data_4KPF
# 
_entry.id   4KPF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4KPF         
NDB   NA2498       
RCSB  RCSB079628   
WWPDB D_1000079628 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3FOE 'Clinafloxacin-stabilised cleavage complex of topo IV from S. pneumoniae'                   unspecified 
PDB 3FOF 'Moxifloxacin-stabilised cleavage complex of topo IV from S. pneumoniae'                    unspecified 
PDB 2NOV 'Crystal structure of ParC55 from S. pneumoniae'                                            unspecified 
PDB 3K9F 'Levofloxacin-stabilised cleavage complex of topo IV from S. pneumoniae (soaked)'           unspecified 
PDB 3KSA 'Drug-free cleavage complex of topo IV from S. pneumoniae (cleaved form)'                   unspecified 
PDB 3KSB 'Drug-free cleavage complex of topo IV from S. pneumoniae (resealed form)'                  unspecified 
PDB 3LTN 'PD0305970-stabilised cleavage complex of topo IV from S. pneumoniae'                       unspecified 
PDB 3RAD 'Quinolone(Clinafloxacin)-DNA cleavage complex of type IV topoisomerase from S. pneumoniae' unspecified 
PDB 3RAE 'Quinolone(Levofloxacin)-DNA cleavage complex of type IV topoisomerase from S. pneumoniae'  unspecified 
PDB 3RAF 'Quinazolinedione-DNA cleavage complex of type IV topoisomerase from S. pneumoniae'         unspecified 
PDB 4KOE .                                                                                           unspecified 
PDB 4KPE .                                                                                           unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4KPF 
_pdbx_database_status.recvd_initial_deposition_date   2013-05-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Laponogov, I.'   1 
'Pan, X.-S.'      2 
'Vesekov, D.A.'   3 
'Cirz, R.T.'      4 
'Wagman, A.S.'    5 
'Moser, H.E.'     6 
'Fisher, L.M.'    7 
'Sanderson, M.R.' 8 
# 
_citation.id                        primary 
_citation.title                     
;Exploring the active site of the Streptococcus pneumoniae topoisomerase IV-DNA cleavage complex with novel 7,8-bridged fluoroquinolones.
;
_citation.journal_abbrev            'Open Biol' 
_citation.journal_volume            6 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2016 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2046-2441 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   27655731 
_citation.pdbx_database_id_DOI      10.1098/rsob.160157 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Laponogov, I.'   1 ?                   
primary 'Pan, X.S.'       2 ?                   
primary 'Veselkov, D.A.'  3 ?                   
primary 'Cirz, R.T.'      4 ?                   
primary 'Wagman, A.'      5 ?                   
primary 'Moser, H.E.'     6 ?                   
primary 'Fisher, L.M.'    7 0000-0002-2172-3369 
primary 'Sanderson, M.R.' 8 0000-0003-4235-7780 
# 
_cell.entry_id           4KPF 
_cell.length_a           157.860 
_cell.length_b           157.860 
_cell.length_c           210.780 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4KPF 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ParC55 56455.434 2  ? ? ParC55 ? 
2 polymer     man ParE30 30415.703 2  ? ? ParE30 ? 
3 polymer     syn E-site1 2121.436  1  ? ? ?      ? 
4 polymer     syn E-site2 3348.209  1  ? ? ?      ? 
5 polymer     syn E-site3 2113.410  1  ? ? ?      ? 
6 polymer     syn E-site4 3358.211  1  ? ? ?      ? 
7 non-polymer syn 'MAGNESIUM ION' 24.305    6  ? ? ?      ? 
8 non-polymer syn 
;(3aS,4R)-4-amino-13-cyclopropyl-8-fluoro-10-oxo-3a,4,5,6,10,13-hexahydro-1H,3H-pyrrolo[2',1':3,4][1,4]oxazepino[5,6-h]quinoline-11-carboxylic acid
;
373.378   2  ? ? ?      ? 
9 water       nat water 18.015    14 ? ? ?      ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MSNIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFHPHGDSS
IYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTVLPAAFP
NLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRS
KTEIEKLKGGKEQIVITEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNYLFKYTD
LQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKAD
AKENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKFATPRLS
SLEDTAKALEHHHHHH
;
;MSNIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFHPHGDSS
IYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTVLPAAFP
NLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRS
KTEIEKLKGGKEQIVITEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNYLFKYTD
LQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKAD
AKENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKFATPRLS
SLEDTAKALEHHHHHH
;
A,B ? 
2 'polypeptide(L)'        no no 
;MGHHHHHHHHHHSSGHIDDDDKHMKNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKV
INTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIAL
PPLYKMSKGKGKKEEVAYAWTDGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVN
VLMGDKVEPRRKWIEDNVKFTLEEATVF
;
;MGHHHHHHHHHHSSGHIDDDDKHMKNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKV
INTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIAL
PPLYKMSKGKGKKEEVAYAWTDGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVN
VLMGDKVEPRRKWIEDNVKFTLEEATVF
;
C,D ? 
3 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DG)(DA)(DA)(DT)' CATGAAT E   ? 
4 polydeoxyribonucleotide no no '(DA)(DG)(DT)(DC)(DA)(DT)(DT)(DC)(DA)(DT)(DG)' AGTCATTCATG F   ? 
5 polydeoxyribonucleotide no no '(DC)(DG)(DT)(DG)(DC)(DA)(DT)' CGTGCAT G   ? 
6 polydeoxyribonucleotide no no '(DG)(DA)(DC)(DT)(DA)(DT)(DG)(DC)(DA)(DC)(DG)' GACTATGCACG H   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ASN n 
1 4   ILE n 
1 5   GLN n 
1 6   ASN n 
1 7   MET n 
1 8   SER n 
1 9   LEU n 
1 10  GLU n 
1 11  ASP n 
1 12  ILE n 
1 13  MET n 
1 14  GLY n 
1 15  GLU n 
1 16  ARG n 
1 17  PHE n 
1 18  GLY n 
1 19  ARG n 
1 20  TYR n 
1 21  SER n 
1 22  LYS n 
1 23  TYR n 
1 24  ILE n 
1 25  ILE n 
1 26  GLN n 
1 27  ASP n 
1 28  ARG n 
1 29  ALA n 
1 30  LEU n 
1 31  PRO n 
1 32  ASP n 
1 33  ILE n 
1 34  ARG n 
1 35  ASP n 
1 36  GLY n 
1 37  LEU n 
1 38  LYS n 
1 39  PRO n 
1 40  VAL n 
1 41  GLN n 
1 42  ARG n 
1 43  ARG n 
1 44  ILE n 
1 45  LEU n 
1 46  TYR n 
1 47  SER n 
1 48  MET n 
1 49  ASN n 
1 50  LYS n 
1 51  ASP n 
1 52  SER n 
1 53  ASN n 
1 54  THR n 
1 55  PHE n 
1 56  ASP n 
1 57  LYS n 
1 58  SER n 
1 59  TYR n 
1 60  ARG n 
1 61  LYS n 
1 62  SER n 
1 63  ALA n 
1 64  LYS n 
1 65  SER n 
1 66  VAL n 
1 67  GLY n 
1 68  ASN n 
1 69  ILE n 
1 70  MET n 
1 71  GLY n 
1 72  ASN n 
1 73  PHE n 
1 74  HIS n 
1 75  PRO n 
1 76  HIS n 
1 77  GLY n 
1 78  ASP n 
1 79  SER n 
1 80  SER n 
1 81  ILE n 
1 82  TYR n 
1 83  ASP n 
1 84  ALA n 
1 85  MET n 
1 86  VAL n 
1 87  ARG n 
1 88  MET n 
1 89  SER n 
1 90  GLN n 
1 91  ASN n 
1 92  TRP n 
1 93  LYS n 
1 94  ASN n 
1 95  ARG n 
1 96  GLU n 
1 97  ILE n 
1 98  LEU n 
1 99  VAL n 
1 100 GLU n 
1 101 MET n 
1 102 HIS n 
1 103 GLY n 
1 104 ASN n 
1 105 ASN n 
1 106 GLY n 
1 107 SER n 
1 108 MET n 
1 109 ASP n 
1 110 GLY n 
1 111 ASP n 
1 112 PRO n 
1 113 PRO n 
1 114 ALA n 
1 115 ALA n 
1 116 MET n 
1 117 ARG n 
1 118 TYR n 
1 119 THR n 
1 120 GLU n 
1 121 ALA n 
1 122 ARG n 
1 123 LEU n 
1 124 SER n 
1 125 GLU n 
1 126 ILE n 
1 127 ALA n 
1 128 GLY n 
1 129 TYR n 
1 130 LEU n 
1 131 LEU n 
1 132 GLN n 
1 133 ASP n 
1 134 ILE n 
1 135 GLU n 
1 136 LYS n 
1 137 LYS n 
1 138 THR n 
1 139 VAL n 
1 140 PRO n 
1 141 PHE n 
1 142 ALA n 
1 143 TRP n 
1 144 ASN n 
1 145 PHE n 
1 146 ASP n 
1 147 ASP n 
1 148 THR n 
1 149 GLU n 
1 150 LYS n 
1 151 GLU n 
1 152 PRO n 
1 153 THR n 
1 154 VAL n 
1 155 LEU n 
1 156 PRO n 
1 157 ALA n 
1 158 ALA n 
1 159 PHE n 
1 160 PRO n 
1 161 ASN n 
1 162 LEU n 
1 163 LEU n 
1 164 VAL n 
1 165 ASN n 
1 166 GLY n 
1 167 SER n 
1 168 THR n 
1 169 GLY n 
1 170 ILE n 
1 171 SER n 
1 172 ALA n 
1 173 GLY n 
1 174 TYR n 
1 175 ALA n 
1 176 THR n 
1 177 ASP n 
1 178 ILE n 
1 179 PRO n 
1 180 PRO n 
1 181 HIS n 
1 182 ASN n 
1 183 LEU n 
1 184 ALA n 
1 185 GLU n 
1 186 VAL n 
1 187 ILE n 
1 188 ASP n 
1 189 ALA n 
1 190 ALA n 
1 191 VAL n 
1 192 TYR n 
1 193 MET n 
1 194 ILE n 
1 195 ASP n 
1 196 HIS n 
1 197 PRO n 
1 198 THR n 
1 199 ALA n 
1 200 LYS n 
1 201 ILE n 
1 202 ASP n 
1 203 LYS n 
1 204 LEU n 
1 205 MET n 
1 206 GLU n 
1 207 PHE n 
1 208 LEU n 
1 209 PRO n 
1 210 GLY n 
1 211 PRO n 
1 212 ASP n 
1 213 PHE n 
1 214 PRO n 
1 215 THR n 
1 216 GLY n 
1 217 ALA n 
1 218 ILE n 
1 219 ILE n 
1 220 GLN n 
1 221 GLY n 
1 222 ARG n 
1 223 ASP n 
1 224 GLU n 
1 225 ILE n 
1 226 LYS n 
1 227 LYS n 
1 228 ALA n 
1 229 TYR n 
1 230 GLU n 
1 231 THR n 
1 232 GLY n 
1 233 LYS n 
1 234 GLY n 
1 235 ARG n 
1 236 VAL n 
1 237 VAL n 
1 238 VAL n 
1 239 ARG n 
1 240 SER n 
1 241 LYS n 
1 242 THR n 
1 243 GLU n 
1 244 ILE n 
1 245 GLU n 
1 246 LYS n 
1 247 LEU n 
1 248 LYS n 
1 249 GLY n 
1 250 GLY n 
1 251 LYS n 
1 252 GLU n 
1 253 GLN n 
1 254 ILE n 
1 255 VAL n 
1 256 ILE n 
1 257 THR n 
1 258 GLU n 
1 259 ILE n 
1 260 PRO n 
1 261 TYR n 
1 262 GLU n 
1 263 ILE n 
1 264 ASN n 
1 265 LYS n 
1 266 ALA n 
1 267 ASN n 
1 268 LEU n 
1 269 VAL n 
1 270 LYS n 
1 271 LYS n 
1 272 ILE n 
1 273 ASP n 
1 274 ASP n 
1 275 VAL n 
1 276 ARG n 
1 277 VAL n 
1 278 ASN n 
1 279 ASN n 
1 280 LYS n 
1 281 VAL n 
1 282 ALA n 
1 283 GLY n 
1 284 ILE n 
1 285 ALA n 
1 286 GLU n 
1 287 VAL n 
1 288 ARG n 
1 289 ASP n 
1 290 GLU n 
1 291 SER n 
1 292 ASP n 
1 293 ARG n 
1 294 ASP n 
1 295 GLY n 
1 296 LEU n 
1 297 ARG n 
1 298 ILE n 
1 299 ALA n 
1 300 ILE n 
1 301 GLU n 
1 302 LEU n 
1 303 LYS n 
1 304 LYS n 
1 305 ASP n 
1 306 ALA n 
1 307 ASN n 
1 308 THR n 
1 309 GLU n 
1 310 LEU n 
1 311 VAL n 
1 312 LEU n 
1 313 ASN n 
1 314 TYR n 
1 315 LEU n 
1 316 PHE n 
1 317 LYS n 
1 318 TYR n 
1 319 THR n 
1 320 ASP n 
1 321 LEU n 
1 322 GLN n 
1 323 ILE n 
1 324 ASN n 
1 325 TYR n 
1 326 ASN n 
1 327 PHE n 
1 328 ASN n 
1 329 MET n 
1 330 VAL n 
1 331 ALA n 
1 332 ILE n 
1 333 ASP n 
1 334 ASN n 
1 335 PHE n 
1 336 THR n 
1 337 PRO n 
1 338 ARG n 
1 339 GLN n 
1 340 VAL n 
1 341 GLY n 
1 342 ILE n 
1 343 VAL n 
1 344 PRO n 
1 345 ILE n 
1 346 LEU n 
1 347 SER n 
1 348 SER n 
1 349 TYR n 
1 350 ILE n 
1 351 ALA n 
1 352 HIS n 
1 353 ARG n 
1 354 ARG n 
1 355 GLU n 
1 356 VAL n 
1 357 ILE n 
1 358 LEU n 
1 359 ALA n 
1 360 ARG n 
1 361 SER n 
1 362 ARG n 
1 363 PHE n 
1 364 ASP n 
1 365 LYS n 
1 366 GLU n 
1 367 LYS n 
1 368 ALA n 
1 369 GLU n 
1 370 LYS n 
1 371 ARG n 
1 372 LEU n 
1 373 HIS n 
1 374 ILE n 
1 375 VAL n 
1 376 GLU n 
1 377 GLY n 
1 378 LEU n 
1 379 ILE n 
1 380 ARG n 
1 381 VAL n 
1 382 ILE n 
1 383 SER n 
1 384 ILE n 
1 385 LEU n 
1 386 ASP n 
1 387 GLU n 
1 388 VAL n 
1 389 ILE n 
1 390 ALA n 
1 391 LEU n 
1 392 ILE n 
1 393 ARG n 
1 394 ALA n 
1 395 SER n 
1 396 GLU n 
1 397 ASN n 
1 398 LYS n 
1 399 ALA n 
1 400 ASP n 
1 401 ALA n 
1 402 LYS n 
1 403 GLU n 
1 404 ASN n 
1 405 LEU n 
1 406 LYS n 
1 407 VAL n 
1 408 SER n 
1 409 TYR n 
1 410 ASP n 
1 411 PHE n 
1 412 THR n 
1 413 GLU n 
1 414 GLU n 
1 415 GLN n 
1 416 ALA n 
1 417 GLU n 
1 418 ALA n 
1 419 ILE n 
1 420 VAL n 
1 421 THR n 
1 422 LEU n 
1 423 GLN n 
1 424 LEU n 
1 425 TYR n 
1 426 ARG n 
1 427 LEU n 
1 428 THR n 
1 429 ASN n 
1 430 THR n 
1 431 ASP n 
1 432 VAL n 
1 433 VAL n 
1 434 VAL n 
1 435 LEU n 
1 436 GLN n 
1 437 GLU n 
1 438 GLU n 
1 439 GLU n 
1 440 ALA n 
1 441 GLU n 
1 442 LEU n 
1 443 ARG n 
1 444 GLU n 
1 445 LYS n 
1 446 ILE n 
1 447 ALA n 
1 448 MET n 
1 449 LEU n 
1 450 ALA n 
1 451 ALA n 
1 452 ILE n 
1 453 ILE n 
1 454 GLY n 
1 455 ASP n 
1 456 GLU n 
1 457 ARG n 
1 458 THR n 
1 459 MET n 
1 460 TYR n 
1 461 ASN n 
1 462 LEU n 
1 463 MET n 
1 464 LYS n 
1 465 LYS n 
1 466 GLU n 
1 467 LEU n 
1 468 ARG n 
1 469 GLU n 
1 470 VAL n 
1 471 LYS n 
1 472 LYS n 
1 473 LYS n 
1 474 PHE n 
1 475 ALA n 
1 476 THR n 
1 477 PRO n 
1 478 ARG n 
1 479 LEU n 
1 480 SER n 
1 481 SER n 
1 482 LEU n 
1 483 GLU n 
1 484 ASP n 
1 485 THR n 
1 486 ALA n 
1 487 LYS n 
1 488 ALA n 
1 489 LEU n 
1 490 GLU n 
1 491 HIS n 
1 492 HIS n 
1 493 HIS n 
1 494 HIS n 
1 495 HIS n 
1 496 HIS n 
2 1   MET n 
2 2   GLY n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   HIS n 
2 10  HIS n 
2 11  HIS n 
2 12  HIS n 
2 13  SER n 
2 14  SER n 
2 15  GLY n 
2 16  HIS n 
2 17  ILE n 
2 18  ASP n 
2 19  ASP n 
2 20  ASP n 
2 21  ASP n 
2 22  LYS n 
2 23  HIS n 
2 24  MET n 
2 25  LYS n 
2 26  ASN n 
2 27  LYS n 
2 28  LYS n 
2 29  ASP n 
2 30  LYS n 
2 31  GLY n 
2 32  LEU n 
2 33  LEU n 
2 34  SER n 
2 35  GLY n 
2 36  LYS n 
2 37  LEU n 
2 38  THR n 
2 39  PRO n 
2 40  ALA n 
2 41  GLN n 
2 42  SER n 
2 43  LYS n 
2 44  ASN n 
2 45  PRO n 
2 46  ALA n 
2 47  LYS n 
2 48  ASN n 
2 49  GLU n 
2 50  LEU n 
2 51  TYR n 
2 52  LEU n 
2 53  VAL n 
2 54  GLU n 
2 55  GLY n 
2 56  ASP n 
2 57  SER n 
2 58  ALA n 
2 59  GLY n 
2 60  GLY n 
2 61  SER n 
2 62  ALA n 
2 63  LYS n 
2 64  GLN n 
2 65  GLY n 
2 66  ARG n 
2 67  ASP n 
2 68  ARG n 
2 69  LYS n 
2 70  PHE n 
2 71  GLN n 
2 72  ALA n 
2 73  ILE n 
2 74  LEU n 
2 75  PRO n 
2 76  LEU n 
2 77  ARG n 
2 78  GLY n 
2 79  LYS n 
2 80  VAL n 
2 81  ILE n 
2 82  ASN n 
2 83  THR n 
2 84  ALA n 
2 85  LYS n 
2 86  ALA n 
2 87  LYS n 
2 88  MET n 
2 89  ALA n 
2 90  ASP n 
2 91  ILE n 
2 92  LEU n 
2 93  LYS n 
2 94  ASN n 
2 95  GLU n 
2 96  GLU n 
2 97  ILE n 
2 98  ASN n 
2 99  THR n 
2 100 MET n 
2 101 ILE n 
2 102 TYR n 
2 103 THR n 
2 104 ILE n 
2 105 GLY n 
2 106 ALA n 
2 107 GLY n 
2 108 VAL n 
2 109 GLY n 
2 110 ALA n 
2 111 ASP n 
2 112 PHE n 
2 113 SER n 
2 114 ILE n 
2 115 GLU n 
2 116 ASP n 
2 117 ALA n 
2 118 ASN n 
2 119 TYR n 
2 120 ASP n 
2 121 LYS n 
2 122 ILE n 
2 123 ILE n 
2 124 ILE n 
2 125 MET n 
2 126 THR n 
2 127 ASP n 
2 128 ALA n 
2 129 ASP n 
2 130 THR n 
2 131 ASP n 
2 132 GLY n 
2 133 ALA n 
2 134 HIS n 
2 135 ILE n 
2 136 GLN n 
2 137 THR n 
2 138 LEU n 
2 139 LEU n 
2 140 LEU n 
2 141 THR n 
2 142 PHE n 
2 143 PHE n 
2 144 TYR n 
2 145 ARG n 
2 146 TYR n 
2 147 MET n 
2 148 ARG n 
2 149 PRO n 
2 150 LEU n 
2 151 VAL n 
2 152 GLU n 
2 153 ALA n 
2 154 GLY n 
2 155 HIS n 
2 156 VAL n 
2 157 TYR n 
2 158 ILE n 
2 159 ALA n 
2 160 LEU n 
2 161 PRO n 
2 162 PRO n 
2 163 LEU n 
2 164 TYR n 
2 165 LYS n 
2 166 MET n 
2 167 SER n 
2 168 LYS n 
2 169 GLY n 
2 170 LYS n 
2 171 GLY n 
2 172 LYS n 
2 173 LYS n 
2 174 GLU n 
2 175 GLU n 
2 176 VAL n 
2 177 ALA n 
2 178 TYR n 
2 179 ALA n 
2 180 TRP n 
2 181 THR n 
2 182 ASP n 
2 183 GLY n 
2 184 GLU n 
2 185 LEU n 
2 186 GLU n 
2 187 GLU n 
2 188 LEU n 
2 189 ARG n 
2 190 LYS n 
2 191 GLN n 
2 192 PHE n 
2 193 GLY n 
2 194 LYS n 
2 195 GLY n 
2 196 ALA n 
2 197 THR n 
2 198 LEU n 
2 199 GLN n 
2 200 ARG n 
2 201 TYR n 
2 202 LYS n 
2 203 GLY n 
2 204 LEU n 
2 205 GLY n 
2 206 GLU n 
2 207 MET n 
2 208 ASN n 
2 209 ALA n 
2 210 ASP n 
2 211 GLN n 
2 212 LEU n 
2 213 TRP n 
2 214 GLU n 
2 215 THR n 
2 216 THR n 
2 217 MET n 
2 218 ASN n 
2 219 PRO n 
2 220 GLU n 
2 221 THR n 
2 222 ARG n 
2 223 THR n 
2 224 LEU n 
2 225 ILE n 
2 226 ARG n 
2 227 VAL n 
2 228 THR n 
2 229 ILE n 
2 230 GLU n 
2 231 ASP n 
2 232 LEU n 
2 233 ALA n 
2 234 ARG n 
2 235 ALA n 
2 236 GLU n 
2 237 ARG n 
2 238 ARG n 
2 239 VAL n 
2 240 ASN n 
2 241 VAL n 
2 242 LEU n 
2 243 MET n 
2 244 GLY n 
2 245 ASP n 
2 246 LYS n 
2 247 VAL n 
2 248 GLU n 
2 249 PRO n 
2 250 ARG n 
2 251 ARG n 
2 252 LYS n 
2 253 TRP n 
2 254 ILE n 
2 255 GLU n 
2 256 ASP n 
2 257 ASN n 
2 258 VAL n 
2 259 LYS n 
2 260 PHE n 
2 261 THR n 
2 262 LEU n 
2 263 GLU n 
2 264 GLU n 
2 265 ALA n 
2 266 THR n 
2 267 VAL n 
2 268 PHE n 
3 1   DC  n 
3 2   DA  n 
3 3   DT  n 
3 4   DG  n 
3 5   DA  n 
3 6   DA  n 
3 7   DT  n 
4 1   DA  n 
4 2   DG  n 
4 3   DT  n 
4 4   DC  n 
4 5   DA  n 
4 6   DT  n 
4 7   DT  n 
4 8   DC  n 
4 9   DA  n 
4 10  DT  n 
4 11  DG  n 
5 1   DC  n 
5 2   DG  n 
5 3   DT  n 
5 4   DG  n 
5 5   DC  n 
5 6   DA  n 
5 7   DT  n 
6 1   DG  n 
6 2   DA  n 
6 3   DC  n 
6 4   DT  n 
6 5   DA  n 
6 6   DT  n 
6 7   DG  n 
6 8   DC  n 
6 9   DA  n 
6 10  DC  n 
6 11  DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? 'parC, SP_0855' ? 'ATCC BAA-334 / TIGR4' ? ? ? ? 'Streptococcus pneumoniae' 170187 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? ? ? parE            ? 'ATCC BAA-334 / TIGR4' ? ? ? ? 'Streptococcus pneumoniae' 170187 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample ? ? 'synthetic construct' ? 32630 ? 
4 1 sample ? ? 'synthetic construct' ? 32630 ? 
5 1 sample ? ? 'synthetic construct' ? 32630 ? 
6 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP PARC_STRPN P72525 1 
;MSNIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFHPHGDSS
IYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTVLPAAFP
NLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRS
KTEIEKLKGGKEQIVIIEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNYLFKYTD
LQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKAD
AKENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKFATPRLS
SLEDTAKA
;
1   ? 
2 UNP PARE_STRPN Q59961 2 
;KNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVVNTAKAKMADILKNEEINTMIYTI
GAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKGKGKKEEVAYAWTDGE
LEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFTLEE
TTVF
;
404 ? 
