN B C     1 
ATOM   6226  O  O     . ASN B 1 328 ? 83.351  -6.651  -14.563 1.00 32.12  ?  328 ASN B O     1 
ATOM   6227  C  CB    . ASN B 1 328 ? 83.050  -4.056  -15.521 1.00 33.90  ?  328 ASN B CB    1 
ATOM   6228  C  CG    . ASN B 1 328 ? 84.553  -4.185  -15.531 1.00 39.52  ?  328 ASN B CG    1 
ATOM   6229  O  OD1   . ASN B 1 328 ? 85.112  -4.991  -16.273 1.00 41.80  ?  328 ASN B OD1   1 
ATOM   6230  N  ND2   . ASN B 1 328 ? 85.222  -3.381  -14.700 1.00 34.49  ?  328 ASN B ND2   1 
ATOM   6231  N  N     . MET B 1 329 ? 82.247  -7.624  -16.235 1.00 47.26  ?  329 MET B N     1 
ATOM   6232  C  CA    . MET B 1 329 ? 82.370  -8.964  -15.696 1.00 44.53  ?  329 MET B CA    1 
ATOM   6233  C  C     . MET B 1 329 ? 83.804  -9.465  -15.644 1.00 42.77  ?  329 MET B C     1 
ATOM   6234  O  O     . MET B 1 329 ? 84.323  -10.012 -16.605 1.00 40.20  ?  329 MET B O     1 
ATOM   6235  C  CB    . MET B 1 329 ? 81.500  -9.920  -16.503 1.00 44.66  ?  329 MET B CB    1 
ATOM   6236  C  CG    . MET B 1 329 ? 80.159  -9.311  -16.831 1.00 43.90  ?  329 MET B CG    1 
ATOM   6237  S  SD    . MET B 1 329 ? 78.919  -10.529 -17.254 1.00 61.35  ?  329 MET B SD    1 
ATOM   6238  C  CE    . MET B 1 329 ? 79.701  -11.333 -18.651 1.00 41.86  ?  329 MET B CE    1 
ATOM   6239  N  N     . VAL B 1 330 ? 84.435  -9.275  -14.497 1.00 46.10  ?  330 VAL B N     1 
ATOM   6240  C  CA    . VAL B 1 330 ? 85.705  -9.918  -14.216 1.00 43.64  ?  330 VAL B CA    1 
ATOM   6241  C  C     . VAL B 1 330 ? 85.533  -10.863 -13.041 1.00 37.00  ?  330 VAL B C     1 
ATOM   6242  O  O     . VAL B 1 330 ? 84.700  -10.637 -12.175 1.00 32.98  ?  330 VAL B O     1 
ATOM   6243  C  CB    . VAL B 1 330 ? 86.776  -8.905  -13.871 1.00 31.38  ?  330 VAL B CB    1 
ATOM   6244  C  CG1   . VAL B 1 330 ? 88.023  -9.626  -13.439 1.00 38.29  ?  330 VAL B CG1   1 
ATOM   6245  C  CG2   . VAL B 1 330 ? 87.044  -8.038  -15.064 1.00 46.88  ?  330 VAL B CG2   1 
ATOM   6246  N  N     . ALA B 1 331 ? 86.325  -11.926 -13.027 1.00 34.97  ?  331 ALA B N     1 
ATOM   6247  C  CA    . ALA B 1 331 ? 86.211  -12.977 -12.029 1.00 39.10  ?  331 ALA B CA    1 
ATOM   6248  C  C     . ALA B 1 331 ? 87.516  -13.757 -12.014 1.00 37.28  ?  331 ALA B C     1 
ATOM   6249  O  O     . ALA B 1 331 ? 88.423  -13.466 -12.798 1.00 39.90  ?  331 ALA B O     1 
ATOM   6250  C  CB    . ALA B 1 331 ? 85.035  -13.891 -12.338 1.00 44.92  ?  331 ALA B CB    1 
ATOM   6251  N  N     . ILE B 1 332 ? 87.620  -14.739 -11.125 1.00 38.97  ?  332 ILE B N     1 
ATOM   6252  C  CA    . ILE B 1 332 ? 88.897  -15.397 -10.902 1.00 35.22  ?  332 ILE B CA    1 
ATOM   6253  C  C     . ILE B 1 332 ? 88.852  -16.808 -11.453 1.00 42.08  ?  332 ILE B C     1 
ATOM   6254  O  O     . ILE B 1 332 ? 88.160  -17.681 -10.923 1.00 45.34  ?  332 ILE B O     1 
ATOM   6255  C  CB    . ILE B 1 332 ? 89.294  -15.387 -9.412  1.00 35.48  ?  332 ILE B CB    1 
ATOM   6256  C  CG1   . ILE B 1 332 ? 89.443  -13.948 -8.906  1.00 38.69  ?  332 ILE B CG1   1 
ATOM   6257  C  CG2   . ILE B 1 332 ? 90.591  -16.105 -9.211  1.00 27.71  ?  332 ILE B CG2   1 
ATOM   6258  C  CD1   . ILE B 1 332 ? 90.839  -13.366 -9.069  1.00 38.70  ?  332 ILE B CD1   1 
ATOM   6259  N  N     . ASP B 1 333 ? 89.581  -17.004 -12.549 1.00 48.73  ?  333 ASP B N     1 
ATOM   6260  C  CA    . ASP B 1 333 ? 89.630  -18.272 -13.264 1.00 50.77  ?  333 ASP B CA    1 
ATOM   6261  C  C     . ASP B 1 333 ? 91.053  -18.791 -13.212 1.00 48.44  ?  333 ASP B C     1 
ATOM   6262  O  O     . ASP B 1 333 ? 92.002  -18.071 -13.509 1.00 48.97  ?  333 ASP B O     1 
ATOM   6263  C  CB    . ASP B 1 333 ? 89.176  -18.098 -14.713 1.00 58.62  ?  333 ASP B CB    1 
ATOM   6264  C  CG    . ASP B 1 333 ? 89.125  -19.415 -15.469 1.00 72.20  ?  333 ASP B CG    1 
ATOM   6265  O  OD1   . ASP B 1 333 ? 89.520  -19.435 -16.656 1.00 79.77  ?  333 ASP B OD1   1 
ATOM   6266  O  OD2   . ASP B 1 333 ? 88.683  -20.431 -14.884 1.00 74.68  ?  333 ASP B OD2   1 
ATOM   6267  N  N     . ASN B 1 334 ? 91.205  -20.041 -12.811 1.00 50.24  ?  334 ASN B N     1 
ATOM   6268  C  CA    . ASN B 1 334 ? 92.532  -20.578 -12.584 1.00 50.77  ?  334 ASN B CA    1 
ATOM   6269  C  C     . ASN B 1 334 ? 93.472  -19.558 -11.933 1.00 47.26  ?  334 ASN B C     1 
ATOM   6270  O  O     . ASN B 1 334 ? 94.471  -19.143 -12.529 1.00 43.40  ?  334 ASN B O     1 
ATOM   6271  C  CB    . ASN B 1 334 ? 93.126  -21.082 -13.887 1.00 51.84  ?  334 ASN B CB    1 
ATOM   6272  C  CG    . ASN B 1 334 ? 94.391  -21.851 -13.669 1.00 56.27  ?  334 ASN B CG    1 
ATOM   6273  O  OD1   . ASN B 1 334 ? 94.552  -22.517 -12.645 1.00 58.45  ?  334 ASN B OD1   1 
ATOM   6274  N  ND2   . ASN B 1 334 ? 95.311  -21.756 -14.616 1.00 58.54  ?  334 ASN B ND2   1 
ATOM   6275  N  N     . PHE B 1 335 ? 93.123  -19.149 -10.714 1.00 47.98  ?  335 PHE B N     1 
ATOM   6276  C  CA    . PHE B 1 335 ? 93.953  -18.264 -9.896  1.00 49.48  ?  335 PHE B CA    1 
ATOM   6277  C  C     . PHE B 1 335 ? 94.254  -16.870 -10.456 1.00 52.65  ?  335 PHE B C     1 
ATOM   6278  O  O     . PHE B 1 335 ? 95.068  -16.144 -9.893  1.00 55.98  ?  335 PHE B O     1 
ATOM   6279  C  CB    . PHE B 1 335 ? 95.254  -18.973 -9.544  1.00 50.38  ?  335 PHE B CB    1 
ATOM   6280  C  CG    . PHE B 1 335 ? 95.040  -20.297 -8.893  1.00 56.77  ?  335 PHE B CG    1 
ATOM   6281  C  CD1   . PHE B 1 335 ? 95.012  -21.457 -9.646  1.00 60.61  ?  335 PHE B CD1   1 
ATOM   6282  C  CD2   . PHE B 1 335 ? 94.826  -20.386 -7.532  1.00 57.74  ?  335 PHE B CD2   1 
ATOM   6283  C  CE1   . PHE B 1 335 ? 94.806  -22.688 -9.047  1.00 59.04  ?  335 PHE B CE1   1 
ATOM   6284  C  CE2   . PHE B 1 335 ? 94.613  -21.610 -6.933  1.00 58.65  ?  335 PHE B CE2   1 
ATOM   6285  C  CZ    . PHE B 1 335 ? 94.604  -22.763 -7.695  1.00 58.23  ?  335 PHE B CZ    1 
ATOM   6286  N  N     . THR B 1 336 ? 93.597  -16.483 -11.542 1.00 49.95  ?  336 THR B N     1 
ATOM   6287  C  CA    . THR B 1 336 ? 93.967  -15.250 -12.234 1.00 46.88  ?  336 THR B CA    1 
ATOM   6288  C  C     . THR B 1 336 ? 92.760  -14.384 -12.541 1.00 39.13  ?  336 THR B C     1 
ATOM   6289  O  O     . THR B 1 336 ? 91.679  -14.892 -12.813 1.00 33.96  ?  336 THR B O     1 
ATOM   6290  C  CB    . THR B 1 336 ? 94.685  -15.540 -13.575 1.00 50.62  ?  336 THR B CB    1 
ATOM   6291  O  OG1   . THR B 1 336 ? 95.768  -16.463 -13.376 1.00 49.15  ?  336 THR B OG1   1 
ATOM   6292  C  CG2   . THR B 1 336 ? 95.215  -14.251 -14.163 1.00 56.03  ?  336 THR B CG2   1 
ATOM   6293  N  N     . PRO B 1 337 ? 92.934  -13.063 -12.494 1.00 40.40  ?  337 PRO B N     1 
ATOM   6294  C  CA    . PRO B 1 337 ? 91.775  -12.242 -12.841 1.00 41.95  ?  337 PRO B CA    1 
ATOM   6295  C  C     . PRO B 1 337 ? 91.580  -12.304 -14.334 1.00 48.04  ?  337 PRO B C     1 
ATOM   6296  O  O     . PRO B 1 337 ? 92.562  -12.261 -15.077 1.00 54.03  ?  337 PRO B O     1 
ATOM   6297  C  CB    . PRO B 1 337 ? 92.184  -10.835 -12.399 1.00 39.62  ?  337 PRO B CB    1 
ATOM   6298  C  CG    . PRO B 1 337 ? 93.670  -10.868 -12.332 1.00 41.94  ?  337 PRO B CG    1 
ATOM   6299  C  CD    . PRO B 1 337 ? 94.049  -12.267 -11.961 1.00 43.28  ?  337 PRO B CD    1 
ATOM   6300  N  N     . ARG B 1 338 ? 90.334  -12.421 -14.772 1.00 45.67  ?  338 ARG B N     1 
ATOM   6301  C  CA    . ARG B 1 338 ? 90.070  -12.603 -16.180 1.00 47.40  ?  338 ARG B CA    1 
ATOM   6302  C  C     . ARG B 1 338 ? 88.754  -11.939 -16.585 1.00 52.22  ?  338 ARG B C     1 
ATOM   6303  O  O     . ARG B 1 338 ? 87.696  -12.246 -16.039 1.00 54.73  ?  338 ARG B O     1 
ATOM   6304  C  CB    . ARG B 1 338 ? 90.062  -14.097 -16.497 1.00 47.26  ?  338 ARG B CB    1 
ATOM   6305  C  CG    . ARG B 1 338 ? 89.699  -14.434 -17.924 1.00 57.96  ?  338 ARG B CG    1 
ATOM   6306  C  CD    . ARG B 1 338 ? 89.560  -15.936 -18.131 1.00 66.76  ?  338 ARG B CD    1 
ATOM   6307  N  NE    . ARG B 1 338 ? 89.109  -16.241 -19.488 1.00 71.73  ?  338 ARG B NE    1 
ATOM   6308  C  CZ    . ARG B 1 338 ? 88.681  -17.433 -19.888 1.00 71.15  ?  338 ARG B CZ    1 
ATOM   6309  N  NH1   . ARG B 1 338 ? 88.645  -18.447 -19.032 1.00 71.83  ?  338 ARG B NH1   1 
ATOM   6310  N  NH2   . ARG B 1 338 ? 88.283  -17.606 -21.145 1.00 69.21  ?  338 ARG B NH2   1 
ATOM   6311  N  N     . GLN B 1 339 ? 88.818  -11.016 -17.539 1.00 53.15  ?  339 GLN B N     1 
ATOM   6312  C  CA    . GLN B 1 339 ? 87.600  -10.421 -18.076 1.00 49.64  ?  339 GLN B CA    1 
ATOM   6313  C  C     . GLN B 1 339 ? 86.894  -11.466 -18.934 1.00 47.69  ?  339 GLN B C     1 
ATOM   6314  O  O     . GLN B 1 339 ? 87.496  -12.057 -19.819 1.00 50.35  ?  339 GLN B O     1 
ATOM   6315  C  CB    . GLN B 1 339 ? 87.911  -9.175  -18.890 1.00 50.48  ?  339 GLN B CB    1 
ATOM   6316  C  CG    . GLN B 1 339 ? 86.750  -8.216  -18.979 1.00 52.21  ?  339 GLN B CG    1 
ATOM   6317  C  CD    . GLN B 1 339 ? 86.991  -7.117  -19.989 1.00 56.53  ?  339 GLN B CD    1 
ATOM   6318  O  OE1   . GLN B 1 339 ? 86.048  -6.530  -20.519 1.00 59.37  ?  339 GLN B OE1   1 
ATOM   6319  N  NE2   . GLN B 1 339 ? 88.261  -6.835  -20.270 1.00 59.23  ?  339 GLN B NE2   1 
ATOM   6320  N  N     . VAL B 1 340 ? 85.624  -11.711 -18.648 1.00 43.47  ?  340 VAL B N     1 
ATOM   6321  C  CA    . VAL B 1 340 ? 84.933  -12.867 -19.200 1.00 42.25  ?  340 VAL B CA    1 
ATOM   6322  C  C     . VAL B 1 340 ? 83.508  -12.530 -19.592 1.00 46.59  ?  340 VAL B C     1 
ATOM   6323  O  O     . VAL B 1 340 ? 82.886  -11.633 -19.020 1.00 53.46  ?  340 VAL B O     1 
ATOM   6324  C  CB    . VAL B 1 340 ? 84.895  -14.043 -18.187 1.00 34.23  ?  340 VAL B CB    1 
ATOM   6325  C  CG1   . VAL B 1 340 ? 86.296  -14.452 -17.792 1.00 33.42  ?  340 VAL B CG1   1 
ATOM   6326  C  CG2   . VAL B 1 340 ? 84.095  -13.666 -16.947 1.00 34.00  ?  340 VAL B CG2   1 
ATOM   6327  N  N     . GLY B 1 341 ? 82.988  -13.265 -20.560 1.00 45.84  ?  341 GLY B N     1 
ATOM   6328  C  CA    . GLY B 1 341 ? 81.613  -13.093 -20.978 1.00 46.39  ?  341 GLY B CA    1 
ATOM   6329  C  C     . GLY B 1 341 ? 80.825  -14.360 -20.715 1.00 45.35  ?  341 GLY B C     1 
ATOM   6330  O  O     . GLY B 1 341 ? 81.360  -15.329 -20.168 1.00 46.16  ?  341 GLY B O     1 
ATOM   6331  N  N     . ILE B 1 342 ? 79.561  -14.363 -21.122 1.00 42.99  ?  342 ILE B N     1 
ATOM   6332  C  CA    . ILE B 1 342 ? 78.657  -15.454 -20.797 1.00 40.90  ?  342 ILE B CA    1 
ATOM   6333  C  C     . ILE B 1 342 ? 79.233  -16.849 -21.044 1.00 43.49  ?  342 ILE B C     1 
ATOM   6334  O  O     . ILE B 1 342 ? 78.801  -17.819 -20.428 1.00 47.65  ?  342 ILE B O     1 
ATOM   6335  C  CB    . ILE B 1 342 ? 77.318  -15.303 -21.535 1.00 41.17  ?  342 ILE B CB    1 
ATOM   6336  C  CG1   . ILE B 1 342 ? 76.389  -14.449 -20.696 1.00 40.57  ?  342 ILE B CG1   1 
ATOM   6337  C  CG2   . ILE B 1 342 ? 76.671  -16.649 -21.748 1.00 43.02  ?  342 ILE B CG2   1 
ATOM   6338  C  CD1   . ILE B 1 342 ? 76.835  -14.394 -19.257 1.00 44.95  ?  342 ILE B CD1   1 
ATOM   6339  N  N     . VAL B 1 343 ? 80.214  -16.964 -21.927 1.00 38.10  ?  343 VAL B N     1 
ATOM   6340  C  CA    . VAL B 1 343 ? 80.646  -18.300 -22.336 1.00 36.82  ?  343 VAL B CA    1 
ATOM   6341  C  C     . VAL B 1 343 ? 81.734  -18.946 -21.471 1.00 38.05  ?  343 VAL B C     1 
ATOM   6342  O  O     . VAL B 1 343 ? 81.566  -20.070 -21.012 1.00 43.85  ?  343 VAL B O     1 
ATOM   6343  C  CB    . VAL B 1 343 ? 80.985  -18.368 -23.836 1.00 36.61  ?  343 VAL B CB    1 
ATOM   6344  C  CG1   . VAL B 1 343 ? 81.940  -19.520 -24.116 1.00 38.42  ?  343 VAL B CG1   1 
ATOM   6345  C  CG2   . VAL B 1 343 ? 79.702  -18.514 -24.634 1.00 35.49  ?  343 VAL B CG2   1 
ATOM   6346  N  N     . PRO B 1 344 ? 82.856  -18.255 -21.267 1.00 36.53  ?  344 PRO B N     1 
ATOM   6347  C  CA    . PRO B 1 344 ? 83.810  -18.691 -20.242 1.00 42.36  ?  344 PRO B CA    1 
ATOM   6348  C  C     . PRO B 1 344 ? 83.146  -18.906 -18.864 1.00 43.91  ?  344 PRO B C     1 
ATOM   6349  O  O     . PRO B 1 344 ? 83.511  -19.836 -18.137 1.00 47.71  ?  344 PRO B O     1 
ATOM   6350  C  CB    . PRO B 1 344 ? 84.827  -17.534 -20.187 1.00 42.14  ?  344 PRO B CB    1 
ATOM   6351  C  CG    . PRO B 1 344 ? 84.200  -16.413 -20.949 1.00 40.91  ?  344 PRO B CG    1 
ATOM   6352  C  CD    . PRO B 1 344 ? 83.335  -17.073 -21.985 1.00 39.18  ?  344 PRO B CD    1 
ATOM   6353  N  N     . ILE B 1 345 ? 82.182  -18.060 -18.510 1.00 38.64  ?  345 ILE B N     1 
ATOM   6354  C  CA    . ILE B 1 345 ? 81.444  -18.246 -17.271 1.00 37.70  ?  345 ILE B CA    1 
ATOM   6355  C  C     . ILE B 1 345 ? 80.742  -19.609 -17.289 1.00 37.53  ?  345 ILE B C     1 
ATOM   6356  O  O     . ILE B 1 345 ? 81.125  -20.527 -16.560 1.00 46.89  ?  345 ILE B O     1 
ATOM   6357  C  CB    . ILE B 1 345 ? 80.430  -17.100 -17.032 1.00 38.59  ?  345 ILE B CB    1 
ATOM   6358  C  CG1   . ILE B 1 345 ? 81.155  -15.818 -16.635 1.00 37.85  ?  345 ILE B CG1   1 
ATOM   6359  C  CG2   . ILE B 1 345 ? 79.416  -17.466 -15.963 1.00 40.20  ?  345 ILE B CG2   1 
ATOM   6360  C  CD1   . ILE B 1 345 ? 80.279  -14.581 -16.723 1.00 36.08  ?  345 ILE B CD1   1 
ATOM   6361  N  N     . LEU B 1 346 ? 79.723  -19.754 -18.126 1.00 29.76  ?  346 LEU B N     1 
ATOM   6362  C  CA    . LEU B 1 346 ? 78.975  -21.005 -18.168 1.00 35.45  ?  346 LEU B CA    1 
ATOM   6363  C  C     . LEU B 1 346 ? 79.847  -22.251 -18.386 1.00 41.39  ?  346 LEU B C     1 
ATOM   6364  O  O     . LEU B 1 346 ? 79.565  -23.323 -17.856 1.00 40.86  ?  346 LEU B O     1 
ATOM   6365  C  CB    . LEU B 1 346 ? 77.903  -20.936 -19.239 1.00 33.43  ?  346 LEU B CB    1 
ATOM   6366  C  CG    . LEU B 1 346 ? 76.766  -19.986 -18.938 1.00 30.59  ?  346 LEU B CG    1 
ATOM   6367  C  CD1   . LEU B 1 346 ? 75.937  -19.772 -20.217 1.00 31.52  ?  346 LEU B CD1   1 
ATOM   6368  C  CD2   . LEU B 1 346 ? 75.949  -20.566 -17.798 1.00 27.89  ?  346 LEU B CD2   1 
ATOM   6369  N  N     . SER B 1 347 ? 80.899  -22.128 -19.179 1.00 43.42  ?  347 SER B N     1 
ATOM   6370  C  CA    . SER B 1 347 ? 81.729  -23.288 -19.416 1.00 43.29  ?  347 SER B CA    1 
ATOM   6371  C  C     . SER B 1 347 ? 82.455  -23.636 -18.126 1.00 42.16  ?  347 SER B C     1 
ATOM   6372  O  O     . SER B 1 347 ? 82.398  -24.774 -17.673 1.00 44.60  ?  347 SER B O     1 
ATOM   6373  C  CB    . SER B 1 347 ? 82.686  -23.072 -20.592 1.00 46.98  ?  347 SER B CB    1 
ATOM   6374  O  OG    . SER B 1 347 ? 83.585  -22.010 -20.346 1.00 50.68  ?  347 SER B OG    1 
ATOM   6375  N  N     . SER B 1 348 ? 83.109  -22.646 -17.525 1.00 40.62  ?  348 SER B N     1 
ATOM   6376  C  CA    . SER B 1 348 ? 83.768  -22.826 -16.228 1.00 42.19  ?  348 SER B CA    1 
ATOM   6377  C  C     . SER B 1 348 ? 82.882  -23.502 -15.189 1.00 38.21  ?  348 SER B C     1 
ATOM   6378  O  O     . SER B 1 348 ? 83.366  -24.330 -14.400 1.00 40.70  ?  348 SER B O     1 
ATOM   6379  C  CB    . SER B 1 348 ? 84.251  -21.490 -15.682 1.00 45.63  ?  348 SER B CB    1 
ATOM   6380  O  OG    . SER B 1 348 ? 85.426  -21.096 -16.361 1.00 52.24  ?  348 SER B OG    1 
ATOM   6381  N  N     . TYR B 1 349 ? 81.596  -23.139 -15.209 1.00 33.94  ?  349 TYR B N     1 
ATOM   6382  C  CA    . TYR B 1 349 ? 80.594  -23.692 -14.307 1.00 33.64  ?  349 TYR B CA    1 
ATOM   6383  C  C     . TYR B 1 349 ? 80.330  -25.166 -14.566 1.00 32.87  ?  349 TYR B C     1 
ATOM   6384  O  O     . TYR B 1 349 ? 80.422  -26.012 -13.665 1.00 34.33  ?  349 TYR B O     1 
ATOM   6385  C  CB    . TYR B 1 349 ? 79.270  -22.931 -14.417 1.00 32.47  ?  349 TYR B CB    1 
ATOM   6386  C  CG    . TYR B 1 349 ? 78.221  -23.544 -13.524 1.00 32.51  ?  349 TYR B CG    1 
ATOM   6387  C  CD1   . TYR B 1 349 ? 78.287  -23.385 -12.154 1.00 35.65  ?  349 TYR B CD1   1 
ATOM   6388  C  CD2   . TYR B 1 349 ? 77.211  -24.330 -14.041 1.00 33.33  ?  349 TYR B CD2   1 
ATOM   6389  C  CE1   . TYR B 1 349 ? 77.358  -23.963 -11.326 1.00 37.66  ?  349 TYR B CE1   1 
ATOM   6390  C  CE2   . TYR B 1 349 ? 76.264  -24.916 -13.217 1.00 34.61  ?  349 TYR B CE2   1 
ATOM   6391  C  CZ    . TYR B 1 349 ? 76.352  -24.731 -11.858 1.00 37.68  ?  349 TYR B CZ    1 
ATOM   6392  O  OH    . TYR B 1 349 ? 75.436  -25.293 -11.009 1.00 40.63  ?  349 TYR B OH    1 
ATOM   6393  N  N     . ILE B 1 350 ? 79.968  -25.454 -15.805 1.00 30.33  ?  350 ILE B N     1 
ATOM   6394  C  CA    . ILE B 1 350 ? 79.825  -26.821 -16.272 1.00 33.11  ?  350 ILE B CA    1 
ATOM   6395  C  C     . ILE B 1 350 ? 81.090  -27.623 -15.973 1.00 39.06  ?  350 ILE B C     1 
ATOM   6396  O  O     . ILE B 1 350 ? 81.018  -28.746 -15.463 1.00 44.67  ?  350 ILE B O     1 
ATOM   6397  C  CB    . ILE B 1 350 ? 79.528  -26.838 -17.774 1.00 35.35  ?  350 ILE B CB    1 
ATOM   6398  C  CG1   . ILE B 1 350 ? 78.129  -26.275 -18.025 1.00 26.37  ?  350 ILE B CG1   1 
ATOM   6399  C  CG2   . ILE B 1 350 ? 79.663  -28.232 -18.322 1.00 26.71  ?  350 ILE B CG2   1 
ATOM   6400  C  CD1   . ILE B 1 350 ? 77.684  -26.410 -19.444 1.00 28.75  ?  350 ILE B CD1   1 
ATOM   6401  N  N     . ALA B 1 351 ? 82.242  -27.031 -16.280 1.00 38.41  ?  351 ALA B N     1 
ATOM   6402  C  CA    . ALA B 1 351 ? 83.544  -27.626 -15.981 1.00 38.89  ?  351 ALA B CA    1 
ATOM   6403  C  C     . ALA B 1 351 ? 83.581  -28.097 -14.547 1.00 36.65  ?  351 ALA B C     1 
ATOM   6404  O  O     . ALA B 1 351 ? 83.920  -29.248 -14.266 1.00 37.46  ?  351 ALA B O     1 
ATOM   6405  C  CB    . ALA B 1 351 ? 84.654  -26.607 -16.199 1.00 46.43  ?  351 ALA B CB    1 
ATOM   6406  N  N     . HIS B 1 352 ? 83.242  -27.165 -13.657 1.00 37.21  ?  352 HIS B N     1 
ATOM   6407  C  CA    . HIS B 1 352 ? 83.275  -27.355 -12.223 1.00 35.55  ?  352 HIS B CA    1 
ATOM   6408  C  C     . HIS B 1 352 ? 82.231  -28.382 -11.761 1.00 31.31  ?  352 HIS B C     1 
ATOM   6409  O  O     . HIS B 1 352 ? 82.558  -29.338 -11.036 1.00 27.13  ?  352 HIS B O     1 
ATOM   6410  C  CB    . HIS B 1 352 ? 83.049  -26.002 -11.545 1.00 36.67  ?  352 HIS B CB    1 
ATOM   6411  C  CG    . HIS B 1 352 ? 82.943  -26.078 -10.056 1.00 38.97  ?  352 HIS B CG    1 
ATOM   6412  N  ND1   . HIS B 1 352 ? 84.020  -26.362 -9.248  1.00 39.74  ?  352 HIS B ND1   1 
ATOM   6413  C  CD2   . HIS B 1 352 ? 81.878  -25.926 -9.231  1.00 38.09  ?  352 HIS B CD2   1 
ATOM   6414  C  CE1   . HIS B 1 352 ? 83.624  -26.371 -7.985  1.00 39.74  ?  352 HIS B CE1   1 
ATOM   6415  N  NE2   . HIS B 1 352 ? 82.331  -26.109 -7.949  1.00 37.80  ?  352 HIS B NE2   1 
ATOM   6416  N  N     . ARG B 1 353 ? 80.980  -28.189 -12.176 1.00 27.43  ?  353 ARG B N     1 
ATOM   6417  C  CA    . ARG B 1 353 ? 79.940  -29.152 -11.855 1.00 27.69  ?  353 ARG B CA    1 
ATOM   6418  C  C     . ARG B 1 353 ? 80.291  -30.565 -12.307 1.00 37.18  ?  353 ARG B C     1 
ATOM   6419  O  O     . ARG B 1 353 ? 79.788  -31.536 -11.750 1.00 45.61  ?  353 ARG B O     1 
ATOM   6420  C  CB    . ARG B 1 353 ? 78.616  -28.735 -12.470 1.00 25.62  ?  353 ARG B CB    1 
ATOM   6421  C  CG    . ARG B 1 353 ? 77.918  -27.640 -11.732 1.00 27.41  ?  353 ARG B CG    1 
ATOM   6422  C  CD    . ARG B 1 353 ? 77.722  -28.040 -10.284 1.00 35.16  ?  353 ARG B CD    1 
ATOM   6423  N  NE    . ARG B 1 353 ? 76.819  -29.173 -10.115 1.00 38.91  ?  353 ARG B NE    1 
ATOM   6424  C  CZ    . ARG B 1 353 ? 76.585  -29.760 -8.946  1.00 42.84  ?  353 ARG B CZ    1 
ATOM   6425  N  NH1   . ARG B 1 353 ? 77.198  -29.329 -7.856  1.00 36.23  ?  353 ARG B NH1   1 
ATOM   6426  N  NH2   . ARG B 1 353 ? 75.741  -30.779 -8.869  1.00 50.25  ?  353 ARG B NH2   1 
ATOM   6427  N  N     . ARG B 1 354 ? 81.133  -30.687 -13.328 1.00 34.27  ?  354 ARG B N     1 
ATOM   6428  C  CA    . ARG B 1 354 ? 81.584  -32.002 -13.751 1.00 33.79  ?  354 ARG B CA    1 
ATOM   6429  C  C     . ARG B 1 354 ? 82.518  -32.614 -12.707 1.00 35.74  ?  354 ARG B C     1 
ATOM   6430  O  O     . ARG B 1 354 ? 82.265  -33.692 -12.176 1.00 35.19  ?  354 ARG B O     1 
ATOM   6431  C  CB    . ARG B 1 354 ? 82.284  -31.919 -15.098 1.00 37.83  ?  354 ARG B CB    1 
ATOM   6432  C  CG    . ARG B 1 354 ? 83.026  -33.190 -15.470 1.00 42.41  ?  354 ARG B CG    1 
ATOM   6433  C  CD    . ARG B 1 354 ? 83.626  -33.130 -16.854 1.00 45.30  ?  354 ARG B CD    1 
ATOM   6434  N  NE    . ARG B 1 354 ? 84.295  -34.385 -17.175 1.00 44.01  ?  354 ARG B NE    1 
ATOM   6435  C  CZ    . ARG B 1 354 ? 85.570  -34.633 -16.899 1.00 45.30  ?  354 ARG B CZ    1 
ATOM   6436  N  NH1   . ARG B 1 354 ? 86.293  -33.692 -16.314 1.00 43.64  ?  354 ARG B NH1   1 
ATOM   6437  N  NH2   . ARG B 1 354 ? 86.114  -35.808 -17.204 1.00 32.18  ?  354 ARG B NH2   1 
ATOM   6438  N  N     . GLU B 1 355 ? 83.602  -31.908 -12.419 1.00 34.45  ?  355 GLU B N     1 
ATOM   6439  C  CA    . GLU B 1 355 ? 84.534  -32.300 -11.371 1.00 35.49  ?  355 GLU B CA    1 
ATOM   6440  C  C     . GLU B 1 355 ? 83.843  -32.721 -10.052 1.00 37.41  ?  355 GLU B C     1 
ATOM   6441  O  O     . GLU B 1 355 ? 84.173  -33.762 -9.473  1.00 40.24  ?  355 GLU B O     1 
ATOM   6442  C  CB    . GLU B 1 355 ? 85.517  -31.159 -11.113 1.00 41.27  ?  355 GLU B CB    1 
ATOM   6443  C  CG    . GLU B 1 355 ? 86.667  -31.070 -12.090 1.00 51.40  ?  355 GLU B CG    1 
ATOM   6444  C  CD    . GLU B 1 355 ? 87.434  -32.364 -12.202 1.00 63.79  ?  355 GLU B CD    1 
ATOM   6445  O  OE1   . GLU B 1 355 ? 88.449  -32.399 -12.931 1.00 69.50  ?  355 GLU B OE1   1 
ATOM   6446  O  OE2   . GLU B 1 355 ? 87.015  -33.355 -11.563 1.00 66.96  ?  355 GLU B OE2   1 
ATOM   6447  N  N     . VAL B 1 356 ? 82.907  -31.895 -9.587  1.00 34.34  ?  356 VAL B N     1 
ATOM   6448  C  CA    . VAL B 1 356 ? 82.105  -32.171 -8.392  1.00 32.02  ?  356 VAL B CA    1 
ATOM   6449  C  C     . VAL B 1 356 ? 81.313  -33.485 -8.495  1.00 32.04  ?  356 VAL B C     1 
ATOM   6450  O  O     . VAL B 1 356 ? 81.464  -34.373 -7.655  1.00 40.29  ?  356 VAL B O     1 
ATOM   6451  C  CB    . VAL B 1 356 ? 81.140  -30.982 -8.083  1.00 29.51  ?  356 VAL B CB    1 
ATOM   6452  C  CG1   . VAL B 1 356 ? 80.039  -31.375 -7.129  1.00 25.79  ?  356 VAL B CG1   1 
ATOM   6453  C  CG2   . VAL B 1 356 ? 81.916  -29.809 -7.550  1.00 27.45  ?  356 VAL B CG2   1 
ATOM   6454  N  N     . ILE B 1 357 ? 80.474  -33.610 -9.520  1.00 24.70  ?  357 ILE B N     1 
ATOM   6455  C  CA    . ILE B 1 357 ? 79.653  -34.804 -9.703  1.00 24.76  ?  357 ILE B CA    1 
ATOM   6456  C  C     . ILE B 1 357 ? 80.491  -36.092 -9.788  1.00 30.79  ?  357 ILE B C     1 
ATOM   6457  O  O     . ILE B 1 357 ? 80.142  -37.128 -9.227  1.00 28.00  ?  357 ILE B O     1 
ATOM   6458  C  CB    . ILE B 1 357 ? 78.828  -34.683 -10.973 1.00 30.43  ?  357 ILE B CB    1 
ATOM   6459  C  CG1   . ILE B 1 357 ? 77.719  -33.664 -10.787 1.00 32.00  ?  357 ILE B CG1   1 
ATOM   6460  C  CG2   . ILE B 1 357 ? 78.240  -36.026 -11.367 1.00 23.38  ?  357 ILE B CG2   1 
ATOM   6461  C  CD1   . ILE B 1 357 ? 76.722  -33.692 -11.917 1.00 33.80  ?  357 ILE B CD1   1 
ATOM   6462  N  N     . LEU B 1 358 ? 81.599  -36.024 -10.505 1.00 35.55  ?  358 LEU B N     1 
ATOM   6463  C  CA    . LEU B 1 358 ? 82.486  -37.165 -10.607 1.00 25.22  ?  358 LEU B CA    1 
ATOM   6464  C  C     . LEU B 1 358 ? 83.084  -37.497 -9.250  1.00 42.05  ?  358 LEU B C     1 
ATOM   6465  O  O     . LEU B 1 358 ? 83.023  -38.628 -8.793  1.00 41.38  ?  358 LEU B O     1 
ATOM   6466  C  CB    . LEU B 1 358 ? 83.597  -36.860 -11.604 1.00 60.96  ?  358 LEU B CB    1 
ATOM   6467  C  CG    . LEU B 1 358 ? 83.201  -36.849 -13.078 1.00 26.66  ?  358 LEU B CG    1 
ATOM   6468  C  CD1   . LEU B 1 358 ? 84.391  -36.482 -13.936 1.00 28.19  ?  358 LEU B CD1   1 
ATOM   6469  C  CD2   . LEU B 1 358 ? 82.640  -38.221 -13.424 1.00 26.47  ?  358 LEU B CD2   1 
ATOM   6470  N  N     . ALA B 1 359 ? 83.668  -36.492 -8.611  1.00 43.91  ?  359 ALA B N     1 
ATOM   6471  C  CA    . ALA B 1 359 ? 84.204  -36.638 -7.268  1.00 44.90  ?  359 ALA B CA    1 
ATOM   6472  C  C     . ALA B 1 359 ? 83.171  -37.230 -6.315  1.00 43.99  ?  359 ALA B C     1 
ATOM   6473  O  O     . ALA B 1 359 ? 83.470  -38.143 -5.542  1.00 47.19  ?  359 ALA B O     1 
ATOM   6474  C  CB    . ALA B 1 359 ? 84.657  -35.305 -6.768  1.00 44.49  ?  359 ALA B CB    1 
ATOM   6475  N  N     . ARG B 1 360 ? 81.958  -36.694 -6.371  1.00 38.41  ?  360 ARG B N     1 
ATOM   6476  C  CA    . ARG B 1 360 ? 80.886  -37.191 -5.543  1.00 33.05  ?  360 ARG B CA    1 
ATOM   6477  C  C     . ARG B 1 360 ? 80.704  -38.665 -5.769  1.00 33.89  ?  360 ARG B C     1 
ATOM   6478  O  O     . ARG B 1 360 ? 80.738  -39.442 -4.840  1.00 40.27  ?  360 ARG B O     1 
ATOM   6479  C  CB    . ARG B 1 360 ? 79.587  -36.496 -5.873  1.00 30.35  ?  360 ARG B CB    1 
ATOM   6480  C  CG    . ARG B 1 360 ? 78.477  -36.854 -4.918  1.00 31.28  ?  360 ARG B CG    1 
ATOM   6481  C  CD    . ARG B 1 360 ? 77.166  -36.947 -5.638  1.00 34.49  ?  360 ARG B CD    1 
ATOM   6482  N  NE    . ARG B 1 360 ? 76.685  -35.650 -6.101  1.00 41.11  ?  360 ARG B NE    1 
ATOM   6483  C  CZ    . ARG B 1 360 ? 75.973  -35.472 -7.210  1.00 48.91  ?  360 ARG B CZ    1 
ATOM   6484  N  NH1   . ARG B 1 360 ? 75.687  -36.496 -7.994  1.00 22.91  ?  360 ARG B NH1   1 
ATOM   6485  N  NH2   . ARG B 1 360 ? 75.560  -34.263 -7.546  1.00 53.43  ?  360 ARG B NH2   1 
ATOM   6486  N  N     . SER B 1 361 ? 80.514  -39.057 -7.020  1.00 28.86  ?  361 SER B N     1 
ATOM   6487  C  CA    . SER B 1 361 ? 80.203  -40.450 -7.351  1.00 29.49  ?  361 SER B CA    1 
ATOM   6488  C  C     . SER B 1 361 ? 81.310  -41.430 -6.970  1.00 29.84  ?  361 SER B C     1 
ATOM   6489  O  O     . SER B 1 361 ? 81.039  -42.594 -6.674  1.00 31.62  ?  361 SER B O     1 
ATOM   6490  C  CB    . SER B 1 361 ? 79.882  -40.574 -8.833  1.00 35.97  ?  361 SER B CB    1 
ATOM   6491  O  OG    . SER B 1 361 ? 79.509  -39.316 -9.359  1.00 43.10  ?  361 SER B OG    1 
ATOM   6492  N  N     . ARG B 1 362 ? 82.556  -40.969 -6.987  1.00 30.12  ?  362 ARG B N     1 
ATOM   6493  C  CA    . ARG B 1 362 ? 83.652  -41.829 -6.579  1.00 25.14  ?  362 ARG B CA    1 
ATOM   6494  C  C     . ARG B 1 362 ? 83.500  -42.085 -5.086  1.00 38.19  ?  362 ARG B C     1 
ATOM   6495  O  O     . ARG B 1 362 ? 83.612  -43.209 -4.606  1.00 37.34  ?  362 ARG B O     1 
ATOM   6496  C  CB    . ARG B 1 362 ? 85.005  -41.181 -6.894  1.00 31.97  ?  362 ARG B CB    1 
ATOM   6497  C  CG    . ARG B 1 362 ? 85.472  -41.348 -8.327  1.00 34.47  ?  362 ARG B CG    1 
ATOM   6498  C  CD    . ARG B 1 362 ? 86.773  -40.595 -8.604  1.00 48.61  ?  362 ARG B CD    1 
ATOM   6499  N  NE    . ARG B 1 362 ? 86.538  -39.336 -9.310  1.00 63.57  ?  362 ARG B NE    1 
ATOM   6500  C  CZ    . ARG B 1 362 ? 86.833  -38.135 -8.820  1.00 76.74  ?  362 ARG B CZ    1 
ATOM   6501  N  NH1   . ARG B 1 362 ? 87.400  -38.019 -7.619  1.00 79.19  ?  362 ARG B NH1   1 
ATOM   6502  N  NH2   . ARG B 1 362 ? 86.571  -37.045 -9.537  1.00 80.07  ?  362 ARG B NH2   1 
ATOM   6503  N  N     . PHE B 1 363 ? 83.210  -41.017 -4.361  1.00 35.35  ?  363 PHE B N     1 
ATOM   6504  C  CA    . PHE B 1 363 ? 83.039  -41.079 -2.923  1.00 33.09  ?  363 PHE B CA    1 
ATOM   6505  C  C     . PHE B 1 363 ? 81.966  -42.074 -2.555  1.00 32.67  ?  363 PHE B C     1 
ATOM   6506  O  O     . PHE B 1 363 ? 82.177  -42.938 -1.703  1.00 39.29  ?  363 PHE B O     1 
ATOM   6507  C  CB    . PHE B 1 363 ? 82.645  -39.711 -2.398  1.00 34.76  ?  363 PHE B CB    1 
ATOM   6508  C  CG    . PHE B 1 363 ? 82.498  -39.656 -0.921  1.00 34.99  ?  363 PHE B CG    1 
ATOM   6509  C  CD1   . PHE B 1 363 ? 83.603  -39.407 -0.109  1.00 32.49  ?  363 PHE B CD1   1 
ATOM   6510  C  CD2   . PHE B 1 363 ? 81.250  -39.838 -0.331  1.00 34.04  ?  363 PHE B CD2   1 
ATOM   6511  C  CE1   . PHE B 1 363 ? 83.465  -39.334 1.250   1.00 31.72  ?  363 PHE B CE1   1 
ATOM   6512  C  CE2   . PHE B 1 363 ? 81.107  -39.778 1.041   1.00 33.59  ?  363 PHE B CE2   1 
ATOM   6513  C  CZ    . PHE B 1 363 ? 82.211  -39.525 1.828   1.00 33.16  ?  363 PHE B CZ    1 
ATOM   6514  N  N     . ASP B 1 364 ? 80.810  -41.941 -3.199  1.00 31.91  ?  364 ASP B N     1 
ATOM   6515  C  CA    . ASP B 1 364 ? 79.656  -42.769 -2.877  1.00 37.27  ?  364 ASP B CA    1 
ATOM   6516  C  C     . ASP B 1 364 ? 79.876  -44.209 -3.300  1.00 33.90  ?  364 ASP B C     1 
ATOM   6517  O  O     . ASP B 1 364 ? 79.377  -45.140 -2.658  1.00 33.98  ?  364 ASP B O     1 
ATOM   6518  C  CB    . ASP B 1 364 ? 78.387  -42.222 -3.528  1.00 46.00  ?  364 ASP B CB    1 
ATOM   6519  C  CG    . ASP B 1 364 ? 77.837  -40.997 -2.808  1.00 55.22  ?  364 ASP B CG    1 
ATOM   6520  O  OD1   . ASP B 1 364 ? 78.368  -40.630 -1.725  1.00 55.80  ?  364 ASP B OD1   1 
ATOM   6521  O  OD2   . ASP B 1 364 ? 76.851  -40.419 -3.328  1.00 57.17  ?  364 ASP B OD2   1 
ATOM   6522  N  N     . LYS B 1 365 ? 80.625  -44.386 -4.384  1.00 30.12  ?  365 LYS B N     1 
ATOM   6523  C  CA    . LYS B 1 365 ? 80.855  -45.714 -4.896  1.00 29.81  ?  365 LYS B CA    1 
ATOM   6524  C  C     . LYS B 1 365 ? 81.696  -46.441 -3.866  1.00 33.47  ?  365 LYS B C     1 
ATOM   6525  O  O     . LYS B 1 365 ? 81.355  -47.552 -3.452  1.00 39.86  ?  365 LYS B O     1 
ATOM   6526  C  CB    . LYS B 1 365 ? 81.545  -45.682 -6.262  1.00 34.07  ?  365 LYS B CB    1 
ATOM   6527  C  CG    . LYS B 1 365 ? 81.399  -46.992 -7.052  1.00 35.53  ?  365 LYS B CG    1 
ATOM   6528  C  CD    . LYS B 1 365 ? 82.078  -46.925 -8.406  1.00 33.41  ?  365 LYS B CD    1 
ATOM   6529  C  CE    . LYS B 1 365 ? 83.515  -47.395 -8.328  1.00 32.31  ?  365 LYS B CE    1 
ATOM   6530  N  NZ    . LYS B 1 365 ? 83.590  -48.876 -8.317  1.00 35.37  ?  365 LYS B NZ    1 
ATOM   6531  N  N     . GLU B 1 366 ? 82.774  -45.795 -3.419  1.00 32.97  ?  366 GLU B N     1 
ATOM   6532  C  CA    . GLU B 1 366 ? 83.658  -46.393 -2.415  1.00 35.32  ?  366 GLU B CA    1 
ATOM   6533  C  C     . GLU B 1 366 ? 82.900  -46.766 -1.131  1.00 40.08  ?  366 GLU B C     1 
ATOM   6534  O  O     . GLU B 1 366 ? 83.045  -47.869 -0.623  1.00 45.00  ?  366 GLU B O     1 
ATOM   6535  C  CB    . GLU B 1 366 ? 84.851  -45.487 -2.116  1.00 43.15  ?  366 GLU B CB    1 
ATOM   6536  C  CG    . GLU B 1 366 ? 85.775  -46.058 -1.057  1.00 63.29  ?  366 GLU B CG    1 
ATOM   6537  C  CD    . GLU B 1 366 ? 86.962  -45.160 -0.771  1.00 84.17  ?  366 GLU B CD    1 
ATOM   6538  O  OE1   . GLU B 1 366 ? 87.468  -45.199 0.374   1.00 89.53  ?  366 GLU B OE1   1 
ATOM   6539  O  OE2   . GLU B 1 366 ? 87.381  -44.416 -1.691  1.00 90.86  ?  366 GLU B OE2   1 
ATOM   6540  N  N     . LYS B 1 367 ? 82.077  -45.851 -0.625  1.00 40.46  ?  367 LYS B N     1 
ATOM   6541  C  CA    . LYS B 1 367 ? 81.203  -46.146 0.502   1.00 36.75  ?  367 LYS B CA    1 
ATOM   6542  C  C     . LYS B 1 367 ? 80.376  -47.399 0.246   1.00 32.74  ?  367 LYS B C     1 
ATOM   6543  O  O     . LYS B 1 367 ? 80.285  -48.271 1.111   1.00 36.67  ?  367 LYS B O     1 
ATOM   6544  C  CB    . LYS B 1 367 ? 80.268  -44.974 0.778   1.00 42.32  ?  367 LYS B CB    1 
ATOM   6545  C  CG    . LYS B 1 367 ? 80.238  -44.504 2.235   1.00 53.99  ?  367 LYS B CG    1 
ATOM   6546  C  CD    . LYS B 1 367 ? 78.924  -43.774 2.585   1.00 58.16  ?  367 LYS B CD    1 
ATOM   6547  N  N     . ALA B 1 368 ? 79.780  -47.496 -0.942  1.00 31.91  ?  368 ALA B N     1 
ATOM   6548  C  CA    . ALA B 1 368 ? 78.884  -48.610 -1.243  1.00 34.42  ?  368 ALA B CA    1 
ATOM   6549  C  C     . ALA B 1 368 ? 79.622  -49.911 -1.425  1.00 38.25  ?  368 ALA B C     1 
ATOM   6550  O  O     . ALA B 1 368 ? 79.108  -50.963 -1.061  1.00 38.60  ?  368 ALA B O     1 
ATOM   6551  C  CB    . ALA B 1 368 ? 78.057  -48.323 -2.449  1.00 36.12  ?  368 ALA B CB    1 
ATOM   6552  N  N     . GLU B 1 369 ? 80.819  -49.838 -2.001  1.00 41.54  ?  369 GLU B N     1 
ATOM   6553  C  CA    . GLU B 1 369 ? 81.623  -51.032 -2.227  1.00 40.51  ?  369 GLU B CA    1 
ATOM   6554  C  C     . GLU B 1 369 ? 81.946  -51.643 -0.874  1.00 42.89  ?  369 GLU B C     1 
ATOM   6555  O  O     . GLU B 1 369 ? 81.757  -52.845 -0.658  1.00 43.79  ?  369 GLU B O     1 
ATOM   6556  C  CB    . GLU B 1 369 ? 82.937  -50.691 -2.932  1.00 40.91  ?  369 GLU B CB    1 
ATOM   6557  C  CG    . GLU B 1 369 ? 82.852  -50.249 -4.375  1.00 46.55  ?  369 GLU B CG    1 
ATOM   6558  C  CD    . GLU B 1 369 ? 84.206  -49.767 -4.902  1.00 59.54  ?  369 GLU B CD    1 
ATOM   6559  O  OE1   . GLU B 1 369 ? 84.314  -48.595 -5.328  1.00 63.94  ?  369 GLU B OE1   1 
ATOM   6560  O  OE2   . GLU B 1 369 ? 85.172  -50.558 -4.888  1.00 65.64  ?  369 GLU B OE2   1 
ATOM   6561  N  N     . LYS B 1 370 ? 82.444  -50.797 0.030   1.00 40.27  ?  370 LYS B N     1 
ATOM   6562  C  CA    . LYS B 1 370 ? 82.866  -51.229 1.356   1.00 33.99  ?  370 LYS B CA    1 
ATOM   6563  C  C     . LYS B 1 370 ? 81.717  -51.930 2.046   1.00 35.61  ?  370 LYS B C     1 
ATOM   6564  O  O     . LYS B 1 370 ? 81.883  -53.017 2.597   1.00 40.11  ?  370 LYS B O     1 
ATOM   6565  C  CB    . LYS B 1 370 ? 83.403  -50.054 2.192   1.00 26.91  ?  370 LYS B CB    1 
ATOM   6566  C  CG    . LYS B 1 370 ? 84.700  -49.454 1.597   1.00 28.61  ?  370 LYS B CG    1 
ATOM   6567  C  CD    . LYS B 1 370 ? 85.725  -48.971 2.633   1.00 27.12  ?  370 LYS B CD    1 
ATOM   6568  N  N     . ARG B 1 371 ? 80.541  -51.322 1.974   1.00 30.30  ?  371 ARG B N     1 
ATOM   6569  C  CA    . ARG B 1 371 ? 79.381  -51.847 2.665   1.00 26.22  ?  371 ARG B CA    1 
ATOM   6570  C  C     . ARG B 1 371 ? 78.898  -53.152 2.057   1.00 31.12  ?  371 ARG B C     1 
ATOM   6571  O  O     . ARG B 1 371 ? 78.574  -54.098 2.773   1.00 32.42  ?  371 ARG B O     1 
ATOM   6572  C  CB    . ARG B 1 371 ? 78.262  -50.816 2.669   1.00 23.66  ?  371 ARG B CB    1 
ATOM   6573  C  CG    . ARG B 1 371 ? 76.928  -51.378 3.095   1.00 26.93  ?  371 ARG B CG    1 
ATOM   6574  C  CD    . ARG B 1 371 ? 76.994  -51.827 4.498   1.00 36.51  ?  371 ARG B CD    1 
ATOM   6575  N  NE    . ARG B 1 371 ? 75.784  -52.498 4.963   1.00 37.52  ?  371 ARG B NE    1 
ATOM   6576  C  CZ    . ARG B 1 371 ? 75.680  -53.041 6.174   1.00 37.06  ?  371 ARG B CZ    1 
ATOM   6577  N  NH1   . ARG B 1 371 ? 76.730  -52.985 7.017   1.00 37.32  ?  371 ARG B NH1   1 
ATOM   6578  N  NH2   . ARG B 1 371 ? 74.544  -53.639 6.534   1.00 35.63  ?  371 ARG B NH2   1 
ATOM   6579  N  N     . LEU B 1 372 ? 78.828  -53.185 0.732   1.00 35.23  ?  372 LEU B N     1 
ATOM   6580  C  CA    . LEU B 1 372 ? 78.509  -54.406 -0.002  1.00 34.66  ?  372 LEU B CA    1 
ATOM   6581  C  C     . LEU B 1 372 ? 79.416  -55.527 0.473   1.00 35.08  ?  372 LEU B C     1 
ATOM   6582  O  O     . LEU B 1 372 ? 78.978  -56.654 0.675   1.00 35.74  ?  372 LEU B O     1 
ATOM   6583  C  CB    . LEU B 1 372 ? 78.763  -54.200 -1.493  1.00 32.13  ?  372 LEU B CB    1 
ATOM   6584  C  CG    . LEU B 1 372 ? 78.043  -55.086 -2.510  1.00 29.52  ?  372 LEU B CG    1 
ATOM   6585  C  CD1   . LEU B 1 372 ? 78.990  -55.436 -3.636  1.00 26.28  ?  372 LEU B CD1   1 
ATOM   6586  C  CD2   . LEU B 1 372 ? 77.426  -56.334 -1.876  1.00 31.87  ?  372 LEU B CD2   1 
ATOM   6587  N  N     . HIS B 1 373 ? 80.694  -55.206 0.637   1.00 33.30  ?  373 HIS B N     1 
ATOM   6588  C  CA    . HIS B 1 373 ? 81.676  -56.206 1.005   1.00 32.13  ?  373 HIS B CA    1 
ATOM   6589  C  C     . HIS B 1 373 ? 81.329  -56.810 2.351   1.00 29.38  ?  373 HIS B C     1 
ATOM   6590  O  O     . HIS B 1 373 ? 81.413  -58.016 2.525   1.00 31.97  ?  373 HIS B O     1 
ATOM   6591  C  CB    . HIS B 1 373 ? 83.070  -55.593 1.031   1.00 35.52  ?  373 HIS B CB    1 
ATOM   6592  C  CG    . HIS B 1 373 ? 84.163  -56.591 1.245   1.00 38.53  ?  373 HIS B CG    1 
ATOM   6593  N  ND1   . HIS B 1 373 ? 84.231  -57.778 0.552   1.00 41.35  ?  373 HIS B ND1   1 
ATOM   6594  C  CD2   . HIS B 1 373 ? 85.236  -56.575 2.068   1.00 40.70  ?  373 HIS B CD2   1 
ATOM   6595  C  CE1   . HIS B 1 373 ? 85.295  -58.455 0.942   1.00 42.34  ?  373 HIS B CE1   1 
ATOM   6596  N  NE2   . HIS B 1 373 ? 85.926  -57.747 1.861   1.00 40.74  ?  373 HIS B NE2   1 
ATOM   6597  N  N     . ILE B 1 374 ? 80.933  -55.967 3.303   1.00 34.56  ?  374 ILE B N     1 
ATOM   6598  C  CA    . ILE B 1 374 ? 80.560  -56.434 4.631   1.00 37.79  ?  374 ILE B CA    1 
ATOM   6599  C  C     . ILE B 1 374 ? 79.244  -57.207 4.536   1.00 35.31  ?  374 ILE B C     1 
ATOM   6600  O  O     . ILE B 1 374 ? 79.104  -58.307 5.074   1.00 38.33  ?  374 ILE B O     1 
ATOM   6601  C  CB    . ILE B 1 374 ? 80.445  -55.268 5.659   1.00 21.39  ?  374 ILE B CB    1 
ATOM   6602  C  CG1   . ILE B 1 374 ? 81.812  -54.875 6.204   1.00 32.43  ?  374 ILE B CG1   1 
ATOM   6603  C  CG2   . ILE B 1 374 ? 79.600  -55.682 6.822   1.00 35.28  ?  374 ILE B CG2   1 
ATOM   6604  C  CD1   . ILE B 1 374 ? 82.813  -54.513 5.120   1.00 41.16  ?  374 ILE B CD1   1 
ATOM   6605  N  N     . VAL B 1 375 ? 78.280  -56.637 3.834   1.00 29.84  ?  375 VAL B N     1 
ATOM   6606  C  CA    . VAL B 1 375 ? 77.010  -57.317 3.658   1.00 32.68  ?  375 VAL B CA    1 
ATOM   6607  C  C     . VAL B 1 375 ? 77.137  -58.703 3.024   1.00 36.33  ?  375 VAL B C     1 
ATOM   6608  O  O     . VAL B 1 375 ? 76.331  -59.586 3.306   1.00 37.35  ?  375 VAL B O     1 
ATOM   6609  C  CB    . VAL B 1 375 ? 76.041  -56.474 2.842   1.00 33.76  ?  375 VAL B CB    1 
ATOM   6610  C  CG1   . VAL B 1 375 ? 74.905  -57.334 2.339   1.00 19.55  ?  375 VAL B CG1   1 
ATOM   6611  C  CG2   . VAL B 1 375 ? 75.539  -55.315 3.683   1.00 19.66  ?  375 VAL B CG2   1 
ATOM   6612  N  N     . GLU B 1 376 ? 78.143  -58.885 2.169   1.00 38.94  ?  376 GLU B N     1 
ATOM   6613  C  CA    . GLU B 1 376 ? 78.360  -60.166 1.491   1.00 37.70  ?  376 GLU B CA    1 
ATOM   6614  C  C     . GLU B 1 376 ? 78.781  -61.213 2.504   1.00 42.74  ?  376 GLU B C     1 
ATOM   6615  O  O     . GLU B 1 376 ? 78.259  -62.338 2.511   1.00 50.98  ?  376 GLU B O     1 
ATOM   6616  C  CB    . GLU B 1 376 ? 79.397  -60.041 0.365   1.00 35.29  ?  376 GLU B CB    1 
ATOM   6617  C  CG    . GLU B 1 376 ? 78.835  -59.374 -0.895  1.00 48.12  ?  376 GLU B CG    1 
ATOM   6618  C  CD    . GLU B 1 376 ? 79.874  -58.993 -1.964  1.00 61.26  ?  376 GLU B CD    1 
ATOM   6619  O  OE1   . GLU B 1 376 ? 81.088  -58.867 -1.644  1.00 64.35  ?  376 GLU B OE1   1 
ATOM   6620  O  OE2   . GLU B 1 376 ? 79.446  -58.806 -3.136  1.00 62.85  ?  376 GLU B OE2   1 
ATOM   6621  N  N     . GLY B 1 377 ? 79.712  -60.819 3.370   1.00 36.29  ?  377 GLY B N     1 
ATOM   6622  C  CA    . GLY B 1 377 ? 80.218  -61.669 4.432   1.00 33.46  ?  377 GLY B CA    1 
ATOM   6623  C  C     . GLY B 1 377 ? 79.159  -62.029 5.452   1.00 36.41  ?  377 GLY B C     1 
ATOM   6624  O  O     . GLY B 1 377 ? 79.129  -63.170 5.911   1.00 39.26  ?  377 GLY B O     1 
ATOM   6625  N  N     . LEU B 1 378 ? 78.298  -61.068 5.808   1.00 35.43  ?  378 LEU B N     1 
ATOM   6626  C  CA    . LEU B 1 378 ? 77.222  -61.323 6.770   1.00 31.45  ?  378 LEU B CA    1 
ATOM   6627  C  C     . LEU B 1 378 ? 76.221  -62.327 6.242   1.00 37.70  ?  378 LEU B C     1 
ATOM   6628  O  O     . LEU B 1 378 ? 75.689  -63.133 7.001   1.00 41.77  ?  378 LEU B O     1 
ATOM   6629  C  CB    . LEU B 1 378 ? 76.483  -60.053 7.133   1.00 22.95  ?  378 LEU B CB    1 
ATOM   6630  C  CG    . LEU B 1 378 ? 77.302  -58.984 7.825   1.00 19.88  ?  378 LEU B CG    1 
ATOM   6631  C  CD1   . LEU B 1 378 ? 76.453  -57.766 8.078   1.00 20.19  ?  378 LEU B CD1   1 
ATOM   6632  C  CD2   . LEU B 1 378 ? 77.770  -59.553 9.103   1.00 25.83  ?  378 LEU B CD2   1 
ATOM   6633  N  N     . ILE B 1 379 ? 75.952  -62.273 4.942   1.00 36.95  ?  379 ILE B N     1 
ATOM   6634  C  CA    . ILE B 1 379 ? 75.092  -63.277 4.336   1.00 35.11  ?  379 ILE B CA    1 
ATOM   6635  C  C     . ILE B 1 379 ? 75.685  -64.674 4.529   1.00 37.84  ?  379 ILE B C     1 
ATOM   6636  O  O     . ILE B 1 379 ? 74.983  -65.597 4.939   1.00 43.72  ?  379 ILE B O     1 
ATOM   6637  C  CB    . ILE B 1 379 ? 74.773  -62.963 2.860   1.00 31.68  ?  379 ILE B CB    1 
ATOM   6638  C  CG1   . ILE B 1 379 ? 73.767  -61.814 2.814   1.00 19.95  ?  379 ILE B CG1   1 
ATOM   6639  C  CG2   . ILE B 1 379 ? 74.154  -64.167 2.176   1.00 20.61  ?  379 ILE B CG2   1 
ATOM   6640  C  CD1   . ILE B 1 379 ? 73.798  -61.016 1.550   1.00 35.75  ?  379 ILE B CD1   1 
ATOM   6641  N  N     . ARG B 1 380 ? 76.981  -64.811 4.274   1.00 30.58  ?  380 ARG B N     1 
ATOM   6642  C  CA    . ARG B 1 380 ? 77.690  -66.075 4.483   1.00 28.79  ?  380 ARG B CA    1 
ATOM   6643  C  C     . ARG B 1 380 ? 77.676  -66.544 5.930   1.00 32.70  ?  380 ARG B C     1 
ATOM   6644  O  O     . ARG B 1 380 ? 77.647  -67.753 6.221   1.00 33.45  ?  380 ARG B O     1 
ATOM   6645  C  CB    . ARG B 1 380 ? 79.146  -65.931 4.071   1.00 28.92  ?  380 ARG B CB    1 
ATOM   6646  C  CG    . ARG B 1 380 ? 79.416  -66.512 2.737   1.00 39.03  ?  380 ARG B CG    1 
ATOM   6647  C  CD    . ARG B 1 380 ? 80.640  -67.375 2.748   1.00 42.74  ?  380 ARG B CD    1 
ATOM   6648  N  NE    . ARG B 1 380 ? 81.825  -66.548 2.870   1.00 42.73  ?  380 ARG B NE    1 
ATOM   6649  C  CZ    . ARG B 1 380 ? 82.980  -67.022 3.299   1.00 47.57  ?  380 ARG B CZ    1 
ATOM   6650  N  NH1   . ARG B 1 380 ? 83.077  -68.311 3.644   1.00 39.77  ?  380 ARG B NH1   1 
ATOM   6651  N  NH2   . ARG B 1 380 ? 84.023  -66.209 3.394   1.00 59.28  ?  380 ARG B NH2   1 
ATOM   6652  N  N     . VAL B 1 381 ? 77.733  -65.580 6.840   1.00 36.46  ?  381 VAL B N     1 
ATOM   6653  C  CA    . VAL B 1 381 ? 77.965  -65.908 8.232   1.00 35.27  ?  381 VAL B CA    1 
ATOM   6654  C  C     . VAL B 1 381 ? 76.718  -66.544 8.790   1.00 41.80  ?  381 VAL B C     1 
ATOM   6655  O  O     . VAL B 1 381 ? 76.792  -67.395 9.670   1.00 49.36  ?  381 VAL B O     1 
ATOM   6656  C  CB    . VAL B 1 381 ? 78.405  -64.673 9.051   1.00 24.82  ?  381 VAL B CB    1 
ATOM   6657  C  CG1   . VAL B 1 381 ? 77.328  -64.263 10.022  1.00 20.81  ?  381 VAL B CG1   1 
ATOM   6658  C  CG2   . VAL B 1 381 ? 79.704  -64.974 9.766   1.00 24.50  ?  381 VAL B CG2   1 
ATOM   6659  N  N     . ILE B 1 382 ? 75.576  -66.152 8.236   1.00 37.92  ?  382 ILE B N     1 
ATOM   6660  C  CA    . ILE B 1 382 ? 74.294  -66.647 8.707   1.00 36.58  ?  382 ILE B CA    1 
ATOM   6661  C  C     . ILE B 1 382 ? 74.155  -68.143 8.532   1.00 39.44  ?  382 ILE B C     1 
ATOM   6662  O  O     . ILE B 1 382 ? 73.592  -68.819 9.383   1.00 39.74  ?  382 ILE B O     1 
ATOM   6663  C  CB    . ILE B 1 382 ? 73.129  -65.959 8.007   1.00 35.97  ?  382 ILE B CB    1 
ATOM   6664  C  CG1   . ILE B 1 382 ? 72.940  -64.567 8.601   1.00 38.70  ?  382 ILE B CG1   1 
ATOM   6665  C  CG2   . ILE B 1 382 ? 71.859  -66.768 8.183   1.00 33.08  ?  382 ILE B CG2   1 
ATOM   6666  C  CD1   . ILE B 1 382 ? 71.810  -63.792 7.987   1.00 39.02  ?  382 ILE B CD1   1 
ATOM   6667  N  N     . SER B 1 383 ? 74.669  -68.670 7.434   1.00 44.92  ?  383 SER B N     1 
ATOM   6668  C  CA    . SER B 1 383 ? 74.511  -70.089 7.168   1.00 47.90  ?  383 SER B CA    1 
ATOM   6669  C  C     . SER B 1 383 ? 75.458  -70.897 8.046   1.00 49.24  ?  383 SER B C     1 
ATOM   6670  O  O     . SER B 1 383 ? 75.289  -72.104 8.220   1.00 54.85  ?  383 SER B O     1 
ATOM   6671  C  CB    . SER B 1 383 ? 74.794  -70.378 5.705   1.00 54.08  ?  383 SER B CB    1 
ATOM   6672  O  OG    . SER B 1 383 ? 76.180  -70.222 5.462   1.00 59.84  ?  383 SER B OG    1 
ATOM   6673  N  N     . ILE B 1 384 ? 76.465  -70.228 8.590   1.00 44.65  ?  384 ILE B N     1 
ATOM   6674  C  CA    . ILE B 1 384 ? 77.383  -70.887 9.508   1.00 39.71  ?  384 ILE B CA    1 
ATOM   6675  C  C     . ILE B 1 384 ? 77.383  -70.261 10.907  1.00 37.83  ?  384 ILE B C     1 
ATOM   6676  O  O     . ILE B 1 384 ? 78.369  -70.370 11.640  1.00 41.61  ?  384 ILE B O     1 
ATOM   6677  C  CB    . ILE B 1 384 ? 78.804  -70.919 8.955   1.00 33.81  ?  384 ILE B CB    1 
ATOM   6678  C  CG1   . ILE B 1 384 ? 79.283  -69.505 8.616   1.00 29.63  ?  384 ILE B CG1   1 
ATOM   6679  C  CG2   . ILE B 1 384 ? 78.840  -71.809 7.761   1.00 24.24  ?  384 ILE B CG2   1 
ATOM   6680  C  CD1   . ILE B 1 384 ? 80.735  -69.459 8.177   1.00 28.93  ?  384 ILE B CD1   1 
ATOM   6681  N  N     . LEU B 1 385 ? 76.262  -69.641 11.274  1.00 36.41  ?  385 LEU B N     1 
ATOM   6682  C  CA    . LEU B 1 385 ? 76.135  -68.882 12.520  1.00 40.77  ?  385 LEU B CA    1 
ATOM   6683  C  C     . LEU B 1 385 ? 76.742  -69.600 13.713  1.00 43.62  ?  385 LEU B C     1 
ATOM   6684  O  O     . LEU B 1 385 ? 77.598  -69.062 14.416  1.00 43.18  ?  385 LEU B O     1 
ATOM   6685  C  CB    . LEU B 1 385 ? 74.665  -68.618 12.822  1.00 42.03  ?  385 LEU B CB    1 
ATOM   6686  C  CG    . LEU B 1 385 ? 74.274  -67.214 13.273  1.00 34.72  ?  385 LEU B CG    1 
ATOM   6687  C  CD1   . LEU B 1 385 ? 73.235  -67.346 14.340  1.00 37.07  ?  385 LEU B CD1   1 
ATOM   6688  C  CD2   . LEU B 1 385 ? 75.462  -66.406 13.759  1.00 25.57  ?  385 LEU B CD2   1 
ATOM   6689  N  N     . ASP B 1 386 ? 76.278  -70.822 13.939  1.00 44.85  ?  386 ASP B N     1 
ATOM   6690  C  CA    . ASP B 1 386 ? 76.694  -71.599 15.096  1.00 47.70  ?  386 ASP B CA    1 
ATOM   6691  C  C     . ASP B 1 386 ? 78.173  -71.948 15.067  1.00 44.62  ?  386 ASP B C     1 
ATOM   6692  O  O     . ASP B 1 386 ? 78.866  -71.770 16.072  1.00 47.70  ?  386 ASP B O     1 
ATOM   6693  C  CB    . ASP B 1 386 ? 75.822  -72.847 15.245  1.00 55.79  ?  386 ASP B CB    1 
ATOM   6694  C  CG    . ASP B 1 386 ? 74.363  -72.503 15.513  1.00 63.68  ?  386 ASP B CG    1 
ATOM   6695  O  OD1   . ASP B 1 386 ? 73.640  -72.233 14.527  1.00 73.78  ?  386 ASP B OD1   1 
ATOM   6696  O  OD2   . ASP B 1 386 ? 73.942  -72.480 16.700  1.00 61.55  ?  386 ASP B OD2   1 
ATOM   6697  N  N     . GLU B 1 387 ? 78.652  -72.428 13.920  1.00 39.19  ?  387 GLU B N     1 
ATOM   6698  C  CA    . GLU B 1 387 ? 80.074  -72.733 13.734  1.00 39.98  ?  387 GLU B CA    1 
ATOM   6699  C  C     . GLU B 1 387 ? 80.933  -71.497 14.001  1.00 39.81  ?  387 GLU B C     1 
ATOM   6700  O  O     . GLU B 1 387 ? 82.046  -71.592 14.527  1.00 44.30  ?  387 GLU B O     1 
ATOM   6701  C  CB    . GLU B 1 387 ? 80.359  -73.247 12.313  1.00 43.61  ?  387 GLU B CB    1 
ATOM   6702  C  CG    . GLU B 1 387 ? 79.723  -74.575 11.956  1.00 58.34  ?  387 GLU B CG    1 
ATOM   6703  C  CD    . GLU B 1 387 ? 78.297  -74.450 11.412  1.00 72.91  ?  387 GLU B CD    1 
ATOM   6704  O  OE1   . GLU B 1 387 ? 77.556  -73.519 11.808  1.00 78.95  ?  387 GLU B OE1   1 
ATOM   6705  O  OE2   . GLU B 1 387 ? 77.915  -75.302 10.581  1.00 77.32  ?  387 GLU B OE2   1 
ATOM   6706  N  N     . VAL B 1 388 ? 80.417  -70.336 13.622  1.00 31.14  ?  388 VAL B N     1 
ATOM   6707  C  CA    . VAL B 1 388 ? 81.163  -69.104 13.799  1.00 29.13  ?  388 VAL B CA    1 
ATOM   6708  C  C     . VAL B 1 388 ? 81.226  -68.712 15.267  1.00 37.19  ?  388 VAL B C     1 
ATOM   6709  O  O     . VAL B 1 388 ? 82.287  -68.316 15.762  1.00 44.53  ?  388 VAL B O     1 
ATOM   6710  C  CB    . VAL B 1 388 ? 80.623  -67.977 12.910  1.00 26.44  ?  388 VAL B CB    1 
ATOM   6711  C  CG1   . VAL B 1 388 ? 81.208  -66.657 13.310  1.00 20.51  ?  388 VAL B CG1   1 
ATOM   6712  C  CG2   . VAL B 1 388 ? 81.006  -68.273 11.494  1.00 30.99  ?  388 VAL B CG2   1 
ATOM   6713  N  N     . ILE B 1 389 ? 80.104  -68.847 15.969  1.00 34.01  ?  389 ILE B N     1 
ATOM   6714  C  CA    . ILE B 1 389 ? 80.104  -68.625 17.406  1.00 32.93  ?  389 ILE B CA    1 
ATOM   6715  C  C     . ILE B 1 389 ? 81.076  -69.594 18.075  1.00 37.97  ?  389 ILE B C     1 
ATOM   6716  O  O     . ILE B 1 389 ? 81.955  -69.195 18.832  1.00 25.77  ?  389 ILE B O     1 
ATOM   6717  C  CB    . ILE B 1 389 ? 78.724  -68.820 18.014  1.00 33.76  ?  389 ILE B CB    1 
ATOM   6718  C  CG1   . ILE B 1 389 ? 77.729  -67.859 17.381  1.00 37.98  ?  389 ILE B CG1   1 
ATOM   6719  C  CG2   . ILE B 1 389 ? 78.789  -68.584 19.515  1.00 25.29  ?  389 ILE B CG2   1 
ATOM   6720  C  CD1   . ILE B 1 389 ? 76.294  -68.164 17.745  1.00 42.43  ?  389 ILE B CD1   1 
ATOM   6721  N  N     . ALA B 1 390 ? 80.919  -70.876 17.780  1.00 38.26  ?  390 ALA B N     1 
ATOM   6722  C  CA    . ALA B 1 390 ? 81.809  -71.894 18.315  1.00 35.78  ?  390 ALA B CA    1 
ATOM   6723  C  C     . ALA B 1 390 ? 83.273  -71.530 18.107  1.00 32.84  ?  390 ALA B C     1 