3 PDB 4KPF       4KPF   3 ? ?   ? 
4 PDB 4KPF       4KPF   4 ? ?   ? 
5 PDB 4KPF       4KPF   5 ? ?   ? 
6 PDB 4KPF       4KPF   6 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4KPF A 1  ? 488 ? P72525 1   ? 488 ? 1   488 
2 1 4KPF B 1  ? 488 ? P72525 1   ? 488 ? 1   488 
3 2 4KPF C 25 ? 268 ? Q59961 404 ? 647 ? 404 647 
4 2 4KPF D 25 ? 268 ? Q59961 404 ? 647 ? 404 647 
5 3 4KPF E 1  ? 7   ? 4KPF   9   ? 15  ? 9   15  
6 4 4KPF F 1  ? 11  ? 4KPF   1   ? 11  ? 1   11  
7 5 4KPF G 1  ? 7   ? 4KPF   9   ? 15  ? 9   15  
8 6 4KPF H 1  ? 11  ? 4KPF   1   ? 11  ? 1   11  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4KPF THR A 257 ? UNP P72525 ILE 257 CONFLICT         257 1  
1 4KPF LEU A 489 ? UNP P72525 ?   ?   'EXPRESSION TAG' 489 2  
1 4KPF GLU A 490 ? UNP P72525 ?   ?   'EXPRESSION TAG' 490 3  
1 4KPF HIS A 491 ? UNP P72525 ?   ?   'EXPRESSION TAG' 491 4  
1 4KPF HIS A 492 ? UNP P72525 ?   ?   'EXPRESSION TAG' 492 5  
1 4KPF HIS A 493 ? UNP P72525 ?   ?   'EXPRESSION TAG' 493 6  
1 4KPF HIS A 494 ? UNP P72525 ?   ?   'EXPRESSION TAG' 494 7  
1 4KPF HIS A 495 ? UNP P72525 ?   ?   'EXPRESSION TAG' 495 8  
1 4KPF HIS A 496 ? UNP P72525 ?   ?   'EXPRESSION TAG' 496 9  
2 4KPF THR B 257 ? UNP P72525 ILE 257 CONFLICT         257 10 
2 4KPF LEU B 489 ? UNP P72525 ?   ?   'EXPRESSION TAG' 489 11 
2 4KPF GLU B 490 ? UNP P72525 ?   ?   'EXPRESSION TAG' 490 12 
2 4KPF HIS B 491 ? UNP P72525 ?   ?   'EXPRESSION TAG' 491 13 
2 4KPF HIS B 492 ? UNP P72525 ?   ?   'EXPRESSION TAG' 492 14 
2 4KPF HIS B 493 ? UNP P72525 ?   ?   'EXPRESSION TAG' 493 15 
2 4KPF HIS B 494 ? UNP P72525 ?   ?   'EXPRESSION TAG' 494 16 
2 4KPF HIS B 495 ? UNP P72525 ?   ?   'EXPRESSION TAG' 495 17 
2 4KPF HIS B 496 ? UNP P72525 ?   ?   'EXPRESSION TAG' 496 18 
3 4KPF MET C 1   ? UNP Q59961 ?   ?   'EXPRESSION TAG' 380 19 
3 4KPF GLY C 2   ? UNP Q59961 ?   ?   'EXPRESSION TAG' 381 20 
3 4KPF HIS C 3   ? UNP Q59961 ?   ?   'EXPRESSION TAG' 382 21 
3 4KPF HIS C 4   ? UNP Q59961 ?   ?   'EXPRESSION TAG' 383 22 
3 4KPF HIS C 5   ? UNP Q59961 ?   ?   'EXPRESSION TAG' 384 23 
3 4KPF HIS C 6   ? UNP Q59961 ?   ?   'EXPRESSION TAG' 385 24 
3 4KPF HIS C 7   ? UNP Q59961 ?   ?   'EXPRESSION TAG' 386 25 
3 4KPF HIS C 8   ? UNP Q59961 ?   ?   'EXPRESSION TAG' 387 26 
3 4KPF HIS C 9   ? UNP Q59961 ?   ?   'EXPRESSION TAG' 388 27 
3 4KPF HIS C 10  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 389 28 
3 4KPF HIS C 11  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 390 29 
3 4KPF HIS C 12  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 391 30 
3 4KPF SER C 13  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 392 31 
3 4KPF SER C 14  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 393 32 
3 4KPF GLY C 15  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 394 33 
3 4KPF HIS C 16  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 395 34 
3 4KPF ILE C 17  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 396 35 
3 4KPF ASP C 18  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 397 36 
3 4KPF ASP C 19  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 398 37 
3 4KPF ASP C 20  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 399 38 
3 4KPF ASP C 21  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 400 39 
3 4KPF LYS C 22  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 401 40 
3 4KPF HIS C 23  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 402 41 
3 4KPF MET C 24  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 403 42 
3 4KPF ILE C 81  ? UNP Q59961 VAL 460 CONFLICT         460 43 
3 4KPF ALA C 265 ? UNP Q59961 THR 644 CONFLICT         644 44 
4 4KPF MET D 1   ? UNP Q59961 ?   ?   'EXPRESSION TAG' 380 45 
4 4KPF GLY D 2   ? UNP Q59961 ?   ?   'EXPRESSION TAG' 381 46 
4 4KPF HIS D 3   ? UNP Q59961 ?   ?   'EXPRESSION TAG' 382 47 
4 4KPF HIS D 4   ? UNP Q59961 ?   ?   'EXPRESSION TAG' 383 48 
4 4KPF HIS D 5   ? UNP Q59961 ?   ?   'EXPRESSION TAG' 384 49 
4 4KPF HIS D 6   ? UNP Q59961 ?   ?   'EXPRESSION TAG' 385 50 
4 4KPF HIS D 7   ? UNP Q59961 ?   ?   'EXPRESSION TAG' 386 51 
4 4KPF HIS D 8   ? UNP Q59961 ?   ?   'EXPRESSION TAG' 387 52 
4 4KPF HIS D 9   ? UNP Q59961 ?   ?   'EXPRESSION TAG' 388 53 
4 4KPF HIS D 10  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 389 54 
4 4KPF HIS D 11  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 390 55 
4 4KPF HIS D 12  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 391 56 
4 4KPF SER D 13  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 392 57 
4 4KPF SER D 14  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 393 58 
4 4KPF GLY D 15  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 394 59 
4 4KPF HIS D 16  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 395 60 
4 4KPF ILE D 17  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 396 61 
4 4KPF ASP D 18  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 397 62 
4 4KPF ASP D 19  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 398 63 
4 4KPF ASP D 20  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 399 64 
4 4KPF ASP D 21  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 400 65 
4 4KPF LYS D 22  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 401 66 
4 4KPF HIS D 23  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 402 67 
4 4KPF MET D 24  ? UNP Q59961 ?   ?   'EXPRESSION TAG' 403 68 
4 4KPF ILE D 81  ? UNP Q59961 VAL 460 CONFLICT         460 69 
4 4KPF ALA D 265 ? UNP Q59961 THR 644 CONFLICT         644 70 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1UV non-polymer         . 
;(3aS,4R)-4-amino-13-cyclopropyl-8-fluoro-10-oxo-3a,4,5,6,10,13-hexahydro-1H,3H-pyrrolo[2',1':3,4][1,4]oxazepino[5,6-h]quinoline-11-carboxylic acid
;
? 'C19 H20 F N3 O4' 373.378 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4KPF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.11 
_exptl_crystal.density_percent_sol   70.04 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'50 mM Na Cacodylate, 4-7% isopropanol, optimized mixture of salts, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2011-05-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I02 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
# 
_reflns.entry_id                     4KPF 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             41.828 
_reflns.d_resolution_high            3.24 
_reflns.number_obs                   48761 
_reflns.number_all                   48832 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.81 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.16 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.91 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.24 
_reflns_shell.d_res_low              3.32 
_reflns_shell.percent_possible_all   100.00 
_reflns_shell.Rmerge_I_obs           0.381 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.91 
_reflns_shell.pdbx_redundancy        7.13 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4KPF 
_refine.ls_number_reflns_obs                     48732 
_refine.ls_number_reflns_all                     48761 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             41.828 
_refine.ls_d_res_high                            3.240 
_refine.ls_percent_reflns_obs                    99.86 
_refine.ls_R_factor_obs                          0.1632 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1621 
_refine.ls_R_factor_R_free                       0.1845 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_number_reflns_R_free                  2446 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.21 
_refine.pdbx_overall_phase_error                 16.69 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10339 
_refine_hist.pdbx_number_atoms_nucleic_acid   730 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             14 
_refine_hist.number_atoms_total               11143 
_refine_hist.d_res_high                       3.240 
_refine_hist.d_res_low                        41.828 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.009  ? ? 11413 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.243  ? ? 15668 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 18.057 ? ? 4176  ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.076  ? ? 1806  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.004  ? ? 1917  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 3.2400 3.3061  2680 0.2105 100.00 0.2145 . . 137 . . . . 'X-RAY DIFFRACTION' 
. 3.3061 3.3780  2717 0.1989 100.00 0.2620 . . 134 . . . . 'X-RAY DIFFRACTION' 
. 3.3780 3.4565  2674 0.1850 100.00 0.2110 . . 151 . . . . 'X-RAY DIFFRACTION' 
. 3.4565 3.5429  2682 0.1805 100.00 0.2012 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 3.5429 3.6387  2694 0.1708 100.00 0.1747 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 3.6387 3.7457  2713 0.1623 100.00 0.1666 . . 145 . . . . 'X-RAY DIFFRACTION' 
. 3.7457 3.8665  2707 0.1564 100.00 0.1778 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 3.8665 4.0046  2668 0.1477 100.00 0.1772 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 4.0046 4.1648  2727 0.1447 100.00 0.1599 . . 145 . . . . 'X-RAY DIFFRACTION' 
. 4.1648 4.3541  2692 0.1315 100.00 0.1592 . . 137 . . . . 'X-RAY DIFFRACTION' 
. 4.3541 4.5834  2712 0.1253 100.00 0.1352 . . 155 . . . . 'X-RAY DIFFRACTION' 
. 4.5834 4.8702  2736 0.1375 100.00 0.1502 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 4.8702 5.2456  2737 0.1522 100.00 0.1785 . . 147 . . . . 'X-RAY DIFFRACTION' 
. 5.2456 5.7722  2730 0.1720 100.00 0.1816 . . 144 . . . . 'X-RAY DIFFRACTION' 
. 5.7722 6.6047  2769 0.1819 100.00 0.2136 . . 149 . . . . 'X-RAY DIFFRACTION' 
. 6.6047 8.3105  2781 0.1654 100.00 0.1887 . . 143 . . . . 'X-RAY DIFFRACTION' 
. 8.3105 41.8310 2867 0.1784 99.00  0.2192 . . 155 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4KPF 
_struct.title                     'Novel fluoroquinolones in complex with topoisomerase IV from S. pneumoniae and E-site G-gate' 
_struct.pdbx_descriptor           'ParC55, ParE30/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4KPF 
_struct_keywords.pdbx_keywords   ISOMERASE/DNA/INHIBITOR 
_struct_keywords.text            
'PROTEIN-DNA CLEAVAGE COMPLEX, ISOMERASE-DNA-INHIBITOR COMPLEX, TOPOISOMERASE IIA, Quinolone, ACHN-454' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 7 ? 
J N N 7 ? 
K N N 7 ? 
L N N 7 ? 
M N N 7 ? 
N N N 7 ? 
O N N 8 ? 
P N N 8 ? 
Q N N 9 ? 
R N N 9 ? 
S N N 9 ? 
T N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 9   ? ASP A 27  ? LEU A 9   ASP A 27  1 ? 19 
HELX_P HELX_P2  2  LYS A 38  ? ASP A 51  ? LYS A 38  ASP A 51  1 ? 14 
HELX_P HELX_P3  3  SER A 62  ? PHE A 73  ? SER A 62  PHE A 73  1 ? 12 
HELX_P HELX_P4  4  GLY A 77  ? MET A 88  ? GLY A 77  MET A 88  1 ? 12 
HELX_P HELX_P5  5  SER A 124 ? GLN A 132 ? SER A 124 GLN A 132 1 ? 9  
HELX_P HELX_P6  6  ASP A 133 ? LYS A 137 ? ASP A 133 LYS A 137 5 ? 5  
HELX_P HELX_P7  7  PRO A 160 ? GLY A 166 ? PRO A 160 GLY A 166 1 ? 7  
HELX_P HELX_P8  8  ASN A 182 ? HIS A 196 ? ASN A 182 HIS A 196 1 ? 15 
HELX_P HELX_P9  9  LYS A 200 ? MET A 205 ? LYS A 200 MET A 205 1 ? 6  
HELX_P HELX_P10 10 GLY A 221 ? GLY A 232 ? GLY A 221 GLY A 232 1 ? 12 
HELX_P HELX_P11 11 ASN A 264 ? ASN A 279 ? ASN A 264 ASN A 279 1 ? 16 
HELX_P HELX_P12 12 ASN A 307 ? THR A 319 ? ASN A 307 THR A 319 1 ? 13 
HELX_P HELX_P13 13 GLY A 341 ? ILE A 384 ? GLY A 341 ILE A 384 1 ? 44 
HELX_P HELX_P14 14 ILE A 384 ? SER A 395 ? ILE A 384 SER A 395 1 ? 12 
HELX_P HELX_P15 15 ASN A 397 ? ASP A 410 ? ASN A 397 ASP A 410 1 ? 14 
HELX_P HELX_P16 16 THR A 412 ? THR A 421 ? THR A 412 THR A 421 1 ? 10 
HELX_P HELX_P17 17 GLN A 423 ? ASN A 429 ? GLN A 423 ASN A 429 5 ? 7  
HELX_P HELX_P18 18 ASP A 431 ? ASP A 455 ? ASP A 431 ASP A 455 1 ? 25 
HELX_P HELX_P19 19 ASP A 455 ? ALA A 475 ? ASP A 455 ALA A 475 1 ? 21 
HELX_P HELX_P20 20 LEU B 9   ? ASP B 27  ? LEU B 9   ASP B 27  1 ? 19 
HELX_P HELX_P21 21 LYS B 38  ? ASP B 51  ? LYS B 38  ASP B 51  1 ? 14 
HELX_P HELX_P22 22 SER B 62  ? PHE B 73  ? SER B 62  PHE B 73  1 ? 12 
HELX_P HELX_P23 23 GLY B 77  ? MET B 88  ? GLY B 77  MET B 88  1 ? 12 
HELX_P HELX_P24 24 SER B 124 ? GLN B 132 ? SER B 124 GLN B 132 1 ? 9  
HELX_P HELX_P25 25 ASP B 133 ? LYS B 137 ? ASP B 133 LYS B 137 5 ? 5  
HELX_P HELX_P26 26 PRO B 160 ? GLY B 166 ? PRO B 160 GLY B 166 1 ? 7  
HELX_P HELX_P27 27 ASN B 182 ? HIS B 196 ? ASN B 182 HIS B 196 1 ? 15 
HELX_P HELX_P28 28 LYS B 200 ? MET B 205 ? LYS B 200 MET B 205 1 ? 6  
HELX_P HELX_P29 29 GLY B 221 ? GLY B 232 ? GLY B 221 GLY B 232 1 ? 12 
HELX_P HELX_P30 30 ASN B 264 ? ASN B 279 ? ASN B 264 ASN B 279 1 ? 16 
HELX_P HELX_P31 31 ASN B 307 ? THR B 319 ? ASN B 307 THR B 319 1 ? 13 
HELX_P HELX_P32 32 GLY B 341 ? ILE B 384 ? GLY B 341 ILE B 384 1 ? 44 
HELX_P HELX_P33 33 ILE B 384 ? SER B 395 ? ILE B 384 SER B 395 1 ? 12 
HELX_P HELX_P34 34 ASN B 397 ? ASP B 410 ? ASN B 397 ASP B 410 1 ? 14 
HELX_P HELX_P35 35 THR B 412 ? THR B 421 ? THR B 412 THR B 421 1 ? 10 
HELX_P HELX_P36 36 GLN B 423 ? ASN B 429 ? GLN B 423 ASN B 429 5 ? 7  
HELX_P HELX_P37 37 ASP B 431 ? ASP B 455 ? ASP B 431 ASP B 455 1 ? 25 
HELX_P HELX_P38 38 ASP B 455 ? ALA B 475 ? ASP B 455 ALA B 475 1 ? 21 
HELX_P HELX_P39 39 GLY C 55  ? ARG C 66  ? GLY C 434 ARG C 445 1 ? 12 
HELX_P HELX_P40 40 LYS C 87  ? LYS C 93  ? LYS C 466 LYS C 472 1 ? 7  
HELX_P HELX_P41 41 ASN C 94  ? THR C 103 ? ASN C 473 THR C 482 1 ? 10 
HELX_P HELX_P42 42 ASP C 129 ? MET C 147 ? ASP C 508 MET C 526 1 ? 19 
HELX_P HELX_P43 43 MET C 147 ? ALA C 153 ? MET C 526 ALA C 532 1 ? 7  
HELX_P HELX_P44 44 THR C 181 ? GLU C 186 ? THR C 560 GLU C 565 1 ? 6  
HELX_P HELX_P45 45 GLY C 203 ? MET C 207 ? GLY C 582 MET C 586 5 ? 5  
HELX_P HELX_P46 46 ASN C 208 ? MET C 217 ? ASN C 587 MET C 596 1 ? 10 
HELX_P HELX_P47 47 ASP C 231 ? GLY C 244 ? ASP C 610 GLY C 623 1 ? 14 
HELX_P HELX_P48 48 LYS C 246 ? VAL C 258 ? LYS C 625 VAL C 637 1 ? 13 
HELX_P HELX_P49 49 GLY D 55  ? ARG D 66  ? GLY D 434 ARG D 445 1 ? 12 
HELX_P HELX_P50 50 LYS D 87  ? LYS D 93  ? LYS D 466 LYS D 472 1 ? 7  
HELX_P HELX_P51 51 ASN D 94  ? TYR D 102 ? ASN D 473 TYR D 481 1 ? 9  
HELX_P HELX_P52 52 VAL D 108 ? PHE D 112 ? VAL D 487 PHE D 491 5 ? 5  
HELX_P HELX_P53 53 SER D 113 ? ALA D 117 ? SER D 492 ALA D 496 5 ? 5  
HELX_P HELX_P54 54 ASP D 129 ? MET D 147 ? ASP D 508 MET D 526 1 ? 19 
HELX_P HELX_P55 55 MET D 147 ? ALA D 153 ? MET D 526 ALA D 532 1 ? 7  
HELX_P HELX_P56 56 THR D 181 ? GLU D 187 ? THR D 560 GLU D 566 1 ? 7  
HELX_P HELX_P57 57 GLY D 203 ? MET D 207 ? GLY D 582 MET D 586 5 ? 5  
HELX_P HELX_P58 58 ASN D 208 ? THR D 216 ? ASN D 587 THR D 595 1 ? 9  
HELX_P HELX_P59 59 ASP D 231 ? GLY D 244 ? ASP D 610 GLY D 623 1 ? 14 
HELX_P HELX_P60 60 VAL D 247 ? VAL D 258 ? VAL D 626 VAL D 637 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? N MG  .   MG  ? ? ? 1_555 O 1UV .  O08 ? ? G MG  100 H 1UV 101 1_555 ? ? ? ? ? ? ?            2.015 ? 
metalc2  metalc ? ? J MG  .   MG  ? ? ? 1_555 P 1UV .  O08 ? ? A MG  502 H 1UV 102 1_555 ? ? ? ? ? ? ?            2.019 ? 
metalc3  metalc ? ? C ASP 129 OD2 ? ? ? 1_555 L MG  .  MG  ? ? C ASP 508 C MG  701 1_555 ? ? ? ? ? ? ?            2.028 ? 
metalc4  metalc ? ? D ASP 129 OD2 ? ? ? 1_555 M MG  .  MG  ? ? D ASP 508 D MG  701 1_555 ? ? ? ? ? ? ?            2.031 ? 
metalc5  metalc ? ? N MG  .   MG  ? ? ? 1_555 O 1UV .  O11 ? ? G MG  100 H 1UV 101 1_555 ? ? ? ? ? ? ?            2.043 ? 
metalc6  metalc ? ? A THR 319 O   ? ? ? 1_555 I MG  .  MG  ? ? A THR 319 A MG  501 1_555 ? ? ? ? ? ? ?            2.045 ? 
metalc7  metalc ? ? J MG  .   MG  ? ? ? 1_555 P 1UV .  O11 ? ? A MG  502 H 1UV 102 1_555 ? ? ? ? ? ? ?            2.046 ? 
metalc8  metalc ? ? A GLN 322 O   ? ? ? 1_555 I MG  .  MG  ? ? A GLN 322 A MG  501 1_555 ? ? ? ? ? ? ?            2.046 ? 
metalc9  metalc ? ? B THR 319 O   ? ? ? 1_555 K MG  .  MG  ? ? B THR 319 B MG  700 1_555 ? ? ? ? ? ? ?            2.049 ? 
metalc10 metalc ? ? B GLN 322 O   ? ? ? 1_555 K MG  .  MG  ? ? B GLN 322 B MG  700 1_555 ? ? ? ? ? ? ?            2.050 ? 
metalc11 metalc ? ? C ASP 127 OD2 ? ? ? 1_555 L MG  .  MG  ? ? C ASP 506 C MG  701 1_555 ? ? ? ? ? ? ?            2.634 ? 
metalc12 metalc ? ? B PHE 316 O   ? ? ? 1_555 K MG  .  MG  ? ? B PHE 316 B MG  700 1_555 ? ? ? ? ? ? ?            2.838 ? 
metalc13 metalc ? ? D ASP 127 OD2 ? ? ? 1_555 M MG  .  MG  ? ? D ASP 506 D MG  701 1_555 ? ? ? ? ? ? ?            2.868 ? 
metalc14 metalc ? ? A PHE 316 O   ? ? ? 1_555 I MG  .  MG  ? ? A PHE 316 A MG  501 1_555 ? ? ? ? ? ? ?            2.889 ? 
metalc15 metalc ? ? A LYS 317 O   ? ? ? 1_555 I MG  .  MG  ? ? A LYS 317 A MG  501 1_555 ? ? ? ? ? ? ?            2.950 ? 
metalc16 metalc ? ? B LYS 317 O   ? ? ? 1_555 K MG  .  MG  ? ? B LYS 317 B MG  700 1_555 ? ? ? ? ? ? ?            2.971 ? 
covale1  covale ? ? B TYR 118 OH  ? ? ? 1_555 H DG  1  P   ? ? B TYR 118 H DG  1   1_555 ? ? ? ? ? ? ?            1.578 ? 
covale2  covale ? ? A TYR 118 OH  ? ? ? 1_555 F DA  1  P   ? ? A TYR 118 F DA  1   1_555 ? ? ? ? ? ? ?            1.580 ? 
hydrog1  hydrog ? ? E DC  1   N3  ? ? ? 1_555 F DG  11 N1  ? ? E DC  9   F DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? E DC  1   N4  ? ? ? 1_555 F DG  11 O6  ? ? E DC  9   F DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? E DC  1   O2  ? ? ? 1_555 F DG  11 N2  ? ? E DC  9   F DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? E DA  2   N1  ? ? ? 1_555 F DT  10 N3  ? ? E DA  10  F DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? E DA  2   N6  ? ? ? 1_555 F DT  10 O4  ? ? E DA  10  F DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? E DT  3   N3  ? ? ? 1_555 F DA  9  N1  ? ? E DT  11  F DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? E DT  3   O4  ? ? ? 1_555 F DA  9  N6  ? ? E DT  11  F DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? E DG  4   N1  ? ? ? 1_555 F DC  8  N3  ? ? E DG  12  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? E DG  4   N2  ? ? ? 1_555 F DC  8  O2  ? ? E DG  12  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? E DG  4   O6  ? ? ? 1_555 F DC  8  N4  ? ? E DG  12  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? E DA  5   N1  ? ? ? 1_555 F DT  7  N3  ? ? E DA  13  F DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? E DA  5   N6  ? ? ? 1_555 F DT  7  O4  ? ? E DA  13  F DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? E DA  6   N1  ? ? ? 1_555 F DT  6  N3  ? ? E DA  14  F DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? E DA  6   N6  ? ? ? 1_555 F DT  6  O4  ? ? E DA  14  F DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? E DT  7   N3  ? ? ? 1_555 F DA  5  N1  ? ? E DT  15  F DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? E DT  7   O4  ? ? ? 1_555 F DA  5  N6  ? ? E DT  15  F DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? F DA  1   N1  ? ? ? 1_555 H DT  4  N3  ? ? F DA  1   H DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? F DA  1   N6  ? ? ? 1_555 H DT  4  O4  ? ? F DA  1   H DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? F DG  2   N1  ? ? ? 1_555 H DC  3  N3  ? ? F DG  2   H DC  3   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog20 hydrog ? ? F DT  3   N3  ? ? ? 1_555 H DA  2  N1  ? ? F DT  3   H DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? F DT  3   O4  ? ? ? 1_555 H DA  2  N6  ? ? F DT  3   H DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? F DC  4   N3  ? ? ? 1_555 H DG  1  N1  ? ? F DC  4   H DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? F DC  4   N4  ? ? ? 1_555 H DG  1  O6  ? ? F DC  4   H DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? F DC  4   O2  ? ? ? 1_555 H DG  1  N2  ? ? F DC  4   H DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? G DC  1   N3  ? ? ? 1_555 H DG  11 N1  ? ? G DC  9   H DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? G DC  1   N4  ? ? ? 1_555 H DG  11 O6  ? ? G DC  9   H DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? G DC  1   O2  ? ? ? 1_555 H DG  11 N2  ? ? G DC  9   H DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? G DG  2   N1  ? ? ? 1_555 H DC  10 N3  ? ? G DG  10  H DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? G DG  2   N2  ? ? ? 1_555 H DC  10 O2  ? ? G DG  10  H DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? G DG  2   O6  ? ? ? 1_555 H DC  10 N4  ? ? G DG  10  H DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? G DT  3   N3  ? ? ? 1_555 H DA  9  N1  ? ? G DT  11  H DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? G DT  3   O4  ? ? ? 1_555 H DA  9  N6  ? ? G DT  11  H DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? G DG  4   N1  ? ? ? 1_555 H DC  8  N3  ? ? G DG  12  H DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? G DG  4   N2  ? ? ? 1_555 H DC  8  O2  ? ? G DG  12  H DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? G DG  4   O6  ? ? ? 1_555 H DC  8  N4  ? ? G DG  12  H DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? G DC  5   N3  ? ? ? 1_555 H DG  7  N1  ? ? G DC  13  H DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? G DC  5   N4  ? ? ? 1_555 H DG  7  O6  ? ? G DC  13  H DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? G DC  5   O2  ? ? ? 1_555 H DG  7  N2  ? ? G DC  13  H DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? G DA  6   N1  ? ? ? 1_555 H DT  6  N3  ? ? G DA  14  H DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? G DA  6   N6  ? ? ? 1_555 H DT  6  O4  ? ? G DA  14  H DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? G DT  7   N3  ? ? ? 1_555 H DA  5  N1  ? ? G DT  15  H DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? G DT  7   O4  ? ? ? 1_555 H DA  5  N6  ? ? G DT  15  H DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 168 A . ? THR 168 A GLY 169 A ? GLY 169 A 1 -5.89  
2 THR 168 B . ? THR 168 B GLY 169 B ? GLY 169 B 1 -11.34 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 4 ? 
F ? 4 ? 
G ? 2 ? 
H ? 6 ? 
I ? 3 ? 
J ? 2 ? 
K ? 2 ? 
L ? 4 ? 
M ? 4 ? 
N ? 2 ? 
O ? 2 ? 
P ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? parallel      
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? parallel      
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? anti-parallel 
O 1 2 ? anti-parallel 
P 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 5   ? SER A 8   ? GLN A 5   SER A 8   
A 2 LEU C 224 ? THR C 228 ? LEU C 603 THR C 607 
A 3 VAL C 156 ? ALA C 159 ? VAL C 535 ALA C 538 
A 4 LYS C 121 ? MET C 125 ? LYS C 500 MET C 504 
A 5 GLU C 49  ? GLU C 54  ? GLU C 428 GLU C 433 
A 6 GLN C 71  ? LEU C 76  ? GLN C 450 LEU C 455 
B 1 ARG A 60  ? LYS A 61  ? ARG A 60  LYS A 61  
B 2 GLU A 120 ? LEU A 123 ? GLU A 120 LEU A 123 
B 3 VAL A 99  ? HIS A 102 ? VAL A 99  HIS A 102 
C 1 PHE A 141 ? TRP A 143 ? PHE A 141 TRP A 143 
C 2 LYS A 150 ? PRO A 152 ? LYS A 150 PRO A 152 
D 1 SER A 167 ? ILE A 170 ? SER A 167 ILE A 170 
D 2 ALA A 175 ? ILE A 178 ? ALA A 175 ILE A 178 
E 1 GLN A 322 ? ASN A 328 ? GLN A 322 ASN A 328 
E 2 LYS A 233 ? ARG A 239 ? LYS A 233 ARG A 239 
E 3 ALA A 217 ? GLN A 220 ? ALA A 217 GLN A 220 
E 4 SER A 480 ? GLU A 483 ? SER A 480 GLU A 483 
F 1 LYS A 241 ? LYS A 246 ? LYS A 241 LYS A 246 
F 2 GLU A 252 ? GLU A 258 ? GLU A 252 GLU A 258 
F 3 ILE A 298 ? LEU A 302 ? ILE A 298 LEU A 302 
F 4 ILE A 284 ? ASP A 289 ? ILE A 284 ASP A 289 
G 1 VAL A 330 ? ASP A 333 ? VAL A 330 ASP A 333 
G 2 THR A 336 ? GLN A 339 ? THR A 336 GLN A 339 
H 1 GLN B 5   ? SER B 8   ? GLN B 5   SER B 8   
H 2 LEU D 224 ? THR D 228 ? LEU D 603 THR D 607 
H 3 VAL D 156 ? ALA D 159 ? VAL D 535 ALA D 538 
H 4 LYS D 121 ? MET D 125 ? LYS D 500 MET D 504 
H 5 GLU D 49  ? GLU D 54  ? GLU D 428 GLU D 433 
H 6 GLN D 71  ? LEU D 76  ? GLN D 450 LEU D 455 
I 1 ARG B 60  ? LYS B 61  ? ARG B 60  LYS B 61  
I 2 GLU B 120 ? LEU B 123 ? GLU B 120 LEU B 123 
I 3 VAL B 99  ? HIS B 102 ? VAL B 99  HIS B 102 
J 1 PHE B 141 ? TRP B 143 ? PHE B 141 TRP B 143 
J 2 LYS B 150 ? PRO B 152 ? LYS B 150 PRO B 152 
K 1 SER B 167 ? ILE B 170 ? SER B 167 ILE B 170 
K 2 ALA B 175 ? ILE B 178 ? ALA B 175 ILE B 178 
L 1 GLN B 322 ? ASN B 328 ? GLN B 322 ASN B 328 
L 2 LYS B 233 ? ARG B 239 ? LYS B 233 ARG B 239 
L 3 ILE B 218 ? GLN B 220 ? ILE B 218 GLN B 220 
L 4 SER B 481 ? GLU B 483 ? SER B 481 GLU B 483 
M 1 LYS B 241 ? LEU B 247 ? LYS B 241 LEU B 247 
M 2 LYS B 251 ? GLU B 258 ? LYS B 251 GLU B 258 
M 3 ILE B 298 ? LEU B 302 ? ILE B 298 LEU B 302 
M 4 ILE B 284 ? ASP B 289 ? ILE B 284 ASP B 289 
N 1 VAL B 330 ? ASP B 333 ? VAL B 330 ASP B 333 
N 2 THR B 336 ? GLN B 339 ? THR B 336 GLN B 339 
O 1 TYR C 164 ? LYS C 165 ? TYR C 543 LYS C 544 
O 2 GLN C 199 ? ARG C 200 ? GLN C 578 ARG C 579 
P 1 TYR D 164 ? LYS D 165 ? TYR D 543 LYS D 544 
P 2 GLN D 199 ? ARG D 200 ? GLN D 578 ARG D 579 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N MET A 7   ? N MET A 7   O ARG C 226 ? O ARG C 605 
A 2 3 O VAL C 227 ? O VAL C 606 N VAL C 156 ? N VAL C 535 
A 3 4 O TYR C 157 ? O TYR C 536 N ILE C 122 ? N ILE C 501 
A 4 5 O ILE C 123 ? O ILE C 502 N LEU C 50  ? N LEU C 429 
A 5 6 N VAL C 53  ? N VAL C 432 O LEU C 76  ? O LEU C 455 
B 1 2 N ARG A 60  ? N ARG A 60  O ALA A 121 ? O ALA A 121 
B 2 3 O ARG A 122 ? O ARG A 122 N GLU A 100 ? N GLU A 100 
C 1 2 N ALA A 142 ? N ALA A 142 O GLU A 151 ? O GLU A 151 
D 1 2 N SER A 167 ? N SER A 167 O ILE A 178 ? O ILE A 178 
E 1 2 O TYR A 325 ? O TYR A 325 N VAL A 236 ? N VAL A 236 
E 2 3 O VAL A 237 ? O VAL A 237 N GLN A 220 ? N GLN A 220 
E 3 4 N ILE A 219 ? N ILE A 219 O SER A 481 ? O SER A 481 
F 1 2 N GLU A 243 ? N GLU A 243 O VAL A 255 ? O VAL A 255 
F 2 3 N ILE A 254 ? N ILE A 254 O ILE A 300 ? O ILE A 300 
F 3 4 O GLU A 301 ? O GLU A 301 N ALA A 285 ? N ALA A 285 
G 1 2 N ALA A 331 ? N ALA A 331 O ARG A 338 ? O ARG A 338 
H 1 2 N MET B 7   ? N MET B 7   O ARG D 226 ? O ARG D 605 
H 2 3 O ILE D 225 ? O ILE D 604 N ILE D 158 ? N ILE D 537 
H 3 4 O TYR D 157 ? O TYR D 536 N ILE D 122 ? N ILE D 501 
H 4 5 O ILE D 123 ? O ILE D 502 N LEU D 50  ? N LEU D 429 
H 5 6 N VAL D 53  ? N VAL D 432 O LEU D 76  ? O LEU D 455 
I 1 2 N ARG B 60  ? N ARG B 60  O ALA B 121 ? O ALA B 121 
I 2 3 O ARG B 122 ? O ARG B 122 N GLU B 100 ? N GLU B 100 
J 1 2 N ALA B 142 ? N ALA B 142 O GLU B 151 ? O GLU B 151 
K 1 2 N SER B 167 ? N SER B 167 O ILE B 178 ? O ILE B 178 
L 1 2 O ILE B 323 ? O ILE B 323 N VAL B 238 ? N VAL B 238 
L 2 3 O ARG B 239 ? O ARG B 239 N ILE B 218 ? N ILE B 218 
L 3 4 N ILE B 219 ? N ILE B 219 O SER B 481 ? O SER B 481 
M 1 2 N LEU B 247 ? N LEU B 247 O LYS B 251 ? O LYS B 251 
M 2 3 N ILE B 254 ? N ILE B 254 O ILE B 300 ? O ILE B 300 
M 3 4 O ALA B 299 ? O ALA B 299 N ARG B 288 ? N ARG B 288 
N 1 2 N ASP B 333 ? N ASP B 333 O THR B 336 ? O THR B 336 
O 1 2 N LYS C 165 ? N LYS C 544 O GLN C 199 ? O GLN C 578 
P 1 2 N LYS D 165 ? N LYS D 544 O GLN D 199 ? O GLN D 578 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 501'  
AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MG A 502'  
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG B 700'  
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG C 701'  
AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG D 701'  
AC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MG G 100'  
AC7 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE 1UV H 101' 
AC8 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE 1UV H 102' 
1   ?        ? ? ? ? ? ?                                    
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 PHE A 316 ? PHE A 316 . ? 1_555 ? 
2  AC1 4 LYS A 317 ? LYS A 317 . ? 1_555 ? 
3  AC1 4 THR A 319 ? THR A 319 . ? 1_555 ? 
4  AC1 4 GLN A 322 ? GLN A 322 . ? 1_555 ? 
5  AC2 1 1UV P .   ? 1UV H 102 . ? 1_555 ? 
6  AC3 4 PHE B 316 ? PHE B 316 . ? 1_555 ? 
7  AC3 4 LYS B 317 ? LYS B 317 . ? 1_555 ? 
8  AC3 4 THR B 319 ? THR B 319 . ? 1_555 ? 
9  AC3 4 GLN B 322 ? GLN B 322 . ? 1_555 ? 
10 AC4 2 ASP C 127 ? ASP C 506 . ? 1_555 ? 
11 AC4 2 ASP C 129 ? ASP C 508 . ? 1_555 ? 
12 AC5 2 ASP D 127 ? ASP D 506 . ? 1_555 ? 
13 AC5 2 ASP D 129 ? ASP D 508 . ? 1_555 ? 
14 AC6 1 1UV O .   ? 1UV H 101 . ? 1_555 ? 
15 AC7 9 ARG A 117 ? ARG A 117 . ? 1_555 ? 
16 AC7 9 SER B 79  ? SER B 79  . ? 1_555 ? 
17 AC7 9 ARG D 77  ? ARG D 456 . ? 1_555 ? 
18 AC7 9 GLU D 96  ? GLU D 475 . ? 1_555 ? 
19 AC7 9 DA  F 1   ? DA  F 1   . ? 1_555 ? 
20 AC7 9 DT  G 7   ? DT  G 15  . ? 1_555 ? 
21 AC7 9 MG  N .   ? MG  G 100 . ? 1_555 ? 
22 AC7 9 DT  H 4   ? DT  H 4   . ? 1_555 ? 
23 AC7 9 DA  H 5   ? DA  H 5   . ? 1_555 ? 
24 AC8 8 SER A 79  ? SER A 79  . ? 1_555 ? 
25 AC8 8 MG  J .   ? MG  A 502 . ? 1_555 ? 
26 AC8 8 ARG B 117 ? ARG B 117 . ? 1_555 ? 
27 AC8 8 ARG C 77  ? ARG C 456 . ? 1_555 ? 
28 AC8 8 DT  E 7   ? DT  E 15  . ? 1_555 ? 
29 AC8 8 DC  F 4   ? DC  F 4   . ? 1_555 ? 
30 AC8 8 DA  F 5   ? DA  F 5   . ? 1_555 ? 
31 AC8 8 DG  H 1   ? DG  H 1   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4KPF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4KPF 
_atom_sites.fract_transf_matrix[1][1]   0.006335 
_atom_sites.fract_transf_matrix[1][2]   0.003657 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007315 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004744 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
F  
H  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ASN A 1 3   ? -23.536  34.283  -22.542 1.00 155.84 ?  3   ASN A N     1 
ATOM   2     C  CA    . ASN A 1 3   ? -23.226  35.464  -21.742 1.00 153.69 ?  3   ASN A CA    1 
ATOM   3     C  C     . ASN A 1 3   ? -22.717  36.640  -22.579 1.00 152.35 ?  3   ASN A C     1 
ATOM   4     O  O     . ASN A 1 3   ? -22.707  37.779  -22.105 1.00 151.19 ?  3   ASN A O     1 
ATOM   5     C  CB    . ASN A 1 3   ? -22.215  35.124  -20.640 1.00 153.36 ?  3   ASN A CB    1 
ATOM   6     N  N     . ILE A 1 4   ? -22.302  36.364  -23.819 1.00 149.46 ?  4   ILE A N     1 
ATOM   7     C  CA    . ILE A 1 4   ? -21.726  37.395  -24.695 1.00 140.30 ?  4   ILE A CA    1 
ATOM   8     C  C     . ILE A 1 4   ? -21.493  36.936  -26.148 1.00 138.66 ?  4   ILE A C     1 
ATOM   9     O  O     . ILE A 1 4   ? -20.738  35.998  -26.391 1.00 144.10 ?  4   ILE A O     1 
ATOM   10    C  CB    . ILE A 1 4   ? -20.395  37.929  -24.122 1.00 137.20 ?  4   ILE A CB    1 
ATOM   11    C  CG1   . ILE A 1 4   ? -19.764  38.936  -25.085 1.00 130.46 ?  4   ILE A CG1   1 
ATOM   12    C  CG2   . ILE A 1 4   ? -19.432  36.777  -23.844 1.00 143.14 ?  4   ILE A CG2   1 
ATOM   13    C  CD1   . ILE A 1 4   ? -18.397  39.413  -24.654 1.00 129.42 ?  4   ILE A CD1   1 
ATOM   14    N  N     . GLN A 1 5   ? -22.126  37.623  -27.101 1.00 134.55 ?  5   GLN A N     1 
ATOM   15    C  CA    . GLN A 1 5   ? -22.079  37.267  -28.531 1.00 137.65 ?  5   GLN A CA    1 
ATOM   16    C  C     . GLN A 1 5   ? -21.749  38.476  -29.421 1.00 138.56 ?  5   GLN A C     1 
ATOM   17    O  O     . GLN A 1 5   ? -22.305  39.559  -29.223 1.00 138.00 ?  5   GLN A O     1 
ATOM   18    C  CB    . GLN A 1 5   ? -23.424  36.670  -28.972 1.00 135.37 ?  5   GLN A CB    1 
ATOM   19    N  N     . ASN A 1 6   ? -20.870  38.295  -30.408 1.00 137.23 ?  6   ASN A N     1 
ATOM   20    C  CA    . ASN A 1 6   ? -20.459  39.423  -31.259 1.00 132.63 ?  6   ASN A CA    1 
ATOM   21    C  C     . ASN A 1 6   ? -21.126  39.542  -32.641 1.00 130.82 ?  6   ASN A C     1 
ATOM   22    O  O     . ASN A 1 6   ? -21.527  38.545  -33.248 1.00 130.43 ?  6   ASN A O     1 
ATOM   23    C  CB    . ASN A 1 6   ? -18.926  39.510  -31.393 1.00 131.94 ?  6   ASN A CB    1 
ATOM   24    C  CG    . ASN A 1 6   ? -18.235  38.192  -31.120 1.00 132.62 ?  6   ASN A CG    1 
ATOM   25    O  OD1   . ASN A 1 6   ? -18.880  37.148  -31.029 1.00 133.52 ?  6   ASN A OD1   1 
ATOM   26    N  ND2   . ASN A 1 6   ? -16.910  38.235  -30.985 1.00 131.06 ?  6   ASN A ND2   1 
ATOM   27    N  N     . MET A 1 7   ? -21.234  40.784  -33.118 1.00 128.31 ?  7   MET A N     1 
ATOM   28    C  CA    . MET A 1 7   ? -21.794  41.096  -34.434 1.00 124.53 ?  7   MET A CA    1 
ATOM   29    C  C     . MET A 1 7   ? -20.873  42.073  -35.187 1.00 122.75 ?  7   MET A C     1 
ATOM   30    O  O     . MET A 1 7   ? -20.025  42.738  -34.576 1.00 121.02 ?  7   MET A O     1 
ATOM   31    C  CB    . MET A 1 7   ? -23.211  41.678  -34.291 1.00 117.29 ?  7   MET A CB    1 
ATOM   32    N  N     . SER A 1 8   ? -21.030  42.149  -36.510 1.00 121.14 ?  8   SER A N     1 
ATOM   33    C  CA    . SER A 1 8   ? -20.238  43.072  -37.326 1.00 121.96 ?  8   SER A CA    1 
ATOM   34    C  C     . SER A 1 8   ? -20.687  44.519  -37.112 1.00 122.08 ?  8   SER A C     1 
ATOM   35    O  O     . SER A 1 8   ? -21.837  44.768  -36.746 1.00 124.13 ?  8   SER A O     1 
ATOM   36    C  CB    . SER A 1 8   ? -20.349  42.709  -38.815 1.00 122.35 ?  8   SER A CB    1 
ATOM   37    O  OG    . SER A 1 8   ? -19.576  43.583  -39.635 1.00 120.42 ?  8   SER A OG    1 
ATOM   38    N  N     . LEU A 1 9   ? -19.784  45.474  -37.328 1.00 117.93 ?  9   LEU A N     1 
ATOM   39    C  CA    . LEU A 1 9   ? -20.194  46.869  -37.387 1.00 109.01 ?  9   LEU A CA    1 
ATOM   40    C  C     . LEU A 1 9   ? -21.154  46.999  -38.571 1.00 118.23 ?  9   LEU A C     1 
ATOM   41    O  O     . LEU A 1 9   ? -22.260  47.539  -38.437 1.00 120.25 ?  9   LEU A O     1 
ATOM   42    C  CB    . LEU A 1 9   ? -18.991  47.798  -37.564 1.00 96.88  ?  9   LEU A CB    1 
ATOM   43    C  CG    . LEU A 1 9   ? -19.101  49.161  -36.866 1.00 86.35  ?  9   LEU A CG    1 
ATOM   44    C  CD1   . LEU A 1 9   ? -18.269  50.246  -37.547 1.00 85.62  ?  9   LEU A CD1   1 
ATOM   45    C  CD2   . LEU A 1 9   ? -20.546  49.589  -36.759 1.00 82.87  ?  9   LEU A CD2   1 
ATOM   46    N  N     . GLU A 1 10  ? -20.734  46.471  -39.724 1.00 121.60 ?  10  GLU A N     1 
ATOM   47    C  CA    . GLU A 1 10  ? -21.550  46.495  -40.940 1.00 122.75 ?  10  GLU A CA    1 
ATOM   48    C  C     . GLU A 1 10  ? -22.952  45.921  -40.705 1.00 119.60 ?  10  GLU A C     1 
ATOM   49    O  O     . GLU A 1 10  ? -23.947  46.442  -41.213 1.00 114.47 ?  10  GLU A O     1 
ATOM   50    C  CB    . GLU A 1 10  ? -20.844  45.750  -42.082 1.00 128.09 ?  10  GLU A CB    1 
ATOM   51    N  N     . ASP A 1 11  ? -23.023  44.849  -39.925 1.00 122.15 ?  11  ASP A N     1 
ATOM   52    C  CA    . ASP A 1 11  ? -24.296  44.202  -39.634 1.00 125.29 ?  11  ASP A CA    1 
ATOM   53    C  C     . ASP A 1 11  ? -25.086  44.859  -38.484 1.00 122.96 ?  11  ASP A C     1 
ATOM   54    O  O     . ASP A 1 11  ? -26.304  44.697  -38.409 1.00 122.16 ?  11  ASP A O     1 
ATOM   55    C  CB    . ASP A 1 11  ? -24.092  42.701  -39.363 1.00 131.74 ?  11  ASP A CB    1 
ATOM   56    C  CG    . ASP A 1 11  ? -23.897  41.886  -40.642 1.00 139.96 ?  11  ASP A CG    1 
ATOM   57    O  OD1   . ASP A 1 11  ? -22.938  41.080  -40.713 1.00 143.86 ?  11  ASP A OD1   1 
ATOM   58    O  OD2   . ASP A 1 11  ? -24.716  42.039  -41.573 1.00 142.52 ?  11  ASP A OD2   1 
ATOM   59    N  N     . ILE A 1 12  ? -24.414  45.588  -37.590 1.00 122.98 ?  12  ILE A N     1 
ATOM   60    C  CA    . ILE A 1 12  ? -25.131  46.234  -36.482 1.00 123.38 ?  12  ILE A CA    1 
ATOM   61    C  C     . ILE A 1 12  ? -25.750  47.567  -36.920 1.00 121.17 ?  12  ILE A C     1 
ATOM   62    O  O     . ILE A 1 12  ? -26.860  47.899  -36.503 1.00 118.22 ?  12  ILE A O     1 
ATOM   63    C  CB    . ILE A 1 12  ? -24.274  46.404  -35.179 1.00 79.79  ?  12  ILE A CB    1 
ATOM   64    N  N     . MET A 1 13  ? -25.050  48.317  -37.772 1.00 118.25 ?  13  MET A N     1 
ATOM   65    C  CA    . MET A 1 13  ? -25.603  49.563  -38.306 1.00 112.20 ?  13  MET A CA    1 
ATOM   66    C  C     . MET A 1 13  ? -26.770  49.266  -39.246 1.00 117.00 ?  13  MET A C     1 
ATOM   67    O  O     . MET A 1 13  ? -27.646  50.099  -39.443 1.00 116.07 ?  13  MET A O     1 
ATOM   68    C  CB    . MET A 1 13  ? -24.533  50.363  -39.047 1.00 108.26 ?  13  MET A CB    1 
ATOM   69    C  CG    . MET A 1 13  ? -23.328  50.714  -38.201 1.00 104.70 ?  13  MET A CG    1 
ATOM   70    S  SD    . MET A 1 13  ? -23.625  52.123  -37.121 1.00 130.90 ?  13  MET A SD    1 
ATOM   71    C  CE    . MET A 1 13  ? -23.599  53.469  -38.301 1.00 101.95 ?  13  MET A CE    1 
ATOM   72    N  N     . GLY A 1 14  ? -26.766  48.071  -39.830 1.00 122.27 ?  14  GLY A N     1 
ATOM   73    C  CA    . GLY A 1 14  ? -27.836  47.636  -40.710 1.00 119.83 ?  14  GLY A CA    1 
ATOM   74    C  C     . GLY A 1 14  ? -29.142  47.496  -39.957 1.00 118.40 ?  14  GLY A C     1 
ATOM   75    O  O     . GLY A 1 14  ? -30.048  48.307  -40.148 1.00 120.09 ?  14  GLY A O     1 
ATOM   76    N  N     . GLU A 1 15  ? -29.237  46.482  -39.093 1.00 114.26 ?  15  GLU A N     1 
ATOM   77    C  CA    . GLU A 1 15  ? -30.448  46.251  -38.287 1.00 105.57 ?  15  GLU A CA    1 
ATOM   78    C  C     . GLU A 1 15  ? -30.903  47.471  -37.462 1.00 103.92 ?  15  GLU A C     1 
ATOM   79    O  O     . GLU A 1 15  ? -32.094  47.630  -37.207 1.00 107.22 ?  15  GLU A O     1 
ATOM   80    C  CB    . GLU A 1 15  ? -30.292  45.021  -37.381 1.00 98.54  ?  15  GLU A CB    1 
ATOM   81    N  N     . ARG A 1 16  ? -29.969  48.328  -37.050 1.00 99.77  ?  16  ARG A N     1 
ATOM   82    C  CA    . ARG A 1 16  ? -30.332  49.550  -36.329 1.00 99.30  ?  16  ARG A CA    1 
ATOM   83    C  C     . ARG A 1 16  ? -30.932  50.647  -37.209 1.00 101.23 ?  16  ARG A C     1 
ATOM   84    O  O     . ARG A 1 16  ? -32.030  51.125  -36.935 1.00 104.02 ?  16  ARG A O     1 
ATOM   85    C  CB    . ARG A 1 16  ? -29.151  50.106  -35.527 1.00 100.52 ?  16  ARG A CB    1 
ATOM   86    C  CG    . ARG A 1 16  ? -29.072  49.545  -34.119 1.00 103.94 ?  16  ARG A CG    1 
ATOM   87    C  CD    . ARG A 1 16  ? -29.444  48.076  -34.142 1.00 111.43 ?  16  ARG A CD    1 
ATOM   88    N  NE    . ARG A 1 16  ? -29.271  47.411  -32.854 1.00 112.25 ?  16  ARG A NE    1 
ATOM   89    C  CZ    . ARG A 1 16  ? -29.382  46.094  -32.685 1.00 112.99 ?  16  ARG A CZ    1 
ATOM   90    N  NH1   . ARG A 1 16  ? -29.664  45.310  -33.730 1.00 114.03 ?  16  ARG A NH1   1 
ATOM   91    N  NH2   . ARG A 1 16  ? -29.211  45.562  -31.477 1.00 110.11 ?  16  ARG A NH2   1 
ATOM   92    N  N     . PHE A 1 17  ? -30.224  51.051  -38.259 1.00 100.62 ?  17  PHE A N     1 
ATOM   93    C  CA    . PHE A 1 17  ? -30.699  52.159  -39.084 1.00 97.10  ?  17  PHE A CA    1 
ATOM   94    C  C     . PHE A 1 17  ? -31.919  51.803  -39.938 1.00 97.02  ?  17  PHE A C     1 
ATOM   95    O  O     . PHE A 1 17  ? -32.816  52.633  -40.151 1.00 96.39  ?  17  PHE A O     1 
ATOM   96    C  CB    . PHE A 1 17  ? -29.588  52.724  -39.959 1.00 97.42  ?  17  PHE A CB    1 
ATOM   97    C  CG    . PHE A 1 17  ? -29.875  54.105  -40.447 1.00 96.33  ?  17  PHE A CG    1 
ATOM   98    C  CD1   . PHE A 1 17  ? -30.528  54.304  -41.663 1.00 99.60  ?  17  PHE A CD1   1 
ATOM   99    C  CD2   . PHE A 1 17  ? -29.527  55.211  -39.672 1.00 89.25  ?  17  PHE A CD2   1 
ATOM   100   C  CE1   . PHE A 1 17  ? -30.813  55.584  -42.106 1.00 99.59  ?  17  PHE A CE1   1 
ATOM   101   C  CE2   . PHE A 1 17  ? -29.803  56.499  -40.105 1.00 88.56  ?  17  PHE A CE2   1 
ATOM   102   C  CZ    . PHE A 1 17  ? -30.448  56.688  -41.325 1.00 96.13  ?  17  PHE A CZ    1 
ATOM   103   N  N     . GLY A 1 18  ? -31.948  50.572  -40.432 1.00 91.12  ?  18  GLY A N     1 
ATOM   104   C  CA    . GLY A 1 18  ? -33.125  50.082  -41.121 1.00 84.86  ?  18  GLY A CA    1 
ATOM   105   C  C     . GLY A 1 18  ? -34.319  50.077  -40.186 1.00 85.61  ?  18  GLY A C     1 
ATOM   106   O  O     . GLY A 1 18  ? -35.399  50.523  -40.563 1.00 87.02  ?  18  GLY A O     1 
ATOM   107   N  N     . ARG A 1 19  ? -34.120  49.576  -38.964 1.00 88.24  ?  19  ARG A N     1 
ATOM   108   C  CA    . ARG A 1 19  ? -35.170  49.558  -37.942 1.00 83.59  ?  19  ARG A CA    1 
ATOM   109   C  C     . ARG A 1 19  ? -35.779  50.942  -37.784 1.00 81.66  ?  19  ARG A C     1 
ATOM   110   O  O     . ARG A 1 19  ? -36.990  51.124  -37.992 1.00 77.22  ?  19  ARG A O     1 
ATOM   111   C  CB    . ARG A 1 19  ? -34.631  49.065  -36.588 1.00 75.08  ?  19  ARG A CB    1 
ATOM   112   N  N     . TYR A 1 20  ? -34.923  51.905  -37.430 1.00 79.49  ?  20  TYR A N     1 
ATOM   113   C  CA    . TYR A 1 20  ? -35.312  53.299  -37.188 1.00 81.06  ?  20  TYR A CA    1 
ATOM   114   C  C     . TYR A 1 20  ? -35.914  53.958  -38.421 1.00 81.21  ?  20  TYR A C     1 
ATOM   115   O  O     . TYR A 1 20  ? -37.022  54.489  -38.367 1.00 76.83  ?  20  TYR A O     1 
ATOM   116   C  CB    . TYR A 1 20  ? -34.093  54.096  -36.722 1.00 84.90  ?  20  TYR A CB    1 
ATOM   117   C  CG    . TYR A 1 20  ? -34.315  55.574  -36.431 1.00 89.28  ?  20  TYR A CG    1 
ATOM   118   C  CD1   . TYR A 1 20  ? -34.889  55.995  -35.243 1.00 97.95  ?  20  TYR A CD1   1 
ATOM   119   C  CD2   . TYR A 1 20  ? -33.887  56.544  -37.322 1.00 90.01  ?  20  TYR A CD2   1 