ATOM   6724  O  O     . ALA B 1 390 ? 84.112  -71.691 18.999  1.00 31.91  ?  390 ALA B O     1 
ATOM   6725  C  CB    . ALA B 1 390 ? 81.510  -73.198 17.660  1.00 38.22  ?  390 ALA B CB    1 
ATOM   6726  N  N     . LEU B 1 391 ? 83.572  -71.047 16.911  1.00 31.58  ?  391 LEU B N     1 
ATOM   6727  C  CA    . LEU B 1 391 ? 84.933  -70.704 16.552  1.00 34.07  ?  391 LEU B CA    1 
ATOM   6728  C  C     . LEU B 1 391 ? 85.442  -69.517 17.363  1.00 34.25  ?  391 LEU B C     1 
ATOM   6729  O  O     . LEU B 1 391 ? 86.564  -69.528 17.875  1.00 39.99  ?  391 LEU B O     1 
ATOM   6730  C  CB    . LEU B 1 391 ? 85.032  -70.438 15.052  1.00 30.34  ?  391 LEU B CB    1 
ATOM   6731  C  CG    . LEU B 1 391 ? 86.356  -69.822 14.622  1.00 31.79  ?  391 LEU B CG    1 
ATOM   6732  C  CD1   . LEU B 1 391 ? 86.798  -70.414 13.329  1.00 30.37  ?  391 LEU B CD1   1 
ATOM   6733  C  CD2   . LEU B 1 391 ? 86.206  -68.315 14.487  1.00 34.60  ?  391 LEU B CD2   1 
ATOM   6734  N  N     . ILE B 1 392 ? 84.615  -68.492 17.487  1.00 27.99  ?  392 ILE B N     1 
ATOM   6735  C  CA    . ILE B 1 392 ? 84.992  -67.341 18.293  1.00 30.64  ?  392 ILE B CA    1 
ATOM   6736  C  C     . ILE B 1 392 ? 85.188  -67.733 19.770  1.00 36.63  ?  392 ILE B C     1 
ATOM   6737  O  O     . ILE B 1 392 ? 86.200  -67.382 20.375  1.00 36.80  ?  392 ILE B O     1 
ATOM   6738  C  CB    . ILE B 1 392 ? 83.981  -66.204 18.137  1.00 31.14  ?  392 ILE B CB    1 
ATOM   6739  C  CG1   . ILE B 1 392 ? 83.937  -65.760 16.678  1.00 34.82  ?  392 ILE B CG1   1 
ATOM   6740  C  CG2   . ILE B 1 392 ? 84.348  -65.042 19.026  1.00 29.61  ?  392 ILE B CG2   1 
ATOM   6741  C  CD1   . ILE B 1 392 ? 82.804  -64.801 16.348  1.00 38.56  ?  392 ILE B CD1   1 
ATOM   6742  N  N     . ARG B 1 393 ? 84.240  -68.476 20.341  1.00 42.47  ?  393 ARG B N     1 
ATOM   6743  C  CA    . ARG B 1 393 ? 84.424  -69.050 21.684  1.00 49.71  ?  393 ARG B CA    1 
ATOM   6744  C  C     . ARG B 1 393 ? 85.752  -69.782 21.813  1.00 57.74  ?  393 ARG B C     1 
ATOM   6745  O  O     . ARG B 1 393 ? 86.383  -69.751 22.872  1.00 64.28  ?  393 ARG B O     1 
ATOM   6746  C  CB    . ARG B 1 393 ? 83.316  -70.045 22.044  1.00 45.73  ?  393 ARG B CB    1 
ATOM   6747  C  CG    . ARG B 1 393 ? 82.170  -69.462 22.812  1.00 48.83  ?  393 ARG B CG    1 
ATOM   6748  C  CD    . ARG B 1 393 ? 81.897  -70.276 24.056  1.00 53.90  ?  393 ARG B CD    1 
ATOM   6749  N  NE    . ARG B 1 393 ? 82.951  -70.053 25.035  1.00 56.45  ?  393 ARG B NE    1 
ATOM   6750  C  CZ    . ARG B 1 393 ? 82.990  -70.622 26.230  1.00 57.46  ?  393 ARG B CZ    1 
ATOM   6751  N  NH1   . ARG B 1 393 ? 84.004  -70.355 27.051  1.00 60.55  ?  393 ARG B NH1   1 
ATOM   6752  N  NH2   . ARG B 1 393 ? 82.023  -71.459 26.590  1.00 52.60  ?  393 ARG B NH2   1 
ATOM   6753  N  N     . ALA B 1 394 ? 86.156  -70.461 20.742  1.00 53.15  ?  394 ALA B N     1 
ATOM   6754  C  CA    . ALA B 1 394 ? 87.358  -71.270 20.786  1.00 48.91  ?  394 ALA B CA    1 
ATOM   6755  C  C     . ALA B 1 394 ? 88.618  -70.418 20.710  1.00 50.85  ?  394 ALA B C     1 
ATOM   6756  O  O     . ALA B 1 394 ? 89.687  -70.864 21.121  1.00 56.96  ?  394 ALA B O     1 
ATOM   6757  C  CB    . ALA B 1 394 ? 87.346  -72.321 19.688  1.00 41.56  ?  394 ALA B CB    1 
ATOM   6758  N  N     . SER B 1 395 ? 88.495  -69.195 20.196  1.00 44.41  ?  395 SER B N     1 
ATOM   6759  C  CA    . SER B 1 395 ? 89.648  -68.298 20.069  1.00 42.91  ?  395 SER B CA    1 
ATOM   6760  C  C     . SER B 1 395 ? 90.081  -67.692 21.421  1.00 46.79  ?  395 SER B C     1 
ATOM   6761  O  O     . SER B 1 395 ? 89.284  -67.633 22.366  1.00 42.34  ?  395 SER B O     1 
ATOM   6762  C  CB    . SER B 1 395 ? 89.341  -67.196 19.056  1.00 36.51  ?  395 SER B CB    1 
ATOM   6763  O  OG    . SER B 1 395 ? 88.618  -67.730 17.972  1.00 33.85  ?  395 SER B OG    1 
ATOM   6764  N  N     . GLU B 1 396 ? 91.336  -67.243 21.511  1.00 53.22  ?  396 GLU B N     1 
ATOM   6765  C  CA    . GLU B 1 396 ? 91.866  -66.725 22.780  1.00 56.17  ?  396 GLU B CA    1 
ATOM   6766  C  C     . GLU B 1 396 ? 91.540  -65.238 22.991  1.00 56.87  ?  396 GLU B C     1 
ATOM   6767  O  O     . GLU B 1 396 ? 91.215  -64.808 24.097  1.00 59.89  ?  396 GLU B O     1 
ATOM   6768  C  CB    . GLU B 1 396 ? 93.376  -67.011 22.930  1.00 54.89  ?  396 GLU B CB    1 
ATOM   6769  N  N     . ASN B 1 397 ? 91.601  -64.461 21.924  1.00 54.28  ?  397 ASN B N     1 
ATOM   6770  C  CA    . ASN B 1 397 ? 91.243  -63.056 21.999  1.00 55.65  ?  397 ASN B CA    1 
ATOM   6771  C  C     . ASN B 1 397 ? 90.696  -62.563 20.658  1.00 54.26  ?  397 ASN B C     1 
ATOM   6772  O  O     . ASN B 1 397 ? 90.524  -63.343 19.724  1.00 56.53  ?  397 ASN B O     1 
ATOM   6773  C  CB    . ASN B 1 397 ? 92.462  -62.240 22.391  1.00 63.70  ?  397 ASN B CB    1 
ATOM   6774  C  CG    . ASN B 1 397 ? 93.543  -62.263 21.328  1.00 67.25  ?  397 ASN B CG    1 
ATOM   6775  O  OD1   . ASN B 1 397 ? 93.509  -61.479 20.379  1.00 69.61  ?  397 ASN B OD1   1 
ATOM   6776  N  ND2   . ASN B 1 397 ? 94.508  -63.158 21.481  1.00 67.00  ?  397 ASN B ND2   1 
ATOM   6777  N  N     . LYS B 1 398 ? 90.441  -61.265 20.558  1.00 50.43  ?  398 LYS B N     1 
ATOM   6778  C  CA    . LYS B 1 398 ? 89.866  -60.698 19.343  1.00 40.81  ?  398 LYS B CA    1 
ATOM   6779  C  C     . LYS B 1 398 ? 90.729  -60.896 18.095  1.00 39.28  ?  398 LYS B C     1 
ATOM   6780  O  O     . LYS B 1 398 ? 90.225  -61.303 17.052  1.00 36.83  ?  398 LYS B O     1 
ATOM   6781  C  CB    . LYS B 1 398 ? 89.536  -59.221 19.554  1.00 38.48  ?  398 LYS B CB    1 
ATOM   6782  C  CG    . LYS B 1 398 ? 89.443  -58.410 18.284  1.00 36.31  ?  398 LYS B CG    1 
ATOM   6783  C  CD    . LYS B 1 398 ? 88.667  -57.128 18.516  1.00 38.47  ?  398 LYS B CD    1 
ATOM   6784  C  CE    . LYS B 1 398 ? 88.815  -56.157 17.338  1.00 39.04  ?  398 LYS B CE    1 
ATOM   6785  N  NZ    . LYS B 1 398 ? 88.019  -54.913 17.548  1.00 41.17  ?  398 LYS B NZ    1 
ATOM   6786  N  N     . ALA B 1 399 ? 92.023  -60.614 18.180  1.00 41.99  ?  399 ALA B N     1 
ATOM   6787  C  CA    . ALA B 1 399 ? 92.871  -60.790 17.001  1.00 39.17  ?  399 ALA B CA    1 
ATOM   6788  C  C     . ALA B 1 399 ? 92.859  -62.243 16.548  1.00 42.61  ?  399 ALA B C     1 
ATOM   6789  O  O     . ALA B 1 399 ? 92.646  -62.538 15.370  1.00 47.18  ?  399 ALA B O     1 
ATOM   6790  C  CB    . ALA B 1 399 ? 94.267  -60.336 17.272  1.00 38.76  ?  399 ALA B CB    1 
ATOM   6791  N  N     . ASP B 1 400 ? 93.075  -63.151 17.492  1.00 41.77  ?  400 ASP B N     1 
ATOM   6792  C  CA    . ASP B 1 400 ? 93.044  -64.581 17.193  1.00 44.62  ?  400 ASP B CA    1 
ATOM   6793  C  C     . ASP B 1 400 ? 91.706  -65.027 16.581  1.00 42.70  ?  400 ASP B C     1 
ATOM   6794  O  O     . ASP B 1 400 ? 91.663  -65.844 15.664  1.00 43.74  ?  400 ASP B O     1 
ATOM   6795  C  CB    . ASP B 1 400 ? 93.326  -65.383 18.461  1.00 48.39  ?  400 ASP B CB    1 
ATOM   6796  C  CG    . ASP B 1 400 ? 93.393  -66.873 18.203  1.00 51.65  ?  400 ASP B CG    1 
ATOM   6797  O  OD1   . ASP B 1 400 ? 92.769  -67.618 19.002  1.00 52.17  ?  400 ASP B OD1   1 
ATOM   6798  O  OD2   . ASP B 1 400 ? 94.073  -67.288 17.219  1.00 51.50  ?  400 ASP B OD2   1 
ATOM   6799  N  N     . ALA B 1 401 ? 90.607  -64.502 17.103  1.00 40.12  ?  401 ALA B N     1 
ATOM   6800  C  CA    . ALA B 1 401 ? 89.318  -64.786 16.515  1.00 37.84  ?  401 ALA B CA    1 
ATOM   6801  C  C     . ALA B 1 401 ? 89.315  -64.418 15.019  1.00 42.97  ?  401 ALA B C     1 
ATOM   6802  O  O     . ALA B 1 401 ? 88.806  -65.176 14.184  1.00 48.12  ?  401 ALA B O     1 
ATOM   6803  C  CB    . ALA B 1 401 ? 88.212  -64.055 17.270  1.00 33.18  ?  401 ALA B CB    1 
ATOM   6804  N  N     . LYS B 1 402 ? 89.895  -63.273 14.666  1.00 40.58  ?  402 LYS B N     1 
ATOM   6805  C  CA    . LYS B 1 402 ? 89.898  -62.886 13.259  1.00 37.48  ?  402 LYS B CA    1 
ATOM   6806  C  C     . LYS B 1 402 ? 90.755  -63.815 12.402  1.00 36.71  ?  402 LYS B C     1 
ATOM   6807  O  O     . LYS B 1 402 ? 90.267  -64.329 11.405  1.00 35.96  ?  402 LYS B O     1 
ATOM   6808  C  CB    . LYS B 1 402 ? 90.268  -61.416 13.062  1.00 36.25  ?  402 LYS B CB    1 
ATOM   6809  C  CG    . LYS B 1 402 ? 89.427  -60.496 13.905  1.00 33.76  ?  402 LYS B CG    1 
ATOM   6810  C  CD    . LYS B 1 402 ? 89.353  -59.114 13.330  1.00 34.48  ?  402 LYS B CD    1 
ATOM   6811  C  CE    . LYS B 1 402 ? 90.715  -58.580 12.978  1.00 37.72  ?  402 LYS B CE    1 
ATOM   6812  N  NZ    . LYS B 1 402 ? 90.603  -57.101 12.831  1.00 38.71  ?  402 LYS B NZ    1 
ATOM   6813  N  N     . GLU B 1 403 ? 92.010  -64.053 12.788  1.00 38.51  ?  403 GLU B N     1 
ATOM   6814  C  CA    . GLU B 1 403 ? 92.830  -65.007 12.034  1.00 44.19  ?  403 GLU B CA    1 
ATOM   6815  C  C     . GLU B 1 403 ? 92.064  -66.326 11.868  1.00 43.96  ?  403 GLU B C     1 
ATOM   6816  O  O     . GLU B 1 403 ? 92.062  -66.929 10.789  1.00 50.84  ?  403 GLU B O     1 
ATOM   6817  C  CB    . GLU B 1 403 ? 94.238  -65.226 12.631  1.00 34.79  ?  403 GLU B CB    1 
ATOM   6818  N  N     . ASN B 1 404 ? 91.380  -66.768 12.912  1.00 36.37  ?  404 ASN B N     1 
ATOM   6819  C  CA    . ASN B 1 404 ? 90.566  -67.970 12.762  1.00 38.83  ?  404 ASN B CA    1 
ATOM   6820  C  C     . ASN B 1 404 ? 89.460  -67.832 11.709  1.00 38.08  ?  404 ASN B C     1 
ATOM   6821  O  O     . ASN B 1 404 ? 89.230  -68.732 10.910  1.00 35.55  ?  404 ASN B O     1 
ATOM   6822  C  CB    . ASN B 1 404 ? 89.983  -68.411 14.099  1.00 41.72  ?  404 ASN B CB    1 
ATOM   6823  C  CG    . ASN B 1 404 ? 90.943  -69.270 14.895  1.00 48.97  ?  404 ASN B CG    1 
ATOM   6824  O  OD1   . ASN B 1 404 ? 91.733  -70.034 14.328  1.00 49.12  ?  404 ASN B OD1   1 
ATOM   6825  N  ND2   . ASN B 1 404 ? 90.878  -69.156 16.223  1.00 52.79  ?  404 ASN B ND2   1 
ATOM   6826  N  N     . LEU B 1 405 ? 88.784  -66.694 11.704  1.00 40.47  ?  405 LEU B N     1 
ATOM   6827  C  CA    . LEU B 1 405 ? 87.706  -66.481 10.758  1.00 42.03  ?  405 LEU B CA    1 
ATOM   6828  C  C     . LEU B 1 405 ? 88.225  -66.471 9.330   1.00 46.32  ?  405 LEU B C     1 
ATOM   6829  O  O     . LEU B 1 405 ? 87.566  -66.962 8.411   1.00 50.20  ?  405 LEU B O     1 
ATOM   6830  C  CB    . LEU B 1 405 ? 86.972  -65.179 11.069  1.00 39.10  ?  405 LEU B CB    1 
ATOM   6831  C  CG    . LEU B 1 405 ? 85.894  -65.340 12.132  1.00 35.19  ?  405 LEU B CG    1 
ATOM   6832  C  CD1   . LEU B 1 405 ? 85.321  -63.998 12.526  1.00 40.92  ?  405 LEU B CD1   1 
ATOM   6833  C  CD2   . LEU B 1 405 ? 84.814  -66.278 11.635  1.00 28.75  ?  405 LEU B CD2   1 
ATOM   6834  N  N     . LYS B 1 406 ? 89.407  -65.900 9.149   1.00 43.93  ?  406 LYS B N     1 
ATOM   6835  C  CA    . LYS B 1 406 ? 90.015  -65.815 7.834   1.00 41.28  ?  406 LYS B CA    1 
ATOM   6836  C  C     . LYS B 1 406 ? 90.445  -67.204 7.398   1.00 44.21  ?  406 LYS B C     1 
ATOM   6837  O  O     . LYS B 1 406 ? 89.960  -67.752 6.405   1.00 52.88  ?  406 LYS B O     1 
ATOM   6838  C  CB    . LYS B 1 406 ? 91.236  -64.900 7.872   1.00 28.46  ?  406 LYS B CB    1 
ATOM   6839  C  CG    . LYS B 1 406 ? 91.001  -63.512 8.449   1.00 27.75  ?  406 LYS B CG    1 
ATOM   6840  C  CD    . LYS B 1 406 ? 92.275  -62.701 8.308   1.00 55.06  ?  406 LYS B CD    1 
ATOM   6841  C  CE    . LYS B 1 406 ? 92.183  -61.356 8.994   1.00 54.05  ?  406 LYS B CE    1 
ATOM   6842  N  NZ    . LYS B 1 406 ? 93.233  -60.427 8.482   1.00 54.52  ?  406 LYS B NZ    1 
ATOM   6843  N  N     . VAL B 1 407 ? 91.363  -67.777 8.158   1.00 39.57  ?  407 VAL B N     1 
ATOM   6844  C  CA    . VAL B 1 407 ? 91.908  -69.082 7.828   1.00 40.74  ?  407 VAL B CA    1 
ATOM   6845  C  C     . VAL B 1 407 ? 90.858  -70.151 7.581   1.00 38.15  ?  407 VAL B C     1 
ATOM   6846  O  O     . VAL B 1 407 ? 90.995  -70.963 6.684   1.00 38.09  ?  407 VAL B O     1 
ATOM   6847  C  CB    . VAL B 1 407 ? 92.801  -69.575 8.947   1.00 43.46  ?  407 VAL B CB    1 
ATOM   6848  C  CG1   . VAL B 1 407 ? 92.930  -71.094 8.874   1.00 35.46  ?  407 VAL B CG1   1 
ATOM   6849  C  CG2   . VAL B 1 407 ? 94.134  -68.862 8.879   1.00 47.53  ?  407 VAL B CG2   1 
ATOM   6850  N  N     . SER B 1 408 ? 89.811  -70.154 8.387   1.00 37.66  ?  408 SER B N     1 
ATOM   6851  C  CA    . SER B 1 408 ? 88.865  -71.254 8.358   1.00 37.76  ?  408 SER B CA    1 
ATOM   6852  C  C     . SER B 1 408 ? 87.704  -71.029 7.407   1.00 36.26  ?  408 SER B C     1 
ATOM   6853  O  O     . SER B 1 408 ? 87.048  -71.977 7.008   1.00 41.70  ?  408 SER B O     1 
ATOM   6854  C  CB    . SER B 1 408 ? 88.342  -71.559 9.772   1.00 39.24  ?  408 SER B CB    1 
ATOM   6855  O  OG    . SER B 1 408 ? 89.382  -72.051 10.604  1.00 42.46  ?  408 SER B OG    1 
ATOM   6856  N  N     . TYR B 1 409 ? 87.432  -69.781 7.052   1.00 35.54  ?  409 TYR B N     1 
ATOM   6857  C  CA    . TYR B 1 409 ? 86.249  -69.497 6.259   1.00 36.29  ?  409 TYR B CA    1 
ATOM   6858  C  C     . TYR B 1 409 ? 86.519  -68.490 5.156   1.00 38.21  ?  409 TYR B C     1 
ATOM   6859  O  O     . TYR B 1 409 ? 85.620  -68.108 4.422   1.00 38.80  ?  409 TYR B O     1 
ATOM   6860  C  CB    . TYR B 1 409 ? 85.106  -69.049 7.158   1.00 34.12  ?  409 TYR B CB    1 
ATOM   6861  C  CG    . TYR B 1 409 ? 84.536  -70.183 7.965   1.00 39.87  ?  409 TYR B CG    1 
ATOM   6862  C  CD1   . TYR B 1 409 ? 83.699  -71.117 7.380   1.00 42.38  ?  409 TYR B CD1   1 
ATOM   6863  C  CD2   . TYR B 1 409 ? 84.847  -70.333 9.311   1.00 42.19  ?  409 TYR B CD2   1 
ATOM   6864  C  CE1   . TYR B 1 409 ? 83.180  -72.164 8.115   1.00 45.63  ?  409 TYR B CE1   1 
ATOM   6865  C  CE2   . TYR B 1 409 ? 84.337  -71.378 10.053  1.00 41.86  ?  409 TYR B CE2   1 
ATOM   6866  C  CZ    . TYR B 1 409 ? 83.505  -72.291 9.452   1.00 45.55  ?  409 TYR B CZ    1 
ATOM   6867  O  OH    . TYR B 1 409 ? 82.987  -73.333 10.189  1.00 47.26  ?  409 TYR B OH    1 
ATOM   6868  N  N     . ASP B 1 410 ? 87.773  -68.086 5.034   1.00 38.46  ?  410 ASP B N     1 
ATOM   6869  C  CA    . ASP B 1 410 ? 88.192  -67.176 3.979   1.00 38.92  ?  410 ASP B CA    1 
ATOM   6870  C  C     . ASP B 1 410 ? 87.471  -65.852 3.984   1.00 36.38  ?  410 ASP B C     1 
ATOM   6871  O  O     . ASP B 1 410 ? 87.307  -65.227 2.938   1.00 42.46  ?  410 ASP B O     1 
ATOM   6872  C  CB    . ASP B 1 410 ? 88.093  -67.831 2.605   1.00 51.08  ?  410 ASP B CB    1 
ATOM   6873  C  CG    . ASP B 1 410 ? 89.259  -68.749 2.329   1.00 72.73  ?  410 ASP B CG    1 
ATOM   6874  O  OD1   . ASP B 1 410 ? 90.396  -68.389 2.723   1.00 77.26  ?  410 ASP B OD1   1 
ATOM   6875  O  OD2   . ASP B 1 410 ? 89.036  -69.835 1.740   1.00 83.09  ?  410 ASP B OD2   1 
ATOM   6876  N  N     . PHE B 1 411 ? 87.045  -65.413 5.158   1.00 29.24  ?  411 PHE B N     1 
ATOM   6877  C  CA    . PHE B 1 411 ? 86.627  -64.030 5.298   1.00 28.44  ?  411 PHE B CA    1 
ATOM   6878  C  C     . PHE B 1 411 ? 87.855  -63.127 5.148   1.00 30.51  ?  411 PHE B C     1 
ATOM   6879  O  O     . PHE B 1 411 ? 88.992  -63.571 5.298   1.00 29.11  ?  411 PHE B O     1 
ATOM   6880  C  CB    . PHE B 1 411 ? 85.925  -63.790 6.636   1.00 27.15  ?  411 PHE B CB    1 
ATOM   6881  C  CG    . PHE B 1 411 ? 84.596  -64.478 6.760   1.00 25.47  ?  411 PHE B CG    1 
ATOM   6882  C  CD1   . PHE B 1 411 ? 83.468  -63.952 6.151   1.00 26.67  ?  411 PHE B CD1   1 
ATOM   6883  C  CD2   . PHE B 1 411 ? 84.469  -65.636 7.502   1.00 28.87  ?  411 PHE B CD2   1 
ATOM   6884  C  CE1   . PHE B 1 411 ? 82.238  -64.582 6.254   1.00 26.66  ?  411 PHE B CE1   1 
ATOM   6885  C  CE2   . PHE B 1 411 ? 83.244  -66.267 7.616   1.00 31.39  ?  411 PHE B CE2   1 
ATOM   6886  C  CZ    . PHE B 1 411 ? 82.128  -65.741 6.983   1.00 29.08  ?  411 PHE B CZ    1 
ATOM   6887  N  N     . THR B 1 412 ? 87.618  -61.866 4.827   1.00 31.84  ?  412 THR B N     1 
ATOM   6888  C  CA    . THR B 1 412 ? 88.690  -60.901 4.694   1.00 34.19  ?  412 THR B CA    1 
ATOM   6889  C  C     . THR B 1 412 ? 88.807  -60.166 6.008   1.00 32.18  ?  412 THR B C     1 
ATOM   6890  O  O     . THR B 1 412 ? 87.869  -60.149 6.792   1.00 34.99  ?  412 THR B O     1 
ATOM   6891  C  CB    . THR B 1 412 ? 88.380  -59.873 3.588   1.00 35.26  ?  412 THR B CB    1 
ATOM   6892  O  OG1   . THR B 1 412 ? 87.518  -58.857 4.103   1.00 31.52  ?  412 THR B OG1   1 
ATOM   6893  C  CG2   . THR B 1 412 ? 87.674  -60.541 2.462   1.00 37.66  ?  412 THR B CG2   1 
ATOM   6894  N  N     . GLU B 1 413 ? 89.958  -59.562 6.248   1.00 29.21  ?  413 GLU B N     1 
ATOM   6895  C  CA    . GLU B 1 413 ? 90.141  -58.693 7.395   1.00 33.81  ?  413 GLU B CA    1 
ATOM   6896  C  C     . GLU B 1 413 ? 88.897  -57.849 7.692   1.00 37.16  ?  413 GLU B C     1 
ATOM   6897  O  O     . GLU B 1 413 ? 88.324  -57.916 8.783   1.00 38.26  ?  413 GLU B O     1 
ATOM   6898  C  CB    . GLU B 1 413 ? 91.331  -57.772 7.140   1.00 42.06  ?  413 GLU B CB    1 
ATOM   6899  C  CG    . GLU B 1 413 ? 91.442  -56.614 8.091   1.00 48.40  ?  413 GLU B CG    1 
ATOM   6900  C  CD    . GLU B 1 413 ? 91.793  -57.058 9.489   1.00 54.17  ?  413 GLU B CD    1 
ATOM   6901  O  OE1   . GLU B 1 413 ? 91.652  -56.233 10.417  1.00 63.50  ?  413 GLU B OE1   1 
ATOM   6902  O  OE2   . GLU B 1 413 ? 92.209  -58.229 9.653   1.00 49.75  ?  413 GLU B OE2   1 
ATOM   6903  N  N     . GLU B 1 414 ? 88.479  -57.056 6.717   1.00 26.90  ?  414 GLU B N     1 
ATOM   6904  C  CA    . GLU B 1 414 ? 87.364  -56.135 6.912   1.00 34.02  ?  414 GLU B CA    1 
ATOM   6905  C  C     . GLU B 1 414 ? 86.075  -56.865 7.279   1.00 30.87  ?  414 GLU B C     1 
ATOM   6906  O  O     . GLU B 1 414 ? 85.256  -56.371 8.065   1.00 32.79  ?  414 GLU B O     1 
ATOM   6907  C  CB    . GLU B 1 414 ? 87.156  -55.233 5.678   1.00 38.64  ?  414 GLU B CB    1 
ATOM   6908  C  CG    . GLU B 1 414 ? 87.926  -55.640 4.429   1.00 47.40  ?  414 GLU B CG    1 
ATOM   6909  C  CD    . GLU B 1 414 ? 89.425  -55.417 4.534   1.00 53.17  ?  414 GLU B CD    1 
ATOM   6910  O  OE1   . GLU B 1 414 ? 90.174  -56.257 3.976   1.00 60.68  ?  414 GLU B OE1   1 
ATOM   6911  O  OE2   . GLU B 1 414 ? 89.846  -54.411 5.157   1.00 50.09  ?  414 GLU B OE2   1 
ATOM   6912  N  N     . GLN B 1 415 ? 85.894  -58.045 6.707   1.00 24.08  ?  415 GLN B N     1 
ATOM   6913  C  CA    . GLN B 1 415 ? 84.726  -58.838 7.034   1.00 38.90  ?  415 GLN B CA    1 
ATOM   6914  C  C     . GLN B 1 415 ? 84.863  -59.404 8.429   1.00 34.87  ?  415 GLN B C     1 
ATOM   6915  O  O     . GLN B 1 415 ? 83.919  -59.391 9.203   1.00 36.30  ?  415 GLN B O     1 
ATOM   6916  C  CB    . GLN B 1 415 ? 84.528  -59.959 6.016   1.00 36.09  ?  415 GLN B CB    1 
ATOM   6917  C  CG    . GLN B 1 415 ? 84.410  -59.444 4.606   1.00 38.96  ?  415 GLN B CG    1 
ATOM   6918  C  CD    . GLN B 1 415 ? 84.183  -60.543 3.621   1.00 41.32  ?  415 GLN B CD    1 
ATOM   6919  O  OE1   . GLN B 1 415 ? 84.918  -61.523 3.590   1.00 49.94  ?  415 GLN B OE1   1 
ATOM   6920  N  NE2   . GLN B 1 415 ? 83.151  -60.399 2.809   1.00 36.38  ?  415 GLN B NE2   1 
ATOM   6921  N  N     . ALA B 1 416 ? 86.049  -59.898 8.753   1.00 32.44  ?  416 ALA B N     1 
ATOM   6922  C  CA    . ALA B 1 416 ? 86.251  -60.546 10.040  1.00 35.02  ?  416 ALA B CA    1 
ATOM   6923  C  C     . ALA B 1 416 ? 86.060  -59.534 11.148  1.00 40.69  ?  416 ALA B C     1 
ATOM   6924  O  O     . ALA B 1 416 ? 85.389  -59.813 12.143  1.00 46.87  ?  416 ALA B O     1 
ATOM   6925  C  CB    . ALA B 1 416 ? 87.612  -61.172 10.119  1.00 37.11  ?  416 ALA B CB    1 
ATOM   6926  N  N     . GLU B 1 417 ? 86.636  -58.351 10.971  1.00 38.46  ?  417 GLU B N     1 
ATOM   6927  C  CA    . GLU B 1 417 ? 86.450  -57.288 11.951  1.00 35.22  ?  417 GLU B CA    1 
ATOM   6928  C  C     . GLU B 1 417 ? 84.972  -56.958 12.156  1.00 38.53  ?  417 GLU B C     1 
ATOM   6929  O  O     . GLU B 1 417 ? 84.520  -56.768 13.275  1.00 44.01  ?  417 GLU B O     1 
ATOM   6930  C  CB    . GLU B 1 417 ? 87.192  -56.037 11.526  1.00 32.53  ?  417 GLU B CB    1 
ATOM   6931  C  CG    . GLU B 1 417 ? 86.901  -54.855 12.375  1.00 37.78  ?  417 GLU B CG    1 
ATOM   6932  C  CD    . GLU B 1 417 ? 87.792  -54.785 13.588  1.00 45.73  ?  417 GLU B CD    1 
ATOM   6933  O  OE1   . GLU B 1 417 ? 88.769  -55.582 13.657  1.00 48.92  ?  417 GLU B OE1   1 
ATOM   6934  O  OE2   . GLU B 1 417 ? 87.506  -53.934 14.465  1.00 48.83  ?  417 GLU B OE2   1 
ATOM   6935  N  N     . ALA B 1 418 ? 84.226  -56.894 11.062  1.00 36.47  ?  418 ALA B N     1 
ATOM   6936  C  CA    . ALA B 1 418 ? 82.804  -56.603 11.113  1.00 35.62  ?  418 ALA B CA    1 
ATOM   6937  C  C     . ALA B 1 418 ? 82.065  -57.607 11.984  1.00 35.28  ?  418 ALA B C     1 
ATOM   6938  O  O     . ALA B 1 418 ? 81.238  -57.235 12.825  1.00 41.67  ?  418 ALA B O     1 
ATOM   6939  C  CB    . ALA B 1 418 ? 82.233  -56.619 9.714   1.00 35.34  ?  418 ALA B CB    1 
ATOM   6940  N  N     . ILE B 1 419 ? 82.368  -58.880 11.763  1.00 29.66  ?  419 ILE B N     1 
ATOM   6941  C  CA    . ILE B 1 419 ? 81.669  -59.976 12.408  1.00 29.44  ?  419 ILE B CA    1 
ATOM   6942  C  C     . ILE B 1 419 ? 81.998  -59.978 13.897  1.00 37.66  ?  419 ILE B C     1 
ATOM   6943  O  O     . ILE B 1 419 ? 81.123  -59.951 14.775  1.00 45.73  ?  419 ILE B O     1 
ATOM   6944  C  CB    . ILE B 1 419 ? 82.092  -61.309 11.766  1.00 25.08  ?  419 ILE B CB    1 
ATOM   6945  C  CG1   . ILE B 1 419 ? 81.515  -61.418 10.343  1.00 23.34  ?  419 ILE B CG1   1 
ATOM   6946  C  CG2   . ILE B 1 419 ? 81.679  -62.481 12.632  1.00 28.87  ?  419 ILE B CG2   1 
ATOM   6947  C  CD1   . ILE B 1 419 ? 82.009  -62.618 9.559   1.00 22.62  ?  419 ILE B CD1   1 
ATOM   6948  N  N     . VAL B 1 420 ? 83.288  -59.975 14.162  1.00 33.62  ?  420 VAL B N     1 
ATOM   6949  C  CA    . VAL B 1 420 ? 83.814  -60.054 15.501  1.00 31.73  ?  420 VAL B CA    1 
ATOM   6950  C  C     . VAL B 1 420 ? 83.347  -58.898 16.406  1.00 32.51  ?  420 VAL B C     1 
ATOM   6951  O  O     . VAL B 1 420 ? 83.328  -59.018 17.636  1.00 38.48  ?  420 VAL B O     1 
ATOM   6952  C  CB    . VAL B 1 420 ? 85.340  -60.137 15.396  1.00 28.84  ?  420 VAL B CB    1 
ATOM   6953  C  CG1   . VAL B 1 420 ? 86.025  -59.096 16.261  1.00 25.06  ?  420 VAL B CG1   1 
ATOM   6954  C  CG2   . VAL B 1 420 ? 85.794  -61.570 15.654  1.00 26.62  ?  420 VAL B CG2   1 
ATOM   6955  N  N     . THR B 1 421 ? 82.939  -57.789 15.803  1.00 27.90  ?  421 THR B N     1 
ATOM   6956  C  CA    . THR B 1 421 ? 82.520  -56.636 16.588  1.00 30.43  ?  421 THR B CA    1 
ATOM   6957  C  C     . THR B 1 421 ? 81.005  -56.405 16.545  1.00 32.88  ?  421 THR B C     1 
ATOM   6958  O  O     . THR B 1 421 ? 80.503  -55.363 16.993  1.00 33.99  ?  421 THR B O     1 
ATOM   6959  C  CB    . THR B 1 421 ? 83.288  -55.369 16.193  1.00 25.85  ?  421 THR B CB    1 
ATOM   6960  O  OG1   . THR B 1 421 ? 82.887  -54.931 14.892  1.00 36.15  ?  421 THR B OG1   1 
ATOM   6961  C  CG2   . THR B 1 421 ? 84.774  -55.652 16.179  1.00 38.82  ?  421 THR B CG2   1 
ATOM   6962  N  N     . LEU B 1 422 ? 80.286  -57.388 16.007  1.00 33.99  ?  422 LEU B N     1 
ATOM   6963  C  CA    . LEU B 1 422 ? 78.833  -57.438 16.118  1.00 38.00  ?  422 LEU B CA    1 
ATOM   6964  C  C     . LEU B 1 422 ? 78.426  -57.578 17.594  1.00 36.36  ?  422 LEU B C     1 
ATOM   6965  O  O     . LEU B 1 422 ? 79.047  -58.331 18.343  1.00 38.02  ?  422 LEU B O     1 
ATOM   6966  C  CB    . LEU B 1 422 ? 78.295  -58.644 15.344  1.00 35.34  ?  422 LEU B CB    1 
ATOM   6967  C  CG    . LEU B 1 422 ? 78.142  -58.697 13.830  1.00 30.18  ?  422 LEU B CG    1 
ATOM   6968  C  CD1   . LEU B 1 422 ? 77.899  -60.138 13.386  1.00 20.99  ?  422 LEU B CD1   1 
ATOM   6969  C  CD2   . LEU B 1 422 ? 76.986  -57.853 13.435  1.00 31.23  ?  422 LEU B CD2   1 
ATOM   6970  N  N     . GLN B 1 423 ? 77.373  -56.881 18.006  1.00 29.69  ?  423 GLN B N     1 
ATOM   6971  C  CA    . GLN B 1 423 ? 76.885  -57.001 19.376  1.00 29.55  ?  423 GLN B CA    1 
ATOM   6972  C  C     . GLN B 1 423 ? 76.018  -58.254 19.534  1.00 30.99  ?  423 GLN B C     1 
ATOM   6973  O  O     . GLN B 1 423 ? 75.278  -58.594 18.628  1.00 35.43  ?  423 GLN B O     1 
ATOM   6974  C  CB    . GLN B 1 423 ? 76.112  -55.743 19.780  1.00 33.48  ?  423 GLN B CB    1 
ATOM   6975  C  CG    . GLN B 1 423 ? 76.998  -54.529 19.904  1.00 39.94  ?  423 GLN B CG    1 
ATOM   6976  C  CD    . GLN B 1 423 ? 76.265  -53.301 20.400  1.00 48.29  ?  423 GLN B CD    1 
ATOM   6977  O  OE1   . GLN B 1 423 ? 75.098  -53.088 20.088  1.00 51.76  ?  423 GLN B OE1   1 
ATOM   6978  N  NE2   . GLN B 1 423 ? 76.953  -52.487 21.190  1.00 51.72  ?  423 GLN B NE2   1 
ATOM   6979  N  N     . LEU B 1 424 ? 76.102  -58.942 20.675  1.00 32.75  ?  424 LEU B N     1 
ATOM   6980  C  CA    . LEU B 1 424 ? 75.366  -60.199 20.839  1.00 31.73  ?  424 LEU B CA    1 
ATOM   6981  C  C     . LEU B 1 424 ? 73.924  -60.180 20.304  1.00 31.03  ?  424 LEU B C     1 
ATOM   6982  O  O     . LEU B 1 424 ? 73.528  -61.089 19.592  1.00 30.70  ?  424 LEU B O     1 
ATOM   6983  C  CB    . LEU B 1 424 ? 75.393  -60.696 22.287  1.00 33.80  ?  424 LEU B CB    1 
ATOM   6984  C  CG    . LEU B 1 424 ? 76.766  -61.063 22.838  1.00 35.20  ?  424 LEU B CG    1 
ATOM   6985  C  CD1   . LEU B 1 424 ? 76.663  -61.715 24.200  1.00 30.44  ?  424 LEU B CD1   1 
ATOM   6986  C  CD2   . LEU B 1 424 ? 77.492  -61.968 21.880  1.00 33.23  ?  424 LEU B CD2   1 
ATOM   6987  N  N     . TYR B 1 425 ? 73.141  -59.164 20.632  1.00 29.05  ?  425 TYR B N     1 
ATOM   6988  C  CA    . TYR B 1 425 ? 71.734  -59.193 20.259  1.00 37.58  ?  425 TYR B CA    1 
ATOM   6989  C  C     . TYR B 1 425 ? 71.509  -59.415 18.755  1.00 39.26  ?  425 TYR B C     1 
ATOM   6990  O  O     . TYR B 1 425 ? 70.444  -59.869 18.327  1.00 42.13  ?  425 TYR B O     1 
ATOM   6991  C  CB    . TYR B 1 425 ? 70.995  -57.944 20.750  1.00 42.35  ?  425 TYR B CB    1 
ATOM   6992  C  CG    . TYR B 1 425 ? 71.302  -56.662 20.002  1.00 45.97  ?  425 TYR B CG    1 
ATOM   6993  C  CD1   . TYR B 1 425 ? 72.248  -55.773 20.478  1.00 53.04  ?  425 TYR B CD1   1 
ATOM   6994  C  CD2   . TYR B 1 425 ? 70.630  -56.332 18.842  1.00 45.59  ?  425 TYR B CD2   1 
ATOM   6995  C  CE1   . TYR B 1 425 ? 72.517  -54.602 19.821  1.00 58.09  ?  425 TYR B CE1   1 
ATOM   6996  C  CE2   . TYR B 1 425 ? 70.900  -55.168 18.179  1.00 50.86  ?  425 TYR B CE2   1 
ATOM   6997  C  CZ    . TYR B 1 425 ? 71.842  -54.301 18.670  1.00 58.16  ?  425 TYR B CZ    1 
ATOM   6998  O  OH    . TYR B 1 425 ? 72.119  -53.121 18.006  1.00 64.07  ?  425 TYR B OH    1 
ATOM   6999  N  N     . ARG B 1 426 ? 72.520  -59.108 17.958  1.00 38.21  ?  426 ARG B N     1 
ATOM   7000  C  CA    . ARG B 1 426 ? 72.435  -59.314 16.520  1.00 35.96  ?  426 ARG B CA    1 
ATOM   7001  C  C     . ARG B 1 426 ? 72.214  -60.794 16.148  1.00 39.60  ?  426 ARG B C     1 
ATOM   7002  O  O     . ARG B 1 426 ? 71.741  -61.098 15.053  1.00 48.89  ?  426 ARG B O     1 
ATOM   7003  C  CB    . ARG B 1 426 ? 73.675  -58.733 15.825  1.00 32.01  ?  426 ARG B CB    1 
ATOM   7004  C  CG    . ARG B 1 426 ? 73.736  -57.204 15.853  1.00 39.04  ?  426 ARG B CG    1 
ATOM   7005  C  CD    . ARG B 1 426 ? 72.976  -56.555 14.692  1.00 45.97  ?  426 ARG B CD    1 
ATOM   7006  N  NE    . ARG B 1 426 ? 73.480  -55.205 14.432  1.00 51.03  ?  426 ARG B NE    1 
ATOM   7007  C  CZ    . ARG B 1 426 ? 72.751  -54.095 14.518  1.00 63.72  ?  426 ARG B CZ    1 
ATOM   7008  N  NH1   . ARG B 1 426 ? 71.462  -54.155 14.837  1.00 72.49  ?  426 ARG B NH1   1 
ATOM   7009  N  NH2   . ARG B 1 426 ? 73.306  -52.917 14.271  1.00 64.77  ?  426 ARG B NH2   1 
ATOM   7010  N  N     . LEU B 1 427 ? 72.538  -61.706 17.059  1.00 32.56  ?  427 LEU B N     1 
ATOM   7011  C  CA    . LEU B 1 427 ? 72.316  -63.127 16.827  1.00 33.23  ?  427 LEU B CA    1 
ATOM   7012  C  C     . LEU B 1 427 ? 70.824  -63.475 16.834  1.00 42.31  ?  427 LEU B C     1 
ATOM   7013  O  O     . LEU B 1 427 ? 70.445  -64.657 16.803  1.00 49.84  ?  427 LEU B O     1 
ATOM   7014  C  CB    . LEU B 1 427 ? 73.022  -63.954 17.897  1.00 36.17  ?  427 LEU B CB    1 
ATOM   7015  C  CG    . LEU B 1 427 ? 74.516  -63.726 18.049  1.00 38.82  ?  427 LEU B CG    1 
ATOM   7016  C  CD1   . LEU B 1 427 ? 75.080  -64.748 19.012  1.00 44.39  ?  427 LEU B CD1   1 
ATOM   7017  C  CD2   . LEU B 1 427 ? 75.204  -63.810 16.690  1.00 33.59  ?  427 LEU B CD2   1 
ATOM   7018  N  N     . THR B 1 428 ? 69.981  -62.449 16.891  1.00 44.11  ?  428 THR B N     1 
ATOM   7019  C  CA    . THR B 1 428 ? 68.536  -62.640 16.886  1.00 57.07  ?  428 THR B CA    1 
ATOM   7020  C  C     . THR B 1 428 ? 67.931  -62.171 15.564  1.00 75.08  ?  428 THR B C     1 
ATOM   7021  O  O     . THR B 1 428 ? 66.828  -62.580 15.204  1.00 79.93  ?  428 THR B O     1 
ATOM   7022  C  CB    . THR B 1 428 ? 67.843  -61.899 18.074  1.00 50.30  ?  428 THR B CB    1 
ATOM   7023  O  OG1   . THR B 1 428 ? 68.119  -60.497 17.999  1.00 56.25  ?  428 THR B OG1   1 
ATOM   7024  C  CG2   . THR B 1 428 ? 68.328  -62.426 19.426  1.00 47.15  ?  428 THR B CG2   1 
ATOM   7025  N  N     . ASN B 1 429 ? 68.641  -61.294 14.853  1.00 83.86  ?  429 ASN B N     1 
ATOM   7026  C  CA    . ASN B 1 429 ? 68.218  -60.874 13.513  1.00 93.40  ?  429 ASN B CA    1 
ATOM   7027  C  C     . ASN B 1 429 ? 68.905  -61.717 12.460  1.00 85.52  ?  429 ASN B C     1 
ATOM   7028  O  O     . ASN B 1 429 ? 69.704  -61.222 11.664  1.00 87.94  ?  429 ASN B O     1 
ATOM   7029  C  CB    . ASN B 1 429 ? 68.493  -59.391 13.236  1.00 105.35 ?  429 ASN B CB    1 
ATOM   7030  C  CG    . ASN B 1 429 ? 68.053  -58.969 11.827  1.00 113.02 ?  429 ASN B CG    1 
ATOM   7031  O  OD1   . ASN B 1 429 ? 68.866  -58.891 10.902  1.00 113.97 ?  429 ASN B OD1   1 
ATOM   7032  N  ND2   . ASN B 1 429 ? 66.758  -58.718 11.663  1.00 117.72 ?  429 ASN B ND2   1 
ATOM   7033  N  N     . THR B 1 430 ? 68.583  -62.998 12.462  1.00 99.36  ?  430 THR B N     1 
ATOM   7034  C  CA    . THR B 1 430 ? 69.216  -63.929 11.560  1.00 91.47  ?  430 THR B CA    1 
ATOM   7035  C  C     . THR B 1 430 ? 68.356  -64.140 10.306  1.00 90.90  ?  430 THR B C     1 
ATOM   7036  O  O     . THR B 1 430 ? 67.799  -65.215 10.097  1.00 99.88  ?  430 THR B O     1 
ATOM   7037  C  CB    . THR B 1 430 ? 69.483  -65.246 12.291  1.00 92.86  ?  430 THR B CB    1 
ATOM   7038  O  OG1   . THR B 1 430 ? 70.001  -66.204 11.369  1.00 95.70  ?  430 THR B OG1   1 
ATOM   7039  C  CG2   . THR B 1 430 ? 68.203  -65.779 12.941  1.00 96.00  ?  430 THR B CG2   1 
ATOM   7040  N  N     . ASP B 1 431 ? 68.240  -63.110 9.472   1.00 82.40  ?  431 ASP B N     1 
ATOM   7041  C  CA    . ASP B 1 431 ? 67.393  -63.210 8.287   1.00 81.87  ?  431 ASP B CA    1 
ATOM   7042  C  C     . ASP B 1 431 ? 68.060  -62.709 6.993   1.00 75.97  ?  431 ASP B C     1 
ATOM   7043  O  O     . ASP B 1 431 ? 68.278  -61.510 6.783   1.00 72.41  ?  431 ASP B O     1 
ATOM   7044  C  CB    . ASP B 1 431 ? 66.026  -62.557 8.533   1.00 92.10  ?  431 ASP B CB    1 
ATOM   7045  C  CG    . ASP B 1 431 ? 65.866  -61.223 7.824   1.00 99.39  ?  431 ASP B CG    1 
ATOM   7046  O  OD1   . ASP B 1 431 ? 65.427  -61.223 6.651   1.00 100.06 ?  431 ASP B OD1   1 
ATOM   7047  O  OD2   . ASP B 1 431 ? 66.160  -60.175 8.445   1.00 103.05 ?  431 ASP B OD2   1 
ATOM   7048  N  N     . VAL B 1 432 ? 68.367  -63.666 6.126   1.00 71.69  ?  432 VAL B N     1 
ATOM   7049  C  CA    . VAL B 1 432 ? 69.140  -63.438 4.916   1.00 64.23  ?  432 VAL B CA    1 
ATOM   7050  C  C     . VAL B 1 432 ? 68.458  -62.506 3.926   1.00 59.45  ?  432 VAL B C     1 
ATOM   7051  O  O     . VAL B 1 432 ? 69.110  -61.715 3.250   1.00 58.92  ?  432 VAL B O     1 
ATOM   7052  C  CB    . VAL B 1 432 ? 69.424  -64.783 4.221   1.00 72.35  ?  432 VAL B CB    1 
ATOM   7053  C  CG1   . VAL B 1 432 ? 70.222  -64.577 2.962   1.00 83.52  ?  432 VAL B CG1   1 
ATOM   7054  C  CG2   . VAL B 1 432 ? 70.176  -65.697 5.154   1.00 69.44  ?  432 VAL B CG2   1 
ATOM   7055  N  N     . VAL B 1 433 ? 67.143  -62.598 3.829   1.00 58.26  ?  433 VAL B N     1 
ATOM   7056  C  CA    . VAL B 1 433 ? 66.434  -61.885 2.773   1.00 51.63  ?  433 VAL B CA    1 
ATOM   7057  C  C     . VAL B 1 433 ? 66.594  -60.356 2.782   1.00 48.87  ?  433 VAL B C     1 
ATOM   7058  O  O     . VAL B 1 433 ? 66.718  -59.758 1.723   1.00 46.70  ?  433 VAL B O     1 
ATOM   7059  C  CB    . VAL B 1 433 ? 64.957  -62.311 2.703   1.00 51.73  ?  433 VAL B CB    1 
ATOM   7060  C  CG1   . VAL B 1 433 ? 64.163  -61.412 1.750   1.00 46.93  ?  433 VAL B CG1   1 
ATOM   7061  C  CG2   . VAL B 1 433 ? 64.866  -63.776 2.290   1.00 51.38  ?  433 VAL B CG2   1 
ATOM   7062  N  N     . VAL B 1 434 ? 66.603  -59.714 3.948   1.00 50.16  ?  434 VAL B N     1 
ATOM   7063  C  CA    . VAL B 1 434 ? 66.826  -58.264 3.965   1.00 49.57  ?  434 VAL B CA    1 
ATOM   7064  C  C     . VAL B 1 434 ? 68.276  -57.917 3.645   1.00 50.71  ?  434 VAL B C     1 
ATOM   7065  O  O     . VAL B 1 434 ? 68.559  -56.866 3.085   1.00 55.46  ?  434 VAL B O     1 
ATOM   7066  C  CB    . VAL B 1 434 ? 66.399  -57.580 5.286   1.00 48.40  ?  434 VAL B CB    1 
ATOM   7067  C  CG1   . VAL B 1 434 ? 65.078  -58.155 5.772   1.00 53.49  ?  434 VAL B CG1   1 
ATOM   7068  C  CG2   . VAL B 1 434 ? 67.486  -57.710 6.349   1.00 40.66  ?  434 VAL B CG2   1 
ATOM   7069  N  N     . LEU B 1 435 ? 69.199  -58.795 4.006   1.00 50.02  ?  435 LEU B N     1 
ATOM   7070  C  CA    . LEU B 1 435 ? 70.574  -58.599 3.599   1.00 47.61  ?  435 LEU B CA    1 
ATOM   7071  C  C     . LEU B 1 435 ? 70.671  -58.778 2.095   1.00 46.14  ?  435 LEU B C     1 
ATOM   7072  O  O     . LEU B 1 435 ? 71.365  -58.022 1.415   1.00 46.00  ?  435 LEU B O     1 
ATOM   7073  C  CB    . LEU B 1 435 ? 71.491  -59.583 4.297   1.00 35.27  ?  435 LEU B CB    1 
ATOM   7074  C  CG    . LEU B 1 435 ? 71.888  -59.167 5.695   1.00 35.78  ?  435 LEU B CG    1 
ATOM   7075  C  CD1   . LEU B 1 435 ? 72.701  -60.269 6.288   1.00 37.00  ?  435 LEU B CD1   1 
ATOM   7076  C  CD2   . LEU B 1 435 ? 72.700  -57.901 5.620   1.00 42.71  ?  435 LEU B CD2   1 
ATOM   7077  N  N     . GLN B 1 436 ? 69.968  -59.772 1.565   1.00 47.12  ?  436 GLN B N     1 
ATOM   7078  C  CA    . GLN B 1 436 ? 69.988  -59.977 0.122   1.00 47.61  ?  436 GLN B CA    1 
ATOM   7079  C  C     . GLN B 1 436 ? 69.345  -58.832 -0.650  1.00 44.68  ?  436 GLN B C     1 
ATOM   7080  O  O     . GLN B 1 436 ? 69.726  -58.588 -1.790  1.00 34.20  ?  436 GLN B O     1 
ATOM   7081  C  CB    . GLN B 1 436 ? 69.393  -61.320 -0.264  1.00 37.99  ?  436 GLN B CB    1 
ATOM   7082  C  CG    . GLN B 1 436 ? 70.416  -62.409 -0.275  1.00 47.57  ?  436 GLN B CG    1 
ATOM   7083  C  CD    . GLN B 1 436 ? 69.802  -63.782 -0.288  1.00 52.15  ?  436 GLN B CD    1 
ATOM   7084  O  OE1   . GLN B 1 436 ? 68.606  -63.937 -0.049  1.00 43.08  ?  436 GLN B OE1   1 
ATOM   7085  N  NE2   . GLN B 1 436 ? 70.619  -64.797 -0.571  1.00 56.25  ?  436 GLN B NE2   1 
ATOM   7086  N  N     . GLU B 1 437 ? 68.396  -58.132 -0.020  1.00 39.53  ?  437 GLU B N     1 
ATOM   7087  C  CA    . GLU B 1 437 ? 67.777  -56.937 -0.602  1.00 39.35  ?  437 GLU B CA    1 
ATOM   7088  C  C     . GLU B 1 437 ? 68.726  -55.746 -0.553  1.00 44.63  ?  437 GLU B C     1 
ATOM   7089  O  O     . GLU B 1 437 ? 68.741  -54.931 -1.472  1.00 50.94  ?  437 GLU B O     1 
ATOM   7090  C  CB    . GLU B 1 437 ? 66.448  -56.578 0.081   1.00 40.08  ?  437 GLU B CB    1 
ATOM   7091  C  CG    . GLU B 1 437 ? 65.305  -57.582 -0.160  1.00 49.00  ?  437 GLU B CG    1 
ATOM   7092  C  CD    . GLU B 1 437 ? 64.034  -57.264 0.637   1.00 51.20  ?  437 GLU B CD    1 
ATOM   7093  N  N     . GLU B 1 438 ? 69.516  -55.639 0.514   1.00 45.16  ?  438 GLU B N     1 
ATOM   7094  C  CA    . GLU B 1 438 ? 70.501  -54.562 0.617   1.00 43.95  ?  438 GLU B CA    1 
ATOM   7095  C  C     . GLU B 1 438 ? 71.623  -54.821 -0.380  1.00 43.79  ?  438 GLU B C     1 
ATOM   7096  O  O     . GLU B 1 438 ? 72.075  -53.910 -1.077  1.00 45.24  ?  438 GLU B O     1 
ATOM   7097  C  CB    . GLU B 1 438 ? 71.058  -54.438 2.037   1.00 44.18  ?  438 GLU B CB    1 
ATOM   7098  C  CG    . GLU B 1 438 ? 72.097  -53.323 2.214   1.00 44.84  ?  438 GLU B CG    1 
ATOM   7099  C  CD    . GLU B 1 438 ? 72.582  -53.211 3.652   1.00 48.83  ?  438 GLU B CD    1 
ATOM   7100  O  OE1   . GLU B 1 438 ? 73.253  -52.213 3.990   1.00 46.75  ?  438 GLU B OE1   1 
ATOM   7101  O  OE2   . GLU B 1 438 ? 72.282  -54.128 4.447   1.00 53.05  ?  438 GLU B OE2   1 
ATOM   7102  N  N     . GLU B 1 439 ? 72.061  -56.073 -0.454  1.00 42.41  ?  439 GLU B N     1 
ATOM   7103  C  CA    . GLU B 1 439 ? 73.061  -56.455 -1.433  1.00 39.92  ?  439 GLU B CA    1 
ATOM   7104  C  C     . GLU B 1 439 ? 72.633  -56.023 -2.827  1.00 37.97  ?  439 GLU B C     1 
ATOM   7105  O  O     . GLU B 1 439 ? 73.443  -55.547 -3.605  1.00 34.29  ?  439 GLU B O     1 
ATOM   7106  C  CB    . GLU B 1 439 ? 73.278  -57.955 -1.416  1.00 43.52  ?  439 GLU B CB    1 
ATOM   7107  C  CG    . GLU B 1 439 ? 74.252  -58.428 -2.456  1.00 48.75  ?  439 GLU B CG    1 
ATOM   7108  C  CD    . GLU B 1 439 ? 74.405  -59.932 -2.441  1.00 63.50  ?  439 GLU B CD    1 
ATOM   7109  O  OE1   . GLU B 1 439 ? 75.564  -60.410 -2.535  1.00 69.59  ?  439 GLU B OE1   1 
ATOM   7110  O  OE2   . GLU B 1 439 ? 73.366  -60.631 -2.335  1.00 67.19  ?  439 GLU B OE2   1 
ATOM   7111  N  N     . ALA B 1 440 ? 71.351  -56.184 -3.131  1.00 38.90  ?  440 ALA B N     1 
ATOM   7112  C  CA    . ALA B 1 440 ? 70.839  -55.857 -4.461  1.00 38.01  ?  440 ALA B CA    1 
ATOM   7113  C  C     . ALA B 1 440 ? 70.798  -54.357 -4.686  1.00 38.56  ?  440 ALA B C     1 
ATOM   7114  O  O     . ALA B 1 440 ? 71.228  -53.880 -5.741  1.00 43.39  ?  440 ALA B O     1 
ATOM   7115  C  CB    . ALA B 1 440 ? 69.463  -56.458 -4.678  1.00 35.89  ?  440 ALA B CB    1 
ATOM   7116  N  N     . GLU B 1 441 ? 70.274  -53.618 -3.706  1.00 33.73  ?  441 GLU B N     1 
ATOM   7117  C  CA    . GLU B 1 441 ? 70.246  -52.170 -3.814  1.00 36.54  ?  441 GLU B CA    1 
ATOM   7118  C  C     . GLU B 1 441 ? 71.668  -51.671 -4.005  1.00 35.68  ?  441 GLU B C     1 
ATOM   7119  O  O     . GLU B 1 441 ? 71.918  -50.738 -4.762  1.00 39.38  ?  441 GLU B O     1 
ATOM   7120  C  CB    . GLU B 1 441 ? 69.615  -51.515 -2.580  1.00 40.09  ?  441 GLU B CB    1 
ATOM   7121  C  CG    . GLU B 1 441 ? 68.100  -51.657 -2.474  1.00 41.96  ?  441 GLU B CG    1 
ATOM   7122  N  N     . LEU B 1 442 ? 72.604  -52.306 -3.318  1.00 32.65  ?  442 LEU B N     1 
ATOM   7123  C  CA    . LEU B 1 442 ? 73.976  -51.840 -3.330  1.00 28.13  ?  442 LEU B CA    1 
ATOM   7124  C  C     . LEU B 1 442 ? 74.603  -52.078 -4.685  1.00 31.62  ?  442 LEU B C     1 
ATOM   7125  O  O     . LEU B 1 442 ? 75.260  -51.197 -5.241  1.00 31.47  ?  442 LEU B O     1 
ATOM   7126  C  CB    . LEU B 1 442 ? 74.776  -52.527 -2.229  1.00 24.96  ?  442 LEU B CB    1 
ATOM   7127  C  CG    . LEU B 1 442 ? 74.628  -51.786 -0.909  1.00 29.55  ?  442 LEU B CG    1 
ATOM   7128  C  CD1   . LEU B 1 442 ? 75.166  -52.607 0.246   1.00 33.83  ?  442 LEU B CD1   1 
ATOM   7129  C  CD2   . LEU B 1 442 ? 75.346  -50.460 -1.009  1.00 28.58  ?  442 LEU B CD2   1 
ATOM   7130  N  N     . ARG B 1 443 ? 74.396  -53.274 -5.221  1.00 31.69  ?  443 ARG B N     1 
ATOM   7131  C  CA    . ARG B 1 443 ? 74.890  -53.595 -6.556  1.00 32.27  ?  443 ARG B CA    1 
ATOM   7132  C  C     . ARG B 1 443 ? 74.389  -52.596 -7.603  1.00 37.64  ?  443 ARG B C     1 
ATOM   7133  O  O     . ARG B 1 443 ? 75.193  -51.974 -8.295  1.00 42.29  ?  443 ARG B O     1 
ATOM   7134  C  CB    . ARG B 1 443 ? 74.526  -55.017 -6.928  1.00 28.58  ?  443 ARG B CB    1 
ATOM   7135  C  CG    . ARG B 1 443 ? 75.336  -56.030 -6.195  1.00 28.75  ?  443 ARG B CG    1 
ATOM   7136  C  CD    . ARG B 1 443 ? 74.937  -57.449 -6.569  1.00 48.31  ?  443 ARG B CD    1 
ATOM   7137  N  NE    . ARG B 1 443 ? 75.873  -57.983 -7.544  1.00 52.34  ?  443 ARG B NE    1 
ATOM   7138  C  CZ    . ARG B 1 443 ? 77.078  -58.451 -7.233  1.00 60.68  ?  443 ARG B CZ    1 
ATOM   7139  N  NH1   . ARG B 1 443 ? 77.463  -58.473 -5.948  1.00 64.61  ?  443 ARG B NH1   1 
ATOM   7140  N  NH2   . ARG B 1 443 ? 77.888  -58.899 -8.203  1.00 59.94  ?  443 ARG B NH2   1 
ATOM   7141  N  N     . GLU B 1 444 ? 73.068  -52.446 -7.705  1.00 36.80  ?  444 GLU B N     1 
ATOM   7142  C  CA    . GLU B 1 444 ? 72.443  -51.418 -8.541  1.00 36.15  ?  444 GLU B CA    1 
ATOM   7143  C  C     . GLU B 1 444 ? 73.111  -50.037 -8.370  1.00 34.11  ?  444 GLU B C     1 
ATOM   7144  O  O     . GLU B 1 444 ? 73.479  -49.386 -9.347  1.00 32.25  ?  444 GLU B O     1 
ATOM   7145  C  CB    . GLU B 1 444 ? 70.948  -51.318 -8.198  1.00 37.00  ?  444 GLU B CB    1 
ATOM   7146  C  CG    . GLU B 1 444 ? 69.991  -51.362 -9.385  1.00 38.39  ?  444 GLU B CG    1 
ATOM   7147  N  N     . LYS B 1 445 ? 73.255  -49.594 -7.125  1.00 33.62  ?  445 LYS B N     1 
ATOM   7148  C  CA    . LYS B 1 445 ? 73.800  -48.276 -6.828  1.00 32.21  ?  445 LYS B CA    1 
ATOM   7149  C  C     . LYS B 1 445 ? 75.205  -48.147 -7.380  1.00 32.57  ?  445 LYS B C     1 
ATOM   7150  O  O     . LYS B 1 445 ? 75.578  -47.110 -7.913  1.00 37.46  ?  445 LYS B O     1 
ATOM   7151  C  CB    . LYS B 1 445 ? 73.790  -48.012 -5.313  1.00 31.54  ?  445 LYS B CB    1 
ATOM   7152  C  CG    . LYS B 1 445 ? 74.431  -46.682 -4.891  1.00 30.67  ?  445 LYS B CG    1 
ATOM   7153  C  CD    . LYS B 1 445 ? 73.812  -46.114 -3.604  1.00 33.77  ?  445 LYS B CD    1 
ATOM   7154  N  N     . ILE B 1 446 ? 75.992  -49.200 -7.240  1.00 31.06  ?  446 ILE B N     1 
ATOM   7155  C  CA    . ILE B 1 446 ? 77.361  -49.167 -7.714  1.00 33.90  ?  446 ILE B CA    1 
ATOM   7156  C  C     . ILE B 1 446 ? 77.370  -49.104 -9.233  1.00 40.50  ?  446 ILE B C     1 
ATOM   7157  O  O     . ILE B 1 446 ? 78.151  -48.371 -9.833  1.00 45.86  ?  446 ILE B O     1 
ATOM   7158  C  CB    . ILE B 1 446 ? 78.138  -50.392 -7.217  1.00 23.52  ?  446 ILE B CB    1 
ATOM   7159  C  CG1   . ILE B 1 446 ? 78.330  -50.283 -5.700  1.00 22.87  ?  446 ILE B CG1   1 
ATOM   7160  C  CG2   . ILE B 1 446 ? 79.475  -50.503 -7.928  1.00 24.19  ?  446 ILE B CG2   1 
ATOM   7161  C  CD1   . ILE B 1 446 ? 78.574  -51.610 -4.986  1.00 23.08  ?  446 ILE B CD1   1 
ATOM   7162  N  N     . ALA B 1 447 ? 76.480  -49.868 -9.853  1.00 40.16  ?  447 ALA B N     1 
ATOM   7163  C  CA    . ALA B 1 447 ? 76.374  -49.906 -11.300 1.00 41.56  ?  447 ALA B CA    1 
ATOM   7164  C  C     . ALA B 1 447 ? 76.077  -48.516 -11.848 1.00 44.57  ?  447 ALA B C     1 
ATOM   7165  O  O     . ALA B 1 447 ? 76.682  -48.098 -12.844 1.00 43.84  ?  447 ALA B O     1 
ATOM   7166  C  CB    . ALA B 1 447 ? 75.290  -50.861 -11.700 1.00 29.89  ?  447 ALA B CB    1 
ATOM   7167  N  N     . MET B 1 448 ? 75.150  -47.808 -11.191 1.00 44.79  ?  448 MET B N     1 
ATOM   7168  C  CA    . MET B 1 448 ? 74.725  -46.482 -11.633 1.00 42.40  ?  448 MET B CA    1 
ATOM   7169  C  C     . MET B 1 448 ? 75.877  -45.479 -11.533 1.00 39.01  ?  448 MET B C     1 
ATOM   7170  O  O     . MET B 1 448 ? 76.014  -44.579 -12.358 1.00 39.62  ?  448 MET B O     1 
ATOM   7171  C  CB    . MET B 1 448 ? 73.489  -45.996 -10.847 1.00 39.77  ?  448 MET B CB    1 
ATOM   7172  C  CG    . MET B 1 448 ? 72.173  -45.986 -11.648 1.00 30.26  ?  448 MET B CG    1 
ATOM   7173  N  N     . LEU B 1 449 ? 76.712  -45.646 -10.524 1.00 37.14  ?  449 LEU B N     1 
ATOM   7174  C  CA    . LEU B 1 449 ? 77.767  -44.687 -10.263 1.00 36.56  ?  449 LEU B CA    1 
ATOM   7175  C  C     . LEU B 1 449 ? 78.948  -44.979 -11.159 1.00 38.36  ?  449 LEU B C     1 
ATOM   7176  O  O     . LEU B 1 449 ? 79.626  -44.073 -11.629 1.00 42.42  ?  449 LEU B O     1 
ATOM   7177  C  CB    . LEU B 1 449 ? 78.209  -44.750 -8.791  1.00 33.63  ?  449 LEU B CB    1 
ATOM   7178  C  CG    . LEU B 1 449 ? 77.297  -44.324 -7.634  1.00 26.65  ?  449 LEU B CG    1 
ATOM   7179  C  CD1   . LEU B 1 449 ? 77.974  -44.728 -6.363  1.00 23.69  ?  449 LEU B CD1   1 
ATOM   7180  C  CD2   . LEU B 1 449 ? 77.045  -42.839 -7.619  1.00 22.48  ?  449 LEU B CD2   1 
ATOM   7181  N  N     . ALA B 1 450 ? 79.213  -46.255 -11.378 1.00 33.94  ?  450 ALA B N     1 
ATOM   7182  C  CA    . ALA B 1 450 ? 80.316  -46.634 -12.236 1.00 31.49  ?  450 ALA B CA    1 
ATOM   7183  C  C     . ALA B 1 450 ? 80.034  -46.031 -13.596 1.00 37.50  ?  450 ALA B C     1 
ATOM   7184  O  O     . ALA B 1 450 ? 80.918  -45.446 -14.219 1.00 39.28  ?  450 ALA B O     1 
ATOM   7185  C  CB    . ALA B 1 450 ? 80.426  -48.133 -12.321 1.00 30.29  ?  450 ALA B CB    1 
ATOM   7186  N  N     . ALA B 1 451 ? 78.782  -46.151 -14.033 1.00 39.34  ?  451 ALA B N     1 
ATOM   7187  C  CA    . ALA B 1 451 ? 78.345  -45.597 -15.312 1.00 36.67  ?  451 ALA B CA    1 
ATOM   7188  C  C     . ALA B 1 451 ? 78.575  -44.093 -15.412 1.00 36.15  ?  451 ALA B C     1 
ATOM   7189  O  O     . ALA B 1 451 ? 79.051  -43.611 -16.424 1.00 38.10  ?  451 ALA B O     1 
ATOM   7190  C  CB    . ALA B 1 451 ? 76.889  -45.925 -15.557 1.00 32.64  ?  451 ALA B CB    1 
ATOM   7191  N  N     . ILE B 1 452 ? 78.232  -43.352 -14.364 1.00 37.20  ?  452 ILE B N     1 
ATOM   7192  C  CA    . ILE B 1 452 ? 78.534  -41.928 -14.306 1.00 28.96  ?  452 ILE B CA    1 
ATOM   7193  C  C     . ILE B 1 452 ? 80.028  -41.702 -14.464 1.00 40.57  ?  452 ILE B C     1 
ATOM   7194  O  O     . ILE B 1 452 ? 80.467  -40.843 -15.228 1.00 41.48  ?  452 ILE B O     1 
ATOM   7195  C  CB    . ILE B 1 452 ? 78.103  -41.307 -12.971 1.00 27.23  ?  452 ILE B CB    1 
ATOM   7196  C  CG1   . ILE B 1 452 ? 76.590  -41.221 -12.891 1.00 27.93  ?  452 ILE B CG1   1 
ATOM   7197  C  CG2   . ILE B 1 452 ? 78.690  -39.914 -12.823 1.00 35.60  ?  452 ILE B CG2   1 
ATOM   7198  C  CD1   . ILE B 1 452 ? 76.068  -40.958 -11.511 1.00 26.71  ?  452 ILE B CD1   1 
ATOM   7199  N  N     . ILE B 1 453 ? 80.810  -42.474 -13.728 1.00 27.84  ?  453 ILE B N     1 
ATOM   7200  C  CA    . ILE B 1 453 ? 82.240  -42.261 -13.674 1.00 35.43  ?  453 ILE B CA    1 
ATOM   7201  C  C     . ILE B 1 453 ? 82.905  -42.526 -15.018 1.00 41.42  ?  453 ILE B C     1 
ATOM   7202  O  O     . ILE B 1 453 ? 83.833  -41.818 -15.418 1.00 45.00  ?  453 ILE B O     1 
ATOM   7203  C  CB    . ILE B 1 453 ? 82.860  -43.159 -12.607 1.00 33.22  ?  453 ILE B CB    1 
ATOM   7204  C  CG1   . ILE B 1 453 ? 82.511  -42.621 -11.220 1.00 31.32  ?  453 ILE B CG1   1 
ATOM   7205  C  CG2   . ILE B 1 453 ? 84.364  -43.269 -12.791 1.00 28.09  ?  453 ILE B CG2   1 
ATOM   7206  C  CD1   . ILE B 1 453 ? 82.675  -43.644 -10.132 1.00 35.10  ?  453 ILE B CD1   1 
ATOM   7207  N  N     . GLY B 1 454 ? 82.421  -43.539 -15.722 1.00 31.81  ?  454 GLY B N     1 
ATOM   7208  C  CA    . GLY B 1 454 ? 83.061  -43.961 -16.951 1.00 40.93  ?  454 GLY B CA    1 
ATOM   7209  C  C     . GLY B 1 454 ? 82.362  -43.586 -18.244 1.00 44.20  ?  454 GLY B C     1 
ATOM   7210  O  O     . GLY B 1 454 ? 82.606  -44.223 -19.263 1.00 49.14  ?  454 GLY B O     1 
ATOM   7211  N  N     . ASP B 1 455 ? 81.515  -42.557 -18.218 1.00 41.92  ?  455 ASP B N     1 
ATOM   7212  C  CA    . ASP B 1 455 ? 80.846  -42.084 -19.433 1.00 50.34  ?  455 ASP B CA    1 
ATOM   7213  C  C     . ASP B 1 455 ? 80.394  -40.616 -19.366 1.00 55.96  ?  455 ASP B C     1 
ATOM   7214  O  O     . ASP B 1 455 ? 79.358  -40.302 -18.781 1.00 53.03  ?  455 ASP B O     1 
ATOM   7215  C  CB    . ASP B 1 455 ? 79.668  -43.000 -19.811 1.00 52.12  ?  455 ASP B CB    1 
ATOM   7216  C  CG    . ASP B 1 455 ? 78.959  -42.565 -21.111 1.00 61.82  ?  455 ASP B CG    1 
ATOM   7217  O  OD1   . ASP B 1 455 ? 79.636  -42.216 -22.115 1.00 70.32  ?  455 ASP B OD1   1 
ATOM   7218  O  OD2   . ASP B 1 455 ? 77.709  -42.574 -21.125 1.00 62.05  ?  455 ASP B OD2   1 
ATOM   7219  N  N     . GLU B 1 456 ? 81.162  -39.735 -20.010 1.00 48.45  ?  456 GLU B N     1 
ATOM   7220  C  CA    . GLU B 1 456 ? 80.849  -38.307 -20.077 1.00 45.75  ?  456 GLU B CA    1 
ATOM   7221  C  C     . GLU B 1 456 ? 79.389  -38.011 -20.414 1.00 44.43  ?  456 GLU B C     1 