ATOM   120   C  CE1   . TYR A 1 20  ? -35.062  57.342  -34.976 1.00 103.06 ?  20  TYR A CE1   1 
ATOM   121   C  CE2   . TYR A 1 20  ? -34.056  57.885  -37.064 1.00 94.90  ?  20  TYR A CE2   1 
ATOM   122   C  CZ    . TYR A 1 20  ? -34.640  58.284  -35.894 1.00 102.15 ?  20  TYR A CZ    1 
ATOM   123   O  OH    . TYR A 1 20  ? -34.804  59.633  -35.646 1.00 105.78 ?  20  TYR A OH    1 
ATOM   124   N  N     . SER A 1 21  ? -35.174  53.924  -39.529 1.00 83.74  ?  21  SER A N     1 
ATOM   125   C  CA    . SER A 1 21  ? -35.632  54.510  -40.782 1.00 76.49  ?  21  SER A CA    1 
ATOM   126   C  C     . SER A 1 21  ? -37.094  54.106  -41.041 1.00 77.72  ?  21  SER A C     1 
ATOM   127   O  O     . SER A 1 21  ? -37.999  54.953  -41.049 1.00 72.19  ?  21  SER A O     1 
ATOM   128   C  CB    . SER A 1 21  ? -34.713  54.087  -41.937 1.00 69.73  ?  21  SER A CB    1 
ATOM   129   N  N     . LYS A 1 22  ? -37.322  52.807  -41.226 1.00 78.49  ?  22  LYS A N     1 
ATOM   130   C  CA    . LYS A 1 22  ? -38.657  52.290  -41.504 1.00 73.64  ?  22  LYS A CA    1 
ATOM   131   C  C     . LYS A 1 22  ? -39.711  52.933  -40.611 1.00 79.46  ?  22  LYS A C     1 
ATOM   132   O  O     . LYS A 1 22  ? -40.774  53.338  -41.099 1.00 80.08  ?  22  LYS A O     1 
ATOM   133   C  CB    . LYS A 1 22  ? -38.704  50.773  -41.322 1.00 71.87  ?  22  LYS A CB    1 
ATOM   134   C  CG    . LYS A 1 22  ? -40.067  50.179  -41.631 1.00 71.14  ?  22  LYS A CG    1 
ATOM   135   C  CD    . LYS A 1 22  ? -40.101  48.664  -41.489 1.00 77.62  ?  22  LYS A CD    1 
ATOM   136   C  CE    . LYS A 1 22  ? -41.293  48.091  -42.258 1.00 87.32  ?  22  LYS A CE    1 
ATOM   137   N  NZ    . LYS A 1 22  ? -41.402  46.608  -42.184 1.00 96.08  ?  22  LYS A NZ    1 
ATOM   138   N  N     . TYR A 1 23  ? -39.421  53.015  -39.307 1.00 80.50  ?  23  TYR A N     1 
ATOM   139   C  CA    . TYR A 1 23  ? -40.398  53.498  -38.326 1.00 79.50  ?  23  TYR A CA    1 
ATOM   140   C  C     . TYR A 1 23  ? -40.659  54.988  -38.509 1.00 82.41  ?  23  TYR A C     1 
ATOM   141   O  O     . TYR A 1 23  ? -41.818  55.420  -38.636 1.00 85.13  ?  23  TYR A O     1 
ATOM   142   C  CB    . TYR A 1 23  ? -39.952  53.188  -36.881 1.00 78.33  ?  23  TYR A CB    1 
ATOM   143   C  CG    . TYR A 1 23  ? -40.924  53.658  -35.794 1.00 76.45  ?  23  TYR A CG    1 
ATOM   144   C  CD1   . TYR A 1 23  ? -40.677  54.810  -35.064 1.00 78.31  ?  23  TYR A CD1   1 
ATOM   145   C  CD2   . TYR A 1 23  ? -42.086  52.955  -35.514 1.00 77.18  ?  23  TYR A CD2   1 
ATOM   146   C  CE1   . TYR A 1 23  ? -41.560  55.248  -34.089 1.00 89.66  ?  23  TYR A CE1   1 
ATOM   147   C  CE2   . TYR A 1 23  ? -42.975  53.386  -34.553 1.00 83.43  ?  23  TYR A CE2   1 
ATOM   148   C  CZ    . TYR A 1 23  ? -42.713  54.534  -33.829 1.00 93.56  ?  23  TYR A CZ    1 
ATOM   149   O  OH    . TYR A 1 23  ? -43.597  54.971  -32.843 1.00 100.89 ?  23  TYR A OH    1 
ATOM   150   N  N     . ILE A 1 24  ? -39.580  55.769  -38.529 1.00 79.54  ?  24  ILE A N     1 
ATOM   151   C  CA    . ILE A 1 24  ? -39.688  57.221  -38.664 1.00 74.70  ?  24  ILE A CA    1 
ATOM   152   C  C     . ILE A 1 24  ? -40.307  57.642  -40.029 1.00 77.58  ?  24  ILE A C     1 
ATOM   153   O  O     . ILE A 1 24  ? -40.849  58.744  -40.163 1.00 81.59  ?  24  ILE A O     1 
ATOM   154   C  CB    . ILE A 1 24  ? -38.328  57.926  -38.353 1.00 85.81  ?  24  ILE A CB    1 
ATOM   155   C  CG1   . ILE A 1 24  ? -38.520  59.406  -38.036 1.00 99.96  ?  24  ILE A CG1   1 
ATOM   156   C  CG2   . ILE A 1 24  ? -37.349  57.786  -39.492 1.00 81.48  ?  24  ILE A CG2   1 
ATOM   157   C  CD1   . ILE A 1 24  ? -37.246  60.233  -38.246 1.00 106.92 ?  24  ILE A CD1   1 
ATOM   158   N  N     . ILE A 1 25  ? -40.264  56.757  -41.026 1.00 66.93  ?  25  ILE A N     1 
ATOM   159   C  CA    . ILE A 1 25  ? -40.937  57.037  -42.300 1.00 65.82  ?  25  ILE A CA    1 
ATOM   160   C  C     . ILE A 1 25  ? -42.422  56.658  -42.302 1.00 68.83  ?  25  ILE A C     1 
ATOM   161   O  O     . ILE A 1 25  ? -43.291  57.474  -42.613 1.00 74.76  ?  25  ILE A O     1 
ATOM   162   C  CB    . ILE A 1 25  ? -40.285  56.290  -43.460 1.00 70.77  ?  25  ILE A CB    1 
ATOM   163   C  CG1   . ILE A 1 25  ? -38.901  56.858  -43.764 1.00 73.64  ?  25  ILE A CG1   1 
ATOM   164   C  CG2   . ILE A 1 25  ? -41.151  56.395  -44.692 1.00 71.38  ?  25  ILE A CG2   1 
ATOM   165   C  CD1   . ILE A 1 25  ? -38.023  55.904  -44.539 1.00 74.53  ?  25  ILE A CD1   1 
ATOM   166   N  N     . GLN A 1 26  ? -42.706  55.408  -41.960 1.00 66.93  ?  26  GLN A N     1 
ATOM   167   C  CA    . GLN A 1 26  ? -44.076  54.901  -41.951 1.00 73.41  ?  26  GLN A CA    1 
ATOM   168   C  C     . GLN A 1 26  ? -44.944  55.416  -40.810 1.00 80.96  ?  26  GLN A C     1 
ATOM   169   O  O     . GLN A 1 26  ? -46.173  55.446  -40.934 1.00 76.30  ?  26  GLN A O     1 
ATOM   170   C  CB    . GLN A 1 26  ? -44.060  53.382  -41.854 1.00 78.33  ?  26  GLN A CB    1 
ATOM   171   C  CG    . GLN A 1 26  ? -43.478  52.681  -43.050 1.00 81.51  ?  26  GLN A CG    1 
ATOM   172   C  CD    . GLN A 1 26  ? -43.526  51.189  -42.886 1.00 83.90  ?  26  GLN A CD    1 
ATOM   173   O  OE1   . GLN A 1 26  ? -43.205  50.662  -41.810 1.00 87.44  ?  26  GLN A OE1   1 
ATOM   174   N  NE2   . GLN A 1 26  ? -43.958  50.490  -43.937 1.00 82.43  ?  26  GLN A NE2   1 
ATOM   175   N  N     . ASP A 1 27  ? -44.312  55.796  -39.699 1.00 88.75  ?  27  ASP A N     1 
ATOM   176   C  CA    . ASP A 1 27  ? -45.036  55.939  -38.440 1.00 89.92  ?  27  ASP A CA    1 
ATOM   177   C  C     . ASP A 1 27  ? -44.697  57.169  -37.618 1.00 89.08  ?  27  ASP A C     1 
ATOM   178   O  O     . ASP A 1 27  ? -44.968  57.195  -36.426 1.00 93.41  ?  27  ASP A O     1 
ATOM   179   C  CB    . ASP A 1 27  ? -44.834  54.692  -37.573 1.00 100.14 ?  27  ASP A CB    1 
ATOM   180   C  CG    . ASP A 1 27  ? -45.798  53.568  -37.923 1.00 113.11 ?  27  ASP A CG    1 
ATOM   181   O  OD1   . ASP A 1 27  ? -46.967  53.856  -38.267 1.00 121.19 ?  27  ASP A OD1   1 
ATOM   182   O  OD2   . ASP A 1 27  ? -45.386  52.390  -37.849 1.00 114.70 ?  27  ASP A OD2   1 
ATOM   183   N  N     . ARG A 1 28  ? -44.127  58.197  -38.233 1.00 87.22  ?  28  ARG A N     1 
ATOM   184   C  CA    . ARG A 1 28  ? -43.808  59.403  -37.468 1.00 85.13  ?  28  ARG A CA    1 
ATOM   185   C  C     . ARG A 1 28  ? -43.966  60.702  -38.241 1.00 78.84  ?  28  ARG A C     1 
ATOM   186   O  O     . ARG A 1 28  ? -44.867  61.494  -37.975 1.00 71.93  ?  28  ARG A O     1 
ATOM   187   C  CB    . ARG A 1 28  ? -42.382  59.328  -36.929 1.00 81.63  ?  28  ARG A CB    1 
ATOM   188   C  CG    . ARG A 1 28  ? -42.064  60.401  -35.917 1.00 81.70  ?  28  ARG A CG    1 
ATOM   189   C  CD    . ARG A 1 28  ? -41.613  59.766  -34.607 1.00 86.05  ?  28  ARG A CD    1 
ATOM   190   N  NE    . ARG A 1 28  ? -40.161  59.786  -34.477 1.00 86.29  ?  28  ARG A NE    1 
ATOM   191   C  CZ    . ARG A 1 28  ? -39.480  59.107  -33.561 1.00 91.93  ?  28  ARG A CZ    1 
ATOM   192   N  NH1   . ARG A 1 28  ? -38.162  59.200  -33.521 1.00 103.06 ?  28  ARG A NH1   1 
ATOM   193   N  NH2   . ARG A 1 28  ? -40.107  58.328  -32.692 1.00 88.26  ?  28  ARG A NH2   1 
ATOM   194   N  N     . ALA A 1 29  ? -43.084  60.891  -39.215 1.00 80.70  ?  29  ALA A N     1 
ATOM   195   C  CA    . ALA A 1 29  ? -42.839  62.195  -39.813 1.00 78.50  ?  29  ALA A CA    1 
ATOM   196   C  C     . ALA A 1 29  ? -43.731  62.504  -40.996 1.00 79.02  ?  29  ALA A C     1 
ATOM   197   O  O     . ALA A 1 29  ? -43.914  63.673  -41.336 1.00 83.40  ?  29  ALA A O     1 
ATOM   198   C  CB    . ALA A 1 29  ? -41.398  62.284  -40.243 1.00 70.28  ?  29  ALA A CB    1 
ATOM   199   N  N     . LEU A 1 30  ? -44.268  61.461  -41.626 1.00 72.74  ?  30  LEU A N     1 
ATOM   200   C  CA    . LEU A 1 30  ? -44.952  61.619  -42.899 1.00 62.83  ?  30  LEU A CA    1 
ATOM   201   C  C     . LEU A 1 30  ? -46.415  61.251  -42.796 1.00 64.72  ?  30  LEU A C     1 
ATOM   202   O  O     . LEU A 1 30  ? -46.768  60.301  -42.104 1.00 71.93  ?  30  LEU A O     1 
ATOM   203   C  CB    . LEU A 1 30  ? -44.267  60.771  -43.959 1.00 54.94  ?  30  LEU A CB    1 
ATOM   204   C  CG    . LEU A 1 30  ? -42.766  61.107  -44.066 1.00 61.70  ?  30  LEU A CG    1 
ATOM   205   C  CD1   . LEU A 1 30  ? -41.942  60.093  -44.885 1.00 58.12  ?  30  LEU A CD1   1 
ATOM   206   C  CD2   . LEU A 1 30  ? -42.561  62.520  -44.589 1.00 56.65  ?  30  LEU A CD2   1 
ATOM   207   N  N     . PRO A 1 31  ? -47.278  62.008  -43.499 1.00 55.42  ?  31  PRO A N     1 
ATOM   208   C  CA    . PRO A 1 31  ? -48.743  61.842  -43.485 1.00 53.36  ?  31  PRO A CA    1 
ATOM   209   C  C     . PRO A 1 31  ? -49.220  60.691  -44.352 1.00 66.94  ?  31  PRO A C     1 
ATOM   210   O  O     . PRO A 1 31  ? -48.675  60.498  -45.447 1.00 75.36  ?  31  PRO A O     1 
ATOM   211   C  CB    . PRO A 1 31  ? -49.236  63.136  -44.126 1.00 56.44  ?  31  PRO A CB    1 
ATOM   212   C  CG    . PRO A 1 31  ? -48.088  63.562  -45.052 1.00 49.59  ?  31  PRO A CG    1 
ATOM   213   C  CD    . PRO A 1 31  ? -46.844  63.153  -44.336 1.00 57.49  ?  31  PRO A CD    1 
ATOM   214   N  N     . ASP A 1 32  ? -50.221  59.946  -43.882 1.00 65.38  ?  32  ASP A N     1 
ATOM   215   C  CA    . ASP A 1 32  ? -50.939  59.012  -44.746 1.00 62.53  ?  32  ASP A CA    1 
ATOM   216   C  C     . ASP A 1 32  ? -51.562  59.845  -45.866 1.00 70.14  ?  32  ASP A C     1 
ATOM   217   O  O     . ASP A 1 32  ? -52.145  60.905  -45.610 1.00 67.11  ?  32  ASP A O     1 
ATOM   218   C  CB    . ASP A 1 32  ? -52.025  58.259  -43.969 1.00 61.62  ?  32  ASP A CB    1 
ATOM   219   C  CG    . ASP A 1 32  ? -52.890  57.360  -44.867 1.00 78.96  ?  32  ASP A CG    1 
ATOM   220   O  OD1   . ASP A 1 32  ? -52.680  56.127  -44.874 1.00 84.72  ?  32  ASP A OD1   1 
ATOM   221   O  OD2   . ASP A 1 32  ? -53.792  57.886  -45.562 1.00 86.77  ?  32  ASP A OD2   1 
ATOM   222   N  N     . ILE A 1 33  ? -51.432  59.377  -47.104 1.00 71.44  ?  33  ILE A N     1 
ATOM   223   C  CA    . ILE A 1 33  ? -51.888  60.148  -48.256 1.00 63.86  ?  33  ILE A CA    1 
ATOM   224   C  C     . ILE A 1 33  ? -53.406  60.387  -48.280 1.00 59.43  ?  33  ILE A C     1 
ATOM   225   O  O     . ILE A 1 33  ? -53.869  61.305  -48.945 1.00 63.80  ?  33  ILE A O     1 
ATOM   226   C  CB    . ILE A 1 33  ? -51.440  59.495  -49.574 1.00 66.09  ?  33  ILE A CB    1 
ATOM   227   C  CG1   . ILE A 1 33  ? -51.693  60.437  -50.747 1.00 67.22  ?  33  ILE A CG1   1 
ATOM   228   C  CG2   . ILE A 1 33  ? -52.164  58.189  -49.781 1.00 68.76  ?  33  ILE A CG2   1 
ATOM   229   C  CD1   . ILE A 1 33  ? -51.130  59.938  -52.056 1.00 65.63  ?  33  ILE A CD1   1 
ATOM   230   N  N     . ARG A 1 34  ? -54.176  59.593  -47.542 1.00 51.71  ?  34  ARG A N     1 
ATOM   231   C  CA    . ARG A 1 34  ? -55.632  59.717  -47.593 1.00 53.80  ?  34  ARG A CA    1 
ATOM   232   C  C     . ARG A 1 34  ? -56.302  60.615  -46.542 1.00 65.51  ?  34  ARG A C     1 
ATOM   233   O  O     . ARG A 1 34  ? -57.249  61.327  -46.872 1.00 74.08  ?  34  ARG A O     1 
ATOM   234   C  CB    . ARG A 1 34  ? -56.270  58.348  -47.535 1.00 53.26  ?  34  ARG A CB    1 
ATOM   235   C  CG    . ARG A 1 34  ? -55.402  57.270  -48.078 1.00 53.92  ?  34  ARG A CG    1 
ATOM   236   C  CD    . ARG A 1 34  ? -55.966  55.946  -47.666 1.00 51.14  ?  34  ARG A CD    1 
ATOM   237   N  NE    . ARG A 1 34  ? -55.153  55.325  -46.635 1.00 53.46  ?  34  ARG A NE    1 
ATOM   238   C  CZ    . ARG A 1 34  ? -55.368  54.090  -46.207 1.00 58.49  ?  34  ARG A CZ    1 
ATOM   239   N  NH1   . ARG A 1 34  ? -56.365  53.402  -46.766 1.00 56.28  ?  34  ARG A NH1   1 
ATOM   240   N  NH2   . ARG A 1 34  ? -54.610  53.553  -45.236 1.00 54.53  ?  34  ARG A NH2   1 
ATOM   241   N  N     . ASP A 1 35  ? -55.854  60.575  -45.287 1.00 64.45  ?  35  ASP A N     1 
ATOM   242   C  CA    . ASP A 1 35  ? -56.457  61.451  -44.265 1.00 62.55  ?  35  ASP A CA    1 
ATOM   243   C  C     . ASP A 1 35  ? -55.551  62.599  -43.821 1.00 64.54  ?  35  ASP A C     1 
ATOM   244   O  O     . ASP A 1 35  ? -55.936  63.412  -42.986 1.00 66.56  ?  35  ASP A O     1 
ATOM   245   C  CB    . ASP A 1 35  ? -56.986  60.662  -43.052 1.00 65.62  ?  35  ASP A CB    1 
ATOM   246   C  CG    . ASP A 1 35  ? -55.869  60.132  -42.151 1.00 72.27  ?  35  ASP A CG    1 
ATOM   247   O  OD1   . ASP A 1 35  ? -54.714  60.600  -42.324 1.00 76.51  ?  35  ASP A OD1   1 
ATOM   248   O  OD2   . ASP A 1 35  ? -56.152  59.257  -41.273 1.00 67.48  ?  35  ASP A OD2   1 
ATOM   249   N  N     . GLY A 1 36  ? -54.350  62.657  -44.381 1.00 63.97  ?  36  GLY A N     1 
ATOM   250   C  CA    . GLY A 1 36  ? -53.454  63.785  -44.175 1.00 61.95  ?  36  GLY A CA    1 
ATOM   251   C  C     . GLY A 1 36  ? -52.732  63.832  -42.842 1.00 66.61  ?  36  GLY A C     1 
ATOM   252   O  O     . GLY A 1 36  ? -51.995  64.782  -42.553 1.00 74.77  ?  36  GLY A O     1 
ATOM   253   N  N     . LEU A 1 37  ? -52.916  62.793  -42.036 1.00 64.40  ?  37  LEU A N     1 
ATOM   254   C  CA    . LEU A 1 37  ? -52.428  62.799  -40.661 1.00 59.22  ?  37  LEU A CA    1 
ATOM   255   C  C     . LEU A 1 37  ? -51.159  61.987  -40.467 1.00 68.24  ?  37  LEU A C     1 
ATOM   256   O  O     . LEU A 1 37  ? -50.985  60.926  -41.083 1.00 74.02  ?  37  LEU A O     1 
ATOM   257   C  CB    . LEU A 1 37  ? -53.522  62.277  -39.737 1.00 53.46  ?  37  LEU A CB    1 
ATOM   258   C  CG    . LEU A 1 37  ? -54.796  63.129  -39.890 1.00 56.16  ?  37  LEU A CG    1 
ATOM   259   C  CD1   . LEU A 1 37  ? -55.997  62.529  -39.144 1.00 42.06  ?  37  LEU A CD1   1 
ATOM   260   C  CD2   . LEU A 1 37  ? -54.535  64.607  -39.476 1.00 42.53  ?  37  LEU A CD2   1 
ATOM   261   N  N     . LYS A 1 38  ? -50.259  62.504  -39.627 1.00 68.37  ?  38  LYS A N     1 
ATOM   262   C  CA    . LYS A 1 38  ? -49.172  61.686  -39.100 1.00 62.88  ?  38  LYS A CA    1 
ATOM   263   C  C     . LYS A 1 38  ? -49.737  60.996  -37.874 1.00 69.28  ?  38  LYS A C     1 
ATOM   264   O  O     . LYS A 1 38  ? -50.650  61.534  -37.230 1.00 74.90  ?  38  LYS A O     1 
ATOM   265   C  CB    . LYS A 1 38  ? -47.956  62.515  -38.704 1.00 53.65  ?  38  LYS A CB    1 
ATOM   266   C  CG    . LYS A 1 38  ? -47.836  63.865  -39.356 1.00 53.13  ?  38  LYS A CG    1 
ATOM   267   C  CD    . LYS A 1 38  ? -46.408  64.361  -39.255 1.00 60.18  ?  38  LYS A CD    1 
ATOM   268   C  CE    . LYS A 1 38  ? -46.334  65.862  -39.466 1.00 66.32  ?  38  LYS A CE    1 
ATOM   269   N  NZ    . LYS A 1 38  ? -44.949  66.371  -39.301 1.00 68.70  ?  38  LYS A NZ    1 
ATOM   270   N  N     . PRO A 1 39  ? -49.194  59.818  -37.528 1.00 65.57  ?  39  PRO A N     1 
ATOM   271   C  CA    . PRO A 1 39  ? -49.825  59.001  -36.475 1.00 65.05  ?  39  PRO A CA    1 
ATOM   272   C  C     . PRO A 1 39  ? -50.115  59.789  -35.176 1.00 69.65  ?  39  PRO A C     1 
ATOM   273   O  O     . PRO A 1 39  ? -51.175  59.572  -34.590 1.00 67.30  ?  39  PRO A O     1 
ATOM   274   C  CB    . PRO A 1 39  ? -48.804  57.877  -36.215 1.00 62.70  ?  39  PRO A CB    1 
ATOM   275   C  CG    . PRO A 1 39  ? -47.777  58.001  -37.280 1.00 63.35  ?  39  PRO A CG    1 
ATOM   276   C  CD    . PRO A 1 39  ? -47.806  59.419  -37.779 1.00 63.05  ?  39  PRO A CD    1 
ATOM   277   N  N     . VAL A 1 40  ? -49.220  60.683  -34.742 1.00 72.94  ?  40  VAL A N     1 
ATOM   278   C  CA    . VAL A 1 40  ? -49.493  61.448  -33.526 1.00 68.69  ?  40  VAL A CA    1 
ATOM   279   C  C     . VAL A 1 40  ? -50.781  62.269  -33.641 1.00 61.05  ?  40  VAL A C     1 
ATOM   280   O  O     . VAL A 1 40  ? -51.680  62.141  -32.782 1.00 59.84  ?  40  VAL A O     1 
ATOM   281   C  CB    . VAL A 1 40  ? -48.324  62.350  -33.083 1.00 66.19  ?  40  VAL A CB    1 
ATOM   282   C  CG1   . VAL A 1 40  ? -48.310  63.641  -33.880 1.00 65.13  ?  40  VAL A CG1   1 
ATOM   283   C  CG2   . VAL A 1 40  ? -48.456  62.648  -31.592 1.00 51.49  ?  40  VAL A CG2   1 
ATOM   284   N  N     . GLN A 1 41  ? -50.893  63.088  -34.694 1.00 52.73  ?  41  GLN A N     1 
ATOM   285   C  CA    . GLN A 1 41  ? -52.157  63.796  -34.935 1.00 50.88  ?  41  GLN A CA    1 
ATOM   286   C  C     . GLN A 1 41  ? -53.395  62.866  -34.927 1.00 50.29  ?  41  GLN A C     1 
ATOM   287   O  O     . GLN A 1 41  ? -54.380  63.147  -34.237 1.00 48.25  ?  41  GLN A O     1 
ATOM   288   C  CB    . GLN A 1 41  ? -52.112  64.622  -36.219 1.00 46.09  ?  41  GLN A CB    1 
ATOM   289   C  CG    . GLN A 1 41  ? -50.975  65.617  -36.290 1.00 54.04  ?  41  GLN A CG    1 
ATOM   290   C  CD    . GLN A 1 41  ? -50.608  65.973  -37.721 1.00 70.02  ?  41  GLN A CD    1 
ATOM   291   O  OE1   . GLN A 1 41  ? -50.661  65.131  -38.626 1.00 75.87  ?  41  GLN A OE1   1 
ATOM   292   N  NE2   . GLN A 1 41  ? -50.242  67.228  -37.935 1.00 77.59  ?  41  GLN A NE2   1 
ATOM   293   N  N     . ARG A 1 42  ? -53.344  61.764  -35.676 1.00 49.99  ?  42  ARG A N     1 
ATOM   294   C  CA    . ARG A 1 42  ? -54.456  60.802  -35.678 1.00 55.58  ?  42  ARG A CA    1 
ATOM   295   C  C     . ARG A 1 42  ? -54.809  60.331  -34.265 1.00 60.39  ?  42  ARG A C     1 
ATOM   296   O  O     . ARG A 1 42  ? -55.976  60.348  -33.858 1.00 57.95  ?  42  ARG A O     1 
ATOM   297   C  CB    . ARG A 1 42  ? -54.156  59.594  -36.577 1.00 60.53  ?  42  ARG A CB    1 
ATOM   298   C  CG    . ARG A 1 42  ? -55.380  58.703  -36.873 1.00 61.70  ?  42  ARG A CG    1 
ATOM   299   C  CD    . ARG A 1 42  ? -55.090  57.621  -37.945 1.00 61.40  ?  42  ARG A CD    1 
ATOM   300   N  NE    . ARG A 1 42  ? -54.550  58.204  -39.173 1.00 63.28  ?  42  ARG A NE    1 
ATOM   301   C  CZ    . ARG A 1 42  ? -53.259  58.195  -39.483 1.00 74.41  ?  42  ARG A CZ    1 
ATOM   302   N  NH1   . ARG A 1 42  ? -52.390  57.605  -38.673 1.00 81.76  ?  42  ARG A NH1   1 
ATOM   303   N  NH2   . ARG A 1 42  ? -52.835  58.765  -40.599 1.00 77.51  ?  42  ARG A NH2   1 
ATOM   304   N  N     . ARG A 1 43  ? -53.799  59.906  -33.517 1.00 61.20  ?  43  ARG A N     1 
ATOM   305   C  CA    . ARG A 1 43  ? -54.021  59.459  -32.153 1.00 57.12  ?  43  ARG A CA    1 
ATOM   306   C  C     . ARG A 1 43  ? -54.683  60.550  -31.345 1.00 64.85  ?  43  ARG A C     1 
ATOM   307   O  O     . ARG A 1 43  ? -55.664  60.301  -30.642 1.00 77.25  ?  43  ARG A O     1 
ATOM   308   C  CB    . ARG A 1 43  ? -52.708  59.064  -31.509 1.00 52.99  ?  43  ARG A CB    1 
ATOM   309   C  CG    . ARG A 1 43  ? -52.447  57.605  -31.620 1.00 60.12  ?  43  ARG A CG    1 
ATOM   310   C  CD    . ARG A 1 43  ? -51.033  57.348  -32.048 1.00 65.30  ?  43  ARG A CD    1 
ATOM   311   N  NE    . ARG A 1 43  ? -50.824  55.926  -32.272 1.00 63.54  ?  43  ARG A NE    1 
ATOM   312   C  CZ    . ARG A 1 43  ? -49.626  55.384  -32.395 1.00 67.15  ?  43  ARG A CZ    1 