ATOM   7222  O  O     . GLU B 1 456 ? 78.784  -37.131 -19.808 1.00 47.35  ?  456 GLU B O     1 
ATOM   7223  C  CB    . GLU B 1 456 ? 81.767  -37.598 -21.072 1.00 48.50  ?  456 GLU B CB    1 
ATOM   7224  C  CG    . GLU B 1 456 ? 83.251  -37.792 -20.775 1.00 56.55  ?  456 GLU B CG    1 
ATOM   7225  C  CD    . GLU B 1 456 ? 83.726  -37.005 -19.561 1.00 60.73  ?  456 GLU B CD    1 
ATOM   7226  O  OE1   . GLU B 1 456 ? 83.265  -35.851 -19.379 1.00 63.43  ?  456 GLU B OE1   1 
ATOM   7227  O  OE2   . GLU B 1 456 ? 84.562  -37.537 -18.790 1.00 58.11  ?  456 GLU B OE2   1 
ATOM   7228  N  N     . ARG B 1 457 ? 78.812  -38.723 -21.375 1.00 41.68  ?  457 ARG B N     1 
ATOM   7229  C  CA    . ARG B 1 457 ? 77.403  -38.473 -21.683 1.00 41.97  ?  457 ARG B CA    1 
ATOM   7230  C  C     . ARG B 1 457 ? 76.507  -38.762 -20.467 1.00 46.09  ?  457 ARG B C     1 
ATOM   7231  O  O     . ARG B 1 457 ? 75.620  -37.980 -20.133 1.00 48.20  ?  457 ARG B O     1 
ATOM   7232  C  CB    . ARG B 1 457 ? 76.925  -39.238 -22.936 1.00 40.68  ?  457 ARG B CB    1 
ATOM   7233  N  N     . THR B 1 458 ? 76.741  -39.883 -19.801 1.00 26.29  ?  458 THR B N     1 
ATOM   7234  C  CA    . THR B 1 458 ? 75.962  -40.208 -18.616 1.00 33.50  ?  458 THR B CA    1 
ATOM   7235  C  C     . THR B 1 458 ? 76.155  -39.190 -17.465 1.00 33.76  ?  458 THR B C     1 
ATOM   7236  O  O     . THR B 1 458 ? 75.196  -38.808 -16.787 1.00 25.82  ?  458 THR B O     1 
ATOM   7237  C  CB    . THR B 1 458 ? 76.263  -41.622 -18.161 1.00 29.18  ?  458 THR B CB    1 
ATOM   7238  O  OG1   . THR B 1 458 ? 75.617  -42.526 -19.056 1.00 28.67  ?  458 THR B OG1   1 
ATOM   7239  C  CG2   . THR B 1 458 ? 75.733  -41.843 -16.776 1.00 29.95  ?  458 THR B CG2   1 
ATOM   7240  N  N     . MET B 1 459 ? 77.391  -38.740 -17.267 1.00 31.65  ?  459 MET B N     1 
ATOM   7241  C  CA    . MET B 1 459 ? 77.678  -37.698 -16.290 1.00 28.76  ?  459 MET B CA    1 
ATOM   7242  C  C     . MET B 1 459 ? 77.016  -36.341 -16.612 1.00 34.88  ?  459 MET B C     1 
ATOM   7243  O  O     . MET B 1 459 ? 76.512  -35.678 -15.723 1.00 40.22  ?  459 MET B O     1 
ATOM   7244  C  CB    . MET B 1 459 ? 79.192  -37.565 -16.091 1.00 33.69  ?  459 MET B CB    1 
ATOM   7245  C  CG    . MET B 1 459 ? 79.628  -36.393 -15.211 1.00 23.06  ?  459 MET B CG    1 
ATOM   7246  S  SD    . MET B 1 459 ? 79.448  -34.796 -16.018 1.00 50.74  ?  459 MET B SD    1 
ATOM   7247  C  CE    . MET B 1 459 ? 80.494  -35.065 -17.445 1.00 34.57  ?  459 MET B CE    1 
ATOM   7248  N  N     . TYR B 1 460 ? 77.009  -35.921 -17.870 1.00 37.65  ?  460 TYR B N     1 
ATOM   7249  C  CA    . TYR B 1 460 ? 76.349  -34.662 -18.215 1.00 36.95  ?  460 TYR B CA    1 
ATOM   7250  C  C     . TYR B 1 460 ? 74.838  -34.768 -18.078 1.00 40.55  ?  460 TYR B C     1 
ATOM   7251  O  O     . TYR B 1 460 ? 74.157  -33.784 -17.816 1.00 45.59  ?  460 TYR B O     1 
ATOM   7252  C  CB    . TYR B 1 460 ? 76.707  -34.197 -19.631 1.00 31.78  ?  460 TYR B CB    1 
ATOM   7253  C  CG    . TYR B 1 460 ? 78.090  -33.605 -19.734 1.00 34.12  ?  460 TYR B CG    1 
ATOM   7254  C  CD1   . TYR B 1 460 ? 78.436  -32.486 -19.000 1.00 42.20  ?  460 TYR B CD1   1 
ATOM   7255  C  CD2   . TYR B 1 460 ? 79.053  -34.164 -20.563 1.00 30.88  ?  460 TYR B CD2   1 
ATOM   7256  C  CE1   . TYR B 1 460 ? 79.707  -31.939 -19.086 1.00 43.84  ?  460 TYR B CE1   1 
ATOM   7257  C  CE2   . TYR B 1 460 ? 80.323  -33.619 -20.650 1.00 32.82  ?  460 TYR B CE2   1 
ATOM   7258  C  CZ    . TYR B 1 460 ? 80.644  -32.507 -19.910 1.00 37.39  ?  460 TYR B CZ    1 
ATOM   7259  O  OH    . TYR B 1 460 ? 81.906  -31.960 -19.971 1.00 36.33  ?  460 TYR B OH    1 
ATOM   7260  N  N     . ASN B 1 461 ? 74.305  -35.964 -18.269 1.00 35.46  ?  461 ASN B N     1 
ATOM   7261  C  CA    . ASN B 1 461 ? 72.866  -36.139 -18.209 1.00 34.53  ?  461 ASN B CA    1 
ATOM   7262  C  C     . ASN B 1 461 ? 72.392  -36.056 -16.789 1.00 34.96  ?  461 ASN B C     1 
ATOM   7263  O  O     . ASN B 1 461 ? 71.272  -35.635 -16.522 1.00 37.76  ?  461 ASN B O     1 
ATOM   7264  C  CB    . ASN B 1 461 ? 72.446  -37.457 -18.849 1.00 39.83  ?  461 ASN B CB    1 
ATOM   7265  C  CG    . ASN B 1 461 ? 72.276  -37.333 -20.346 1.00 46.56  ?  461 ASN B CG    1 
ATOM   7266  O  OD1   . ASN B 1 461 ? 72.867  -36.456 -20.978 1.00 44.90  ?  461 ASN B OD1   1 
ATOM   7267  N  ND2   . ASN B 1 461 ? 71.436  -38.176 -20.916 1.00 55.66  ?  461 ASN B ND2   1 
ATOM   7268  N  N     . LEU B 1 462 ? 73.272  -36.456 -15.882 1.00 37.25  ?  462 LEU B N     1 
ATOM   7269  C  CA    . LEU B 1 462 ? 73.065  -36.275 -14.453 1.00 38.37  ?  462 LEU B CA    1 
ATOM   7270  C  C     . LEU B 1 462 ? 73.056  -34.788 -14.133 1.00 33.72  ?  462 LEU B C     1 
ATOM   7271  O  O     . LEU B 1 462 ? 72.158  -34.292 -13.457 1.00 31.79  ?  462 LEU B O     1 
ATOM   7272  C  CB    . LEU B 1 462 ? 74.212  -36.924 -13.689 1.00 41.36  ?  462 LEU B CB    1 
ATOM   7273  C  CG    . LEU B 1 462 ? 73.825  -37.648 -12.414 1.00 25.75  ?  462 LEU B CG    1 
ATOM   7274  C  CD1   . LEU B 1 462 ? 74.739  -37.214 -11.307 1.00 24.42  ?  462 LEU B CD1   1 
ATOM   7275  C  CD2   . LEU B 1 462 ? 72.372  -37.333 -12.131 1.00 30.85  ?  462 LEU B CD2   1 
ATOM   7276  N  N     . MET B 1 463 ? 74.081  -34.096 -14.627 1.00 30.47  ?  463 MET B N     1 
ATOM   7277  C  CA    . MET B 1 463 ? 74.252  -32.659 -14.459 1.00 29.16  ?  463 MET B CA    1 
ATOM   7278  C  C     . MET B 1 463 ? 73.024  -31.903 -14.983 1.00 37.12  ?  463 MET B C     1 
ATOM   7279  O  O     . MET B 1 463 ? 72.607  -30.892 -14.415 1.00 46.23  ?  463 MET B O     1 
ATOM   7280  C  CB    . MET B 1 463 ? 75.552  -32.222 -15.150 1.00 28.89  ?  463 MET B CB    1 
ATOM   7281  C  CG    . MET B 1 463 ? 75.797  -30.736 -15.283 1.00 22.88  ?  463 MET B CG    1 
ATOM   7282  S  SD    . MET B 1 463 ? 77.571  -30.499 -15.552 1.00 37.52  ?  463 MET B SD    1 
ATOM   7283  C  CE    . MET B 1 463 ? 77.540  -29.018 -16.547 1.00 46.22  ?  463 MET B CE    1 
ATOM   7284  N  N     . LYS B 1 464 ? 72.425  -32.403 -16.056 1.00 35.18  ?  464 LYS B N     1 
ATOM   7285  C  CA    . LYS B 1 464 ? 71.225  -31.772 -16.561 1.00 33.10  ?  464 LYS B CA    1 
ATOM   7286  C  C     . LYS B 1 464 ? 70.013  -32.106 -15.682 1.00 28.51  ?  464 LYS B C     1 
ATOM   7287  O  O     . LYS B 1 464 ? 69.278  -31.201 -15.323 1.00 35.52  ?  464 LYS B O     1 
ATOM   7288  C  CB    . LYS B 1 464 ? 70.995  -32.105 -18.042 1.00 35.40  ?  464 LYS B CB    1 
ATOM   7289  C  CG    . LYS B 1 464 ? 71.711  -31.183 -19.032 1.00 28.02  ?  464 LYS B CG    1 
ATOM   7290  C  CD    . LYS B 1 464 ? 71.910  -31.872 -20.385 1.00 48.99  ?  464 LYS B CD    1 
ATOM   7291  C  CE    . LYS B 1 464 ? 70.691  -32.722 -20.758 1.00 50.90  ?  464 LYS B CE    1 
ATOM   7292  N  NZ    . LYS B 1 464 ? 70.959  -33.640 -21.892 1.00 32.36  ?  464 LYS B NZ    1 
ATOM   7293  N  N     . LYS B 1 465 ? 69.812  -33.378 -15.324 1.00 31.72  ?  465 LYS B N     1 
ATOM   7294  C  CA    . LYS B 1 465 ? 68.715  -33.755 -14.413 1.00 34.00  ?  465 LYS B CA    1 
ATOM   7295  C  C     . LYS B 1 465 ? 68.713  -32.867 -13.192 1.00 40.14  ?  465 LYS B C     1 
ATOM   7296  O  O     . LYS B 1 465 ? 67.667  -32.386 -12.754 1.00 44.13  ?  465 LYS B O     1 
ATOM   7297  C  CB    . LYS B 1 465 ? 68.814  -35.210 -13.922 1.00 35.89  ?  465 LYS B CB    1 
ATOM   7298  C  CG    . LYS B 1 465 ? 67.550  -35.706 -13.175 1.00 43.01  ?  465 LYS B CG    1 
ATOM   7299  C  CD    . LYS B 1 465 ? 67.709  -37.085 -12.473 1.00 34.21  ?  465 LYS B CD    1 
ATOM   7300  N  N     . GLU B 1 466 ? 69.903  -32.660 -12.639 1.00 38.68  ?  466 GLU B N     1 
ATOM   7301  C  CA    . GLU B 1 466 ? 70.041  -31.968 -11.383 1.00 39.43  ?  466 GLU B CA    1 
ATOM   7302  C  C     . GLU B 1 466 ? 69.764  -30.469 -11.507 1.00 38.41  ?  466 GLU B C     1 
ATOM   7303  O  O     . GLU B 1 466 ? 69.026  -29.895 -10.703 1.00 41.72  ?  466 GLU B O     1 
ATOM   7304  C  CB    . GLU B 1 466 ? 71.418  -32.254 -10.785 1.00 45.36  ?  466 GLU B CB    1 
ATOM   7305  C  CG    . GLU B 1 466 ? 71.543  -33.648 -10.121 1.00 52.10  ?  466 GLU B CG    1 
ATOM   7306  C  CD    . GLU B 1 466 ? 72.904  -33.895 -9.426  1.00 55.83  ?  466 GLU B CD    1 
ATOM   7307  O  OE1   . GLU B 1 466 ? 73.644  -32.920 -9.129  1.00 50.63  ?  466 GLU B OE1   1 
ATOM   7308  O  OE2   . GLU B 1 466 ? 73.227  -35.080 -9.167  1.00 60.59  ?  466 GLU B OE2   1 
ATOM   7309  N  N     . LEU B 1 467 ? 70.337  -29.831 -12.515 1.00 37.11  ?  467 LEU B N     1 
ATOM   7310  C  CA    . LEU B 1 467 ? 70.104  -28.409 -12.710 1.00 39.28  ?  467 LEU B CA    1 
ATOM   7311  C  C     . LEU B 1 467 ? 68.628  -28.132 -12.890 1.00 46.05  ?  467 LEU B C     1 
ATOM   7312  O  O     . LEU B 1 467 ? 68.130  -27.076 -12.486 1.00 52.09  ?  467 LEU B O     1 
ATOM   7313  C  CB    . LEU B 1 467 ? 70.859  -27.904 -13.926 1.00 33.67  ?  467 LEU B CB    1 
ATOM   7314  C  CG    . LEU B 1 467 ? 72.350  -27.698 -13.733 1.00 32.22  ?  467 LEU B CG    1 
ATOM   7315  C  CD1   . LEU B 1 467 ? 73.019  -27.550 -15.084 1.00 33.09  ?  467 LEU B CD1   1 
ATOM   7316  C  CD2   . LEU B 1 467 ? 72.608  -26.490 -12.841 1.00 31.19  ?  467 LEU B CD2   1 
ATOM   7317  N  N     . ARG B 1 468 ? 67.922  -29.074 -13.508 1.00 40.63  ?  468 ARG B N     1 
ATOM   7318  C  CA    . ARG B 1 468 ? 66.508  -28.863 -13.774 1.00 38.16  ?  468 ARG B CA    1 
ATOM   7319  C  C     . ARG B 1 468 ? 65.676  -28.971 -12.500 1.00 44.19  ?  468 ARG B C     1 
ATOM   7320  O  O     . ARG B 1 468 ? 64.749  -28.181 -12.295 1.00 49.27  ?  468 ARG B O     1 
ATOM   7321  C  CB    . ARG B 1 468 ? 65.993  -29.811 -14.844 1.00 37.19  ?  468 ARG B CB    1 
ATOM   7322  C  CG    . ARG B 1 468 ? 66.531  -29.564 -16.225 1.00 37.28  ?  468 ARG B CG    1 
ATOM   7323  C  CD    . ARG B 1 468 ? 65.693  -30.354 -17.227 1.00 50.06  ?  468 ARG B CD    1 
ATOM   7324  N  NE    . ARG B 1 468 ? 66.313  -30.428 -18.549 1.00 58.27  ?  468 ARG B NE    1 
ATOM   7325  C  CZ    . ARG B 1 468 ? 67.024  -31.470 -18.967 1.00 60.58  ?  468 ARG B CZ    1 
ATOM   7326  N  NH1   . ARG B 1 468 ? 67.196  -32.522 -18.162 1.00 55.82  ?  468 ARG B NH1   1 
ATOM   7327  N  NH2   . ARG B 1 468 ? 67.558  -31.463 -20.185 1.00 63.69  ?  468 ARG B NH2   1 
ATOM   7328  N  N     . GLU B 1 469 ? 66.015  -29.942 -11.652 1.00 44.34  ?  469 GLU B N     1 
ATOM   7329  C  CA    . GLU B 1 469 ? 65.453  -30.040 -10.303 1.00 46.10  ?  469 GLU B CA    1 
ATOM   7330  C  C     . GLU B 1 469 ? 65.578  -28.718 -9.524  1.00 37.84  ?  469 GLU B C     1 
ATOM   7331  O  O     . GLU B 1 469 ? 64.600  -28.256 -8.922  1.00 37.52  ?  469 GLU B O     1 
ATOM   7332  C  CB    . GLU B 1 469 ? 66.094  -31.203 -9.534  1.00 54.17  ?  469 GLU B CB    1 
ATOM   7333  C  CG    . GLU B 1 469 ? 65.509  -32.585 -9.907  1.00 67.58  ?  469 GLU B CG    1 
ATOM   7334  C  CD    . GLU B 1 469 ? 66.337  -33.788 -9.410  1.00 74.04  ?  469 GLU B CD    1 
ATOM   7335  O  OE1   . GLU B 1 469 ? 67.354  -33.593 -8.700  1.00 73.50  ?  469 GLU B OE1   1 
ATOM   7336  O  OE2   . GLU B 1 469 ? 65.963  -34.940 -9.745  1.00 77.72  ?  469 GLU B OE2   1 
ATOM   7337  N  N     . VAL B 1 470 ? 66.771  -28.115 -9.550  1.00 32.65  ?  470 VAL B N     1 
ATOM   7338  C  CA    . VAL B 1 470 ? 67.003  -26.821 -8.915  1.00 33.25  ?  470 VAL B CA    1 
ATOM   7339  C  C     . VAL B 1 470 ? 66.132  -25.714 -9.517  1.00 38.68  ?  470 VAL B C     1 
ATOM   7340  O  O     . VAL B 1 470 ? 65.551  -24.904 -8.790  1.00 39.82  ?  470 VAL B O     1 
ATOM   7341  C  CB    . VAL B 1 470 ? 68.501  -26.425 -8.947  1.00 31.00  ?  470 VAL B CB    1 
ATOM   7342  C  CG1   . VAL B 1 470 ? 68.680  -24.923 -8.770  1.00 26.28  ?  470 VAL B CG1   1 
ATOM   7343  C  CG2   . VAL B 1 470 ? 69.247  -27.151 -7.869  1.00 33.65  ?  470 VAL B CG2   1 
ATOM   7344  N  N     . LYS B 1 471 ? 66.043  -25.679 -10.845 1.00 38.78  ?  471 LYS B N     1 
ATOM   7345  C  CA    . LYS B 1 471 ? 65.143  -24.746 -11.509 1.00 38.05  ?  471 LYS B CA    1 
ATOM   7346  C  C     . LYS B 1 471 ? 63.707  -24.967 -11.038 1.00 45.99  ?  471 LYS B C     1 
ATOM   7347  O  O     . LYS B 1 471 ? 63.046  -24.025 -10.628 1.00 46.32  ?  471 LYS B O     1 
ATOM   7348  C  CB    . LYS B 1 471 ? 65.251  -24.857 -13.035 1.00 31.13  ?  471 LYS B CB    1 
ATOM   7349  C  CG    . LYS B 1 471 ? 64.111  -24.186 -13.812 1.00 38.55  ?  471 LYS B CG    1 
ATOM   7350  C  CD    . LYS B 1 471 ? 64.500  -23.902 -15.264 1.00 37.48  ?  471 LYS B CD    1 
ATOM   7351  C  CE    . LYS B 1 471 ? 63.431  -24.348 -16.273 1.00 44.72  ?  471 LYS B CE    1 
ATOM   7352  N  NZ    . LYS B 1 471 ? 63.561  -25.801 -16.684 1.00 49.08  ?  471 LYS B NZ    1 
ATOM   7353  N  N     . LYS B 1 472 ? 63.226  -26.209 -11.075 1.00 53.46  ?  472 LYS B N     1 
ATOM   7354  C  CA    . LYS B 1 472 ? 61.838  -26.458 -10.695 1.00 36.78  ?  472 LYS B CA    1 
ATOM   7355  C  C     . LYS B 1 472 ? 61.622  -25.947 -9.308  1.00 43.85  ?  472 LYS B C     1 
ATOM   7356  O  O     . LYS B 1 472 ? 60.566  -25.421 -9.002  1.00 48.24  ?  472 LYS B O     1 
ATOM   7357  C  CB    . LYS B 1 472 ? 61.441  -27.936 -10.741 1.00 38.40  ?  472 LYS B CB    1 
ATOM   7358  C  CG    . LYS B 1 472 ? 59.925  -28.144 -10.594 1.00 41.38  ?  472 LYS B CG    1 
ATOM   7359  C  CD    . LYS B 1 472 ? 59.446  -29.565 -10.896 1.00 43.43  ?  472 LYS B CD    1 
ATOM   7360  N  N     . LYS B 1 473 ? 62.636  -26.089 -8.466  1.00 44.26  ?  473 LYS B N     1 
ATOM   7361  C  CA    . LYS B 1 473 ? 62.461  -25.822 -7.042  1.00 45.29  ?  473 LYS B CA    1 
ATOM   7362  C  C     . LYS B 1 473 ? 62.564  -24.347 -6.652  1.00 40.55  ?  473 LYS B C     1 
ATOM   7363  O  O     . LYS B 1 473 ? 61.846  -23.901 -5.767  1.00 35.91  ?  473 LYS B O     1 
ATOM   7364  C  CB    . LYS B 1 473 ? 63.425  -26.667 -6.202  1.00 45.09  ?  473 LYS B CB    1 
ATOM   7365  C  CG    . LYS B 1 473 ? 63.246  -26.461 -4.707  1.00 51.54  ?  473 LYS B CG    1 
ATOM   7366  C  CD    . LYS B 1 473 ? 64.057  -27.440 -3.871  1.00 57.60  ?  473 LYS B CD    1 
ATOM   7367  C  CE    . LYS B 1 473 ? 63.686  -27.323 -2.391  1.00 64.79  ?  473 LYS B CE    1 
ATOM   7368  N  NZ    . LYS B 1 473 ? 64.589  -28.134 -1.515  1.00 70.75  ?  473 LYS B NZ    1 
ATOM   7369  N  N     . PHE B 1 474 ? 63.448  -23.594 -7.303  1.00 35.80  ?  474 PHE B N     1 
ATOM   7370  C  CA    . PHE B 1 474 ? 63.711  -22.223 -6.882  1.00 38.29  ?  474 PHE B CA    1 
ATOM   7371  C  C     . PHE B 1 474 ? 63.370  -21.173 -7.938  1.00 42.19  ?  474 PHE B C     1 
ATOM   7372  O  O     . PHE B 1 474 ? 63.571  -19.965 -7.731  1.00 41.97  ?  474 PHE B O     1 
ATOM   7373  C  CB    . PHE B 1 474 ? 65.175  -22.075 -6.472  1.00 36.04  ?  474 PHE B CB    1 
ATOM   7374  C  CG    . PHE B 1 474 ? 65.605  -23.028 -5.397  1.00 38.19  ?  474 PHE B CG    1 
ATOM   7375  C  CD1   . PHE B 1 474 ? 65.417  -22.719 -4.062  1.00 30.88  ?  474 PHE B CD1   1 
ATOM   7376  C  CD2   . PHE B 1 474 ? 66.208  -24.229 -5.719  1.00 43.59  ?  474 PHE B CD2   1 
ATOM   7377  C  CE1   . PHE B 1 474 ? 65.810  -23.587 -3.066  1.00 35.12  ?  474 PHE B CE1   1 
ATOM   7378  C  CE2   . PHE B 1 474 ? 66.611  -25.104 -4.723  1.00 47.18  ?  474 PHE B CE2   1 
ATOM   7379  C  CZ    . PHE B 1 474 ? 66.406  -24.777 -3.391  1.00 41.54  ?  474 PHE B CZ    1 
ATOM   7380  N  N     . ALA B 1 475 ? 62.857  -21.636 -9.070  1.00 42.90  ?  475 ALA B N     1 
ATOM   7381  C  CA    . ALA B 1 475 ? 62.576  -20.761 -10.201 1.00 39.10  ?  475 ALA B CA    1 
ATOM   7382  C  C     . ALA B 1 475 ? 61.559  -19.701 -9.833  1.00 38.33  ?  475 ALA B C     1 
ATOM   7383  O  O     . ALA B 1 475 ? 60.570  -19.975 -9.154  1.00 38.83  ?  475 ALA B O     1 
ATOM   7384  C  CB    . ALA B 1 475 ? 62.078  -21.573 -11.387 1.00 40.94  ?  475 ALA B CB    1 
ATOM   7385  N  N     . THR B 1 476 ? 61.804  -18.480 -10.284 1.00 39.55  ?  476 THR B N     1 
ATOM   7386  C  CA    . THR B 1 476 ? 60.823  -17.421 -10.098 1.00 42.62  ?  476 THR B CA    1 
ATOM   7387  C  C     . THR B 1 476 ? 60.782  -16.511 -11.314 1.00 48.16  ?  476 THR B C     1 
ATOM   7388  O  O     . THR B 1 476 ? 61.739  -16.448 -12.092 1.00 51.75  ?  476 THR B O     1 
ATOM   7389  C  CB    . THR B 1 476 ? 61.066  -16.607 -8.797  1.00 36.68  ?  476 THR B CB    1 
ATOM   7390  O  OG1   . THR B 1 476 ? 62.329  -15.930 -8.859  1.00 40.82  ?  476 THR B OG1   1 
ATOM   7391  C  CG2   . THR B 1 476 ? 61.105  -17.526 -7.637  1.00 34.14  ?  476 THR B CG2   1 
ATOM   7392  N  N     . PRO B 1 477 ? 59.662  -15.804 -11.475 1.00 47.65  ?  477 PRO B N     1 
ATOM   7393  C  CA    . PRO B 1 477 ? 59.361  -14.886 -12.573 1.00 48.68  ?  477 PRO B CA    1 
ATOM   7394  C  C     . PRO B 1 477 ? 60.373  -13.741 -12.709 1.00 49.94  ?  477 PRO B C     1 
ATOM   7395  O  O     . PRO B 1 477 ? 60.955  -13.308 -11.716 1.00 50.85  ?  477 PRO B O     1 
ATOM   7396  C  CB    . PRO B 1 477 ? 57.995  -14.330 -12.174 1.00 47.77  ?  477 PRO B CB    1 
ATOM   7397  C  CG    . PRO B 1 477 ? 57.412  -15.359 -11.255 1.00 44.83  ?  477 PRO B CG    1 
ATOM   7398  C  CD    . PRO B 1 477 ? 58.567  -15.867 -10.491 1.00 46.48  ?  477 PRO B CD    1 
ATOM   7399  N  N     . ARG B 1 478 ? 60.574  -13.259 -13.934 1.00 49.67  ?  478 ARG B N     1 
ATOM   7400  C  CA    . ARG B 1 478 ? 61.391  -12.078 -14.165 1.00 42.21  ?  478 ARG B CA    1 
ATOM   7401  C  C     . ARG B 1 478 ? 60.835  -10.930 -13.371 1.00 41.20  ?  478 ARG B C     1 
ATOM   7402  O  O     . ARG B 1 478 ? 59.630  -10.850 -13.140 1.00 46.11  ?  478 ARG B O     1 
ATOM   7403  C  CB    . ARG B 1 478 ? 61.361  -11.661 -15.629 1.00 35.94  ?  478 ARG B CB    1 
ATOM   7404  C  CG    . ARG B 1 478 ? 62.459  -12.245 -16.462 1.00 52.94  ?  478 ARG B CG    1 
ATOM   7405  C  CD    . ARG B 1 478 ? 62.675  -11.425 -17.694 1.00 36.35  ?  478 ARG B CD    1 
ATOM   7406  N  NE    . ARG B 1 478 ? 63.731  -10.456 -17.496 1.00 35.81  ?  478 ARG B NE    1 
ATOM   7407  C  CZ    . ARG B 1 478 ? 65.007  -10.721 -17.730 1.00 48.54  ?  478 ARG B CZ    1 
ATOM   7408  N  NH1   . ARG B 1 478 ? 65.350  -11.925 -18.161 1.00 42.67  ?  478 ARG B NH1   1 
ATOM   7409  N  NH2   . ARG B 1 478 ? 65.938  -9.793  -17.529 1.00 51.31  ?  478 ARG B NH2   1 
ATOM   7410  N  N     . LEU B 1 479 ? 61.713  -10.025 -12.972 1.00 37.14  ?  479 LEU B N     1 
ATOM   7411  C  CA    . LEU B 1 479 ? 61.279  -8.816  -12.301 1.00 38.28  ?  479 LEU B CA    1 
ATOM   7412  C  C     . LEU B 1 479 ? 61.535  -7.642  -13.221 1.00 42.25  ?  479 LEU B C     1 
ATOM   7413  O  O     . LEU B 1 479 ? 60.681  -6.783  -13.392 1.00 46.94  ?  479 LEU B O     1 
ATOM   7414  C  CB    . LEU B 1 479 ? 62.018  -8.649  -10.976 1.00 38.67  ?  479 LEU B CB    1 
ATOM   7415  C  CG    . LEU B 1 479 ? 61.819  -9.809  -10.008 1.00 32.82  ?  479 LEU B CG    1 
ATOM   7416  C  CD1   . LEU B 1 479 ? 62.646  -9.610  -8.739  1.00 43.27  ?  479 LEU B CD1   1 
ATOM   7417  C  CD2   . LEU B 1 479 ? 60.357  -9.926  -9.683  1.00 39.05  ?  479 LEU B CD2   1 
ATOM   7418  N  N     . SER B 1 480 ? 62.721  -7.629  -13.817 1.00 41.55  ?  480 SER B N     1 
ATOM   7419  C  CA    . SER B 1 480 ? 63.101  -6.615  -14.786 1.00 42.21  ?  480 SER B CA    1 
ATOM   7420  C  C     . SER B 1 480 ? 62.625  -6.991  -16.194 1.00 42.96  ?  480 SER B C     1 
ATOM   7421  O  O     . SER B 1 480 ? 62.862  -8.106  -16.665 1.00 40.22  ?  480 SER B O     1 
ATOM   7422  C  CB    . SER B 1 480 ? 64.620  -6.444  -14.782 1.00 40.77  ?  480 SER B CB    1 
ATOM   7423  O  OG    . SER B 1 480 ? 65.103  -6.136  -13.494 1.00 33.92  ?  480 SER B OG    1 
ATOM   7424  N  N     . SER B 1 481 ? 61.955  -6.055  -16.861 1.00 44.39  ?  481 SER B N     1 
ATOM   7425  C  CA    . SER B 1 481 ? 61.516  -6.249  -18.244 1.00 48.17  ?  481 SER B CA    1 
ATOM   7426  C  C     . SER B 1 481 ? 62.538  -5.689  -19.241 1.00 51.84  ?  481 SER B C     1 
ATOM   7427  O  O     . SER B 1 481 ? 63.313  -4.796  -18.903 1.00 54.68  ?  481 SER B O     1 
ATOM   7428  C  CB    . SER B 1 481 ? 60.147  -5.603  -18.458 1.00 46.82  ?  481 SER B CB    1 
ATOM   7429  O  OG    . SER B 1 481 ? 60.137  -4.263  -17.998 1.00 44.34  ?  481 SER B OG    1 
ATOM   7430  N  N     . LEU B 1 482 ? 62.542  -6.208  -20.468 1.00 48.74  ?  482 LEU B N     1 
ATOM   7431  C  CA    . LEU B 1 482 ? 63.538  -5.768  -21.451 1.00 45.58  ?  482 LEU B CA    1 
ATOM   7432  C  C     . LEU B 1 482 ? 62.981  -4.984  -22.672 1.00 72.35  ?  482 LEU B C     1 
ATOM   7433  O  O     . LEU B 1 482 ? 61.797  -5.070  -22.997 1.00 72.76  ?  482 LEU B O     1 
ATOM   7434  C  CB    . LEU B 1 482 ? 64.398  -6.957  -21.889 1.00 43.10  ?  482 LEU B CB    1 
ATOM   7435  C  CG    . LEU B 1 482 ? 65.058  -7.802  -20.787 1.00 40.45  ?  482 LEU B CG    1 
ATOM   7436  C  CD1   . LEU B 1 482 ? 64.976  -9.274  -21.125 1.00 41.88  ?  482 LEU B CD1   1 
ATOM   7437  C  CD2   . LEU B 1 482 ? 66.516  -7.420  -20.583 1.00 39.38  ?  482 LEU B CD2   1 
ATOM   7438  N  N     . GLU B 1 483 ? 63.848  -4.200  -23.314 1.00 67.71  ?  483 GLU B N     1 
ATOM   7439  C  CA    . GLU B 1 483 ? 63.502  -3.394  -24.492 1.00 72.15  ?  483 GLU B CA    1 
ATOM   7440  C  C     . GLU B 1 483 ? 64.800  -3.075  -25.232 1.00 77.34  ?  483 GLU B C     1 
ATOM   7441  O  O     . GLU B 1 483 ? 65.875  -3.137  -24.633 1.00 81.61  ?  483 GLU B O     1 
ATOM   7442  C  CB    . GLU B 1 483 ? 62.868  -2.068  -24.076 1.00 74.92  ?  483 GLU B CB    1 
ATOM   7443  C  CG    . GLU B 1 483 ? 61.652  -2.149  -23.167 1.00 79.19  ?  483 GLU B CG    1 
ATOM   7444  C  CD    . GLU B 1 483 ? 61.134  -0.760  -22.745 1.00 83.80  ?  483 GLU B CD    1 
ATOM   7445  O  OE1   . GLU B 1 483 ? 61.796  0.273   -23.045 1.00 81.11  ?  483 GLU B OE1   1 
ATOM   7446  O  OE2   . GLU B 1 483 ? 60.057  -0.706  -22.105 1.00 87.22  ?  483 GLU B OE2   1 
ATOM   7447  N  N     . ASP B 1 484 ? 64.721  -2.717  -26.513 1.00 75.18  ?  484 ASP B N     1 
ATOM   7448  C  CA    . ASP B 1 484 ? 65.922  -2.255  -27.229 1.00 70.16  ?  484 ASP B CA    1 
ATOM   7449  C  C     . ASP B 1 484 ? 65.778  -0.841  -27.847 1.00 71.83  ?  484 ASP B C     1 
ATOM   7450  O  O     . ASP B 1 484 ? 66.265  0.165   -27.296 1.00 70.80  ?  484 ASP B O     1 
ATOM   7451  C  CB    . ASP B 1 484 ? 66.356  -3.283  -28.280 1.00 62.38  ?  484 ASP B CB    1 
ATOM   7452  N  N     . LYS C 2 36  ? 67.424  14.432  14.432  1.00 79.89  ?  415 LYS C N     1 
ATOM   7453  C  CA    . LYS C 2 36  ? 67.467  13.281  15.342  1.00 73.04  ?  415 LYS C CA    1 
ATOM   7454  C  C     . LYS C 2 36  ? 66.282  12.345  15.112  1.00 65.13  ?  415 LYS C C     1 
ATOM   7455  O  O     . LYS C 2 36  ? 66.463  11.133  15.063  1.00 55.18  ?  415 LYS C O     1 
ATOM   7456  C  CB    . LYS C 2 36  ? 67.526  13.732  16.813  1.00 70.88  ?  415 LYS C CB    1 
ATOM   7457  N  N     . LEU C 2 37  ? 65.089  12.927  14.941  1.00 67.98  ?  416 LEU C N     1 
ATOM   7458  C  CA    . LEU C 2 37  ? 63.825  12.187  14.774  1.00 67.45  ?  416 LEU C CA    1 
ATOM   7459  C  C     . LEU C 2 37  ? 63.318  12.032  13.329  1.00 69.24  ?  416 LEU C C     1 
ATOM   7460  O  O     . LEU C 2 37  ? 63.542  12.893  12.482  1.00 70.95  ?  416 LEU C O     1 
ATOM   7461  C  CB    . LEU C 2 37  ? 62.705  12.842  15.596  1.00 65.43  ?  416 LEU C CB    1 
ATOM   7462  C  CG    . LEU C 2 37  ? 61.411  13.183  14.834  1.00 64.33  ?  416 LEU C CG    1 
ATOM   7463  C  CD1   . LEU C 2 37  ? 60.167  12.817  15.623  1.00 62.08  ?  416 LEU C CD1   1 
ATOM   7464  C  CD2   . LEU C 2 37  ? 61.372  14.638  14.509  1.00 53.76  ?  416 LEU C CD2   1 
ATOM   7465  N  N     . THR C 2 38  ? 62.615  10.928  13.075  1.00 66.36  ?  417 THR C N     1 
ATOM   7466  C  CA    . THR C 2 38  ? 61.935  10.690  11.802  1.00 64.88  ?  417 THR C CA    1 
ATOM   7467  C  C     . THR C 2 38  ? 60.474  11.070  11.955  1.00 68.86  ?  417 THR C C     1 
ATOM   7468  O  O     . THR C 2 38  ? 59.724  10.401  12.673  1.00 72.91  ?  417 THR C O     1 
ATOM   7469  C  CB    . THR C 2 38  ? 61.974  9.203   11.383  1.00 63.82  ?  417 THR C CB    1 
ATOM   7470  O  OG1   . THR C 2 38  ? 63.330  8.763   11.237  1.00 66.82  ?  417 THR C OG1   1 
ATOM   7471  C  CG2   . THR C 2 38  ? 61.245  9.010   10.068  1.00 62.87  ?  417 THR C CG2   1 
ATOM   7472  N  N     . PRO C 2 39  ? 60.055  12.139  11.262  1.00 67.53  ?  418 PRO C N     1 
ATOM   7473  C  CA    . PRO C 2 39  ? 58.740  12.778  11.434  1.00 69.48  ?  418 PRO C CA    1 
ATOM   7474  C  C     . PRO C 2 39  ? 57.615  12.200  10.569  1.00 72.04  ?  418 PRO C C     1 
ATOM   7475  O  O     . PRO C 2 39  ? 57.864  11.484  9.594   1.00 72.53  ?  418 PRO C O     1 
ATOM   7476  C  CB    . PRO C 2 39  ? 59.019  14.212  11.014  1.00 67.78  ?  418 PRO C CB    1 
ATOM   7477  C  CG    . PRO C 2 39  ? 60.072  14.060  9.937   1.00 65.89  ?  418 PRO C CG    1 
ATOM   7478  C  CD    . PRO C 2 39  ? 60.901  12.857  10.292  1.00 64.55  ?  418 PRO C CD    1 
ATOM   7479  N  N     . ALA C 2 40  ? 56.378  12.517  10.941  1.00 72.69  ?  419 ALA C N     1 
ATOM   7480  C  CA    . ALA C 2 40  ? 55.217  12.148  10.144  1.00 73.97  ?  419 ALA C CA    1 
ATOM   7481  C  C     . ALA C 2 40  ? 55.186  12.980  8.852   1.00 74.86  ?  419 ALA C C     1 
ATOM   7482  O  O     . ALA C 2 40  ? 55.859  14.011  8.749   1.00 76.12  ?  419 ALA C O     1 
ATOM   7483  C  CB    . ALA C 2 40  ? 53.945  12.351  10.953  1.00 74.24  ?  419 ALA C CB    1 
ATOM   7484  N  N     . GLN C 2 41  ? 54.420  12.539  7.859   1.00 72.38  ?  420 GLN C N     1 
ATOM   7485  C  CA    . GLN C 2 41  ? 54.367  13.279  6.604   1.00 75.91  ?  420 GLN C CA    1 
ATOM   7486  C  C     . GLN C 2 41  ? 53.478  14.533  6.703   1.00 81.72  ?  420 GLN C C     1 
ATOM   7487  O  O     . GLN C 2 41  ? 53.861  15.609  6.246   1.00 86.01  ?  420 GLN C O     1 
ATOM   7488  C  CB    . GLN C 2 41  ? 53.939  12.369  5.451   1.00 79.14  ?  420 GLN C CB    1 
ATOM   7489  C  CG    . GLN C 2 41  ? 54.506  12.783  4.098   1.00 86.06  ?  420 GLN C CG    1 
ATOM   7490  C  CD    . GLN C 2 41  ? 54.931  11.595  3.251   1.00 92.88  ?  420 GLN C CD    1 
ATOM   7491  O  OE1   . GLN C 2 41  ? 54.250  10.564  3.207   1.00 93.03  ?  420 GLN C OE1   1 
ATOM   7492  N  NE2   . GLN C 2 41  ? 56.071  11.730  2.578   1.00 96.66  ?  420 GLN C NE2   1 
ATOM   7493  N  N     . SER C 2 42  ? 52.303  14.391  7.312   1.00 82.75  ?  421 SER C N     1 
ATOM   7494  C  CA    . SER C 2 42  ? 51.400  15.520  7.533   1.00 84.09  ?  421 SER C CA    1 
ATOM   7495  C  C     . SER C 2 42  ? 51.351  15.942  9.008   1.00 89.22  ?  421 SER C C     1 
ATOM   7496  O  O     . SER C 2 42  ? 51.297  15.094  9.904   1.00 85.07  ?  421 SER C O     1 
ATOM   7497  C  CB    . SER C 2 42  ? 49.990  15.173  7.050   1.00 81.09  ?  421 SER C CB    1 
ATOM   7498  N  N     . LYS C 2 43  ? 51.378  17.255  9.250   1.00 92.95  ?  422 LYS C N     1 
ATOM   7499  C  CA    . LYS C 2 43  ? 51.203  17.809  10.595  1.00 88.13  ?  422 LYS C CA    1 
ATOM   7500  C  C     . LYS C 2 43  ? 49.726  17.736  10.970  1.00 92.23  ?  422 LYS C C     1 
ATOM   7501  O  O     . LYS C 2 43  ? 48.883  18.288  10.277  1.00 90.75  ?  422 LYS C O     1 
ATOM   7502  C  CB    . LYS C 2 43  ? 51.708  19.256  10.668  1.00 79.94  ?  422 LYS C CB    1 
ATOM   7503  N  N     . ASN C 2 44  ? 49.414  17.041  12.059  1.00 97.07  ?  423 ASN C N     1 
ATOM   7504  C  CA    . ASN C 2 44  ? 48.023  16.788  12.430  1.00 102.06 ?  423 ASN C CA    1 
ATOM   7505  C  C     . ASN C 2 44  ? 47.833  16.435  13.908  1.00 105.19 ?  423 ASN C C     1 
ATOM   7506  O  O     . ASN C 2 44  ? 47.542  15.288  14.253  1.00 104.80 ?  423 ASN C O     1 
ATOM   7507  C  CB    . ASN C 2 44  ? 47.424  15.694  11.542  1.00 101.33 ?  423 ASN C CB    1 
ATOM   7508  C  CG    . ASN C 2 44  ? 45.995  15.355  11.924  1.00 104.08 ?  423 ASN C CG    1 
ATOM   7509  O  OD1   . ASN C 2 44  ? 45.319  16.139  12.593  1.00 104.98 ?  423 ASN C OD1   1 
ATOM   7510  N  ND2   . ASN C 2 44  ? 45.528  14.181  11.503  1.00 105.07 ?  423 ASN C ND2   1 
ATOM   7511  N  N     . PRO C 2 45  ? 48.001  17.433  14.785  1.00 106.23 ?  424 PRO C N     1 
ATOM   7512  C  CA    . PRO C 2 45  ? 47.812  17.360  16.239  1.00 106.40 ?  424 PRO C CA    1 
ATOM   7513  C  C     . PRO C 2 45  ? 46.533  16.651  16.728  1.00 107.14 ?  424 PRO C C     1 
ATOM   7514  O  O     . PRO C 2 45  ? 46.122  16.880  17.867  1.00 109.55 ?  424 PRO C O     1 
ATOM   7515  C  CB    . PRO C 2 45  ? 47.784  18.838  16.641  1.00 106.46 ?  424 PRO C CB    1 
ATOM   7516  C  CG    . PRO C 2 45  ? 48.723  19.480  15.678  1.00 104.76 ?  424 PRO C CG    1 
ATOM   7517  C  CD    . PRO C 2 45  ? 48.586  18.724  14.376  1.00 104.95 ?  424 PRO C CD    1 
ATOM   7518  N  N     . ALA C 2 46  ? 45.922  15.802  15.909  1.00 104.98 ?  425 ALA C N     1 
ATOM   7519  C  CA    . ALA C 2 46  ? 44.688  15.124  16.319  1.00 102.44 ?  425 ALA C CA    1 
ATOM   7520  C  C     . ALA C 2 46  ? 44.747  13.613  16.091  1.00 99.19  ?  425 ALA C C     1 
ATOM   7521  O  O     . ALA C 2 46  ? 44.020  12.840  16.732  1.00 97.54  ?  425 ALA C O     1 
ATOM   7522  C  CB    . ALA C 2 46  ? 43.489  15.723  15.602  1.00 102.68 ?  425 ALA C CB    1 
ATOM   7523  N  N     . LYS C 2 47  ? 45.609  13.208  15.158  1.00 95.40  ?  426 LYS C N     1 
ATOM   7524  C  CA    . LYS C 2 47  ? 45.857  11.802  14.870  1.00 87.77  ?  426 LYS C CA    1 
ATOM   7525  C  C     . LYS C 2 47  ? 47.312  11.489  15.203  1.00 86.53  ?  426 LYS C C     1 
ATOM   7526  O  O     . LYS C 2 47  ? 47.599  10.529  15.926  1.00 86.70  ?  426 LYS C O     1 
ATOM   7527  C  CB    . LYS C 2 47  ? 45.554  11.482  13.399  1.00 79.97  ?  426 LYS C CB    1 
ATOM   7528  N  N     . ASN C 2 48  ? 48.214  12.326  14.691  1.00 83.08  ?  427 ASN C N     1 
ATOM   7529  C  CA    . ASN C 2 48  ? 49.661  12.169  14.870  1.00 78.79  ?  427 ASN C CA    1 
ATOM   7530  C  C     . ASN C 2 48  ? 50.124  11.587  16.212  1.00 77.17  ?  427 ASN C C     1 
ATOM   7531  O  O     . ASN C 2 48  ? 49.702  12.037  17.279  1.00 80.68  ?  427 ASN C O     1 
ATOM   7532  C  CB    . ASN C 2 48  ? 50.370  13.501  14.617  1.00 77.80  ?  427 ASN C CB    1 
ATOM   7533  C  CG    . ASN C 2 48  ? 50.651  13.739  13.150  1.00 77.59  ?  427 ASN C CG    1 
ATOM   7534  O  OD1   . ASN C 2 48  ? 50.058  13.093  12.286  1.00 78.92  ?  427 ASN C OD1   1 
ATOM   7535  N  ND2   . ASN C 2 48  ? 51.565  14.667  12.858  1.00 76.60  ?  427 ASN C ND2   1 
ATOM   7536  N  N     . GLU C 2 49  ? 51.008  10.591  16.134  1.00 72.08  ?  428 GLU C N     1 
ATOM   7537  C  CA    . GLU C 2 49  ? 51.534  9.895   17.307  1.00 71.17  ?  428 GLU C CA    1 
ATOM   7538  C  C     . GLU C 2 49  ? 53.060  9.999   17.366  1.00 71.53  ?  428 GLU C C     1 
ATOM   7539  O  O     . GLU C 2 49  ? 53.737  9.963   16.340  1.00 73.04  ?  428 GLU C O     1 
ATOM   7540  C  CB    . GLU C 2 49  ? 51.105  8.422   17.289  1.00 70.94  ?  428 GLU C CB    1 
ATOM   7541  C  CG    . GLU C 2 49  ? 49.604  8.227   17.143  1.00 78.38  ?  428 GLU C CG    1 
ATOM   7542  C  CD    . GLU C 2 49  ? 49.195  6.771   16.959  1.00 82.39  ?  428 GLU C CD    1 
ATOM   7543  O  OE1   . GLU C 2 49  ? 50.089  5.896   16.927  1.00 79.47  ?  428 GLU C OE1   1 
ATOM   7544  O  OE2   . GLU C 2 49  ? 47.972  6.505   16.849  1.00 86.37  ?  428 GLU C OE2   1 
ATOM   7545  N  N     . LEU C 2 50  ? 53.599  10.141  18.570  1.00 69.94  ?  429 LEU C N     1 
ATOM   7546  C  CA    . LEU C 2 50  ? 55.044  10.130  18.752  1.00 68.21  ?  429 LEU C CA    1 
ATOM   7547  C  C     . LEU C 2 50  ? 55.439  8.794   19.358  1.00 67.51  ?  429 LEU C C     1 
ATOM   7548  O  O     . LEU C 2 50  ? 54.913  8.394   20.396  1.00 73.39  ?  429 LEU C O     1 
ATOM   7549  C  CB    . LEU C 2 50  ? 55.489  11.268  19.674  1.00 69.29  ?  429 LEU C CB    1 
ATOM   7550  C  CG    . LEU C 2 50  ? 56.726  12.028  19.200  1.00 66.70  ?  429 LEU C CG    1 
ATOM   7551  C  CD1   . LEU C 2 50  ? 57.656  12.340  20.348  1.00 59.83  ?  429 LEU C CD1   1 
ATOM   7552  C  CD2   . LEU C 2 50  ? 57.430  11.228  18.137  1.00 68.85  ?  429 LEU C CD2   1 
ATOM   7553  N  N     . TYR C 2 51  ? 56.345  8.086   18.699  1.00 61.98  ?  430 TYR C N     1 
ATOM   7554  C  CA    . TYR C 2 51  ? 56.846  6.840   19.243  1.00 59.00  ?  430 TYR C CA    1 
ATOM   7555  C  C     . TYR C 2 51  ? 58.232  7.061   19.817  1.00 60.62  ?  430 TYR C C     1 
ATOM   7556  O  O     . TYR C 2 51  ? 59.186  7.304   19.070  1.00 62.23  ?  430 TYR C O     1 
ATOM   7557  C  CB    . TYR C 2 51  ? 56.895  5.751   18.178  1.00 56.98  ?  430 TYR C CB    1 
ATOM   7558  C  CG    . TYR C 2 51  ? 55.598  4.985   18.031  1.00 59.13  ?  430 TYR C CG    1 
ATOM   7559  C  CD1   . TYR C 2 51  ? 55.390  3.799   18.712  1.00 60.59  ?  430 TYR C CD1   1 
ATOM   7560  C  CD2   . TYR C 2 51  ? 54.586  5.449   17.205  1.00 62.92  ?  430 TYR C CD2   1 
ATOM   7561  C  CE1   . TYR C 2 51  ? 54.214  3.102   18.576  1.00 63.60  ?  430 TYR C CE1   1 
ATOM   7562  C  CE2   . TYR C 2 51  ? 53.408  4.758   17.067  1.00 66.08  ?  430 TYR C CE2   1 
ATOM   7563  C  CZ    . TYR C 2 51  ? 53.226  3.588   17.754  1.00 67.34  ?  430 TYR C CZ    1 
ATOM   7564  O  OH    . TYR C 2 51  ? 52.046  2.899   17.611  1.00 72.26  ?  430 TYR C OH    1 
ATOM   7565  N  N     . LEU C 2 52  ? 58.332  6.992   21.145  1.00 59.78  ?  431 LEU C N     1 
ATOM   7566  C  CA    . LEU C 2 52  ? 59.622  7.000   21.814  1.00 57.44  ?  431 LEU C CA    1 
ATOM   7567  C  C     . LEU C 2 52  ? 60.150  5.573   21.899  1.00 54.70  ?  431 LEU C C     1 
ATOM   7568  O  O     . LEU C 2 52  ? 59.665  4.763   22.686  1.00 53.97  ?  431 LEU C O     1 
ATOM   7569  C  CB    . LEU C 2 52  ? 59.497  7.609   23.203  1.00 57.77  ?  431 LEU C CB    1 
ATOM   7570  C  CG    . LEU C 2 52  ? 58.896  9.009   23.177  1.00 62.18  ?  431 LEU C CG    1 
ATOM   7571  C  CD1   . LEU C 2 52  ? 58.725  9.544   24.602  1.00 65.88  ?  431 LEU C CD1   1 
ATOM   7572  C  CD2   . LEU C 2 52  ? 59.751  9.941   22.307  1.00 59.32  ?  431 LEU C CD2   1 
ATOM   7573  N  N     . VAL C 2 53  ? 61.139  5.260   21.075  1.00 53.11  ?  432 VAL C N     1 
ATOM   7574  C  CA    . VAL C 2 53  ? 61.635  3.903   21.011  1.00 53.35  ?  432 VAL C CA    1 
ATOM   7575  C  C     . VAL C 2 53  ? 62.976  3.772   21.720  1.00 57.88  ?  432 VAL C C     1 
ATOM   7576  O  O     . VAL C 2 53  ? 63.856  4.613   21.547  1.00 59.08  ?  432 VAL C O     1 
ATOM   7577  C  CB    . VAL C 2 53  ? 61.785  3.443   19.566  1.00 51.68  ?  432 VAL C CB    1 
ATOM   7578  C  CG1   . VAL C 2 53  ? 62.262  2.009   19.539  1.00 49.24  ?  432 VAL C CG1   1 
ATOM   7579  C  CG2   . VAL C 2 53  ? 60.471  3.600   18.816  1.00 46.17  ?  432 VAL C CG2   1 
ATOM   7580  N  N     . GLU C 2 54  ? 63.102  2.716   22.525  1.00 57.56  ?  433 GLU C N     1 
ATOM   7581  C  CA    . GLU C 2 54  ? 64.342  2.355   23.216  1.00 56.55  ?  433 GLU C CA    1 
ATOM   7582  C  C     . GLU C 2 54  ? 65.344  1.795   22.225  1.00 53.83  ?  433 GLU C C     1 
ATOM   7583  O  O     . GLU C 2 54  ? 65.222  0.651   21.800  1.00 56.10  ?  433 GLU C O     1 
ATOM   7584  C  CB    . GLU C 2 54  ? 64.067  1.287   24.291  1.00 65.20  ?  433 GLU C CB    1 
ATOM   7585  C  CG    . GLU C 2 54  ? 65.316  0.715   25.005  1.00 71.87  ?  433 GLU C CG    1 
ATOM   7586  C  CD    . GLU C 2 54  ? 65.069  -0.648  25.666  1.00 74.92  ?  433 GLU C CD    1 
ATOM   7587  O  OE1   . GLU C 2 54  ? 66.032  -1.277  26.173  1.00 73.08  ?  433 GLU C OE1   1 
ATOM   7588  O  OE2   . GLU C 2 54  ? 63.906  -1.099  25.669  1.00 78.50  ?  433 GLU C OE2   1 
ATOM   7589  N  N     . GLY C 2 55  ? 66.325  2.609   21.853  1.00 53.21  ?  434 GLY C N     1 
ATOM   7590  C  CA    . GLY C 2 55  ? 67.447  2.144   21.056  1.00 54.94  ?  434 GLY C CA    1 
ATOM   7591  C  C     . GLY C 2 55  ? 67.357  2.444   19.576  1.00 59.17  ?  434 GLY C C     1 
ATOM   7592  O  O     . GLY C 2 55  ? 66.267  2.562   19.023  1.00 60.13  ?  434 GLY C O     1 
ATOM   7593  N  N     . ASP C 2 56  ? 68.508  2.559   18.925  1.00 64.53  ?  435 ASP C N     1 
ATOM   7594  C  CA    . ASP C 2 56  ? 68.531  2.744   17.475  1.00 70.81  ?  435 ASP C CA    1 
ATOM   7595  C  C     . ASP C 2 56  ? 68.053  1.498   16.751  1.00 68.59  ?  435 ASP C C     1 
ATOM   7596  O  O     . ASP C 2 56  ? 67.408  1.590   15.709  1.00 65.58  ?  435 ASP C O     1 
ATOM   7597  C  CB    . ASP C 2 56  ? 69.933  3.106   16.993  1.00 80.34  ?  435 ASP C CB    1 
ATOM   7598  C  CG    . ASP C 2 56  ? 70.084  4.580   16.721  1.00 88.23  ?  435 ASP C CG    1 
ATOM   7599  O  OD1   . ASP C 2 56  ? 69.079  5.220   16.348  1.00 86.07  ?  435 ASP C OD1   1 
ATOM   7600  O  OD2   . ASP C 2 56  ? 71.209  5.095   16.887  1.00 96.00  ?  435 ASP C OD2   1 
ATOM   7601  N  N     . SER C 2 57  ? 68.385  0.333   17.306  1.00 68.62  ?  436 SER C N     1 
ATOM   7602  C  CA    . SER C 2 57  ? 67.965  -0.939  16.726  1.00 67.63  ?  436 SER C CA    1 
ATOM   7603  C  C     . SER C 2 57  ? 66.466  -0.961  16.465  1.00 59.99  ?  436 SER C C     1 
ATOM   7604  O  O     . SER C 2 57  ? 66.031  -1.046  15.323  1.00 59.53  ?  436 SER C O     1 
ATOM   7605  C  CB    . SER C 2 57  ? 68.340  -2.104  17.630  1.00 70.33  ?  436 SER C CB    1 
ATOM   7606  O  OG    . SER C 2 57  ? 67.903  -3.318  17.051  1.00 72.46  ?  436 SER C OG    1 
ATOM   7607  N  N     . ALA C 2 58  ? 65.679  -0.876  17.531  1.00 55.10  ?  437 ALA C N     1 
ATOM   7608  C  CA    . ALA C 2 58  ? 64.232  -0.800  17.397  1.00 53.93  ?  437 ALA C CA    1 
ATOM   7609  C  C     . ALA C 2 58  ? 63.780  0.490   16.709  1.00 52.97  ?  437 ALA C C     1 
ATOM   7610  O  O     . ALA C 2 58  ? 62.825  0.482   15.934  1.00 54.38  ?  437 ALA C O     1 
ATOM   7611  C  CB    . ALA C 2 58  ? 63.574  -0.938  18.746  1.00 56.01  ?  437 ALA C CB    1 
ATOM   7612  N  N     . GLY C 2 59  ? 64.454  1.599   16.996  1.00 53.65  ?  438 GLY C N     1 
ATOM   7613  C  CA    . GLY C 2 59  ? 64.148  2.852   16.326  1.00 57.28  ?  438 GLY C CA    1 
ATOM   7614  C  C     . GLY C 2 59  ? 64.051  2.670   14.818  1.00 62.76  ?  438 GLY C C     1 
ATOM   7615  O  O     . GLY C 2 59  ? 63.171  3.244   14.171  1.00 65.70  ?  438 GLY C O     1 
ATOM   7616  N  N     . GLY C 2 60  ? 64.955  1.855   14.271  1.00 61.77  ?  439 GLY C N     1 
ATOM   7617  C  CA    . GLY C 2 60  ? 65.010  1.564   12.847  1.00 60.04  ?  439 GLY C CA    1 
ATOM   7618  C  C     . GLY C 2 60  ? 63.941  0.605   12.344  1.00 61.68  ?  439 GLY C C     1 
ATOM   7619  O  O     . GLY C 2 60  ? 63.434  0.776   11.240  1.00 61.15  ?  439 GLY C O     1 
ATOM   7620  N  N     . SER C 2 61  ? 63.605  -0.408  13.143  1.00 65.41  ?  440 SER C N     1 
ATOM   7621  C  CA    . SER C 2 61  ? 62.538  -1.352  12.805  1.00 66.85  ?  440 SER C CA    1 
ATOM   7622  C  C     . SER C 2 61  ? 61.158  -0.676  12.844  1.00 69.27  ?  440 SER C C     1 
ATOM   7623  O  O     . SER C 2 61  ? 60.212  -1.137  12.201  1.00 74.04  ?  440 SER C O     1 
ATOM   7624  C  CB    . SER C 2 61  ? 62.566  -2.569  13.746  1.00 65.50  ?  440 SER C CB    1 
ATOM   7625  O  OG    . SER C 2 61  ? 63.676  -3.424  13.500  1.00 63.37  ?  440 SER C OG    1 
ATOM   7626  N  N     . ALA C 2 62  ? 61.052  0.414   13.601  1.00 66.49  ?  441 ALA C N     1 
ATOM   7627  C  CA    . ALA C 2 62  ? 59.812  1.185   13.690  1.00 64.73  ?  441 ALA C CA    1 
ATOM   7628  C  C     . ALA C 2 62  ? 59.643  2.107   12.487  1.00 67.56  ?  441 ALA C C     1 
ATOM   7629  O  O     . ALA C 2 62  ? 58.553  2.207   11.930  1.00 72.93  ?  441 ALA C O     1 
ATOM   7630  C  CB    . ALA C 2 62  ? 59.769  1.986   14.983  1.00 62.62  ?  441 ALA C CB    1 
ATOM   7631  N  N     . LYS C 2 63  ? 60.722  2.790   12.101  1.00 64.29  ?  442 LYS C N     1 
ATOM   7632  C  CA    . LYS C 2 63  ? 60.745  3.595   10.874  1.00 60.98  ?  442 LYS C CA    1 
ATOM   7633  C  C     . LYS C 2 63  ? 60.210  2.764   9.696   1.00 61.91  ?  442 LYS C C     1 
ATOM   7634  O  O     . LYS C 2 63  ? 59.382  3.243   8.922   1.00 64.91  ?  442 LYS C O     1 
ATOM   7635  C  CB    . LYS C 2 63  ? 62.172  4.121   10.596  1.00 56.22  ?  442 LYS C CB    1 
ATOM   7636  C  CG    . LYS C 2 63  ? 62.339  5.075   9.399   1.00 51.61  ?  442 LYS C CG    1 
ATOM   7637  N  N     . GLN C 2 64  ? 60.671  1.514   9.593   1.00 59.66  ?  443 GLN C N     1 
ATOM   7638  C  CA    . GLN C 2 64  ? 60.249  0.570   8.549   1.00 61.32  ?  443 GLN C CA    1 
ATOM   7639  C  C     . GLN C 2 64  ? 58.822  0.052   8.730   1.00 61.38  ?  443 GLN C C     1 
ATOM   7640  O  O     . GLN C 2 64  ? 58.019  0.041   7.790   1.00 59.20  ?  443 GLN C O     1 
ATOM   7641  C  CB    . GLN C 2 64  ? 61.228  -0.612  8.472   1.00 65.16  ?  443 GLN C CB    1 
ATOM   7642  C  CG    . GLN C 2 64  ? 62.503  -0.309  7.678   1.00 72.26  ?  443 GLN C CG    1 
ATOM   7643  C  CD    . GLN C 2 64  ? 63.749  -1.015  8.211   1.00 76.61  ?  443 GLN C CD    1 
ATOM   7644  O  OE1   . GLN C 2 64  ? 64.783  -0.376  8.446   1.00 79.45  ?  443 GLN C OE1   1 
ATOM   7645  N  NE2   . GLN C 2 64  ? 63.665  -2.334  8.384   1.00 75.46  ?  443 GLN C NE2   1 
ATOM   7646  N  N     . GLY C 2 65  ? 58.508  -0.365  9.950   1.00 64.29  ?  444 GLY C N     1 
ATOM   7647  C  CA    . GLY C 2 65  ? 57.221  -0.966  10.245  1.00 66.10  ?  444 GLY C CA    1 
ATOM   7648  C  C     . GLY C 2 65  ? 56.030  -0.029  10.252  1.00 64.00  ?  444 GLY C C     1 
ATOM   7649  O  O     . GLY C 2 65  ? 54.902  -0.477  10.069  1.00 68.24  ?  444 GLY C O     1 
ATOM   7650  N  N     . ARG C 2 66  ? 56.280  1.266   10.431  1.00 58.44  ?  445 ARG C N     1 
ATOM   7651  C  CA    . ARG C 2 66  ? 55.226  2.237   10.745  1.00 58.62  ?  445 ARG C CA    1 
ATOM   7652  C  C     . ARG C 2 66  ? 54.284  2.609   9.592   1.00 64.74  ?  445 ARG C C     1 
ATOM   7653  O  O     . ARG C 2 66  ? 54.365  2.076   8.482   1.00 68.29  ?  445 ARG C O     1 
ATOM   7654  C  CB    . ARG C 2 66  ? 55.860  3.524   11.294  1.00 55.15  ?  445 ARG C CB    1 
ATOM   7655  C  CG    . ARG C 2 66  ? 56.094  4.611   10.237  1.00 56.57  ?  445 ARG C CG    1 
ATOM   7656  C  CD    . ARG C 2 66  ? 57.489  5.212   10.312  1.00 57.08  ?  445 ARG C CD    1 
ATOM   7657  N  NE    . ARG C 2 66  ? 57.497  6.637   9.981   1.00 63.49  ?  445 ARG C NE    1 
ATOM   7658  C  CZ    . ARG C 2 66  ? 58.059  7.156   8.893   1.00 70.05  ?  445 ARG C CZ    1 
ATOM   7659  N  NH1   . ARG C 2 66  ? 58.671  6.365   8.015   1.00 71.49  ?  445 ARG C NH1   1 
ATOM   7660  N  NH2   . ARG C 2 66  ? 58.018  8.469   8.685   1.00 72.01  ?  445 ARG C NH2   1 
ATOM   7661  N  N     . ASP C 2 67  ? 53.387  3.539   9.888   1.00 66.15  ?  446 ASP C N     1 
ATOM   7662  C  CA    . ASP C 2 67  ? 52.623  4.247   8.875   1.00 70.62  ?  446 ASP C CA    1 
ATOM   7663  C  C     . ASP C 2 67  ? 53.093  5.699   8.879   1.00 67.57  ?  446 ASP C C     1 
ATOM   7664  O  O     . ASP C 2 67  ? 52.812  6.452   9.812   1.00 67.71  ?  446 ASP C O     1 
ATOM   7665  C  CB    . ASP C 2 67  ? 51.131  4.173   9.198   1.00 79.05  ?  446 ASP C CB    1 
ATOM   7666  C  CG    . ASP C 2 67  ? 50.273  4.910   8.188   1.00 81.81  ?  446 ASP C CG    1 
ATOM   7667  O  OD1   . ASP C 2 67  ? 49.374  4.269   7.602   1.00 81.80  ?  446 ASP C OD1   1 
ATOM   7668  O  OD2   . ASP C 2 67  ? 50.489  6.126   7.992   1.00 82.47  ?  446 ASP C OD2   1 
ATOM   7669  N  N     . ARG C 2 68  ? 53.810  6.090   7.834   1.00 65.62  ?  447 ARG C N     1 
ATOM   7670  C  CA    . ARG C 2 68  ? 54.498  7.381   7.818   1.00 65.25  ?  447 ARG C CA    1 
ATOM   7671  C  C     . ARG C 2 68  ? 53.573  8.615   7.824   1.00 67.51  ?  447 ARG C C     1 
ATOM   7672  O  O     . ARG C 2 68  ? 53.997  9.730   8.153   1.00 66.73  ?  447 ARG C O     1 
ATOM   7673  C  CB    . ARG C 2 68  ? 55.484  7.435   6.639   1.00 64.90  ?  447 ARG C CB    1 
ATOM   7674  C  CG    . ARG C 2 68  ? 54.843  7.624   5.276   1.00 65.51  ?  447 ARG C CG    1 
ATOM   7675  C  CD    . ARG C 2 68  ? 55.716  7.062   4.180   1.00 63.24  ?  447 ARG C CD    1 
ATOM   7676  N  NE    . ARG C 2 68  ? 57.047  7.662   4.139   1.00 60.06  ?  447 ARG C NE    1 
ATOM   7677  C  CZ    . ARG C 2 68  ? 58.126  7.020   3.692   1.00 58.19  ?  447 ARG C CZ    1 
ATOM   7678  N  NH1   . ARG C 2 68  ? 58.026  5.762   3.267   1.00 58.08  ?  447 ARG C NH1   1 
ATOM   7679  N  NH2   . ARG C 2 68  ? 59.308  7.623   3.671   1.00 58.01  ?  447 ARG C NH2   1 
ATOM   7680  N  N     . LYS C 2 69  ? 52.309  8.423   7.465   1.00 69.56  ?  448 LYS C N     1 
ATOM   7681  C  CA    . LYS C 2 69  ? 51.401  9.557   7.360   1.00 72.97  ?  448 LYS C CA    1 
ATOM   7682  C  C     . LYS C 2 69  ? 51.246  10.267  8.702   1.00 74.03  ?  448 LYS C C     1 
ATOM   7683  O  O     . LYS C 2 69  ? 51.431  11.477  8.793   1.00 78.96  ?  448 LYS C O     1 
ATOM   7684  C  CB    . LYS C 2 69  ? 50.041  9.130   6.798   1.00 75.31  ?  448 LYS C CB    1 
ATOM   7685  N  N     . PHE C 2 70  ? 50.929  9.515   9.749   1.00 71.74  ?  449 PHE C N     1 
ATOM   7686  C  CA    . PHE C 2 70  ? 50.654  10.130  11.036  1.00 75.31  ?  449 PHE C CA    1 
ATOM   7687  C  C     . PHE C 2 70  ? 51.536  9.602   12.165  1.00 75.01  ?  449 PHE C C     1 
ATOM   7688  O  O     . PHE C 2 70  ? 51.238  9.829   13.339  1.00 79.23  ?  449 PHE C O     1 
ATOM   7689  C  CB    . PHE C 2 70  ? 49.193  9.902   11.406  1.00 81.38  ?  449 PHE C CB    1 
ATOM   7690  C  CG    . PHE C 2 70  ? 48.854  8.460   11.628  1.00 83.63  ?  449 PHE C CG    1 
ATOM   7691  C  CD1   . PHE C 2 70  ? 48.724  7.595   10.551  1.00 86.06  ?  449 PHE C CD1   1 
ATOM   7692  C  CD2   . PHE C 2 70  ? 48.682  7.963   12.914  1.00 82.57  ?  449 PHE C CD2   1 
ATOM   7693  C  CE1   . PHE C 2 70  ? 48.418  6.258   10.752  1.00 87.34  ?  449 PHE C CE1   1 
ATOM   7694  C  CE2   . PHE C 2 70  ? 48.378  6.630   13.125  1.00 82.08  ?  449 PHE C CE2   1 
ATOM   7695  C  CZ    . PHE C 2 70  ? 48.244  5.775   12.044  1.00 85.12  ?  449 PHE C CZ    1 
ATOM   7696  N  N     . GLN C 2 71  ? 52.609  8.893   11.821  1.00 70.96  ?  450 GLN C N     1 
ATOM   7697  C  CA    . GLN C 2 71  ? 53.467  8.281   12.837  1.00 64.19  ?  450 GLN C CA    1 
ATOM   7698  C  C     . GLN C 2 71  ? 54.918  8.724   12.732  1.00 64.95  ?  450 GLN C C     1 
ATOM   7699  O  O     . GLN C 2 71  ? 55.582  8.490   11.718  1.00 70.24  ?  450 GLN C O     1 
ATOM   7700  C  CB    . GLN C 2 71  ? 53.376  6.753   12.784  1.00 57.88  ?  450 GLN C CB    1 
ATOM   7701  C  CG    . GLN C 2 71  ? 52.127  6.205   13.454  1.00 60.27  ?  450 GLN C CG    1 
ATOM   7702  C  CD    . GLN C 2 71  ? 52.031  4.695   13.391  1.00 61.93  ?  450 GLN C CD    1 
ATOM   7703  O  OE1   . GLN C 2 71  ? 52.591  4.054   12.498  1.00 63.52  ?  450 GLN C OE1   1 
ATOM   7704  N  NE2   . GLN C 2 71  ? 51.316  4.114   14.346  1.00 55.65  ?  450 GLN C NE2   1 
ATOM   7705  N  N     . ALA C 2 72  ? 55.406  9.362   13.791  1.00 61.33  ?  451 ALA C N     1 
ATOM   7706  C  CA    . ALA C 2 72  ? 56.808  9.758   13.869  1.00 61.26  ?  451 ALA C CA    1 
ATOM   7707  C  C     . ALA C 2 72  ? 57.604  8.842   14.808  1.00 59.52  ?  451 ALA C C     1 
ATOM   7708  O  O     . ALA C 2 72  ? 57.039  8.183   15.679  1.00 62.37  ?  451 ALA C O     1 
ATOM   7709  C  CB    . ALA C 2 72  ? 56.923  11.202  14.313  1.00 63.29  ?  451 ALA C CB    1 
ATOM   7710  N  N     . ILE C 2 73  ? 58.918  8.797   14.619  1.00 55.15  ?  452 ILE C N     1 
ATOM   7711  C  CA    . ILE C 2 73  ? 59.782  7.985   15.458  1.00 49.52  ?  452 ILE C CA    1 
ATOM   7712  C  C     . ILE C 2 73  ? 60.840  8.861   16.090  1.00 49.17  ?  452 ILE C C     1 
ATOM   7713  O  O     . ILE C 2 73  ? 61.490  9.643   15.407  1.00 58.43  ?  452 ILE C O     1 
ATOM   7714  C  CB    . ILE C 2 73  ? 60.490  6.881   14.643  1.00 56.52  ?  452 ILE C CB    1 
ATOM   7715  C  CG1   . ILE C 2 73  ? 59.478  6.136   13.777  1.00 49.25  ?  452 ILE C CG1   1 
ATOM   7716  C  CG2   . ILE C 2 73  ? 61.246  5.909   15.560  1.00 52.97  ?  452 ILE C CG2   1 
ATOM   7717  C  CD1   . ILE C 2 73  ? 58.341  5.560   14.552  1.00 49.57  ?  452 ILE C CD1   1 
ATOM   7718  N  N     . LEU C 2 74  ? 61.004  8.730   17.400  1.00 58.03  ?  453 LEU C N     1 
ATOM   7719  C  CA    . LEU C 2 74  ? 62.068  9.427   18.113  1.00 59.94  ?  453 LEU C CA    1 
ATOM   7720  C  C     . LEU C 2 74  ? 62.839  8.405   18.930  1.00 62.34  ?  453 LEU C C     1 
ATOM   7721  O  O     . LEU C 2 74  ? 62.383  7.968   19.989  1.00 65.96  ?  453 LEU C O     1 
ATOM   7722  C  CB    . LEU C 2 74  ? 61.492  10.502  19.037  1.00 60.35  ?  453 LEU C CB    1 
ATOM   7723  C  CG    . LEU C 2 74  ? 62.373  11.691  19.433  1.00 56.52  ?  453 LEU C CG    1 
ATOM   7724  C  CD1   . LEU C 2 74  ? 62.196  12.013  20.914  1.00 54.88  ?  453 LEU C CD1   1 
ATOM   7725  C  CD2   . LEU C 2 74  ? 63.830  11.448  19.075  1.00 53.02  ?  453 LEU C CD2   1 
ATOM   7726  N  N     . PRO C 2 75  ? 63.999  7.985   18.417  1.00 59.37  ?  454 PRO C N     1 
ATOM   7727  C  CA    . PRO C 2 75  ? 64.857  7.075   19.178  1.00 55.90  ?  454 PRO C CA    1 
ATOM   7728  C  C     . PRO C 2 75  ? 65.417  7.698   20.464  1.00 57.78  ?  454 PRO C C     1 
ATOM   7729  O  O     . PRO C 2 75  ? 65.799  8.875   20.523  1.00 57.93  ?  454 PRO C O     1 
ATOM   7730  C  CB    . PRO C 2 75  ? 65.986  6.769   18.188  1.00 53.29  ?  454 PRO C CB    1 
ATOM   7731  C  CG    . PRO C 2 75  ? 65.360  6.949   16.850  1.00 52.38  ?  454 PRO C CG    1 
ATOM   7732  C  CD    . PRO C 2 75  ? 64.431  8.106   17.015  1.00 56.55  ?  454 PRO C CD    1 
ATOM   7733  N  N     . LEU C 2 76  ? 65.444  6.885   21.509  1.00 59.46  ?  455 LEU C N     1 
ATOM   7734  C  CA    . LEU C 2 76  ? 66.145  7.233   22.734  1.00 57.60  ?  455 LEU C CA    1 
ATOM   7735  C  C     . LEU C 2 76  ? 67.401  6.376   22.810  1.00 58.81  ?  455 LEU C C     1 
ATOM   7736  O  O     . LEU C 2 76  ? 67.332  5.173   23.071  1.00 64.88  ?  455 LEU C O     1 
ATOM   7737  C  CB    . LEU C 2 76  ? 65.246  6.991   23.942  1.00 53.19  ?  455 LEU C CB    1 
ATOM   7738  C  CG    . LEU C 2 76  ? 64.039  7.919   23.964  1.00 55.83  ?  455 LEU C CG    1 
ATOM   7739  C  CD1   . LEU C 2 76  ? 63.266  7.771   25.268  1.00 58.77  ?  455 LEU C CD1   1 
ATOM   7740  C  CD2   . LEU C 2 76  ? 64.486  9.369   23.734  1.00 45.80  ?  455 LEU C CD2   1 
ATOM   7741  N  N     . ARG C 2 77  ? 68.552  6.984   22.566  1.00 56.88  ?  456 ARG C N     1 
ATOM   7742  C  CA    . ARG C 2 77  ? 69.773  6.204   22.456  1.00 62.29  ?  456 ARG C CA    1 
ATOM   7743  C  C     . ARG C 2 77  ? 70.539  6.249   23.764  1.00 65.20  ?  456 ARG C C     1 
ATOM   7744  O  O     . ARG C 2 77  ? 71.299  7.182   24.021  1.00 69.47  ?  456 ARG C O     1 
ATOM   7745  C  CB    . ARG C 2 77  ? 70.609  6.718   21.286  1.00 65.55  ?  456 ARG C CB    1 
ATOM   7746  C  CG    . ARG C 2 77  ? 69.774  7.569   20.328  1.00 70.12  ?  456 ARG C CG    1 
ATOM   7747  C  CD    . ARG C 2 77  ? 70.380  7.700   18.953  1.00 71.96  ?  456 ARG C CD    1 
ATOM   7748  N  NE    . ARG C 2 77  ? 71.613  8.472   18.961  1.00 79.70  ?  456 ARG C NE    1 
ATOM   7749  C  CZ    . ARG C 2 77  ? 72.754  8.039   18.435  1.00 91.07  ?  456 ARG C CZ    1 
ATOM   7750  N  NH1   . ARG C 2 77  ? 73.844  8.796   18.476  1.00 96.81  ?  456 ARG C NH1   1 
ATOM   7751  N  NH2   . ARG C 2 77  ? 72.805  6.840   17.866  1.00 93.61  ?  456 ARG C NH2   1 
ATOM   7752  N  N     . GLY C 2 78  ? 70.323  5.231   24.595  1.00 60.25  ?  457 GLY C N     1 
ATOM   7753  C  CA    . GLY C 2 78  ? 70.909  5.182   25.922  1.00 57.04  ?  457 GLY C CA    1 
ATOM   7754  C  C     . GLY C 2 78  ? 69.841  5.297   26.993  1.00 56.67  ?  457 GLY C C     1 
ATOM   7755  O  O     . GLY C 2 78  ? 68.665  5.551   26.697  1.00 55.05  ?  457 GLY C O     1 
ATOM   7756  N  N     . LYS C 2 79  ? 70.246  5.102   28.245  1.00 55.71  ?  458 LYS C N     1 
ATOM   7757  C  CA    . LYS C 2 79  ? 69.319  5.216   29.360  1.00 49.65  ?  458 LYS C CA    1 
ATOM   7758  C  C     . LYS C 2 79  ? 69.009  6.688   29.564  1.00 54.58  ?  458 LYS C C     1 
ATOM   7759  O  O     . LYS C 2 79  ? 69.918  7.503   29.699  1.00 55.23  ?  458 LYS C O     1 
ATOM   7760  C  CB    . LYS C 2 79  ? 69.897  4.582   30.634  1.00 43.39  ?  458 LYS C CB    1 
ATOM   7761  C  CG    . LYS C 2 79  ? 69.670  3.060   30.775  1.00 44.53  ?  458 LYS C CG    1 
ATOM   7762  C  CD    . LYS C 2 79  ? 70.390  2.476   32.007  1.00 46.59  ?  458 LYS C CD    1 
ATOM   7763  C  CE    . LYS C 2 79  ? 70.167  0.948   32.180  1.00 61.32  ?  458 LYS C CE    1 
ATOM   7764  N  NZ    . LYS C 2 79  ? 68.724  0.501   32.249  1.00 57.28  ?  458 LYS C NZ    1 
ATOM   7765  N  N     . VAL C 2 80  ? 67.721  7.020   29.546  1.00 58.79  ?  459 VAL C N     1 
ATOM   7766  C  CA    . VAL C 2 80  ? 67.249  8.387   29.748  1.00 61.89  ?  459 VAL C CA    1 
ATOM   7767  C  C     . VAL C 2 80  ? 67.688  8.935   31.094  1.00 66.19  ?  459 VAL C C     1 
ATOM   7768  O  O     . VAL C 2 80  ? 67.700  8.204   32.082  1.00 70.46  ?  459 VAL C O     1 
ATOM   7769  C  CB    . VAL C 2 80  ? 65.729  8.412   29.777  1.00 61.16  ?  459 VAL C CB    1 
ATOM   7770  C  CG1   . VAL C 2 80  ? 65.227  9.841   29.747  1.00 58.55  ?  459 VAL C CG1   1 
ATOM   7771  C  CG2   . VAL C 2 80  ? 65.173  7.590   28.630  1.00 62.03  ?  459 VAL C CG2   1 
ATOM   7772  N  N     . ILE C 2 81  ? 68.020  10.221  31.145  1.00 64.32  ?  460 ILE C N     1 
ATOM   7773  C  CA    . ILE C 2 81  ? 68.390  10.861  32.410  1.00 61.82  ?  460 ILE C CA    1 
ATOM   7774  C  C     . ILE C 2 81  ? 67.265  10.734  33.445  1.00 65.61  ?  460 ILE C C     1 
ATOM   7775  O  O     . ILE C 2 81  ? 66.098  10.560  33.086  1.00 69.81  ?  460 ILE C O     1 
ATOM   7776  C  CB    . ILE C 2 81  ? 68.744  12.352  32.208  1.00 56.51  ?  460 ILE C CB    1 
ATOM   7777  C  CG1   . ILE C 2 81  ? 69.719  12.826  33.277  1.00 56.08  ?  460 ILE C CG1   1 
ATOM   7778  C  CG2   . ILE C 2 81  ? 67.488  13.228  32.201  1.00 54.59  ?  460 ILE C CG2   1 
ATOM   7779  C  CD1   . ILE C 2 81  ? 70.380  14.152  32.943  1.00 56.57  ?  460 ILE C CD1   1 
ATOM   7780  N  N     . ASN C 2 82  ? 67.620  10.794  34.727  1.00 64.12  ?  461 ASN C N     1 
ATOM   7781  C  CA    . ASN C 2 82  ? 66.625  10.801  35.798  1.00 66.04  ?  461 ASN C CA    1 
ATOM   7782  C  C     . ASN C 2 82  ? 66.325  12.232  36.222  1.00 73.94  ?  461 ASN C C     1 
ATOM   7783  O  O     . ASN C 2 82  ? 67.183  12.911  36.794  1.00 78.07  ?  461 ASN C O     1 
ATOM   7784  C  CB    . ASN C 2 82  ? 67.097  9.982   37.005  1.00 65.52  ?  461 ASN C CB    1 
ATOM   7785  C  CG    . ASN C 2 82  ? 66.060  9.925   38.122  1.00 64.75  ?  461 ASN C CG    1 
ATOM   7786  O  OD1   . ASN C 2 82  ? 65.391  10.910  38.405  1.00 67.58  ?  461 ASN C OD1   1 
ATOM   7787  N  ND2   . ASN C 2 82  ? 65.922  8.768   38.754  1.00 61.37  ?  461 ASN C ND2   1 
ATOM   7788  N  N     . THR C 2 83  ? 65.102  12.677  35.940  1.00 74.88  ?  462 THR C N     1 
ATOM   7789  C  CA    . THR C 2 83  ? 64.689  14.060  36.167  1.00 72.58  ?  462 THR C CA    1 
ATOM   7790  C  C     . THR C 2 83  ? 64.198  14.329  37.589  1.00 76.52  ?  462 THR C C     1 
ATOM   7791  O  O     . THR C 2 83  ? 63.732  15.423  37.888  1.00 84.37  ?  462 THR C O     1 
ATOM   7792  C  CB    . THR C 2 83  ? 63.601  14.475  35.162  1.00 68.90  ?  462 THR C CB    1 
ATOM   7793  O  OG1   . THR C 2 83  ? 62.538  13.510  35.175  1.00 68.63  ?  462 THR C OG1   1 
ATOM   7794  C  CG2   . THR C 2 83  ? 64.185  14.545  33.764  1.00 66.28  ?  462 THR C CG2   1 
ATOM   7795  N  N     . ALA C 2 84  ? 64.296  13.326  38.457  1.00 73.02  ?  463 ALA C N     1 
ATOM   7796  C  CA    . ALA C 2 84  ? 64.008  13.498  39.882  1.00 70.95  ?  463 ALA C CA    1 
ATOM   7797  C  C     . ALA C 2 84  ? 65.286  13.663  40.700  1.00 70.19  ?  463 ALA C C     1 
ATOM   7798  O  O     . ALA C 2 84  ? 65.240  14.107  41.845  1.00 71.90  ?  463 ALA C O     1 
ATOM   7799  C  CB    . ALA C 2 84  ? 63.207  12.328  40.411  1.00 69.08  ?  463 ALA C CB    1 
ATOM   7800  N  N     . LYS C 2 85  ? 66.419  13.313  40.099  1.00 67.60  ?  464 LYS C N     1 
ATOM   7801  C  CA    . LYS C 2 85  ? 67.701  13.276  40.790  1.00 63.58  ?  464 LYS C CA    1 
ATOM   7802  C  C     . LYS C 2 85  ? 68.674  14.348  40.300  1.00 69.01  ?  464 LYS C C     1 
ATOM   7803  O  O     . LYS C 2 85  ? 69.564  14.772  41.039  1.00 69.94  ?  464 LYS C O     1 
ATOM   7804  C  CB    . LYS C 2 85  ? 68.372  11.909  40.598  1.00 56.18  ?  464 LYS C CB    1 
ATOM   7805  C  CG    . LYS C 2 85  ? 67.733  10.754  41.323  1.00 51.11  ?  464 LYS C CG    1 
ATOM   7806  C  CD    . LYS C 2 85  ? 68.650  9.542   41.286  1.00 48.04  ?  464 LYS C CD    1 
ATOM   7807  C  CE    . LYS C 2 85  ? 67.938  8.281   41.763  1.00 50.42  ?  464 LYS C CE    1 
ATOM   7808  N  NZ    . LYS C 2 85  ? 68.767  7.066   41.539  1.00 53.07  ?  464 LYS C NZ    1 
ATOM   7809  N  N     . ALA C 2 86  ? 68.532  14.760  39.047  1.00 75.58  ?  465 ALA C N     1 
ATOM   7810  C  CA    . ALA C 2 86  ? 69.546  15.606  38.428  1.00 82.75  ?  465 ALA C CA    1 
ATOM   7811  C  C     . ALA C 2 86  ? 69.237  17.074  38.639  1.00 92.49  ?  465 ALA C C     1 
ATOM   7812  O  O     . ALA C 2 86  ? 68.078  17.447  38.834  1.00 96.46  ?  465 ALA C O     1 
ATOM   7813  C  CB    . ALA C 2 86  ? 69.671  15.295  36.941  1.00 81.95  ?  465 ALA C CB    1 
ATOM   7814  N  N     . LYS C 2 87  ? 70.283  17.899  38.611  1.00 94.97  ?  466 LYS C N     1 
ATOM   7815  C  CA    . LYS C 2 87  ? 70.135  19.348  38.707  1.00 93.76  ?  466 LYS C CA    1 
ATOM   7816  C  C     . LYS C 2 87  ? 69.458  19.857  37.431  1.00 94.15  ?  466 LYS C C     1 
ATOM   7817  O  O     . LYS C 2 87  ? 69.796  19.401  36.336  1.00 92.63  ?  466 LYS C O     1 
ATOM   7818  C  CB    . LYS C 2 87  ? 71.504  20.009  38.902  1.00 89.26  ?  466 LYS C CB    1 
ATOM   7819  N  N     . MET C 2 88  ? 68.495  20.774  37.565  1.00 95.16  ?  467 MET C N     1 
ATOM   7820  C  CA    . MET C 2 88  ? 67.761  21.263  36.394  1.00 93.95  ?  467 MET C CA    1 
ATOM   7821  C  C     . MET C 2 88  ? 68.707  21.959  35.407  1.00 101.74 ?  467 MET C C     1 
ATOM   7822  O  O     . MET C 2 88  ? 68.331  22.239  34.258  1.00 104.19 ?  467 MET C O     1 
ATOM   7823  C  CB    . MET C 2 88  ? 66.580  22.174  36.773  1.00 83.80  ?  467 MET C CB    1 
ATOM   7824  C  CG    . MET C 2 88  ? 65.628  22.462  35.594  1.00 76.23  ?  467 MET C CG    1 
ATOM   7825  N  N     . ALA C 2 89  ? 69.932  22.224  35.871  1.00 102.18 ?  468 ALA C N     1 
ATOM   7826  C  CA    . ALA C 2 89  ? 71.014  22.719  35.021  1.00 99.67  ?  468 ALA C CA    1 
ATOM   7827  C  C     . ALA C 2 89  ? 71.328  21.681  33.943  1.00 97.85  ?  468 ALA C C     1 
ATOM   7828  O  O     . ALA C 2 89  ? 71.095  21.904  32.744  1.00 94.72  ?  468 ALA C O     1 
ATOM   7829  C  CB    . ALA C 2 89  ? 72.255  23.014  35.860  1.00 94.81  ?  468 ALA C CB    1 
ATOM   7830  N  N     . ASP C 2 90  ? 71.851  20.540  34.386  1.00 96.31  ?  469 ASP C N     1 
ATOM   7831  C  CA    . ASP C 2 90  ? 72.101  19.411  33.498  1.00 92.35  ?  469 ASP C CA    1 
ATOM   7832  C  C     . ASP C 2 90  ? 70.809  18.901  32.831  1.00 94.81  ?  469 ASP C C     1 
ATOM   7833  O  O     . ASP C 2 90  ? 70.785  18.697  31.621  1.00 96.12  ?  469 ASP C O     1 
ATOM   7834  C  CB    . ASP C 2 90  ? 72.825  18.284  34.248  1.00 82.89  ?  469 ASP C CB    1 
ATOM   7835  C  CG    . ASP C 2 90  ? 74.233  18.669  34.667  1.00 76.43  ?  469 ASP C CG    1 
ATOM   7836  N  N     . ILE C 2 91  ? 69.739  18.716  33.611  1.00 94.14  ?  470 ILE C N     1 
ATOM   7837  C  CA    . ILE C 2 91  ? 68.467  18.210  33.074  1.00 89.56  ?  470 ILE C CA    1 
ATOM   7838  C  C     . ILE C 2 91  ? 68.117  18.828  31.724  1.00 85.95  ?  470 ILE C C     1 
ATOM   7839  O  O     . ILE C 2 91  ? 67.565  18.151  30.857  1.00 81.32  ?  470 ILE C O     1 
ATOM   7840  C  CB    . ILE C 2 91  ? 67.275  18.413  34.045  1.00 51.97  ?  470 ILE C CB    1 
ATOM   7841  N  N     . LEU C 2 92  ? 68.450  20.106  31.543  1.00 87.15  ?  471 LEU C N     1 
ATOM   7842  C  CA    . LEU C 2 92  ? 68.084  20.830  30.319  1.00 85.32  ?  471 LEU C CA    1 
ATOM   7843  C  C     . LEU C 2 92  ? 69.175  20.782  29.244  1.00 80.42  ?  471 LEU C C     1 
ATOM   7844  O  O     . LEU C 2 92  ? 68.876  20.890  28.053  1.00 74.89  ?  471 LEU C O     1 
ATOM   7845  C  CB    . LEU C 2 92  ? 67.677  22.280  30.626  1.00 83.58  ?  471 LEU C CB    1 
ATOM   7846  N  N     . LYS C 2 93  ? 70.430  20.614  29.665  1.00 78.99  ?  472 LYS C N     1 
ATOM   7847  C  CA    . LYS C 2 93  ? 71.544  20.449  28.723  1.00 73.97  ?  472 LYS C CA    1 
ATOM   7848  C  C     . LYS C 2 93  ? 71.652  19.010  28.187  1.00 73.60  ?  472 LYS C C     1 
ATOM   7849  O  O     . LYS C 2 93  ? 72.733  18.569  27.796  1.00 73.28  ?  472 LYS C O     1 
ATOM   7850  C  CB    . LYS C 2 93  ? 72.877  20.879  29.366  1.00 66.36  ?  472 LYS C CB    1 
ATOM   7851  N  N     . ASN C 2 94  ? 70.532  18.286  28.168  1.00 73.43  ?  473 ASN C N     1 
ATOM   7852  C  CA    . ASN C 2 94  ? 70.528  16.870  27.784  1.00 72.94  ?  473 ASN C CA    1 
ATOM   7853  C  C     . ASN C 2 94  ? 69.831  16.588  26.453  1.00 79.36  ?  473 ASN C C     1 
ATOM   7854  O  O     . ASN C 2 94  ? 68.637  16.840  26.300  1.00 80.97  ?  473 ASN C O     1 
ATOM   7855  C  CB    . ASN C 2 94  ? 69.898  16.019  28.887  1.00 66.99  ?  473 ASN C CB    1 
ATOM   7856  C  CG    . ASN C 2 94  ? 69.783  14.560  28.505  1.00 64.00  ?  473 ASN C CG    1 
ATOM   7857  O  OD1   . ASN C 2 94  ? 68.684  14.016  28.421  1.00 60.49  ?  473 ASN C OD1   1 
ATOM   7858  N  ND2   . ASN C 2 94  ? 70.920  13.918  28.268  1.00 65.95  ?  473 ASN C ND2   1 
ATOM   7859  N  N     . GLU C 2 95  ? 70.587  16.043  25.505  1.00 81.44  ?  474 GLU C N     1 
ATOM   7860  C  CA    . GLU C 2 95  ? 70.105  15.816  24.147  1.00 81.41  ?  474 GLU C CA    1 
ATOM   7861  C  C     . GLU C 2 95  ? 68.734  15.130  24.062  1.00 75.61  ?  474 GLU C C     1 
ATOM   7862  O  O     . GLU C 2 95  ? 67.817  15.640  23.416  1.00 75.16  ?  474 GLU C O     1 
ATOM   7863  C  CB    . GLU C 2 95  ? 71.148  15.036  23.347  1.00 87.63  ?  474 GLU C CB    1 
ATOM   7864  C  CG    . GLU C 2 95  ? 70.728  14.692  21.927  1.00 96.70  ?  474 GLU C CG    1 
ATOM   7865  C  CD    . GLU C 2 95  ? 71.577  13.579  21.331  1.00 103.70 ?  474 GLU C CD    1 
ATOM   7866  O  OE1   . GLU C 2 95  ? 72.807  13.777  21.203  1.00 104.89 ?  474 GLU C OE1   1 
ATOM   7867  O  OE2   . GLU C 2 95  ? 71.017  12.503  21.008  1.00 105.50 ?  474 GLU C OE2   1 
ATOM   7868  N  N     . GLU C 2 96  ? 68.586  13.974  24.696  1.00 73.06  ?  475 GLU C N     1 
ATOM   7869  C  CA    . GLU C 2 96  ? 67.305  13.268  24.639  1.00 76.96  ?  475 GLU C CA    1 
ATOM   7870  C  C     . GLU C 2 96  ? 66.172  14.145  25.176  1.00 76.97  ?  475 GLU C C     1 
ATOM   7871  O  O     . GLU C 2 96  ? 65.078  14.188  24.611  1.00 77.81  ?  475 GLU C O     1 
ATOM   7872  C  CB    . GLU C 2 96  ? 67.362  11.932  25.391  1.00 83.78  ?  475 GLU C CB    1 
ATOM   7873  C  CG    . GLU C 2 96  ? 68.672  11.680  26.132  1.00 94.44  ?  475 GLU C CG    1 
ATOM   7874  C  CD    . GLU C 2 96  ? 69.823  11.302  25.204  1.00 103.31 ?  475 GLU C CD    1 
ATOM   7875  O  OE1   . GLU C 2 96  ? 70.997  11.521  25.594  1.00 104.84 ?  475 GLU C OE1   1 
ATOM   7876  O  OE2   . GLU C 2 96  ? 69.550  10.777  24.097  1.00 106.14 ?  475 GLU C OE2   1 
ATOM   7877  N  N     . ILE C 2 97  ? 66.456  14.858  26.262  1.00 76.76  ?  476 ILE C N     1 
ATOM   7878  C  CA    . ILE C 2 97  ? 65.482  15.742  26.888  1.00 75.58  ?  476 ILE C CA    1 
ATOM   7879  C  C     . ILE C 2 97  ? 65.165  16.997  26.049  1.00 76.85  ?  476 ILE C C     1 
ATOM   7880  O  O     . ILE C 2 97  ? 64.008  17.393  25.950  1.00 74.63  ?  476 ILE C O     1 
ATOM   7881  C  CB    . ILE C 2 97  ? 65.935  16.128  28.322  1.00 73.32  ?  476 ILE C CB    1 
ATOM   7882  C  CG1   . ILE C 2 97  ? 64.840  15.773  29.320  1.00 62.91  ?  476 ILE C CG1   1 
ATOM   7883  C  CG2   . ILE C 2 97  ? 66.342  17.595  28.400  1.00 80.35  ?  476 ILE C CG2   1 
ATOM   7884  C  CD1   . ILE C 2 97  ? 64.329  14.394  29.087  1.00 54.23  ?  476 ILE C CD1   1 
ATOM   7885  N  N     . ASN C 2 98  ? 66.183  17.615  25.447  1.00 80.21  ?  477 ASN C N     1 
ATOM   7886  C  CA    . ASN C 2 98  ? 65.971  18.765  24.552  1.00 83.43  ?  477 ASN C CA    1 
ATOM   7887  C  C     . ASN C 2 98  ? 65.114  18.434  23.345  1.00 81.24  ?  477 ASN C C     1 
ATOM   7888  O  O     . ASN C 2 98  ? 64.194  19.177  23.013  1.00 82.45  ?  477 ASN C O     1 
ATOM   7889  C  CB    . ASN C 2 98  ? 67.295  19.347  24.052  1.00 88.63  ?  477 ASN C CB    1 
ATOM   7890  C  CG    . ASN C 2 98  ? 67.884  20.362  25.007  1.00 97.78  ?  477 ASN C CG    1 
ATOM   7891  O  OD1   . ASN C 2 98  ? 67.170  20.964  25.819  1.00 101.84 ?  477 ASN C OD1   1 
ATOM   7892  N  ND2   . ASN C 2 98  ? 69.199  20.564  24.913  1.00 99.76  ?  477 ASN C ND2   1 
ATOM   7893  N  N     . THR C 2 99  ? 65.422  17.323  22.681  1.00 79.56  ?  478 THR C N     1 
ATOM   7894  C  CA    . THR C 2 99  ? 64.714  16.981  21.454  1.00 79.73  ?  478 THR C CA    1 
ATOM   7895  C  C     . THR C 2 99  ? 63.299  16.433  21.706  1.00 75.26  ?  478 THR C C     1 
ATOM   7896  O  O     . THR C 2 99  ? 62.538  16.211  20.763  1.00 75.18  ?  478 THR C O     1 
ATOM   7897  C  CB    . THR C 2 99  ? 65.556  16.063  20.497  1.00 72.68  ?  478 THR C CB    1 
ATOM   7898  O  OG1   . THR C 2 99  ? 65.318  14.681  20.785  1.00 70.59  ?  478 THR C OG1   1 
ATOM   7899  C  CG2   . THR C 2 99  ? 67.056  16.378  20.593  1.00 70.82  ?  478 THR C CG2   1 
ATOM   7900  N  N     . MET C 2 100 ? 62.942  16.228  22.972  1.00 71.97  ?  479 MET C N     1 
ATOM   7901  C  CA    . MET C 2 100 ? 61.558  15.901  23.318  1.00 72.35  ?  479 MET C CA    1 
ATOM   7902  C  C     . MET C 2 100 ? 60.769  17.178  23.603  1.00 79.60  ?  479 MET C C     1 
ATOM   7903  O  O     . MET C 2 100 ? 59.656  17.349  23.099  1.00 81.93  ?  479 MET C O     1 
ATOM   7904  C  CB    . MET C 2 100 ? 61.467  14.953  24.521  1.00 69.56  ?  479 MET C CB    1 
ATOM   7905  C  CG    . MET C 2 100 ? 62.096  13.583  24.321  1.00 68.20  ?  479 MET C CG    1 
ATOM   7906  S  SD    . MET C 2 100 ? 61.957  12.528  25.788  1.00 88.46  ?  479 MET C SD    1 
ATOM   7907  C  CE    . MET C 2 100 ? 60.428  11.680  25.429  1.00 50.83  ?  479 MET C CE    1 
ATOM   7908  N  N     . ILE C 2 101 ? 61.337  18.067  24.419  1.00 83.55  ?  480 ILE C N     1 
ATOM   7909  C  CA    . ILE C 2 101 ? 60.696  19.348  24.688  1.00 83.66  ?  480 ILE C CA    1 
ATOM   7910  C  C     . ILE C 2 101 ? 60.462  20.012  23.339  1.00 84.61  ?  480 ILE C C     1 
ATOM   7911  O  O     . ILE C 2 101 ? 59.409  20.600  23.101  1.00 88.41  ?  480 ILE C O     1 
ATOM   7912  C  CB    . ILE C 2 101 ? 61.545  20.263  25.621  1.00 57.43  ?  480 ILE C CB    1 
ATOM   7913  N  N     . TYR C 2 102 ? 61.437  19.858  22.445  1.00 80.48  ?  481 TYR C N     1 
ATOM   7914  C  CA    . TYR C 2 102 ? 61.452  20.551  21.156  1.00 81.41  ?  481 TYR C CA    1 
ATOM   7915  C  C     . TYR C 2 102 ? 60.783  19.807  19.996  1.00 80.67  ?  481 TYR C C     1 
ATOM   7916  O  O     . TYR C 2 102 ? 60.533  20.403  18.948  1.00 78.04  ?  481 TYR C O     1 
ATOM   7917  C  CB    . TYR C 2 102 ? 62.892  20.906  20.767  1.00 80.70  ?  481 TYR C CB    1 
ATOM   7918  N  N     . THR C 2 103 ? 60.523  18.514  20.168  1.00 82.98  ?  482 THR C N     1 
ATOM   7919  C  CA    . THR C 2 103 ? 59.872  17.709  19.130  1.00 84.26  ?  482 THR C CA    1 
ATOM   7920  C  C     . THR C 2 103 ? 58.373  17.616  19.426  1.00 84.79  ?  482 THR C C     1 
ATOM   7921  O  O     . THR C 2 103 ? 57.568  17.270  18.559  1.00 84.50  ?  482 THR C O     1 
ATOM   7922  C  CB    . THR C 2 103 ? 60.515  16.272  18.972  1.00 54.70  ?  482 THR C CB    1 
ATOM   7923  N  N     . ILE C 2 104 ? 58.011  17.933  20.664  1.00 85.07  ?  483 ILE C N     1 
ATOM   7924  C  CA    . ILE C 2 104 ? 56.621  17.889  21.101  1.00 86.78  ?  483 ILE C CA    1 
ATOM   7925  C  C     . ILE C 2 104 ? 56.073  19.295  21.012  1.00 87.93  ?  483 ILE C C     1 
ATOM   7926  O  O     . ILE C 2 104 ? 54.859  19.498  20.951  1.00 87.08  ?  483 ILE C O     1 
ATOM   7927  C  CB    . ILE C 2 104 ? 56.489  17.354  22.556  1.00 74.85  ?  483 ILE C CB    1 
ATOM   7928  C  CG1   . ILE C 2 104 ? 57.065  15.936  22.656  1.00 66.58  ?  483 ILE C CG1   1 
ATOM   7929  C  CG2   . ILE C 2 104 ? 55.028  17.406  23.046  1.00 59.65  ?  483 ILE C CG2   1 
ATOM   7930  C  CD1   . ILE C 2 104 ? 56.670  15.217  23.918  1.00 64.05  ?  483 ILE C CD1   1 
ATOM   7931  N  N     . GLY C 2 105 ? 56.997  20.257  21.014  1.00 89.99  ?  484 GLY C N     1 
ATOM   7932  C  CA    . GLY C 2 105 ? 56.693  21.664  20.806  1.00 94.38  ?  484 GLY C CA    1 
ATOM   7933  C  C     . GLY C 2 105 ? 55.620  22.263  21.698  1.00 91.89  ?  484 GLY C C     1 
ATOM   7934  O  O     . GLY C 2 105 ? 54.641  22.834  21.204  1.00 88.83  ?  484 GLY C O     1 
ATOM   7935  N  N     . ALA C 2 106 ? 55.804  22.132  23.010  1.00 89.85  ?  485 ALA C N     1 
ATOM   7936  C  CA    . ALA C 2 106 ? 54.900  22.741  23.980  1.00 86.97  ?  485 ALA C CA    1 
ATOM   7937  C  C     . ALA C 2 106 ? 55.673  23.339  25.143  1.00 88.49  ?  485 ALA C C     1 
ATOM   7938  O  O     . ALA C 2 106 ? 55.083  23.998  26.001  1.00 91.39  ?  485 ALA C O     1 
ATOM   7939  C  CB    . ALA C 2 106 ? 53.880  21.738  24.482  1.00 82.20  ?  485 ALA C CB    1 
ATOM   7940  N  N     . GLY C 2 107 ? 56.989  23.115  25.168  1.00 88.38  ?  486 GLY C N     1 
ATOM   7941  C  CA    . GLY C 2 107 ? 57.829  23.649  26.233  1.00 91.42  ?  486 GLY C CA    1 
ATOM   7942  C  C     . GLY C 2 107 ? 57.676  22.940  27.574  1.00 92.99  ?  486 GLY C C     1 
ATOM   7943  O  O     . GLY C 2 107 ? 56.804  22.085  27.741  1.00 93.58  ?  486 GLY C O     1 
ATOM   7944  N  N     . VAL C 2 108 ? 58.509  23.296  28.546  1.00 96.90  ?  487 VAL C N     1 
ATOM   7945  C  CA    . VAL C 2 108 ? 58.593  22.479  29.754  1.00 100.19 ?  487 VAL C CA    1 
ATOM   7946  C  C     . VAL C 2 108 ? 58.188  23.178  31.074  1.00 105.25 ?  487 VAL C C     1 
ATOM   7947  O  O     . VAL C 2 108 ? 58.285  24.402  31.216  1.00 106.93 ?  487 VAL C O     1 
ATOM   7948  C  CB    . VAL C 2 108 ? 59.995  21.817  29.874  1.00 60.21  ?  487 VAL C CB    1 
ATOM   7949  N  N     . GLY C 2 109 ? 57.720  22.382  32.031  1.00 103.72 ?  488 GLY C N     1 
ATOM   7950  C  CA    . GLY C 2 109 ? 57.331  22.895  33.331  1.00 104.15 ?  488 GLY C CA    1 
ATOM   7951  C  C     . GLY C 2 109 ? 55.930  23.470  33.327  1.00 105.17 ?  488 GLY C C     1 
ATOM   7952  O  O     . GLY C 2 109 ? 54.967  22.773  32.996  1.00 103.26 ?  488 GLY C O     1 
ATOM   7953  N  N     . ALA C 2 110 ? 55.820  24.742  33.707  1.00 106.31 ?  489 ALA C N     1 
ATOM   7954  C  CA    . ALA C 2 110 ? 54.550  25.462  33.634  1.00 109.34 ?  489 ALA C CA    1 
ATOM   7955  C  C     . ALA C 2 110 ? 54.483  26.360  32.383  1.00 115.13 ?  489 ALA C C     1 
ATOM   7956  O  O     . ALA C 2 110 ? 53.395  26.766  31.960  1.00 117.34 ?  489 ALA C O     1 
ATOM   7957  C  CB    . ALA C 2 110 ? 54.308  26.263  34.908  1.00 107.92 ?  489 ALA C CB    1 
ATOM   7958  N  N     . ASP C 2 111 ? 55.644  26.654  31.791  1.00 114.74 ?  490 ASP C N     1 
ATOM   7959  C  CA    . ASP C 2 111 ? 55.706  27.304  30.477  1.00 112.33 ?  490 ASP C CA    1 
ATOM   7960  C  C     . ASP C 2 111 ? 55.099  26.378  29.415  1.00 111.86 ?  490 ASP C C     1 
ATOM   7961  O  O     . ASP C 2 111 ? 55.244  26.611  28.210  1.00 112.28 ?  490 ASP C O     1 
ATOM   7962  C  CB    . ASP C 2 111 ? 57.156  27.650  30.101  1.00 104.90 ?  490 ASP C CB    1 
ATOM   7963  C  CG    . ASP C 2 111 ? 57.619  28.968  30.694  1.00 101.07 ?  490 ASP C CG    1 
ATOM   7964  N  N     . PHE C 2 112 ? 54.407  25.339  29.887  1.00 108.61 ?  491 PHE C N     1 
ATOM   7965  C  CA    . PHE C 2 112 ? 53.936  24.228  29.053  1.00 103.52 ?  491 PHE C CA    1 
ATOM   7966  C  C     . PHE C 2 112 ? 52.463  24.346  28.627  1.00 101.60 ?  491 PHE C C     1 
ATOM   7967  O  O     . PHE C 2 112 ? 51.547  24.235  29.451  1.00 98.74  ?  491 PHE C O     1 
ATOM   7968  C  CB    . PHE C 2 112 ? 54.191  22.885  29.770  1.00 100.46 ?  491 PHE C CB    1 
ATOM   7969  C  CG    . PHE C 2 112 ? 53.714  21.676  29.001  1.00 98.16  ?  491 PHE C CG    1 
ATOM   7970  C  CD1   . PHE C 2 112 ? 52.579  20.986  29.402  1.00 97.69  ?  491 PHE C CD1   1 
ATOM   7971  C  CD2   . PHE C 2 112 ? 54.398  21.233  27.875  1.00 94.54  ?  491 PHE C CD2   1 
ATOM   7972  C  CE1   . PHE C 2 112 ? 52.135  19.881  28.691  1.00 95.26  ?  491 PHE C CE1   1 
ATOM   7973  C  CE2   . PHE C 2 112 ? 53.962  20.131  27.163  1.00 91.86  ?  491 PHE C CE2   1 
ATOM   7974  C  CZ    . PHE C 2 112 ? 52.830  19.454  27.569  1.00 92.20  ?  491 PHE C CZ    1 
ATOM   7975  N  N     . SER C 2 113 ? 52.253  24.555  27.327  1.00 100.93 ?  492 SER C N     1 
ATOM   7976  C  CA    . SER C 2 113 ? 50.917  24.703  26.760  1.00 100.25 ?  492 SER C CA    1 
ATOM   7977  C  C     . SER C 2 113 ? 50.447  23.432  26.042  1.00 99.74  ?  492 SER C C     1 
ATOM   7978  O  O     . SER C 2 113 ? 50.865  23.163  24.913  1.00 99.43  ?  492 SER C O     1 
ATOM   7979  C  CB    . SER C 2 113 ? 50.899  25.886  25.788  1.00 99.94  ?  492 SER C CB    1 
ATOM   7980  N  N     . ILE C 2 114 ? 49.574  22.660  26.692  1.00 97.98  ?  493 ILE C N     1 
ATOM   7981  C  CA    . ILE C 2 114 ? 49.035  21.429  26.102  1.00 93.61  ?  493 ILE C CA    1 
ATOM   7982  C  C     . ILE C 2 114 ? 48.290  21.708  24.798  1.00 96.16  ?  493 ILE C C     1 
ATOM   7983  O  O     . ILE C 2 114 ? 48.225  20.856  23.904  1.00 89.69  ?  493 ILE C O     1 
ATOM   7984  C  CB    . ILE C 2 114 ? 48.080  20.703  27.069  1.00 90.20  ?  493 ILE C CB    1 
ATOM   7985  N  N     . GLU C 2 115 ? 47.732  22.913  24.702  1.00 102.89 ?  494 GLU C N     1 
ATOM   7986  C  CA    . GLU C 2 115 ? 46.952  23.336  23.542  1.00 103.12 ?  494 GLU C CA    1 
ATOM   7987  C  C     . GLU C 2 115 ? 47.815  23.500  22.281  1.00 108.49 ?  494 GLU C C     1 
ATOM   7988  O  O     . GLU C 2 115 ? 47.321  23.346  21.159  1.00 111.71 ?  494 GLU C O     1 
ATOM   7989  C  CB    . GLU C 2 115 ? 46.198  24.635  23.853  1.00 96.11  ?  494 GLU C CB    1 
ATOM   7990  N  N     . ASP C 2 116 ? 49.099  23.807  22.467  1.00 108.84 ?  495 ASP C N     1 
ATOM   7991  C  CA    . ASP C 2 116 ? 50.020  23.993  21.343  1.00 109.44 ?  495 ASP C CA    1 
ATOM   7992  C  C     . ASP C 2 116 ? 50.863  22.735  21.066  1.00 114.34 ?  495 ASP C C     1 
ATOM   7993  O  O     . ASP C 2 116 ? 51.939  22.813  20.460  1.00 117.36 ?  495 ASP C O     1 
ATOM   7994  C  CB    . ASP C 2 116 ? 50.917  25.220  21.575  1.00 105.93 ?  495 ASP C CB    1 
ATOM   7995  N  N     . ALA C 2 117 ? 50.355  21.580  21.504  1.00 111.87 ?  496 ALA C N     1 
ATOM   7996  C  CA    . ALA C 2 117 ? 51.027  20.283  21.328  1.00 103.46 ?  496 ALA C CA    1 
ATOM   7997  C  C     . ALA C 2 117 ? 51.186  19.879  19.858  1.00 100.54 ?  496 ALA C C     1 
ATOM   7998  O  O     . ALA C 2 117 ? 50.673  20.551  18.960  1.00 102.36 ?  496 ALA C O     1 
ATOM   7999  C  CB    . ALA C 2 117 ? 50.280  19.194  22.096  1.00 98.18  ?  496 ALA C CB    1 
ATOM   8000  N  N     . ASN C 2 118 ? 51.890  18.776  19.615  1.00 95.51  ?  497 ASN C N     1 
ATOM   8001  C  CA    . ASN C 2 118 ? 52.137  18.324  18.244  1.00 92.36  ?  497 ASN C CA    1 
ATOM   8002  C  C     . ASN C 2 118 ? 51.603  16.927  17.938  1.00 87.61  ?  497 ASN C C     1 
ATOM   8003  O  O     . ASN C 2 118 ? 51.562  16.512  16.773  1.00 89.64  ?  497 ASN C O     1 
ATOM   8004  C  CB    . ASN C 2 118 ? 53.624  18.416  17.899  1.00 91.52  ?  497 ASN C CB    1 
ATOM   8005  C  CG    . ASN C 2 118 ? 54.065  19.840  17.626  1.00 95.78  ?  497 ASN C CG    1 
ATOM   8006  O  OD1   . ASN C 2 118 ? 53.254  20.769  17.666  1.00 100.99 ?  497 ASN C OD1   1 
ATOM   8007  N  ND2   . ASN C 2 118 ? 55.353  20.026  17.351  1.00 94.69  ?  497 ASN C ND2   1 
ATOM   8008  N  N     . TYR C 2 119 ? 51.175  16.219  18.981  1.00 81.35  ?  498 TYR C N     1 
ATOM   8009  C  CA    . TYR C 2 119 ? 50.730  14.841  18.839  1.00 77.75  ?  498 TYR C CA    1 
ATOM   8010  C  C     . TYR C 2 119 ? 49.510  14.556  19.707  1.00 82.35  ?  498 TYR C C     1 
ATOM   8011  O  O     . TYR C 2 119 ? 49.430  15.014  20.840  1.00 80.25  ?  498 TYR C O     1 
ATOM   8012  C  CB    . TYR C 2 119 ? 51.876  13.891  19.198  1.00 73.35  ?  498 TYR C CB    1 
ATOM   8013  C  CG    . TYR C 2 119 ? 53.119  14.119  18.360  1.00 75.39  ?  498 TYR C CG    1 
ATOM   8014  C  CD1   . TYR C 2 119 ? 53.295  13.460  17.134  1.00 75.16  ?  498 TYR C CD1   1 
ATOM   8015  C  CD2   . TYR C 2 119 ? 54.111  15.006  18.776  1.00 75.85  ?  498 TYR C CD2   1 
ATOM   8016  C  CE1   . TYR C 2 119 ? 54.434  13.674  16.353  1.00 73.19  ?  498 TYR C CE1   1 
ATOM   8017  C  CE2   . TYR C 2 119 ? 55.254  15.229  18.001  1.00 75.30  ?  498 TYR C CE2   1 
ATOM   8018  C  CZ    . TYR C 2 119 ? 55.407  14.561  16.793  1.00 72.12  ?  498 TYR C CZ    1 
ATOM   8019  O  OH    . TYR C 2 119 ? 56.528  14.778  16.030  1.00 68.83  ?  498 TYR C OH    1 
ATOM   8020  N  N     . ASP C 2 120 ? 48.554  13.810  19.169  1.00 89.88  ?  499 ASP C N     1 
ATOM   8021  C  CA    . ASP C 2 120 ? 47.404  13.372  19.954  1.00 97.38  ?  499 ASP C CA    1 
ATOM   8022  C  C     . ASP C 2 120 ? 47.839  12.306  20.966  1.00 92.82  ?  499 ASP C C     1 
ATOM   8023  O  O     . ASP C 2 120 ? 47.399  12.299  22.121  1.00 92.75  ?  499 ASP C O     1 
ATOM   8024  C  CB    . ASP C 2 120 ? 46.296  12.840  19.032  1.00 104.23 ?  499 ASP C CB    1 
ATOM   8025  C  CG    . ASP C 2 120 ? 45.209  12.074  19.786  1.00 108.11 ?  499 ASP C CG    1 
ATOM   8026  O  OD1   . ASP C 2 120 ? 44.487  12.694  20.601  1.00 110.42 ?  499 ASP C OD1   1 
ATOM   8027  O  OD2   . ASP C 2 120 ? 45.064  10.854  19.541  1.00 108.39 ?  499 ASP C OD2   1 
ATOM   8028  N  N     . LYS C 2 121 ? 48.710  11.407  20.519  1.00 88.38  ?  500 LYS C N     1 
ATOM   8029  C  CA    . LYS C 2 121 ? 49.217  10.339  21.370  1.00 84.35  ?  500 LYS C CA    1 
ATOM   8030  C  C     . LYS C 2 121 ? 50.730  10.432  21.484  1.00 83.87  ?  500 LYS C C     1 
ATOM   8031  O  O     . LYS C 2 121 ? 51.405  10.987  20.612  1.00 89.74  ?  500 LYS C O     1 
ATOM   8032  C  CB    . LYS C 2 121 ? 48.790  8.959   20.840  1.00 82.03  ?  500 LYS C CB    1 
ATOM   8033  C  CG    . LYS C 2 121 ? 47.348  8.584   21.198  1.00 81.67  ?  500 LYS C CG    1 
ATOM   8034  C  CD    . LYS C 2 121 ? 46.720  7.565   20.244  1.00 79.20  ?  500 LYS C CD    1 
ATOM   8035  C  CE    . LYS C 2 121 ? 45.196  7.520   20.444  1.00 80.07  ?  500 LYS C CE    1 
ATOM   8036  N  NZ    . LYS C 2 121 ? 44.465  6.628   19.493  1.00 79.35  ?  500 LYS C NZ    1 
ATOM   8037  N  N     . ILE C 2 122 ? 51.254  9.907   22.583  1.00 77.16  ?  501 ILE C N     1 
ATOM   8038  C  CA    . ILE C 2 122 ? 52.690  9.800   22.767  1.00 69.24  ?  501 ILE C CA    1 
ATOM   8039  C  C     . ILE C 2 122 ? 52.964  8.403   23.270  1.00 65.71  ?  501 ILE C C     1 
ATOM   8040  O  O     . ILE C 2 122 ? 52.537  8.026   24.349  1.00 67.20  ?  501 ILE C O     1 
ATOM   8041  C  CB    . ILE C 2 122 ? 53.222  10.870  23.731  1.00 68.44  ?  501 ILE C CB    1 
ATOM   8042  C  CG1   . ILE C 2 122 ? 53.032  12.260  23.100  1.00 56.90  ?  501 ILE C CG1   1 
ATOM   8043  C  CG2   . ILE C 2 122 ? 54.672  10.599  24.080  1.00 53.85  ?  501 ILE C CG2   1 
ATOM   8044  C  CD1   . ILE C 2 122 ? 54.106  13.276  23.451  1.00 56.57  ?  501 ILE C CD1   1 
ATOM   8045  N  N     . ILE C 2 123 ? 53.651  7.617   22.460  1.00 65.26  ?  502 ILE C N     1 
ATOM   8046  C  CA    . ILE C 2 123 ? 53.832  6.209   22.770  1.00 65.22  ?  502 ILE C CA    1 
ATOM   8047  C  C     . ILE C 2 123 ? 55.271  5.842   23.160  1.00 66.57  ?  502 ILE C C     1 
ATOM   8048  O  O     . ILE C 2 123 ? 56.211  6.070   22.397  1.00 65.68  ?  502 ILE C O     1 
ATOM   8049  C  CB    . ILE C 2 123 ? 53.354  5.349   21.599  1.00 62.55  ?  502 ILE C CB    1 
ATOM   8050  C  CG1   . ILE C 2 123 ? 51.918  5.728   21.244  1.00 63.54  ?  502 ILE C CG1   1 
ATOM   8051  C  CG2   . ILE C 2 123 ? 53.433  3.884   21.950  1.00 62.93  ?  502 ILE C CG2   1 
ATOM   8052  C  CD1   . ILE C 2 123 ? 51.334  4.912   20.111  1.00 63.81  ?  502 ILE C CD1   1 
ATOM   8053  N  N     . ILE C 2 124 ? 55.427  5.287   24.362  1.00 65.89  ?  503 ILE C N     1 
ATOM   8054  C  CA    . ILE C 2 124 ? 56.711  4.779   24.826  1.00 61.42  ?  503 ILE C CA    1 
ATOM   8055  C  C     . ILE C 2 124 ? 56.843  3.301   24.493  1.00 62.89  ?  503 ILE C C     1 
ATOM   8056  O  O     . ILE C 2 124 ? 56.241  2.450   25.138  1.00 63.01  ?  503 ILE C O     1 
ATOM   8057  C  CB    . ILE C 2 124 ? 56.855  4.911   26.335  1.00 58.37  ?  503 ILE C CB    1 
ATOM   8058  C  CG1   . ILE C 2 124 ? 56.620  6.348   26.784  1.00 58.39  ?  503 ILE C CG1   1 
ATOM   8059  C  CG2   . ILE C 2 124 ? 58.224  4.429   26.770  1.00 55.14  ?  503 ILE C CG2   1 
ATOM   8060  C  CD1   . ILE C 2 124 ? 56.511  6.462   28.283  1.00 49.29  ?  503 ILE C CD1   1 
ATOM   8061  N  N     . MET C 2 125 ? 57.647  2.999   23.486  1.00 64.98  ?  504 MET C N     1 
ATOM   8062  C  CA    . MET C 2 125 ? 57.796  1.637   23.015  1.00 68.31  ?  504 MET C CA    1 
ATOM   8063  C  C     . MET C 2 125 ? 59.183  1.126   23.397  1.00 70.08  ?  504 MET C C     1 
ATOM   8064  O  O     . MET C 2 125 ? 60.174  1.526   22.789  1.00 71.55  ?  504 MET C O     1 
ATOM   8065  C  CB    . MET C 2 125 ? 57.610  1.613   21.497  1.00 67.26  ?  504 MET C CB    1 
ATOM   8066  C  CG    . MET C 2 125 ? 57.248  0.260   20.913  1.00 65.55  ?  504 MET C CG    1 
ATOM   8067  S  SD    . MET C 2 125 ? 56.959  0.345   19.128  1.00 65.80  ?  504 MET C SD    1 
ATOM   8068  C  CE    . MET C 2 125 ? 58.550  0.922   18.554  1.00 89.51  ?  504 MET C CE    1 
ATOM   8069  N  N     . THR C 2 126 ? 59.255  0.267   24.417  1.00 69.67  ?  505 THR C N     1 
ATOM   8070  C  CA    . THR C 2 126 ? 60.537  -0.314  24.839  1.00 70.02  ?  505 THR C CA    1 
ATOM   8071  C  C     . THR C 2 126 ? 60.588  -1.823  24.671  1.00 72.77  ?  505 THR C C     1 
ATOM   8072  O  O     . THR C 2 126 ? 59.577  -2.463  24.393  1.00 76.74  ?  505 THR C O     1 
ATOM   8073  C  CB    . THR C 2 126 ? 60.881  -0.025  26.317  1.00 69.35  ?  505 THR C CB    1 
ATOM   8074  O  OG1   . THR C 2 126 ? 59.854  -0.552  27.160  1.00 71.43  ?  505 THR C OG1   1 
ATOM   8075  C  CG2   . THR C 2 126 ? 61.041  1.463   26.568  1.00 69.74  ?  505 THR C CG2   1 
ATOM   8076  N  N     . ASP C 2 127 ? 61.781  -2.382  24.852  1.00 71.55  ?  506 ASP C N     1 
ATOM   8077  C  CA    . ASP C 2 127 ? 61.959  -3.825  24.872  1.00 71.43  ?  506 ASP C CA    1 
ATOM   8078  C  C     . ASP C 2 127 ? 61.136  -4.369  26.026  1.00 65.11  ?  506 ASP C C     1 
ATOM   8079  O  O     . ASP C 2 127 ? 60.954  -3.695  27.047  1.00 61.26  ?  506 ASP C O     1 
ATOM   8080  C  CB    . ASP C 2 127 ? 63.433  -4.188  25.083  1.00 81.09  ?  506 ASP C CB    1 
ATOM   8081  C  CG    . ASP C 2 127 ? 64.257  -4.112  23.805  1.00 91.17  ?  506 ASP C CG    1 
ATOM   8082  O  OD1   . ASP C 2 127 ? 63.839  -3.428  22.839  1.00 93.14  ?  506 ASP C OD1   1 
ATOM   8083  O  OD2   . ASP C 2 127 ? 65.342  -4.739  23.779  1.00 94.69  ?  506 ASP C OD2   1 
ATOM   8084  N  N     . ALA C 2 128 ? 60.637  -5.588  25.865  1.00 65.00  ?  507 ALA C N     1 
ATOM   8085  C  CA    . ALA C 2 128 ? 59.918  -6.251  26.942  1.00 65.13  ?  507 ALA C CA    1 
ATOM   8086  C  C     . ALA C 2 128 ? 60.892  -6.863  27.948  1.00 69.76  ?  507 ALA C C     1 
ATOM   8087  O  O     . ALA C 2 128 ? 60.583  -7.857  28.594  1.00 75.91  ?  507 ALA C O     1 
ATOM   8088  C  CB    . ALA C 2 128 ? 58.999  -7.308  26.384  1.00 63.83  ?  507 ALA C CB    1 
ATOM   8089  N  N     . ASP C 2 129 ? 62.079  -6.279  28.071  1.00 67.35  ?  508 ASP C N     1 
ATOM   8090  C  CA    . ASP C 2 129 ? 62.991  -6.690  29.132  1.00 59.22  ?  508 ASP C CA    1 
ATOM   8091  C  C     . ASP C 2 129 ? 62.929  -5.768  30.365  1.00 54.78  ?  508 ASP C C     1 
ATOM   8092  O  O     . ASP C 2 129 ? 62.038  -4.921  30.507  1.00 44.17  ?  508 ASP C O     1 
ATOM   8093  C  CB    . ASP C 2 129 ? 64.438  -6.955  28.633  1.00 78.57  ?  508 ASP C CB    1 
ATOM   8094  C  CG    . ASP C 2 129 ? 65.068  -5.772  27.889  1.00 83.80  ?  508 ASP C CG    1 
ATOM   8095  O  OD1   . ASP C 2 129 ? 64.695  -4.605  28.148  1.00 83.45  ?  508 ASP C OD1   1 
ATOM   8096  O  OD2   . ASP C 2 129 ? 65.970  -6.034  27.047  1.00 89.25  ?  508 ASP C OD2   1 
ATOM   8097  N  N     . THR C 2 130 ? 63.864  -5.966  31.276  1.00 58.65  ?  509 THR C N     1 
ATOM   8098  C  CA    . THR C 2 130 ? 63.866  -5.209  32.504  1.00 58.07  ?  509 THR C CA    1 
ATOM   8099  C  C     . THR C 2 130 ? 64.354  -3.783  32.265  1.00 57.42  ?  509 THR C C     1 
ATOM   8100  O  O     . THR C 2 130 ? 63.744  -2.833  32.745  1.00 59.58  ?  509 THR C O     1 
ATOM   8101  C  CB    . THR C 2 130 ? 64.676  -5.936  33.577  1.00 58.72  ?  509 THR C CB    1 
ATOM   8102  O  OG1   . THR C 2 130 ? 65.866  -6.467  32.984  1.00 62.27  ?  509 THR C OG1   1 
ATOM   8103  C  CG2   . THR C 2 130 ? 63.861  -7.090  34.117  1.00 58.23  ?  509 THR C CG2   1 
ATOM   8104  N  N     . ASP C 2 131 ? 65.431  -3.633  31.501  1.00 55.89  ?  510 ASP C N     1 
ATOM   8105  C  CA    . ASP C 2 131 ? 65.918  -2.304  31.138  1.00 55.98  ?  510 ASP C CA    1 
ATOM   8106  C  C     . ASP C 2 131 ? 64.876  -1.562  30.326  1.00 52.65  ?  510 ASP C C     1 
ATOM   8107  O  O     . ASP C 2 131 ? 64.832  -0.336  30.338  1.00 53.36  ?  510 ASP C O     1 
ATOM   8108  C  CB    . ASP C 2 131 ? 67.230  -2.382  30.363  1.00 59.38  ?  510 ASP C CB    1 
ATOM   8109  C  CG    . ASP C 2 131 ? 68.238  -3.295  31.028  1.00 62.55  ?  510 ASP C CG    1 
ATOM   8110  O  OD1   . ASP C 2 131 ? 69.082  -2.795  31.816  1.00 57.60  ?  510 ASP C OD1   1 
ATOM   8111  O  OD2   . ASP C 2 131 ? 68.162  -4.520  30.769  1.00 67.83  ?  510 ASP C OD2   1 
ATOM   8112  N  N     . GLY C 2 132 ? 64.031  -2.304  29.623  1.00 51.57  ?  511 GLY C N     1 
ATOM   8113  C  CA    . GLY C 2 132 ? 62.917  -1.685  28.935  1.00 51.98  ?  511 GLY C CA    1 
ATOM   8114  C  C     . GLY C 2 132 ? 62.042  -1.062  29.991  1.00 50.36  ?  511 GLY C C     1 
ATOM   8115  O  O     . GLY C 2 132 ? 61.691  0.112   29.923  1.00 48.96  ?  511 GLY C O     1 
ATOM   8116  N  N     . ALA C 2 133 ? 61.705  -1.873  30.985  1.00 51.22  ?  512 ALA C N     1 
ATOM   8117  C  CA    . ALA C 2 133 ? 60.938  -1.421  32.128  1.00 50.23  ?  512 ALA C CA    1 
ATOM   8118  C  C     . ALA C 2 133 ? 61.569  -0.171  32.750  1.00 50.41  ?  512 ALA C C     1 
ATOM   8119  O  O     . ALA C 2 133 ? 60.880  0.809   33.051  1.00 49.00  ?  512 ALA C O     1 
ATOM   8120  C  CB    . ALA C 2 133 ? 60.840  -2.542  33.152  1.00 45.99  ?  512 ALA C CB    1 
ATOM   8121  N  N     . HIS C 2 134 ? 62.885  -0.214  32.930  1.00 50.44  ?  513 HIS C N     1 
ATOM   8122  C  CA    . HIS C 2 134 ? 63.607  0.886   33.555  1.00 48.66  ?  513 HIS C CA    1 
ATOM   8123  C  C     . HIS C 2 134 ? 63.488  2.174   32.741  1.00 46.98  ?  513 HIS C C     1 
ATOM   8124  O  O     . HIS C 2 134 ? 63.414  3.269   33.306  1.00 44.34  ?  513 HIS C O     1 
ATOM   8125  C  CB    . HIS C 2 134 ? 65.078  0.512   33.770  1.00 48.56  ?  513 HIS C CB    1 
ATOM   8126  C  CG    . HIS C 2 134 ? 65.850  1.520   34.562  1.00 52.07  ?  513 HIS C CG    1 
ATOM   8127  N  ND1   . HIS C 2 134 ? 67.137  1.897   34.235  1.00 57.16  ?  513 HIS C ND1   1 
ATOM   8128  C  CD2   . HIS C 2 134 ? 65.524  2.226   35.670  1.00 54.40  ?  513 HIS C CD2   1 
ATOM   8129  C  CE1   . HIS C 2 134 ? 67.566  2.796   35.103  1.00 58.66  ?  513 HIS C CE1   1 
ATOM   8130  N  NE2   . HIS C 2 134 ? 66.606  3.014   35.984  1.00 57.39  ?  513 HIS C NE2   1 
ATOM   8131  N  N     . ILE C 2 135 ? 63.470  2.042   31.418  1.00 46.89  ?  514 ILE C N     1 
ATOM   8132  C  CA    . ILE C 2 135 ? 63.384  3.214   30.562  1.00 47.99  ?  514 ILE C CA    1 
ATOM   8133  C  C     . ILE C 2 135 ? 61.972  3.774   30.621  1.00 53.42  ?  514 ILE C C     1 
ATOM   8134  O  O     . ILE C 2 135 ? 61.794  4.989   30.681  1.00 62.09  ?  514 ILE C O     1 
ATOM   8135  C  CB    . ILE C 2 135 ? 63.838  2.946   29.090  1.00 48.98  ?  514 ILE C CB    1 
ATOM   8136  C  CG1   . ILE C 2 135 ? 65.300  3.332   28.904  1.00 50.94  ?  514 ILE C CG1   1 
ATOM   8137  C  CG2   . ILE C 2 135 ? 63.033  3.780   28.115  1.00 50.75  ?  514 ILE C CG2   1 
ATOM   8138  C  CD1   . ILE C 2 135 ? 66.252  2.186   29.117  1.00 53.80  ?  514 ILE C CD1   1 
ATOM   8139  N  N     . GLN C 2 136 ? 60.970  2.897   30.614  1.00 50.29  ?  515 GLN C N     1 
ATOM   8140  C  CA    . GLN C 2 136 ? 59.591  3.346   30.760  1.00 53.02  ?  515 GLN C CA    1 
ATOM   8141  C  C     . GLN C 2 136 ? 59.486  4.171   32.035  1.00 55.55  ?  515 GLN C C     1 
ATOM   8142  O  O     . GLN C 2 136 ? 58.806  5.197   32.091  1.00 53.65  ?  515 GLN C O     1 
ATOM   8143  C  CB    . GLN C 2 136 ? 58.643  2.161   30.852  1.00 53.98  ?  515 GLN C CB    1 
ATOM   8144  C  CG    . GLN C 2 136 ? 58.665  1.247   29.657  1.00 57.23  ?  515 GLN C CG    1 
ATOM   8145  C  CD    . GLN C 2 136 ? 57.559  0.224   29.743  1.00 60.53  ?  515 GLN C CD    1 
ATOM   8146  O  OE1   . GLN C 2 136 ? 56.898  0.106   30.773  1.00 59.90  ?  515 GLN C OE1   1 
ATOM   8147  N  NE2   . GLN C 2 136 ? 57.337  -0.511  28.663  1.00 61.41  ?  515 GLN C NE2   1 
ATOM   8148  N  N     . THR C 2 137 ? 60.201  3.710   33.051  1.00 57.75  ?  516 THR C N     1 
ATOM   8149  C  CA    . THR C 2 137 ? 60.194  4.320   34.368  1.00 55.90  ?  516 THR C CA    1 
ATOM   8150  C  C     . THR C 2 137 ? 60.770  5.735   34.385  1.00 58.52  ?  516 THR C C     1 
ATOM   8151  O  O     . THR C 2 137 ? 60.220  6.621   35.024  1.00 63.73  ?  516 THR C O     1 
ATOM   8152  C  CB    . THR C 2 137 ? 60.951  3.422   35.364  1.00 50.35  ?  516 THR C CB    1 
ATOM   8153  O  OG1   . THR C 2 137 ? 60.008  2.731   36.196  1.00 47.46  ?  516 THR C OG1   1 
ATOM   8154  C  CG2   . THR C 2 137 ? 61.885  4.243   36.226  1.00 50.19  ?  516 THR C CG2   1 
ATOM   8155  N  N     . LEU C 2 138 ? 61.879  5.943   33.690  1.00 55.16  ?  517 LEU C N     1 
ATOM   8156  C  CA    . LEU C 2 138 ? 62.531  7.250   33.648  1.00 55.55  ?  517 LEU C CA    1 
ATOM   8157  C  C     . LEU C 2 138 ? 61.769  8.248   32.779  1.00 59.69  ?  517 LEU C C     1 
ATOM   8158  O  O     . LEU C 2 138 ? 61.693  9.435   33.102  1.00 63.40  ?  517 LEU C O     1 
ATOM   8159  C  CB    . LEU C 2 138 ? 63.953  7.103   33.116  1.00 53.25  ?  517 LEU C CB    1 
ATOM   8160  C  CG    . LEU C 2 138 ? 64.855  6.222   33.968  1.00 52.30  ?  517 LEU C CG    1 
ATOM   8161  C  CD1   . LEU C 2 138 ? 65.725  5.348   33.086  1.00 49.55  ?  517 LEU C CD1   1 
ATOM   8162  C  CD2   . LEU C 2 138 ? 65.696  7.094   34.887  1.00 54.10  ?  517 LEU C CD2   1 
ATOM   8163  N  N     . LEU C 2 139 ? 61.227  7.768   31.664  1.00 58.76  ?  518 LEU C N     1 
ATOM   8164  C  CA    . LEU C 2 139 ? 60.387  8.599   30.820  1.00 60.91  ?  518 LEU C CA    1 
ATOM   8165  C  C     . LEU C 2 139 ? 59.180  9.072   31.614  1.00 64.77  ?  518 LEU C C     1 
ATOM   8166  O  O     . LEU C 2 139 ? 58.921  10.275  31.703  1.00 68.20  ?  518 LEU C O     1 
ATOM   8167  C  CB    . LEU C 2 139 ? 59.939  7.844   29.569  1.00 61.66  ?  518 LEU C CB    1 
ATOM   8168  C  CG    . LEU C 2 139 ? 60.985  7.736   28.458  1.00 62.69  ?  518 LEU C CG    1 
ATOM   8169  C  CD1   . LEU C 2 139 ? 60.433  6.975   27.267  1.00 66.36  ?  518 LEU C CD1   1 
ATOM   8170  C  CD2   . LEU C 2 139 ? 61.491  9.109   28.038  1.00 61.13  ?  518 LEU C CD2   1 
ATOM   8171  N  N     . LEU C 2 140 ? 58.448  8.127   32.201  1.00 64.55  ?  519 LEU C N     1 
ATOM   8172  C  CA    . LEU C 2 140 ? 57.267  8.473   32.999  1.00 63.62  ?  519 LEU C CA    1 
ATOM   8173  C  C     . LEU C 2 140 ? 57.534  9.554   34.053  1.00 59.13  ?  519 LEU C C     1 
ATOM   8174  O  O     . LEU C 2 140 ? 56.747  10.489  34.183  1.00 56.15  ?  519 LEU C O     1 
ATOM   8175  C  CB    . LEU C 2 140 ? 56.616  7.230   33.624  1.00 62.88  ?  519 LEU C CB    1 
ATOM   8176  C  CG    . LEU C 2 140 ? 55.879  6.360   32.598  1.00 63.28  ?  519 LEU C CG    1 
ATOM   8177  C  CD1   . LEU C 2 140 ? 54.926  5.349   33.251  1.00 64.88  ?  519 LEU C CD1   1 
ATOM   8178  C  CD2   . LEU C 2 140 ? 55.136  7.252   31.611  1.00 62.69  ?  519 LEU C CD2   1 
ATOM   8179  N  N     . THR C 2 141 ? 58.640  9.454   34.786  1.00 56.87  ?  520 THR C N     1 
ATOM   8180  C  CA    . THR C 2 141 ? 58.906  10.459  35.812  1.00 61.58  ?  520 THR C CA    1 
ATOM   8181  C  C     . THR C 2 141 ? 59.160  11.820  35.183  1.00 64.76  ?  520 THR C C     1 
ATOM   8182  O  O     . THR C 2 141 ? 58.784  12.843  35.749  1.00 67.34  ?  520 THR C O     1 
ATOM   8183  C  CB    . THR C 2 141 ? 60.032  10.070  36.851  1.00 57.78  ?  520 THR C CB    1 
ATOM   8184  O  OG1   . THR C 2 141 ? 61.282  10.685  36.506  1.00 56.52  ?  520 THR C OG1   1 
ATOM   8185  C  CG2   . THR C 2 141 ? 60.183  8.548   36.991  1.00 56.13  ?  520 THR C CG2   1 
ATOM   8186  N  N     . PHE C 2 142 ? 59.772  11.838  34.005  1.00 65.22  ?  521 PHE C N     1 
ATOM   8187  C  CA    . PHE C 2 142 ? 59.982  13.102  33.300  1.00 67.34  ?  521 PHE C CA    1 
ATOM   8188  C  C     . PHE C 2 142 ? 58.663  13.739  32.844  1.00 72.52  ?  521 PHE C C     1 
ATOM   8189  O  O     . PHE C 2 142 ? 58.507  14.963  32.899  1.00 70.40  ?  521 PHE C O     1 
ATOM   8190  C  CB    . PHE C 2 142 ? 60.918  12.918  32.104  1.00 61.84  ?  521 PHE C CB    1 
ATOM   8191  C  CG    . PHE C 2 142 ? 60.981  14.114  31.191  1.00 62.92  ?  521 PHE C CG    1 
ATOM   8192  C  CD1   . PHE C 2 142 ? 60.188  14.180  30.051  1.00 60.32  ?  521 PHE C CD1   1 
ATOM   8193  C  CD2   . PHE C 2 142 ? 61.834  15.177  31.466  1.00 65.70  ?  521 PHE C CD2   1 
ATOM   8194  C  CE1   . PHE C 2 142 ? 60.250  15.282  29.200  1.00 58.82  ?  521 PHE C CE1   1 
ATOM   8195  C  CE2   . PHE C 2 142 ? 61.900  16.285  30.616  1.00 61.98  ?  521 PHE C CE2   1 
ATOM   8196  C  CZ    . PHE C 2 142 ? 61.105  16.332  29.486  1.00 58.67  ?  521 PHE C CZ    1 
ATOM   8197  N  N     . PHE C 2 143 ? 57.721  12.909  32.397  1.00 76.65  ?  522 PHE C N     1 
ATOM   8198  C  CA    . PHE C 2 143 ? 56.442  13.404  31.894  1.00 80.32  ?  522 PHE C CA    1 
ATOM   8199  C  C     . PHE C 2 143 ? 55.528  13.836  33.028  1.00 79.90  ?  522 PHE C C     1 
ATOM   8200  O  O     . PHE C 2 143 ? 54.623  14.650  32.839  1.00 81.85  ?  522 PHE C O     1 
ATOM   8201  C  CB    . PHE C 2 143 ? 55.750  12.357  31.015  1.00 82.34  ?  522 PHE C CB    1 
ATOM   8202  C  CG    . PHE C 2 143 ? 56.387  12.189  29.666  1.00 84.36  ?  522 PHE C CG    1 
ATOM   8203  C  CD1   . PHE C 2 143 ? 56.949  13.273  29.015  1.00 86.52  ?  522 PHE C CD1   1 
ATOM   8204  C  CD2   . PHE C 2 143 ? 56.444  10.948  29.059  1.00 87.05  ?  522 PHE C CD2   1 
ATOM   8205  C  CE1   . PHE C 2 143 ? 57.554  13.127  27.775  1.00 88.23  ?  522 PHE C CE1   1 
ATOM   8206  C  CE2   . PHE C 2 143 ? 57.051  10.794  27.821  1.00 89.03  ?  522 PHE C CE2   1 
ATOM   8207  C  CZ    . PHE C 2 143 ? 57.604  11.890  27.177  1.00 88.79  ?  522 PHE C CZ    1 
ATOM   8208  N  N     . TYR C 2 144 ? 55.771  13.284  34.209  1.00 79.39  ?  523 TYR C N     1 
ATOM   8209  C  CA    . TYR C 2 144 ? 55.019  13.657  35.397  1.00 80.27  ?  523 TYR C CA    1 
ATOM   8210  C  C     . TYR C 2 144 ? 55.640  14.909  36.032  1.00 79.43  ?  523 TYR C C     1 
ATOM   8211  O  O     . TYR C 2 144 ? 54.935  15.859  36.371  1.00 82.50  ?  523 TYR C O     1 
ATOM   8212  C  CB    . TYR C 2 144 ? 54.969  12.477  36.375  1.00 78.80  ?  523 TYR C CB    1 
ATOM   8213  C  CG    . TYR C 2 144 ? 54.453  12.807  37.750  1.00 80.86  ?  523 TYR C CG    1 
ATOM   8214  C  CD1   . TYR C 2 144 ? 53.130  12.565  38.095  1.00 83.00  ?  523 TYR C CD1   1 
ATOM   8215  C  CD2   . TYR C 2 144 ? 55.298  13.347  38.715  1.00 83.80  ?  523 TYR C CD2   1 
ATOM   8216  C  CE1   . TYR C 2 144 ? 52.655  12.865  39.366  1.00 87.29  ?  523 TYR C CE1   1 
ATOM   8217  C  CE2   . TYR C 2 144 ? 54.839  13.652  39.984  1.00 86.90  ?  523 TYR C CE2   1 