ATOM   313   N  NH1   . ARG A 1 43  ? -48.551  56.162  -32.310 1.00 65.41  ?  43  ARG A NH1   1 
ATOM   314   N  NH2   . ARG A 1 43  ? -49.508  54.077  -32.592 1.00 74.04  ?  43  ARG A NH2   1 
ATOM   315   N  N     . ILE A 1 44  ? -54.147  61.762  -31.446 1.00 55.79  ?  44  ILE A N     1 
ATOM   316   C  CA    . ILE A 1 44  ? -54.778  62.901  -30.796 1.00 58.15  ?  44  ILE A CA    1 
ATOM   317   C  C     . ILE A 1 44  ? -56.286  63.020  -31.107 1.00 60.79  ?  44  ILE A C     1 
ATOM   318   O  O     . ILE A 1 44  ? -57.105  63.062  -30.189 1.00 57.84  ?  44  ILE A O     1 
ATOM   319   C  CB    . ILE A 1 44  ? -54.071  64.201  -31.146 1.00 58.33  ?  44  ILE A CB    1 
ATOM   320   C  CG1   . ILE A 1 44  ? -52.699  64.238  -30.475 1.00 59.30  ?  44  ILE A CG1   1 
ATOM   321   C  CG2   . ILE A 1 44  ? -54.919  65.388  -30.712 1.00 57.30  ?  44  ILE A CG2   1 
ATOM   322   C  CD1   . ILE A 1 44  ? -51.892  65.477  -30.789 1.00 58.90  ?  44  ILE A CD1   1 
ATOM   323   N  N     . LEU A 1 45  ? -56.663  63.060  -32.386 1.00 57.44  ?  45  LEU A N     1 
ATOM   324   C  CA    . LEU A 1 45  ? -58.082  63.182  -32.719 1.00 58.02  ?  45  LEU A CA    1 
ATOM   325   C  C     . LEU A 1 45  ? -58.934  61.974  -32.299 1.00 62.45  ?  45  LEU A C     1 
ATOM   326   O  O     . LEU A 1 45  ? -60.074  62.135  -31.846 1.00 71.66  ?  45  LEU A O     1 
ATOM   327   C  CB    . LEU A 1 45  ? -58.295  63.458  -34.201 1.00 52.65  ?  45  LEU A CB    1 
ATOM   328   C  CG    . LEU A 1 45  ? -57.560  64.621  -34.839 1.00 59.32  ?  45  LEU A CG    1 
ATOM   329   C  CD1   . LEU A 1 45  ? -57.957  64.682  -36.303 1.00 68.48  ?  45  LEU A CD1   1 
ATOM   330   C  CD2   . LEU A 1 45  ? -57.877  65.919  -34.152 1.00 57.85  ?  45  LEU A CD2   1 
ATOM   331   N  N     . TYR A 1 46  ? -58.405  60.767  -32.470 1.00 52.34  ?  46  TYR A N     1 
ATOM   332   C  CA    . TYR A 1 46  ? -59.198  59.587  -32.158 1.00 55.25  ?  46  TYR A CA    1 
ATOM   333   C  C     . TYR A 1 46  ? -59.435  59.505  -30.644 1.00 63.28  ?  46  TYR A C     1 
ATOM   334   O  O     . TYR A 1 46  ? -60.521  59.133  -30.187 1.00 62.82  ?  46  TYR A O     1 
ATOM   335   C  CB    . TYR A 1 46  ? -58.518  58.326  -32.670 1.00 44.28  ?  46  TYR A CB    1 
ATOM   336   C  CG    . TYR A 1 46  ? -59.166  57.076  -32.156 1.00 54.20  ?  46  TYR A CG    1 
ATOM   337   C  CD1   . TYR A 1 46  ? -58.571  56.335  -31.133 1.00 55.71  ?  46  TYR A CD1   1 
ATOM   338   C  CD2   . TYR A 1 46  ? -60.399  56.649  -32.647 1.00 45.50  ?  46  TYR A CD2   1 
ATOM   339   C  CE1   . TYR A 1 46  ? -59.180  55.190  -30.628 1.00 67.39  ?  46  TYR A CE1   1 
ATOM   340   C  CE2   . TYR A 1 46  ? -61.021  55.491  -32.147 1.00 58.84  ?  46  TYR A CE2   1 
ATOM   341   C  CZ    . TYR A 1 46  ? -60.407  54.769  -31.144 1.00 68.27  ?  46  TYR A CZ    1 
ATOM   342   O  OH    . TYR A 1 46  ? -61.013  53.636  -30.630 1.00 72.08  ?  46  TYR A OH    1 
ATOM   343   N  N     . SER A 1 47  ? -58.416  59.873  -29.870 1.00 63.70  ?  47  SER A N     1 
ATOM   344   C  CA    . SER A 1 47  ? -58.521  59.830  -28.427 1.00 67.34  ?  47  SER A CA    1 
ATOM   345   C  C     . SER A 1 47  ? -59.558  60.846  -27.954 1.00 65.92  ?  47  SER A C     1 
ATOM   346   O  O     . SER A 1 47  ? -60.524  60.489  -27.260 1.00 69.37  ?  47  SER A O     1 
ATOM   347   C  CB    . SER A 1 47  ? -57.155  60.061  -27.755 1.00 70.71  ?  47  SER A CB    1 
ATOM   348   O  OG    . SER A 1 47  ? -57.260  60.039  -26.330 1.00 69.59  ?  47  SER A OG    1 
ATOM   349   N  N     . MET A 1 48  ? -59.373  62.108  -28.331 1.00 59.26  ?  48  MET A N     1 
ATOM   350   C  CA    . MET A 1 48  ? -60.287  63.144  -27.865 1.00 60.77  ?  48  MET A CA    1 
ATOM   351   C  C     . MET A 1 48  ? -61.730  62.781  -28.239 1.00 62.78  ?  48  MET A C     1 
ATOM   352   O  O     . MET A 1 48  ? -62.692  63.011  -27.482 1.00 58.50  ?  48  MET A O     1 
ATOM   353   C  CB    . MET A 1 48  ? -59.886  64.511  -28.408 1.00 45.47  ?  48  MET A CB    1 
ATOM   354   C  CG    . MET A 1 48  ? -58.570  65.010  -27.837 1.00 47.45  ?  48  MET A CG    1 
ATOM   355   S  SD    . MET A 1 48  ? -58.099  66.718  -28.255 1.00 64.77  ?  48  MET A SD    1 
ATOM   356   C  CE    . MET A 1 48  ? -59.702  67.516  -28.288 1.00 183.15 ?  48  MET A CE    1 
ATOM   357   N  N     . ASN A 1 49  ? -61.873  62.181  -29.407 1.00 63.12  ?  49  ASN A N     1 
ATOM   358   C  CA    . ASN A 1 49  ? -63.180  61.792  -29.854 1.00 59.83  ?  49  ASN A CA    1 
ATOM   359   C  C     . ASN A 1 49  ? -63.769  60.663  -29.007 1.00 57.57  ?  49  ASN A C     1 
ATOM   360   O  O     . ASN A 1 49  ? -64.954  60.680  -28.668 1.00 52.31  ?  49  ASN A O     1 
ATOM   361   C  CB    . ASN A 1 49  ? -63.118  61.392  -31.312 1.00 61.04  ?  49  ASN A CB    1 
ATOM   362   C  CG    . ASN A 1 49  ? -64.482  61.262  -31.909 1.00 64.43  ?  49  ASN A CG    1 
ATOM   363   O  OD1   . ASN A 1 49  ? -64.952  60.152  -32.163 1.00 75.57  ?  49  ASN A OD1   1 
ATOM   364   N  ND2   . ASN A 1 49  ? -65.160  62.398  -32.090 1.00 51.14  ?  49  ASN A ND2   1 
ATOM   365   N  N     . LYS A 1 50  ? -62.948  59.674  -28.668 1.00 61.55  ?  50  LYS A N     1 
ATOM   366   C  CA    . LYS A 1 50  ? -63.431  58.533  -27.888 1.00 59.77  ?  50  LYS A CA    1 
ATOM   367   C  C     . LYS A 1 50  ? -63.916  59.084  -26.566 1.00 67.32  ?  50  LYS A C     1 
ATOM   368   O  O     . LYS A 1 50  ? -64.823  58.531  -25.935 1.00 76.65  ?  50  LYS A O     1 
ATOM   369   C  CB    . LYS A 1 50  ? -62.305  57.502  -27.664 1.00 57.02  ?  50  LYS A CB    1 
ATOM   370   C  CG    . LYS A 1 50  ? -62.771  56.042  -27.500 1.00 60.48  ?  50  LYS A CG    1 
ATOM   371   C  CD    . LYS A 1 50  ? -61.767  55.220  -26.665 1.00 65.15  ?  50  LYS A CD    1 
ATOM   372   N  N     . ASP A 1 51  ? -63.296  60.196  -26.169 1.00 66.46  ?  51  ASP A N     1 
ATOM   373   C  CA    . ASP A 1 51  ? -63.532  60.827  -24.879 1.00 70.79  ?  51  ASP A CA    1 
ATOM   374   C  C     . ASP A 1 51  ? -64.691  61.839  -24.889 1.00 68.85  ?  51  ASP A C     1 
ATOM   375   O  O     . ASP A 1 51  ? -65.024  62.435  -23.866 1.00 79.42  ?  51  ASP A O     1 
ATOM   376   C  CB    . ASP A 1 51  ? -62.236  61.482  -24.374 1.00 80.85  ?  51  ASP A CB    1 
ATOM   377   C  CG    . ASP A 1 51  ? -61.245  60.466  -23.793 1.00 95.97  ?  51  ASP A CG    1 
ATOM   378   O  OD1   . ASP A 1 51  ? -61.674  59.330  -23.455 1.00 102.93 ?  51  ASP A OD1   1 
ATOM   379   O  OD2   . ASP A 1 51  ? -60.045  60.817  -23.652 1.00 99.35  ?  51  ASP A OD2   1 
ATOM   380   N  N     . SER A 1 52  ? -65.302  62.038  -26.044 1.00 60.93  ?  52  SER A N     1 
ATOM   381   C  CA    . SER A 1 52  ? -66.440  62.937  -26.153 1.00 59.79  ?  52  SER A CA    1 
ATOM   382   C  C     . SER A 1 52  ? -66.053  64.399  -25.969 1.00 64.76  ?  52  SER A C     1 
ATOM   383   O  O     . SER A 1 52  ? -66.895  65.241  -25.637 1.00 77.01  ?  52  SER A O     1 
ATOM   384   C  CB    . SER A 1 52  ? -67.507  62.547  -25.155 1.00 62.73  ?  52  SER A CB    1 
ATOM   385   O  OG    . SER A 1 52  ? -68.053  61.282  -25.485 1.00 67.03  ?  52  SER A OG    1 
ATOM   386   N  N     . ASN A 1 53  ? -64.778  64.691  -26.211 1.00 55.61  ?  53  ASN A N     1 
ATOM   387   C  CA    . ASN A 1 53  ? -64.247  66.036  -26.075 1.00 60.82  ?  53  ASN A CA    1 
ATOM   388   C  C     . ASN A 1 53  ? -64.431  66.725  -27.435 1.00 70.26  ?  53  ASN A C     1 
ATOM   389   O  O     . ASN A 1 53  ? -63.484  66.934  -28.223 1.00 70.82  ?  53  ASN A O     1 
ATOM   390   C  CB    . ASN A 1 53  ? -62.775  65.947  -25.640 1.00 61.99  ?  53  ASN A CB    1 
ATOM   391   C  CG    . ASN A 1 53  ? -62.190  67.283  -25.220 1.00 67.66  ?  53  ASN A CG    1 
ATOM   392   O  OD1   . ASN A 1 53  ? -62.857  68.321  -25.276 1.00 71.36  ?  53  ASN A OD1   1 
ATOM   393   N  ND2   . ASN A 1 53  ? -60.928  67.262  -24.785 1.00 66.86  ?  53  ASN A ND2   1 
ATOM   394   N  N     . THR A 1 54  ? -65.677  67.068  -27.719 1.00 72.84  ?  54  THR A N     1 
ATOM   395   C  CA    . THR A 1 54  ? -66.034  67.483  -29.068 1.00 71.79  ?  54  THR A CA    1 
ATOM   396   C  C     . THR A 1 54  ? -66.547  68.921  -29.119 1.00 76.49  ?  54  THR A C     1 
ATOM   397   O  O     . THR A 1 54  ? -66.802  69.534  -28.082 1.00 85.16  ?  54  THR A O     1 
ATOM   398   C  CB    . THR A 1 54  ? -66.992  66.468  -29.709 1.00 70.82  ?  54  THR A CB    1 
ATOM   399   O  OG1   . THR A 1 54  ? -68.191  66.336  -28.929 1.00 73.28  ?  54  THR A OG1   1 
ATOM   400   C  CG2   . THR A 1 54  ? -66.315  65.111  -29.750 1.00 70.47  ?  54  THR A CG2   1 
ATOM   401   N  N     . PHE A 1 55  ? -66.665  69.464  -30.322 1.00 71.92  ?  55  PHE A N     1 
ATOM   402   C  CA    . PHE A 1 55  ? -66.899  70.898  -30.495 1.00 69.23  ?  55  PHE A CA    1 
ATOM   403   C  C     . PHE A 1 55  ? -68.141  71.386  -29.741 1.00 67.28  ?  55  PHE A C     1 
ATOM   404   O  O     . PHE A 1 55  ? -68.296  72.579  -29.493 1.00 76.09  ?  55  PHE A O     1 
ATOM   405   C  CB    . PHE A 1 55  ? -67.042  71.234  -31.986 1.00 67.90  ?  55  PHE A CB    1 
ATOM   406   C  CG    . PHE A 1 55  ? -68.411  70.973  -32.513 1.00 63.50  ?  55  PHE A CG    1 
ATOM   407   C  CD1   . PHE A 1 55  ? -68.840  69.679  -32.736 1.00 68.10  ?  55  PHE A CD1   1 
ATOM   408   C  CD2   . PHE A 1 55  ? -69.293  72.016  -32.730 1.00 57.28  ?  55  PHE A CD2   1 
ATOM   409   C  CE1   . PHE A 1 55  ? -70.112  69.432  -33.181 1.00 66.25  ?  55  PHE A CE1   1 
ATOM   410   C  CE2   . PHE A 1 55  ? -70.565  71.777  -33.188 1.00 56.77  ?  55  PHE A CE2   1 
ATOM   411   C  CZ    . PHE A 1 55  ? -70.975  70.482  -33.414 1.00 61.87  ?  55  PHE A CZ    1 
ATOM   412   N  N     . ASP A 1 56  ? -69.013  70.453  -29.371 1.00 58.86  ?  56  ASP A N     1 
ATOM   413   C  CA    . ASP A 1 56  ? -70.336  70.775  -28.829 1.00 65.94  ?  56  ASP A CA    1 
ATOM   414   C  C     . ASP A 1 56  ? -70.432  70.607  -27.305 1.00 69.64  ?  56  ASP A C     1 
ATOM   415   O  O     . ASP A 1 56  ? -71.519  70.621  -26.721 1.00 78.51  ?  56  ASP A O     1 
ATOM   416   C  CB    . ASP A 1 56  ? -71.384  69.879  -29.498 1.00 76.36  ?  56  ASP A CB    1 
ATOM   417   C  CG    . ASP A 1 56  ? -71.050  68.392  -29.368 1.00 86.30  ?  56  ASP A CG    1 
ATOM   418   O  OD1   . ASP A 1 56  ? -69.873  68.019  -29.572 1.00 86.80  ?  56  ASP A OD1   1 
ATOM   419   O  OD2   . ASP A 1 56  ? -71.959  67.594  -29.051 1.00 93.03  ?  56  ASP A OD2   1 
ATOM   420   N  N     . LYS A 1 57  ? -69.289  70.436  -26.667 1.00 66.89  ?  57  LYS A N     1 
ATOM   421   C  CA    . LYS A 1 57  ? -69.255  70.044  -25.278 1.00 67.07  ?  57  LYS A CA    1 
ATOM   422   C  C     . LYS A 1 57  ? -68.142  70.823  -24.572 1.00 75.75  ?  57  LYS A C     1 
ATOM   423   O  O     . LYS A 1 57  ? -67.182  71.250  -25.214 1.00 82.35  ?  57  LYS A O     1 
ATOM   424   C  CB    . LYS A 1 57  ? -69.008  68.537  -25.194 1.00 63.99  ?  57  LYS A CB    1 
ATOM   425   C  CG    . LYS A 1 57  ? -70.025  67.681  -25.925 1.00 59.18  ?  57  LYS A CG    1 
ATOM   426   C  CD    . LYS A 1 57  ? -70.477  66.486  -25.073 1.00 71.85  ?  57  LYS A CD    1 
ATOM   427   C  CE    . LYS A 1 57  ? -71.524  65.608  -25.779 1.00 80.68  ?  57  LYS A CE    1 
ATOM   428   N  NZ    . LYS A 1 57  ? -70.986  64.868  -26.972 1.00 82.42  ?  57  LYS A NZ    1 
ATOM   429   N  N     . SER A 1 58  ? -68.263  71.000  -23.259 1.00 78.86  ?  58  SER A N     1 
ATOM   430   C  CA    . SER A 1 58  ? -67.311  71.821  -22.509 1.00 81.25  ?  58  SER A CA    1 
ATOM   431   C  C     . SER A 1 58  ? -65.879  71.483  -22.876 1.00 81.82  ?  58  SER A C     1 
ATOM   432   O  O     . SER A 1 58  ? -65.584  70.340  -23.212 1.00 88.24  ?  58  SER A O     1 
ATOM   433   C  CB    . SER A 1 58  ? -67.516  71.608  -21.023 1.00 92.02  ?  58  SER A CB    1 
ATOM   434   O  OG    . SER A 1 58  ? -68.863  71.246  -20.775 1.00 103.45 ?  58  SER A OG    1 
ATOM   435   N  N     . TYR A 1 59  ? -64.990  72.470  -22.830 1.00 79.20  ?  59  TYR A N     1 
ATOM   436   C  CA    . TYR A 1 59  ? -63.571  72.202  -23.071 1.00 75.77  ?  59  TYR A CA    1 
ATOM   437   C  C     . TYR A 1 59  ? -63.026  71.319  -21.939 1.00 79.96  ?  59  TYR A C     1 
ATOM   438   O  O     . TYR A 1 59  ? -63.545  71.365  -20.818 1.00 93.05  ?  59  TYR A O     1 
ATOM   439   C  CB    . TYR A 1 59  ? -62.770  73.506  -23.134 1.00 78.11  ?  59  TYR A CB    1 
ATOM   440   C  CG    . TYR A 1 59  ? -63.035  74.409  -24.335 1.00 80.69  ?  59  TYR A CG    1 
ATOM   441   C  CD1   . TYR A 1 59  ? -63.976  75.429  -24.266 1.00 86.12  ?  59  TYR A CD1   1 
ATOM   442   C  CD2   . TYR A 1 59  ? -62.305  74.277  -25.512 1.00 77.30  ?  59  TYR A CD2   1 
ATOM   443   C  CE1   . TYR A 1 59  ? -64.209  76.276  -25.343 1.00 86.30  ?  59  TYR A CE1   1 
ATOM   444   C  CE2   . TYR A 1 59  ? -62.530  75.116  -26.596 1.00 80.19  ?  59  TYR A CE2   1 
ATOM   445   C  CZ    . TYR A 1 59  ? -63.489  76.118  -26.508 1.00 83.50  ?  59  TYR A CZ    1 
ATOM   446   O  OH    . TYR A 1 59  ? -63.731  76.962  -27.583 1.00 82.64  ?  59  TYR A OH    1 
ATOM   447   N  N     . ARG A 1 60  ? -62.002  70.512  -22.228 1.00 72.33  ?  60  ARG A N     1 
ATOM   448   C  CA    . ARG A 1 60  ? -61.297  69.732  -21.195 1.00 71.93  ?  60  ARG A CA    1 
ATOM   449   C  C     . ARG A 1 60  ? -59.919  70.329  -20.902 1.00 75.28  ?  60  ARG A C     1 
ATOM   450   O  O     . ARG A 1 60  ? -59.332  70.997  -21.756 1.00 78.58  ?  60  ARG A O     1 
ATOM   451   C  CB    . ARG A 1 60  ? -61.124  68.260  -21.606 1.00 67.56  ?  60  ARG A CB    1 
ATOM   452   C  CG    . ARG A 1 60  ? -62.338  67.370  -21.392 1.00 81.51  ?  60  ARG A CG    1 
ATOM   453   C  CD    . ARG A 1 60  ? -61.999  65.871  -21.573 1.00 94.09  ?  60  ARG A CD    1 
ATOM   454   N  NE    . ARG A 1 60  ? -63.121  65.106  -22.128 1.00 103.00 ?  60  ARG A NE    1 
ATOM   455   C  CZ    . ARG A 1 60  ? -64.406  65.345  -21.860 1.00 109.02 ?  60  ARG A CZ    1 
ATOM   456   N  NH1   . ARG A 1 60  ? -64.749  66.316  -21.017 1.00 111.04 ?  60  ARG A NH1   1 
ATOM   457   N  NH2   . ARG A 1 60  ? -65.355  64.606  -22.426 1.00 108.75 ?  60  ARG A NH2   1 
ATOM   458   N  N     . LYS A 1 61  ? -59.384  70.090  -19.707 1.00 74.52  ?  61  LYS A N     1 
ATOM   459   C  CA    . LYS A 1 61  ? -58.003  70.515  -19.465 1.00 76.04  ?  61  LYS A CA    1 
ATOM   460   C  C     . LYS A 1 61  ? -57.074  69.726  -20.401 1.00 64.59  ?  61  LYS A C     1 
ATOM   461   O  O     . LYS A 1 61  ? -57.157  68.492  -20.506 1.00 58.12  ?  61  LYS A O     1 
ATOM   462   C  CB    . LYS A 1 61  ? -57.585  70.413  -17.974 1.00 57.44  ?  61  LYS A CB    1 
ATOM   463   N  N     . SER A 1 62  ? -56.216  70.441  -21.113 1.00 58.95  ?  62  SER A N     1 
ATOM   464   C  CA    . SER A 1 62  ? -55.295  69.777  -22.032 1.00 62.03  ?  62  SER A CA    1 
ATOM   465   C  C     . SER A 1 62  ? -54.564  68.606  -21.372 1.00 65.88  ?  62  SER A C     1 
ATOM   466   O  O     . SER A 1 62  ? -54.393  67.550  -21.985 1.00 66.67  ?  62  SER A O     1 
ATOM   467   C  CB    . SER A 1 62  ? -54.283  70.773  -22.602 1.00 50.85  ?  62  SER A CB    1 
ATOM   468   O  OG    . SER A 1 62  ? -54.946  71.777  -23.352 1.00 79.99  ?  62  SER A OG    1 
ATOM   469   N  N     . ALA A 1 63  ? -54.133  68.785  -20.124 1.00 61.81  ?  63  ALA A N     1 
ATOM   470   C  CA    . ALA A 1 63  ? -53.392  67.717  -19.468 1.00 61.17  ?  63  ALA A CA    1 
ATOM   471   C  C     . ALA A 1 63  ? -54.205  66.404  -19.380 1.00 64.37  ?  63  ALA A C     1 
ATOM   472   O  O     . ALA A 1 63  ? -53.645  65.310  -19.456 1.00 71.26  ?  63  ALA A O     1 
ATOM   473   C  CB    . ALA A 1 63  ? -52.889  68.154  -18.130 1.00 55.27  ?  63  ALA A CB    1 
ATOM   474   N  N     . LYS A 1 64  ? -55.523  66.501  -19.261 1.00 61.95  ?  64  LYS A N     1 
ATOM   475   C  CA    . LYS A 1 64  ? -56.327  65.291  -19.162 1.00 64.05  ?  64  LYS A CA    1 
ATOM   476   C  C     . LYS A 1 64  ? -56.257  64.582  -20.493 1.00 69.14  ?  64  LYS A C     1 
ATOM   477   O  O     . LYS A 1 64  ? -55.982  63.391  -20.556 1.00 79.82  ?  64  LYS A O     1 
ATOM   478   C  CB    . LYS A 1 64  ? -57.781  65.595  -18.785 1.00 64.22  ?  64  LYS A CB    1 
ATOM   479   C  CG    . LYS A 1 64  ? -58.602  64.364  -18.375 1.00 55.72  ?  64  LYS A CG    1 
ATOM   480   C  CD    . LYS A 1 64  ? -60.064  64.735  -18.149 1.00 76.90  ?  64  LYS A CD    1 
ATOM   481   C  CE    . LYS A 1 64  ? -60.965  63.514  -18.078 1.00 81.35  ?  64  LYS A CE    1 
ATOM   482   N  NZ    . LYS A 1 64  ? -62.363  63.905  -17.707 1.00 88.93  ?  64  LYS A NZ    1 
ATOM   483   N  N     . SER A 1 65  ? -56.485  65.328  -21.561 1.00 63.80  ?  65  SER A N     1 
ATOM   484   C  CA    . SER A 1 65  ? -56.460  64.758  -22.905 1.00 65.24  ?  65  SER A CA    1 
ATOM   485   C  C     . SER A 1 65  ? -55.121  64.097  -23.214 1.00 68.77  ?  65  SER A C     1 
ATOM   486   O  O     . SER A 1 65  ? -55.061  62.921  -23.609 1.00 70.88  ?  65  SER A O     1 
ATOM   487   C  CB    . SER A 1 65  ? -56.758  65.846  -23.939 1.00 66.61  ?  65  SER A CB    1 
ATOM   488   O  OG    . SER A 1 65  ? -58.084  66.331  -23.782 1.00 75.49  ?  65  SER A OG    1 
ATOM   489   N  N     . VAL A 1 66  ? -54.057  64.875  -23.025 1.00 66.83  ?  66  VAL A N     1 
ATOM   490   C  CA    . VAL A 1 66  ? -52.702  64.464  -23.354 1.00 60.61  ?  66  VAL A CA    1 
ATOM   491   C  C     . VAL A 1 66  ? -52.296  63.183  -22.641 1.00 61.88  ?  66  VAL A C     1 
ATOM   492   O  O     . VAL A 1 66  ? -51.707  62.283  -23.238 1.00 69.32  ?  66  VAL A O     1 
ATOM   493   C  CB    . VAL A 1 66  ? -51.711  65.577  -23.018 1.00 54.99  ?  66  VAL A CB    1 
ATOM   494   C  CG1   . VAL A 1 66  ? -50.307  64.998  -22.746 1.00 50.92  ?  66  VAL A CG1   1 
ATOM   495   C  CG2   . VAL A 1 66  ? -51.706  66.613  -24.137 1.00 57.74  ?  66  VAL A CG2   1 
ATOM   496   N  N     . GLY A 1 67  ? -52.612  63.098  -21.360 1.00 54.47  ?  67  GLY A N     1 
ATOM   497   C  CA    . GLY A 1 67  ? -52.266  61.918  -20.599 1.00 62.27  ?  67  GLY A CA    1 
ATOM   498   C  C     . GLY A 1 67  ? -53.041  60.711  -21.081 1.00 65.62  ?  67  GLY A C     1 
ATOM   499   O  O     . GLY A 1 67  ? -52.580  59.578  -20.966 1.00 66.19  ?  67  GLY A O     1 
ATOM   500   N  N     . ASN A 1 68  ? -54.230  60.952  -21.626 1.00 65.47  ?  68  ASN A N     1 
ATOM   501   C  CA    . ASN A 1 68  ? -55.073  59.857  -22.070 1.00 67.53  ?  68  ASN A CA    1 
ATOM   502   C  C     . ASN A 1 68  ? -54.592  59.331  -23.406 1.00 65.73  ?  68  ASN A C     1 
ATOM   503   O  O     . ASN A 1 68  ? -54.651  58.127  -23.673 1.00 61.05  ?  68  ASN A O     1 
ATOM   504   C  CB    . ASN A 1 68  ? -56.555  60.257  -22.099 1.00 73.23  ?  68  ASN A CB    1 
ATOM   505   C  CG    . ASN A 1 68  ? -57.206  60.141  -20.735 1.00 83.39  ?  68  ASN A CG    1 