ATOM   8218  C  CZ    . TYR C 2 144 ? 53.516  13.411  40.308  1.00 88.52  ?  523 TYR C CZ    1 
ATOM   8219  O  OH    . TYR C 2 144 ? 53.060  13.712  41.571  1.00 89.35  ?  523 TYR C OH    1 
ATOM   8220  N  N     . ARG C 2 145 ? 56.964  14.918  36.165  1.00 75.65  ?  524 ARG C N     1 
ATOM   8221  C  CA    . ARG C 2 145 ? 57.664  16.061  36.747  1.00 75.42  ?  524 ARG C CA    1 
ATOM   8222  C  C     . ARG C 2 145 ? 57.558  17.319  35.885  1.00 78.68  ?  524 ARG C C     1 
ATOM   8223  O  O     . ARG C 2 145 ? 57.538  18.423  36.419  1.00 80.90  ?  524 ARG C O     1 
ATOM   8224  C  CB    . ARG C 2 145 ? 59.151  15.746  37.006  1.00 76.16  ?  524 ARG C CB    1 
ATOM   8225  C  CG    . ARG C 2 145 ? 59.464  14.868  38.234  1.00 78.68  ?  524 ARG C CG    1 
ATOM   8226  C  CD    . ARG C 2 145 ? 58.993  15.514  39.546  1.00 82.57  ?  524 ARG C CD    1 
ATOM   8227  N  NE    . ARG C 2 145 ? 60.049  15.635  40.551  1.00 84.42  ?  524 ARG C NE    1 
ATOM   8228  C  CZ    . ARG C 2 145 ? 61.214  16.253  40.355  1.00 88.71  ?  524 ARG C CZ    1 
ATOM   8229  N  NH1   . ARG C 2 145 ? 61.503  16.808  39.181  1.00 83.79  ?  524 ARG C NH1   1 
ATOM   8230  N  NH2   . ARG C 2 145 ? 62.103  16.310  41.341  1.00 95.08  ?  524 ARG C NH2   1 
ATOM   8231  N  N     . TYR C 2 146 ? 57.490  17.163  34.561  1.00 82.50  ?  525 TYR C N     1 
ATOM   8232  C  CA    . TYR C 2 146 ? 57.711  18.305  33.663  1.00 86.35  ?  525 TYR C CA    1 
ATOM   8233  C  C     . TYR C 2 146 ? 56.697  18.523  32.528  1.00 87.14  ?  525 TYR C C     1 
ATOM   8234  O  O     . TYR C 2 146 ? 56.890  19.404  31.687  1.00 90.51  ?  525 TYR C O     1 
ATOM   8235  C  CB    . TYR C 2 146 ? 59.134  18.253  33.089  1.00 86.01  ?  525 TYR C CB    1 
ATOM   8236  C  CG    . TYR C 2 146 ? 60.209  18.552  34.105  1.00 87.87  ?  525 TYR C CG    1 
ATOM   8237  C  CD1   . TYR C 2 146 ? 60.707  17.550  34.931  1.00 89.42  ?  525 TYR C CD1   1 
ATOM   8238  C  CD2   . TYR C 2 146 ? 60.727  19.835  34.246  1.00 90.03  ?  525 TYR C CD2   1 
ATOM   8239  C  CE1   . TYR C 2 146 ? 61.694  17.813  35.873  1.00 91.18  ?  525 TYR C CE1   1 
ATOM   8240  C  CE2   . TYR C 2 146 ? 61.717  20.113  35.183  1.00 92.53  ?  525 TYR C CE2   1 
ATOM   8241  C  CZ    . TYR C 2 146 ? 62.197  19.096  35.995  1.00 93.93  ?  525 TYR C CZ    1 
ATOM   8242  O  OH    . TYR C 2 146 ? 63.181  19.353  36.931  1.00 95.84  ?  525 TYR C OH    1 
ATOM   8243  N  N     . MET C 2 147 ? 55.630  17.728  32.501  1.00 82.51  ?  526 MET C N     1 
ATOM   8244  C  CA    . MET C 2 147 ? 54.576  17.876  31.496  1.00 78.39  ?  526 MET C CA    1 
ATOM   8245  C  C     . MET C 2 147 ? 53.323  17.183  31.997  1.00 75.25  ?  526 MET C C     1 
ATOM   8246  O  O     . MET C 2 147 ? 52.728  16.374  31.278  1.00 74.48  ?  526 MET C O     1 
ATOM   8247  C  CB    . MET C 2 147 ? 54.981  17.250  30.157  1.00 77.73  ?  526 MET C CB    1 
ATOM   8248  C  CG    . MET C 2 147 ? 56.116  17.953  29.420  1.00 80.14  ?  526 MET C CG    1 
ATOM   8249  S  SD    . MET C 2 147 ? 56.703  17.060  27.948  1.00 108.70 ?  526 MET C SD    1 
ATOM   8250  C  CE    . MET C 2 147 ? 55.184  16.299  27.389  1.00 123.93 ?  526 MET C CE    1 
ATOM   8251  N  N     . ARG C 2 148 ? 52.930  17.493  33.233  1.00 74.29  ?  527 ARG C N     1 
ATOM   8252  C  CA    . ARG C 2 148 ? 51.814  16.792  33.871  1.00 75.22  ?  527 ARG C CA    1 
ATOM   8253  C  C     . ARG C 2 148 ? 50.558  16.799  32.993  1.00 79.51  ?  527 ARG C C     1 
ATOM   8254  O  O     . ARG C 2 148 ? 49.933  15.748  32.807  1.00 75.58  ?  527 ARG C O     1 
ATOM   8255  C  CB    . ARG C 2 148 ? 51.532  17.321  35.293  1.00 74.60  ?  527 ARG C CB    1 
ATOM   8256  N  N     . PRO C 2 149 ? 50.206  17.977  32.433  1.00 85.73  ?  528 PRO C N     1 
ATOM   8257  C  CA    . PRO C 2 149 ? 49.068  18.146  31.519  1.00 89.28  ?  528 PRO C CA    1 
ATOM   8258  C  C     . PRO C 2 149 ? 48.890  16.929  30.624  1.00 91.81  ?  528 PRO C C     1 
ATOM   8259  O  O     . PRO C 2 149 ? 47.770  16.423  30.476  1.00 94.05  ?  528 PRO C O     1 
ATOM   8260  C  CB    . PRO C 2 149 ? 49.491  19.346  30.670  1.00 88.31  ?  528 PRO C CB    1 
ATOM   8261  C  CG    . PRO C 2 149 ? 50.303  20.177  31.606  1.00 86.70  ?  528 PRO C CG    1 
ATOM   8262  C  CD    . PRO C 2 149 ? 50.979  19.226  32.572  1.00 84.92  ?  528 PRO C CD    1 
ATOM   8263  N  N     . LEU C 2 150 ? 50.003  16.475  30.048  1.00 89.39  ?  529 LEU C N     1 
ATOM   8264  C  CA    . LEU C 2 150 ? 50.035  15.312  29.173  1.00 86.87  ?  529 LEU C CA    1 
ATOM   8265  C  C     . LEU C 2 150 ? 49.641  13.986  29.849  1.00 90.97  ?  529 LEU C C     1 
ATOM   8266  O  O     . LEU C 2 150 ? 48.879  13.195  29.282  1.00 87.90  ?  529 LEU C O     1 
ATOM   8267  C  CB    . LEU C 2 150 ? 51.410  15.202  28.517  1.00 79.99  ?  529 LEU C CB    1 
ATOM   8268  C  CG    . LEU C 2 150 ? 51.432  15.838  27.132  1.00 79.51  ?  529 LEU C CG    1 
ATOM   8269  C  CD1   . LEU C 2 150 ? 52.742  15.580  26.416  1.00 75.83  ?  529 LEU C CD1   1 
ATOM   8270  C  CD2   . LEU C 2 150 ? 50.269  15.296  26.323  1.00 81.66  ?  529 LEU C CD2   1 
ATOM   8271  N  N     . VAL C 2 151 ? 50.153  13.736  31.053  1.00 96.08  ?  530 VAL C N     1 
ATOM   8272  C  CA    . VAL C 2 151 ? 49.821  12.489  31.741  1.00 96.97  ?  530 VAL C CA    1 
ATOM   8273  C  C     . VAL C 2 151 ? 48.398  12.535  32.298  1.00 98.79  ?  530 VAL C C     1 
ATOM   8274  O  O     . VAL C 2 151 ? 47.682  11.533  32.238  1.00 100.09 ?  530 VAL C O     1 
ATOM   8275  C  CB    . VAL C 2 151 ? 50.852  12.108  32.835  1.00 59.24  ?  530 VAL C CB    1 
ATOM   8276  N  N     . GLU C 2 152 ? 47.991  13.703  32.809  1.00 99.18  ?  531 GLU C N     1 
ATOM   8277  C  CA    . GLU C 2 152 ? 46.638  13.911  33.361  1.00 99.31  ?  531 GLU C CA    1 
ATOM   8278  C  C     . GLU C 2 152 ? 45.582  14.079  32.255  1.00 100.51 ?  531 GLU C C     1 
ATOM   8279  O  O     . GLU C 2 152 ? 44.375  13.978  32.503  1.00 97.37  ?  531 GLU C O     1 
ATOM   8280  C  CB    . GLU C 2 152 ? 46.606  15.108  34.331  1.00 96.01  ?  531 GLU C CB    1 
ATOM   8281  N  N     . ALA C 2 153 ? 46.049  14.326  31.035  1.00 102.14 ?  532 ALA C N     1 
ATOM   8282  C  CA    . ALA C 2 153 ? 45.170  14.412  29.877  1.00 104.25 ?  532 ALA C CA    1 
ATOM   8283  C  C     . ALA C 2 153 ? 44.990  13.052  29.192  1.00 105.87 ?  532 ALA C C     1 
ATOM   8284  O  O     . ALA C 2 153 ? 44.142  12.906  28.312  1.00 106.10 ?  532 ALA C O     1 
ATOM   8285  C  CB    . ALA C 2 153 ? 45.698  15.440  28.887  1.00 102.20 ?  532 ALA C CB    1 
ATOM   8286  N  N     . GLY C 2 154 ? 45.799  12.068  29.585  1.00 104.94 ?  533 GLY C N     1 
ATOM   8287  C  CA    . GLY C 2 154 ? 45.694  10.721  29.040  1.00 103.95 ?  533 GLY C CA    1 
ATOM   8288  C  C     . GLY C 2 154 ? 46.262  10.569  27.639  1.00 100.13 ?  533 GLY C C     1 
ATOM   8289  O  O     . GLY C 2 154 ? 45.822  9.723   26.859  1.00 98.97  ?  533 GLY C O     1 
ATOM   8290  N  N     . HIS C 2 155 ? 47.252  11.395  27.325  1.00 97.36  ?  534 HIS C N     1 
ATOM   8291  C  CA    . HIS C 2 155 ? 47.893  11.378  26.018  1.00 94.51  ?  534 HIS C CA    1 
ATOM   8292  C  C     . HIS C 2 155 ? 49.147  10.492  26.004  1.00 91.23  ?  534 HIS C C     1 
ATOM   8293  O  O     . HIS C 2 155 ? 49.667  10.150  24.941  1.00 96.46  ?  534 HIS C O     1 
ATOM   8294  C  CB    . HIS C 2 155 ? 48.258  12.807  25.599  1.00 94.81  ?  534 HIS C CB    1 
ATOM   8295  C  CG    . HIS C 2 155 ? 47.149  13.543  24.910  1.00 94.71  ?  534 HIS C CG    1 
ATOM   8296  N  ND1   . HIS C 2 155 ? 45.867  13.045  24.815  1.00 96.84  ?  534 HIS C ND1   1 
ATOM   8297  C  CD2   . HIS C 2 155 ? 47.137  14.735  24.267  1.00 94.26  ?  534 HIS C CD2   1 
ATOM   8298  C  CE1   . HIS C 2 155 ? 45.112  13.903  24.153  1.00 99.03  ?  534 HIS C CE1   1 
ATOM   8299  N  NE2   . HIS C 2 155 ? 45.859  14.935  23.805  1.00 96.93  ?  534 HIS C NE2   1 
ATOM   8300  N  N     . VAL C 2 156 ? 49.634  10.125  27.185  1.00 82.14  ?  535 VAL C N     1 
ATOM   8301  C  CA    . VAL C 2 156 ? 50.844  9.324   27.280  1.00 71.69  ?  535 VAL C CA    1 
ATOM   8302  C  C     . VAL C 2 156 ? 50.496  7.853   27.442  1.00 68.52  ?  535 VAL C C     1 
ATOM   8303  O  O     . VAL C 2 156 ? 49.778  7.472   28.361  1.00 72.05  ?  535 VAL C O     1 
ATOM   8304  C  CB    . VAL C 2 156 ? 51.752  9.789   28.433  1.00 69.94  ?  535 VAL C CB    1 
ATOM   8305  C  CG1   . VAL C 2 156 ? 53.065  9.040   28.395  1.00 66.63  ?  535 VAL C CG1   1 
ATOM   8306  C  CG2   . VAL C 2 156 ? 52.020  11.276  28.330  1.00 71.85  ?  535 VAL C CG2   1 
ATOM   8307  N  N     . TYR C 2 157 ? 51.015  7.034   26.534  1.00 67.80  ?  536 TYR C N     1 
ATOM   8308  C  CA    . TYR C 2 157 ? 50.700  5.613   26.475  1.00 70.75  ?  536 TYR C CA    1 
ATOM   8309  C  C     . TYR C 2 157 ? 51.965  4.766   26.531  1.00 70.82  ?  536 TYR C C     1 
ATOM   8310  O  O     . TYR C 2 157 ? 53.081  5.278   26.423  1.00 72.85  ?  536 TYR C O     1 
ATOM   8311  C  CB    . TYR C 2 157 ? 49.975  5.301   25.166  1.00 71.85  ?  536 TYR C CB    1 
ATOM   8312  C  CG    . TYR C 2 157 ? 48.708  6.091   24.942  1.00 73.30  ?  536 TYR C CG    1 
ATOM   8313  C  CD1   . TYR C 2 157 ? 47.481  5.452   24.826  1.00 72.49  ?  536 TYR C CD1   1 
ATOM   8314  C  CD2   . TYR C 2 157 ? 48.737  7.474   24.840  1.00 76.79  ?  536 TYR C CD2   1 
ATOM   8315  C  CE1   . TYR C 2 157 ? 46.320  6.168   24.611  1.00 76.85  ?  536 TYR C CE1   1 
ATOM   8316  C  CE2   . TYR C 2 157 ? 47.578  8.200   24.631  1.00 81.16  ?  536 TYR C CE2   1 
ATOM   8317  C  CZ    . TYR C 2 157 ? 46.370  7.543   24.516  1.00 79.37  ?  536 TYR C CZ    1 
ATOM   8318  O  OH    . TYR C 2 157 ? 45.212  8.262   24.307  1.00 76.24  ?  536 TYR C OH    1 
ATOM   8319  N  N     . ILE C 2 158 ? 51.792  3.460   26.683  1.00 66.22  ?  537 ILE C N     1 
ATOM   8320  C  CA    . ILE C 2 158 ? 52.926  2.554   26.632  1.00 64.90  ?  537 ILE C CA    1 
ATOM   8321  C  C     . ILE C 2 158 ? 52.586  1.329   25.800  1.00 68.73  ?  537 ILE C C     1 
ATOM   8322  O  O     . ILE C 2 158 ? 51.605  0.635   26.064  1.00 70.85  ?  537 ILE C O     1 
ATOM   8323  C  CB    . ILE C 2 158 ? 53.392  2.153   28.035  1.00 66.36  ?  537 ILE C CB    1 
ATOM   8324  C  CG1   . ILE C 2 158 ? 54.037  3.357   28.721  1.00 71.06  ?  537 ILE C CG1   1 
ATOM   8325  C  CG2   . ILE C 2 158 ? 54.392  1.017   27.960  1.00 64.93  ?  537 ILE C CG2   1 
ATOM   8326  C  CD1   . ILE C 2 158 ? 54.113  3.245   30.222  1.00 74.62  ?  537 ILE C CD1   1 
ATOM   8327  N  N     . ALA C 2 159 ? 53.399  1.084   24.777  1.00 70.95  ?  538 ALA C N     1 
ATOM   8328  C  CA    . ALA C 2 159 ? 53.178  -0.021  23.855  1.00 71.38  ?  538 ALA C CA    1 
ATOM   8329  C  C     . ALA C 2 159 ? 53.363  -1.356  24.551  1.00 72.91  ?  538 ALA C C     1 
ATOM   8330  O  O     . ALA C 2 159 ? 54.137  -1.470  25.497  1.00 73.03  ?  538 ALA C O     1 
ATOM   8331  C  CB    . ALA C 2 159 ? 54.121  0.088   22.670  1.00 71.14  ?  538 ALA C CB    1 
ATOM   8332  N  N     . LEU C 2 160 ? 52.644  -2.365  24.085  1.00 79.40  ?  539 LEU C N     1 
ATOM   8333  C  CA    . LEU C 2 160 ? 52.811  -3.707  24.614  1.00 87.60  ?  539 LEU C CA    1 
ATOM   8334  C  C     . LEU C 2 160 ? 53.219  -4.632  23.469  1.00 88.52  ?  539 LEU C C     1 
ATOM   8335  O  O     . LEU C 2 160 ? 52.360  -5.130  22.741  1.00 88.78  ?  539 LEU C O     1 
ATOM   8336  C  CB    . LEU C 2 160 ? 51.516  -4.201  25.294  1.00 94.37  ?  539 LEU C CB    1 
ATOM   8337  C  CG    . LEU C 2 160 ? 51.031  -3.593  26.621  1.00 54.52  ?  539 LEU C CG    1 
ATOM   8338  N  N     . PRO C 2 161 ? 54.536  -4.841  23.288  1.00 84.47  ?  540 PRO C N     1 
ATOM   8339  C  CA    . PRO C 2 161 ? 55.018  -5.774  22.262  1.00 84.09  ?  540 PRO C CA    1 
ATOM   8340  C  C     . PRO C 2 161 ? 54.686  -7.183  22.699  1.00 90.50  ?  540 PRO C C     1 
ATOM   8341  O  O     . PRO C 2 161 ? 54.533  -7.407  23.902  1.00 94.01  ?  540 PRO C O     1 
ATOM   8342  C  CB    . PRO C 2 161 ? 56.540  -5.590  22.284  1.00 81.84  ?  540 PRO C CB    1 
ATOM   8343  C  CG    . PRO C 2 161 ? 56.786  -4.358  23.089  1.00 82.49  ?  540 PRO C CG    1 
ATOM   8344  C  CD    . PRO C 2 161 ? 55.642  -4.231  24.039  1.00 83.87  ?  540 PRO C CD    1 
ATOM   8345  N  N     . PRO C 2 162 ? 54.562  -8.118  21.746  1.00 91.76  ?  541 PRO C N     1 
ATOM   8346  C  CA    . PRO C 2 162 ? 54.324  -9.520  22.104  1.00 92.81  ?  541 PRO C CA    1 
ATOM   8347  C  C     . PRO C 2 162 ? 55.576  -10.141 22.716  1.00 92.92  ?  541 PRO C C     1 
ATOM   8348  O  O     . PRO C 2 162 ? 56.687  -9.681  22.438  1.00 92.94  ?  541 PRO C O     1 
ATOM   8349  C  CB    . PRO C 2 162 ? 53.992  -10.178 20.758  1.00 92.88  ?  541 PRO C CB    1 
ATOM   8350  C  CG    . PRO C 2 162 ? 54.637  -9.312  19.739  1.00 90.82  ?  541 PRO C CG    1 
ATOM   8351  C  CD    . PRO C 2 162 ? 54.603  -7.910  20.288  1.00 90.48  ?  541 PRO C CD    1 
ATOM   8352  N  N     . LEU C 2 163 ? 55.397  -11.160 23.553  1.00 93.06  ?  542 LEU C N     1 
ATOM   8353  C  CA    . LEU C 2 163 ? 56.528  -11.855 24.163  1.00 90.82  ?  542 LEU C CA    1 
ATOM   8354  C  C     . LEU C 2 163 ? 56.832  -13.177 23.441  1.00 98.86  ?  542 LEU C C     1 
ATOM   8355  O  O     . LEU C 2 163 ? 57.939  -13.712 23.551  1.00 100.45 ?  542 LEU C O     1 
ATOM   8356  C  CB    . LEU C 2 163 ? 56.286  -12.092 25.666  1.00 81.84  ?  542 LEU C CB    1 
ATOM   8357  C  CG    . LEU C 2 163 ? 56.238  -10.894 26.628  1.00 71.65  ?  542 LEU C CG    1 
ATOM   8358  N  N     . TYR C 2 164 ? 55.856  -13.688 22.689  1.00 100.83 ?  543 TYR C N     1 
ATOM   8359  C  CA    . TYR C 2 164 ? 55.997  -14.988 22.034  1.00 102.05 ?  543 TYR C CA    1 
ATOM   8360  C  C     . TYR C 2 164 ? 55.330  -15.061 20.653  1.00 96.96  ?  543 TYR C C     1 
ATOM   8361  O  O     . TYR C 2 164 ? 54.429  -14.276 20.349  1.00 93.16  ?  543 TYR C O     1 
ATOM   8362  C  CB    . TYR C 2 164 ? 55.399  -16.087 22.915  1.00 109.42 ?  543 TYR C CB    1 
ATOM   8363  C  CG    . TYR C 2 164 ? 55.859  -16.112 24.362  1.00 114.28 ?  543 TYR C CG    1 
ATOM   8364  C  CD1   . TYR C 2 164 ? 56.985  -16.834 24.746  1.00 117.95 ?  543 TYR C CD1   1 
ATOM   8365  C  CD2   . TYR C 2 164 ? 55.139  -15.450 25.350  1.00 114.95 ?  543 TYR C CD2   1 
ATOM   8366  C  CE1   . TYR C 2 164 ? 57.392  -16.877 26.074  1.00 121.59 ?  543 TYR C CE1   1 
ATOM   8367  C  CE2   . TYR C 2 164 ? 55.538  -15.486 26.676  1.00 118.55 ?  543 TYR C CE2   1 
ATOM   8368  C  CZ    . TYR C 2 164 ? 56.663  -16.201 27.035  1.00 121.94 ?  543 TYR C CZ    1 
ATOM   8369  O  OH    . TYR C 2 164 ? 57.051  -16.238 28.360  1.00 124.57 ?  543 TYR C OH    1 
ATOM   8370  N  N     . LYS C 2 165 ? 55.776  -16.017 19.833  1.00 97.65  ?  544 LYS C N     1 
ATOM   8371  C  CA    . LYS C 2 165 ? 55.132  -16.332 18.548  1.00 96.52  ?  544 LYS C CA    1 
ATOM   8372  C  C     . LYS C 2 165 ? 54.906  -17.842 18.370  1.00 100.54 ?  544 LYS C C     1 
ATOM   8373  O  O     . LYS C 2 165 ? 55.845  -18.641 18.419  1.00 102.45 ?  544 LYS C O     1 
ATOM   8374  C  CB    . LYS C 2 165 ? 55.929  -15.771 17.361  1.00 90.75  ?  544 LYS C CB    1 
ATOM   8375  N  N     . ALA C 2 177 ? 50.273  -17.276 15.288  1.00 93.12  ?  556 ALA C N     1 
ATOM   8376  C  CA    . ALA C 2 177 ? 49.656  -16.428 16.312  1.00 96.54  ?  556 ALA C CA    1 
ATOM   8377  C  C     . ALA C 2 177 ? 50.694  -15.799 17.245  1.00 104.08 ?  556 ALA C C     1 
ATOM   8378  O  O     . ALA C 2 177 ? 51.865  -16.182 17.226  1.00 112.28 ?  556 ALA C O     1 
ATOM   8379  C  CB    . ALA C 2 177 ? 48.635  -17.222 17.117  1.00 96.56  ?  556 ALA C CB    1 
ATOM   8380  N  N     . TYR C 2 178 ? 50.261  -14.840 18.062  1.00 101.24 ?  557 TYR C N     1 
ATOM   8381  C  CA    . TYR C 2 178 ? 51.151  -14.178 19.018  1.00 95.49  ?  557 TYR C CA    1 
ATOM   8382  C  C     . TYR C 2 178 ? 50.578  -14.199 20.426  1.00 97.05  ?  557 TYR C C     1 
ATOM   8383  O  O     . TYR C 2 178 ? 49.366  -14.100 20.610  1.00 97.22  ?  557 TYR C O     1 
ATOM   8384  C  CB    . TYR C 2 178 ? 51.406  -12.725 18.620  1.00 88.00  ?  557 TYR C CB    1 
ATOM   8385  C  CG    . TYR C 2 178 ? 52.030  -12.548 17.261  1.00 85.22  ?  557 TYR C CG    1 
ATOM   8386  C  CD1   . TYR C 2 178 ? 51.239  -12.318 16.139  1.00 84.14  ?  557 TYR C CD1   1 
ATOM   8387  C  CD2   . TYR C 2 178 ? 53.409  -12.599 17.096  1.00 86.29  ?  557 TYR C CD2   1 
ATOM   8388  C  CE1   . TYR C 2 178 ? 51.801  -12.144 14.887  1.00 84.28  ?  557 TYR C CE1   1 
ATOM   8389  C  CE2   . TYR C 2 178 ? 53.983  -12.426 15.850  1.00 88.00  ?  557 TYR C CE2   1 
ATOM   8390  C  CZ    . TYR C 2 178 ? 53.172  -12.196 14.747  1.00 87.09  ?  557 TYR C CZ    1 
ATOM   8391  O  OH    . TYR C 2 178 ? 53.734  -12.019 13.501  1.00 86.44  ?  557 TYR C OH    1 
ATOM   8392  N  N     . ALA C 2 179 ? 51.462  -14.306 21.416  1.00 98.14  ?  558 ALA C N     1 
ATOM   8393  C  CA    . ALA C 2 179 ? 51.057  -14.322 22.818  1.00 99.46  ?  558 ALA C CA    1 
ATOM   8394  C  C     . ALA C 2 179 ? 51.821  -13.282 23.639  1.00 97.97  ?  558 ALA C C     1 
ATOM   8395  O  O     . ALA C 2 179 ? 53.009  -13.053 23.409  1.00 98.35  ?  558 ALA C O     1 
ATOM   8396  C  CB    . ALA C 2 179 ? 51.244  -15.716 23.410  1.00 102.81 ?  558 ALA C CB    1 
ATOM   8397  N  N     . TRP C 2 180 ? 51.131  -12.663 24.597  1.00 97.71  ?  559 TRP C N     1 
ATOM   8398  C  CA    . TRP C 2 180 ? 51.718  -11.626 25.451  1.00 98.85  ?  559 TRP C CA    1 
ATOM   8399  C  C     . TRP C 2 180 ? 52.058  -12.115 26.863  1.00 104.27 ?  559 TRP C C     1 
ATOM   8400  O  O     . TRP C 2 180 ? 52.897  -11.527 27.548  1.00 102.42 ?  559 TRP C O     1 
ATOM   8401  C  CB    . TRP C 2 180 ? 50.778  -10.421 25.546  1.00 99.53  ?  559 TRP C CB    1 
ATOM   8402  C  CG    . TRP C 2 180 ? 50.838  -9.503  24.363  1.00 100.11 ?  559 TRP C CG    1 
ATOM   8403  C  CD1   . TRP C 2 180 ? 51.376  -8.248  24.325  1.00 98.55  ?  559 TRP C CD1   1 
ATOM   8404  C  CD2   . TRP C 2 180 ? 50.343  -9.769  23.044  1.00 101.18 ?  559 TRP C CD2   1 
ATOM   8405  N  NE1   . TRP C 2 180 ? 51.246  -7.716  23.066  1.00 98.46  ?  559 TRP C NE1   1 
ATOM   8406  C  CE2   . TRP C 2 180 ? 50.615  -8.628  22.260  1.00 98.48  ?  559 TRP C CE2   1 
ATOM   8407  C  CE3   . TRP C 2 180 ? 49.696  -10.859 22.450  1.00 101.83 ?  559 TRP C CE3   1 
ATOM   8408  C  CZ2   . TRP C 2 180 ? 50.265  -8.548  20.913  1.00 95.33  ?  559 TRP C CZ2   1 
ATOM   8409  C  CZ3   . TRP C 2 180 ? 49.351  -10.777 21.117  1.00 99.49  ?  559 TRP C CZ3   1 
ATOM   8410  C  CH2   . TRP C 2 180 ? 49.636  -9.630  20.362  1.00 96.82  ?  559 TRP C CH2   1 
ATOM   8411  N  N     . THR C 2 181 ? 51.396  -13.186 27.292  1.00 110.14 ?  560 THR C N     1 
ATOM   8412  C  CA    . THR C 2 181 ? 51.584  -13.736 28.632  1.00 113.12 ?  560 THR C CA    1 
ATOM   8413  C  C     . THR C 2 181 ? 51.910  -15.228 28.586  1.00 119.86 ?  560 THR C C     1 
ATOM   8414  O  O     . THR C 2 181 ? 51.373  -15.964 27.755  1.00 121.53 ?  560 THR C O     1 
ATOM   8415  C  CB    . THR C 2 181 ? 50.321  -13.543 29.500  1.00 113.17 ?  560 THR C CB    1 
ATOM   8416  N  N     . ASP C 2 182 ? 52.788  -15.669 29.483  1.00 123.10 ?  561 ASP C N     1 
ATOM   8417  C  CA    . ASP C 2 182 ? 53.065  -17.093 29.641  1.00 124.63 ?  561 ASP C CA    1 
ATOM   8418  C  C     . ASP C 2 182 ? 51.754  -17.833 29.930  1.00 129.24 ?  561 ASP C C     1 
ATOM   8419  O  O     . ASP C 2 182 ? 51.687  -19.063 29.855  1.00 130.74 ?  561 ASP C O     1 
ATOM   8420  C  CB    . ASP C 2 182 ? 54.088  -17.322 30.757  1.00 123.18 ?  561 ASP C CB    1 
ATOM   8421  N  N     . GLY C 2 183 ? 50.714  -17.063 30.247  1.00 131.63 ?  562 GLY C N     1 
ATOM   8422  C  CA    . GLY C 2 183 ? 49.382  -17.596 30.469  1.00 137.95 ?  562 GLY C CA    1 
ATOM   8423  C  C     . GLY C 2 183 ? 48.643  -17.872 29.171  1.00 140.28 ?  562 GLY C C     1 
ATOM   8424  O  O     . GLY C 2 183 ? 48.081  -18.956 28.998  1.00 144.74 ?  562 GLY C O     1 
ATOM   8425  N  N     . GLU C 2 184 ? 48.641  -16.899 28.258  1.00 136.76 ?  563 GLU C N     1 
ATOM   8426  C  CA    . GLU C 2 184 ? 47.979  -17.072 26.962  1.00 136.97 ?  563 GLU C CA    1 
ATOM   8427  C  C     . GLU C 2 184 ? 48.834  -17.843 25.953  1.00 138.30 ?  563 GLU C C     1 
ATOM   8428  O  O     . GLU C 2 184 ? 48.460  -17.985 24.787  1.00 138.29 ?  563 GLU C O     1 
ATOM   8429  C  CB    . GLU C 2 184 ? 47.519  -15.732 26.366  1.00 130.73 ?  563 GLU C CB    1 
ATOM   8430  C  CG    . GLU C 2 184 ? 48.177  -14.482 26.939  1.00 126.80 ?  563 GLU C CG    1 
ATOM   8431  C  CD    . GLU C 2 184 ? 47.805  -13.223 26.155  1.00 125.09 ?  563 GLU C CD    1 
ATOM   8432  O  OE1   . GLU C 2 184 ? 48.137  -13.152 24.953  1.00 124.52 ?  563 GLU C OE1   1 
ATOM   8433  O  OE2   . GLU C 2 184 ? 47.176  -12.306 26.728  1.00 124.67 ?  563 GLU C OE2   1 
ATOM   8434  N  N     . LEU C 2 185 ? 49.976  -18.346 26.412  1.00 138.29 ?  564 LEU C N     1 
ATOM   8435  C  CA    . LEU C 2 185 ? 50.872  -19.132 25.569  1.00 134.83 ?  564 LEU C CA    1 
ATOM   8436  C  C     . LEU C 2 185 ? 50.379  -20.580 25.451  1.00 140.16 ?  564 LEU C C     1 
ATOM   8437  O  O     . LEU C 2 185 ? 49.895  -20.990 24.395  1.00 140.68 ?  564 LEU C O     1 
ATOM   8438  C  CB    . LEU C 2 185 ? 52.299  -19.094 26.127  1.00 130.11 ?  564 LEU C CB    1 
ATOM   8439  C  CG    . LEU C 2 185 ? 53.493  -19.207 25.171  1.00 122.17 ?  564 LEU C CG    1 
ATOM   8440  C  CD1   . LEU C 2 185 ? 54.788  -19.280 25.961  1.00 121.48 ?  564 LEU C CD1   1 
ATOM   8441  C  CD2   . LEU C 2 185 ? 53.375  -20.403 24.238  1.00 122.69 ?  564 LEU C CD2   1 
ATOM   8442  N  N     . GLU C 2 186 ? 50.495  -21.345 26.535  1.00 144.47 ?  565 GLU C N     1 
ATOM   8443  C  CA    . GLU C 2 186 ? 50.077  -22.747 26.535  1.00 148.29 ?  565 GLU C CA    1 
ATOM   8444  C  C     . GLU C 2 186 ? 48.631  -22.896 26.065  1.00 149.81 ?  565 GLU C C     1 
ATOM   8445  O  O     . GLU C 2 186 ? 48.204  -23.984 25.667  1.00 153.70 ?  565 GLU C O     1 
ATOM   8446  C  CB    . GLU C 2 186 ? 50.254  -23.364 27.923  1.00 152.73 ?  565 GLU C CB    1 
ATOM   8447  N  N     . GLU C 2 187 ? 47.883  -21.796 26.121  1.00 146.32 ?  566 GLU C N     1 
ATOM   8448  C  CA    . GLU C 2 187 ? 46.537  -21.745 25.563  1.00 146.38 ?  566 GLU C CA    1 
ATOM   8449  C  C     . GLU C 2 187 ? 46.625  -21.613 24.045  1.00 142.67 ?  566 GLU C C     1 
ATOM   8450  O  O     . GLU C 2 187 ? 45.674  -21.921 23.322  1.00 142.22 ?  566 GLU C O     1 
ATOM   8451  C  CB    . GLU C 2 187 ? 45.754  -20.572 26.156  1.00 144.19 ?  566 GLU C CB    1 
ATOM   8452  N  N     . LEU C 2 188 ? 47.781  -21.148 23.575  1.00 138.58 ?  567 LEU C N     1 
ATOM   8453  C  CA    . LEU C 2 188 ? 48.069  -21.062 22.144  1.00 133.44 ?  567 LEU C CA    1 
ATOM   8454  C  C     . LEU C 2 188 ? 48.771  -22.331 21.663  1.00 134.43 ?  567 LEU C C     1 
ATOM   8455  O  O     . LEU C 2 188 ? 49.008  -22.507 20.466  1.00 132.95 ?  567 LEU C O     1 
ATOM   8456  C  CB    . LEU C 2 188 ? 48.927  -19.829 21.828  1.00 124.25 ?  567 LEU C CB    1 
ATOM   8457  N  N     . ARG C 2 189 ? 49.098  -23.211 22.607  1.00 136.49 ?  568 ARG C N     1 
ATOM   8458  C  CA    . ARG C 2 189 ? 49.708  -24.501 22.291  1.00 137.25 ?  568 ARG C CA    1 
ATOM   8459  C  C     . ARG C 2 189 ? 48.699  -25.431 21.609  1.00 140.21 ?  568 ARG C C     1 
ATOM   8460  O  O     . ARG C 2 189 ? 48.997  -26.595 21.323  1.00 144.26 ?  568 ARG C O     1 
ATOM   8461  C  CB    . ARG C 2 189 ? 50.277  -25.150 23.556  1.00 140.72 ?  568 ARG C CB    1 
ATOM   8462  N  N     . LYS C 2 190 ? 47.505  -24.901 21.353  1.00 137.56 ?  569 LYS C N     1 
ATOM   8463  C  CA    . LYS C 2 190 ? 46.465  -25.625 20.631  1.00 133.77 ?  569 LYS C CA    1 
ATOM   8464  C  C     . LYS C 2 190 ? 46.589  -25.388 19.126  1.00 121.26 ?  569 LYS C C     1 
ATOM   8465  O  O     . LYS C 2 190 ? 47.541  -25.850 18.492  1.00 114.98 ?  569 LYS C O     1 
ATOM   8466  C  CB    . LYS C 2 190 ? 45.080  -25.197 21.122  1.00 136.13 ?  569 LYS C CB    1 
ATOM   8467  N  N     . LEU C 2 198 ? 57.756  -21.941 19.470  1.00 78.86  ?  577 LEU C N     1 
ATOM   8468  C  CA    . LEU C 2 198 ? 57.754  -20.656 20.167  1.00 114.49 ?  577 LEU C CA    1 
ATOM   8469  C  C     . LEU C 2 198 ? 58.997  -19.832 19.825  1.00 107.87 ?  577 LEU C C     1 
ATOM   8470  O  O     . LEU C 2 198 ? 60.120  -20.333 19.899  1.00 104.05 ?  577 LEU C O     1 
ATOM   8471  C  CB    . LEU C 2 198 ? 57.662  -20.860 21.685  1.00 79.42  ?  577 LEU C CB    1 
ATOM   8472  N  N     . GLN C 2 199 ? 58.796  -18.571 19.446  1.00 100.26 ?  578 GLN C N     1 
ATOM   8473  C  CA    . GLN C 2 199 ? 59.912  -17.666 19.168  1.00 95.76  ?  578 GLN C CA    1 
ATOM   8474  C  C     . GLN C 2 199 ? 59.962  -16.516 20.179  1.00 98.36  ?  578 GLN C C     1 
ATOM   8475  O  O     . GLN C 2 199 ? 59.520  -15.405 19.882  1.00 98.43  ?  578 GLN C O     1 
ATOM   8476  C  CB    . GLN C 2 199 ? 59.825  -17.111 17.740  1.00 86.05  ?  578 GLN C CB    1 
ATOM   8477  N  N     . ARG C 2 200 ? 60.506  -16.788 21.366  1.00 99.61  ?  579 ARG C N     1 
ATOM   8478  C  CA    . ARG C 2 200 ? 60.569  -15.808 22.458  1.00 99.69  ?  579 ARG C CA    1 
ATOM   8479  C  C     . ARG C 2 200 ? 61.334  -14.529 22.087  1.00 97.94  ?  579 ARG C C     1 
ATOM   8480  O  O     . ARG C 2 200 ? 62.536  -14.576 21.833  1.00 99.16  ?  579 ARG C O     1 
ATOM   8481  C  CB    . ARG C 2 200 ? 61.197  -16.452 23.699  1.00 102.55 ?  579 ARG C CB    1 
ATOM   8482  N  N     . TYR C 2 201 ? 60.645  -13.389 22.075  1.00 94.02  ?  580 TYR C N     1 
ATOM   8483  C  CA    . TYR C 2 201 ? 61.260  -12.139 21.619  1.00 90.55  ?  580 TYR C CA    1 
ATOM   8484  C  C     . TYR C 2 201 ? 62.205  -11.527 22.641  1.00 89.31  ?  580 TYR C C     1 
ATOM   8485  O  O     . TYR C 2 201 ? 61.765  -10.909 23.612  1.00 87.80  ?  580 TYR C O     1 
ATOM   8486  C  CB    . TYR C 2 201 ? 60.205  -11.112 21.193  1.00 90.16  ?  580 TYR C CB    1 
ATOM   8487  C  CG    . TYR C 2 201 ? 59.471  -11.490 19.925  1.00 91.41  ?  580 TYR C CG    1 
ATOM   8488  C  CD1   . TYR C 2 201 ? 60.143  -11.588 18.715  1.00 91.47  ?  580 TYR C CD1   1 
ATOM   8489  C  CD2   . TYR C 2 201 ? 58.103  -11.746 19.936  1.00 91.85  ?  580 TYR C CD2   1 
ATOM   8490  C  CE1   . TYR C 2 201 ? 59.475  -11.939 17.551  1.00 91.07  ?  580 TYR C CE1   1 
ATOM   8491  C  CE2   . TYR C 2 201 ? 57.426  -12.096 18.778  1.00 90.94  ?  580 TYR C CE2   1 
ATOM   8492  C  CZ    . TYR C 2 201 ? 58.118  -12.191 17.587  1.00 90.47  ?  580 TYR C CZ    1 
ATOM   8493  O  OH    . TYR C 2 201 ? 57.452  -12.538 16.430  1.00 89.51  ?  580 TYR C OH    1 
ATOM   8494  N  N     . LYS C 2 202 ? 63.505  -11.695 22.400  1.00 90.36  ?  581 LYS C N     1 
ATOM   8495  C  CA    . LYS C 2 202 ? 64.547  -11.156 23.275  1.00 90.35  ?  581 LYS C CA    1 
ATOM   8496  C  C     . LYS C 2 202 ? 64.540  -9.622  23.279  1.00 91.20  ?  581 LYS C C     1 
ATOM   8497  O  O     . LYS C 2 202 ? 65.213  -8.990  24.098  1.00 90.92  ?  581 LYS C O     1 
ATOM   8498  C  CB    . LYS C 2 202 ? 65.933  -11.689 22.865  1.00 87.90  ?  581 LYS C CB    1 
ATOM   8499  C  CG    . LYS C 2 202 ? 66.115  -13.210 23.005  1.00 85.76  ?  581 LYS C CG    1 
ATOM   8500  C  CD    . LYS C 2 202 ? 67.094  -13.781 21.973  1.00 84.18  ?  581 LYS C CD    1 
ATOM   8501  N  N     . GLY C 2 203 ? 63.773  -9.029  22.365  1.00 77.12  ?  582 GLY C N     1 
ATOM   8502  C  CA    . GLY C 2 203 ? 63.665  -7.580  22.274  1.00 80.18  ?  582 GLY C CA    1 
ATOM   8503  C  C     . GLY C 2 203 ? 63.076  -7.156  20.945  1.00 80.72  ?  582 GLY C C     1 
ATOM   8504  O  O     . GLY C 2 203 ? 62.958  -7.988  20.052  1.00 80.47  ?  582 GLY C O     1 
ATOM   8505  N  N     . LEU C 2 204 ? 62.704  -5.879  20.814  1.00 83.41  ?  583 LEU C N     1 
ATOM   8506  C  CA    . LEU C 2 204 ? 62.073  -5.379  19.585  1.00 86.75  ?  583 LEU C CA    1 
ATOM   8507  C  C     . LEU C 2 204 ? 62.971  -5.631  18.389  1.00 94.44  ?  583 LEU C C     1 
ATOM   8508  O  O     . LEU C 2 204 ? 62.485  -5.826  17.269  1.00 97.07  ?  583 LEU C O     1 
ATOM   8509  C  CB    . LEU C 2 204 ? 61.764  -3.882  19.663  1.00 81.29  ?  583 LEU C CB    1 
ATOM   8510  C  CG    . LEU C 2 204 ? 60.850  -3.325  20.754  1.00 79.37  ?  583 LEU C CG    1 
ATOM   8511  C  CD1   . LEU C 2 204 ? 60.613  -1.843  20.501  1.00 78.86  ?  583 LEU C CD1   1 
ATOM   8512  C  CD2   . LEU C 2 204 ? 59.522  -4.079  20.868  1.00 77.71  ?  583 LEU C CD2   1 
ATOM   8513  N  N     . GLY C 2 205 ? 64.280  -5.618  18.641  1.00 96.64  ?  584 GLY C N     1 
ATOM   8514  C  CA    . GLY C 2 205 ? 65.275  -5.929  17.632  1.00 100.33 ?  584 GLY C CA    1 
ATOM   8515  C  C     . GLY C 2 205 ? 64.828  -6.987  16.637  1.00 103.95 ?  584 GLY C C     1 
ATOM   8516  O  O     . GLY C 2 205 ? 64.517  -6.670  15.485  1.00 106.19 ?  584 GLY C O     1 
ATOM   8517  N  N     . GLU C 2 206 ? 64.773  -8.239  17.089  1.00 103.85 ?  585 GLU C N     1 
ATOM   8518  C  CA    . GLU C 2 206 ? 64.510  -9.379  16.206  1.00 105.92 ?  585 GLU C CA    1 
ATOM   8519  C  C     . GLU C 2 206 ? 63.056  -9.532  15.738  1.00 104.72 ?  585 GLU C C     1 
ATOM   8520  O  O     . GLU C 2 206 ? 62.654  -10.596 15.261  1.00 105.05 ?  585 GLU C O     1 
ATOM   8521  C  CB    . GLU C 2 206 ? 65.001  -10.682 16.843  1.00 110.90 ?  585 GLU C CB    1 
ATOM   8522  C  CG    . GLU C 2 206 ? 64.225  -11.101 18.072  1.00 117.31 ?  585 GLU C CG    1 
ATOM   8523  C  CD    . GLU C 2 206 ? 65.123  -11.341 19.266  1.00 122.07 ?  585 GLU C CD    1 
ATOM   8524  O  OE1   . GLU C 2 206 ? 64.673  -12.014 20.217  1.00 124.71 ?  585 GLU C OE1   1 
ATOM   8525  O  OE2   . GLU C 2 206 ? 66.275  -10.854 19.252  1.00 122.99 ?  585 GLU C OE2   1 
ATOM   8526  N  N     . MET C 2 207 ? 62.268  -8.475  15.858  1.00 104.79 ?  586 MET C N     1 
ATOM   8527  C  CA    . MET C 2 207 ? 60.952  -8.485  15.240  1.00 108.34 ?  586 MET C CA    1 
ATOM   8528  C  C     . MET C 2 207 ? 61.066  -7.837  13.851  1.00 108.30 ?  586 MET C C     1 
ATOM   8529  O  O     . MET C 2 207 ? 61.922  -6.973  13.628  1.00 109.53 ?  586 MET C O     1 
ATOM   8530  C  CB    . MET C 2 207 ? 59.940  -7.759  16.129  1.00 110.74 ?  586 MET C CB    1 
ATOM   8531  C  CG    . MET C 2 207 ? 58.509  -8.279  16.007  1.00 112.49 ?  586 MET C CG    1 
ATOM   8532  S  SD    . MET C 2 207 ? 57.404  -7.587  17.265  1.00 98.23  ?  586 MET C SD    1 
ATOM   8533  C  CE    . MET C 2 207 ? 58.312  -7.996  18.759  1.00 118.86 ?  586 MET C CE    1 
ATOM   8534  N  N     . ASN C 2 208 ? 60.228  -8.264  12.911  1.00 105.65 ?  587 ASN C N     1 
ATOM   8535  C  CA    . ASN C 2 208 ? 60.307  -7.745  11.548  1.00 106.01 ?  587 ASN C CA    1 
ATOM   8536  C  C     . ASN C 2 208 ? 59.108  -6.878  11.177  1.00 102.17 ?  587 ASN C C     1 
ATOM   8537  O  O     . ASN C 2 208 ? 57.963  -7.277  11.385  1.00 105.21 ?  587 ASN C O     1 
ATOM   8538  C  CB    . ASN C 2 208 ? 60.500  -8.887  10.538  1.00 113.06 ?  587 ASN C CB    1 
ATOM   8539  C  CG    . ASN C 2 208 ? 61.972  -9.294  10.378  1.00 115.43 ?  587 ASN C CG    1 
ATOM   8540  O  OD1   . ASN C 2 208 ? 62.847  -8.782  11.075  1.00 115.50 ?  587 ASN C OD1   1 
ATOM   8541  N  ND2   . ASN C 2 208 ? 62.241  -10.219 9.457   1.00 115.54 ?  587 ASN C ND2   1 
ATOM   8542  N  N     . ALA C 2 209 ? 59.390  -5.698  10.619  1.00 97.32  ?  588 ALA C N     1 
ATOM   8543  C  CA    . ALA C 2 209 ? 58.385  -4.666  10.324  1.00 93.72  ?  588 ALA C CA    1 
ATOM   8544  C  C     . ALA C 2 209 ? 56.969  -5.166  10.013  1.00 94.89  ?  588 ALA C C     1 
ATOM   8545  O  O     . ALA C 2 209 ? 55.985  -4.577  10.463  1.00 95.87  ?  588 ALA C O     1 
ATOM   8546  C  CB    . ALA C 2 209 ? 58.874  -3.747  9.222   1.00 92.14  ?  588 ALA C CB    1 
ATOM   8547  N  N     . ASP C 2 210 ? 56.857  -6.238  9.238   1.00 94.52  ?  589 ASP C N     1 
ATOM   8548  C  CA    . ASP C 2 210 ? 55.551  -6.847  9.018   1.00 94.96  ?  589 ASP C CA    1 
ATOM   8549  C  C     . ASP C 2 210 ? 54.899  -7.162  10.373  1.00 93.91  ?  589 ASP C C     1 
ATOM   8550  O  O     . ASP C 2 210 ? 53.772  -6.730  10.654  1.00 92.89  ?  589 ASP C O     1 
ATOM   8551  C  CB    . ASP C 2 210 ? 55.685  -8.116  8.170   1.00 93.79  ?  589 ASP C CB    1 
ATOM   8552  N  N     . GLN C 2 211 ? 55.637  -7.897  11.209  1.00 91.94  ?  590 GLN C N     1 
ATOM   8553  C  CA    . GLN C 2 211 ? 55.171  -8.326  12.531  1.00 88.07  ?  590 GLN C CA    1 
ATOM   8554  C  C     . GLN C 2 211 ? 54.943  -7.160  13.492  1.00 81.45  ?  590 GLN C C     1 
ATOM   8555  O  O     . GLN C 2 211 ? 53.889  -7.073  14.126  1.00 85.05  ?  590 GLN C O     1 
ATOM   8556  C  CB    . GLN C 2 211 ? 56.159  -9.322  13.156  1.00 89.58  ?  590 GLN C CB    1 
ATOM   8557  C  CG    . GLN C 2 211 ? 56.250  -10.673 12.453  1.00 91.70  ?  590 GLN C CG    1 
ATOM   8558  C  CD    . GLN C 2 211 ? 57.645  -11.268 12.533  1.00 95.16  ?  590 GLN C CD    1 
ATOM   8559  O  OE1   . GLN C 2 211 ? 58.471  -10.833 13.338  1.00 100.37 ?  590 GLN C OE1   1 
ATOM   8560  N  NE2   . GLN C 2 211 ? 57.922  -12.256 11.687  1.00 92.63  ?  590 GLN C NE2   1 
ATOM   8561  N  N     . LEU C 2 212 ? 55.927  -6.270  13.599  1.00 73.73  ?  591 LEU C N     1 
ATOM   8562  C  CA    . LEU C 2 212 ? 55.833  -5.130  14.512  1.00 72.42  ?  591 LEU C CA    1 
ATOM   8563  C  C     . LEU C 2 212 ? 54.578  -4.293  14.245  1.00 77.04  ?  591 LEU C C     1 
ATOM   8564  O  O     . LEU C 2 212 ? 53.910  -3.839  15.179  1.00 76.10  ?  591 LEU C O     1 
ATOM   8565  C  CB    . LEU C 2 212 ? 57.095  -4.255  14.433  1.00 68.77  ?  591 LEU C CB    1 
ATOM   8566  C  CG    . LEU C 2 212 ? 57.459  -3.461  15.699  1.00 66.81  ?  591 LEU C CG    1 
ATOM   8567  C  CD1   . LEU C 2 212 ? 58.715  -2.602  15.524  1.00 63.24  ?  591 LEU C CD1   1 
ATOM   8568  C  CD2   . LEU C 2 212 ? 56.284  -2.605  16.135  1.00 70.37  ?  591 LEU C CD2   1 
ATOM   8569  N  N     . TRP C 2 213 ? 54.261  -4.097  12.966  1.00 80.49  ?  592 TRP C N     1 
ATOM   8570  C  CA    . TRP C 2 213 ? 53.077  -3.335  12.586  1.00 79.46  ?  592 TRP C CA    1 
ATOM   8571  C  C     . TRP C 2 213 ? 51.807  -4.015  13.091  1.00 82.74  ?  592 TRP C C     1 
ATOM   8572  O  O     . TRP C 2 213 ? 51.071  -3.446  13.904  1.00 83.22  ?  592 TRP C O     1 
ATOM   8573  C  CB    . TRP C 2 213 ? 53.001  -3.127  11.064  1.00 74.48  ?  592 TRP C CB    1 
ATOM   8574  C  CG    . TRP C 2 213 ? 51.694  -2.510  10.641  1.00 72.68  ?  592 TRP C CG    1 
ATOM   8575  C  CD1   . TRP C 2 213 ? 50.659  -3.137  10.016  1.00 73.44  ?  592 TRP C CD1   1 
ATOM   8576  C  CD2   . TRP C 2 213 ? 51.267  -1.155  10.862  1.00 73.18  ?  592 TRP C CD2   1 
ATOM   8577  N  NE1   . TRP C 2 213 ? 49.621  -2.259  9.824   1.00 74.31  ?  592 TRP C NE1   1 
ATOM   8578  C  CE2   . TRP C 2 213 ? 49.969  -1.035  10.331  1.00 73.70  ?  592 TRP C CE2   1 
ATOM   8579  C  CE3   . TRP C 2 213 ? 51.862  -0.032  11.451  1.00 73.17  ?  592 TRP C CE3   1 
ATOM   8580  C  CZ2   . TRP C 2 213 ? 49.254  0.161   10.366  1.00 74.62  ?  592 TRP C CZ2   1 
ATOM   8581  C  CZ3   . TRP C 2 213 ? 51.151  1.158   11.486  1.00 74.16  ?  592 TRP C CZ3   1 
ATOM   8582  C  CH2   . TRP C 2 213 ? 49.858  1.243   10.949  1.00 75.14  ?  592 TRP C CH2   1 
ATOM   8583  N  N     . GLU C 2 214 ? 51.564  -5.233  12.604  1.00 83.74  ?  593 GLU C N     1 
ATOM   8584  C  CA    . GLU C 2 214 ? 50.357  -5.981  12.943  1.00 84.14  ?  593 GLU C CA    1 
ATOM   8585  C  C     . GLU C 2 214 ? 50.183  -6.134  14.459  1.00 80.39  ?  593 GLU C C     1 
ATOM   8586  O  O     . GLU C 2 214 ? 49.084  -5.928  14.995  1.00 79.55  ?  593 GLU C O     1 
ATOM   8587  C  CB    . GLU C 2 214 ? 50.371  -7.351  12.259  1.00 83.58  ?  593 GLU C CB    1 
ATOM   8588  N  N     . THR C 2 215 ? 51.281  -6.467  15.140  1.00 74.96  ?  594 THR C N     1 
ATOM   8589  C  CA    . THR C 2 215 ? 51.258  -6.768  16.572  1.00 73.10  ?  594 THR C CA    1 
ATOM   8590  C  C     . THR C 2 215 ? 51.184  -5.565  17.503  1.00 68.47  ?  594 THR C C     1 
ATOM   8591  O  O     . THR C 2 215 ? 50.464  -5.607  18.493  1.00 71.32  ?  594 THR C O     1 
ATOM   8592  C  CB    . THR C 2 215 ? 52.491  -7.567  17.007  1.00 77.33  ?  594 THR C CB    1 
ATOM   8593  O  OG1   . THR C 2 215 ? 53.668  -6.813  16.705  1.00 83.22  ?  594 THR C OG1   1 
ATOM   8594  C  CG2   . THR C 2 215 ? 52.554  -8.898  16.294  1.00 77.83  ?  594 THR C CG2   1 
ATOM   8595  N  N     . THR C 2 216 ? 51.935  -4.504  17.219  1.00 64.86  ?  595 THR C N     1 
ATOM   8596  C  CA    . THR C 2 216 ? 52.031  -3.421  18.200  1.00 64.26  ?  595 THR C CA    1 
ATOM   8597  C  C     . THR C 2 216 ? 51.936  -1.960  17.713  1.00 65.19  ?  595 THR C C     1 
ATOM   8598  O  O     . THR C 2 216 ? 51.772  -1.053  18.528  1.00 67.62  ?  595 THR C O     1 
ATOM   8599  C  CB    . THR C 2 216 ? 53.279  -3.602  19.108  1.00 56.35  ?  595 THR C CB    1 
ATOM   8600  O  OG1   . THR C 2 216 ? 54.184  -2.505  18.937  1.00 53.05  ?  595 THR C OG1   1 
ATOM   8601  C  CG2   . THR C 2 216 ? 53.991  -4.900  18.789  1.00 57.87  ?  595 THR C CG2   1 
ATOM   8602  N  N     . MET C 2 217 ? 52.025  -1.715  16.412  1.00 63.78  ?  596 MET C N     1 
ATOM   8603  C  CA    . MET C 2 217 ? 51.933  -0.338  15.925  1.00 64.49  ?  596 MET C CA    1 
ATOM   8604  C  C     . MET C 2 217 ? 50.621  -0.052  15.191  1.00 66.48  ?  596 MET C C     1 
ATOM   8605  O  O     . MET C 2 217 ? 50.209  1.099   15.040  1.00 64.48  ?  596 MET C O     1 
ATOM   8606  C  CB    . MET C 2 217 ? 53.113  -0.004  15.019  1.00 65.20  ?  596 MET C CB    1 
ATOM   8607  C  CG    . MET C 2 217 ? 54.453  -0.212  15.665  1.00 64.04  ?  596 MET C CG    1 
ATOM   8608  S  SD    . MET C 2 217 ? 55.771  0.553   14.709  1.00 71.67  ?  596 MET C SD    1 
ATOM   8609  C  CE    . MET C 2 217 ? 55.430  2.288   14.996  1.00 50.70  ?  596 MET C CE    1 
ATOM   8610  N  N     . ASN C 2 218 ? 49.972  -1.108  14.726  1.00 68.93  ?  597 ASN C N     1 
ATOM   8611  C  CA    . ASN C 2 218 ? 48.707  -0.968  14.029  1.00 70.93  ?  597 ASN C CA    1 
ATOM   8612  C  C     . ASN C 2 218 ? 47.612  -0.503  14.988  1.00 73.37  ?  597 ASN C C     1 
ATOM   8613  O  O     . ASN C 2 218 ? 47.217  -1.241  15.893  1.00 75.56  ?  597 ASN C O     1 
ATOM   8614  C  CB    . ASN C 2 218 ? 48.340  -2.304  13.387  1.00 72.55  ?  597 ASN C CB    1 
ATOM   8615  C  CG    . ASN C 2 218 ? 47.143  -2.207  12.475  1.00 74.81  ?  597 ASN C CG    1 
ATOM   8616  O  OD1   . ASN C 2 218 ? 46.568  -1.129  12.284  1.00 73.46  ?  597 ASN C OD1   1 
ATOM   8617  N  ND2   . ASN C 2 218 ? 46.759  -3.344  11.896  1.00 77.55  ?  597 ASN C ND2   1 
ATOM   8618  N  N     . PRO C 2 219 ? 47.118  0.731   14.800  1.00 73.36  ?  598 PRO C N     1 
ATOM   8619  C  CA    . PRO C 2 219 ? 46.097  1.277   15.706  1.00 73.07  ?  598 PRO C CA    1 
ATOM   8620  C  C     . PRO C 2 219 ? 44.877  0.373   15.806  1.00 78.78  ?  598 PRO C C     1 
ATOM   8621  O  O     . PRO C 2 219 ? 44.164  0.431   16.801  1.00 83.27  ?  598 PRO C O     1 
ATOM   8622  C  CB    . PRO C 2 219 ? 45.709  2.605   15.051  1.00 71.31  ?  598 PRO C CB    1 
ATOM   8623  C  CG    . PRO C 2 219 ? 46.887  2.974   14.213  1.00 73.24  ?  598 PRO C CG    1 
ATOM   8624  C  CD    . PRO C 2 219 ? 47.469  1.671   13.723  1.00 74.64  ?  598 PRO C CD    1 
ATOM   8625  N  N     . GLU C 2 220 ? 44.651  -0.455  14.789  1.00 79.88  ?  599 GLU C N     1 
ATOM   8626  C  CA    . GLU C 2 220 ? 43.500  -1.352  14.770  1.00 79.28  ?  599 GLU C CA    1 
ATOM   8627  C  C     . GLU C 2 220 ? 43.782  -2.727  15.418  1.00 82.77  ?  599 GLU C C     1 
ATOM   8628  O  O     . GLU C 2 220 ? 42.854  -3.400  15.874  1.00 84.38  ?  599 GLU C O     1 
ATOM   8629  C  CB    . GLU C 2 220 ? 42.977  -1.512  13.339  1.00 72.34  ?  599 GLU C CB    1 
ATOM   8630  N  N     . THR C 2 221 ? 45.054  -3.127  15.479  1.00 83.37  ?  600 THR C N     1 
ATOM   8631  C  CA    . THR C 2 221 ? 45.422  -4.453  15.983  1.00 84.16  ?  600 THR C CA    1 
ATOM   8632  C  C     . THR C 2 221 ? 46.225  -4.426  17.296  1.00 87.17  ?  600 THR C C     1 
ATOM   8633  O  O     . THR C 2 221 ? 46.555  -5.475  17.849  1.00 88.30  ?  600 THR C O     1 
ATOM   8634  C  CB    . THR C 2 221 ? 46.221  -5.261  14.917  1.00 60.89  ?  600 THR C CB    1 
ATOM   8635  N  N     . ARG C 2 222 ? 46.528  -3.236  17.807  1.00 85.44  ?  601 ARG C N     1 
ATOM   8636  C  CA    . ARG C 2 222 ? 47.487  -3.117  18.908  1.00 81.85  ?  601 ARG C CA    1 
ATOM   8637  C  C     . ARG C 2 222 ? 46.846  -2.967  20.285  1.00 85.02  ?  601 ARG C C     1 
ATOM   8638  O  O     . ARG C 2 222 ? 45.824  -2.291  20.438  1.00 87.64  ?  601 ARG C O     1 
ATOM   8639  C  CB    . ARG C 2 222 ? 48.429  -1.932  18.661  1.00 77.87  ?  601 ARG C CB    1 
ATOM   8640  C  CG    . ARG C 2 222 ? 47.764  -0.581  18.877  1.00 77.50  ?  601 ARG C CG    1 
ATOM   8641  C  CD    . ARG C 2 222 ? 48.598  0.598   18.382  1.00 76.14  ?  601 ARG C CD    1 
ATOM   8642  N  NE    . ARG C 2 222 ? 47.882  1.857   18.602  1.00 79.84  ?  601 ARG C NE    1 
ATOM   8643  C  CZ    . ARG C 2 222 ? 48.196  3.024   18.042  1.00 80.94  ?  601 ARG C CZ    1 
ATOM   8644  N  NH1   . ARG C 2 222 ? 49.228  3.118   17.211  1.00 78.33  ?  601 ARG C NH1   1 
ATOM   8645  N  NH2   . ARG C 2 222 ? 47.470  4.103   18.312  1.00 83.49  ?  601 ARG C NH2   1 
ATOM   8646  N  N     . THR C 2 223 ? 47.455  -3.602  21.287  1.00 85.07  ?  602 THR C N     1 
ATOM   8647  C  CA    . THR C 2 223 ? 47.129  -3.321  22.686  1.00 82.39  ?  602 THR C CA    1 
ATOM   8648  C  C     . THR C 2 223 ? 47.978  -2.128  23.106  1.00 82.70  ?  602 THR C C     1 
ATOM   8649  O  O     . THR C 2 223 ? 49.082  -1.939  22.592  1.00 84.37  ?  602 THR C O     1 
ATOM   8650  C  CB    . THR C 2 223 ? 47.411  -4.526  23.608  1.00 75.06  ?  602 THR C CB    1 
ATOM   8651  N  N     . LEU C 2 224 ? 47.474  -1.317  24.027  1.00 80.77  ?  603 LEU C N     1 
ATOM   8652  C  CA    . LEU C 2 224 ? 48.090  -0.015  24.261  1.00 78.38  ?  603 LEU C CA    1 
ATOM   8653  C  C     . LEU C 2 224 ? 47.704  0.568   25.623  1.00 76.04  ?  603 LEU C C     1 
ATOM   8654  O  O     . LEU C 2 224 ? 46.556  0.937   25.831  1.00 79.95  ?  603 LEU C O     1 
ATOM   8655  C  CB    . LEU C 2 224 ? 47.659  0.932   23.132  1.00 80.18  ?  603 LEU C CB    1 
ATOM   8656  C  CG    . LEU C 2 224 ? 48.531  2.108   22.707  1.00 78.22  ?  603 LEU C CG    1 
ATOM   8657  C  CD1   . LEU C 2 224 ? 48.614  3.115   23.830  1.00 79.30  ?  603 LEU C CD1   1 
ATOM   8658  C  CD2   . LEU C 2 224 ? 49.906  1.605   22.316  1.00 76.83  ?  603 LEU C CD2   1 
ATOM   8659  N  N     . ILE C 2 225 ? 48.661  0.653   26.545  1.00 72.41  ?  604 ILE C N     1 
ATOM   8660  C  CA    . ILE C 2 225 ? 48.371  1.117   27.908  1.00 73.27  ?  604 ILE C CA    1 
ATOM   8661  C  C     . ILE C 2 225 ? 48.279  2.628   28.017  1.00 75.32  ?  604 ILE C C     1 
ATOM   8662  O  O     . ILE C 2 225 ? 49.140  3.358   27.517  1.00 73.53  ?  604 ILE C O     1 
ATOM   8663  C  CB    . ILE C 2 225 ? 49.424  0.650   28.935  1.00 69.41  ?  604 ILE C CB    1 
ATOM   8664  C  CG1   . ILE C 2 225 ? 49.435  -0.872  29.050  1.00 67.37  ?  604 ILE C CG1   1 
ATOM   8665  C  CG2   . ILE C 2 225 ? 49.152  1.272   30.297  1.00 67.00  ?  604 ILE C CG2   1 
ATOM   8666  C  CD1   . ILE C 2 225 ? 50.292  -1.372  30.180  1.00 63.36  ?  604 ILE C CD1   1 
ATOM   8667  N  N     . ARG C 2 226 ? 47.238  3.087   28.702  1.00 77.20  ?  605 ARG C N     1 
ATOM   8668  C  CA    . ARG C 2 226 ? 47.011  4.510   28.872  1.00 78.20  ?  605 ARG C CA    1 
ATOM   8669  C  C     . ARG C 2 226 ? 47.418  4.927   30.275  1.00 78.69  ?  605 ARG C C     1 
ATOM   8670  O  O     . ARG C 2 226 ? 46.896  4.403   31.256  1.00 77.81  ?  605 ARG C O     1 
ATOM   8671  C  CB    . ARG C 2 226 ? 45.544  4.842   28.627  1.00 80.10  ?  605 ARG C CB    1 
ATOM   8672  C  CG    . ARG C 2 226 ? 45.352  6.101   27.826  1.00 83.17  ?  605 ARG C CG    1 
ATOM   8673  C  CD    . ARG C 2 226 ? 44.475  7.094   28.552  1.00 87.98  ?  605 ARG C CD    1 
ATOM   8674  N  NE    . ARG C 2 226 ? 43.690  7.874   27.603  1.00 90.43  ?  605 ARG C NE    1 
ATOM   8675  C  CZ    . ARG C 2 226 ? 42.630  7.404   26.951  1.00 90.26  ?  605 ARG C CZ    1 
ATOM   8676  N  NH1   . ARG C 2 226 ? 42.218  6.156   27.140  1.00 87.47  ?  605 ARG C NH1   1 
ATOM   8677  N  NH2   . ARG C 2 226 ? 41.980  8.184   26.103  1.00 93.69  ?  605 ARG C NH2   1 
ATOM   8678  N  N     . VAL C 2 227 ? 48.363  5.861   30.365  1.00 79.46  ?  606 VAL C N     1 
ATOM   8679  C  CA    . VAL C 2 227 ? 48.883  6.289   31.659  1.00 77.55  ?  606 VAL C CA    1 
ATOM   8680  C  C     . VAL C 2 227 ? 48.005  7.385   32.228  1.00 82.23  ?  606 VAL C C     1 
ATOM   8681  O  O     . VAL C 2 227 ? 47.737  8.397   31.571  1.00 81.72  ?  606 VAL C O     1 
ATOM   8682  C  CB    . VAL C 2 227 ? 50.348  6.767   31.589  1.00 73.11  ?  606 VAL C CB    1 
ATOM   8683  C  CG1   . VAL C 2 227 ? 50.893  6.991   32.997  1.00 70.20  ?  606 VAL C CG1   1 
ATOM   8684  C  CG2   . VAL C 2 227 ? 51.213  5.750   30.843  1.00 71.13  ?  606 VAL C CG2   1 
ATOM   8685  N  N     . THR C 2 228 ? 47.565  7.164   33.461  1.00 86.72  ?  607 THR C N     1 
ATOM   8686  C  CA    . THR C 2 228 ? 46.523  7.973   34.067  1.00 90.57  ?  607 THR C CA    1 
ATOM   8687  C  C     . THR C 2 228 ? 46.814  8.231   35.536  1.00 82.45  ?  607 THR C C     1 
ATOM   8688  O  O     . THR C 2 228 ? 46.864  7.294   36.332  1.00 78.71  ?  607 THR C O     1 
ATOM   8689  C  CB    . THR C 2 228 ? 45.163  7.251   33.978  1.00 99.27  ?  607 THR C CB    1 
ATOM   8690  O  OG1   . THR C 2 228 ? 45.192  6.066   34.790  1.00 101.81 ?  607 THR C OG1   1 
ATOM   8691  C  CG2   . THR C 2 228 ? 44.845  6.875   32.527  1.00 98.26  ?  607 THR C CG2   1 
ATOM   8692  N  N     . ILE C 2 229 ? 46.998  9.499   35.893  1.00 80.36  ?  608 ILE C N     1 
ATOM   8693  C  CA    . ILE C 2 229 ? 47.122  9.878   37.295  1.00 78.28  ?  608 ILE C CA    1 
ATOM   8694  C  C     . ILE C 2 229 ? 45.782  9.683   38.032  1.00 83.92  ?  608 ILE C C     1 
ATOM   8695  O  O     . ILE C 2 229 ? 44.823  10.419  37.784  1.00 85.22  ?  608 ILE C O     1 
ATOM   8696  C  CB    . ILE C 2 229 ? 47.619  11.333  37.447  1.00 72.77  ?  608 ILE C CB    1 
ATOM   8697  N  N     . GLU C 2 230 ? 45.721  8.681   38.918  1.00 87.29  ?  609 GLU C N     1 
ATOM   8698  C  CA    . GLU C 2 230 ? 44.519  8.401   39.722  1.00 88.78  ?  609 GLU C CA    1 
ATOM   8699  C  C     . GLU C 2 230 ? 44.469  9.193   41.054  1.00 98.61  ?  609 GLU C C     1 
ATOM   8700  O  O     . GLU C 2 230 ? 43.478  9.865   41.349  1.00 96.10  ?  609 GLU C O     1 
ATOM   8701  C  CB    . GLU C 2 230 ? 44.353  6.891   39.970  1.00 84.86  ?  609 GLU C CB    1 
ATOM   8702  N  N     . ASP C 2 231 ? 45.535  9.113   41.847  1.00 113.05 ?  610 ASP C N     1 
ATOM   8703  C  CA    . ASP C 2 231 ? 45.649  9.905   43.077  1.00 112.86 ?  610 ASP C CA    1 
ATOM   8704  C  C     . ASP C 2 231 ? 46.908  10.778  43.044  1.00 105.49 ?  610 ASP C C     1 
ATOM   8705  O  O     . ASP C 2 231 ? 48.019  10.301  43.287  1.00 102.46 ?  610 ASP C O     1 
ATOM   8706  C  CB    . ASP C 2 231 ? 45.667  8.992   44.316  1.00 115.16 ?  610 ASP C CB    1 
ATOM   8707  C  CG    . ASP C 2 231 ? 45.500  9.763   45.630  1.00 117.53 ?  610 ASP C CG    1 
ATOM   8708  O  OD1   . ASP C 2 231 ? 45.925  10.939  45.719  1.00 118.54 ?  610 ASP C OD1   1 
ATOM   8709  O  OD2   . ASP C 2 231 ? 44.939  9.181   46.582  1.00 117.86 ?  610 ASP C OD2   1 
ATOM   8710  N  N     . LEU C 2 232 ? 46.730  12.060  42.750  1.00 104.56 ?  611 LEU C N     1 
ATOM   8711  C  CA    . LEU C 2 232 ? 47.865  12.964  42.611  1.00 102.77 ?  611 LEU C CA    1 
ATOM   8712  C  C     . LEU C 2 232 ? 48.909  12.793  43.712  1.00 99.84  ?  611 LEU C C     1 
ATOM   8713  O  O     . LEU C 2 232 ? 50.107  12.775  43.441  1.00 99.13  ?  611 LEU C O     1 
ATOM   8714  C  CB    . LEU C 2 232 ? 47.392  14.415  42.573  1.00 106.29 ?  611 LEU C CB    1 
ATOM   8715  C  CG    . LEU C 2 232 ? 48.149  15.268  41.558  1.00 107.08 ?  611 LEU C CG    1 
ATOM   8716  C  CD1   . LEU C 2 232 ? 49.626  15.406  41.932  1.00 101.85 ?  611 LEU C CD1   1 
ATOM   8717  C  CD2   . LEU C 2 232 ? 47.985  14.642  40.181  1.00 109.38 ?  611 LEU C CD2   1 
ATOM   8718  N  N     . ALA C 2 233 ? 48.442  12.665  44.951  1.00 97.75  ?  612 ALA C N     1 
ATOM   8719  C  CA    . ALA C 2 233 ? 49.326  12.590  46.112  1.00 92.30  ?  612 ALA C CA    1 
ATOM   8720  C  C     . ALA C 2 233 ? 49.962  11.208  46.315  1.00 94.40  ?  612 ALA C C     1 
ATOM   8721  O  O     . ALA C 2 233 ? 51.112  11.116  46.750  1.00 95.06  ?  612 ALA C O     1 
ATOM   8722  C  CB    . ALA C 2 233 ? 48.588  13.031  47.363  1.00 89.13  ?  612 ALA C CB    1 
ATOM   8723  N  N     . ARG C 2 234 ? 49.220  10.142  46.013  1.00 97.57  ?  613 ARG C N     1 
ATOM   8724  C  CA    . ARG C 2 234 ? 49.770  8.787   46.085  1.00 95.84  ?  613 ARG C CA    1 
ATOM   8725  C  C     . ARG C 2 234 ? 50.773  8.567   44.940  1.00 95.98  ?  613 ARG C C     1 
ATOM   8726  O  O     . ARG C 2 234 ? 51.669  7.721   45.036  1.00 96.66  ?  613 ARG C O     1 
ATOM   8727  C  CB    . ARG C 2 234 ? 48.654  7.723   46.094  1.00 71.79  ?  613 ARG C CB    1 
ATOM   8728  N  N     . ALA C 2 235 ? 50.631  9.358   43.874  1.00 92.99  ?  614 ALA C N     1 
ATOM   8729  C  CA    . ALA C 2 235 ? 51.521  9.289   42.712  1.00 87.35  ?  614 ALA C CA    1 
ATOM   8730  C  C     . ALA C 2 235 ? 52.836  10.031  42.934  1.00 86.44  ?  614 ALA C C     1 
ATOM   8731  O  O     . ALA C 2 235 ? 53.893  9.550   42.540  1.00 85.51  ?  614 ALA C O     1 
ATOM   8732  C  CB    . ALA C 2 235 ? 50.827  9.821   41.473  1.00 86.74  ?  614 ALA C CB    1 
ATOM   8733  N  N     . GLU C 2 236 ? 52.773  11.206  43.551  1.00 86.82  ?  615 GLU C N     1 
ATOM   8734  C  CA    . GLU C 2 236 ? 53.982  11.966  43.864  1.00 88.10  ?  615 GLU C CA    1 
ATOM   8735  C  C     . GLU C 2 236 ? 54.877  11.228  44.859  1.00 88.71  ?  615 GLU C C     1 
ATOM   8736  O  O     . GLU C 2 236 ? 56.112  11.290  44.761  1.00 86.12  ?  615 GLU C O     1 
ATOM   8737  C  CB    . GLU C 2 236 ? 53.624  13.341  44.430  1.00 89.45  ?  615 GLU C CB    1 
ATOM   8738  C  CG    . GLU C 2 236 ? 54.807  14.113  45.007  1.00 89.52  ?  615 GLU C CG    1 
ATOM   8739  C  CD    . GLU C 2 236 ? 55.465  15.036  43.996  1.00 93.65  ?  615 GLU C CD    1 
ATOM   8740  O  OE1   . GLU C 2 236 ? 55.189  14.904  42.781  1.00 96.66  ?  615 GLU C OE1   1 
ATOM   8741  O  OE2   . GLU C 2 236 ? 56.254  15.903  44.423  1.00 94.58  ?  615 GLU C OE2   1 
ATOM   8742  N  N     . ARG C 2 237 ? 54.250  10.551  45.825  1.00 90.02  ?  616 ARG C N     1 
ATOM   8743  C  CA    . ARG C 2 237 ? 54.991  9.799   46.835  1.00 86.53  ?  616 ARG C CA    1 
ATOM   8744  C  C     . ARG C 2 237 ? 55.700  8.660   46.140  1.00 86.34  ?  616 ARG C C     1 
ATOM   8745  O  O     . ARG C 2 237 ? 56.916  8.527   46.239  1.00 88.13  ?  616 ARG C O     1 
ATOM   8746  C  CB    . ARG C 2 237 ? 54.071  9.260   47.934  1.00 82.70  ?  616 ARG C CB    1 
ATOM   8747  N  N     . ARG C 2 238 ? 54.934  7.857   45.410  1.00 85.04  ?  617 ARG C N     1 
ATOM   8748  C  CA    . ARG C 2 238 ? 55.501  6.739   44.664  1.00 81.42  ?  617 ARG C CA    1 
ATOM   8749  C  C     . ARG C 2 238 ? 56.718  7.138   43.829  1.00 78.91  ?  617 ARG C C     1 
ATOM   8750  O  O     . ARG C 2 238 ? 57.797  6.568   43.997  1.00 80.41  ?  617 ARG C O     1 
ATOM   8751  C  CB    . ARG C 2 238 ? 54.451  6.098   43.762  1.00 79.67  ?  617 ARG C CB    1 
ATOM   8752  C  CG    . ARG C 2 238 ? 55.038  5.066   42.830  1.00 73.49  ?  617 ARG C CG    1 
ATOM   8753  C  CD    . ARG C 2 238 ? 54.419  3.720   43.057  1.00 69.83  ?  617 ARG C CD    1 
ATOM   8754  N  NE    . ARG C 2 238 ? 54.371  3.410   44.472  1.00 69.52  ?  617 ARG C NE    1 
ATOM   8755  C  CZ    . ARG C 2 238 ? 53.835  2.301   44.962  1.00 69.48  ?  617 ARG C CZ    1 
ATOM   8756  N  NH1   . ARG C 2 238 ? 53.313  1.400   44.132  1.00 64.85  ?  617 ARG C NH1   1 
ATOM   8757  N  NH2   . ARG C 2 238 ? 53.820  2.099   46.280  1.00 71.83  ?  617 ARG C NH2   1 
ATOM   8758  N  N     . VAL C 2 239 ? 56.537  8.106   42.931  1.00 77.07  ?  618 VAL C N     1 
ATOM   8759  C  CA    . VAL C 2 239 ? 57.616  8.569   42.056  1.00 75.25  ?  618 VAL C CA    1 
ATOM   8760  C  C     . VAL C 2 239 ? 58.854  9.007   42.832  1.00 76.53  ?  618 VAL C C     1 
ATOM   8761  O  O     . VAL C 2 239 ? 59.977  8.669   42.455  1.00 75.58  ?  618 VAL C O     1 
ATOM   8762  C  CB    . VAL C 2 239 ? 57.183  9.764   41.156  1.00 70.22  ?  618 VAL C CB    1 
ATOM   8763  C  CG1   . VAL C 2 239 ? 58.411  10.460  40.574  1.00 71.19  ?  618 VAL C CG1   1 
ATOM   8764  C  CG2   . VAL C 2 239 ? 56.224  9.319   40.044  1.00 68.77  ?  618 VAL C CG2   1 
ATOM   8765  N  N     . ASN C 2 240 ? 58.649  9.769   43.906  1.00 80.77  ?  619 ASN C N     1 
ATOM   8766  C  CA    . ASN C 2 240 ? 59.762  10.372  44.637  1.00 80.72  ?  619 ASN C CA    1 
ATOM   8767  C  C     . ASN C 2 240 ? 60.541  9.357   45.479  1.00 76.17  ?  619 ASN C C     1 
ATOM   8768  O  O     . ASN C 2 240 ? 61.683  9.611   45.862  1.00 75.65  ?  619 ASN C O     1 
ATOM   8769  C  CB    . ASN C 2 240 ? 59.302  11.597  45.459  1.00 65.18  ?  619 ASN C CB    1 
ATOM   8770  N  N     . VAL C 2 241 ? 59.933  8.199   45.745  1.00 72.73  ?  620 VAL C N     1 
ATOM   8771  C  CA    . VAL C 2 241 ? 60.606  7.142   46.506  1.00 71.35  ?  620 VAL C CA    1 
ATOM   8772  C  C     . VAL C 2 241 ? 61.486  6.323   45.586  1.00 72.44  ?  620 VAL C C     1 
ATOM   8773  O  O     . VAL C 2 241 ? 62.651  6.064   45.889  1.00 74.16  ?  620 VAL C O     1 
ATOM   8774  C  CB    . VAL C 2 241 ? 59.621  6.163   47.185  1.00 65.66  ?  620 VAL C CB    1 
ATOM   8775  C  CG1   . VAL C 2 241 ? 60.292  5.483   48.369  1.00 60.35  ?  620 VAL C CG1   1 
ATOM   8776  C  CG2   . VAL C 2 241 ? 58.382  6.883   47.643  1.00 68.09  ?  620 VAL C CG2   1 
ATOM   8777  N  N     . LEU C 2 242 ? 60.909  5.916   44.459  1.00 70.58  ?  621 LEU C N     1 
ATOM   8778  C  CA    . LEU C 2 242 ? 61.600  5.098   43.469  1.00 68.30  ?  621 LEU C CA    1 
ATOM   8779  C  C     . LEU C 2 242 ? 62.701  5.862   42.747  1.00 68.96  ?  621 LEU C C     1 
ATOM   8780  O  O     . LEU C 2 242 ? 63.760  5.303   42.451  1.00 71.39  ?  621 LEU C O     1 
ATOM   8781  C  CB    . LEU C 2 242 ? 60.602  4.556   42.443  1.00 66.60  ?  621 LEU C CB    1 
ATOM   8782  C  CG    . LEU C 2 242 ? 59.439  3.742   43.021  1.00 67.79  ?  621 LEU C CG    1 
ATOM   8783  C  CD1   . LEU C 2 242 ? 58.484  3.327   41.921  1.00 70.66  ?  621 LEU C CD1   1 
ATOM   8784  C  CD2   . LEU C 2 242 ? 59.919  2.518   43.802  1.00 65.25  ?  621 LEU C CD2   1 
ATOM   8785  N  N     . MET C 2 243 ? 62.460  7.139   42.471  1.00 67.67  ?  622 MET C N     1 
ATOM   8786  C  CA    . MET C 2 243 ? 63.353  7.885   41.589  1.00 70.98  ?  622 MET C CA    1 
ATOM   8787  C  C     . MET C 2 243 ? 64.091  9.079   42.224  1.00 71.39  ?  622 MET C C     1 
ATOM   8788  O  O     . MET C 2 243 ? 64.867  9.761   41.546  1.00 73.84  ?  622 MET C O     1 
ATOM   8789  C  CB    . MET C 2 243 ? 62.586  8.335   40.345  1.00 73.31  ?  622 MET C CB    1 
ATOM   8790  C  CG    . MET C 2 243 ? 61.605  7.309   39.809  1.00 58.27  ?  622 MET C CG    1 
ATOM   8791  S  SD    . MET C 2 243 ? 62.342  5.967   38.841  1.00 67.90  ?  622 MET C SD    1 
ATOM   8792  C  CE    . MET C 2 243 ? 63.583  6.862   37.915  1.00 70.61  ?  622 MET C CE    1 
ATOM   8793  N  N     . GLY C 2 244 ? 63.870  9.321   43.514  1.00 69.40  ?  623 GLY C N     1 
ATOM   8794  C  CA    . GLY C 2 244 ? 64.435  10.490  44.175  1.00 73.23  ?  623 GLY C CA    1 
ATOM   8795  C  C     . GLY C 2 244 ? 65.860  10.368  44.697  1.00 76.43  ?  623 GLY C C     1 
ATOM   8796  O  O     . GLY C 2 244 ? 66.437  9.285   44.703  1.00 76.59  ?  623 GLY C O     1 
ATOM   8797  N  N     . ASP C 2 245 ? 66.422  11.486  45.153  1.00 79.09  ?  624 ASP C N     1 
ATOM   8798  C  CA    . ASP C 2 245 ? 67.807  11.533  45.632  1.00 78.03  ?  624 ASP C CA    1 
ATOM   8799  C  C     . ASP C 2 245 ? 68.088  10.611  46.817  1.00 75.78  ?  624 ASP C C     1 
ATOM   8800  O  O     . ASP C 2 245 ? 69.219  10.154  46.983  1.00 71.77  ?  624 ASP C O     1 
ATOM   8801  C  CB    . ASP C 2 245 ? 68.228  12.973  45.977  1.00 78.53  ?  624 ASP C CB    1 
ATOM   8802  C  CG    . ASP C 2 245 ? 68.679  13.762  44.754  1.00 77.61  ?  624 ASP C CG    1 
ATOM   8803  N  N     . LYS C 2 246 ? 67.066  10.332  47.629  1.00 76.64  ?  625 LYS C N     1 
ATOM   8804  C  CA    . LYS C 2 246 ? 67.265  9.589   48.885  1.00 73.89  ?  625 LYS C CA    1 
ATOM   8805  C  C     . LYS C 2 246 ? 67.208  8.067   48.716  1.00 74.17  ?  625 LYS C C     1 
ATOM   8806  O  O     . LYS C 2 246 ? 66.175  7.518   48.321  1.00 76.97  ?  625 LYS C O     1 
ATOM   8807  C  CB    . LYS C 2 246 ? 66.279  10.052  49.975  1.00 67.99  ?  625 LYS C CB    1 
ATOM   8808  N  N     . VAL C 2 247 ? 68.315  7.395   49.040  1.00 70.79  ?  626 VAL C N     1 
ATOM   8809  C  CA    . VAL C 2 247 ? 68.418  5.944   48.869  1.00 67.60  ?  626 VAL C CA    1 
ATOM   8810  C  C     . VAL C 2 247 ? 67.607  5.118   49.869  1.00 69.28  ?  626 VAL C C     1 
ATOM   8811  O  O     . VAL C 2 247 ? 66.946  4.154   49.486  1.00 64.91  ?  626 VAL C O     1 
ATOM   8812  C  CB    . VAL C 2 247 ? 69.872  5.448   48.969  1.00 66.07  ?  626 VAL C CB    1 
ATOM   8813  C  CG1   . VAL C 2 247 ? 69.916  3.936   48.774  1.00 60.35  ?  626 VAL C CG1   1 
ATOM   8814  C  CG2   . VAL C 2 247 ? 70.752  6.143   47.955  1.00 71.35  ?  626 VAL C CG2   1 
ATOM   8815  N  N     . GLU C 2 248 ? 67.672  5.486   51.148  1.00 73.34  ?  627 GLU C N     1 
ATOM   8816  C  CA    . GLU C 2 248 ? 67.135  4.639   52.223  1.00 69.92  ?  627 GLU C CA    1 
ATOM   8817  C  C     . GLU C 2 248 ? 65.649  4.231   52.084  1.00 70.79  ?  627 GLU C C     1 
ATOM   8818  O  O     . GLU C 2 248 ? 65.307  3.065   52.295  1.00 70.66  ?  627 GLU C O     1 
ATOM   8819  C  CB    . GLU C 2 248 ? 67.445  5.236   53.605  1.00 64.86  ?  627 GLU C CB    1 
ATOM   8820  N  N     . PRO C 2 249 ? 64.766  5.181   51.727  1.00 68.32  ?  628 PRO C N     1 
ATOM   8821  C  CA    . PRO C 2 249 ? 63.340  4.861   51.541  1.00 65.82  ?  628 PRO C CA    1 
ATOM   8822  C  C     . PRO C 2 249 ? 63.085  3.928   50.349  1.00 65.15  ?  628 PRO C C     1 
ATOM   8823  O  O     . PRO C 2 249 ? 62.194  3.075   50.407  1.00 63.14  ?  628 PRO C O     1 
ATOM   8824  C  CB    . PRO C 2 249 ? 62.701  6.229   51.289  1.00 64.28  ?  628 PRO C CB    1 
ATOM   8825  C  CG    . PRO C 2 249 ? 63.703  7.232   51.787  1.00 63.95  ?  628 PRO C CG    1 
ATOM   8826  C  CD    . PRO C 2 249 ? 65.038  6.620   51.568  1.00 59.24  ?  628 PRO C CD    1 
ATOM   8827  N  N     . ARG C 2 250 ? 63.855  4.109   49.276  1.00 65.15  ?  629 ARG C N     1 
ATOM   8828  C  CA    . ARG C 2 250 ? 63.847  3.189   48.145  1.00 60.47  ?  629 ARG C CA    1 
ATOM   8829  C  C     . ARG C 2 250 ? 64.201  1.779   48.594  1.00 58.37  ?  629 ARG C C     1 
ATOM   8830  O  O     . ARG C 2 250 ? 63.477  0.832   48.296  1.00 54.58  ?  629 ARG C O     1 
ATOM   8831  C  CB    . ARG C 2 250 ? 64.840  3.646   47.088  1.00 59.75  ?  629 ARG C CB    1 
ATOM   8832  C  CG    . ARG C 2 250 ? 65.224  2.585   46.061  1.00 58.87  ?  629 ARG C CG    1 
ATOM   8833  C  CD    . ARG C 2 250 ? 66.081  3.236   45.002  1.00 62.10  ?  629 ARG C CD    1 
ATOM   8834  N  NE    . ARG C 2 250 ? 65.576  4.586   44.775  1.00 68.34  ?  629 ARG C NE    1 
ATOM   8835  C  CZ    . ARG C 2 250 ? 66.319  5.689   44.748  1.00 71.29  ?  629 ARG C CZ    1 
ATOM   8836  N  NH1   . ARG C 2 250 ? 67.637  5.631   44.904  1.00 54.90  ?  629 ARG C NH1   1 
ATOM   8837  N  NH2   . ARG C 2 250 ? 65.732  6.858   44.546  1.00 72.24  ?  629 ARG C NH2   1 
ATOM   8838  N  N     . ARG C 2 251 ? 65.318  1.641   49.309  1.00 60.76  ?  630 ARG C N     1 
ATOM   8839  C  CA    . ARG C 2 251 ? 65.723  0.336   49.816  1.00 63.18  ?  630 ARG C CA    1 
ATOM   8840  C  C     . ARG C 2 251 ? 64.576  -0.267  50.608  1.00 65.09  ?  630 ARG C C     1 
ATOM   8841  O  O     . ARG C 2 251 ? 64.181  -1.410  50.362  1.00 65.30  ?  630 ARG C O     1 
ATOM   8842  C  CB    . ARG C 2 251 ? 66.987  0.421   50.679  1.00 53.49  ?  630 ARG C CB    1 
ATOM   8843  C  CG    . ARG C 2 251 ? 67.422  -0.937  51.249  1.00 67.59  ?  630 ARG C CG    1 
ATOM   8844  C  CD    . ARG C 2 251 ? 68.518  -0.806  52.300  1.00 75.40  ?  630 ARG C CD    1 
ATOM   8845  N  NE    . ARG C 2 251 ? 69.738  -0.222  51.739  1.00 82.19  ?  630 ARG C NE    1 
ATOM   8846  C  CZ    . ARG C 2 251 ? 70.334  0.877   52.200  1.00 89.42  ?  630 ARG C CZ    1 
ATOM   8847  N  NH1   . ARG C 2 251 ? 69.832  1.518   53.249  1.00 95.80  ?  630 ARG C NH1   1 
ATOM   8848  N  NH2   . ARG C 2 251 ? 71.438  1.332   51.614  1.00 88.44  ?  630 ARG C NH2   1 
ATOM   8849  N  N     . LYS C 2 252 ? 64.046  0.517   51.551  1.00 67.90  ?  631 LYS C N     1 
ATOM   8850  C  CA    . LYS C 2 252 ? 62.904  0.110   52.364  1.00 69.31  ?  631 LYS C CA    1 
ATOM   8851  C  C     . LYS C 2 252 ? 61.792  -0.390  51.457  1.00 69.26  ?  631 LYS C C     1 
ATOM   8852  O  O     . LYS C 2 252 ? 61.316  -1.512  51.626  1.00 71.46  ?  631 LYS C O     1 
ATOM   8853  C  CB    . LYS C 2 252 ? 62.409  1.275   53.240  1.00 75.78  ?  631 LYS C CB    1 
ATOM   8854  C  CG    . LYS C 2 252 ? 61.022  1.084   53.904  1.00 77.36  ?  631 LYS C CG    1 
ATOM   8855  C  CD    . LYS C 2 252 ? 61.096  0.581   55.358  1.00 74.62  ?  631 LYS C CD    1 
ATOM   8856  N  N     . TRP C 2 253 ? 61.396  0.441   50.488  1.00 70.52  ?  632 TRP C N     1 
ATOM   8857  C  CA    . TRP C 2 253 ? 60.337  0.087   49.544  1.00 53.45  ?  632 TRP C CA    1 
ATOM   8858  C  C     . TRP C 2 253 ? 60.651  -1.241  48.887  1.00 52.16  ?  632 TRP C C     1 
ATOM   8859  O  O     . TRP C 2 253 ? 59.791  -2.115  48.778  1.00 56.35  ?  632 TRP C O     1 
ATOM   8860  C  CB    . TRP C 2 253 ? 60.178  1.166   48.469  1.00 53.65  ?  632 TRP C CB    1 
ATOM   8861  C  CG    . TRP C 2 253 ? 58.982  0.948   47.569  1.00 53.77  ?  632 TRP C CG    1 
ATOM   8862  C  CD1   . TRP C 2 253 ? 57.744  1.481   47.725  1.00 55.07  ?  632 TRP C CD1   1 
ATOM   8863  C  CD2   . TRP C 2 253 ? 58.918  0.134   46.386  1.00 62.12  ?  632 TRP C CD2   1 
ATOM   8864  N  NE1   . TRP C 2 253 ? 56.906  1.052   46.729  1.00 55.08  ?  632 TRP C NE1   1 
ATOM   8865  C  CE2   . TRP C 2 253 ? 57.602  0.227   45.887  1.00 53.69  ?  632 TRP C CE2   1 
ATOM   8866  C  CE3   . TRP C 2 253 ? 59.842  -0.662  45.699  1.00 60.39  ?  632 TRP C CE3   1 
ATOM   8867  C  CZ2   . TRP C 2 253 ? 57.187  -0.443  44.733  1.00 68.64  ?  632 TRP C CZ2   1 
ATOM   8868  C  CZ3   . TRP C 2 253 ? 59.426  -1.325  44.557  1.00 63.11  ?  632 TRP C CZ3   1 
ATOM   8869  C  CH2   . TRP C 2 253 ? 58.111  -1.212  44.085  1.00 66.00  ?  632 TRP C CH2   1 
ATOM   8870  N  N     . ILE C 2 254 ? 61.900  -1.386  48.458  1.00 59.16  ?  633 ILE C N     1 
ATOM   8871  C  CA    . ILE C 2 254 ? 62.322  -2.589  47.764  1.00 56.79  ?  633 ILE C CA    1 
ATOM   8872  C  C     . ILE C 2 254 ? 62.160  -3.809  48.645  1.00 58.21  ?  633 ILE C C     1 
ATOM   8873  O  O     . ILE C 2 254 ? 61.657  -4.826  48.190  1.00 58.13  ?  633 ILE C O     1 
ATOM   8874  C  CB    . ILE C 2 254 ? 63.767  -2.480  47.239  1.00 52.59  ?  633 ILE C CB    1 
ATOM   8875  C  CG1   . ILE C 2 254 ? 63.914  -1.228  46.380  1.00 52.52  ?  633 ILE C CG1   1 
ATOM   8876  C  CG2   . ILE C 2 254 ? 64.138  -3.706  46.409  1.00 50.17  ?  633 ILE C CG2   1 
ATOM   8877  C  CD1   . ILE C 2 254 ? 65.180  -1.203  45.576  1.00 51.76  ?  633 ILE C CD1   1 
ATOM   8878  N  N     . GLU C 2 255 ? 62.572  -3.702  49.906  1.00 60.64  ?  634 GLU C N     1 
ATOM   8879  C  CA    . GLU C 2 255 ? 62.429  -4.803  50.866  1.00 65.29  ?  634 GLU C CA    1 
ATOM   8880  C  C     . GLU C 2 255 ? 60.967  -5.150  51.124  1.00 69.54  ?  634 GLU C C     1 
ATOM   8881  O  O     . GLU C 2 255 ? 60.599  -6.321  51.190  1.00 69.52  ?  634 GLU C O     1 
ATOM   8882  C  CB    . GLU C 2 255 ? 63.080  -4.451  52.202  1.00 69.83  ?  634 GLU C CB    1 
ATOM   8883  C  CG    . GLU C 2 255 ? 64.411  -3.752  52.091  1.00 76.39  ?  634 GLU C CG    1 
ATOM   8884  C  CD    . GLU C 2 255 ? 65.199  -3.836  53.378  1.00 84.59  ?  634 GLU C CD    1 
ATOM   8885  O  OE1   . GLU C 2 255 ? 65.009  -4.840  54.107  1.00 88.59  ?  634 GLU C OE1   1 
ATOM   8886  O  OE2   . GLU C 2 255 ? 65.994  -2.903  53.660  1.00 86.55  ?  634 GLU C OE2   1 
ATOM   8887  N  N     . ASP C 2 256 ? 60.143  -4.119  51.282  1.00 68.13  ?  635 ASP C N     1 
ATOM   8888  C  CA    . ASP C 2 256 ? 58.732  -4.299  51.589  1.00 74.61  ?  635 ASP C CA    1 
ATOM   8889  C  C     . ASP C 2 256 ? 57.978  -4.937  50.426  1.00 73.34  ?  635 ASP C C     1 
ATOM   8890  O  O     . ASP C 2 256 ? 57.032  -5.697  50.640  1.00 79.26  ?  635 ASP C O     1 
ATOM   8891  C  CB    . ASP C 2 256 ? 58.070  -2.957  51.943  1.00 83.55  ?  635 ASP C CB    1 
ATOM   8892  C  CG    . ASP C 2 256 ? 58.589  -2.354  53.252  1.00 90.96  ?  635 ASP C CG    1 
ATOM   8893  O  OD1   . ASP C 2 256 ? 58.880  -3.102  54.216  1.00 89.71  ?  635 ASP C OD1   1 
ATOM   8894  O  OD2   . ASP C 2 256 ? 58.693  -1.110  53.313  1.00 97.38  ?  635 ASP C OD2   1 
ATOM   8895  N  N     . ASN C 2 257 ? 58.399  -4.634  49.199  1.00 65.95  ?  636 ASN C N     1 
ATOM   8896  C  CA    . ASN C 2 257 ? 57.589  -4.951  48.022  1.00 61.00  ?  636 ASN C CA    1 
ATOM   8897  C  C     . ASN C 2 257 ? 58.148  -5.990  47.058  1.00 60.83  ?  636 ASN C C     1 
ATOM   8898  O  O     . ASN C 2 257 ? 57.390  -6.695  46.398  1.00 66.73  ?  636 ASN C O     1 
ATOM   8899  C  CB    . ASN C 2 257 ? 57.260  -3.672  47.263  1.00 59.77  ?  636 ASN C CB    1 
ATOM   8900  C  CG    . ASN C 2 257 ? 56.510  -2.680  48.115  1.00 61.21  ?  636 ASN C CG    1 
ATOM   8901  O  OD1   . ASN C 2 257 ? 55.349  -2.901  48.447  1.00 67.40  ?  636 ASN C OD1   1 
ATOM   8902  N  ND2   . ASN C 2 257 ? 57.168  -1.580  48.482  1.00 59.20  ?  636 ASN C ND2   1 
ATOM   8903  N  N     . VAL C 2 258 ? 59.466  -6.086  46.971  1.00 57.68  ?  637 VAL C N     1 
ATOM   8904  C  CA    . VAL C 2 258 ? 60.093  -7.053  46.076  1.00 57.99  ?  637 VAL C CA    1 
ATOM   8905  C  C     . VAL C 2 258 ? 60.226  -8.436  46.725  1.00 65.44  ?  637 VAL C C     1 
ATOM   8906  O  O     . VAL C 2 258 ? 60.835  -8.574  47.789  1.00 69.82  ?  637 VAL C O     1 
ATOM   8907  C  CB    . VAL C 2 258 ? 61.467  -6.539  45.597  1.00 53.14  ?  637 VAL C CB    1 
ATOM   8908  C  CG1   . VAL C 2 258 ? 62.290  -7.668  44.998  1.00 54.88  ?  637 VAL C CG1   1 
ATOM   8909  C  CG2   . VAL C 2 258 ? 61.284  -5.388  44.599  1.00 49.31  ?  637 VAL C CG2   1 
ATOM   8910  N  N     . LYS C 2 259 ? 59.650  -9.454  46.088  1.00 65.52  ?  638 LYS C N     1 
ATOM   8911  C  CA    . LYS C 2 259 ? 59.703  -10.822 46.617  1.00 65.44  ?  638 LYS C CA    1 
ATOM   8912  C  C     . LYS C 2 259 ? 60.829  -11.665 45.990  1.00 70.89  ?  638 LYS C C     1 
ATOM   8913  O  O     . LYS C 2 259 ? 60.681  -12.232 44.903  1.00 71.97  ?  638 LYS C O     1 
ATOM   8914  C  CB    . LYS C 2 259 ? 58.344  -11.519 46.452  1.00 61.15  ?  638 LYS C CB    1 
ATOM   8915  N  N     . PHE C 2 260 ? 61.955  -11.755 46.688  1.00 73.55  ?  639 PHE C N     1 
ATOM   8916  C  CA    . PHE C 2 260 ? 63.095  -12.528 46.200  1.00 76.90  ?  639 PHE C CA    1 
ATOM   8917  C  C     . PHE C 2 260 ? 62.875  -14.051 46.283  1.00 84.20  ?  639 PHE C C     1 
ATOM   8918  O  O     . PHE C 2 260 ? 63.547  -14.825 45.590  1.00 82.48  ?  639 PHE C O     1 
ATOM   8919  C  CB    . PHE C 2 260 ? 64.364  -12.117 46.958  1.00 74.35  ?  639 PHE C CB    1 
ATOM   8920  C  CG    . PHE C 2 260 ? 64.681  -10.642 46.863  1.00 71.67  ?  639 PHE C CG    1 
ATOM   8921  C  CD1   . PHE C 2 260 ? 65.252  -10.112 45.723  1.00 70.57  ?  639 PHE C CD1   1 
ATOM   8922  C  CD2   . PHE C 2 260 ? 64.411  -9.790  47.914  1.00 71.84  ?  639 PHE C CD2   1 
ATOM   8923  C  CE1   . PHE C 2 260 ? 65.545  -8.754  45.638  1.00 68.98  ?  639 PHE C CE1   1 
ATOM   8924  C  CE2   . PHE C 2 260 ? 64.700  -8.437  47.830  1.00 67.76  ?  639 PHE C CE2   1 
ATOM   8925  C  CZ    . PHE C 2 260 ? 65.264  -7.920  46.693  1.00 65.48  ?  639 PHE C CZ    1 
ATOM   8926  N  N     . THR C 2 261 ? 61.917  -14.463 47.117  1.00 90.28  ?  640 THR C N     1 
ATOM   8927  C  CA    . THR C 2 261 ? 61.650  -15.875 47.415  1.00 90.56  ?  640 THR C CA    1 
ATOM   8928  C  C     . THR C 2 261 ? 62.897  -16.559 47.973  1.00 88.66  ?  640 THR C C     1 
ATOM   8929  O  O     . THR C 2 261 ? 63.569  -16.020 48.860  1.00 84.87  ?  640 THR C O     1 
ATOM   8930  C  CB    . THR C 2 261 ? 61.096  -16.660 46.190  1.00 56.51  ?  640 THR C CB    1 
ATOM   8931  N  N     . LYS D 2 36  ? 96.723  12.901  19.920  1.00 71.00  ?  415 LYS D N     1 
ATOM   8932  C  CA    . LYS D 2 36  ? 96.943  11.814  18.958  1.00 71.34  ?  415 LYS D CA    1 
ATOM   8933  C  C     . LYS D 2 36  ? 98.286  11.114  19.192  1.00 74.27  ?  415 LYS D C     1 
ATOM   8934  O  O     . LYS D 2 36  ? 98.345  9.889   19.356  1.00 72.23  ?  415 LYS D O     1 
ATOM   8935  C  CB    . LYS D 2 36  ? 96.866  12.340  17.514  1.00 64.74  ?  415 LYS D CB    1 
ATOM   8936  N  N     . LEU D 2 37  ? 99.353  11.913  19.212  1.00 74.19  ?  416 LEU D N     1 
ATOM   8937  C  CA    . LEU D 2 37  ? 100.731 11.436  19.350  1.00 68.00  ?  416 LEU D CA    1 
ATOM   8938  C  C     . LEU D 2 37  ? 101.197 11.275  20.803  1.00 67.25  ?  416 LEU D C     1 
ATOM   8939  O  O     . LEU D 2 37  ? 101.002 12.152  21.630  1.00 66.29  ?  416 LEU D O     1 
ATOM   8940  C  CB    . LEU D 2 37  ? 101.675 12.407  18.630  1.00 64.37  ?  416 LEU D CB    1 
ATOM   8941  C  CG    . LEU D 2 37  ? 103.141 12.483  19.083  1.00 60.97  ?  416 LEU D CG    1 
ATOM   8942  C  CD1   . LEU D 2 37  ? 104.071 11.739  18.123  1.00 60.40  ?  416 LEU D CD1   1 
ATOM   8943  C  CD2   . LEU D 2 37  ? 103.595 13.928  19.253  1.00 58.26  ?  416 LEU D CD2   1 
ATOM   8944  N  N     . THR D 2 38  ? 101.828 10.147  21.100  1.00 67.18  ?  417 THR D N     1 
ATOM   8945  C  CA    . THR D 2 38  ? 102.493 9.950   22.384  1.00 66.56  ?  417 THR D CA    1 
ATOM   8946  C  C     . THR D 2 38  ? 103.967 10.379  22.279  1.00 74.67  ?  417 THR D C     1 
ATOM   8947  O  O     . THR D 2 38  ? 104.802 9.671   21.703  1.00 76.25  ?  417 THR D O     1 
ATOM   8948  C  CB    . THR D 2 38  ? 102.399 8.479   22.842  1.00 59.53  ?  417 THR D CB    1 
ATOM   8949  O  OG1   . THR D 2 38  ? 101.030 8.130   23.047  1.00 54.61  ?  417 THR D OG1   1 
ATOM   8950  C  CG2   . THR D 2 38  ? 103.166 8.254   24.134  1.00 62.49  ?  417 THR D CG2   1 
ATOM   8951  N  N     . PRO D 2 39  ? 104.294 11.552  22.838  1.00 79.96  ?  418 PRO D N     1 
ATOM   8952  C  CA    . PRO D 2 39  ? 105.636 12.129  22.686  1.00 82.69  ?  418 PRO D CA    1 
ATOM   8953  C  C     . PRO D 2 39  ? 106.708 11.437  23.533  1.00 82.32  ?  418 PRO D C     1 
ATOM   8954  O  O     . PRO D 2 39  ? 106.388 10.759  24.516  1.00 80.73  ?  418 PRO D O     1 
ATOM   8955  C  CB    . PRO D 2 39  ? 105.439 13.567  23.162  1.00 84.58  ?  418 PRO D CB    1 
ATOM   8956  C  CG    . PRO D 2 39  ? 104.319 13.469  24.159  1.00 82.88  ?  418 PRO D CG    1 
ATOM   8957  C  CD    . PRO D 2 39  ? 103.400 12.411  23.638  1.00 80.45  ?  418 PRO D CD    1 
ATOM   8958  N  N     . ALA D 2 40  ? 107.969 11.605  23.138  1.00 83.35  ?  419 ALA D N     1 
ATOM   8959  C  CA    . ALA D 2 40  ? 109.093 11.142  23.950  1.00 83.40  ?  419 ALA D CA    1 
ATOM   8960  C  C     . ALA D 2 40  ? 109.305 12.082  25.155  1.00 83.28  ?  419 ALA D C     1 
ATOM   8961  O  O     . ALA D 2 40  ? 109.065 13.294  25.068  1.00 81.40  ?  419 ALA D O     1 
ATOM   8962  C  CB    . ALA D 2 40  ? 110.371 11.017  23.095  1.00 83.14  ?  419 ALA D CB    1 
ATOM   8963  N  N     . GLN D 2 41  ? 109.740 11.526  26.281  1.00 84.34  ?  420 GLN D N     1 
ATOM   8964  C  CA    . GLN D 2 41  ? 109.833 12.306  27.510  1.00 88.64  ?  420 GLN D CA    1 
ATOM   8965  C  C     . GLN D 2 41  ? 110.926 13.385  27.460  1.00 94.40  ?  420 GLN D C     1 
ATOM   8966  O  O     . GLN D 2 41  ? 110.983 14.269  28.320  1.00 99.27  ?  420 GLN D O     1 
ATOM   8967  C  CB    . GLN D 2 41  ? 110.029 11.383  28.715  1.00 90.00  ?  420 GLN D CB    1 
ATOM   8968  C  CG    . GLN D 2 41  ? 109.875 12.076  30.061  1.00 95.46  ?  420 GLN D CG    1 
ATOM   8969  C  CD    . GLN D 2 41  ? 109.195 11.196  31.090  1.00 101.49 ?  420 GLN D CD    1 
ATOM   8970  O  OE1   . GLN D 2 41  ? 109.366 9.973   31.089  1.00 102.19 ?  420 GLN D OE1   1 
ATOM   8971  N  NE2   . GLN D 2 41  ? 108.402 11.813  31.965  1.00 104.65 ?  420 GLN D NE2   1 
ATOM   8972  N  N     . SER D 2 42  ? 111.784 13.320  26.447  1.00 93.30  ?  421 SER D N     1 
ATOM   8973  C  CA    . SER D 2 42  ? 112.884 14.270  26.336  1.00 91.87  ?  421 SER D CA    1 
ATOM   8974  C  C     . SER D 2 42  ? 113.239 14.568  24.879  1.00 93.49  ?  421 SER D C     1 
ATOM   8975  O  O     . SER D 2 42  ? 113.614 13.664  24.134  1.00 92.89  ?  421 SER D O     1 
ATOM   8976  C  CB    . SER D 2 42  ? 114.110 13.749  27.095  1.00 89.94  ?  421 SER D CB    1 
ATOM   8977  N  N     . LYS D 2 43  ? 113.120 15.839  24.488  1.00 95.46  ?  422 LYS D N     1 
ATOM   8978  C  CA    . LYS D 2 43  ? 113.488 16.293  23.141  1.00 93.35  ?  422 LYS D CA    1 
ATOM   8979  C  C     . LYS D 2 43  ? 114.969 16.047  22.850  1.00 92.68  ?  422 LYS D C     1 
ATOM   8980  O  O     . LYS D 2 43  ? 115.814 16.218  23.726  1.00 88.62  ?  422 LYS D O     1 
ATOM   8981  C  CB    . LYS D 2 43  ? 113.148 17.777  22.952  1.00 91.07  ?  422 LYS D CB    1 
ATOM   8982  N  N     . ASN D 2 44  ? 115.274 15.647  21.619  1.00 93.53  ?  423 ASN D N     1 
ATOM   8983  C  CA    . ASN D 2 44  ? 116.634 15.269  21.242  1.00 97.77  ?  423 ASN D CA    1 
ATOM   8984  C  C     . ASN D 2 44  ? 116.690 14.804  19.790  1.00 101.79 ?  423 ASN D C     1 
ATOM   8985  O  O     . ASN D 2 44  ? 116.859 13.614  19.520  1.00 103.59 ?  423 ASN D O     1 
ATOM   8986  C  CB    . ASN D 2 44  ? 117.171 14.165  22.165  1.00 96.94  ?  423 ASN D CB    1 
ATOM   8987  C  CG    . ASN D 2 44  ? 118.614 13.770  21.842  1.00 97.68  ?  423 ASN D CG    1 
ATOM   8988  O  OD1   . ASN D 2 44  ? 119.354 14.535  21.220  1.00 99.29  ?  423 ASN D OD1   1 
ATOM   8989  N  ND2   . ASN D 2 44  ? 119.017 12.573  22.270  1.00 95.87  ?  423 ASN D ND2   1 
ATOM   8990  N  N     . PRO D 2 45  ? 116.543 15.746  18.845  1.00 102.99 ?  424 PRO D N     1 
ATOM   8991  C  CA    . PRO D 2 45  ? 116.540 15.418  17.415  1.00 101.07 ?  424 PRO D CA    1 
ATOM   8992  C  C     . PRO D 2 45  ? 117.772 14.624  16.973  1.00 99.11  ?  424 PRO D C     1 
ATOM   8993  O  O     . PRO D 2 45  ? 118.140 14.667  15.803  1.00 101.95 ?  424 PRO D O     1 
ATOM   8994  C  CB    . PRO D 2 45  ? 116.517 16.797  16.747  1.00 103.17 ?  424 PRO D CB    1 
ATOM   8995  C  CG    . PRO D 2 45  ? 115.831 17.679  17.737  1.00 103.20 ?  424 PRO D CG    1 
ATOM   8996  C  CD    . PRO D 2 45  ? 116.285 17.177  19.086  1.00 103.06 ?  424 PRO D CD    1 
ATOM   8997  N  N     . ALA D 2 46  ? 118.389 13.893  17.892  1.00 97.86  ?  425 ALA D N     1 
ATOM   8998  C  CA    . ALA D 2 46  ? 119.598 13.143  17.575  1.00 99.96  ?  425 ALA D CA    1 
ATOM   8999  C  C     . ALA D 2 46  ? 119.507 11.678  17.993  1.00 101.54 ?  425 ALA D C     1 
ATOM   9000  O  O     . ALA D 2 46  ? 120.240 10.833  17.476  1.00 102.07 ?  425 ALA D O     1 
ATOM   9001  C  CB    . ALA D 2 46  ? 120.796 13.799  18.225  1.00 102.27 ?  425 ALA D CB    1 
ATOM   9002  N  N     . LYS D 2 47  ? 118.615 11.390  18.940  1.00 99.58  ?  426 LYS D N     1 
ATOM   9003  C  CA    . LYS D 2 47  ? 118.378 10.026  19.409  1.00 94.11  ?  426 LYS D CA    1 
ATOM   9004  C  C     . LYS D 2 47  ? 116.921 9.640   19.198  1.00 94.78  ?  426 LYS D C     1 
ATOM   9005  O  O     . LYS D 2 47  ? 116.621 8.514   18.800  1.00 95.55  ?  426 LYS D O     1 
ATOM   9006  C  CB    . LYS D 2 47  ? 118.737 9.881   20.893  1.00 90.14  ?  426 LYS D CB    1 
ATOM   9007  N  N     . ASN D 2 48  ? 116.024 10.587  19.466  1.00 95.35  ?  427 ASN D N     1 
ATOM   9008  C  CA    . ASN D 2 48  ? 114.582 10.345  19.400  1.00 94.73  ?  427 ASN D CA    1 
ATOM   9009  C  C     . ASN D 2 48  ? 114.117 9.628   18.128  1.00 95.12  ?  427 ASN D C     1 
ATOM   9010  O  O     . ASN D 2 48  ? 114.669 9.834   17.043  1.00 99.80  ?  427 ASN D O     1 
ATOM   9011  C  CB    . ASN D 2 48  ? 113.808 11.658  19.589  1.00 95.70  ?  427 ASN D CB    1 
ATOM   9012  C  CG    . ASN D 2 48  ? 113.704 12.080  21.054  1.00 98.54  ?  427 ASN D CG    1 
ATOM   9013  O  OD1   . ASN D 2 48  ? 114.455 11.599  21.912  1.00 99.52  ?  427 ASN D OD1   1 
ATOM   9014  N  ND2   . ASN D 2 48  ? 112.766 12.984  21.344  1.00 98.27  ?  427 ASN D ND2   1 
ATOM   9015  N  N     . GLU D 2 49  ? 113.098 8.785   18.278  1.00 90.32  ?  428 GLU D N     1 
ATOM   9016  C  CA    . GLU D 2 49  ? 112.534 8.016   17.167  1.00 84.31  ?  428 GLU D CA    1 
ATOM   9017  C  C     . GLU D 2 49  ? 111.016 8.176   17.060  1.00 80.16  ?  428 GLU D C     1 
ATOM   9018  O  O     . GLU D 2 49  ? 110.308 8.252   18.069  1.00 80.48  ?  428 GLU D O     1 
ATOM   9019  C  CB    . GLU D 2 49  ? 112.846 6.530   17.340  1.00 84.79  ?  428 GLU D CB    1 
ATOM   9020  C  CG    . GLU D 2 49  ? 114.291 6.212   17.644  1.00 90.92  ?  428 GLU D CG    1 
ATOM   9021  C  CD    . GLU D 2 49  ? 114.514 4.731   17.873  1.00 95.76  ?  428 GLU D CD    1 
ATOM   9022  O  OE1   . GLU D 2 49  ? 113.706 4.110   18.599  1.00 94.06  ?  428 GLU D OE1   1 
ATOM   9023  O  OE2   . GLU D 2 49  ? 115.496 4.186   17.320  1.00 101.42 ?  428 GLU D OE2   1 
ATOM   9024  N  N     . LEU D 2 50  ? 110.515 8.209   15.833  1.00 76.83  ?  429 LEU D N     1 
ATOM   9025  C  CA    . LEU D 2 50  ? 109.078 8.241   15.619  1.00 73.65  ?  429 LEU D CA    1 
ATOM   9026  C  C     . LEU D 2 50  ? 108.594 6.886   15.134  1.00 72.19  ?  429 LEU D C     1 
ATOM   9027  O  O     . LEU D 2 50  ? 109.013 6.414   14.078  1.00 72.91  ?  429 LEU D O     1 
ATOM   9028  C  CB    . LEU D 2 50  ? 108.703 9.310   14.600  1.00 74.20  ?  429 LEU D CB    1 
ATOM   9029  C  CG    . LEU D 2 50  ? 107.567 10.227  15.049  1.00 76.46  ?  429 LEU D CG    1 
ATOM   9030  C  CD1   . LEU D 2 50  ? 106.854 10.819  13.841  1.00 76.15  ?  429 LEU D CD1   1 
ATOM   9031  C  CD2   . LEU D 2 50  ? 106.591 9.510   15.971  1.00 75.36  ?  429 LEU D CD2   1 
ATOM   9032  N  N     . TYR D 2 51  ? 107.719 6.259   15.913  1.00 70.68  ?  430 TYR D N     1 
ATOM   9033  C  CA    . TYR D 2 51  ? 107.064 5.028   15.495  1.00 68.25  ?  430 TYR D CA    1 
ATOM   9034  C  C     . TYR D 2 51  ? 105.689 5.321   14.894  1.00 68.84  ?  430 TYR D C     1 
ATOM   9035  O  O     . TYR D 2 51  ? 104.785 5.788   15.594  1.00 69.91  ?  430 TYR D O     1 
ATOM   9036  C  CB    . TYR D 2 51  ? 106.945 4.046   16.666  1.00 66.36  ?  430 TYR D CB    1 
ATOM   9037  C  CG    . TYR D 2 51  ? 108.198 3.236   16.878  1.00 67.48  ?  430 TYR D CG    1 
ATOM   9038  C  CD1   . TYR D 2 51  ? 108.311 1.951   16.369  1.00 69.66  ?  430 TYR D CD1   1 
ATOM   9039  C  CD2   . TYR D 2 51  ? 109.278 3.765   17.564  1.00 68.23  ?  430 TYR D CD2   1 
ATOM   9040  C  CE1   . TYR D 2 51  ? 109.463 1.212   16.550  1.00 70.61  ?  430 TYR D CE1   1 
ATOM   9041  C  CE2   . TYR D 2 51  ? 110.432 3.037   17.746  1.00 70.58  ?  430 TYR D CE2   1 
ATOM   9042  C  CZ    . TYR D 2 51  ? 110.523 1.762   17.239  1.00 70.69  ?  430 TYR D CZ    1 
ATOM   9043  O  OH    . TYR D 2 51  ? 111.680 1.036   17.421  1.00 72.13  ?  430 TYR D OH    1 
ATOM   9044  N  N     . LEU D 2 52  ? 105.553 5.070   13.590  1.00 66.26  ?  431 LEU D N     1 
ATOM   9045  C  CA    . LEU D 2 52  ? 104.270 5.179   12.897  1.00 59.41  ?  431 LEU D CA    1 
ATOM   9046  C  C     . LEU D 2 52  ? 103.604 3.805   12.853  1.00 58.38  ?  431 LEU D C     1 
ATOM   9047  O  O     . LEU D 2 52  ? 104.008 2.914   12.108  1.00 59.58  ?  431 LEU D O     1 
ATOM   9048  C  CB    . LEU D 2 52  ? 104.472 5.715   11.490  1.00 52.23  ?  431 LEU D CB    1 
ATOM   9049  C  CG    . LEU D 2 52  ? 105.334 6.968   11.366  1.00 51.07  ?  431 LEU D CG    1 
ATOM   9050  C  CD1   . LEU D 2 52  ? 105.605 7.243   9.902   1.00 53.10  ?  431 LEU D CD1   1 
ATOM   9051  C  CD2   . LEU D 2 52  ? 104.670 8.168   12.028  1.00 51.04  ?  431 LEU D CD2   1 
ATOM   9052  N  N     . VAL D 2 53  ? 102.576 3.639   13.664  1.00 56.44  ?  432 VAL D N     1 
ATOM   9053  C  CA    . VAL D 2 53  ? 102.030 2.327   13.906  1.00 56.40  ?  432 VAL D CA    1 
ATOM   9054  C  C     . VAL D 2 53  ? 100.662 2.176   13.254  1.00 61.25  ?  432 VAL D C     1 
ATOM   9055  O  O     . VAL D 2 53  ? 99.827  3.076   13.314  1.00 62.33  ?  432 VAL D O     1 
ATOM   9056  C  CB    . VAL D 2 53  ? 101.931 2.089   15.419  1.00 53.77  ?  432 VAL D CB    1 
ATOM   9057  C  CG1   . VAL D 2 53  ? 101.646 0.631   15.722  1.00 57.68  ?  432 VAL D CG1   1 
ATOM   9058  C  CG2   . VAL D 2 53  ? 103.215 2.503   16.060  1.00 50.09  ?  432 VAL D CG2   1 
ATOM   9059  N  N     . GLU D 2 54  ? 100.450 1.031   12.621  1.00 62.14  ?  433 GLU D N     1 
ATOM   9060  C  CA    . GLU D 2 54  ? 99.167  0.698   12.026  1.00 65.07  ?  433 GLU D CA    1 
ATOM   9061  C  C     . GLU D 2 54  ? 98.155  0.446   13.140  1.00 64.45  ?  433 GLU D C     1 
ATOM   9062  O  O     . GLU D 2 54  ? 98.282  -0.510  13.907  1.00 64.35  ?  433 GLU D O     1 
ATOM   9063  C  CB    . GLU D 2 54  ? 99.321  -0.546  11.137  1.00 71.62  ?  433 GLU D CB    1 
ATOM   9064  C  CG    . GLU D 2 54  ? 98.098  -0.950  10.310  1.00 75.84  ?  433 GLU D CG    1 
ATOM   9065  C  CD    . GLU D 2 54  ? 98.258  -2.335  9.683   1.00 78.34  ?  433 GLU D CD    1 
ATOM   9066  O  OE1   . GLU D 2 54  ? 97.261  -2.901  9.176   1.00 77.34  ?  433 GLU D OE1   1 
ATOM   9067  O  OE2   . GLU D 2 54  ? 99.389  -2.864  9.709   1.00 80.75  ?  433 GLU D OE2   1 
ATOM   9068  N  N     . GLY D 2 55  ? 97.166  1.326   13.246  1.00 65.33  ?  434 GLY D N     1 
ATOM   9069  C  CA    . GLY D 2 55  ? 96.052  1.123   14.158  1.00 66.66  ?  434 GLY D CA    1 
ATOM   9070  C  C     . GLY D 2 55  ? 96.311  1.425   15.622  1.00 67.21  ?  434 GLY D C     1 
ATOM   9071  O  O     . GLY D 2 55  ? 97.450  1.445   16.074  1.00 64.77  ?  434 GLY D O     1 
ATOM   9072  N  N     . ASP D 2 56  ? 95.234  1.639   16.368  1.00 71.01  ?  435 ASP D N     1 
ATOM   9073  C  CA    . ASP D 2 56  ? 95.319  2.034   17.765  1.00 76.46  ?  435 ASP D CA    1 
ATOM   9074  C  C     . ASP D 2 56  ? 95.748  0.888   18.664  1.00 78.32  ?  435 ASP D C     1 
ATOM   9075  O  O     . ASP D 2 56  ? 96.593  1.071   19.542  1.00 79.31  ?  435 ASP D O     1 
ATOM   9076  C  CB    . ASP D 2 56  ? 93.974  2.579   18.243  1.00 81.57  ?  435 ASP D CB    1 
ATOM   9077  C  CG    . ASP D 2 56  ? 93.753  4.023   17.842  1.00 86.08  ?  435 ASP D CG    1 
ATOM   9078  O  OD1   . ASP D 2 56  ? 94.598  4.887   18.190  1.00 83.48  ?  435 ASP D OD1   1 
ATOM   9079  O  OD2   . ASP D 2 56  ? 92.728  4.283   17.174  1.00 90.12  ?  435 ASP D OD2   1 
ATOM   9080  N  N     . SER D 2 57  ? 95.155  -0.286  18.460  1.00 78.29  ?  436 SER D N     1 
ATOM   9081  C  CA    . SER D 2 57  ? 95.497  -1.452  19.272  1.00 77.76  ?  436 SER D CA    1 
ATOM   9082  C  C     . SER D 2 57  ? 97.020  -1.627  19.378  1.00 69.57  ?  436 SER D C     1 
ATOM   9083  O  O     . SER D 2 57  ? 97.574  -1.576  20.472  1.00 67.28  ?  436 SER D O     1 
ATOM   9084  C  CB    . SER D 2 57  ? 94.827  -2.722  18.731  1.00 81.70  ?  436 SER D CB    1 
ATOM   9085  O  OG    . SER D 2 57  ? 95.774  -3.586  18.121  1.00 83.70  ?  436 SER D OG    1 
ATOM   9086  N  N     . ALA D 2 58  ? 97.692  -1.815  18.244  1.00 64.71  ?  437 ALA D N     1 
ATOM   9087  C  CA    . ALA D 2 58  ? 99.149  -1.928  18.222  1.00 61.61  ?  437 ALA D CA    1 
ATOM   9088  C  C     . ALA D 2 58  ? 99.841  -0.630  18.648  1.00 59.64  ?  437 ALA D C     1 
ATOM   9089  O  O     . ALA D 2 58  ? 100.917 -0.662  19.245  1.00 61.91  ?  437 ALA D O     1 
ATOM   9090  C  CB    . ALA D 2 58  ? 99.634  -2.365  16.846  1.00 61.75  ?  437 ALA D CB    1 
ATOM   9091  N  N     . GLY D 2 59  ? 99.237  0.510   18.331  1.00 54.65  ?  438 GLY D N     1 
ATOM   9092  C  CA    . GLY D 2 59  ? 99.726  1.780   18.840  1.00 52.68  ?  438 GLY D CA    1 
ATOM   9093  C  C     . GLY D 2 59  ? 99.677  1.823   20.361  1.00 55.24  ?  438 GLY D C     1 
ATOM   9094  O  O     . GLY D 2 59  ? 100.480 2.498   21.006  1.00 54.88  ?  438 GLY D O     1 
ATOM   9095  N  N     . GLY D 2 60  ? 98.727  1.093   20.939  1.00 58.26  ?  439 GLY D N     1 
ATOM   9096  C  CA    . GLY D 2 60  ? 98.587  1.008   22.386  1.00 61.69  ?  439 GLY D CA    1 
ATOM   9097  C  C     . GLY D 2 60  ? 99.643  0.111   22.993  1.00 60.75  ?  439 GLY D C     1 
ATOM   9098  O  O     . GLY D 2 60  ? 100.281 0.462   23.982  1.00 63.65  ?  439 GLY D O     1 
ATOM   9099  N  N     . SER D 2 61  ? 99.825  -1.057  22.390  1.00 57.83  ?  440 SER D N     1 
ATOM   9100  C  CA    . SER D 2 61  ? 100.904 -1.952  22.760  1.00 58.38  ?  440 SER D CA    1 
ATOM   9101  C  C     . SER D 2 61  ? 102.270 -1.276  22.587  1.00 58.88  ?  440 SER D C     1 
ATOM   9102  O  O     . SER D 2 61  ? 103.184 -1.502  23.369  1.00 63.46  ?  440 SER D O     1 
ATOM   9103  C  CB    . SER D 2 61  ? 100.830 -3.234  21.930  1.00 63.01  ?  440 SER D CB    1 
ATOM   9104  O  OG    . SER D 2 61  ? 99.637  -3.962  22.193  1.00 66.61  ?  440 SER D OG    1 
ATOM   9105  N  N     . ALA D 2 62  ? 102.410 -0.441  21.566  1.00 58.84  ?  441 ALA D N     1 
ATOM   9106  C  CA    . ALA D 2 62  ? 103.654 0.307   21.376  1.00 60.63  ?  441 ALA D CA    1 
ATOM   9107  C  C     . ALA D 2 62  ? 103.872 1.341   22.483  1.00 63.49  ?  441 ALA D C     1 
ATOM   9108  O  O     . ALA D 2 62  ? 104.974 1.445   23.017  1.00 67.98  ?  441 ALA D O     1 
ATOM   9109  C  CB    . ALA D 2 62  ? 103.693 0.970   19.998  1.00 59.16  ?  441 ALA D CB    1 
ATOM   9110  N  N     . LYS D 2 63  ? 102.831 2.107   22.821  1.00 62.23  ?  442 LYS D N     1 
ATOM   9111  C  CA    . LYS D 2 63  ? 102.901 3.024   23.962  1.00 64.29  ?  442 LYS D CA    1 
ATOM   9112  C  C     . LYS D 2 63  ? 103.469 2.262   25.174  1.00 61.73  ?  442 LYS D C     1 
ATOM   9113  O  O     . LYS D 2 63  ? 104.482 2.658   25.761  1.00 58.16  ?  442 LYS D O     1 
ATOM   9114  C  CB    . LYS D 2 63  ? 101.515 3.634   24.270  1.00 67.02  ?  442 LYS D CB    1 
ATOM   9115  C  CG    . LYS D 2 63  ? 101.494 4.743   25.354  1.00 50.06  ?  442 LYS D CG    1 
ATOM   9116  N  N     . GLN D 2 64  ? 102.821 1.145   25.503  1.00 61.67  ?  443 GLN D N     1 
ATOM   9117  C  CA    . GLN D 2 64  ? 103.225 0.265   26.600  1.00 65.76  ?  443 GLN D CA    1 
ATOM   9118  C  C     . GLN D 2 64  ? 104.643 -0.331  26.494  1.00 65.82  ?  443 GLN D C     1 
ATOM   9119  O  O     . GLN D 2 64  ? 105.401 -0.290  27.457  1.00 68.87  ?  443 GLN D O     1 
ATOM   9120  C  CB    . GLN D 2 64  ? 102.182 -0.841  26.790  1.00 69.78  ?  443 GLN D CB    1 
ATOM   9121  C  CG    . GLN D 2 64  ? 100.983 -0.379  27.595  1.00 75.05  ?  443 GLN D CG    1 
ATOM   9122  C  CD    . GLN D 2 64  ? 99.675  -1.013  27.154  1.00 76.77  ?  443 GLN D CD    1 
ATOM   9123  O  OE1   . GLN D 2 64  ? 98.729  -0.309  26.777  1.00 81.02  ?  443 GLN D OE1   1 
ATOM   9124  N  NE2   . GLN D 2 64  ? 99.604  -2.342  27.218  1.00 71.84  ?  443 GLN D NE2   1 
ATOM   9125  N  N     . GLY D 2 65  ? 105.006 -0.872  25.336  1.00 61.33  ?  444 GLY D N     1 
ATOM   9126  C  CA    . GLY D 2 65  ? 106.308 -1.500  25.174  1.00 61.45  ?  444 GLY D CA    1 
ATOM   9127  C  C     . GLY D 2 65  ? 107.537 -0.609  24.982  1.00 65.00  ?  444 GLY D C     1 
ATOM   9128  O  O     . GLY D 2 65  ? 108.660 -1.093  25.100  1.00 70.50  ?  444 GLY D O     1 
ATOM   9129  N  N     . ARG D 2 66  ? 107.344 0.680   24.704  1.00 62.59  ?  445 ARG D N     1 
ATOM   9130  C  CA    . ARG D 2 66  ? 108.447 1.557   24.287  1.00 61.44  ?  445 ARG D CA    1 
ATOM   9131  C  C     . ARG D 2 66  ? 109.451 1.871   25.399  1.00 67.06  ?  445 ARG D C     1 
ATOM   9132  O  O     . ARG D 2 66  ? 109.408 1.282   26.479  1.00 67.91  ?  445 ARG D O     1 
ATOM   9133  C  CB    . ARG D 2 66  ? 107.885 2.872   23.737  1.00 57.72  ?  445 ARG D CB    1 
ATOM   9134  C  CG    . ARG D 2 66  ? 107.404 3.853   24.819  1.00 60.21  ?  445 ARG D CG    1 
ATOM   9135  C  CD    . ARG D 2 66  ? 106.322 4.778   24.295  1.00 64.53  ?  445 ARG D CD    1 
ATOM   9136  N  NE    . ARG D 2 66  ? 106.512 6.173   24.681  1.00 71.06  ?  445 ARG D NE    1 
ATOM   9137  C  CZ    . ARG D 2 66  ? 105.903 6.749   25.711  1.00 76.64  ?  445 ARG D CZ    1 
ATOM   9138  N  NH1   . ARG D 2 66  ? 105.073 6.043   26.465  1.00 77.08  ?  445 ARG D NH1   1 
ATOM   9139  N  NH2   . ARG D 2 66  ? 106.125 8.027   25.991  1.00 79.99  ?  445 ARG D NH2   1 
ATOM   9140  N  N     . ASP D 2 67  ? 110.358 2.803   25.110  1.00 72.33  ?  446 ASP D N     1 
ATOM   9141  C  CA    . ASP D 2 67  ? 111.229 3.413   26.117  1.00 78.95  ?  446 ASP D CA    1 
ATOM   9142  C  C     . ASP D 2 67  ? 110.908 4.911   26.173  1.00 77.45  ?  446 ASP D C     1 
ATOM   9143  O  O     . ASP D 2 67  ? 111.423 5.693   25.365  1.00 76.44  ?  446 ASP D O     1 
ATOM   9144  C  CB    . ASP D 2 67  ? 112.708 3.193   25.760  1.00 83.50  ?  446 ASP D CB    1 
ATOM   9145  C  CG    . ASP D 2 67  ? 113.667 3.651   26.866  1.00 83.39  ?  446 ASP D CG    1 
ATOM   9146  O  OD1   . ASP D 2 67  ? 114.785 3.093   26.958  1.00 80.00  ?  446 ASP D OD1   1 
ATOM   9147  O  OD2   . ASP D 2 67  ? 113.308 4.565   27.639  1.00 86.01  ?  446 ASP D OD2   1 
ATOM   9148  N  N     . ARG D 2 68  ? 110.058 5.304   27.122  1.00 77.24  ?  447 ARG D N     1 
ATOM   9149  C  CA    . ARG D 2 68  ? 109.500 6.658   27.147  1.00 80.29  ?  447 ARG D CA    1 
ATOM   9150  C  C     . ARG D 2 68  ? 110.534 7.732   26.825  1.00 85.11  ?  447 ARG D C     1 
ATOM   9151  O  O     . ARG D 2 68  ? 110.210 8.760   26.226  1.00 87.65  ?  447 ARG D O     1 
ATOM   9152  C  CB    . ARG D 2 68  ? 108.861 6.986   28.506  1.00 83.04  ?  447 ARG D CB    1 
ATOM   9153  C  CG    . ARG D 2 68  ? 108.486 5.798   29.389  1.00 84.79  ?  447 ARG D CG    1 
ATOM   9154  C  CD    . ARG D 2 68  ? 107.998 6.288   30.756  1.00 82.88  ?  447 ARG D CD    1 
ATOM   9155  N  NE    . ARG D 2 68  ? 106.984 7.326   30.601  1.00 82.37  ?  447 ARG D NE    1 
ATOM   9156  C  CZ    . ARG D 2 68  ? 105.686 7.158   30.854  1.00 83.17  ?  447 ARG D CZ    1 
ATOM   9157  N  NH1   . ARG D 2 68  ? 105.237 5.989   31.303  1.00 82.09  ?  447 ARG D NH1   1 
ATOM   9158  N  NH2   . ARG D 2 68  ? 104.833 8.167   30.670  1.00 83.23  ?  447 ARG D NH2   1 
ATOM   9159  N  N     . LYS D 2 69  ? 111.778 7.489   27.227  1.00 86.11  ?  448 LYS D N     1 
ATOM   9160  C  CA    . LYS D 2 69  ? 112.809 8.523   27.208  1.00 85.45  ?  448 LYS D CA    1 
ATOM   9161  C  C     . LYS D 2 69  ? 113.173 9.019   25.801  1.00 89.82  ?  448 LYS D C     1 
ATOM   9162  O  O     . LYS D 2 69  ? 113.516 10.193  25.631  1.00 94.33  ?  448 LYS D O     1 
ATOM   9163  C  CB    . LYS D 2 69  ? 114.054 8.067   27.986  1.00 81.95  ?  448 LYS D CB    1 
ATOM   9164  N  N     . PHE D 2 70  ? 113.083 8.145   24.796  1.00 87.77  ?  449 PHE D N     1 
ATOM   9165  C  CA    . PHE D 2 70  ? 113.486 8.533   23.438  1.00 84.75  ?  449 PHE D CA    1 
ATOM   9166  C  C     . PHE D 2 70  ? 112.613 8.014   22.293  1.00 80.17  ?  449 PHE D C     1 
ATOM   9167  O  O     . PHE D 2 70  ? 112.924 8.252   21.127  1.00 80.02  ?  449 PHE D O     1 
ATOM   9168  C  CB    . PHE D 2 70  ? 114.947 8.146   23.175  1.00 85.78  ?  449 PHE D CB    1 
ATOM   9169  C  CG    . PHE D 2 70  ? 115.180 6.657   23.051  1.00 85.39  ?  449 PHE D CG    1 
ATOM   9170  C  CD1   . PHE D 2 70  ? 115.110 5.828   24.172  1.00 87.11  ?  449 PHE D CD1   1 
ATOM   9171  C  CD2   . PHE D 2 70  ? 115.495 6.089   21.816  1.00 80.56  ?  449 PHE D CD2   1 
ATOM   9172  C  CE1   . PHE D 2 70  ? 115.341 4.457   24.063  1.00 84.91  ?  449 PHE D CE1   1 
ATOM   9173  C  CE2   . PHE D 2 70  ? 115.724 4.721   21.694  1.00 77.75  ?  449 PHE D CE2   1 
ATOM   9174  C  CZ    . PHE D 2 70  ? 115.649 3.902   22.820  1.00 79.89  ?  449 PHE D CZ    1 
ATOM   9175  N  N     . GLN D 2 71  ? 111.534 7.309   22.614  1.00 76.21  ?  450 GLN D N     1 
ATOM   9176  C  CA    . GLN D 2 71  ? 110.665 6.748   21.579  1.00 70.96  ?  450 GLN D CA    1 
ATOM   9177  C  C     . GLN D 2 71  ? 109.241 7.302   21.609  1.00 70.86  ?  450 GLN D C     1 
ATOM   9178  O  O     . GLN D 2 71  ? 108.498 7.113   22.583  1.00 73.19  ?  450 GLN D O     1 
ATOM   9179  C  CB    . GLN D 2 71  ? 110.626 5.227   21.681  1.00 70.33  ?  450 GLN D CB    1 
ATOM   9180  C  CG    . GLN D 2 71  ? 111.918 4.552   21.288  1.00 73.68  ?  450 GLN D CG    1 
ATOM   9181  C  CD    . GLN D 2 71  ? 111.847 3.039   21.398  1.00 76.76  ?  450 GLN D CD    1 
ATOM   9182  O  OE1   . GLN D 2 71  ? 111.238 2.496   22.326  1.00 80.31  ?  450 GLN D OE1   1 
ATOM   9183  N  NE2   . GLN D 2 71  ? 112.471 2.349   20.447  1.00 75.73  ?  450 GLN D NE2   1 
ATOM   9184  N  N     . ALA D 2 72  ? 108.867 7.983   20.532  1.00 67.37  ?  451 ALA D N     1 
ATOM   9185  C  CA    . ALA D 2 72  ? 107.514 8.503   20.394  1.00 65.84  ?  451 ALA D CA    1 
ATOM   9186  C  C     . ALA D 2 72  ? 106.626 7.568   19.546  1.00 63.07  ?  451 ALA D C     1 
ATOM   9187  O  O     . ALA D 2 72  ? 107.112 6.758   18.760  1.00 65.72  ?  451 ALA D O     1 
ATOM   9188  C  CB    . ALA D 2 72  ? 107.553 9.919   19.817  1.00 67.84  ?  451 ALA D CB    1 
ATOM   9189  N  N     . ILE D 2 73  ? 105.317 7.663   19.722  1.00 59.12  ?  452 ILE D N     1 
ATOM   9190  C  CA    . ILE D 2 73  ? 104.406 6.829   18.960  1.00 58.78  ?  452 ILE D CA    1 
ATOM   9191  C  C     . ILE D 2 73  ? 103.376 7.711   18.268  1.00 63.08  ?  452 ILE D C     1 
ATOM   9192  O  O     . ILE D 2 73  ? 102.747 8.566   18.899  1.00 61.57  ?  452 ILE D O     1 
ATOM   9193  C  CB    . ILE D 2 73  ? 103.680 5.788   19.860  1.00 48.36  ?  452 ILE D CB    1 
ATOM   9194  C  CG1   . ILE D 2 73  ? 104.665 5.085   20.801  1.00 49.08  ?  452 ILE D CG1   1 
ATOM   9195  C  CG2   . ILE D 2 73  ? 102.932 4.753   19.006  1.00 47.15  ?  452 ILE D CG2   1 
ATOM   9196  C  CD1   . ILE D 2 73  ? 105.658 4.175   20.084  1.00 49.06  ?  452 ILE D CD1   1 
ATOM   9197  N  N     . LEU D 2 74  ? 103.212 7.515   16.965  1.00 67.07  ?  453 LEU D N     1 
ATOM   9198  C  CA    . LEU D 2 74  ? 102.144 8.193   16.244  1.00 70.63  ?  453 LEU D CA    1 
ATOM   9199  C  C     . LEU D 2 74  ? 101.309 7.181   15.489  1.00 70.95  ?  453 LEU D C     1 
ATOM   9200  O  O     . LEU D 2 74  ? 101.661 6.789   14.377  1.00 71.51  ?  453 LEU D O     1 
ATOM   9201  C  CB    . LEU D 2 74  ? 102.696 9.250   15.280  1.00 70.60  ?  453 LEU D CB    1 
ATOM   9202  C  CG    . LEU D 2 74  ? 101.660 10.263  14.778  1.00 65.98  ?  453 LEU D CG    1 
ATOM   9203  C  CD1   . LEU D 2 74  ? 101.569 10.219  13.275  1.00 61.81  ?  453 LEU D CD1   1 
ATOM   9204  C  CD2   . LEU D 2 74  ? 100.279 10.023  15.417  1.00 65.10  ?  453 LEU D CD2   1 
ATOM   9205  N  N     . PRO D 2 75  ? 100.201 6.744   16.098  1.00 69.27  ?  454 PRO D N     1 
ATOM   9206  C  CA    . PRO D 2 75  ? 99.269  5.798   15.472  1.00 65.79  ?  454 PRO D CA    1 
ATOM   9207  C  C     . PRO D 2 75  ? 98.656  6.341   14.184  1.00 66.78  ?  454 PRO D C     1 
ATOM   9208  O  O     . PRO D 2 75  ? 98.135  7.464   14.158  1.00 67.65  ?  454 PRO D O     1 
ATOM   9209  C  CB    . PRO D 2 75  ? 98.184  5.621   16.538  1.00 64.99  ?  454 PRO D CB    1 
ATOM   9210  C  CG    . PRO D 2 75  ? 98.881  5.904   17.811  1.00 69.85  ?  454 PRO D CG    1 
ATOM   9211  C  CD    . PRO D 2 75  ? 99.847  7.013   17.499  1.00 71.07  ?  454 PRO D CD    1 
ATOM   9212  N  N     . LEU D 2 76  ? 98.745  5.539   13.125  1.00 64.63  ?  455 LEU D N     1 
ATOM   9213  C  CA    . LEU D 2 76  ? 98.056  5.806   11.869  1.00 59.62  ?  455 LEU D CA    1 