ATOM   506   O  OD1   . ASN A 1 68  ? -57.496  59.041  -20.261 1.00 91.02  ?  68  ASN A OD1   1 
ATOM   507   N  ND2   . ASN A 1 68  ? -57.410  61.277  -20.079 1.00 88.63  ?  68  ASN A ND2   1 
ATOM   508   N  N     . ILE A 1 69  ? -54.092  60.242  -24.233 1.00 68.76  ?  69  ILE A N     1 
ATOM   509   C  CA    . ILE A 1 69  ? -53.446  59.865  -25.478 1.00 67.26  ?  69  ILE A CA    1 
ATOM   510   C  C     . ILE A 1 69  ? -52.228  59.011  -25.166 1.00 66.57  ?  69  ILE A C     1 
ATOM   511   O  O     . ILE A 1 69  ? -52.035  57.931  -25.728 1.00 66.03  ?  69  ILE A O     1 
ATOM   512   C  CB    . ILE A 1 69  ? -52.990  61.103  -26.221 1.00 58.94  ?  69  ILE A CB    1 
ATOM   513   C  CG1   . ILE A 1 69  ? -54.184  61.778  -26.886 1.00 52.41  ?  69  ILE A CG1   1 
ATOM   514   C  CG2   . ILE A 1 69  ? -51.930  60.746  -27.240 1.00 60.29  ?  69  ILE A CG2   1 
ATOM   515   C  CD1   . ILE A 1 69  ? -53.918  63.217  -27.219 1.00 53.64  ?  69  ILE A CD1   1 
ATOM   516   N  N     . MET A 1 70  ? -51.427  59.505  -24.231 1.00 62.60  ?  70  MET A N     1 
ATOM   517   C  CA    . MET A 1 70  ? -50.171  58.879  -23.851 1.00 58.82  ?  70  MET A CA    1 
ATOM   518   C  C     . MET A 1 70  ? -50.323  57.473  -23.241 1.00 62.49  ?  70  MET A C     1 
ATOM   519   O  O     . MET A 1 70  ? -49.438  56.631  -23.369 1.00 70.09  ?  70  MET A O     1 
ATOM   520   C  CB    . MET A 1 70  ? -49.406  59.816  -22.912 1.00 55.23  ?  70  MET A CB    1 
ATOM   521   C  CG    . MET A 1 70  ? -48.009  59.346  -22.559 1.00 59.76  ?  70  MET A CG    1 
ATOM   522   S  SD    . MET A 1 70  ? -47.139  60.570  -21.571 1.00 105.13 ?  70  MET A SD    1 
ATOM   523   C  CE    . MET A 1 70  ? -48.038  62.040  -22.077 1.00 73.70  ?  70  MET A CE    1 
ATOM   524   N  N     . GLY A 1 71  ? -51.440  57.205  -22.587 1.00 58.93  ?  71  GLY A N     1 
ATOM   525   C  CA    . GLY A 1 71  ? -51.605  55.928  -21.925 1.00 58.75  ?  71  GLY A CA    1 
ATOM   526   C  C     . GLY A 1 71  ? -52.357  54.947  -22.796 1.00 68.62  ?  71  GLY A C     1 
ATOM   527   O  O     . GLY A 1 71  ? -52.325  53.736  -22.564 1.00 81.08  ?  71  GLY A O     1 
ATOM   528   N  N     . ASN A 1 72  ? -53.041  55.450  -23.814 1.00 62.47  ?  72  ASN A N     1 
ATOM   529   C  CA    . ASN A 1 72  ? -53.846  54.551  -24.627 1.00 63.27  ?  72  ASN A CA    1 
ATOM   530   C  C     . ASN A 1 72  ? -53.264  54.256  -26.001 1.00 59.38  ?  72  ASN A C     1 
ATOM   531   O  O     . ASN A 1 72  ? -53.382  53.128  -26.489 1.00 59.22  ?  72  ASN A O     1 
ATOM   532   C  CB    . ASN A 1 72  ? -55.275  55.062  -24.741 1.00 71.69  ?  72  ASN A CB    1 
ATOM   533   C  CG    . ASN A 1 72  ? -55.939  55.213  -23.393 1.00 82.57  ?  72  ASN A CG    1 
ATOM   534   O  OD1   . ASN A 1 72  ? -55.644  54.467  -22.459 1.00 76.49  ?  72  ASN A OD1   1 
ATOM   535   N  ND2   . ASN A 1 72  ? -56.838  56.187  -23.280 1.00 91.57  ?  72  ASN A ND2   1 
ATOM   536   N  N     . PHE A 1 73  ? -52.606  55.248  -26.600 1.00 58.47  ?  73  PHE A N     1 
ATOM   537   C  CA    . PHE A 1 73  ? -52.228  55.154  -28.012 1.00 60.61  ?  73  PHE A CA    1 
ATOM   538   C  C     . PHE A 1 73  ? -50.804  55.575  -28.366 1.00 69.33  ?  73  PHE A C     1 
ATOM   539   O  O     . PHE A 1 73  ? -50.071  54.806  -28.977 1.00 75.69  ?  73  PHE A O     1 
ATOM   540   C  CB    . PHE A 1 73  ? -53.225  55.940  -28.858 1.00 53.99  ?  73  PHE A CB    1 
ATOM   541   C  CG    . PHE A 1 73  ? -54.652  55.643  -28.517 1.00 58.48  ?  73  PHE A CG    1 
ATOM   542   C  CD1   . PHE A 1 73  ? -55.453  56.601  -27.932 1.00 68.32  ?  73  PHE A CD1   1 
ATOM   543   C  CD2   . PHE A 1 73  ? -55.183  54.388  -28.746 1.00 60.64  ?  73  PHE A CD2   1 
ATOM   544   C  CE1   . PHE A 1 73  ? -56.764  56.317  -27.605 1.00 73.30  ?  73  PHE A CE1   1 
ATOM   545   C  CE2   . PHE A 1 73  ? -56.491  54.098  -28.421 1.00 62.69  ?  73  PHE A CE2   1 
ATOM   546   C  CZ    . PHE A 1 73  ? -57.282  55.062  -27.851 1.00 67.95  ?  73  PHE A CZ    1 
ATOM   547   N  N     . HIS A 1 74  ? -50.419  56.794  -27.999 1.00 70.37  ?  74  HIS A N     1 
ATOM   548   C  CA    . HIS A 1 74  ? -49.114  57.328  -28.377 1.00 67.80  ?  74  HIS A CA    1 
ATOM   549   C  C     . HIS A 1 74  ? -48.109  57.218  -27.268 1.00 77.50  ?  74  HIS A C     1 
ATOM   550   O  O     . HIS A 1 74  ? -48.104  58.037  -26.365 1.00 84.88  ?  74  HIS A O     1 
ATOM   551   C  CB    . HIS A 1 74  ? -49.234  58.797  -28.704 1.00 62.27  ?  74  HIS A CB    1 
ATOM   552   C  CG    . HIS A 1 74  ? -48.134  59.306  -29.576 1.00 69.47  ?  74  HIS A CG    1 
ATOM   553   N  ND1   . HIS A 1 74  ? -47.810  58.712  -30.777 1.00 74.07  ?  74  HIS A ND1   1 
ATOM   554   C  CD2   . HIS A 1 74  ? -47.298  60.359  -29.436 1.00 69.25  ?  74  HIS A CD2   1 
ATOM   555   C  CE1   . HIS A 1 74  ? -46.815  59.379  -31.336 1.00 71.08  ?  74  HIS A CE1   1 
ATOM   556   N  NE2   . HIS A 1 74  ? -46.485  60.381  -30.546 1.00 65.92  ?  74  HIS A NE2   1 
ATOM   557   N  N     . PRO A 1 75  ? -47.217  56.235  -27.347 1.00 78.82  ?  75  PRO A N     1 
ATOM   558   C  CA    . PRO A 1 75  ? -46.292  56.009  -26.236 1.00 82.53  ?  75  PRO A CA    1 
ATOM   559   C  C     . PRO A 1 75  ? -45.032  56.887  -26.309 1.00 81.63  ?  75  PRO A C     1 
ATOM   560   O  O     . PRO A 1 75  ? -43.945  56.337  -26.489 1.00 81.52  ?  75  PRO A O     1 
ATOM   561   C  CB    . PRO A 1 75  ? -45.920  54.548  -26.431 1.00 82.59  ?  75  PRO A CB    1 
ATOM   562   C  CG    . PRO A 1 75  ? -45.881  54.410  -27.921 1.00 78.43  ?  75  PRO A CG    1 
ATOM   563   C  CD    . PRO A 1 75  ? -46.986  55.297  -28.456 1.00 76.17  ?  75  PRO A CD    1 
ATOM   564   N  N     . HIS A 1 76  ? -45.169  58.209  -26.164 1.00 76.78  ?  76  HIS A N     1 
ATOM   565   C  CA    . HIS A 1 76  ? -44.015  59.115  -26.228 1.00 77.60  ?  76  HIS A CA    1 
ATOM   566   C  C     . HIS A 1 76  ? -44.175  60.344  -25.330 1.00 78.68  ?  76  HIS A C     1 
ATOM   567   O  O     . HIS A 1 76  ? -44.994  60.361  -24.418 1.00 77.09  ?  76  HIS A O     1 
ATOM   568   C  CB    . HIS A 1 76  ? -43.748  59.589  -27.664 1.00 80.21  ?  76  HIS A CB    1 
ATOM   569   C  CG    . HIS A 1 76  ? -43.511  58.478  -28.641 1.00 81.27  ?  76  HIS A CG    1 
ATOM   570   N  ND1   . HIS A 1 76  ? -42.267  57.940  -28.864 1.00 81.20  ?  76  HIS A ND1   1 
ATOM   571   C  CD2   . HIS A 1 76  ? -44.366  57.814  -29.457 1.00 80.72  ?  76  HIS A CD2   1 
ATOM   572   C  CE1   . HIS A 1 76  ? -42.358  56.988  -29.782 1.00 82.25  ?  76  HIS A CE1   1 
ATOM   573   N  NE2   . HIS A 1 76  ? -43.622  56.889  -30.149 1.00 80.00  ?  76  HIS A NE2   1 
ATOM   574   N  N     . GLY A 1 77  ? -43.385  61.378  -25.612 1.00 80.43  ?  77  GLY A N     1 
ATOM   575   C  CA    . GLY A 1 77  ? -43.381  62.584  -24.805 1.00 79.60  ?  77  GLY A CA    1 
ATOM   576   C  C     . GLY A 1 77  ? -44.752  63.192  -24.589 1.00 75.59  ?  77  GLY A C     1 
ATOM   577   O  O     . GLY A 1 77  ? -45.554  63.312  -25.511 1.00 69.93  ?  77  GLY A O     1 
ATOM   578   N  N     . ASP A 1 78  ? -45.041  63.590  -23.360 1.00 79.43  ?  78  ASP A N     1 
ATOM   579   C  CA    . ASP A 1 78  ? -46.282  64.317  -23.138 1.00 76.01  ?  78  ASP A CA    1 
ATOM   580   C  C     . ASP A 1 78  ? -46.158  65.682  -23.829 1.00 82.62  ?  78  ASP A C     1 
ATOM   581   O  O     . ASP A 1 78  ? -47.122  66.194  -24.377 1.00 90.94  ?  78  ASP A O     1 
ATOM   582   C  CB    . ASP A 1 78  ? -46.620  64.422  -21.642 1.00 64.73  ?  78  ASP A CB    1 
ATOM   583   C  CG    . ASP A 1 78  ? -45.592  65.208  -20.873 1.00 79.63  ?  78  ASP A CG    1 
ATOM   584   O  OD1   . ASP A 1 78  ? -45.701  66.452  -20.841 1.00 86.69  ?  78  ASP A OD1   1 
ATOM   585   O  OD2   . ASP A 1 78  ? -44.667  64.588  -20.313 1.00 86.77  ?  78  ASP A OD2   1 
ATOM   586   N  N     . SER A 1 79  ? -44.953  66.242  -23.838 1.00 82.06  ?  79  SER A N     1 
ATOM   587   C  CA    . SER A 1 79  ? -44.689  67.499  -24.533 1.00 88.70  ?  79  SER A CA    1 
ATOM   588   C  C     . SER A 1 79  ? -44.910  67.408  -26.053 1.00 93.41  ?  79  SER A C     1 
ATOM   589   O  O     . SER A 1 79  ? -45.642  68.214  -26.631 1.00 97.31  ?  79  SER A O     1 
ATOM   590   C  CB    . SER A 1 79  ? -43.263  67.944  -24.270 1.00 99.07  ?  79  SER A CB    1 
ATOM   591   O  OG    . SER A 1 79  ? -42.374  66.961  -24.764 1.00 111.53 ?  79  SER A OG    1 
ATOM   592   N  N     . SER A 1 80  ? -44.259  66.444  -26.699 1.00 93.33  ?  80  SER A N     1 
ATOM   593   C  CA    . SER A 1 80  ? -44.458  66.225  -28.130 1.00 89.75  ?  80  SER A CA    1 
ATOM   594   C  C     . SER A 1 80  ? -45.951  66.184  -28.432 1.00 78.54  ?  80  SER A C     1 
ATOM   595   O  O     . SER A 1 80  ? -46.452  66.949  -29.254 1.00 81.53  ?  80  SER A O     1 
ATOM   596   C  CB    . SER A 1 80  ? -43.785  64.928  -28.589 1.00 95.88  ?  80  SER A CB    1 
ATOM   597   O  OG    . SER A 1 80  ? -42.459  64.843  -28.089 1.00 102.24 ?  80  SER A OG    1 
ATOM   598   N  N     . ILE A 1 81  ? -46.662  65.300  -27.745 1.00 69.27  ?  81  ILE A N     1 
ATOM   599   C  CA    . ILE A 1 81  ? -48.099  65.183  -27.928 1.00 60.03  ?  81  ILE A CA    1 
ATOM   600   C  C     . ILE A 1 81  ? -48.797  66.530  -27.783 1.00 58.08  ?  81  ILE A C     1 
ATOM   601   O  O     . ILE A 1 81  ? -49.557  66.924  -28.654 1.00 62.61  ?  81  ILE A O     1 
ATOM   602   C  CB    . ILE A 1 81  ? -48.708  64.159  -26.965 1.00 60.13  ?  81  ILE A CB    1 
ATOM   603   C  CG1   . ILE A 1 81  ? -47.995  62.820  -27.118 1.00 67.02  ?  81  ILE A CG1   1 
ATOM   604   C  CG2   . ILE A 1 81  ? -50.194  63.974  -27.239 1.00 56.20  ?  81  ILE A CG2   1 
ATOM   605   C  CD1   . ILE A 1 81  ? -48.494  61.772  -26.173 1.00 74.84  ?  81  ILE A CD1   1 
ATOM   606   N  N     . TYR A 1 82  ? -48.545  67.241  -26.691 1.00 55.38  ?  82  TYR A N     1 
ATOM   607   C  CA    . TYR A 1 82  ? -49.125  68.573  -26.524 1.00 57.44  ?  82  TYR A CA    1 
ATOM   608   C  C     . TYR A 1 82  ? -48.760  69.502  -27.688 1.00 66.57  ?  82  TYR A C     1 
ATOM   609   O  O     . TYR A 1 82  ? -49.627  69.981  -28.409 1.00 70.14  ?  82  TYR A O     1 
ATOM   610   C  CB    . TYR A 1 82  ? -48.663  69.194  -25.214 1.00 56.45  ?  82  TYR A CB    1 
ATOM   611   C  CG    . TYR A 1 82  ? -49.328  70.511  -24.845 1.00 64.65  ?  82  TYR A CG    1 
ATOM   612   C  CD1   . TYR A 1 82  ? -50.700  70.587  -24.595 1.00 66.90  ?  82  TYR A CD1   1 
ATOM   613   C  CD2   . TYR A 1 82  ? -48.574  71.676  -24.710 1.00 64.80  ?  82  TYR A CD2   1 
ATOM   614   C  CE1   . TYR A 1 82  ? -51.299  71.798  -24.231 1.00 62.72  ?  82  TYR A CE1   1 
ATOM   615   C  CE2   . TYR A 1 82  ? -49.166  72.886  -24.348 1.00 64.55  ?  82  TYR A CE2   1 
ATOM   616   C  CZ    . TYR A 1 82  ? -50.521  72.937  -24.106 1.00 64.01  ?  82  TYR A CZ    1 
ATOM   617   O  OH    . TYR A 1 82  ? -51.088  74.136  -23.744 1.00 69.42  ?  82  TYR A OH    1 
ATOM   618   N  N     . ASP A 1 83  ? -47.473  69.764  -27.864 1.00 63.25  ?  83  ASP A N     1 
ATOM   619   C  CA    . ASP A 1 83  ? -47.030  70.640  -28.942 1.00 65.74  ?  83  ASP A CA    1 
ATOM   620   C  C     . ASP A 1 83  ? -47.755  70.374  -30.268 1.00 66.39  ?  83  ASP A C     1 
ATOM   621   O  O     . ASP A 1 83  ? -48.042  71.313  -31.024 1.00 73.13  ?  83  ASP A O     1 
ATOM   622   C  CB    . ASP A 1 83  ? -45.517  70.542  -29.118 1.00 70.54  ?  83  ASP A CB    1 
ATOM   623   C  CG    . ASP A 1 83  ? -44.758  71.187  -27.979 1.00 80.64  ?  83  ASP A CG    1 
ATOM   624   O  OD1   . ASP A 1 83  ? -45.406  71.747  -27.061 1.00 89.50  ?  83  ASP A OD1   1 
ATOM   625   O  OD2   . ASP A 1 83  ? -43.511  71.145  -28.018 1.00 83.16  ?  83  ASP A OD2   1 
ATOM   626   N  N     . ALA A 1 84  ? -48.040  69.101  -30.540 1.00 59.24  ?  84  ALA A N     1 
ATOM   627   C  CA    . ALA A 1 84  ? -48.837  68.698  -31.701 1.00 60.53  ?  84  ALA A CA    1 
ATOM   628   C  C     . ALA A 1 84  ? -50.289  69.179  -31.609 1.00 65.83  ?  84  ALA A C     1 
ATOM   629   O  O     . ALA A 1 84  ? -50.812  69.814  -32.522 1.00 66.43  ?  84  ALA A O     1 
ATOM   630   C  CB    . ALA A 1 84  ? -48.808  67.192  -31.855 1.00 59.21  ?  84  ALA A CB    1 
ATOM   631   N  N     . MET A 1 85  ? -50.931  68.835  -30.500 1.00 65.22  ?  85  MET A N     1 
ATOM   632   C  CA    . MET A 1 85  ? -52.263  69.314  -30.145 1.00 60.54  ?  85  MET A CA    1 
ATOM   633   C  C     . MET A 1 85  ? -52.390  70.847  -30.296 1.00 59.55  ?  85  MET A C     1 
ATOM   634   O  O     . MET A 1 85  ? -53.345  71.354  -30.884 1.00 65.81  ?  85  MET A O     1 
ATOM   635   C  CB    . MET A 1 85  ? -52.565  68.855  -28.711 1.00 62.99  ?  85  MET A CB    1 
ATOM   636   C  CG    . MET A 1 85  ? -53.845  69.375  -28.080 1.00 67.47  ?  85  MET A CG    1 
ATOM   637   S  SD    . MET A 1 85  ? -54.351  68.268  -26.749 1.00 64.54  ?  85  MET A SD    1 
ATOM   638   N  N     . VAL A 1 86  ? -51.415  71.575  -29.773 1.00 54.50  ?  86  VAL A N     1 
ATOM   639   C  CA    . VAL A 1 86  ? -51.413  73.027  -29.850 1.00 58.99  ?  86  VAL A CA    1 
ATOM   640   C  C     . VAL A 1 86  ? -51.329  73.487  -31.310 1.00 61.02  ?  86  VAL A C     1 
ATOM   641   O  O     . VAL A 1 86  ? -51.964  74.473  -31.701 1.00 66.03  ?  86  VAL A O     1 
ATOM   642   C  CB    . VAL A 1 86  ? -50.240  73.639  -28.993 1.00 66.70  ?  86  VAL A CB    1 
ATOM   643   C  CG1   . VAL A 1 86  ? -49.911  75.118  -29.390 1.00 50.30  ?  86  VAL A CG1   1 
ATOM   644   C  CG2   . VAL A 1 86  ? -50.537  73.518  -27.508 1.00 61.97  ?  86  VAL A CG2   1 
ATOM   645   N  N     . ARG A 1 87  ? -50.549  72.781  -32.123 1.00 59.89  ?  87  ARG A N     1 
ATOM   646   C  CA    . ARG A 1 87  ? -50.380  73.235  -33.492 1.00 66.47  ?  87  ARG A CA    1 
ATOM   647   C  C     . ARG A 1 87  ? -51.673  73.045  -34.286 1.00 68.73  ?  87  ARG A C     1 
ATOM   648   O  O     . ARG A 1 87  ? -52.073  73.923  -35.048 1.00 71.42  ?  87  ARG A O     1 
ATOM   649   C  CB    . ARG A 1 87  ? -49.204  72.552  -34.182 1.00 67.06  ?  87  ARG A CB    1 
ATOM   650   C  CG    . ARG A 1 87  ? -48.880  73.136  -35.555 1.00 72.00  ?  87  ARG A CG    1 
ATOM   651   C  CD    . ARG A 1 87  ? -47.851  72.291  -36.288 1.00 75.04  ?  87  ARG A CD    1 
ATOM   652   N  NE    . ARG A 1 87  ? -47.405  72.900  -37.539 1.00 78.47  ?  87  ARG A NE    1 
ATOM   653   C  CZ    . ARG A 1 87  ? -47.983  72.689  -38.715 1.00 84.72  ?  87  ARG A CZ    1 
ATOM   654   N  NH1   . ARG A 1 87  ? -49.042  71.895  -38.789 1.00 91.58  ?  87  ARG A NH1   1 
ATOM   655   N  NH2   . ARG A 1 87  ? -47.508  73.270  -39.812 1.00 89.61  ?  87  ARG A NH2   1 
ATOM   656   N  N     . MET A 1 88  ? -52.339  71.912  -34.088 1.00 62.97  ?  88  MET A N     1 
ATOM   657   C  CA    . MET A 1 88  ? -53.600  71.662  -34.779 1.00 61.13  ?  88  MET A CA    1 
ATOM   658   C  C     . MET A 1 88  ? -54.677  72.675  -34.365 1.00 67.91  ?  88  MET A C     1 
ATOM   659   O  O     . MET A 1 88  ? -55.828  72.574  -34.794 1.00 73.86  ?  88  MET A O     1 
ATOM   660   C  CB    . MET A 1 88  ? -54.122  70.231  -34.530 1.00 55.46  ?  88  MET A CB    1 
ATOM   661   C  CG    . MET A 1 88  ? -53.065  69.109  -34.419 1.00 44.02  ?  88  MET A CG    1 
ATOM   662   S  SD    . MET A 1 88  ? -53.864  67.472  -34.430 1.00 68.18  ?  88  MET A SD    1 
ATOM   663   C  CE    . MET A 1 88  ? -52.613  66.507  -33.589 1.00 194.00 ?  88  MET A CE    1 
ATOM   664   N  N     . SER A 1 89  ? -54.309  73.645  -33.531 1.00 66.07  ?  89  SER A N     1 
ATOM   665   C  CA    . SER A 1 89  ? -55.274  74.622  -33.038 1.00 66.93  ?  89  SER A CA    1 
ATOM   666   C  C     . SER A 1 89  ? -54.853  76.049  -33.382 1.00 71.38  ?  89  SER A C     1 
ATOM   667   O  O     . SER A 1 89  ? -55.568  77.021  -33.099 1.00 74.78  ?  89  SER A O     1 
ATOM   668   C  CB    . SER A 1 89  ? -55.451  74.484  -31.523 1.00 67.78  ?  89  SER A CB    1 
ATOM   669   O  OG    . SER A 1 89  ? -54.447  75.203  -30.814 1.00 68.10  ?  89  SER A OG    1 
ATOM   670   N  N     . GLN A 1 90  ? -53.677  76.187  -33.975 1.00 71.87  ?  90  GLN A N     1 
ATOM   671   C  CA    . GLN A 1 90  ? -53.215  77.517  -34.337 1.00 72.73  ?  90  GLN A CA    1 
ATOM   672   C  C     . GLN A 1 90  ? -53.749  77.871  -35.713 1.00 75.34  ?  90  GLN A C     1 
ATOM   673   O  O     . GLN A 1 90  ? -53.377  77.263  -36.712 1.00 69.81  ?  90  GLN A O     1 
ATOM   674   C  CB    . GLN A 1 90  ? -51.697  77.595  -34.317 1.00 65.41  ?  90  GLN A CB    1 
ATOM   675   C  CG    . GLN A 1 90  ? -51.047  76.536  -33.474 1.00 61.49  ?  90  GLN A CG    1 
ATOM   676   C  CD    . GLN A 1 90  ? -49.762  77.033  -32.909 1.00 67.38  ?  90  GLN A CD    1 
ATOM   677   O  OE1   . GLN A 1 90  ? -49.765  78.011  -32.173 1.00 73.02  ?  90  GLN A OE1   1 
ATOM   678   N  NE2   . GLN A 1 90  ? -48.640  76.398  -33.274 1.00 69.07  ?  90  GLN A NE2   1 
ATOM   679   N  N     . ASN A 1 91  ? -54.625  78.864  -35.753 1.00 77.94  ?  91  ASN A N     1 
ATOM   680   C  CA    . ASN A 1 91  ? -55.330  79.204  -36.975 1.00 73.32  ?  91  ASN A CA    1 
ATOM   681   C  C     . ASN A 1 91  ? -54.445  79.850  -38.047 1.00 70.23  ?  91  ASN A C     1 
ATOM   682   O  O     . ASN A 1 91  ? -54.914  80.116  -39.156 1.00 76.32  ?  91  ASN A O     1 
ATOM   683   C  CB    . ASN A 1 91  ? -56.546  80.077  -36.652 1.00 74.14  ?  91  ASN A CB    1 
ATOM   684   C  CG    . ASN A 1 91  ? -56.224  81.549  -36.685 1.00 79.99  ?  91  ASN A CG    1 
ATOM   685   O  OD1   . ASN A 1 91  ? -55.400  82.039  -35.912 1.00 87.20  ?  91  ASN A OD1   1 
ATOM   686   N  ND2   . ASN A 1 91  ? -56.879  82.272  -37.583 1.00 80.33  ?  91  ASN A ND2   1 
ATOM   687   N  N     . TRP A 1 92  ? -53.167  80.072  -37.732 1.00 67.97  ?  92  TRP A N     1 
ATOM   688   C  CA    . TRP A 1 92  ? -52.210  80.605  -38.715 1.00 69.25  ?  92  TRP A CA    1 
ATOM   689   C  C     . TRP A 1 92  ? -51.196  79.564  -39.220 1.00 67.43  ?  92  TRP A C     1 
ATOM   690   O  O     . TRP A 1 92  ? -50.265  79.901  -39.963 1.00 69.12  ?  92  TRP A O     1 
ATOM   691   C  CB    . TRP A 1 92  ? -51.454  81.801  -38.135 1.00 79.43  ?  92  TRP A CB    1 
ATOM   692   C  CG    . TRP A 1 92  ? -50.519  81.422  -37.009 1.00 81.03  ?  92  TRP A CG    1 
ATOM   693   C  CD1   . TRP A 1 92  ? -49.181  81.192  -37.100 1.00 84.91  ?  92  TRP A CD1   1 
ATOM   694   C  CD2   . TRP A 1 92  ? -50.863  81.223  -35.633 1.00 71.32  ?  92  TRP A CD2   1 
ATOM   695   N  NE1   . TRP A 1 92  ? -48.668  80.868  -35.868 1.00 79.71  ?  92  TRP A NE1   1 
ATOM   696   C  CE2   . TRP A 1 92  ? -49.681  80.884  -34.950 1.00 70.67  ?  92  TRP A CE2   1 
ATOM   697   C  CE3   . TRP A 1 92  ? -52.056  81.304  -34.912 1.00 70.14  ?  92  TRP A CE3   1 
ATOM   698   C  CZ2   . TRP A 1 92  ? -49.654  80.630  -33.594 1.00 70.72  ?  92  TRP A CZ2   1 