ATOM   9214  C  C     . LEU D 2 76  ? 96.787  4.975   11.839  1.00 59.80  ?  455 LEU D C     1 
ATOM   9215  O  O     . LEU D 2 76  ? 96.826  3.773   11.572  1.00 61.55  ?  455 LEU D O     1 
ATOM   9216  C  CB    . LEU D 2 76  ? 98.946  5.449   10.681  1.00 57.20  ?  455 LEU D CB    1 
ATOM   9217  C  CG    . LEU D 2 76  ? 100.142 6.386   10.510  1.00 60.79  ?  455 LEU D CG    1 
ATOM   9218  C  CD1   . LEU D 2 76  ? 100.942 6.055   9.250   1.00 63.66  ?  455 LEU D CD1   1 
ATOM   9219  C  CD2   . LEU D 2 76  ? 99.681  7.840   10.502  1.00 60.65  ?  455 LEU D CD2   1 
ATOM   9220  N  N     . ARG D 2 77  ? 95.663  5.617   12.135  1.00 58.90  ?  456 ARG D N     1 
ATOM   9221  C  CA    . ARG D 2 77  ? 94.396  4.918   12.261  1.00 57.54  ?  456 ARG D CA    1 
ATOM   9222  C  C     . ARG D 2 77  ? 93.685  4.882   10.908  1.00 59.75  ?  456 ARG D C     1 
ATOM   9223  O  O     . ARG D 2 77  ? 93.057  5.861   10.504  1.00 61.84  ?  456 ARG D O     1 
ATOM   9224  C  CB    . ARG D 2 77  ? 93.526  5.605   13.313  1.00 60.03  ?  456 ARG D CB    1 
ATOM   9225  C  CG    . ARG D 2 77  ? 94.320  6.249   14.455  1.00 69.29  ?  456 ARG D CG    1 
ATOM   9226  C  CD    . ARG D 2 77  ? 93.474  7.240   15.247  1.00 81.97  ?  456 ARG D CD    1 
ATOM   9227  N  NE    . ARG D 2 77  ? 92.162  6.674   15.550  1.00 98.13  ?  456 ARG D NE    1 
ATOM   9228  C  CZ    . ARG D 2 77  ? 91.253  7.236   16.343  1.00 109.07 ?  456 ARG D CZ    1 
ATOM   9229  N  NH1   . ARG D 2 77  ? 91.513  8.396   16.938  1.00 112.27 ?  456 ARG D NH1   1 
ATOM   9230  N  NH2   . ARG D 2 77  ? 90.081  6.630   16.542  1.00 111.53 ?  456 ARG D NH2   1 
ATOM   9231  N  N     . GLY D 2 78  ? 93.806  3.753   10.206  1.00 57.89  ?  457 GLY D N     1 
ATOM   9232  C  CA    . GLY D 2 78  ? 93.138  3.557   8.932   1.00 56.17  ?  457 GLY D CA    1 
ATOM   9233  C  C     . GLY D 2 78  ? 94.120  3.557   7.782   1.00 59.12  ?  457 GLY D C     1 
ATOM   9234  O  O     . GLY D 2 78  ? 95.323  3.719   7.992   1.00 61.72  ?  457 GLY D O     1 
ATOM   9235  N  N     . LYS D 2 79  ? 93.616  3.370   6.563   1.00 58.29  ?  458 LYS D N     1 
ATOM   9236  C  CA    . LYS D 2 79  ? 94.478  3.372   5.380   1.00 57.61  ?  458 LYS D CA    1 
ATOM   9237  C  C     . LYS D 2 79  ? 94.889  4.801   5.014   1.00 61.07  ?  458 LYS D C     1 
ATOM   9238  O  O     . LYS D 2 79  ? 94.047  5.699   4.962   1.00 66.25  ?  458 LYS D O     1 
ATOM   9239  C  CB    . LYS D 2 79  ? 93.806  2.670   4.186   1.00 54.77  ?  458 LYS D CB    1 
ATOM   9240  C  CG    . LYS D 2 79  ? 94.122  1.171   4.037   1.00 53.97  ?  458 LYS D CG    1 
ATOM   9241  C  CD    . LYS D 2 79  ? 93.463  0.624   2.768   1.00 57.07  ?  458 LYS D CD    1 
ATOM   9242  C  CE    . LYS D 2 79  ? 93.447  -0.899  2.715   1.00 58.47  ?  458 LYS D CE    1 
ATOM   9243  N  NZ    . LYS D 2 79  ? 94.826  -1.461  2.643   1.00 57.73  ?  458 LYS D NZ    1 
ATOM   9244  N  N     . VAL D 2 80  ? 96.180  5.002   4.754   1.00 58.51  ?  459 VAL D N     1 
ATOM   9245  C  CA    . VAL D 2 80  ? 96.723  6.343   4.546   1.00 56.45  ?  459 VAL D CA    1 
ATOM   9246  C  C     . VAL D 2 80  ? 96.471  6.880   3.153   1.00 51.93  ?  459 VAL D C     1 
ATOM   9247  O  O     . VAL D 2 80  ? 96.592  6.155   2.170   1.00 47.37  ?  459 VAL D O     1 
ATOM   9248  C  CB    . VAL D 2 80  ? 98.233  6.387   4.777   1.00 57.08  ?  459 VAL D CB    1 
ATOM   9249  C  CG1   . VAL D 2 80  ? 98.753  7.754   4.419   1.00 56.68  ?  459 VAL D CG1   1 
ATOM   9250  C  CG2   . VAL D 2 80  ? 98.566  6.044   6.223   1.00 56.77  ?  459 VAL D CG2   1 
ATOM   9251  N  N     . ILE D 2 81  ? 96.153  8.167   3.075   1.00 53.19  ?  460 ILE D N     1 
ATOM   9252  C  CA    . ILE D 2 81  ? 95.809  8.798   1.806   1.00 55.07  ?  460 ILE D CA    1 
ATOM   9253  C  C     . ILE D 2 81  ? 96.876  8.597   0.742   1.00 59.53  ?  460 ILE D C     1 
ATOM   9254  O  O     . ILE D 2 81  ? 98.070  8.602   1.032   1.00 62.98  ?  460 ILE D O     1 
ATOM   9255  C  CB    . ILE D 2 81  ? 95.563  10.305  1.978   1.00 54.68  ?  460 ILE D CB    1 
ATOM   9256  C  CG1   . ILE D 2 81  ? 94.867  10.869  0.737   1.00 55.07  ?  460 ILE D CG1   1 
ATOM   9257  C  CG2   . ILE D 2 81  ? 96.875  11.036  2.302   1.00 52.23  ?  460 ILE D CG2   1 
ATOM   9258  C  CD1   . ILE D 2 81  ? 94.200  12.209  0.955   1.00 55.34  ?  460 ILE D CD1   1 
ATOM   9259  N  N     . ASN D 2 82  ? 96.446  8.427   -0.502  1.00 60.20  ?  461 ASN D N     1 
ATOM   9260  C  CA    . ASN D 2 82  ? 97.398  8.253   -1.587  1.00 61.04  ?  461 ASN D CA    1 
ATOM   9261  C  C     . ASN D 2 82  ? 97.878  9.589   -2.131  1.00 65.12  ?  461 ASN D C     1 
ATOM   9262  O  O     . ASN D 2 82  ? 97.130  10.319  -2.783  1.00 68.05  ?  461 ASN D O     1 
ATOM   9263  C  CB    . ASN D 2 82  ? 96.820  7.395   -2.705  1.00 58.07  ?  461 ASN D CB    1 
ATOM   9264  C  CG    . ASN D 2 82  ? 97.879  6.960   -3.683  1.00 56.75  ?  461 ASN D CG    1 
ATOM   9265  O  OD1   . ASN D 2 82  ? 98.866  7.662   -3.877  1.00 58.54  ?  461 ASN D OD1   1 
ATOM   9266  N  ND2   . ASN D 2 82  ? 97.696  5.796   -4.293  1.00 56.65  ?  461 ASN D ND2   1 
ATOM   9267  N  N     . THR D 2 83  ? 99.135  9.905   -1.857  1.00 64.38  ?  462 THR D N     1 
ATOM   9268  C  CA    . THR D 2 83  ? 99.683  11.206  -2.213  1.00 66.95  ?  462 THR D CA    1 
ATOM   9269  C  C     . THR D 2 83  ? 100.162 11.288  -3.667  1.00 73.12  ?  462 THR D C     1 
ATOM   9270  O  O     . THR D 2 83  ? 100.611 12.343  -4.125  1.00 80.05  ?  462 THR D O     1 
ATOM   9271  C  CB    . THR D 2 83  ? 100.794 11.604  -1.241  1.00 64.65  ?  462 THR D CB    1 
ATOM   9272  O  OG1   . THR D 2 83  ? 101.597 10.457  -0.945  1.00 62.53  ?  462 THR D OG1   1 
ATOM   9273  C  CG2   . THR D 2 83  ? 100.177 12.104  0.046   1.00 63.82  ?  462 THR D CG2   1 
ATOM   9274  N  N     . ALA D 2 84  ? 100.045 10.178  -4.390  1.00 68.50  ?  463 ALA D N     1 
ATOM   9275  C  CA    . ALA D 2 84  ? 100.350 10.147  -5.819  1.00 65.96  ?  463 ALA D CA    1 
ATOM   9276  C  C     . ALA D 2 84  ? 99.081  10.278  -6.661  1.00 68.25  ?  463 ALA D C     1 
ATOM   9277  O  O     . ALA D 2 84  ? 99.137  10.680  -7.824  1.00 73.09  ?  463 ALA D O     1 
ATOM   9278  C  CB    . ALA D 2 84  ? 101.085 8.870   -6.177  1.00 63.89  ?  463 ALA D CB    1 
ATOM   9279  N  N     . LYS D 2 85  ? 97.939  9.935   -6.073  1.00 65.87  ?  464 LYS D N     1 
ATOM   9280  C  CA    . LYS D 2 85  ? 96.669  9.966   -6.793  1.00 64.63  ?  464 LYS D CA    1 
ATOM   9281  C  C     . LYS D 2 85  ? 95.848  11.219  -6.482  1.00 71.13  ?  464 LYS D C     1 
ATOM   9282  O  O     . LYS D 2 85  ? 95.191  11.771  -7.366  1.00 74.14  ?  464 LYS D O     1 
ATOM   9283  C  CB    . LYS D 2 85  ? 95.840  8.706   -6.495  1.00 57.47  ?  464 LYS D CB    1 
ATOM   9284  C  CG    . LYS D 2 85  ? 96.317  7.434   -7.220  1.00 55.18  ?  464 LYS D CG    1 
ATOM   9285  C  CD    . LYS D 2 85  ? 95.402  6.229   -6.949  1.00 53.46  ?  464 LYS D CD    1 
ATOM   9286  C  CE    . LYS D 2 85  ? 96.047  4.927   -7.420  1.00 52.29  ?  464 LYS D CE    1 
ATOM   9287  N  NZ    . LYS D 2 85  ? 95.590  3.732   -6.649  1.00 50.03  ?  464 LYS D NZ    1 
ATOM   9288  N  N     . ALA D 2 86  ? 95.900  11.673  -5.232  1.00 73.83  ?  465 ALA D N     1 
ATOM   9289  C  CA    . ALA D 2 86  ? 94.982  12.703  -4.760  1.00 77.35  ?  465 ALA D CA    1 
ATOM   9290  C  C     . ALA D 2 86  ? 95.495  14.122  -4.966  1.00 81.23  ?  465 ALA D C     1 
ATOM   9291  O  O     . ALA D 2 86  ? 96.697  14.339  -5.128  1.00 81.27  ?  465 ALA D O     1 
ATOM   9292  C  CB    . ALA D 2 86  ? 94.629  12.467  -3.299  1.00 77.41  ?  465 ALA D CB    1 
ATOM   9293  N  N     . LYS D 2 87  ? 94.563  15.076  -4.948  1.00 85.43  ?  466 LYS D N     1 
ATOM   9294  C  CA    . LYS D 2 87  ? 94.848  16.491  -5.205  1.00 91.00  ?  466 LYS D CA    1 
ATOM   9295  C  C     . LYS D 2 87  ? 95.388  17.201  -3.963  1.00 96.64  ?  466 LYS D C     1 
ATOM   9296  O  O     . LYS D 2 87  ? 94.764  17.135  -2.903  1.00 99.69  ?  466 LYS D O     1 
ATOM   9297  C  CB    . LYS D 2 87  ? 93.576  17.200  -5.684  1.00 89.04  ?  466 LYS D CB    1 
ATOM   9298  N  N     . MET D 2 88  ? 96.524  17.895  -4.101  1.00 97.99  ?  467 MET D N     1 
ATOM   9299  C  CA    . MET D 2 88  ? 97.212  18.525  -2.957  1.00 96.70  ?  467 MET D CA    1 
ATOM   9300  C  C     . MET D 2 88  ? 96.277  19.280  -2.000  1.00 101.81 ?  467 MET D C     1 
ATOM   9301  O  O     . MET D 2 88  ? 96.651  19.580  -0.862  1.00 102.44 ?  467 MET D O     1 
ATOM   9302  C  CB    . MET D 2 88  ? 98.351  19.446  -3.423  1.00 88.35  ?  467 MET D CB    1 
ATOM   9303  C  CG    . MET D 2 88  ? 99.365  19.783  -2.331  1.00 80.21  ?  467 MET D CG    1 
ATOM   9304  N  N     . ALA D 2 89  ? 95.068  19.580  -2.472  1.00 102.82 ?  468 ALA D N     1 
ATOM   9305  C  CA    . ALA D 2 89  ? 94.031  20.197  -1.648  1.00 99.83  ?  468 ALA D CA    1 
ATOM   9306  C  C     . ALA D 2 89  ? 93.559  19.216  -0.588  1.00 96.94  ?  468 ALA D C     1 
ATOM   9307  O  O     . ALA D 2 89  ? 93.732  19.446  0.613   1.00 97.53  ?  468 ALA D O     1 
ATOM   9308  C  CB    . ALA D 2 89  ? 92.859  20.635  -2.511  1.00 98.47  ?  468 ALA D CB    1 
ATOM   9309  N  N     . ASP D 2 90  ? 92.955  18.122  -1.048  1.00 94.02  ?  469 ASP D N     1 
ATOM   9310  C  CA    . ASP D 2 90  ? 92.545  17.032  -0.169  1.00 88.61  ?  469 ASP D CA    1 
ATOM   9311  C  C     . ASP D 2 90  ? 93.717  16.514  0.684   1.00 85.53  ?  469 ASP D C     1 
ATOM   9312  O  O     . ASP D 2 90  ? 93.519  16.127  1.840   1.00 87.14  ?  469 ASP D O     1 
ATOM   9313  C  CB    . ASP D 2 90  ? 91.909  15.894  -0.984  1.00 82.45  ?  469 ASP D CB    1 
ATOM   9314  C  CG    . ASP D 2 90  ? 90.534  16.255  -1.525  1.00 77.95  ?  469 ASP D CG    1 
ATOM   9315  N  N     . ILE D 2 91  ? 94.928  16.524  0.119   1.00 79.68  ?  470 ILE D N     1 
ATOM   9316  C  CA    . ILE D 2 91  ? 96.130  16.056  0.823   1.00 74.46  ?  470 ILE D CA    1 
ATOM   9317  C  C     . ILE D 2 91  ? 96.501  16.885  2.049   1.00 72.19  ?  470 ILE D C     1 
ATOM   9318  O  O     . ILE D 2 91  ? 96.907  16.336  3.070   1.00 66.88  ?  470 ILE D O     1 
ATOM   9319  C  CB    . ILE D 2 91  ? 97.378  16.018  -0.085  1.00 75.22  ?  470 ILE D CB    1 
ATOM   9320  C  CG1   . ILE D 2 91  ? 97.220  14.978  -1.191  1.00 78.94  ?  470 ILE D CG1   1 
ATOM   9321  C  CG2   . ILE D 2 91  ? 98.621  15.694  0.742   1.00 71.94  ?  470 ILE D CG2   1 
ATOM   9322  C  CD1   . ILE D 2 91  ? 98.481  14.761  -2.003  1.00 81.98  ?  470 ILE D CD1   1 
ATOM   9323  N  N     . LEU D 2 92  ? 96.397  18.205  1.938   1.00 77.79  ?  471 LEU D N     1 
ATOM   9324  C  CA    . LEU D 2 92  ? 96.736  19.082  3.055   1.00 80.83  ?  471 LEU D CA    1 
ATOM   9325  C  C     . LEU D 2 92  ? 95.588  19.107  4.068   1.00 83.23  ?  471 LEU D C     1 
ATOM   9326  O  O     . LEU D 2 92  ? 95.753  19.573  5.199   1.00 86.45  ?  471 LEU D O     1 
ATOM   9327  C  CB    . LEU D 2 92  ? 97.076  20.494  2.561   1.00 77.04  ?  471 LEU D CB    1 
ATOM   9328  N  N     . LYS D 2 93  ? 94.437  18.578  3.650   1.00 78.53  ?  472 LYS D N     1 
ATOM   9329  C  CA    . LYS D 2 93  ? 93.242  18.522  4.485   1.00 77.59  ?  472 LYS D CA    1 
ATOM   9330  C  C     . LYS D 2 93  ? 93.103  17.170  5.205   1.00 79.09  ?  472 LYS D C     1 
ATOM   9331  O  O     . LYS D 2 93  ? 92.181  16.972  6.001   1.00 78.74  ?  472 LYS D O     1 
ATOM   9332  C  CB    . LYS D 2 93  ? 91.989  18.815  3.644   1.00 76.01  ?  472 LYS D CB    1 
ATOM   9333  N  N     . ASN D 2 94  ? 94.022  16.247  4.924   1.00 80.54  ?  473 ASN D N     1 
ATOM   9334  C  CA    . ASN D 2 94  ? 93.996  14.905  5.514   1.00 80.32  ?  473 ASN D CA    1 
ATOM   9335  C  C     . ASN D 2 94  ? 94.615  14.863  6.908   1.00 86.43  ?  473 ASN D C     1 
ATOM   9336  O  O     . ASN D 2 94  ? 95.809  15.122  7.071   1.00 88.58  ?  473 ASN D O     1 
ATOM   9337  C  CB    . ASN D 2 94  ? 94.713  13.910  4.599   1.00 77.39  ?  473 ASN D CB    1 
ATOM   9338  C  CG    . ASN D 2 94  ? 94.676  12.491  5.130   1.00 76.98  ?  473 ASN D CG    1 
ATOM   9339  O  OD1   . ASN D 2 94  ? 95.702  11.926  5.508   1.00 76.78  ?  473 ASN D OD1   1 
ATOM   9340  N  ND2   . ASN D 2 94  ? 93.489  11.904  5.153   1.00 78.02  ?  473 ASN D ND2   1 
ATOM   9341  N  N     . GLU D 2 95  ? 93.797  14.528  7.906   1.00 88.09  ?  474 GLU D N     1 
ATOM   9342  C  CA    . GLU D 2 95  ? 94.216  14.551  9.310   1.00 88.25  ?  474 GLU D CA    1 
ATOM   9343  C  C     . GLU D 2 95  ? 95.602  13.957  9.535   1.00 85.05  ?  474 GLU D C     1 
ATOM   9344  O  O     . GLU D 2 95  ? 96.497  14.646  10.016  1.00 86.88  ?  474 GLU D O     1 
ATOM   9345  C  CB    . GLU D 2 95  ? 93.186  13.846  10.196  1.00 93.58  ?  474 GLU D CB    1 
ATOM   9346  C  CG    . GLU D 2 95  ? 93.694  13.472  11.587  1.00 101.04 ?  474 GLU D CG    1 
ATOM   9347  C  CD    . GLU D 2 95  ? 92.772  12.492  12.316  1.00 108.21 ?  474 GLU D CD    1 
ATOM   9348  O  OE1   . GLU D 2 95  ? 91.544  12.526  12.074  1.00 111.39 ?  474 GLU D OE1   1 
ATOM   9349  O  OE2   . GLU D 2 95  ? 93.276  11.680  13.126  1.00 109.58 ?  474 GLU D OE2   1 
ATOM   9350  N  N     . GLU D 2 96  ? 95.779  12.686  9.179   1.00 83.29  ?  475 GLU D N     1 
ATOM   9351  C  CA    . GLU D 2 96  ? 97.045  11.986  9.425   1.00 84.72  ?  475 GLU D CA    1 
ATOM   9352  C  C     . GLU D 2 96  ? 98.264  12.698  8.820   1.00 83.23  ?  475 GLU D C     1 
ATOM   9353  O  O     . GLU D 2 96  ? 99.262  12.917  9.512   1.00 83.46  ?  475 GLU D O     1 
ATOM   9354  C  CB    . GLU D 2 96  ? 96.982  10.529  8.944   1.00 87.68  ?  475 GLU D CB    1 
ATOM   9355  C  CG    . GLU D 2 96  ? 95.649  10.118  8.326   1.00 95.09  ?  475 GLU D CG    1 
ATOM   9356  C  CD    . GLU D 2 96  ? 94.567  9.853   9.363   1.00 100.85 ?  475 GLU D CD    1 
ATOM   9357  O  OE1   . GLU D 2 96  ? 93.393  10.201  9.097   1.00 102.17 ?  475 GLU D OE1   1 
ATOM   9358  O  OE2   . GLU D 2 96  ? 94.890  9.285   10.434  1.00 102.12 ?  475 GLU D OE2   1 
ATOM   9359  N  N     . ILE D 2 97  ? 98.177  13.049  7.535   1.00 81.00  ?  476 ILE D N     1 
ATOM   9360  C  CA    . ILE D 2 97  ? 99.243  13.786  6.847   1.00 74.66  ?  476 ILE D CA    1 
ATOM   9361  C  C     . ILE D 2 97  ? 99.641  15.059  7.608   1.00 71.00  ?  476 ILE D C     1 
ATOM   9362  O  O     . ILE D 2 97  ? 100.817 15.264  7.932   1.00 66.27  ?  476 ILE D O     1 
ATOM   9363  C  CB    . ILE D 2 97  ? 98.835  14.174  5.407   1.00 71.33  ?  476 ILE D CB    1 
ATOM   9364  C  CG1   . ILE D 2 97  ? 99.324  13.149  4.393   1.00 62.89  ?  476 ILE D CG1   1 
ATOM   9365  C  CG2   . ILE D 2 97  ? 99.471  15.481  5.024   1.00 77.69  ?  476 ILE D CG2   1 
ATOM   9366  C  CD1   . ILE D 2 97  ? 99.812  11.887  4.987   1.00 58.16  ?  476 ILE D CD1   1 
ATOM   9367  N  N     . ASN D 2 98  ? 98.657  15.912  7.886   1.00 71.82  ?  477 ASN D N     1 
ATOM   9368  C  CA    . ASN D 2 98  ? 98.909  17.142  8.632   1.00 72.50  ?  477 ASN D CA    1 
ATOM   9369  C  C     . ASN D 2 98  ? 99.575  16.873  9.981   1.00 74.02  ?  477 ASN D C     1 
ATOM   9370  O  O     . ASN D 2 98  ? 100.443 17.630  10.407  1.00 74.47  ?  477 ASN D O     1 
ATOM   9371  C  CB    . ASN D 2 98  ? 97.626  17.972  8.799   1.00 67.81  ?  477 ASN D CB    1 
ATOM   9372  C  CG    . ASN D 2 98  ? 97.180  18.623  7.502   1.00 64.76  ?  477 ASN D CG    1 
ATOM   9373  N  N     . THR D 2 99  ? 99.185  15.784  10.640  1.00 75.94  ?  478 THR D N     1 
ATOM   9374  C  CA    . THR D 2 99  ? 99.754  15.450  11.949  1.00 79.46  ?  478 THR D CA    1 
ATOM   9375  C  C     . THR D 2 99  ? 100.987 14.539  11.886  1.00 78.13  ?  478 THR D C     1 
ATOM   9376  O  O     . THR D 2 99  ? 101.315 13.861  12.854  1.00 79.56  ?  478 THR D O     1 
ATOM   9377  C  CB    . THR D 2 99  ? 98.680  14.910  12.964  1.00 70.66  ?  478 THR D CB    1 
ATOM   9378  O  OG1   . THR D 2 99  ? 99.277  13.962  13.858  1.00 71.91  ?  478 THR D OG1   1 
ATOM   9379  C  CG2   . THR D 2 99  ? 97.531  14.252  12.248  1.00 65.31  ?  478 THR D CG2   1 
ATOM   9380  N  N     . MET D 2 100 ? 101.660 14.525  10.741  1.00 75.99  ?  479 MET D N     1 
ATOM   9381  C  CA    . MET D 2 100 ? 102.997 13.954  10.648  1.00 73.39  ?  479 MET D CA    1 
ATOM   9382  C  C     . MET D 2 100 ? 103.927 15.092  10.285  1.00 77.14  ?  479 MET D C     1 
ATOM   9383  O  O     . MET D 2 100 ? 105.042 15.189  10.802  1.00 78.83  ?  479 MET D O     1 
ATOM   9384  C  CB    . MET D 2 100 ? 103.094 12.889  9.560   1.00 71.33  ?  479 MET D CB    1 
ATOM   9385  C  CG    . MET D 2 100 ? 102.163 11.708  9.700   1.00 71.78  ?  479 MET D CG    1 
ATOM   9386  S  SD    . MET D 2 100 ? 102.524 10.438  8.457   1.00 84.00  ?  479 MET D SD    1 
ATOM   9387  C  CE    . MET D 2 100 ? 104.200 10.004  8.914   1.00 58.65  ?  479 MET D CE    1 
ATOM   9388  N  N     . ILE D 2 101 ? 103.462 15.943  9.369   1.00 81.32  ?  480 ILE D N     1 
ATOM   9389  C  CA    . ILE D 2 101 ? 104.195 17.142  8.999   1.00 83.78  ?  480 ILE D CA    1 
ATOM   9390  C  C     . ILE D 2 101 ? 104.413 17.999  10.258  1.00 86.49  ?  480 ILE D C     1 
ATOM   9391  O  O     . ILE D 2 101 ? 105.549 18.386  10.566  1.00 88.69  ?  480 ILE D O     1 
ATOM   9392  C  CB    . ILE D 2 101 ? 103.477 17.940  7.880   1.00 57.44  ?  480 ILE D CB    1 
ATOM   9393  N  N     . TYR D 2 102 ? 103.333 18.250  11.001  1.00 85.89  ?  481 TYR D N     1 
ATOM   9394  C  CA    . TYR D 2 102 ? 103.377 19.108  12.194  1.00 86.50  ?  481 TYR D CA    1 
ATOM   9395  C  C     . TYR D 2 102 ? 103.859 18.378  13.451  1.00 83.24  ?  481 TYR D C     1 
ATOM   9396  O  O     . TYR D 2 102 ? 103.696 18.883  14.571  1.00 76.53  ?  481 TYR D O     1 
ATOM   9397  C  CB    . TYR D 2 102 ? 102.006 19.747  12.457  1.00 85.93  ?  481 TYR D CB    1 
ATOM   9398  N  N     . THR D 2 103 ? 104.445 17.195  13.246  1.00 86.33  ?  482 THR D N     1 
ATOM   9399  C  CA    . THR D 2 103 ? 104.918 16.316  14.322  1.00 86.77  ?  482 THR D CA    1 
ATOM   9400  C  C     . THR D 2 103 ? 106.412 16.113  14.163  1.00 84.57  ?  482 THR D C     1 
ATOM   9401  O  O     . THR D 2 103 ? 107.164 16.152  15.137  1.00 84.37  ?  482 THR D O     1 
ATOM   9402  C  CB    . THR D 2 103 ? 104.253 14.909  14.261  1.00 59.53  ?  482 THR D CB    1 
ATOM   9403  O  OG1   . THR D 2 103 ? 102.839 15.039  14.083  1.00 60.39  ?  482 THR D OG1   1 
ATOM   9404  C  CG2   . THR D 2 103 ? 104.527 14.108  15.526  1.00 57.65  ?  482 THR D CG2   1 
ATOM   9405  N  N     . ILE D 2 104 ? 106.821 15.867  12.921  1.00 84.86  ?  483 ILE D N     1 
ATOM   9406  C  CA    . ILE D 2 104 ? 108.228 15.772  12.564  1.00 88.26  ?  483 ILE D CA    1 
ATOM   9407  C  C     . ILE D 2 104 ? 108.815 17.169  12.506  1.00 99.91  ?  483 ILE D C     1 
ATOM   9408  O  O     . ILE D 2 104 ? 110.035 17.353  12.560  1.00 103.15 ?  483 ILE D O     1 
ATOM   9409  C  CB    . ILE D 2 104 ? 108.405 15.142  11.193  1.00 81.03  ?  483 ILE D CB    1 
ATOM   9410  C  CG1   . ILE D 2 104 ? 107.935 13.694  11.215  1.00 77.29  ?  483 ILE D CG1   1 
ATOM   9411  C  CG2   . ILE D 2 104 ? 109.850 15.219  10.769  1.00 81.30  ?  483 ILE D CG2   1 
ATOM   9412  C  CD1   . ILE D 2 104 ? 108.106 13.009  9.893   1.00 76.63  ?  483 ILE D CD1   1 
ATOM   9413  N  N     . GLY D 2 105 ? 107.923 18.147  12.379  1.00 103.46 ?  484 GLY D N     1 
ATOM   9414  C  CA    . GLY D 2 105 ? 108.288 19.549  12.451  1.00 107.43 ?  484 GLY D CA    1 
ATOM   9415  C  C     . GLY D 2 105 ? 109.379 19.954  11.484  1.00 104.38 ?  484 GLY D C     1 
ATOM   9416  O  O     . GLY D 2 105 ? 110.484 20.317  11.895  1.00 105.19 ?  484 GLY D O     1 
ATOM   9417  N  N     . ALA D 2 106 ? 109.074 19.891  10.194  1.00 102.08 ?  485 ALA D N     1 
ATOM   9418  C  CA    . ALA D 2 106 ? 109.999 20.391  9.189   1.00 104.40 ?  485 ALA D CA    1 
ATOM   9419  C  C     . ALA D 2 106 ? 109.244 20.833  7.951   1.00 106.50 ?  485 ALA D C     1 
ATOM   9420  O  O     . ALA D 2 106 ? 109.845 21.074  6.904   1.00 113.57 ?  485 ALA D O     1 
ATOM   9421  C  CB    . ALA D 2 106 ? 111.047 19.342  8.842   1.00 105.14 ?  485 ALA D CB    1 
ATOM   9422  N  N     . GLY D 2 107 ? 107.925 20.951  8.077   1.00 101.31 ?  486 GLY D N     1 
ATOM   9423  C  CA    . GLY D 2 107 ? 107.092 21.308  6.943   1.00 98.97  ?  486 GLY D CA    1 
ATOM   9424  C  C     . GLY D 2 107 ? 107.169 20.282  5.820   1.00 97.22  ?  486 GLY D C     1 
ATOM   9425  O  O     . GLY D 2 107 ? 107.796 19.227  5.963   1.00 100.35 ?  486 GLY D O     1 
ATOM   9426  N  N     . VAL D 2 108 ? 106.540 20.594  4.691   1.00 93.45  ?  487 VAL D N     1 
ATOM   9427  C  CA    . VAL D 2 108 ? 106.429 19.640  3.595   1.00 84.25  ?  487 VAL D CA    1 
ATOM   9428  C  C     . VAL D 2 108 ? 107.004 20.196  2.284   1.00 90.95  ?  487 VAL D C     1 
ATOM   9429  O  O     . VAL D 2 108 ? 107.178 21.413  2.127   1.00 94.36  ?  487 VAL D O     1 
ATOM   9430  C  CB    . VAL D 2 108 ? 104.956 19.204  3.395   1.00 73.00  ?  487 VAL D CB    1 
ATOM   9431  N  N     . GLY D 2 109 ? 107.314 19.298  1.352   1.00 90.06  ?  488 GLY D N     1 
ATOM   9432  C  CA    . GLY D 2 109 ? 107.743 19.700  0.024   1.00 91.76  ?  488 GLY D CA    1 
ATOM   9433  C  C     . GLY D 2 109 ? 109.109 20.351  -0.037  1.00 95.42  ?  488 GLY D C     1 
ATOM   9434  O  O     . GLY D 2 109 ? 110.020 19.987  0.708   1.00 93.59  ?  488 GLY D O     1 
ATOM   9435  N  N     . ALA D 2 110 ? 109.255 21.312  -0.944  1.00 100.16 ?  489 ALA D N     1 
ATOM   9436  C  CA    . ALA D 2 110 ? 110.530 21.993  -1.140  1.00 107.27 ?  489 ALA D CA    1 
ATOM   9437  C  C     . ALA D 2 110 ? 110.766 23.028  -0.044  1.00 112.04 ?  489 ALA D C     1 
ATOM   9438  O  O     . ALA D 2 110 ? 111.845 23.625  0.049   1.00 112.64 ?  489 ALA D O     1 
ATOM   9439  C  CB    . ALA D 2 110 ? 110.590 22.639  -2.523  1.00 108.49 ?  489 ALA D CB    1 
ATOM   9440  N  N     . ASP D 2 111 ? 109.744 23.241  0.779   1.00 112.70 ?  490 ASP D N     1 
ATOM   9441  C  CA    . ASP D 2 111 ? 109.875 24.095  1.948   1.00 117.77 ?  490 ASP D CA    1 
ATOM   9442  C  C     . ASP D 2 111 ? 110.295 23.233  3.144   1.00 121.58 ?  490 ASP D C     1 
ATOM   9443  O  O     . ASP D 2 111 ? 110.030 23.574  4.301   1.00 125.11 ?  490 ASP D O     1 
ATOM   9444  C  CB    . ASP D 2 111 ? 108.559 24.827  2.227   1.00 114.76 ?  490 ASP D CB    1 
ATOM   9445  N  N     . PHE D 2 112 ? 110.972 22.123  2.845   1.00 119.70 ?  491 PHE D N     1 
ATOM   9446  C  CA    . PHE D 2 112 ? 111.318 21.101  3.838   1.00 115.35 ?  491 PHE D CA    1 
ATOM   9447  C  C     . PHE D 2 112 ? 112.760 21.180  4.365   1.00 113.86 ?  491 PHE D C     1 
ATOM   9448  O  O     . PHE D 2 112 ? 113.716 20.851  3.655   1.00 117.60 ?  491 PHE D O     1 
ATOM   9449  C  CB    . PHE D 2 112 ? 111.050 19.706  3.260   1.00 112.56 ?  491 PHE D CB    1 
ATOM   9450  C  CG    . PHE D 2 112 ? 111.425 18.582  4.185   1.00 111.26 ?  491 PHE D CG    1 
ATOM   9451  C  CD1   . PHE D 2 112 ? 112.668 17.970  4.088   1.00 112.11 ?  491 PHE D CD1   1 
ATOM   9452  C  CD2   . PHE D 2 112 ? 110.537 18.138  5.154   1.00 107.54 ?  491 PHE D CD2   1 
ATOM   9453  C  CE1   . PHE D 2 112 ? 113.019 16.936  4.939   1.00 109.38 ?  491 PHE D CE1   1 
ATOM   9454  C  CE2   . PHE D 2 112 ? 110.882 17.109  6.007   1.00 105.06 ?  491 PHE D CE2   1 
ATOM   9455  C  CZ    . PHE D 2 112 ? 112.125 16.506  5.898   1.00 105.82 ?  491 PHE D CZ    1 
ATOM   9456  N  N     . SER D 2 113 ? 112.900 21.583  5.627   1.00 107.52 ?  492 SER D N     1 
ATOM   9457  C  CA    . SER D 2 113 ? 114.209 21.765  6.253   1.00 103.90 ?  492 SER D CA    1 
ATOM   9458  C  C     . SER D 2 113 ? 114.677 20.547  7.064   1.00 103.23 ?  492 SER D C     1 
ATOM   9459  O  O     . SER D 2 113 ? 114.287 20.399  8.223   1.00 105.22 ?  492 SER D O     1 
ATOM   9460  C  CB    . SER D 2 113 ? 114.163 22.994  7.165   1.00 102.55 ?  492 SER D CB    1 
ATOM   9461  N  N     . ILE D 2 114 ? 115.524 19.697  6.473   1.00 99.32  ?  493 ILE D N     1 
ATOM   9462  C  CA    . ILE D 2 114 ? 116.006 18.479  7.153   1.00 91.93  ?  493 ILE D CA    1 
ATOM   9463  C  C     . ILE D 2 114 ? 116.625 18.747  8.532   1.00 94.45  ?  493 ILE D C     1 
ATOM   9464  O  O     . ILE D 2 114 ? 116.320 18.055  9.511   1.00 89.07  ?  493 ILE D O     1 
ATOM   9465  C  CB    . ILE D 2 114 ? 117.030 17.690  6.302   1.00 87.36  ?  493 ILE D CB    1 
ATOM   9466  N  N     . GLU D 2 115 ? 117.493 19.755  8.597   1.00 100.05 ?  494 GLU D N     1 
ATOM   9467  C  CA    . GLU D 2 115 ? 118.202 20.110  9.831   1.00 98.40  ?  494 GLU D CA    1 
ATOM   9468  C  C     . GLU D 2 115 ? 117.263 20.402  11.011  1.00 98.21  ?  494 GLU D C     1 
ATOM   9469  O  O     . GLU D 2 115 ? 117.704 20.523  12.157  1.00 96.00  ?  494 GLU D O     1 
ATOM   9470  C  CB    . GLU D 2 115 ? 119.134 21.306  9.586   1.00 94.16  ?  494 GLU D CB    1 
ATOM   9471  N  N     . ASP D 2 116 ? 115.970 20.513  10.727  1.00 97.86  ?  495 ASP D N     1 
ATOM   9472  C  CA    . ASP D 2 116 ? 115.002 20.867  11.754  1.00 98.76  ?  495 ASP D CA    1 
ATOM   9473  C  C     . ASP D 2 116 ? 114.077 19.690  12.115  1.00 102.38 ?  495 ASP D C     1 
ATOM   9474  O  O     . ASP D 2 116 ? 113.108 19.860  12.862  1.00 106.13 ?  495 ASP D O     1 
ATOM   9475  C  CB    . ASP D 2 116 ? 114.201 22.105  11.323  1.00 95.64  ?  495 ASP D CB    1 
ATOM   9476  N  N     . ALA D 2 117 ? 114.379 18.501  11.590  1.00 99.32  ?  496 ALA D N     1 
ATOM   9477  C  CA    . ALA D 2 117 ? 113.650 17.288  11.969  1.00 93.71  ?  496 ALA D CA    1 
ATOM   9478  C  C     . ALA D 2 117 ? 113.722 17.104  13.479  1.00 100.66 ?  496 ALA D C     1 
ATOM   9479  O  O     . ALA D 2 117 ? 114.590 17.678  14.137  1.00 106.63 ?  496 ALA D O     1 
ATOM   9480  C  CB    . ALA D 2 117 ? 114.227 16.078  11.273  1.00 86.89  ?  496 ALA D CB    1 
ATOM   9481  N  N     . ASN D 2 118 ? 112.816 16.302  14.030  1.00 98.45  ?  497 ASN D N     1 
ATOM   9482  C  CA    . ASN D 2 118 ? 112.765 16.101  15.481  1.00 94.90  ?  497 ASN D CA    1 
ATOM   9483  C  C     . ASN D 2 118 ? 113.261 14.726  15.904  1.00 90.42  ?  497 ASN D C     1 
ATOM   9484  O  O     . ASN D 2 118 ? 113.445 14.444  17.090  1.00 85.81  ?  497 ASN D O     1 
ATOM   9485  C  CB    . ASN D 2 118 ? 111.346 16.329  16.001  1.00 91.22  ?  497 ASN D CB    1 
ATOM   9486  C  CG    . ASN D 2 118 ? 110.980 17.790  16.047  1.00 90.61  ?  497 ASN D CG    1 
ATOM   9487  O  OD1   . ASN D 2 118 ? 111.794 18.633  16.441  1.00 94.77  ?  497 ASN D OD1   1 
ATOM   9488  N  ND2   . ASN D 2 118 ? 109.756 18.108  15.641  1.00 86.80  ?  497 ASN D ND2   1 
ATOM   9489  N  N     . TYR D 2 119 ? 113.472 13.875  14.912  1.00 89.28  ?  498 TYR D N     1 
ATOM   9490  C  CA    . TYR D 2 119 ? 113.848 12.499  15.148  1.00 86.09  ?  498 TYR D CA    1 
ATOM   9491  C  C     . TYR D 2 119 ? 114.873 12.165  14.092  1.00 84.20  ?  498 TYR D C     1 
ATOM   9492  O  O     . TYR D 2 119 ? 114.741 12.592  12.950  1.00 80.09  ?  498 TYR D O     1 
ATOM   9493  C  CB    . TYR D 2 119 ? 112.621 11.588  15.007  1.00 83.11  ?  498 TYR D CB    1 
ATOM   9494  C  CG    . TYR D 2 119 ? 111.388 12.065  15.769  1.00 81.47  ?  498 TYR D CG    1 
ATOM   9495  C  CD1   . TYR D 2 119 ? 111.041 11.510  17.003  1.00 78.71  ?  498 TYR D CD1   1 
ATOM   9496  C  CD2   . TYR D 2 119 ? 110.574 13.068  15.252  1.00 80.95  ?  498 TYR D CD2   1 
ATOM   9497  C  CE1   . TYR D 2 119 ? 109.914 11.940  17.698  1.00 76.76  ?  498 TYR D CE1   1 
ATOM   9498  C  CE2   . TYR D 2 119 ? 109.454 13.510  15.939  1.00 79.41  ?  498 TYR D CE2   1 
ATOM   9499  C  CZ    . TYR D 2 119 ? 109.128 12.943  17.160  1.00 78.12  ?  498 TYR D CZ    1 
ATOM   9500  O  OH    . TYR D 2 119 ? 108.012 13.385  17.835  1.00 78.92  ?  498 TYR D OH    1 
ATOM   9501  N  N     . ASP D 2 120 ? 115.911 11.429  14.466  1.00 89.15  ?  499 ASP D N     1 
ATOM   9502  C  CA    . ASP D 2 120 ? 116.908 11.013  13.489  1.00 97.36  ?  499 ASP D CA    1 
ATOM   9503  C  C     . ASP D 2 120 ? 116.548 9.630   12.934  1.00 94.75  ?  499 ASP D C     1 
ATOM   9504  O  O     . ASP D 2 120 ? 117.237 9.089   12.063  1.00 94.62  ?  499 ASP D O     1 
ATOM   9505  C  CB    . ASP D 2 120 ? 118.307 11.021  14.106  1.00 106.06 ?  499 ASP D CB    1 
ATOM   9506  C  CG    . ASP D 2 120 ? 118.924 9.642   14.157  1.00 113.65 ?  499 ASP D CG    1 
ATOM   9507  O  OD1   . ASP D 2 120 ? 119.733 9.322   13.259  1.00 115.87 ?  499 ASP D OD1   1 
ATOM   9508  O  OD2   . ASP D 2 120 ? 118.592 8.875   15.087  1.00 116.93 ?  499 ASP D OD2   1 
ATOM   9509  N  N     . LYS D 2 121 ? 115.447 9.075   13.437  1.00 90.77  ?  500 LYS D N     1 
ATOM   9510  C  CA    . LYS D 2 121 ? 114.982 7.751   13.032  1.00 84.76  ?  500 LYS D CA    1 
ATOM   9511  C  C     . LYS D 2 121 ? 113.449 7.702   12.996  1.00 82.22  ?  500 LYS D C     1 
ATOM   9512  O  O     . LYS D 2 121 ? 112.792 7.760   14.036  1.00 87.18  ?  500 LYS D O     1 
ATOM   9513  C  CB    . LYS D 2 121 ? 115.538 6.687   13.991  1.00 81.87  ?  500 LYS D CB    1 
ATOM   9514  C  CG    . LYS D 2 121 ? 116.300 5.552   13.319  1.00 78.16  ?  500 LYS D CG    1 
ATOM   9515  C  CD    . LYS D 2 121 ? 117.244 4.833   14.281  1.00 75.62  ?  500 LYS D CD    1 
ATOM   9516  C  CE    . LYS D 2 121 ? 118.534 5.623   14.489  1.00 79.32  ?  500 LYS D CE    1 
ATOM   9517  N  NZ    . LYS D 2 121 ? 119.638 4.803   15.087  1.00 83.17  ?  500 LYS D NZ    1 
ATOM   9518  N  N     . ILE D 2 122 ? 112.880 7.612   11.798  1.00 77.24  ?  501 ILE D N     1 
ATOM   9519  C  CA    . ILE D 2 122 ? 111.430 7.473   11.651  1.00 71.92  ?  501 ILE D CA    1 
ATOM   9520  C  C     . ILE D 2 122 ? 111.042 6.039   11.272  1.00 67.92  ?  501 ILE D C     1 
ATOM   9521  O  O     . ILE D 2 122 ? 111.285 5.584   10.157  1.00 65.53  ?  501 ILE D O     1 
ATOM   9522  C  CB    . ILE D 2 122 ? 110.869 8.481   10.629  1.00 68.54  ?  501 ILE D CB    1 
ATOM   9523  C  CG1   . ILE D 2 122 ? 111.029 9.898   11.173  1.00 69.18  ?  501 ILE D CG1   1 
ATOM   9524  C  CG2   . ILE D 2 122 ? 109.404 8.177   10.298  1.00 61.44  ?  501 ILE D CG2   1 
ATOM   9525  C  CD1   . ILE D 2 122 ? 110.396 10.946  10.308  1.00 71.20  ?  501 ILE D CD1   1 
ATOM   9526  N  N     . ILE D 2 123 ? 110.436 5.328   12.212  1.00 68.06  ?  502 ILE D N     1 
ATOM   9527  C  CA    . ILE D 2 123 ? 110.208 3.897   12.048  1.00 69.82  ?  502 ILE D CA    1 
ATOM   9528  C  C     . ILE D 2 123 ? 108.761 3.524   11.687  1.00 72.19  ?  502 ILE D C     1 
ATOM   9529  O  O     . ILE D 2 123 ? 107.818 3.877   12.401  1.00 74.14  ?  502 ILE D O     1 
ATOM   9530  C  CB    . ILE D 2 123 ? 110.638 3.137   13.313  1.00 67.51  ?  502 ILE D CB    1 
ATOM   9531  C  CG1   . ILE D 2 123 ? 112.141 3.336   13.563  1.00 67.15  ?  502 ILE D CG1   1 
ATOM   9532  C  CG2   . ILE D 2 123 ? 110.267 1.667   13.197  1.00 65.81  ?  502 ILE D CG2   1 
ATOM   9533  C  CD1   . ILE D 2 123 ? 112.591 2.999   14.982  1.00 67.69  ?  502 ILE D CD1   1 
ATOM   9534  N  N     . ILE D 2 124 ? 108.595 2.809   10.575  1.00 68.07  ?  503 ILE D N     1 
ATOM   9535  C  CA    . ILE D 2 124 ? 107.278 2.357   10.153  1.00 62.16  ?  503 ILE D CA    1 
ATOM   9536  C  C     . ILE D 2 124 ? 107.014 0.947   10.658  1.00 62.00  ?  503 ILE D C     1 
ATOM   9537  O  O     . ILE D 2 124 ? 107.714 0.001   10.291  1.00 59.00  ?  503 ILE D O     1 
ATOM   9538  C  CB    . ILE D 2 124 ? 107.142 2.368   8.633   1.00 62.29  ?  503 ILE D CB    1 
ATOM   9539  C  CG1   . ILE D 2 124 ? 107.431 3.765   8.087   1.00 58.97  ?  503 ILE D CG1   1 
ATOM   9540  C  CG2   . ILE D 2 124 ? 105.750 1.898   8.229   1.00 63.38  ?  503 ILE D CG2   1 
ATOM   9541  C  CD1   . ILE D 2 124 ? 107.316 3.853   6.586   1.00 55.14  ?  503 ILE D CD1   1 
ATOM   9542  N  N     . MET D 2 125 ? 105.994 0.819   11.500  1.00 67.24  ?  504 MET D N     1 
ATOM   9543  C  CA    . MET D 2 125 ? 105.677 -0.443  12.162  1.00 70.85  ?  504 MET D CA    1 
ATOM   9544  C  C     . MET D 2 125 ? 104.261 -0.896  11.794  1.00 71.87  ?  504 MET D C     1 
ATOM   9545  O  O     . MET D 2 125 ? 103.269 -0.349  12.286  1.00 72.91  ?  504 MET D O     1 
ATOM   9546  C  CB    . MET D 2 125 ? 105.812 -0.289  13.684  1.00 71.70  ?  504 MET D CB    1 
ATOM   9547  C  CG    . MET D 2 125 ? 106.480 -1.468  14.382  1.00 72.19  ?  504 MET D CG    1 
ATOM   9548  S  SD    . MET D 2 125 ? 106.578 -1.300  16.188  1.00 74.90  ?  504 MET D SD    1 
ATOM   9549  C  CE    . MET D 2 125 ? 104.842 -1.234  16.609  1.00 102.41 ?  504 MET D CE    1 
ATOM   9550  N  N     . THR D 2 126 ? 104.177 -1.893  10.918  1.00 69.99  ?  505 THR D N     1 
ATOM   9551  C  CA    . THR D 2 126 ? 102.894 -2.406  10.462  1.00 66.05  ?  505 THR D CA    1 
ATOM   9552  C  C     . THR D 2 126 ? 102.792 -3.878  10.790  1.00 67.13  ?  505 THR D C     1 
ATOM   9553  O  O     . THR D 2 126 ? 103.796 -4.518  11.081  1.00 70.11  ?  505 THR D O     1 
ATOM   9554  C  CB    . THR D 2 126 ? 102.776 -2.308  8.947   1.00 62.55  ?  505 THR D CB    1 
ATOM   9555  O  OG1   . THR D 2 126 ? 103.834 -3.075  8.358   1.00 64.28  ?  505 THR D OG1   1 
ATOM   9556  C  CG2   . THR D 2 126 ? 102.858 -0.854  8.483   1.00 58.77  ?  505 THR D CG2   1 
ATOM   9557  N  N     . ASP D 2 127 ? 101.577 -4.414  10.732  1.00 66.46  ?  506 ASP D N     1 
ATOM   9558  C  CA    . ASP D 2 127 ? 101.387 -5.853  10.814  1.00 71.43  ?  506 ASP D CA    1 
ATOM   9559  C  C     . ASP D 2 127 ? 102.218 -6.453  9.687   1.00 65.72  ?  506 ASP D C     1 
ATOM   9560  O  O     . ASP D 2 127 ? 102.611 -5.751  8.754   1.00 66.71  ?  506 ASP D O     1 
ATOM   9561  C  CB    . ASP D 2 127 ? 99.906  -6.227  10.626  1.00 84.96  ?  506 ASP D CB    1 
ATOM   9562  C  CG    . ASP D 2 127 ? 99.063  -6.021  11.888  1.00 95.21  ?  506 ASP D CG    1 
ATOM   9563  O  OD1   . ASP D 2 127 ? 99.595  -5.548  12.918  1.00 99.88  ?  506 ASP D OD1   1 
ATOM   9564  O  OD2   . ASP D 2 127 ? 97.850  -6.331  11.842  1.00 96.03  ?  506 ASP D OD2   1 
ATOM   9565  N  N     . ALA D 2 128 ? 102.491 -7.749  9.769   1.00 62.66  ?  507 ALA D N     1 
ATOM   9566  C  CA    . ALA D 2 128 ? 103.147 -8.440  8.668   1.00 62.84  ?  507 ALA D CA    1 
ATOM   9567  C  C     . ALA D 2 128 ? 102.148 -8.903  7.587   1.00 67.52  ?  507 ALA D C     1 
ATOM   9568  O  O     . ALA D 2 128 ? 102.538 -9.564  6.628   1.00 71.58  ?  507 ALA D O     1 
ATOM   9569  C  CB    . ALA D 2 128 ? 103.952 -9.609  9.196   1.00 60.11  ?  507 ALA D CB    1 
ATOM   9570  N  N     . ASP D 2 129 ? 100.866 -8.554  7.739   1.00 65.20  ?  508 ASP D N     1 
ATOM   9571  C  CA    . ASP D 2 129 ? 99.856  -8.899  6.733   1.00 59.04  ?  508 ASP D CA    1 
ATOM   9572  C  C     . ASP D 2 129 ? 99.957  -8.050  5.446   1.00 58.54  ?  508 ASP D C     1 
ATOM   9573  O  O     . ASP D 2 129 ? 100.824 -7.186  5.321   1.00 58.63  ?  508 ASP D O     1 
ATOM   9574  C  CB    . ASP D 2 129 ? 98.408  -8.992  7.307   1.00 94.78  ?  508 ASP D CB    1 
ATOM   9575  C  CG    . ASP D 2 129 ? 97.916  -7.704  8.011   1.00 94.67  ?  508 ASP D CG    1 
ATOM   9576  O  OD1   . ASP D 2 129 ? 98.322  -6.585  7.628   1.00 94.94  ?  508 ASP D OD1   1 
ATOM   9577  O  OD2   . ASP D 2 129 ? 97.059  -7.834  8.927   1.00 93.46  ?  508 ASP D OD2   1 
ATOM   9578  N  N     . THR D 2 130 ? 99.090  -8.326  4.479   1.00 57.01  ?  509 THR D N     1 
ATOM   9579  C  CA    . THR D 2 130 ? 99.169  -7.650  3.190   1.00 52.85  ?  509 THR D CA    1 
ATOM   9580  C  C     . THR D 2 130 ? 98.768  -6.187  3.292   1.00 48.81  ?  509 THR D C     1 
ATOM   9581  O  O     . THR D 2 130 ? 99.385  -5.322  2.678   1.00 49.91  ?  509 THR D O     1 
ATOM   9582  C  CB    . THR D 2 130 ? 98.312  -8.352  2.115   1.00 54.27  ?  509 THR D CB    1 
ATOM   9583  O  OG1   . THR D 2 130 ? 97.007  -8.616  2.639   1.00 56.46  ?  509 THR D OG1   1 
ATOM   9584  C  CG2   . THR D 2 130 ? 98.957  -9.654  1.692   1.00 53.56  ?  509 THR D CG2   1 
ATOM   9585  N  N     . ASP D 2 131 ? 97.725  -5.910  4.062   1.00 47.53  ?  510 ASP D N     1 
ATOM   9586  C  CA    . ASP D 2 131 ? 97.316  -4.532  4.309   1.00 51.88  ?  510 ASP D CA    1 
ATOM   9587  C  C     . ASP D 2 131 ? 98.393  -3.761  5.060   1.00 53.84  ?  510 ASP D C     1 
ATOM   9588  O  O     . ASP D 2 131 ? 98.416  -2.538  5.018   1.00 57.94  ?  510 ASP D O     1 
ATOM   9589  C  CB    . ASP D 2 131 ? 96.008  -4.483  5.088   1.00 57.65  ?  510 ASP D CB    1 
ATOM   9590  C  CG    . ASP D 2 131 ? 94.912  -5.287  4.430   1.00 58.29  ?  510 ASP D CG    1 
ATOM   9591  O  OD1   . ASP D 2 131 ? 94.298  -4.744  3.487   1.00 59.69  ?  510 ASP D OD1   1 
ATOM   9592  O  OD2   . ASP D 2 131 ? 94.670  -6.445  4.860   1.00 56.52  ?  510 ASP D OD2   1 
ATOM   9593  N  N     . GLY D 2 132 ? 99.274  -4.474  5.758   1.00 52.61  ?  511 GLY D N     1 
ATOM   9594  C  CA    . GLY D 2 132 ? 100.444 -3.852  6.354   1.00 54.64  ?  511 GLY D CA    1 
ATOM   9595  C  C     . GLY D 2 132 ? 101.417 -3.477  5.251   1.00 54.81  ?  511 GLY D C     1 
ATOM   9596  O  O     . GLY D 2 132 ? 101.938 -2.366  5.189   1.00 55.10  ?  511 GLY D O     1 
ATOM   9597  N  N     . ALA D 2 133 ? 101.651 -4.425  4.357   1.00 54.02  ?  512 ALA D N     1 
ATOM   9598  C  CA    . ALA D 2 133 ? 102.455 -4.168  3.186   1.00 51.49  ?  512 ALA D CA    1 
ATOM   9599  C  C     . ALA D 2 133 ? 101.878 -3.000  2.388   1.00 55.50  ?  512 ALA D C     1 
ATOM   9600  O  O     . ALA D 2 133 ? 102.613 -2.265  1.728   1.00 60.49  ?  512 ALA D O     1 
ATOM   9601  C  CB    . ALA D 2 133 ? 102.521 -5.408  2.339   1.00 45.91  ?  512 ALA D CB    1 
ATOM   9602  N  N     . HIS D 2 134 ? 100.560 -2.826  2.447   1.00 53.11  ?  513 HIS D N     1 
ATOM   9603  C  CA    . HIS D 2 134 ? 99.927  -1.733  1.717   1.00 48.39  ?  513 HIS D CA    1 
ATOM   9604  C  C     . HIS D 2 134 ? 100.247 -0.388  2.362   1.00 47.24  ?  513 HIS D C     1 
ATOM   9605  O  O     . HIS D 2 134 ? 100.722 0.526   1.686   1.00 50.47  ?  513 HIS D O     1 
ATOM   9606  C  CB    . HIS D 2 134 ? 98.414  -1.920  1.598   1.00 46.34  ?  513 HIS D CB    1 
ATOM   9607  C  CG    . HIS D 2 134 ? 97.776  -0.989  0.612   1.00 47.69  ?  513 HIS D CG    1 
ATOM   9608  N  ND1   . HIS D 2 134 ? 96.475  -0.547  0.731   1.00 48.28  ?  513 HIS D ND1   1 
ATOM   9609  C  CD2   . HIS D 2 134 ? 98.269  -0.407  -0.510  1.00 48.68  ?  513 HIS D CD2   1 
ATOM   9610  C  CE1   . HIS D 2 134 ? 96.193  0.260   -0.277  1.00 48.10  ?  513 HIS D CE1   1 
ATOM   9611  N  NE2   . HIS D 2 134 ? 97.262  0.361   -1.045  1.00 47.20  ?  513 HIS D NE2   1 
ATOM   9612  N  N     . ILE D 2 135 ? 99.991  -0.280  3.664   1.00 42.57  ?  514 ILE D N     1 
ATOM   9613  C  CA    . ILE D 2 135 ? 100.273 0.947   4.409   1.00 40.82  ?  514 ILE D CA    1 
ATOM   9614  C  C     . ILE D 2 135 ? 101.710 1.433   4.179   1.00 41.96  ?  514 ILE D C     1 
ATOM   9615  O  O     . ILE D 2 135 ? 101.948 2.631   4.033   1.00 68.51  ?  514 ILE D O     1 
ATOM   9616  C  CB    . ILE D 2 135 ? 99.993  0.801   5.947   1.00 57.98  ?  514 ILE D CB    1 
ATOM   9617  C  CG1   . ILE D 2 135 ? 98.582  1.277   6.304   1.00 57.95  ?  514 ILE D CG1   1 
ATOM   9618  C  CG2   . ILE D 2 135 ? 100.963 1.632   6.752   1.00 41.62  ?  514 ILE D CG2   1 
ATOM   9619  C  CD1   . ILE D 2 135 ? 97.518  0.208   6.189   1.00 58.70  ?  514 ILE D CD1   1 
ATOM   9620  N  N     . GLN D 2 136 ? 102.662 0.505   4.149   1.00 42.28  ?  515 GLN D N     1 
ATOM   9621  C  CA    . GLN D 2 136 ? 104.056 0.865   3.944   1.00 49.87  ?  515 GLN D CA    1 
ATOM   9622  C  C     . GLN D 2 136 ? 104.209 1.502   2.578   1.00 58.62  ?  515 GLN D C     1 
ATOM   9623  O  O     . GLN D 2 136 ? 104.818 2.563   2.417   1.00 64.13  ?  515 GLN D O     1 
ATOM   9624  C  CB    . GLN D 2 136 ? 104.941 -0.370  4.012   1.00 52.87  ?  515 GLN D CB    1 
ATOM   9625  C  CG    . GLN D 2 136 ? 105.165 -0.912  5.398   1.00 55.55  ?  515 GLN D CG    1 
ATOM   9626  C  CD    . GLN D 2 136 ? 105.777 -2.281  5.349   1.00 58.21  ?  515 GLN D CD    1 
ATOM   9627  O  OE1   . GLN D 2 136 ? 106.815 -2.489  4.721   1.00 53.34  ?  515 GLN D OE1   1 
ATOM   9628  N  NE2   . GLN D 2 136 ? 105.117 -3.240  5.980   1.00 64.50  ?  515 GLN D NE2   1 
ATOM   9629  N  N     . THR D 2 137 ? 103.656 0.820   1.590   1.00 58.22  ?  516 THR D N     1 
ATOM   9630  C  CA    . THR D 2 137 ? 103.575 1.336   0.241   1.00 58.52  ?  516 THR D CA    1 
ATOM   9631  C  C     . THR D 2 137 ? 103.073 2.785   0.154   1.00 58.88  ?  516 THR D C     1 
ATOM   9632  O  O     . THR D 2 137 ? 103.562 3.575   -0.641  1.00 61.97  ?  516 THR D O     1 
ATOM   9633  C  CB    . THR D 2 137 ? 102.624 0.471   -0.545  1.00 57.55  ?  516 THR D CB    1 
ATOM   9634  O  OG1   . THR D 2 137 ? 103.361 -0.253  -1.538  1.00 60.78  ?  516 THR D OG1   1 
ATOM   9635  C  CG2   . THR D 2 137 ? 101.534 1.335   -1.177  1.00 55.42  ?  516 THR D CG2   1 
ATOM   9636  N  N     . LEU D 2 138 ? 102.085 3.125   0.967   1.00 55.36  ?  517 LEU D N     1 
ATOM   9637  C  CA    . LEU D 2 138 ? 101.467 4.439   0.901   1.00 56.65  ?  517 LEU D CA    1 
ATOM   9638  C  C     . LEU D 2 138 ? 102.285 5.477   1.655   1.00 62.45  ?  517 LEU D C     1 
ATOM   9639  O  O     . LEU D 2 138 ? 102.453 6.606   1.182   1.00 66.18  ?  517 LEU D O     1 
ATOM   9640  C  CB    . LEU D 2 138 ? 100.042 4.378   1.451   1.00 57.61  ?  517 LEU D CB    1 
ATOM   9641  C  CG    . LEU D 2 138 ? 99.086  3.441   0.702   1.00 58.93  ?  517 LEU D CG    1 
ATOM   9642  C  CD1   . LEU D 2 138 ? 98.322  2.567   1.679   1.00 58.91  ?  517 LEU D CD1   1 
ATOM   9643  C  CD2   . LEU D 2 138 ? 98.118  4.231   -0.159  1.00 59.25  ?  517 LEU D CD2   1 
ATOM   9644  N  N     . LEU D 2 139 ? 102.787 5.093   2.828   1.00 63.90  ?  518 LEU D N     1 
ATOM   9645  C  CA    . LEU D 2 139 ? 103.648 5.963   3.631   1.00 66.08  ?  518 LEU D CA    1 
ATOM   9646  C  C     . LEU D 2 139 ? 104.904 6.339   2.866   1.00 72.97  ?  518 LEU D C     1 
ATOM   9647  O  O     . LEU D 2 139 ? 105.259 7.512   2.789   1.00 77.70  ?  518 LEU D O     1 
ATOM   9648  C  CB    . LEU D 2 139 ? 104.048 5.285   4.938   1.00 61.76  ?  518 LEU D CB    1 
ATOM   9649  C  CG    . LEU D 2 139 ? 102.991 5.227   6.031   1.00 58.04  ?  518 LEU D CG    1 
ATOM   9650  C  CD1   . LEU D 2 139 ? 103.589 4.602   7.254   1.00 58.74  ?  518 LEU D CD1   1 
ATOM   9651  C  CD2   . LEU D 2 139 ? 102.462 6.612   6.331   1.00 53.53  ?  518 LEU D CD2   1 
ATOM   9652  N  N     . LEU D 2 140 ? 105.579 5.335   2.310   1.00 73.48  ?  519 LEU D N     1 
ATOM   9653  C  CA    . LEU D 2 140 ? 106.779 5.570   1.509   1.00 72.05  ?  519 LEU D CA    1 
ATOM   9654  C  C     . LEU D 2 140 ? 106.534 6.559   0.367   1.00 71.62  ?  519 LEU D C     1 
ATOM   9655  O  O     . LEU D 2 140 ? 107.286 7.522   0.224   1.00 74.39  ?  519 LEU D O     1 
ATOM   9656  C  CB    . LEU D 2 140 ? 107.390 4.251   1.003   1.00 67.81  ?  519 LEU D CB    1 
ATOM   9657  C  CG    . LEU D 2 140 ? 108.095 3.461   2.119   1.00 63.63  ?  519 LEU D CG    1 
ATOM   9658  C  CD1   . LEU D 2 140 ? 108.815 2.199   1.630   1.00 60.07  ?  519 LEU D CD1   1 
ATOM   9659  C  CD2   . LEU D 2 140 ? 109.064 4.378   2.851   1.00 65.76  ?  519 LEU D CD2   1 
ATOM   9660  N  N     . THR D 2 141 ? 105.482 6.359   -0.426  1.00 67.97  ?  520 THR D N     1 
ATOM   9661  C  CA    . THR D 2 141 ? 105.219 7.299   -1.516  1.00 71.23  ?  520 THR D CA    1 
ATOM   9662  C  C     . THR D 2 141 ? 104.938 8.717   -1.002  1.00 73.90  ?  520 THR D C     1 
ATOM   9663  O  O     . THR D 2 141 ? 105.089 9.688   -1.742  1.00 75.62  ?  520 THR D O     1 
ATOM   9664  C  CB    . THR D 2 141 ? 104.123 6.819   -2.540  1.00 59.88  ?  520 THR D CB    1 
ATOM   9665  O  OG1   . THR D 2 141 ? 102.839 7.357   -2.199  1.00 60.48  ?  520 THR D OG1   1 
ATOM   9666  C  CG2   . THR D 2 141 ? 104.063 5.298   -2.634  1.00 56.49  ?  520 THR D CG2   1 
ATOM   9667  N  N     . PHE D 2 142 ? 104.555 8.844   0.266   1.00 73.51  ?  521 PHE D N     1 
ATOM   9668  C  CA    . PHE D 2 142 ? 104.438 10.176  0.871   1.00 73.97  ?  521 PHE D CA    1 
ATOM   9669  C  C     . PHE D 2 142 ? 105.804 10.821  1.104   1.00 76.58  ?  521 PHE D C     1 
ATOM   9670  O  O     . PHE D 2 142 ? 106.082 11.913  0.606   1.00 78.53  ?  521 PHE D O     1 
ATOM   9671  C  CB    . PHE D 2 142 ? 103.660 10.135  2.187   1.00 69.46  ?  521 PHE D CB    1 
ATOM   9672  C  CG    . PHE D 2 142 ? 103.626 11.458  2.915   1.00 69.32  ?  521 PHE D CG    1 
ATOM   9673  C  CD1   . PHE D 2 142 ? 104.320 11.632  4.107   1.00 67.66  ?  521 PHE D CD1   1 
ATOM   9674  C  CD2   . PHE D 2 142 ? 102.907 12.526  2.409   1.00 70.15  ?  521 PHE D CD2   1 
ATOM   9675  C  CE1   . PHE D 2 142 ? 104.287 12.839  4.783   1.00 67.19  ?  521 PHE D CE1   1 
ATOM   9676  C  CE2   . PHE D 2 142 ? 102.874 13.736  3.078   1.00 69.21  ?  521 PHE D CE2   1 
ATOM   9677  C  CZ    . PHE D 2 142 ? 103.565 13.894  4.264   1.00 68.43  ?  521 PHE D CZ    1 
ATOM   9678  N  N     . PHE D 2 143 ? 106.649 10.142  1.870   1.00 77.03  ?  522 PHE D N     1 
ATOM   9679  C  CA    . PHE D 2 143 ? 107.968 10.664  2.195   1.00 78.81  ?  522 PHE D CA    1 
ATOM   9680  C  C     . PHE D 2 143 ? 108.788 10.904  0.937   1.00 80.87  ?  522 PHE D C     1 
ATOM   9681  O  O     . PHE D 2 143 ? 109.520 11.887  0.838   1.00 82.40  ?  522 PHE D O     1 
ATOM   9682  C  CB    . PHE D 2 143 ? 108.695 9.721   3.154   1.00 76.76  ?  522 PHE D CB    1 
ATOM   9683  C  CG    . PHE D 2 143 ? 108.057 9.645   4.501   1.00 76.36  ?  522 PHE D CG    1 
ATOM   9684  C  CD1   . PHE D 2 143 ? 107.689 10.805  5.166   1.00 80.17  ?  522 PHE D CD1   1 
ATOM   9685  C  CD2   . PHE D 2 143 ? 107.785 8.426   5.088   1.00 76.01  ?  522 PHE D CD2   1 
ATOM   9686  C  CE1   . PHE D 2 143 ? 107.078 10.752  6.414   1.00 81.08  ?  522 PHE D CE1   1 
ATOM   9687  C  CE2   . PHE D 2 143 ? 107.171 8.364   6.329   1.00 78.58  ?  522 PHE D CE2   1 
ATOM   9688  C  CZ    . PHE D 2 143 ? 106.820 9.533   6.997   1.00 79.80  ?  522 PHE D CZ    1 
ATOM   9689  N  N     . TYR D 2 144 ? 108.656 10.004  -0.027  1.00 79.98  ?  523 TYR D N     1 
ATOM   9690  C  CA    . TYR D 2 144 ? 109.337 10.174  -1.293  1.00 80.39  ?  523 TYR D CA    1 
ATOM   9691  C  C     . TYR D 2 144 ? 108.860 11.474  -1.915  1.00 81.54  ?  523 TYR D C     1 
ATOM   9692  O  O     . TYR D 2 144 ? 109.654 12.372  -2.175  1.00 87.63  ?  523 TYR D O     1 
ATOM   9693  C  CB    . TYR D 2 144 ? 109.050 8.994   -2.219  1.00 81.94  ?  523 TYR D CB    1 
ATOM   9694  C  CG    . TYR D 2 144 ? 109.633 9.142   -3.602  1.00 88.27  ?  523 TYR D CG    1 
ATOM   9695  C  CD1   . TYR D 2 144 ? 110.934 8.743   -3.875  1.00 91.09  ?  523 TYR D CD1   1 
ATOM   9696  C  CD2   . TYR D 2 144 ? 108.880 9.679   -4.640  1.00 92.54  ?  523 TYR D CD2   1 
ATOM   9697  C  CE1   . TYR D 2 144 ? 111.472 8.880   -5.146  1.00 95.98  ?  523 TYR D CE1   1 
ATOM   9698  C  CE2   . TYR D 2 144 ? 109.409 9.821   -5.914  1.00 95.86  ?  523 TYR D CE2   1 
ATOM   9699  C  CZ    . TYR D 2 144 ? 110.705 9.419   -6.162  1.00 98.00  ?  523 TYR D CZ    1 
ATOM   9700  O  OH    . TYR D 2 144 ? 111.237 9.552   -7.426  1.00 101.52 ?  523 TYR D OH    1 
ATOM   9701  N  N     . ARG D 2 145 ? 107.555 11.586  -2.123  1.00 78.66  ?  524 ARG D N     1 
ATOM   9702  C  CA    . ARG D 2 145 ? 107.001 12.749  -2.808  1.00 81.32  ?  524 ARG D CA    1 
ATOM   9703  C  C     . ARG D 2 145 ? 107.089 14.063  -2.004  1.00 83.67  ?  524 ARG D C     1 
ATOM   9704  O  O     . ARG D 2 145 ? 107.141 15.145  -2.585  1.00 84.31  ?  524 ARG D O     1 
ATOM   9705  C  CB    . ARG D 2 145 ? 105.548 12.480  -3.238  1.00 82.51  ?  524 ARG D CB    1 
ATOM   9706  C  CG    . ARG D 2 145 ? 105.361 11.338  -4.246  1.00 84.36  ?  524 ARG D CG    1 
ATOM   9707  C  CD    . ARG D 2 145 ? 105.683 11.766  -5.680  1.00 87.98  ?  524 ARG D CD    1 
ATOM   9708  N  NE    . ARG D 2 145 ? 104.505 11.859  -6.547  1.00 85.85  ?  524 ARG D NE    1 
ATOM   9709  C  CZ    . ARG D 2 145 ? 103.431 12.604  -6.286  1.00 85.41  ?  524 ARG D CZ    1 
ATOM   9710  N  NH1   . ARG D 2 145 ? 103.358 13.323  -5.168  1.00 84.57  ?  524 ARG D NH1   1 
ATOM   9711  N  NH2   . ARG D 2 145 ? 102.419 12.626  -7.144  1.00 85.69  ?  524 ARG D NH2   1 
ATOM   9712  N  N     . TYR D 2 146 ? 107.108 13.987  -0.677  1.00 84.44  ?  525 TYR D N     1 
ATOM   9713  C  CA    . TYR D 2 146 ? 106.978 15.216  0.111   1.00 85.05  ?  525 TYR D CA    1 
ATOM   9714  C  C     . TYR D 2 146 ? 108.045 15.454  1.175   1.00 80.70  ?  525 TYR D C     1 
ATOM   9715  O  O     . TYR D 2 146 ? 107.987 16.446  1.909   1.00 77.08  ?  525 TYR D O     1 
ATOM   9716  C  CB    . TYR D 2 146 ? 105.578 15.314  0.716   1.00 84.60  ?  525 TYR D CB    1 
ATOM   9717  C  CG    . TYR D 2 146 ? 104.518 15.654  -0.303  1.00 84.73  ?  525 TYR D CG    1 
ATOM   9718  C  CD1   . TYR D 2 146 ? 103.999 14.680  -1.145  1.00 85.18  ?  525 TYR D CD1   1 
ATOM   9719  C  CD2   . TYR D 2 146 ? 104.041 16.949  -0.424  1.00 86.08  ?  525 TYR D CD2   1 
ATOM   9720  C  CE1   . TYR D 2 146 ? 103.034 14.990  -2.076  1.00 87.50  ?  525 TYR D CE1   1 
ATOM   9721  C  CE2   . TYR D 2 146 ? 103.074 17.269  -1.348  1.00 88.84  ?  525 TYR D CE2   1 
ATOM   9722  C  CZ    . TYR D 2 146 ? 102.574 16.287  -2.170  1.00 91.40  ?  525 TYR D CZ    1 
ATOM   9723  O  OH    . TYR D 2 146 ? 101.609 16.604  -3.094  1.00 96.51  ?  525 TYR D OH    1 
ATOM   9724  N  N     . MET D 2 147 ? 109.013 14.547  1.239   1.00 79.96  ?  526 MET D N     1 
ATOM   9725  C  CA    . MET D 2 147 ? 110.149 14.672  2.150   1.00 80.83  ?  526 MET D CA    1 
ATOM   9726  C  C     . MET D 2 147 ? 111.325 13.851  1.613   1.00 82.33  ?  526 MET D C     1 
ATOM   9727  O  O     . MET D 2 147 ? 111.930 13.061  2.344   1.00 81.80  ?  526 MET D O     1 
ATOM   9728  C  CB    . MET D 2 147 ? 109.769 14.235  3.575   1.00 76.46  ?  526 MET D CB    1 
ATOM   9729  C  CG    . MET D 2 147 ? 108.707 15.126  4.209   1.00 76.50  ?  526 MET D CG    1 
ATOM   9730  S  SD    . MET D 2 147 ? 107.792 14.456  5.625   1.00 69.56  ?  526 MET D SD    1 
ATOM   9731  C  CE    . MET D 2 147 ? 109.090 14.310  6.852   1.00 148.93 ?  526 MET D CE    1 
ATOM   9732  N  N     . ARG D 2 148 ? 111.636 14.041  0.328   1.00 82.18  ?  527 ARG D N     1 
ATOM   9733  C  CA    . ARG D 2 148 ? 112.720 13.292  -0.312  1.00 79.72  ?  527 ARG D CA    1 
ATOM   9734  C  C     . ARG D 2 148 ? 114.010 13.403  0.513   1.00 88.21  ?  527 ARG D C     1 
ATOM   9735  O  O     . ARG D 2 148 ? 114.693 12.394  0.735   1.00 88.95  ?  527 ARG D O     1 
ATOM   9736  C  CB    . ARG D 2 148 ? 112.915 13.703  -1.790  1.00 73.06  ?  527 ARG D CB    1 
ATOM   9737  N  N     . PRO D 2 149 ? 114.324 14.625  1.000   1.00 93.43  ?  528 PRO D N     1 
ATOM   9738  C  CA    . PRO D 2 149 ? 115.490 14.896  1.859   1.00 94.33  ?  528 PRO D CA    1 
ATOM   9739  C  C     . PRO D 2 149 ? 115.629 13.891  3.006   1.00 95.18  ?  528 PRO D C     1 
ATOM   9740  O  O     . PRO D 2 149 ? 116.751 13.583  3.421   1.00 95.14  ?  528 PRO D O     1 
ATOM   9741  C  CB    . PRO D 2 149 ? 115.182 16.284  2.434   1.00 92.05  ?  528 PRO D CB    1 
ATOM   9742  C  CG    . PRO D 2 149 ? 114.341 16.934  1.409   1.00 91.91  ?  528 PRO D CG    1 
ATOM   9743  C  CD    . PRO D 2 149 ? 113.536 15.848  0.747   1.00 92.49  ?  528 PRO D CD    1 
ATOM   9744  N  N     . LEU D 2 150 ? 114.492 13.393  3.492   1.00 94.56  ?  529 LEU D N     1 
ATOM   9745  C  CA    . LEU D 2 150 ? 114.437 12.512  4.651   1.00 93.86  ?  529 LEU D CA    1 
ATOM   9746  C  C     . LEU D 2 150 ? 114.765 11.067  4.300   1.00 98.12  ?  529 LEU D C     1 
ATOM   9747  O  O     . LEU D 2 150 ? 115.553 10.412  4.987   1.00 96.36  ?  529 LEU D O     1 
ATOM   9748  C  CB    . LEU D 2 150 ? 113.050 12.575  5.292   1.00 89.88  ?  529 LEU D CB    1 
ATOM   9749  C  CG    . LEU D 2 150 ? 113.012 12.703  6.819   1.00 89.78  ?  529 LEU D CG    1 
ATOM   9750  C  CD1   . LEU D 2 150 ? 111.674 12.237  7.370   1.00 88.82  ?  529 LEU D CD1   1 
ATOM   9751  C  CD2   . LEU D 2 150 ? 114.162 11.951  7.476   1.00 89.52  ?  529 LEU D CD2   1 
ATOM   9752  N  N     . VAL D 2 151 ? 114.141 10.560  3.242   1.00 105.01 ?  530 VAL D N     1 
ATOM   9753  C  CA    . VAL D 2 151 ? 114.393 9.191   2.819   1.00 108.14 ?  530 VAL D CA    1 
ATOM   9754  C  C     . VAL D 2 151 ? 115.840 9.106   2.354   1.00 109.61 ?  530 VAL D C     1 
ATOM   9755  O  O     . VAL D 2 151 ? 116.548 8.152   2.673   1.00 110.56 ?  530 VAL D O     1 
ATOM   9756  C  CB    . VAL D 2 151 ? 113.420 8.732   1.694   1.00 58.94  ?  530 VAL D CB    1 
ATOM   9757  N  N     . GLU D 2 152 ? 116.285 10.135  1.638   1.00 108.70 ?  531 GLU D N     1 
ATOM   9758  C  CA    . GLU D 2 152 ? 117.592 10.111  0.990   1.00 112.69 ?  531 GLU D CA    1 
ATOM   9759  C  C     . GLU D 2 152 ? 118.759 10.285  1.963   1.00 114.99 ?  531 GLU D C     1 
ATOM   9760  O  O     . GLU D 2 152 ? 119.915 10.036  1.615   1.00 117.13 ?  531 GLU D O     1 
ATOM   9761  C  CB    . GLU D 2 152 ? 117.655 11.162  -0.119  1.00 117.14 ?  531 GLU D CB    1 
ATOM   9762  C  CG    . GLU D 2 152 ? 118.693 10.868  -1.183  1.00 122.55 ?  531 GLU D CG    1 
ATOM   9763  C  CD    . GLU D 2 152 ? 118.337 11.492  -2.518  1.00 127.64 ?  531 GLU D CD    1 
ATOM   9764  O  OE1   . GLU D 2 152 ? 117.468 12.394  -2.538  1.00 126.87 ?  531 GLU D OE1   1 
ATOM   9765  O  OE2   . GLU D 2 152 ? 118.917 11.075  -3.546  1.00 131.75 ?  531 GLU D OE2   1 
ATOM   9766  N  N     . ALA D 2 153 ? 118.458 10.717  3.180   1.00 113.87 ?  532 ALA D N     1 
ATOM   9767  C  CA    . ALA D 2 153 ? 119.486 10.822  4.207   1.00 113.81 ?  532 ALA D CA    1 
ATOM   9768  C  C     . ALA D 2 153 ? 119.495 9.566   5.076   1.00 115.89 ?  532 ALA D C     1 
ATOM   9769  O  O     . ALA D 2 153 ? 120.083 9.556   6.161   1.00 118.86 ?  532 ALA D O     1 
ATOM   9770  C  CB    . ALA D 2 153 ? 119.272 12.062  5.057   1.00 111.44 ?  532 ALA D CB    1 
ATOM   9771  N  N     . GLY D 2 154 ? 118.834 8.514   4.592   1.00 113.13 ?  533 GLY D N     1 
ATOM   9772  C  CA    . GLY D 2 154 ? 118.775 7.236   5.286   1.00 108.25 ?  533 GLY D CA    1 
ATOM   9773  C  C     . GLY D 2 154 ? 118.105 7.297   6.646   1.00 102.08 ?  533 GLY D C     1 
ATOM   9774  O  O     . GLY D 2 154 ? 118.476 6.546   7.558   1.00 100.37 ?  533 GLY D O     1 
ATOM   9775  N  N     . HIS D 2 155 ? 117.117 8.187   6.771   1.00 98.74  ?  534 HIS D N     1 
ATOM   9776  C  CA    . HIS D 2 155 ? 116.430 8.449   8.039   1.00 96.04  ?  534 HIS D CA    1 
ATOM   9777  C  C     . HIS D 2 155 ? 115.073 7.743   8.128   1.00 93.78  ?  534 HIS D C     1 
ATOM   9778  O  O     . HIS D 2 155 ? 114.448 7.731   9.190   1.00 91.18  ?  534 HIS D O     1 
ATOM   9779  C  CB    . HIS D 2 155 ? 116.206 9.957   8.238   1.00 96.67  ?  534 HIS D CB    1 
ATOM   9780  C  CG    . HIS D 2 155 ? 117.366 10.688  8.846   1.00 101.81 ?  534 HIS D CG    1 
ATOM   9781  N  ND1   . HIS D 2 155 ? 118.549 10.067  9.188   1.00 106.84 ?  534 HIS D ND1   1 
ATOM   9782  C  CD2   . HIS D 2 155 ? 117.518 11.992  9.177   1.00 103.71 ?  534 HIS D CD2   1 
ATOM   9783  C  CE1   . HIS D 2 155 ? 119.382 10.958  9.698   1.00 109.82 ?  534 HIS D CE1   1 
ATOM   9784  N  NE2   . HIS D 2 155 ? 118.779 12.136  9.704   1.00 108.18 ?  534 HIS D NE2   1 
ATOM   9785  N  N     . VAL D 2 156 ? 114.605 7.176   7.016   1.00 92.03  ?  535 VAL D N     1 
ATOM   9786  C  CA    . VAL D 2 156 ? 113.289 6.535   6.996   1.00 84.87  ?  535 VAL D CA    1 
ATOM   9787  C  C     . VAL D 2 156 ? 113.401 5.015   6.989   1.00 80.42  ?  535 VAL D C     1 
ATOM   9788  O  O     . VAL D 2 156 ? 113.922 4.433   6.034   1.00 77.82  ?  535 VAL D O     1 
ATOM   9789  C  CB    . VAL D 2 156 ? 112.457 6.972   5.784   1.00 81.97  ?  535 VAL D CB    1 
ATOM   9790  C  CG1   . VAL D 2 156 ? 111.086 6.342   5.853   1.00 75.22  ?  535 VAL D CG1   1 
ATOM   9791  C  CG2   . VAL D 2 156 ? 112.336 8.480   5.742   1.00 85.00  ?  535 VAL D CG2   1 
ATOM   9792  N  N     . TYR D 2 157 ? 112.885 4.389   8.049   1.00 77.92  ?  536 TYR D N     1 
ATOM   9793  C  CA    . TYR D 2 157 ? 113.063 2.954   8.311   1.00 74.64  ?  536 TYR D CA    1 
ATOM   9794  C  C     . TYR D 2 157 ? 111.760 2.143   8.272   1.00 72.76  ?  536 TYR D C     1 
ATOM   9795  O  O     . TYR D 2 157 ? 110.659 2.688   8.364   1.00 73.23  ?  536 TYR D O     1 
ATOM   9796  C  CB    . TYR D 2 157 ? 113.717 2.748   9.687   1.00 73.99  ?  536 TYR D CB    1 
ATOM   9797  C  CG    . TYR D 2 157 ? 115.092 3.368   9.854   1.00 75.27  ?  536 TYR D CG    1 
ATOM   9798  C  CD1   . TYR D 2 157 ? 116.239 2.582   9.845   1.00 76.99  ?  536 TYR D CD1   1 
ATOM   9799  C  CD2   . TYR D 2 157 ? 115.241 4.740   10.028  1.00 77.17  ?  536 TYR D CD2   1 
ATOM   9800  C  CE1   . TYR D 2 157 ? 117.494 3.149   9.999   1.00 80.67  ?  536 TYR D CE1   1 
ATOM   9801  C  CE2   . TYR D 2 157 ? 116.490 5.311   10.181  1.00 80.99  ?  536 TYR D CE2   1 
ATOM   9802  C  CZ    . TYR D 2 157 ? 117.612 4.513   10.168  1.00 81.00  ?  536 TYR D CZ    1 
ATOM   9803  O  OH    . TYR D 2 157 ? 118.851 5.088   10.321  1.00 80.39  ?  536 TYR D OH    1 
ATOM   9804  N  N     . ILE D 2 158 ? 111.897 0.828   8.157   1.00 71.82  ?  537 ILE D N     1 
ATOM   9805  C  CA    . ILE D 2 158 ? 110.755 -0.064  8.288   1.00 72.49  ?  537 ILE D CA    1 
ATOM   9806  C  C     . ILE D 2 158 ? 111.071 -1.156  9.290   1.00 73.55  ?  537 ILE D C     1 
ATOM   9807  O  O     . ILE D 2 158 ? 112.045 -1.881  9.119   1.00 74.69  ?  537 ILE D O     1 
ATOM   9808  C  CB    . ILE D 2 158 ? 110.431 -0.752  6.969   1.00 74.23  ?  537 ILE D CB    1 
ATOM   9809  C  CG1   . ILE D 2 158 ? 109.855 0.248   5.971   1.00 70.57  ?  537 ILE D CG1   1 
ATOM   9810  C  CG2   . ILE D 2 158 ? 109.460 -1.910  7.203   1.00 77.24  ?  537 ILE D CG2   1 
ATOM   9811  C  CD1   . ILE D 2 158 ? 110.026 -0.205  4.533   1.00 71.65  ?  537 ILE D CD1   1 
ATOM   9812  N  N     . ALA D 2 159 ? 110.250 -1.284  10.329  1.00 74.29  ?  538 ALA D N     1 
ATOM   9813  C  CA    . ALA D 2 159 ? 110.487 -2.302  11.352  1.00 71.99  ?  538 ALA D CA    1 
ATOM   9814  C  C     . ALA D 2 159 ? 109.993 -3.656  10.891  1.00 69.18  ?  538 ALA D C     1 
ATOM   9815  O  O     . ALA D 2 159 ? 108.879 -3.781  10.388  1.00 68.10  ?  538 ALA D O     1 
ATOM   9816  C  CB    . ALA D 2 159 ? 109.836 -1.923  12.674  1.00 69.32  ?  538 ALA D CB    1 
ATOM   9817  N  N     . LEU D 2 160 ? 110.843 -4.662  11.052  1.00 74.91  ?  539 LEU D N     1 
ATOM   9818  C  CA    . LEU D 2 160 ? 110.476 -6.032  10.749  1.00 76.05  ?  539 LEU D CA    1 
ATOM   9819  C  C     . LEU D 2 160 ? 110.113 -6.733  12.059  1.00 73.80  ?  539 LEU D C     1 
ATOM   9820  O  O     . LEU D 2 160 ? 110.990 -7.023  12.871  1.00 77.24  ?  539 LEU D O     1 
ATOM   9821  C  CB    . LEU D 2 160 ? 111.627 -6.762  10.026  1.00 79.96  ?  539 LEU D CB    1 
ATOM   9822  C  CG    . LEU D 2 160 ? 112.026 -6.295  8.618   1.00 58.24  ?  539 LEU D CG    1 
ATOM   9823  N  N     . PRO D 2 161 ? 108.810 -6.976  12.278  1.00 71.31  ?  540 PRO D N     1 
ATOM   9824  C  CA    . PRO D 2 161 ? 108.331 -7.749  13.425  1.00 71.67  ?  540 PRO D CA    1 
ATOM   9825  C  C     . PRO D 2 161 ? 108.482 -9.218  13.108  1.00 76.81  ?  540 PRO D C     1 
ATOM   9826  O  O     . PRO D 2 161 ? 108.665 -9.565  11.940  1.00 76.71  ?  540 PRO D O     1 
ATOM   9827  C  CB    . PRO D 2 161 ? 106.837 -7.414  13.488  1.00 70.24  ?  540 PRO D CB    1 
ATOM   9828  C  CG    . PRO D 2 161 ? 106.594 -6.388  12.413  1.00 71.91  ?  540 PRO D CG    1 
ATOM   9829  C  CD    . PRO D 2 161 ? 107.696 -6.541  11.427  1.00 72.33  ?  540 PRO D CD    1 
ATOM   9830  N  N     . PRO D 2 162 ? 108.404 -10.075 14.133  1.00 81.42  ?  541 PRO D N     1 
ATOM   9831  C  CA    . PRO D 2 162 ? 108.541 -11.526 13.957  1.00 83.08  ?  541 PRO D CA    1 
ATOM   9832  C  C     . PRO D 2 162 ? 107.239 -12.173 13.504  1.00 80.22  ?  541 PRO D C     1 
ATOM   9833  O  O     . PRO D 2 162 ? 106.157 -11.767 13.940  1.00 77.77  ?  541 PRO D O     1 
ATOM   9834  C  CB    . PRO D 2 162 ? 108.902 -12.011 15.363  1.00 85.65  ?  541 PRO D CB    1 
ATOM   9835  C  CG    . PRO D 2 162 ? 108.238 -11.032 16.261  1.00 84.44  ?  541 PRO D CG    1 
ATOM   9836  C  CD    . PRO D 2 162 ? 108.281 -9.697  15.551  1.00 82.39  ?  541 PRO D CD    1 
ATOM   9837  N  N     . LEU D 2 163 ? 107.341 -13.168 12.633  1.00 80.86  ?  542 LEU D N     1 
ATOM   9838  C  CA    . LEU D 2 163 ? 106.154 -13.903 12.222  1.00 80.54  ?  542 LEU D CA    1 
ATOM   9839  C  C     . LEU D 2 163 ? 105.856 -15.030 13.212  1.00 87.64  ?  542 LEU D C     1 
ATOM   9840  O  O     . LEU D 2 163 ? 104.692 -15.371 13.426  1.00 90.35  ?  542 LEU D O     1 
ATOM   9841  C  CB    . LEU D 2 163 ? 106.290 -14.443 10.787  1.00 75.84  ?  542 LEU D CB    1 
ATOM   9842  C  CG    . LEU D 2 163 ? 106.431 -13.417 9.654   1.00 68.43  ?  542 LEU D CG    1 
ATOM   9843  N  N     . TYR D 2 164 ? 106.900 -15.576 13.840  1.00 90.31  ?  543 TYR D N     1 
ATOM   9844  C  CA    . TYR D 2 164 ? 106.758 -16.806 14.629  1.00 94.06  ?  543 TYR D CA    1 
ATOM   9845  C  C     . TYR D 2 164 ? 107.355 -16.783 16.042  1.00 93.88  ?  543 TYR D C     1 
ATOM   9846  O  O     . TYR D 2 164 ? 108.227 -15.972 16.346  1.00 96.39  ?  543 TYR D O     1 
ATOM   9847  C  CB    . TYR D 2 164 ? 107.354 -17.981 13.853  1.00 99.29  ?  543 TYR D CB    1 
ATOM   9848  C  CG    . TYR D 2 164 ? 106.822 -18.110 12.446  1.00 102.41 ?  543 TYR D CG    1 
ATOM   9849  C  CD1   . TYR D 2 164 ? 105.572 -18.663 12.202  1.00 104.17 ?  543 TYR D CD1   1 
ATOM   9850  C  CD2   . TYR D 2 164 ? 107.566 -17.677 11.363  1.00 103.98 ?  543 TYR D CD2   1 
ATOM   9851  C  CE1   . TYR D 2 164 ? 105.078 -18.784 10.920  1.00 106.57 ?  543 TYR D CE1   1 
ATOM   9852  C  CE2   . TYR D 2 164 ? 107.082 -17.795 10.075  1.00 107.46 ?  543 TYR D CE2   1 
ATOM   9853  C  CZ    . TYR D 2 164 ? 105.838 -18.350 9.858   1.00 108.98 ?  543 TYR D CZ    1 
ATOM   9854  O  OH    . TYR D 2 164 ? 105.354 -18.471 8.572   1.00 113.08 ?  543 TYR D OH    1 
ATOM   9855  N  N     . LYS D 2 165 ? 106.863 -17.687 16.892  1.00 93.68  ?  544 LYS D N     1 
ATOM   9856  C  CA    . LYS D 2 165 ? 107.418 -17.943 18.231  1.00 93.98  ?  544 LYS D CA    1 
ATOM   9857  C  C     . LYS D 2 165 ? 107.045 -19.370 18.649  1.00 99.06  ?  544 LYS D C     1 
ATOM   9858  O  O     . LYS D 2 165 ? 105.869 -19.736 18.591  1.00 103.08 ?  544 LYS D O     1 
ATOM   9859  C  CB    . LYS D 2 165 ? 106.886 -16.937 19.259  1.00 87.58  ?  544 LYS D CB    1 
ATOM   9860  N  N     . MET D 2 166 ? 108.030 -20.172 19.068  1.00 99.82  ?  545 MET D N     1 
ATOM   9861  C  CA    . MET D 2 166 ? 107.794 -21.605 19.325  1.00 104.01 ?  545 MET D CA    1 
ATOM   9862  C  C     . MET D 2 166 ? 107.986 -22.034 20.788  1.00 101.20 ?  545 MET D C     1 
ATOM   9863  O  O     . MET D 2 166 ? 107.939 -21.217 21.709  1.00 96.41  ?  545 MET D O     1 
ATOM   9864  C  CB    . MET D 2 166 ? 108.664 -22.472 18.398  1.00 109.61 ?  545 MET D CB    1 
ATOM   9865  C  CG    . MET D 2 166 ? 107.972 -23.718 17.847  1.00 78.87  ?  545 MET D CG    1 
ATOM   9866  N  N     . ALA D 2 177 ? 111.907 -18.721 21.732  1.00 99.51  ?  556 ALA D N     1 
ATOM   9867  C  CA    . ALA D 2 177 ? 112.609 -17.882 20.758  1.00 102.61 ?  556 ALA D CA    1 
ATOM   9868  C  C     . ALA D 2 177 ? 111.689 -17.372 19.632  1.00 103.96 ?  556 ALA D C     1 
ATOM   9869  O  O     . ALA D 2 177 ? 110.471 -17.585 19.665  1.00 100.34 ?  556 ALA D O     1 
ATOM   9870  C  CB    . ALA D 2 177 ? 113.819 -18.626 20.180  1.00 103.59 ?  556 ALA D CB    1 
ATOM   9871  N  N     . TYR D 2 178 ? 112.282 -16.704 18.639  1.00 105.91 ?  557 TYR D N     1 
ATOM   9872  C  CA    . TYR D 2 178 ? 111.524 -16.088 17.545  1.00 102.01 ?  557 TYR D CA    1 
ATOM   9873  C  C     . TYR D 2 178 ? 112.127 -16.359 16.170  1.00 99.66  ?  557 TYR D C     1 
ATOM   9874  O  O     . TYR D 2 178 ? 113.334 -16.533 16.040  1.00 101.06 ?  557 TYR D O     1 
ATOM   9875  C  CB    . TYR D 2 178 ? 111.419 -14.575 17.758  1.00 101.92 ?  557 TYR D CB    1 
ATOM   9876  C  CG    . TYR D 2 178 ? 110.644 -14.191 18.994  1.00 100.54 ?  557 TYR D CG    1 
ATOM   9877  C  CD1   . TYR D 2 178 ? 111.273 -14.108 20.232  1.00 101.22 ?  557 TYR D CD1   1 
ATOM   9878  C  CD2   . TYR D 2 178 ? 109.281 -13.918 18.925  1.00 99.17  ?  557 TYR D CD2   1 
ATOM   9879  C  CE1   . TYR D 2 178 ? 110.571 -13.761 21.367  1.00 102.88 ?  557 TYR D CE1   1 
ATOM   9880  C  CE2   . TYR D 2 178 ? 108.569 -13.572 20.055  1.00 101.23 ?  557 TYR D CE2   1 
ATOM   9881  C  CZ    . TYR D 2 178 ? 109.220 -13.493 21.277  1.00 104.13 ?  557 TYR D CZ    1 
ATOM   9882  O  OH    . TYR D 2 178 ? 108.520 -13.143 22.412  1.00 106.51 ?  557 TYR D OH    1 
ATOM   9883  N  N     . ALA D 2 179 ? 111.275 -16.386 15.147  1.00 99.48  ?  558 ALA D N     1 
ATOM   9884  C  CA    . ALA D 2 179 ? 111.714 -16.564 13.762  1.00 103.53 ?  558 ALA D CA    1 
ATOM   9885  C  C     . ALA D 2 179 ? 111.000 -15.580 12.840  1.00 102.81 ?  558 ALA D C     1 
ATOM   9886  O  O     . ALA D 2 179 ? 109.807 -15.306 13.009  1.00 98.70  ?  558 ALA D O     1 
ATOM   9887  C  CB    . ALA D 2 179 ? 111.481 -17.995 13.300  1.00 104.91 ?  558 ALA D CB    1 
ATOM   9888  N  N     . TRP D 2 180 ? 111.734 -15.061 11.859  1.00 103.91 ?  559 TRP D N     1 
ATOM   9889  C  CA    . TRP D 2 180 ? 111.231 -13.983 11.008  1.00 97.82  ?  559 TRP D CA    1 
ATOM   9890  C  C     . TRP D 2 180 ? 110.796 -14.444 9.616   1.00 94.64  ?  559 TRP D C     1 
ATOM   9891  O  O     . TRP D 2 180 ? 109.920 -13.835 9.000   1.00 93.82  ?  559 TRP D O     1 
ATOM   9892  C  CB    . TRP D 2 180 ? 112.277 -12.872 10.895  1.00 98.93  ?  559 TRP D CB    1 
ATOM   9893  C  CG    . TRP D 2 180 ? 112.130 -11.796 11.930  1.00 97.00  ?  559 TRP D CG    1 
ATOM   9894  C  CD1   . TRP D 2 180 ? 111.514 -10.591 11.770  1.00 96.34  ?  559 TRP D CD1   1 
ATOM   9895  C  CD2   . TRP D 2 180 ? 112.607 -11.827 13.286  1.00 99.47  ?  559 TRP D CD2   1 
ATOM   9896  N  NE1   . TRP D 2 180 ? 111.578 -9.868  12.935  1.00 97.95  ?  559 TRP D NE1   1 
ATOM   9897  C  CE2   . TRP D 2 180 ? 112.242 -10.603 13.882  1.00 99.21  ?  559 TRP D CE2   1 
ATOM   9898  C  CE3   . TRP D 2 180 ? 113.303 -12.767 14.052  1.00 100.54 ?  559 TRP D CE3   1 
ATOM   9899  C  CZ2   . TRP D 2 180 ? 112.552 -10.295 15.211  1.00 97.08  ?  559 TRP D CZ2   1 
ATOM   9900  C  CZ3   . TRP D 2 180 ? 113.610 -12.457 15.372  1.00 99.84  ?  559 TRP D CZ3   1 
ATOM   9901  C  CH2   . TRP D 2 180 ? 113.234 -11.233 15.935  1.00 98.32  ?  559 TRP D CH2   1 
ATOM   9902  N  N     . THR D 2 181 ? 111.412 -15.516 9.127   1.00 94.63  ?  560 THR D N     1 
ATOM   9903  C  CA    . THR D 2 181 ? 111.087 -16.057 7.813   1.00 93.66  ?  560 THR D CA    1 
ATOM   9904  C  C     . THR D 2 181 ? 110.932 -17.574 7.904   1.00 99.13  ?  560 THR D C     1 
ATOM   9905  O  O     . THR D 2 181 ? 111.702 -18.232 8.603   1.00 101.87 ?  560 THR D O     1 
ATOM   9906  C  CB    . THR D 2 181 ? 112.182 -15.715 6.786   1.00 94.25  ?  560 THR D CB    1 
ATOM   9907  N  N     . ASP D 2 182 ? 109.937 -18.123 7.206   1.00 101.67 ?  561 ASP D N     1 
ATOM   9908  C  CA    . ASP D 2 182 ? 109.688 -19.570 7.204   1.00 103.88 ?  561 ASP D CA    1 
ATOM   9909  C  C     . ASP D 2 182 ? 110.989 -20.380 7.243   1.00 113.07 ?  561 ASP D C     1 
ATOM   9910  O  O     . ASP D 2 182 ? 111.061 -21.427 7.894   1.00 114.25 ?  561 ASP D O     1 
ATOM   9911  C  CB    . ASP D 2 182 ? 108.835 -19.978 5.994   1.00 102.52 ?  561 ASP D CB    1 
ATOM   9912  N  N     . GLY D 2 183 ? 112.014 -19.884 6.550   1.00 119.04 ?  562 GLY D N     1 
ATOM   9913  C  CA    . GLY D 2 183 ? 113.330 -20.504 6.554   1.00 127.92 ?  562 GLY D CA    1 
ATOM   9914  C  C     . GLY D 2 183 ? 114.022 -20.422 7.905   1.00 129.45 ?  562 GLY D C     1 
ATOM   9915  O  O     . GLY D 2 183 ? 114.375 -21.446 8.497   1.00 129.55 ?  562 GLY D O     1 
ATOM   9916  N  N     . GLU D 2 184 ? 114.224 -19.200 8.394   1.00 127.97 ?  563 GLU D N     1 
ATOM   9917  C  CA    . GLU D 2 184 ? 114.759 -18.997 9.737   1.00 126.70 ?  563 GLU D CA    1 
ATOM   9918  C  C     . GLU D 2 184 ? 113.934 -19.785 10.761  1.00 129.15 ?  563 GLU D C     1 
ATOM   9919  O  O     . GLU D 2 184 ? 114.422 -20.123 11.840  1.00 131.18 ?  563 GLU D O     1 
ATOM   9920  C  CB    . GLU D 2 184 ? 114.779 -17.504 10.093  1.00 116.73 ?  563 GLU D CB    1 
ATOM   9921  N  N     . LEU D 2 185 ? 112.688 -20.089 10.403  1.00 129.82 ?  564 LEU D N     1 
ATOM   9922  C  CA    . LEU D 2 185 ? 111.759 -20.786 11.292  1.00 127.39 ?  564 LEU D CA    1 
ATOM   9923  C  C     . LEU D 2 185 ? 112.129 -22.250 11.500  1.00 135.62 ?  564 LEU D C     1 
ATOM   9924  O  O     . LEU D 2 185 ? 112.472 -22.657 12.611  1.00 135.91 ?  564 LEU D O     1 
ATOM   9925  C  CB    . LEU D 2 185 ? 110.331 -20.704 10.742  1.00 120.14 ?  564 LEU D CB    1 
ATOM   9926  C  CG    . LEU D 2 185 ? 109.184 -21.051 11.700  1.00 111.01 ?  564 LEU D CG    1 
ATOM   9927  C  CD1   . LEU D 2 185 ? 107.930 -21.466 10.932  1.00 109.64 ?  564 LEU D CD1   1 
ATOM   9928  C  CD2   . LEU D 2 185 ? 109.592 -22.118 12.711  1.00 109.96 ?  564 LEU D CD2   1 
ATOM   9929  N  N     . GLU D 2 186 ? 112.041 -23.035 10.427  1.00 142.22 ?  565 GLU D N     1 
ATOM   9930  C  CA    . GLU D 2 186 ? 112.236 -24.484 10.495  1.00 148.69 ?  565 GLU D CA    1 
ATOM   9931  C  C     . GLU D 2 186 ? 113.541 -24.899 11.180  1.00 153.11 ?  565 GLU D C     1 
ATOM   9932  O  O     . GLU D 2 186 ? 113.658 -26.024 11.664  1.00 156.23 ?  565 GLU D O     1 
ATOM   9933  C  CB    . GLU D 2 186 ? 112.152 -25.107 9.097   1.00 153.71 ?  565 GLU D CB    1 
ATOM   9934  N  N     . GLU D 2 187 ? 114.515 -23.993 11.216  1.00 152.63 ?  566 GLU D N     1 
ATOM   9935  C  CA    . GLU D 2 187 ? 115.788 -24.262 11.886  1.00 154.93 ?  566 GLU D CA    1 
ATOM   9936  C  C     . GLU D 2 187 ? 115.623 -24.280 13.409  1.00 150.88 ?  566 GLU D C     1 
ATOM   9937  O  O     . GLU D 2 187 ? 116.388 -24.943 14.117  1.00 153.11 ?  566 GLU D O     1 
ATOM   9938  C  CB    . GLU D 2 187 ? 116.848 -23.237 11.471  1.00 154.56 ?  566 GLU D CB    1 
ATOM   9939  N  N     . LEU D 2 188 ? 114.621 -23.550 13.900  1.00 145.16 ?  567 LEU D N     1 
ATOM   9940  C  CA    . LEU D 2 188 ? 114.294 -23.519 15.329  1.00 141.52 ?  567 LEU D CA    1 
ATOM   9941  C  C     . LEU D 2 188 ? 113.427 -24.721 15.729  1.00 144.29 ?  567 LEU D C     1 
ATOM   9942  O  O     . LEU D 2 188 ? 113.350 -25.083 16.909  1.00 142.87 ?  567 LEU D O     1 
ATOM   9943  C  CB    . LEU D 2 188 ? 113.592 -22.203 15.701  1.00 130.73 ?  567 LEU D CB    1 
ATOM   9944  N  N     . ARG D 2 189 ? 112.782 -25.331 14.735  1.00 145.90 ?  568 ARG D N     1 
ATOM   9945  C  CA    . ARG D 2 189 ? 111.927 -26.498 14.948  1.00 145.61 ?  568 ARG D CA    1 
ATOM   9946  C  C     . ARG D 2 189 ? 112.766 -27.737 15.269  1.00 151.57 ?  568 ARG D C     1 
ATOM   9947  O  O     . ARG D 2 189 ? 112.248 -28.755 15.740  1.00 154.19 ?  568 ARG D O     1 
ATOM   9948  C  CB    . ARG D 2 189 ? 111.039 -26.746 13.722  1.00 144.15 ?  568 ARG D CB    1 
ATOM   9949  N  N     . LYS D 2 190 ? 114.067 -27.641 15.009  1.00 152.87 ?  569 LYS D N     1 
ATOM   9950  C  CA    . LYS D 2 190 ? 115.000 -28.685 15.398  1.00 155.12 ?  569 LYS D CA    1 
ATOM   9951  C  C     . LYS D 2 190 ? 115.213 -28.631 16.910  1.00 149.73 ?  569 LYS D C     1 
ATOM   9952  O  O     . LYS D 2 190 ? 114.255 -28.698 17.687  1.00 145.21 ?  569 LYS D O     1 
ATOM   9953  C  CB    . LYS D 2 190 ? 116.331 -28.519 14.658  1.00 159.17 ?  569 LYS D CB    1 
ATOM   9954  N  N     . GLN D 2 191 ? 116.472 -28.501 17.321  1.00 149.92 ?  570 GLN D N     1 
ATOM   9955  C  CA    . GLN D 2 191 ? 116.821 -28.445 18.738  1.00 142.02 ?  570 GLN D CA    1 
ATOM   9956  C  C     . GLN D 2 191 ? 116.749 -27.013 19.277  1.00 129.29 ?  570 GLN D C     1 
ATOM   9957  O  O     . GLN D 2 191 ? 115.776 -26.628 19.928  1.00 117.50 ?  570 GLN D O     1 
ATOM   9958  C  CB    . GLN D 2 191 ? 118.218 -29.036 18.967  1.00 145.94 ?  570 GLN D CB    1 
ATOM   9959  N  N     . LEU D 2 198 ? 104.464 -23.319 17.575  1.00 98.84  ?  577 LEU D N     1 
ATOM   9960  C  CA    . LEU D 2 198 ? 104.627 -22.141 16.714  1.00 98.98  ?  577 LEU D CA    1 
ATOM   9961  C  C     . LEU D 2 198 ? 103.443 -21.165 16.786  1.00 106.54 ?  577 LEU D C     1 
ATOM   9962  O  O     . LEU D 2 198 ? 102.453 -21.325 16.072  1.00 111.82 ?  577 LEU D O     1 
ATOM   9963  C  CB    . LEU D 2 198 ? 104.873 -22.557 15.257  1.00 95.06  ?  577 LEU D CB    1 
ATOM   9964  N  N     . GLN D 2 199 ? 103.545 -20.156 17.648  1.00 104.87 ?  578 GLN D N     1 
ATOM   9965  C  CA    . GLN D 2 199 ? 102.538 -19.100 17.704  1.00 102.62 ?  578 GLN D CA    1 
ATOM   9966  C  C     . GLN D 2 199 ? 102.684 -18.189 16.490  1.00 101.44 ?  578 GLN D C     1 
ATOM   9967  O  O     . GLN D 2 199 ? 103.538 -17.307 16.475  1.00 100.64 ?  578 GLN D O     1 
ATOM   9968  C  CB    . GLN D 2 199 ? 102.673 -18.280 18.993  1.00 98.95  ?  578 GLN D CB    1 
ATOM   9969  N  N     . ARG D 2 200 ? 101.860 -18.410 15.471  1.00 102.39 ?  579 ARG D N     1 
ATOM   9970  C  CA    . ARG D 2 200 ? 101.892 -17.582 14.264  1.00 100.86 ?  579 ARG D CA    1 
ATOM   9971  C  C     . ARG D 2 200 ? 101.283 -16.195 14.516  1.00 100.74 ?  579 ARG D C     1 
ATOM   9972  O  O     . ARG D 2 200 ? 100.067 -16.018 14.392  1.00 104.72 ?  579 ARG D O     1 
ATOM   9973  C  CB    . ARG D 2 200 ? 101.163 -18.286 13.106  1.00 99.75  ?  579 ARG D CB    1 
ATOM   9974  N  N     . TYR D 2 201 ? 102.120 -15.215 14.862  1.00 97.04  ?  580 TYR D N     1 
ATOM   9975  C  CA    . TYR D 2 201 ? 101.621 -13.876 15.180  1.00 97.86  ?  580 TYR D CA    1 
ATOM   9976  C  C     . TYR D 2 201 ? 100.734 -13.348 14.064  1.00 99.82  ?  580 TYR D C     1 
ATOM   9977  O  O     . TYR D 2 201 ? 101.223 -12.963 13.001  1.00 100.12 ?  580 TYR D O     1 
ATOM   9978  C  CB    . TYR D 2 201 ? 102.762 -12.898 15.488  1.00 97.79  ?  580 TYR D CB    1 
ATOM   9979  C  CG    . TYR D 2 201 ? 103.553 -13.291 16.714  1.00 102.09 ?  580 TYR D CG    1 
ATOM   9980  C  CD1   . TYR D 2 201 ? 103.006 -13.182 17.989  1.00 103.79 ?  580 TYR D CD1   1 
ATOM   9981  C  CD2   . TYR D 2 201 ? 104.844 -13.790 16.597  1.00 105.44 ?  580 TYR D CD2   1 
ATOM   9982  C  CE1   . TYR D 2 201 ? 103.730 -13.559 19.116  1.00 106.36 ?  580 TYR D CE1   1 
ATOM   9983  C  CE2   . TYR D 2 201 ? 105.576 -14.167 17.715  1.00 107.52 ?  580 TYR D CE2   1 
ATOM   9984  C  CZ    . TYR D 2 201 ? 105.019 -14.051 18.971  1.00 108.37 ?  580 TYR D CZ    1 
ATOM   9985  O  OH    . TYR D 2 201 ? 105.762 -14.433 20.070  1.00 110.39 ?  580 TYR D OH    1 
ATOM   9986  N  N     . LYS D 2 202 ? 99.425  -13.348 14.320  1.00 101.36 ?  581 LYS D N     1 
ATOM   9987  C  CA    . LYS D 2 202 ? 98.426  -12.943 13.333  1.00 100.94 ?  581 LYS D CA    1 
ATOM   9988  C  C     . LYS D 2 202 ? 98.558  -11.457 12.976  1.00 100.04 ?  581 LYS D C     1 
ATOM   9989  O  O     . LYS D 2 202 ? 98.038  -11.001 11.958  1.00 97.53  ?  581 LYS D O     1 
ATOM   9990  C  CB    . LYS D 2 202 ? 97.013  -13.267 13.841  1.00 102.84 ?  581 LYS D CB    1 
ATOM   9991  N  N     . GLY D 2 203 ? 99.274  -10.716 13.816  1.00 85.81  ?  582 GLY D N     1 
ATOM   9992  C  CA    . GLY D 2 203 ? 99.489  -9.294  13.618  1.00 85.82  ?  582 GLY D CA    1 
ATOM   9993  C  C     . GLY D 2 203 ? 100.048 -8.691  14.892  1.00 88.06  ?  582 GLY D C     1 
ATOM   9994  O  O     . GLY D 2 203 ? 100.297 -9.417  15.855  1.00 90.14  ?  582 GLY D O     1 
ATOM   9995  N  N     . LEU D 2 204 ? 100.233 -7.372  14.908  1.00 89.78  ?  583 LEU D N     1 
ATOM   9996  C  CA    . LEU D 2 204 ? 100.837 -6.684  16.056  1.00 93.41  ?  583 LEU D CA    1 
ATOM   9997  C  C     . LEU D 2 204 ? 100.005 -6.724  17.346  1.00 102.02 ?  583 LEU D C     1 
ATOM   9998  O  O     . LEU D 2 204 ? 100.553 -6.859  18.446  1.00 99.19  ?  583 LEU D O     1 
ATOM   9999  C  CB    . LEU D 2 204 ? 101.156 -5.234  15.693  1.00 85.07  ?  583 LEU D CB    1 
ATOM   10000 C  CG    . LEU D 2 204 ? 102.365 -5.050  14.783  1.00 81.11  ?  583 LEU D CG    1 
ATOM   10001 C  CD1   . LEU D 2 204 ? 102.666 -3.567  14.604  1.00 80.00  ?  583 LEU D CD1   1 
ATOM   10002 C  CD2   . LEU D 2 204 ? 103.569 -5.797  15.353  1.00 80.73  ?  583 LEU D CD2   1 
ATOM   10003 N  N     . GLY D 2 205 ? 98.687  -6.603  17.197  1.00 108.20 ?  584 GLY D N     1 
ATOM   10004 C  CA    . GLY D 2 205 ? 97.778  -6.516  18.326  1.00 114.52 ?  584 GLY D CA    1 
ATOM   10005 C  C     . GLY D 2 205 ? 97.651  -7.794  19.128  1.00 118.22 ?  584 GLY D C     1 
ATOM   10006 O  O     . GLY D 2 205 ? 96.902  -7.843  20.108  1.00 120.32 ?  584 GLY D O     1 
ATOM   10007 N  N     . GLU D 2 206 ? 98.382  -8.826  18.713  1.00 120.51 ?  585 GLU D N     1 
ATOM   10008 C  CA    . GLU D 2 206 ? 98.382  -10.112 19.409  1.00 122.35 ?  585 GLU D CA    1 
ATOM   10009 C  C     . GLU D 2 206 ? 99.698  -10.365 20.165  1.00 119.37 ?  585 GLU D C     1 
ATOM   10010 O  O     . GLU D 2 206 ? 99.840  -11.371 20.867  1.00 119.98 ?  585 GLU D O     1 
ATOM   10011 C  CB    . GLU D 2 206 ? 98.085  -11.255 18.429  1.00 124.47 ?  585 GLU D CB    1 
ATOM   10012 N  N     . MET D 2 207 ? 100.655 -9.452  20.014  1.00 116.78 ?  586 MET D N     1 
ATOM   10013 C  CA    . MET D 2 207 ? 101.895 -9.507  20.782  1.00 117.07 ?  586 MET D CA    1 
ATOM   10014 C  C     . MET D 2 207 ? 101.722 -8.706  22.083  1.00 118.15 ?  586 MET D C     1 
ATOM   10015 O  O     . MET D 2 207 ? 100.943 -7.748  22.123  1.00 119.65 ?  586 MET D O     1 
ATOM   10016 C  CB    . MET D 2 207 ? 103.070 -8.974  19.951  1.00 115.47 ?  586 MET D CB    1 
ATOM   10017 N  N     . ASN D 2 208 ? 102.429 -9.109  23.141  1.00 114.36 ?  587 ASN D N     1 
ATOM   10018 C  CA    . ASN D 2 208 ? 102.317 -8.461  24.456  1.00 110.24 ?  587 ASN D CA    1 
ATOM   10019 C  C     . ASN D 2 208 ? 103.521 -7.574  24.781  1.00 101.98 ?  587 ASN D C     1 
ATOM   10020 O  O     . ASN D 2 208 ? 104.663 -8.024  24.733  1.00 103.56 ?  587 ASN D O     1 
ATOM   10021 C  CB    . ASN D 2 208 ? 102.109 -9.499  25.574  1.00 116.89 ?  587 ASN D CB    1 
ATOM   10022 C  CG    . ASN D 2 208 ? 100.627 -9.793  25.857  1.00 119.65 ?  587 ASN D CG    1 
ATOM   10023 O  OD1   . ASN D 2 208 ? 99.757  -9.527  25.029  1.00 120.28 ?  587 ASN D OD1   1 
ATOM   10024 N  ND2   . ASN D 2 208 ? 100.346 -10.347 27.035  1.00 120.67 ?  587 ASN D ND2   1 
ATOM   10025 N  N     . ALA D 2 209 ? 103.241 -6.323  25.137  1.00 96.20  ?  588 ALA D N     1 
ATOM   10026 C  CA    . ALA D 2 209 ? 104.246 -5.262  25.295  1.00 94.02  ?  588 ALA D CA    1 
ATOM   10027 C  C     . ALA D 2 209 ? 105.707 -5.644  25.641  1.00 93.25  ?  588 ALA D C     1 
ATOM   10028 O  O     . ALA D 2 209 ? 106.643 -5.006  25.150  1.00 91.56  ?  588 ALA D O     1 
ATOM   10029 C  CB    . ALA D 2 209 ? 103.728 -4.178  26.248  1.00 94.77  ?  588 ALA D CB    1 
ATOM   10030 N  N     . ASP D 2 210 ? 105.917 -6.650  26.484  1.00 93.59  ?  589 ASP D N     1 
ATOM   10031 C  CA    . ASP D 2 210 ? 107.290 -7.050  26.811  1.00 94.27  ?  589 ASP D CA    1 
ATOM   10032 C  C     . ASP D 2 210 ? 107.928 -7.793  25.624  1.00 97.60  ?  589 ASP D C     1 
ATOM   10033 O  O     . ASP D 2 210 ? 109.142 -7.716  25.393  1.00 93.82  ?  589 ASP D O     1 
ATOM   10034 C  CB    . ASP D 2 210 ? 107.343 -7.878  28.106  1.00 92.39  ?  589 ASP D CB    1 
ATOM   10035 N  N     . GLN D 2 211 ? 107.092 -8.498  24.865  1.00 101.41 ?  590 GLN D N     1 
ATOM   10036 C  CA    . GLN D 2 211 ? 107.538 -9.206  23.665  1.00 100.95 ?  590 GLN D CA    1 
ATOM   10037 C  C     . GLN D 2 211 ? 107.851 -8.227  22.541  1.00 94.41  ?  590 GLN D C     1 
ATOM   10038 O  O     . GLN D 2 211 ? 108.896 -8.322  21.892  1.00 93.79  ?  590 GLN D O     1 
ATOM   10039 C  CB    . GLN D 2 211 ? 106.480 -10.217 23.215  1.00 103.59 ?  590 GLN D CB    1 
ATOM   10040 C  CG    . GLN D 2 211 ? 106.334 -11.410 24.151  1.00 110.77 ?  590 GLN D CG    1 
ATOM   10041 C  CD    . GLN D 2 211 ? 104.938 -11.994 24.129  1.00 119.87 ?  590 GLN D CD    1 
ATOM   10042 O  OE1   . GLN D 2 211 ? 103.976 -11.304 23.789  1.00 124.16 ?  590 GLN D OE1   1 
ATOM   10043 N  NE2   . GLN D 2 211 ? 104.816 -13.270 24.488  1.00 122.66 ?  590 GLN D NE2   1 
ATOM   10044 N  N     . LEU D 2 212 ? 106.941 -7.284  22.321  1.00 91.24  ?  591 LEU D N     1 
ATOM   10045 C  CA    . LEU D 2 212 ? 107.151 -6.227  21.337  1.00 88.60  ?  591 LEU D CA    1 
ATOM   10046 C  C     . LEU D 2 212 ? 108.517 -5.583  21.517  1.00 86.41  ?  591 LEU D C     1 
ATOM   10047 O  O     . LEU D 2 212 ? 109.291 -5.457  20.567  1.00 87.01  ?  591 LEU D O     1 
ATOM   10048 C  CB    . LEU D 2 212 ? 106.077 -5.145  21.478  1.00 88.26  ?  591 LEU D CB    1 
ATOM   10049 C  CG    . LEU D 2 212 ? 105.256 -4.698  20.260  1.00 86.89  ?  591 LEU D CG    1 
ATOM   10050 C  CD1   . LEU D 2 212 ? 104.851 -3.236  20.405  1.00 86.74  ?  591 LEU D CD1   1 
ATOM   10051 C  CD2   . LEU D 2 212 ? 105.974 -4.935  18.943  1.00 86.83  ?  591 LEU D CD2   1 
ATOM   10052 N  N     . TRP D 2 213 ? 108.798 -5.171  22.749  1.00 84.53  ?  592 TRP D N     1 
ATOM   10053 C  CA    . TRP D 2 213 ? 110.018 -4.439  23.048  1.00 82.63  ?  592 TRP D CA    1 
ATOM   10054 C  C     . TRP D 2 213 ? 111.253 -5.228  22.657  1.00 85.03  ?  592 TRP D C     1 
ATOM   10055 O  O     . TRP D 2 213 ? 112.176 -4.687  22.037  1.00 83.01  ?  592 TRP D O     1 
ATOM   10056 C  CB    . TRP D 2 213 ? 110.083 -4.093  24.532  1.00 80.19  ?  592 TRP D CB    1 
ATOM   10057 C  CG    . TRP D 2 213 ? 111.430 -3.605  24.950  1.00 78.48  ?  592 TRP D CG    1 
ATOM   10058 C  CD1   . TRP D 2 213 ? 112.343 -4.272  25.713  1.00 76.69  ?  592 TRP D CD1   1 
ATOM   10059 C  CD2   . TRP D 2 213 ? 112.032 -2.350  24.607  1.00 81.49  ?  592 TRP D CD2   1 
ATOM   10060 N  NE1   . TRP D 2 213 ? 113.470 -3.505  25.877  1.00 79.42  ?  592 TRP D NE1   1 
ATOM   10061 C  CE2   . TRP D 2 213 ? 113.305 -2.320  25.208  1.00 81.47  ?  592 TRP D CE2   1 
ATOM   10062 C  CE3   . TRP D 2 213 ? 111.615 -1.246  23.853  1.00 83.86  ?  592 TRP D CE3   1 
ATOM   10063 C  CZ2   . TRP D 2 213 ? 114.169 -1.229  25.078  1.00 83.73  ?  592 TRP D CZ2   1 
ATOM   10064 C  CZ3   . TRP D 2 213 ? 112.474 -0.160  23.728  1.00 84.56  ?  592 TRP D CZ3   1 
ATOM   10065 C  CH2   . TRP D 2 213 ? 113.735 -0.162  24.334  1.00 83.91  ?  592 TRP D CH2   1 
ATOM   10066 N  N     . GLU D 2 214 ? 111.250 -6.510  23.020  1.00 87.65  ?  593 GLU D N     1 
ATOM   10067 C  CA    . GLU D 2 214 ? 112.411 -7.384  22.865  1.00 87.21  ?  593 GLU D CA    1 
ATOM   10068 C  C     . GLU D 2 214 ? 112.753 -7.676  21.402  1.00 84.79  ?  593 GLU D C     1 
ATOM   10069 O  O     . GLU D 2 214 ? 113.933 -7.764  21.038  1.00 86.03  ?  593 GLU D O     1 
ATOM   10070 C  CB    . GLU D 2 214 ? 112.186 -8.691  23.633  1.00 85.71  ?  593 GLU D CB    1 
ATOM   10071 N  N     . THR D 2 215 ? 111.716 -7.797  20.573  1.00 80.54  ?  594 THR D N     1 
ATOM   10072 C  CA    . THR D 2 215 ? 111.855 -8.250  19.188  1.00 77.47  ?  594 THR D CA    1 
ATOM   10073 C  C     . THR D 2 215 ? 111.919 -7.132  18.145  1.00 81.04  ?  594 THR D C     1 
ATOM   10074 O  O     . THR D 2 215 ? 112.628 -7.255  17.136  1.00 86.66  ?  594 THR D O     1 
ATOM   10075 C  CB    . THR D 2 215 ? 110.691 -9.171  18.789  1.00 71.28  ?  594 THR D CB    1 
ATOM   10076 O  OG1   . THR D 2 215 ? 109.485 -8.401  18.699  1.00 67.77  ?  594 THR D OG1   1 
ATOM   10077 C  CG2   . THR D 2 215 ? 110.507 -10.283 19.809  1.00 70.19  ?  594 THR D CG2   1 
ATOM   10078 N  N     . THR D 2 216 ? 111.174 -6.053  18.370  1.00 78.62  ?  595 THR D N     1 
ATOM   10079 C  CA    . THR D 2 216 ? 111.043 -5.021  17.345  1.00 77.01  ?  595 THR D CA    1 
ATOM   10080 C  C     . THR D 2 216 ? 111.462 -3.621  17.800  1.00 73.95  ?  595 THR D C     1 
ATOM   10081 O  O     . THR D 2 216 ? 112.044 -2.869  17.025  1.00 76.17  ?  595 THR D O     1 
ATOM   10082 C  CB    . THR D 2 216 ? 109.599 -4.923  16.833  1.00 77.42  ?  595 THR D CB    1 
ATOM   10083 O  OG1   . THR D 2 216 ? 108.796 -4.306  17.842  1.00 84.42  ?  595 THR D OG1   1 
ATOM   10084 C  CG2   . THR D 2 216 ? 109.025 -6.306  16.501  1.00 71.48  ?  595 THR D CG2   1 
ATOM   10085 N  N     . MET D 2 217 ? 111.159 -3.262  19.042  1.00 69.99  ?  596 MET D N     1 
ATOM   10086 C  CA    . MET D 2 217 ? 111.389 -1.890  19.498  1.00 69.58  ?  596 MET D CA    1 
ATOM   10087 C  C     . MET D 2 217 ? 112.764 -1.635  20.147  1.00 71.36  ?  596 MET D C     1 
ATOM   10088 O  O     . MET D 2 217 ? 113.328 -0.547  20.020  1.00 68.49  ?  596 MET D O     1 
ATOM   10089 C  CB    . MET D 2 217 ? 110.272 -1.448  20.446  1.00 69.16  ?  596 MET D CB    1 
ATOM   10090 C  CG    . MET D 2 217 ? 108.870 -1.759  19.952  1.00 65.29  ?  596 MET D CG    1 
ATOM   10091 S  SD    . MET D 2 217 ? 107.637 -0.656  20.672  1.00 85.24  ?  596 MET D SD    1 
ATOM   10092 C  CE    . MET D 2 217 ? 108.188 0.916   20.014  1.00 70.62  ?  596 MET D CE    1 
ATOM   10093 N  N     . ASN D 2 218 ? 113.299 -2.628  20.849  1.00 75.01  ?  597 ASN D N     1 
ATOM   10094 C  CA    . ASN D 2 218 ? 114.611 -2.489  21.481  1.00 80.00  ?  597 ASN D CA    1 
ATOM   10095 C  C     . ASN D 2 218 ? 115.751 -2.358  20.457  1.00 79.96  ?  597 ASN D C     1 
ATOM   10096 O  O     . ASN D 2 218 ? 116.028 -3.292  19.699  1.00 79.79  ?  597 ASN D O     1 
ATOM   10097 C  CB    . ASN D 2 218 ? 114.857 -3.669  22.423  1.00 84.94  ?  597 ASN D CB    1 
ATOM   10098 C  CG    . ASN D 2 218 ? 116.183 -3.578  23.139  1.00 86.84  ?  597 ASN D CG    1 
ATOM   10099 O  OD1   . ASN D 2 218 ? 116.816 -2.523  23.169  1.00 85.57  ?  597 ASN D OD1   1 
ATOM   10100 N  ND2   . ASN D 2 218 ? 116.611 -4.688  23.726  1.00 89.80  ?  597 ASN D ND2   1 
ATOM   10101 N  N     . PRO D 2 219 ? 116.422 -1.198  20.441  1.00 78.90  ?  598 PRO D N     1 
ATOM   10102 C  CA    . PRO D 2 219 ? 117.408 -0.866  19.402  1.00 80.53  ?  598 PRO D CA    1 
ATOM   10103 C  C     . PRO D 2 219 ? 118.537 -1.876  19.337  1.00 83.60  ?  598 PRO D C     1 
ATOM   10104 O  O     . PRO D 2 219 ? 119.214 -1.991  18.307  1.00 85.63  ?  598 PRO D O     1 
ATOM   10105 C  CB    . PRO D 2 219 ? 117.949 0.489   19.848  1.00 80.23  ?  598 PRO D CB    1 
ATOM   10106 C  CG    . PRO D 2 219 ? 116.870 1.054   20.714  1.00 80.51  ?  598 PRO D CG    1 
ATOM   10107 C  CD    . PRO D 2 219 ? 116.281 -0.121  21.431  1.00 79.30  ?  598 PRO D CD    1 
ATOM   10108 N  N     . GLU D 2 220 ? 118.732 -2.598  20.436  1.00 83.30  ?  599 GLU D N     1 
ATOM   10109 C  CA    . GLU D 2 220 ? 119.744 -3.644  20.494  1.00 83.04  ?  599 GLU D CA    1 
ATOM   10110 C  C     . GLU D 2 220 ? 119.246 -4.961  19.867  1.00 85.29  ?  599 GLU D C     1 
ATOM   10111 O  O     . GLU D 2 220 ? 119.835 -5.460  18.907  1.00 89.04  ?  599 GLU D O     1 
ATOM   10112 C  CB    . GLU D 2 220 ? 120.225 -3.851  21.936  1.00 77.40  ?  599 GLU D CB    1 
ATOM   10113 N  N     . THR D 2 221 ? 118.150 -5.501  20.391  1.00 82.62  ?  600 THR D N     1 
ATOM   10114 C  CA    . THR D 2 221 ? 117.662 -6.812  19.972  1.00 82.73  ?  600 THR D CA    1 
ATOM   10115 C  C     . THR D 2 221 ? 116.753 -6.814  18.722  1.00 89.02  ?  600 THR D C     1 
ATOM   10116 O  O     . THR D 2 221 ? 115.981 -7.754  18.519  1.00 90.18  ?  600 THR D O     1 
ATOM   10117 C  CB    . THR D 2 221 ? 116.916 -7.504  21.134  1.00 78.91  ?  600 THR D CB    1 
ATOM   10118 N  N     . ARG D 2 222 ? 116.848 -5.794  17.873  1.00 91.31  ?  601 ARG D N     1 
ATOM   10119 C  CA    . ARG D 2 222 ? 115.859 -5.634  16.799  1.00 92.75  ?  601 ARG D CA    1 
ATOM   10120 C  C     . ARG D 2 222 ? 116.437 -5.624  15.382  1.00 97.37  ?  601 ARG D C     1 
ATOM   10121 O  O     . ARG D 2 222 ? 117.498 -5.045  15.132  1.00 99.06  ?  601 ARG D O     1 
ATOM   10122 C  CB    . ARG D 2 222 ? 115.040 -4.352  17.011  1.00 87.92  ?  601 ARG D CB    1 
ATOM   10123 C  CG    . ARG D 2 222 ? 115.746 -3.099  16.512  1.00 85.43  ?  601 ARG D CG    1 
ATOM   10124 C  CD    . ARG D 2 222 ? 115.020 -1.810  16.875  1.00 82.85  ?  601 ARG D CD    1 
ATOM   10125 N  NE    . ARG D 2 222 ? 115.791 -0.649  16.431  1.00 85.25  ?  601 ARG D NE    1 
ATOM   10126 C  CZ    . ARG D 2 222 ? 115.626 0.592   16.881  1.00 85.48  ?  601 ARG D CZ    1 
ATOM   10127 N  NH1   . ARG D 2 222 ? 114.705 0.861   17.797  1.00 84.63  ?  601 ARG D NH1   1 
ATOM   10128 N  NH2   . ARG D 2 222 ? 116.388 1.568   16.411  1.00 86.39  ?  601 ARG D NH2   1 
ATOM   10129 N  N     . THR D 2 223 ? 115.721 -6.255  14.455  1.00 96.49  ?  602 THR D N     1 
ATOM   10130 C  CA    . THR D 2 223 ? 116.045 -6.129  13.040  1.00 93.80  ?  602 THR D CA    1 
ATOM   10131 C  C     . THR D 2 223 ? 115.294 -4.908  12.495  1.00 95.33  ?  602 THR D C     1 
ATOM   10132 O  O     . THR D 2 223 ? 114.189 -4.595  12.960  1.00 95.88  ?  602 THR D O     1 
ATOM   10133 C  CB    . THR D 2 223 ? 115.684 -7.405  12.255  1.00 88.16  ?  602 THR D CB    1 
ATOM   10134 N  N     . LEU D 2 224 ? 115.900 -4.220  11.526  1.00 95.39  ?  603 LEU D N     1 
ATOM   10135 C  CA    . LEU D 2 224 ? 115.395 -2.931  11.036  1.00 92.67  ?  603 LEU D CA    1 
ATOM   10136 C  C     . LEU D 2 224 ? 115.823 -2.673  9.586   1.00 94.21  ?  603 LEU D C     1 
ATOM   10137 O  O     . LEU D 2 224 ? 117.010 -2.609  9.293   1.00 97.35  ?  603 LEU D O     1 
ATOM   10138 C  CB    . LEU D 2 224 ? 115.935 -1.800  11.923  1.00 91.04  ?  603 LEU D CB    1 
ATOM   10139 C  CG    . LEU D 2 224 ? 115.025 -0.832  12.688  1.00 85.57  ?  603 LEU D CG    1 
ATOM   10140 C  CD1   . LEU D 2 224 ? 115.170 0.575   12.137  1.00 83.09  ?  603 LEU D CD1   1 
ATOM   10141 C  CD2   . LEU D 2 224 ? 113.573 -1.278  12.657  1.00 82.41  ?  603 LEU D CD2   1 
ATOM   10142 N  N     . ILE D 2 225 ? 114.867 -2.523  8.675   1.00 94.99  ?  604 ILE D N     1 
ATOM   10143 C  CA    . ILE D 2 225 ? 115.198 -2.171  7.290   1.00 98.17  ?  604 ILE D CA    1 
ATOM   10144 C  C     . ILE D 2 225 ? 115.487 -0.683  7.182   1.00 97.96  ?  604 ILE D C     1 
ATOM   10145 O  O     . ILE D 2 225 ? 114.763 0.132   7.754   1.00 99.90  ?  604 ILE D O     1 
ATOM   10146 C  CB    . ILE D 2 225 ? 114.051 -2.503  6.299   1.00 67.81  ?  604 ILE D CB    1 
ATOM   10147 C  CG1   . ILE D 2 225 ? 114.093 -3.977  5.888   1.00 63.03  ?  604 ILE D CG1   1 
ATOM   10148 C  CG2   . ILE D 2 225 ? 114.140 -1.614  5.057   1.00 69.04  ?  604 ILE D CG2   1 
ATOM   10149 C  CD1   . ILE D 2 225 ? 112.806 -4.488  5.290   1.00 57.93  ?  604 ILE D CD1   1 
ATOM   10150 N  N     . ARG D 2 226 ? 116.545 -0.326  6.459   1.00 95.28  ?  605 ARG D N     1 
ATOM   10151 C  CA    . ARG D 2 226 ? 116.798 1.077   6.140   1.00 91.30  ?  605 ARG D CA    1 
ATOM   10152 C  C     . ARG D 2 226 ? 116.419 1.297   4.681   1.00 88.22  ?  605 ARG D C     1 
ATOM   10153 O  O     . ARG D 2 226 ? 116.820 0.521   3.817   1.00 90.61  ?  605 ARG D O     1 
ATOM   10154 C  CB    . ARG D 2 226 ? 118.262 1.459   6.405   1.00 92.59  ?  605 ARG D CB    1 
ATOM   10155 N  N     . VAL D 2 227 ? 115.623 2.329   4.411   1.00 86.28  ?  606 VAL D N     1 
ATOM   10156 C  CA    . VAL D 2 227 ? 115.161 2.588   3.048   1.00 86.74  ?  606 VAL D CA    1 
ATOM   10157 C  C     . VAL D 2 227 ? 116.071 3.577   2.325   1.00 86.93  ?  606 VAL D C     1 
ATOM   10158 O  O     . VAL D 2 227 ? 115.996 4.783   2.563   1.00 87.24  ?  606 VAL D O     1 
ATOM   10159 C  CB    . VAL D 2 227 ? 113.689 3.091   3.000   1.00 55.37  ?  606 VAL D CB    1 
ATOM   10160 N  N     . THR D 2 228 ? 116.927 3.044   1.450   1.00 88.06  ?  607 THR D N     1 
ATOM   10161 C  CA    . THR D 2 228 ? 117.865 3.831   0.647   1.00 90.45  ?  607 THR D CA    1 
ATOM   10162 C  C     . THR D 2 228 ? 117.399 3.958   -0.806  1.00 89.26  ?  607 THR D C     1 
ATOM   10163 O  O     . THR D 2 228 ? 116.880 3.006   -1.379  1.00 88.28  ?  607 THR D O     1 
ATOM   10164 C  CB    . THR D 2 228 ? 119.274 3.181   0.644   1.00 65.00  ?  607 THR D CB    1 
ATOM   10165 N  N     . ILE D 2 229 ? 117.582 5.134   -1.400  1.00 89.86  ?  608 ILE D N     1 
ATOM   10166 C  CA    . ILE D 2 229 ? 117.364 5.314   -2.837  1.00 93.30  ?  608 ILE D CA    1 
ATOM   10167 C  C     . ILE D 2 229 ? 118.650 5.007   -3.623  1.00 101.02 ?  608 ILE D C     1 
ATOM   10168 O  O     . ILE D 2 229 ? 119.721 5.521   -3.298  1.00 105.58 ?  608 ILE D O     1 
ATOM   10169 C  CB    . ILE D 2 229 ? 116.904 6.752   -3.165  1.00 91.84  ?  608 ILE D CB    1 
ATOM   10170 C  CG1   . ILE D 2 229 ? 115.635 7.103   -2.388  1.00 88.08  ?  608 ILE D CG1   1 
ATOM   10171 C  CG2   . ILE D 2 229 ? 116.690 6.926   -4.669  1.00 91.71  ?  608 ILE D CG2   1 
ATOM   10172 C  CD1   . ILE D 2 229 ? 115.177 8.533   -2.593  1.00 87.71  ?  608 ILE D CD1   1 
ATOM   10173 N  N     . GLU D 2 230 ? 118.544 4.169   -4.654  1.00 99.74  ?  609 GLU D N     1 
ATOM   10174 C  CA    . GLU D 2 230 ? 119.715 3.776   -5.445  1.00 97.28  ?  609 GLU D CA    1 
ATOM   10175 C  C     . GLU D 2 230 ? 119.685 4.338   -6.874  1.00 97.00  ?  609 GLU D C     1 
ATOM   10176 O  O     . GLU D 2 230 ? 120.724 4.450   -7.524  1.00 97.33  ?  609 GLU D O     1 
ATOM   10177 C  CB    . GLU D 2 230 ? 119.879 2.246   -5.463  1.00 93.55  ?  609 GLU D CB    1 
ATOM   10178 N  N     . ASP D 2 231 ? 118.496 4.693   -7.352  1.00 108.33 ?  610 ASP D N     1 
ATOM   10179 C  CA    . ASP D 2 231 ? 118.324 5.181   -8.719  1.00 110.52 ?  610 ASP D CA    1 
ATOM   10180 C  C     . ASP D 2 231 ? 117.121 6.124   -8.796  1.00 103.67 ?  610 ASP D C     1 
ATOM   10181 O  O     . ASP D 2 231 ? 116.002 5.704   -9.097  1.00 101.30 ?  610 ASP D O     1 
ATOM   10182 C  CB    . ASP D 2 231 ? 118.166 4.004   -9.700  1.00 115.00 ?  610 ASP D CB    1 
ATOM   10183 C  CG    . ASP D 2 231 ? 118.494 4.380   -11.150 1.00 121.39 ?  610 ASP D CG    1 
ATOM   10184 O  OD1   . ASP D 2 231 ? 118.986 5.506   -11.399 1.00 123.78 ?  610 ASP D OD1   1 
ATOM   10185 O  OD2   . ASP D 2 231 ? 118.272 3.531   -12.044 1.00 123.72 ?  610 ASP D OD2   1 
ATOM   10186 N  N     . LEU D 2 232 ? 117.368 7.399   -8.513  1.00 101.57 ?  611 LEU D N     1 
ATOM   10187 C  CA    . LEU D 2 232 ? 116.342 8.435   -8.550  1.00 96.74  ?  611 LEU D CA    1 
ATOM   10188 C  C     . LEU D 2 232 ? 115.286 8.190   -9.622  1.00 98.18  ?  611 LEU D C     1 
ATOM   10189 O  O     . LEU D 2 232 ? 114.092 8.111   -9.328  1.00 97.19  ?  611 LEU D O     1 
ATOM   10190 C  CB    . LEU D 2 232 ? 116.994 9.792   -8.798  1.00 97.30  ?  611 LEU D CB    1 
ATOM   10191 C  CG    . LEU D 2 232 ? 116.419 10.942  -7.972  1.00 94.16  ?  611 LEU D CG    1 
ATOM   10192 C  CD1   . LEU D 2 232 ? 114.898 10.890  -7.970  1.00 84.89  ?  611 LEU D CD1   1 
ATOM   10193 C  CD2   . LEU D 2 232 ? 116.981 10.935  -6.547  1.00 95.99  ?  611 LEU D CD2   1 
ATOM   10194 N  N     . ALA D 2 233 ? 115.737 8.078   -10.868 1.00 100.94 ?  612 ALA D N     1 
ATOM   10195 C  CA    . ALA D 2 233 ? 114.843 7.890   -12.008 1.00 97.95  ?  612 ALA D CA    1 
ATOM   10196 C  C     . ALA D 2 233 ? 114.153 6.526   -12.017 1.00 98.58  ?  612 ALA D C     1 
ATOM   10197 O  O     . ALA D 2 233 ? 112.985 6.427   -12.398 1.00 98.70  ?  612 ALA D O     1 
ATOM   10198 C  CB    . ALA D 2 233 ? 115.596 8.093   -13.293 1.00 99.88  ?  612 ALA D CB    1 
ATOM   10199 N  N     . ARG D 2 234 ? 114.872 5.477   -11.614 1.00 98.54  ?  613 ARG D N     1 
ATOM   10200 C  CA    . ARG D 2 234 ? 114.314 4.123   -11.624 1.00 96.34  ?  613 ARG D CA    1 
ATOM   10201 C  C     . ARG D 2 234 ? 113.410 3.892   -10.416 1.00 97.06  ?  613 ARG D C     1 
ATOM   10202 O  O     . ARG D 2 234 ? 112.668 2.899   -10.350 1.00 99.29  ?  613 ARG D O     1 
ATOM   10203 C  CB    . ARG D 2 234 ? 115.416 3.057   -11.681 1.00 94.00  ?  613 ARG D CB    1 
ATOM   10204 C  CG    . ARG D 2 234 ? 115.229 2.026   -12.801 1.00 92.92  ?  613 ARG D CG    1 
ATOM   10205 C  CD    . ARG D 2 234 ? 115.852 0.696   -12.427 1.00 93.32  ?  613 ARG D CD    1 
ATOM   10206 N  NE    . ARG D 2 234 ? 117.090 0.887   -11.677 1.00 96.11  ?  613 ARG D NE    1 
ATOM   10207 N  N     . ALA D 2 235 ? 113.479 4.816   -9.462  1.00 94.32  ?  614 ALA D N     1 
ATOM   10208 C  CA    . ALA D 2 235 ? 112.608 4.767   -8.296  1.00 89.18  ?  614 ALA D CA    1 
ATOM   10209 C  C     . ALA D 2 235 ? 111.529 5.845   -8.380  1.00 87.86  ?