ATOM   699   C  CZ3   . TRP A 1 92  ? -52.026  81.053  -33.570 1.00 73.13  ?  92  TRP A CZ3   1 
ATOM   700   C  CH2   . TRP A 1 92  ? -50.834  80.714  -32.922 1.00 71.73  ?  92  TRP A CH2   1 
ATOM   701   N  N     . LYS A 1 93  ? -51.364  78.316  -38.783 1.00 67.80  ?  93  LYS A N     1 
ATOM   702   C  CA    . LYS A 1 93  ? -50.582  77.188  -39.293 1.00 64.06  ?  93  LYS A CA    1 
ATOM   703   C  C     . LYS A 1 93  ? -51.521  76.233  -40.035 1.00 63.38  ?  93  LYS A C     1 
ATOM   704   O  O     . LYS A 1 93  ? -51.182  75.703  -41.097 1.00 71.96  ?  93  LYS A O     1 
ATOM   705   C  CB    . LYS A 1 93  ? -49.816  76.456  -38.170 1.00 56.03  ?  93  LYS A CB    1 
ATOM   706   C  CG    . LYS A 1 93  ? -48.796  77.332  -37.434 1.00 62.51  ?  93  LYS A CG    1 
ATOM   707   C  CD    . LYS A 1 93  ? -47.352  76.872  -37.601 1.00 69.90  ?  93  LYS A CD    1 
ATOM   708   C  CE    . LYS A 1 93  ? -46.414  78.074  -37.840 1.00 84.91  ?  93  LYS A CE    1 
ATOM   709   N  NZ    . LYS A 1 93  ? -44.943  77.763  -37.781 1.00 93.22  ?  93  LYS A NZ    1 
ATOM   710   N  N     . ASN A 1 94  ? -52.715  76.038  -39.490 1.00 57.11  ?  94  ASN A N     1 
ATOM   711   C  CA    . ASN A 1 94  ? -53.723  75.250  -40.185 1.00 58.56  ?  94  ASN A CA    1 
ATOM   712   C  C     . ASN A 1 94  ? -54.796  76.086  -40.916 1.00 66.62  ?  94  ASN A C     1 
ATOM   713   O  O     . ASN A 1 94  ? -55.330  77.070  -40.370 1.00 69.40  ?  94  ASN A O     1 
ATOM   714   C  CB    . ASN A 1 94  ? -54.329  74.220  -39.239 1.00 58.40  ?  94  ASN A CB    1 
ATOM   715   C  CG    . ASN A 1 94  ? -53.312  73.194  -38.785 1.00 69.33  ?  94  ASN A CG    1 
ATOM   716   O  OD1   . ASN A 1 94  ? -52.634  73.390  -37.787 1.00 82.14  ?  94  ASN A OD1   1 
ATOM   717   N  ND2   . ASN A 1 94  ? -53.195  72.096  -39.521 1.00 69.31  ?  94  ASN A ND2   1 
ATOM   718   N  N     . ARG A 1 95  ? -55.077  75.709  -42.167 1.00 67.71  ?  95  ARG A N     1 
ATOM   719   C  CA    . ARG A 1 95  ? -56.042  76.439  -42.989 1.00 65.02  ?  95  ARG A CA    1 
ATOM   720   C  C     . ARG A 1 95  ? -57.400  76.223  -42.370 1.00 67.00  ?  95  ARG A C     1 
ATOM   721   O  O     . ARG A 1 95  ? -58.257  77.116  -42.345 1.00 76.47  ?  95  ARG A O     1 
ATOM   722   C  CB    . ARG A 1 95  ? -56.045  75.931  -44.436 1.00 61.51  ?  95  ARG A CB    1 
ATOM   723   C  CG    . ARG A 1 95  ? -57.052  76.627  -45.334 1.00 52.60  ?  95  ARG A CG    1 
ATOM   724   C  CD    . ARG A 1 95  ? -56.843  78.097  -45.197 1.00 58.48  ?  95  ARG A CD    1 
ATOM   725   N  NE    . ARG A 1 95  ? -57.620  78.929  -46.106 1.00 61.07  ?  95  ARG A NE    1 
ATOM   726   C  CZ    . ARG A 1 95  ? -58.888  79.261  -45.916 1.00 61.90  ?  95  ARG A CZ    1 
ATOM   727   N  NH1   . ARG A 1 95  ? -59.544  78.786  -44.869 1.00 61.49  ?  95  ARG A NH1   1 
ATOM   728   N  NH2   . ARG A 1 95  ? -59.499  80.060  -46.782 1.00 65.77  ?  95  ARG A NH2   1 
ATOM   729   N  N     . GLU A 1 96  ? -57.572  75.022  -41.842 1.00 57.07  ?  96  GLU A N     1 
ATOM   730   C  CA    . GLU A 1 96  ? -58.805  74.647  -41.182 1.00 60.27  ?  96  GLU A CA    1 
ATOM   731   C  C     . GLU A 1 96  ? -58.501  73.916  -39.840 1.00 70.96  ?  96  GLU A C     1 
ATOM   732   O  O     . GLU A 1 96  ? -58.334  72.682  -39.834 1.00 68.49  ?  96  GLU A O     1 
ATOM   733   C  CB    . GLU A 1 96  ? -59.591  73.758  -42.141 1.00 58.82  ?  96  GLU A CB    1 
ATOM   734   C  CG    . GLU A 1 96  ? -61.077  74.003  -42.179 1.00 70.44  ?  96  GLU A CG    1 
ATOM   735   C  CD    . GLU A 1 96  ? -61.456  75.310  -42.836 1.00 84.40  ?  96  GLU A CD    1 
ATOM   736   O  OE1   . GLU A 1 96  ? -61.203  75.476  -44.061 1.00 80.93  ?  96  GLU A OE1   1 
ATOM   737   O  OE2   . GLU A 1 96  ? -62.033  76.160  -42.114 1.00 95.65  ?  96  GLU A OE2   1 
ATOM   738   N  N     . ILE A 1 97  ? -58.427  74.652  -38.716 1.00 62.14  ?  97  ILE A N     1 
ATOM   739   C  CA    . ILE A 1 97  ? -57.961  74.024  -37.463 1.00 57.38  ?  97  ILE A CA    1 
ATOM   740   C  C     . ILE A 1 97  ? -58.860  72.898  -36.965 1.00 54.78  ?  97  ILE A C     1 
ATOM   741   O  O     . ILE A 1 97  ? -60.086  73.018  -36.968 1.00 51.13  ?  97  ILE A O     1 
ATOM   742   C  CB    . ILE A 1 97  ? -57.737  75.008  -36.272 1.00 56.28  ?  97  ILE A CB    1 
ATOM   743   C  CG1   . ILE A 1 97  ? -58.987  75.110  -35.399 1.00 51.45  ?  97  ILE A CG1   1 
ATOM   744   C  CG2   . ILE A 1 97  ? -57.252  76.374  -36.732 1.00 63.17  ?  97  ILE A CG2   1 
ATOM   745   C  CD1   . ILE A 1 97  ? -59.316  76.520  -35.010 1.00 49.70  ?  97  ILE A CD1   1 
ATOM   746   N  N     . LEU A 1 98  ? -58.224  71.817  -36.519 1.00 59.66  ?  98  LEU A N     1 
ATOM   747   C  CA    . LEU A 1 98  ? -58.907  70.617  -36.044 1.00 64.79  ?  98  LEU A CA    1 
ATOM   748   C  C     . LEU A 1 98  ? -59.090  70.601  -34.518 1.00 63.71  ?  98  LEU A C     1 
ATOM   749   O  O     . LEU A 1 98  ? -59.791  69.760  -33.958 1.00 60.97  ?  98  LEU A O     1 
ATOM   750   C  CB    . LEU A 1 98  ? -58.090  69.395  -36.438 1.00 65.38  ?  98  LEU A CB    1 
ATOM   751   C  CG    . LEU A 1 98  ? -57.660  69.386  -37.888 1.00 57.35  ?  98  LEU A CG    1 
ATOM   752   C  CD1   . LEU A 1 98  ? -56.878  68.124  -38.182 1.00 49.53  ?  98  LEU A CD1   1 
ATOM   753   C  CD2   . LEU A 1 98  ? -58.910  69.446  -38.697 1.00 58.05  ?  98  LEU A CD2   1 
ATOM   754   N  N     . VAL A 1 99  ? -58.437  71.520  -33.835 1.00 65.01  ?  99  VAL A N     1 
ATOM   755   C  CA    . VAL A 1 99  ? -58.512  71.534  -32.392 1.00 60.09  ?  99  VAL A CA    1 
ATOM   756   C  C     . VAL A 1 99  ? -58.829  72.950  -31.965 1.00 64.36  ?  99  VAL A C     1 
ATOM   757   O  O     . VAL A 1 99  ? -58.247  73.898  -32.489 1.00 71.52  ?  99  VAL A O     1 
ATOM   758   C  CB    . VAL A 1 99  ? -57.188  71.026  -31.780 1.00 51.40  ?  99  VAL A CB    1 
ATOM   759   C  CG1   . VAL A 1 99  ? -57.034  71.478  -30.377 1.00 52.18  ?  99  VAL A CG1   1 
ATOM   760   C  CG2   . VAL A 1 99  ? -57.143  69.526  -31.834 1.00 54.16  ?  99  VAL A CG2   1 
ATOM   761   N  N     . GLU A 1 100 ? -59.787  73.086  -31.053 1.00 58.91  ?  100 GLU A N     1 
ATOM   762   C  CA    . GLU A 1 100 ? -60.101  74.373  -30.453 1.00 63.55  ?  100 GLU A CA    1 
ATOM   763   C  C     . GLU A 1 100 ? -59.541  74.450  -29.027 1.00 70.30  ?  100 GLU A C     1 
ATOM   764   O  O     . GLU A 1 100 ? -59.872  73.625  -28.169 1.00 82.76  ?  100 GLU A O     1 
ATOM   765   C  CB    . GLU A 1 100 ? -61.603  74.601  -30.442 1.00 67.62  ?  100 GLU A CB    1 
ATOM   766   C  CG    . GLU A 1 100 ? -62.112  75.349  -31.639 1.00 79.99  ?  100 GLU A CG    1 
ATOM   767   C  CD    . GLU A 1 100 ? -63.618  75.277  -31.739 1.00 97.34  ?  100 GLU A CD    1 
ATOM   768   O  OE1   . GLU A 1 100 ? -64.140  75.230  -32.876 1.00 104.62 ?  100 GLU A OE1   1 
ATOM   769   O  OE2   . GLU A 1 100 ? -64.277  75.255  -30.674 1.00 100.02 ?  100 GLU A OE2   1 
ATOM   770   N  N     . MET A 1 101 ? -58.693  75.444  -28.780 1.00 59.38  ?  101 MET A N     1 
ATOM   771   C  CA    . MET A 1 101 ? -58.009  75.559  -27.502 1.00 59.60  ?  101 MET A CA    1 
ATOM   772   C  C     . MET A 1 101 ? -58.249  76.923  -26.835 1.00 67.93  ?  101 MET A C     1 
ATOM   773   O  O     . MET A 1 101 ? -57.918  77.975  -27.386 1.00 66.36  ?  101 MET A O     1 
ATOM   774   C  CB    . MET A 1 101 ? -56.510  75.229  -27.668 1.00 50.12  ?  101 MET A CB    1 
ATOM   775   C  CG    . MET A 1 101 ? -55.611  75.552  -26.472 1.00 64.59  ?  101 MET A CG    1 
ATOM   776   S  SD    . MET A 1 101 ? -53.920  74.879  -26.562 1.00 81.64  ?  101 MET A SD    1 
ATOM   777   C  CE    . MET A 1 101 ? -54.217  73.259  -27.266 1.00 48.63  ?  101 MET A CE    1 
ATOM   778   N  N     . HIS A 1 102 ? -58.861  76.882  -25.652 1.00 74.93  ?  102 HIS A N     1 
ATOM   779   C  CA    . HIS A 1 102 ? -59.034  78.048  -24.790 1.00 75.48  ?  102 HIS A CA    1 
ATOM   780   C  C     . HIS A 1 102 ? -57.692  78.359  -24.122 1.00 71.15  ?  102 HIS A C     1 
ATOM   781   O  O     . HIS A 1 102 ? -57.063  77.472  -23.529 1.00 65.50  ?  102 HIS A O     1 
ATOM   782   C  CB    . HIS A 1 102 ? -60.038  77.711  -23.697 1.00 92.30  ?  102 HIS A CB    1 
ATOM   783   C  CG    . HIS A 1 102 ? -61.293  78.518  -23.740 1.00 108.42 ?  102 HIS A CG    1 
ATOM   784   N  ND1   . HIS A 1 102 ? -62.090  78.601  -24.862 1.00 112.00 ?  102 HIS A ND1   1 
ATOM   785   C  CD2   . HIS A 1 102 ? -61.908  79.255  -22.783 1.00 119.22 ?  102 HIS A CD2   1 
ATOM   786   C  CE1   . HIS A 1 102 ? -63.135  79.367  -24.598 1.00 121.54 ?  102 HIS A CE1   1 
ATOM   787   N  NE2   . HIS A 1 102 ? -63.046  79.778  -23.345 1.00 125.62 ?  102 HIS A NE2   1 
ATOM   788   N  N     . GLY A 1 103 ? -57.248  79.610  -24.208 1.00 75.23  ?  103 GLY A N     1 
ATOM   789   C  CA    . GLY A 1 103 ? -56.026  80.025  -23.539 1.00 75.60  ?  103 GLY A CA    1 
ATOM   790   C  C     . GLY A 1 103 ? -54.879  80.334  -24.483 1.00 79.83  ?  103 GLY A C     1 
ATOM   791   O  O     . GLY A 1 103 ? -54.992  80.173  -25.707 1.00 86.86  ?  103 GLY A O     1 
ATOM   792   N  N     . ASN A 1 104 ? -53.774  80.798  -23.909 1.00 78.18  ?  104 ASN A N     1 
ATOM   793   C  CA    . ASN A 1 104 ? -52.573  81.098  -24.675 1.00 79.47  ?  104 ASN A CA    1 
ATOM   794   C  C     . ASN A 1 104 ? -52.057  79.883  -25.452 1.00 80.72  ?  104 ASN A C     1 
ATOM   795   O  O     . ASN A 1 104 ? -51.483  78.959  -24.883 1.00 80.04  ?  104 ASN A O     1 
ATOM   796   C  CB    . ASN A 1 104 ? -51.483  81.632  -23.744 1.00 82.55  ?  104 ASN A CB    1 
ATOM   797   C  CG    . ASN A 1 104 ? -50.252  82.097  -24.491 1.00 86.94  ?  104 ASN A CG    1 
ATOM   798   O  OD1   . ASN A 1 104 ? -50.210  82.086  -25.729 1.00 94.70  ?  104 ASN A OD1   1 
ATOM   799   N  ND2   . ASN A 1 104 ? -49.241  82.528  -23.740 1.00 83.76  ?  104 ASN A ND2   1 
ATOM   800   N  N     . ASN A 1 105 ? -52.258  79.876  -26.761 1.00 86.55  ?  105 ASN A N     1 
ATOM   801   C  CA    . ASN A 1 105 ? -51.736  78.776  -27.559 1.00 81.68  ?  105 ASN A CA    1 
ATOM   802   C  C     . ASN A 1 105 ? -50.714  79.267  -28.548 1.00 77.24  ?  105 ASN A C     1 
ATOM   803   O  O     . ASN A 1 105 ? -50.408  78.581  -29.516 1.00 76.60  ?  105 ASN A O     1 
ATOM   804   C  CB    . ASN A 1 105 ? -52.850  78.036  -28.286 1.00 77.41  ?  105 ASN A CB    1 
ATOM   805   C  CG    . ASN A 1 105 ? -53.569  78.908  -29.278 1.00 72.50  ?  105 ASN A CG    1 
ATOM   806   O  OD1   . ASN A 1 105 ? -53.715  80.126  -29.084 1.00 75.51  ?  105 ASN A OD1   1 
ATOM   807   N  ND2   . ASN A 1 105 ? -54.034  78.290  -30.353 1.00 70.43  ?  105 ASN A ND2   1 
ATOM   808   N  N     . GLY A 1 106 ? -50.187  80.458  -28.284 1.00 74.02  ?  106 GLY A N     1 
ATOM   809   C  CA    . GLY A 1 106 ? -49.165  81.045  -29.126 1.00 76.36  ?  106 GLY A CA    1 
ATOM   810   C  C     . GLY A 1 106 ? -49.664  82.193  -29.982 1.00 78.84  ?  106 GLY A C     1 
ATOM   811   O  O     . GLY A 1 106 ? -50.831  82.588  -29.923 1.00 83.91  ?  106 GLY A O     1 
ATOM   812   N  N     . SER A 1 107 ? -48.762  82.727  -30.792 1.00 74.11  ?  107 SER A N     1 
ATOM   813   C  CA    . SER A 1 107 ? -49.097  83.806  -31.700 1.00 78.59  ?  107 SER A CA    1 
ATOM   814   C  C     . SER A 1 107 ? -48.252  83.713  -32.975 1.00 85.32  ?  107 SER A C     1 
ATOM   815   O  O     . SER A 1 107 ? -47.316  82.910  -33.055 1.00 86.62  ?  107 SER A O     1 
ATOM   816   C  CB    . SER A 1 107 ? -48.848  85.135  -31.005 1.00 75.08  ?  107 SER A CB    1 
ATOM   817   O  OG    . SER A 1 107 ? -47.507  85.198  -30.550 1.00 77.01  ?  107 SER A OG    1 
ATOM   818   N  N     . MET A 1 108 ? -48.581  84.531  -33.972 1.00 81.54  ?  108 MET A N     1 
ATOM   819   C  CA    . MET A 1 108 ? -47.748  84.621  -35.162 1.00 78.45  ?  108 MET A CA    1 
ATOM   820   C  C     . MET A 1 108 ? -46.403  85.219  -34.812 1.00 77.31  ?  108 MET A C     1 
ATOM   821   O  O     . MET A 1 108 ? -45.505  85.264  -35.650 1.00 83.37  ?  108 MET A O     1 
ATOM   822   C  CB    . MET A 1 108 ? -48.396  85.498  -36.221 1.00 81.64  ?  108 MET A CB    1 
ATOM   823   C  CG    . MET A 1 108 ? -49.426  84.817  -37.090 1.00 76.75  ?  108 MET A CG    1 
ATOM   824   S  SD    . MET A 1 108 ? -49.906  86.010  -38.349 1.00 96.09  ?  108 MET A SD    1 
ATOM   825   C  CE    . MET A 1 108 ? -48.528  85.898  -39.496 1.00 167.94 ?  108 MET A CE    1 
ATOM   826   N  N     . ASP A 1 109 ? -46.287  85.720  -33.586 1.00 72.91  ?  109 ASP A N     1 
ATOM   827   C  CA    . ASP A 1 109 ? -45.022  86.230  -33.059 1.00 75.72  ?  109 ASP A CA    1 
ATOM   828   C  C     . ASP A 1 109 ? -44.207  85.071  -32.482 1.00 74.45  ?  109 ASP A C     1 
ATOM   829   O  O     . ASP A 1 109 ? -43.028  85.220  -32.132 1.00 68.19  ?  109 ASP A O     1 
ATOM   830   C  CB    . ASP A 1 109 ? -45.271  87.281  -31.981 1.00 83.04  ?  109 ASP A CB    1 
ATOM   831   C  CG    . ASP A 1 109 ? -45.337  88.676  -32.540 1.00 96.08  ?  109 ASP A CG    1 
ATOM   832   O  OD1   . ASP A 1 109 ? -45.514  88.797  -33.770 1.00 100.25 ?  109 ASP A OD1   1 
ATOM   833   O  OD2   . ASP A 1 109 ? -45.213  89.648  -31.755 1.00 103.37 ?  109 ASP A OD2   1 
ATOM   834   N  N     . GLY A 1 110 ? -44.849  83.911  -32.386 1.00 73.10  ?  110 GLY A N     1 
ATOM   835   C  CA    . GLY A 1 110 ? -44.151  82.707  -31.997 1.00 80.69  ?  110 GLY A CA    1 
ATOM   836   C  C     . GLY A 1 110 ? -43.619  82.768  -30.587 1.00 90.46  ?  110 GLY A C     1 
ATOM   837   O  O     . GLY A 1 110 ? -42.528  82.266  -30.301 1.00 97.09  ?  110 GLY A O     1 
ATOM   838   N  N     . ASP A 1 111 ? -44.372  83.412  -29.702 1.00 93.90  ?  111 ASP A N     1 
ATOM   839   C  CA    . ASP A 1 111 ? -44.137  83.217  -28.284 1.00 97.15  ?  111 ASP A CA    1 
ATOM   840   C  C     . ASP A 1 111 ? -44.798  81.887  -27.943 1.00 93.88  ?  111 ASP A C     1 
ATOM   841   O  O     . ASP A 1 111 ? -45.775  81.485  -28.586 1.00 93.09  ?  111 ASP A O     1 
ATOM   842   C  CB    . ASP A 1 111 ? -44.648  84.387  -27.424 1.00 100.18 ?  111 ASP A CB    1 
ATOM   843   C  CG    . ASP A 1 111 ? -45.772  85.173  -28.084 1.00 102.25 ?  111 ASP A CG    1 
ATOM   844   O  OD1   . ASP A 1 111 ? -45.759  86.422  -27.992 1.00 103.58 ?  111 ASP A OD1   1 
ATOM   845   O  OD2   . ASP A 1 111 ? -46.673  84.548  -28.678 1.00 103.21 ?  111 ASP A OD2   1 
ATOM   846   N  N     . PRO A 1 112 ? -44.241  81.176  -26.960 1.00 89.40  ?  112 PRO A N     1 
ATOM   847   C  CA    . PRO A 1 112 ? -44.673  79.799  -26.728 1.00 84.36  ?  112 PRO A CA    1 
ATOM   848   C  C     . PRO A 1 112 ? -46.069  79.807  -26.168 1.00 82.78  ?  112 PRO A C     1 
ATOM   849   O  O     . PRO A 1 112 ? -46.432  80.770  -25.488 1.00 91.15  ?  112 PRO A O     1 
ATOM   850   C  CB    . PRO A 1 112 ? -43.709  79.325  -25.649 1.00 85.30  ?  112 PRO A CB    1 
ATOM   851   C  CG    . PRO A 1 112 ? -43.404  80.575  -24.871 1.00 86.28  ?  112 PRO A CG    1 
ATOM   852   C  CD    . PRO A 1 112 ? -43.342  81.666  -25.901 1.00 87.23  ?  112 PRO A CD    1 
ATOM   853   N  N     . PRO A 1 113 ? -46.839  78.748  -26.438 1.00 73.39  ?  113 PRO A N     1 
ATOM   854   C  CA    . PRO A 1 113 ? -48.177  78.570  -25.865 1.00 73.90  ?  113 PRO A CA    1 
ATOM   855   C  C     . PRO A 1 113 ? -48.109  78.405  -24.339 1.00 72.02  ?  113 PRO A C     1 
ATOM   856   O  O     . PRO A 1 113 ? -47.053  78.046  -23.801 1.00 61.96  ?  113 PRO A O     1 
ATOM   857   C  CB    . PRO A 1 113 ? -48.661  77.265  -26.516 1.00 69.07  ?  113 PRO A CB    1 
ATOM   858   C  CG    . PRO A 1 113 ? -47.419  76.525  -26.881 1.00 63.66  ?  113 PRO A CG    1 
ATOM   859   C  CD    . PRO A 1 113 ? -46.393  77.574  -27.209 1.00 65.66  ?  113 PRO A CD    1 
ATOM   860   N  N     . ALA A 1 114 ? -49.213  78.678  -23.648 1.00 77.40  ?  114 ALA A N     1 
ATOM   861   C  CA    . ALA A 1 114 ? -49.293  78.374  -22.219 1.00 79.40  ?  114 ALA A CA    1 
ATOM   862   C  C     . ALA A 1 114 ? -49.015  76.885  -22.041 1.00 78.77  ?  114 ALA A C     1 
ATOM   863   O  O     . ALA A 1 114 ? -49.230  76.085  -22.960 1.00 75.79  ?  114 ALA A O     1 
ATOM   864   C  CB    . ALA A 1 114 ? -50.672  78.754  -21.636 1.00 76.42  ?  114 ALA A CB    1 
ATOM   865   N  N     . ALA A 1 115 ? -48.518  76.521  -20.865 1.00 72.02  ?  115 ALA A N     1 
ATOM   866   C  CA    . ALA A 1 115 ? -48.161  75.139  -20.580 1.00 58.75  ?  115 ALA A CA    1 
ATOM   867   C  C     . ALA A 1 115 ? -49.399  74.264  -20.466 1.00 59.60  ?  115 ALA A C     1 
ATOM   868   O  O     . ALA A 1 115 ? -50.466  74.713  -20.034 1.00 59.77  ?  115 ALA A O     1 
ATOM   869   C  CB    . ALA A 1 115 ? -47.361  75.075  -19.314 1.00 58.61  ?  115 ALA A CB    1 
ATOM   870   N  N     . MET A 1 116 ? -49.240  73.007  -20.857 1.00 62.63  ?  116 MET A N     1 
ATOM   871   C  CA    . MET A 1 116 ? -50.316  72.017  -20.834 1.00 61.95  ?  116 MET A CA    1 
ATOM   872   C  C     . MET A 1 116 ? -51.267  72.119  -19.613 1.00 77.89  ?  116 MET A C     1 
ATOM   873   O  O     . MET A 1 116 ? -52.446  71.751  -19.678 1.00 74.23  ?  116 MET A O     1 
ATOM   874   C  CB    . MET A 1 116 ? -49.659  70.636  -20.898 1.00 61.60  ?  116 MET A CB    1 
ATOM   875   C  CG    . MET A 1 116 ? -50.577  69.427  -20.938 1.00 61.73  ?  116 MET A CG    1 
ATOM   876   S  SD    . MET A 1 116 ? -49.678  68.038  -20.223 1.00 74.30  ?  116 MET A SD    1 
ATOM   877   C  CE    . MET A 1 116 ? -48.182  68.071  -21.215 1.00 124.12 ?  116 MET A CE    1 
ATOM   878   N  N     . ARG A 1 117 ? -50.753  72.629  -18.502 1.00 79.12  ?  117 ARG A N     1 
ATOM   879   C  CA    A ARG A 1 117 ? -51.505  72.662  -17.252 0.49 76.92  ?  117 ARG A CA    1 
ATOM   880   C  CA    B ARG A 1 117 ? -51.515  72.654  -17.259 0.51 76.88  ?  117 ARG A CA    1 
ATOM   881   C  C     . ARG A 1 117 ? -52.532  73.799  -17.206 1.00 76.78  ?  117 ARG A C     1 
ATOM   882   O  O     . ARG A 1 117 ? -53.420  73.818  -16.346 1.00 76.42  ?  117 ARG A O     1 
ATOM   883   C  CB    A ARG A 1 117 ? -50.531  72.783  -16.080 0.49 78.80  ?  117 ARG A CB    1 
ATOM   884   C  CB    B ARG A 1 117 ? -50.565  72.671  -16.050 0.51 78.65  ?  117 ARG A CB    1 
ATOM   885   C  CG    A ARG A 1 117 ? -50.181  74.216  -15.698 0.49 81.16  ?  117 ARG A CG    1 
ATOM   886   C  CG    B ARG A 1 117 ? -50.229  74.039  -15.422 0.51 81.56  ?  117 ARG A CG    1 
ATOM   887   C  CD    A ARG A 1 117 ? -48.977  74.256  -14.778 0.49 83.80  ?  117 ARG A CD    1 
ATOM   888   C  CD    B ARG A 1 117 ? -49.497  73.804  -14.087 0.51 83.94  ?  117 ARG A CD    1 
ATOM   889   N  NE    A ARG A 1 117 ? -47.740  74.063  -15.527 0.49 81.78  ?  117 ARG A NE    1 
ATOM   890   N  NE    B ARG A 1 117 ? -49.228  74.998  -13.290 0.51 82.30  ?  117 ARG A NE    1 
ATOM   891   C  CZ    A ARG A 1 117 ? -46.632  73.526  -15.030 0.49 77.04  ?  117 ARG A CZ    1 
ATOM   892   C  CZ    B ARG A 1 117 ? -50.053  75.497  -12.373 0.51 82.84  ?  117 ARG A CZ    1 
ATOM   893   N  NH1   A ARG A 1 117 ? -46.595  73.099  -13.771 0.49 67.26  ?  117 ARG A NH1   1 
ATOM   894   N  NH1   B ARG A 1 117 ? -51.228  74.926  -12.150 0.51 66.69  ?  117 ARG A NH1   1 
ATOM   895   N  NH2   A ARG A 1 117 ? -45.563  73.406  -15.809 0.49 81.88  ?  117 ARG A NH2   1 
ATOM   896   N  NH2   B ARG A 1 117 ? -49.708  76.579  -11.688 0.51 68.81  ?  117 ARG A NH2   1 
ATOM   897   N  N     . TYR A 1 118 ? -52.410  74.742  -18.138 1.00 72.76  ?  118 TYR A N     1 
ATOM   898   C  CA    . TYR A 1 118 ? -53.263  75.929  -18.161 1.00 68.53  ?  118 TYR A CA    1 
ATOM   899   C  C     . TYR A 1 118 ? -54.388  75.863  -19.195 1.00 77.12  ?  118 TYR A C     1 
ATOM   900   O  O     . TYR A 1 118 ? -55.490  76.356  -18.969 1.00 84.24  ?  118 TYR A O     1 
ATOM   901   C  CB    . TYR A 1 118 ? -52.420  77.156  -18.470 1.00 63.63  ?  118 TYR A CB    1 
ATOM   902   C  CG    . TYR A 1 118 ? -51.402  77.499  -17.421 1.00 70.51  ?  118 TYR A CG    1 
ATOM   903   C  CD1   . TYR A 1 118 ? -51.795  77.978  -16.173 1.00 76.20  ?  118 TYR A CD1   1 
ATOM   904   C  CD2   . TYR A 1 118 ? -50.043  77.375  -17.679 1.00 73.17  ?  118 TYR A CD2   1 
ATOM   905   C  CE1   . TYR A 1 118 ? -50.864  78.298  -15.205 1.00 76.32  ?  118 TYR A CE1   1 
ATOM   906   C  CE2   . TYR A 1 118 ? -49.104  77.703  -16.712 1.00 76.71  ?  118 TYR A CE2   1 
ATOM   907   C  CZ    . TYR A 1 118 ? -49.526  78.175  -15.485 1.00 76.93  ?  118 TYR A CZ    1 
ATOM   908   O  OH    . TYR A 1 118 ? -48.614  78.467  -14.511 1.00 80.42  ?  118 TYR A OH    1 
ATOM   909   N  N     . THR A 1 119 ? -54.102  75.266  -20.341 1.00 75.30  ?  119 THR A N     1 
ATOM   910   C  CA    . THR A 1 119 ? -55.003  75.363  -21.468 1.00 67.80  ?  119 THR A CA    1 
ATOM   911   C  C     . THR A 1 119 ? -56.133  74.339  -21.400 1.00 67.69  ?  119 THR A C     1 
ATOM   912   O  O     . THR A 1 119 ? -56.011  73.309  -20.748 1.00 69.24  ?  119 THR A O     1 
ATOM   913   C  CB    . THR A 1 119 ? -54.212  75.232  -22.789 1.00 66.90  ?  119 THR A CB    1 
ATOM   914   O  OG1   . THR A 1 119 ? -53.564  73.958  -22.835 1.00 69.45  ?  119 THR A OG1   1 
ATOM   915   C  CG2   . THR A 1 119 ? -53.140  76.308  -22.856 1.00 67.57  ?  119 THR A CG2   1 
ATOM   916   N  N     . GLU A 1 120 ? -57.242  74.642  -22.066 1.00 70.00  ?  120 GLU A N     1 
ATOM   917   C  CA    . GLU A 1 120 ? -58.293  73.665  -22.312 1.00 67.09  ?  120 GLU A CA    1 
ATOM   918   C  C     . GLU A 1 120 ? -58.469  73.492  -23.821 1.00 65.64  ?  120 GLU A C     1 
ATOM   919   O  O     . GLU A 1 120 ? -58.047  74.341  -24.598 1.00 69.96  ?  120 GLU A O     1 
ATOM   920   C  CB    . GLU A 1 120 ? -59.610  74.153  -21.754 1.00 74.80  ?  120 GLU A CB    1 
ATOM   921   C  CG    . GLU A 1 120 ? -59.566  74.636  -20.348 1.00 90.00  ?  120 GLU A CG    1 
ATOM   922   C  CD    . GLU A 1 120 ? -60.947  75.013  -19.872 1.00 100.65 ?  120 GLU A CD    1 
ATOM   923   O  OE1   . GLU A 1 120 ? -61.636  75.749  -20.627 1.00 101.19 ?  120 GLU A OE1   1 
ATOM   924   O  OE2   . GLU A 1 120 ? -61.345  74.546  -18.774 1.00 104.96 ?  120 GLU A OE2   1 
ATOM   925   N  N     . ALA A 1 121 ? -59.128  72.414  -24.235 1.00 61.14  ?  121 ALA A N     1 
ATOM   926   C  CA    . ALA A 1 121 ? -59.287  72.140  -25.653 1.00 56.37  ?  121 ALA A CA    1 
ATOM   927   C  C     . ALA A 1 121 ? -60.386  71.129  -25.935 1.00 61.36  ?  121 ALA A C     1 
ATOM   928   O  O     . ALA A 1 121 ? -60.872  70.431  -25.032 1.00 60.22  ?  121 ALA A O     1 
ATOM   929   C  CB    . ALA A 1 121 ? -57.983  71.659  -26.244 1.00 53.30  ?  121 ALA A CB    1 
ATOM   930   N  N     . ARG A 1 122 ? -60.766  71.075  -27.209 1.00 65.03  ?  122 ARG A N     1 
ATOM   931   C  CA    . ARG A 1 122 ? -61.757  70.137  -27.716 1.00 66.36  ?  122 ARG A CA    1 
ATOM   932   C  C     . ARG A 1 122 ? -61.581  70.066  -29.219 1.00 68.60  ?  122 ARG A C     1 
ATOM   933   O  O     . ARG A 1 122 ? -60.941  70.950  -29.808 1.00 68.36  ?  122 ARG A O     1 
ATOM   934   C  CB    . ARG A 1 122 ? -63.163  70.621  -27.408 1.00 67.98  ?  122 ARG A CB    1 
ATOM   935   C  CG    . ARG A 1 122 ? -63.449  72.033  -27.895 1.00 71.57  ?  122 ARG A CG    1 
ATOM   936   C  CD    . ARG A 1 122 ? -64.945  72.319  -27.884 1.00 73.95  ?  122 ARG A CD    1 
ATOM   937   N  NE    . ARG A 1 122 ? -65.249  73.738  -28.058 1.00 76.12  ?  122 ARG A NE    1 
ATOM   938   C  CZ    . ARG A 1 122 ? -66.249  74.357  -27.441 1.00 80.88  ?  122 ARG A CZ    1 
ATOM   939   N  NH1   . ARG A 1 122 ? -67.026  73.674  -26.610 1.00 78.97  ?  122 ARG A NH1   1 
ATOM   940   N  NH2   . ARG A 1 122 ? -66.472  75.653  -27.647 1.00 86.90  ?  122 ARG A NH2   1 
ATOM   941   N  N     . LEU A 1 123 ? -62.140  69.027  -29.841 1.00 65.81  ?  123 LEU A N     1 
ATOM   942   C  CA    . LEU A 1 123 ? -62.087  68.928  -31.300 1.00 62.62  ?  123 LEU A CA    1 
ATOM   943   C  C     . LEU A 1 123 ? -62.939  70.036  -31.896 1.00 68.27  ?  123 LEU A C     1 
ATOM   944   O  O     . LEU A 1 123 ? -63.968  70.400  -31.328 1.00 68.47  ?  123 LEU A O     1 
ATOM   945   C  CB    . LEU A 1 123 ? -62.578  67.566  -31.799 1.00 56.08  ?  123 LEU A CB    1 
ATOM   946   C  CG    . LEU A 1 123 ? -61.788  66.351  -31.316 1.00 52.79  ?  123 LEU A CG    1 
ATOM   947   C  CD1   . LEU A 1 123 ? -62.498  65.046  -31.679 1.00 48.67  ?  123 LEU A CD1   1 
ATOM   948   C  CD2   . LEU A 1 123 ? -60.367  66.376  -31.861 1.00 56.22  ?  123 LEU A CD2   1 
ATOM   949   N  N     . SER A 1 124 ? -62.496  70.580  -33.029 1.00 69.78  ?  124 SER A N     1 
ATOM   950   C  CA    . SER A 1 124 ? -63.284  71.554  -33.774 1.00 67.44  ?  124 SER A CA    1 
ATOM   951   C  C     . SER A 1 124 ? -64.429  70.829  -34.471 1.00 64.46  ?  124 SER A C     1 
ATOM   952   O  O     . SER A 1 124 ? -64.370  69.615  -34.656 1.00 58.32  ?  124 SER A O     1 
ATOM   953   C  CB    . SER A 1 124 ? -62.410  72.236  -34.812 1.00 69.14  ?  124 SER A CB    1 
ATOM   954   O  OG    . SER A 1 124 ? -62.050  71.321  -35.828 1.00 70.65  ?  124 SER A OG    1 
ATOM   955   N  N     . GLU A 1 125 ? -65.471  71.552  -34.868 1.00 67.45  ?  125 GLU A N     1 
ATOM   956   C  CA    . GLU A 1 125 ? -66.546  70.892  -35.604 1.00 68.33  ?  125 GLU A CA    1 
ATOM   957   C  C     . GLU A 1 125 ? -66.019  70.160  -36.857 1.00 68.95  ?  125 GLU A C     1 
ATOM   958   O  O     . GLU A 1 125 ? -66.378  69.004  -37.116 1.00 63.35  ?  125 GLU A O     1 
ATOM   959   C  CB    . GLU A 1 125 ? -67.660  71.866  -35.978 1.00 62.42  ?  125 GLU A CB    1 
ATOM   960   C  CG    . GLU A 1 125 ? -68.877  71.172  -36.534 1.00 64.10  ?  125 GLU A CG    1 
ATOM   961   C  CD    . GLU A 1 125 ? -70.067  72.112  -36.671 1.00 75.69  ?  125 GLU A CD    1 
ATOM   962   O  OE1   . GLU A 1 125 ? -69.860  73.344  -36.536 1.00 81.27  ?  125 GLU A OE1   1 
ATOM   963   O  OE2   . GLU A 1 125 ? -71.204  71.616  -36.900 1.00 77.92  ?  125 GLU A OE2   1 
ATOM   964   N  N     . ILE A 1 126 ? -65.154  70.815  -37.624 1.00 67.25  ?  126 ILE A N     1 
ATOM   965   C  CA    . ILE A 1 126 ? -64.657  70.180  -38.833 1.00 63.36  ?  126 ILE A CA    1 
ATOM   966   C  C     . ILE A 1 126 ? -63.923  68.873  -38.525 1.00 64.33  ?  126 ILE A C     1 
ATOM   967   O  O     . ILE A 1 126 ? -64.005  67.903  -39.293 1.00 64.69  ?  126 ILE A O     1 
ATOM   968   C  CB    . ILE A 1 126 ? -63.753  71.114  -39.627 1.00 56.12  ?  126 ILE A CB    1 
ATOM   969   C  CG1   . ILE A 1 126 ? -63.814  70.765  -41.107 1.00 52.15  ?  126 ILE A CG1   1 
ATOM   970   C  CG2   . ILE A 1 126 ? -62.328  71.020  -39.122 1.00 58.27  ?  126 ILE A CG2   1 
ATOM   971   C  CD1   . ILE A 1 126 ? -63.368  71.887  -42.007 1.00 54.02  ?  126 ILE A CD1   1 
ATOM   972   N  N     . ALA A 1 127 ? -63.205  68.857  -37.404 1.00 62.22  ?  127 ALA A N     1 
ATOM   973   C  CA    . ALA A 1 127 ? -62.460  67.674  -36.974 1.00 61.76  ?  127 ALA A CA    1 
ATOM   974   C  C     . ALA A 1 127 ? -63.377  66.455  -36.940 1.00 57.49  ?  127 ALA A C     1 
ATOM   975   O  O     . ALA A 1 127 ? -62.996  65.339  -37.305 1.00 58.98  ?  127 ALA A O     1 
ATOM   976   C  CB    . ALA A 1 127 ? -61.874  67.899  -35.608 1.00 60.42  ?  127 ALA A CB    1 
ATOM   977   N  N     . GLY A 1 128 ? -64.596  66.682  -36.488 1.00 52.83  ?  128 GLY A N     1 
ATOM   978   C  CA    . GLY A 1 128 ? -65.569  65.619  -36.415 1.00 62.93  ?  128 GLY A CA    1 
ATOM   979   C  C     . GLY A 1 128 ? -65.763  64.995  -37.768 1.00 69.04  ?  128 GLY A C     1 
ATOM   980   O  O     . GLY A 1 128 ? -65.896  63.777  -37.895 1.00 76.46  ?  128 GLY A O     1 
ATOM   981   N  N     . TYR A 1 129 ? -65.766  65.832  -38.792 1.00 66.18  ?  129 TYR A N     1 
ATOM   982   C  CA    . TYR A 1 129 ? -65.921  65.320  -40.138 1.00 62.94  ?  129 TYR A CA    1 
ATOM   983   C  C     . TYR A 1 129 ? -64.779  64.387  -40.561 1.00 66.62  ?  129 TYR A C     1 
ATOM   984   O  O     . TYR A 1 129 ? -65.021  63.409  -41.252 1.00 75.07  ?  129 TYR A O     1 
ATOM   985   C  CB    . TYR A 1 129 ? -66.177  66.452  -41.120 1.00 58.51  ?  129 TYR A CB    1 
ATOM   986   C  CG    . TYR A 1 129 ? -67.623  66.878  -41.118 1.00 56.66  ?  129 TYR A CG    1 
ATOM   987   C  CD1   . TYR A 1 129 ? -68.523  66.324  -42.006 1.00 56.50  ?  129 TYR A CD1   1 
ATOM   988   C  CD2   . TYR A 1 129 ? -68.093  67.823  -40.214 1.00 56.40  ?  129 TYR A CD2   1 
ATOM   989   C  CE1   . TYR A 1 129 ? -69.855  66.710  -42.008 1.00 60.05  ?  129 TYR A CE1   1 
ATOM   990   C  CE2   . TYR A 1 129 ? -69.430  68.216  -40.201 1.00 51.84  ?  129 TYR A CE2   1 
ATOM   991   C  CZ    . TYR A 1 129 ? -70.304  67.657  -41.102 1.00 58.38  ?  129 TYR A CZ    1 
ATOM   992   O  OH    . TYR A 1 129 ? -71.627  68.049  -41.129 1.00 65.55  ?  129 TYR A OH    1 
ATOM   993   N  N     . LEU A 1 130 ? -63.553  64.658  -40.124 1.00 63.37  ?  130 LEU A N     1 
ATOM   994   C  CA    . LEU A 1 130 ? -62.491  63.649  -40.233 1.00 63.77  ?  130 LEU A CA    1 
ATOM   995   C  C     . LEU A 1 130 ? -62.817  62.294  -39.571 1.00 65.44  ?  130 LEU A C     1 
ATOM   996   O  O     . LEU A 1 130 ? -62.282  61.258  -39.981 1.00 71.24  ?  130 LEU A O     1 
ATOM   997   C  CB    . LEU A 1 130 ? -61.184  64.165  -39.639 1.00 61.78  ?  130 LEU A CB    1 
ATOM   998   C  CG    . LEU A 1 130 ? -60.365  65.009  -40.592 1.00 66.74  ?  130 LEU A CG    1 
ATOM   999   C  CD1   . LEU A 1 130 ? -58.917  64.987  -40.179 1.00 67.73  ?  130 LEU A CD1   1 
ATOM   1000  C  CD2   . LEU A 1 130 ? -60.547  64.458  -41.986 1.00 72.45  ?  130 LEU A CD2   1 
ATOM   1001  N  N     . LEU A 1 131 ? -63.661  62.300  -38.539 1.00 59.79  ?  131 LEU A N     1 
ATOM   1002  C  CA    . LEU A 1 131 ? -63.910  61.086  -37.762 1.00 63.00  ?  131 LEU A CA    1 
ATOM   1003  C  C     . LEU A 1 131 ? -65.256  60.490  -38.079 1.00 66.70  ?  131 LEU A C     1 
ATOM   1004  O  O     . LEU A 1 131 ? -65.650  59.473  -37.495 1.00 72.39  ?  131 LEU A O     1 
ATOM   1005  C  CB    . LEU A 1 131 ? -63.835  61.351  -36.255 1.00 59.89  ?  131 LEU A CB    1 
ATOM   1006  C  CG    . LEU A 1 131 ? -62.527  61.914  -35.723 1.00 54.33  ?  131 LEU A CG    1 
ATOM   1007  C  CD1   . LEU A 1 131 ? -62.836  62.780  -34.537 1.00 49.42  ?  131 LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A 1 131 ? -61.595  60.784  -35.344 1.00 55.81  ?  131 LEU A CD2   1 
ATOM   1009  N  N     . GLN A 1 132 ? -65.959  61.121  -39.010 1.00 62.10  ?  132 GLN A N     1 
ATOM   1010  C  CA    . GLN A 1 132 ? -67.326  60.718  -39.316 1.00 63.41  ?  132 GLN A CA    1 
ATOM   1011  C  C     . GLN A 1 132 ? -67.398  59.213  -39.603 1.00 68.46  ?  132 GLN A C     1 
ATOM   1012  O  O     . GLN A 1 132 ? -66.588  58.666  -40.346 1.00 75.60  ?  132 GLN A O     1 
ATOM   1013  C  CB    . GLN A 1 132 ? -67.852  61.550  -40.478 1.00 53.11  ?  132 GLN A CB    1 
ATOM   1014  C  CG    . GLN A 1 132 ? -69.351  61.590  -40.659 1.00 60.47  ?  132 GLN A CG    1 
ATOM   1015  C  CD    . GLN A 1 132 ? -69.711  62.187  -42.017 1.00 81.16  ?  132 GLN A CD    1 
ATOM   1016  O  OE1   . GLN A 1 132 ? -69.172  61.773  -43.064 1.00 93.47  ?  132 GLN A OE1   1 
ATOM   1017  N  NE2   . GLN A 1 132 ? -70.602  63.179  -42.011 1.00 83.30  ?  132 GLN A NE2   1 
ATOM   1018  N  N     . ASP A 1 133 ? -68.333  58.535  -38.961 1.00 67.37  ?  133 ASP A N     1 
ATOM   1019  C  CA    . ASP A 1 133 ? -68.583  57.137  -39.270 1.00 73.85  ?  133 ASP A CA    1 
ATOM   1020  C  C     . ASP A 1 133 ? -67.532  56.127  -38.788 1.00 68.66  ?  133 ASP A C     1 
ATOM   1021  O  O     . ASP A 1 133 ? -67.672  54.931  -39.060 1.00 70.85  ?  133 ASP A O     1 
ATOM   1022  C  CB    . ASP A 1 133 ? -68.826  56.982  -40.767 1.00 82.63  ?  133 ASP A CB    1 
ATOM   1023  C  CG    . ASP A 1 133 ? -70.117  57.656  -41.217 1.00 95.23  ?  133 ASP A CG    1 
ATOM   1024  O  OD1   . ASP A 1 133 ? -71.154  57.491  -40.524 1.00 100.78 ?  133 ASP A OD1   1 
ATOM   1025  O  OD2   . ASP A 1 133 ? -70.086  58.350  -42.260 1.00 96.62  ?  133 ASP A OD2   1 
ATOM   1026  N  N     . ILE A 1 134 ? -66.511  56.589  -38.058 1.00 62.75  ?  134 ILE A N     1 
ATOM   1027  C  CA    . ILE A 1 134 ? -65.511  55.680  -37.464 1.00 62.18  ?  134 ILE A CA    1 
ATOM   1028  C  C     . ILE A 1 134 ? -66.141  54.535  -36.643 1.00 61.59  ?  134 ILE A C     1 
ATOM   1029  O  O     . ILE A 1 134 ? -65.598  53.419  -36.542 1.00 61.40  ?  134 ILE A O     1 
ATOM   1030  C  CB    . ILE A 1 134 ? -64.496  56.432  -36.575 1.00 56.68  ?  134 ILE A CB    1 
ATOM   1031  C  CG1   . ILE A 1 134 ? -63.361  55.506  -36.173 1.00 55.49  ?  134 ILE A CG1   1 
ATOM   1032  C  CG2   . ILE A 1 134 ? -65.149  56.907  -35.312 1.00 53.70  ?  134 ILE A CG2   1 
ATOM   1033  C  CD1   . ILE A 1 134 ? -62.053  56.207  -36.074 1.00 58.09  ?  134 ILE A CD1   1 
ATOM   1034  N  N     . GLU A 1 135 ? -67.300  54.815  -36.069 1.00 60.11  ?  135 GLU A N     1 
ATOM   1035  C  CA    . GLU A 1 135 ? -67.987  53.842  -35.240 1.00 61.91  ?  135 GLU A CA    1 
ATOM   1036  C  C     . GLU A 1 135 ? -68.759  52.831  -36.078 1.00 65.10  ?  135 GLU A C     1 
ATOM   1037  O  O     . GLU A 1 135 ? -69.523  52.033  -35.533 1.00 69.21  ?  135 GLU A O     1 
ATOM   1038  C  CB    . GLU A 1 135 ? -68.943  54.559  -34.278 1.00 65.28  ?  135 GLU A CB    1 
ATOM   1039  C  CG    . GLU A 1 135 ? -70.275  55.038  -34.895 1.00 74.39  ?  135 GLU A CG    1 
ATOM   1040  C  CD    . GLU A 1 135 ? -70.146  56.347  -35.668 1.00 90.03  ?  135 GLU A CD    1 
ATOM   1041  O  OE1   . GLU A 1 135 ? -69.034  56.927  -35.694 1.00 95.75  ?  135 GLU A OE1   1 
ATOM   1042  O  OE2   . GLU A 1 135 ? -71.163  56.796  -36.254 1.00 96.85  ?  135 GLU A OE2   1 
ATOM   1043  N  N     . LYS A 1 136 ? -68.594  52.876  -37.401 1.00 66.96  ?  136 LYS A N     1 
ATOM   1044  C  CA    . LYS A 1 136 ? -69.312  51.927  -38.260 1.00 65.84  ?  136 LYS A CA    1 
ATOM   1045  C  C     . LYS A 1 136 ? -68.392  50.947  -38.978 1.00 70.02  ?  136 LYS A C     1 
ATOM   1046  O  O     . LYS A 1 136 ? -68.774  50.386  -39.987 1.00 68.45  ?  136 LYS A O     1 
ATOM   1047  C  CB    . LYS A 1 136 ? -70.189  52.625  -39.296 1.00 60.36  ?  136 LYS A CB    1 
ATOM   1048  C  CG    . LYS A 1 136 ? -70.867  53.877  -38.831 1.00 55.86  ?  136 LYS A CG    1 
ATOM   1049  C  CD    . LYS A 1 136 ? -72.365  53.749  -38.951 1.00 59.30  ?  136 LYS A CD    1 
ATOM   1050  C  CE    . LYS A 1 136 ? -72.989  55.000  -39.580 1.00 57.71  ?  136 LYS A CE    1 
ATOM   1051  N  NZ    . LYS A 1 136 ? -74.487  54.904  -39.545 1.00 55.25  ?  136 LYS A NZ    1 
ATOM   1052  N  N     . LYS A 1 137 ? -67.197  50.726  -38.441 1.00 76.95  ?  137 LYS A N     1 
ATOM   1053  C  CA    . LYS A 1 137 ? -66.281  49.736  -38.999 1.00 67.91  ?  137 LYS A CA    1 
ATOM   1054  C  C     . LYS A 1 137 ? -66.033  50.115  -40.445 1.00 66.08  ?  137 LYS A C     1 
ATOM   1055  O  O     . LYS A 1 137 ? -66.236  49.300  -41.353 1.00 67.58  ?  137 LYS A O     1 
ATOM   1056  C  CB    . LYS A 1 137 ? -66.832  48.293  -38.872 1.00 58.29  ?  137 LYS A CB    1 
ATOM   1057  C  CG    . LYS A 1 137 ? -67.356  47.931  -37.467 1.00 63.90  ?  137 LYS A CG    1 
ATOM   1058  C  CD    . LYS A 1 137 ? -67.376  46.430  -37.167 1.00 63.03  ?  137 LYS A CD    1 
ATOM   1059  N  N     . THR A 1 138 ? -65.603  51.363  -40.641 1.00 62.05  ?  138 THR A N     1 
ATOM   1060  C  CA    . THR A 1 138 ? -65.281  51.892  -41.970 1.00 66.35  ?  138 THR A CA    1 
ATOM   1061  C  C     . THR A 1 138 ? -63.784  51.991  -42.273 1.00 67.67  ?  138 THR A C     1 
ATOM   1062  O  O     . THR A 1 138 ? -63.391  52.327  -43.384 1.00 64.30  ?  138 THR A O     1 
ATOM   1063  C  CB    . THR A 1 138 ? -65.846  53.302  -42.146 1.00 66.52  ?  138 THR A CB    1 
ATOM   1064  O  OG1   . THR A 1 138 ? -65.428  54.119  -41.040 1.00 68.07  ?  138 THR A OG1   1 
ATOM   1065  C  CG2   . THR A 1 138 ? -67.368  53.259  -42.238 1.00 68.33  ?  138 THR A CG2   1 
ATOM   1066  N  N     . VAL A 1 139 ? -62.954  51.722  -41.278 1.00 68.32  ?  139 VAL A N     1 
ATOM   1067  C  CA    . VAL A 1 139 ? -61.514  51.843  -41.423 1.00 62.46  ?  139 VAL A CA    1 
ATOM   1068  C  C     . VAL A 1 139 ? -60.837  50.757  -40.604 1.00 65.52  ?  139 VAL A C     1 
ATOM   1069  O  O     . VAL A 1 139 ? -61.275  50.452  -39.495 1.00 76.33  ?  139 VAL A O     1 
ATOM   1070  C  CB    . VAL A 1 139 ? -61.024  53.185  -40.883 1.00 63.06  ?  139 VAL A CB    1 
ATOM   1071  C  CG1   . VAL A 1 139 ? -59.521  53.206  -40.878 1.00 76.97  ?  139 VAL A CG1   1 
ATOM   1072  C  CG2   . VAL A 1 139 ? -61.566  54.330  -41.709 1.00 54.32  ?  139 VAL A CG2   1 
ATOM   1073  N  N     . PRO A 1 140 ? -59.762  50.165  -41.144 1.00 65.19  ?  140 PRO A N     1 
ATOM   1074  C  CA    . PRO A 1 140 ? -58.954  49.160  -40.435 1.00 70.25  ?  140 PRO A CA    1 
ATOM   1075  C  C     . PRO A 1 140 ? -58.377  49.644  -39.103 1.00 68.80  ?  140 PRO A C     1 
ATOM   1076  O  O     . PRO A 1 140 ? -57.784  50.728  -39.004 1.00 60.46  ?  140 PRO A O     1 
ATOM   1077  C  CB    . PRO A 1 140 ? -57.804  48.889  -41.415 1.00 63.83  ?  140 PRO A CB    1 
ATOM   1078  C  CG    . PRO A 1 140 ? -57.761  50.120  -42.264 1.00 55.16  ?  140 PRO A CG    1 
ATOM   1079  C  CD    . PRO A 1 140 ? -59.206  50.435  -42.474 1.00 49.07  ?  140 PRO A CD    1 
ATOM   1080  N  N     . PHE A 1 141 ? -58.537  48.814  -38.082 1.00 72.87  ?  141 PHE A N     1 
ATOM   1081  C  CA    . PHE A 1 141 ? -57.958  49.100  -36.779 1.00 72.01  ?  141 PHE A CA    1 
ATOM   1082  C  C     . PHE A 1 141 ? -56.781  48.163  -36.501 1.00 78.38  ?  141 PHE A C     1 
ATOM   1083  O  O     . PHE A 1 141 ? -56.728  47.052  -37.026 1.00 88.70  ?  141 PHE A O     1 
ATOM   1084  C  CB    . PHE A 1 141 ? -59.028  48.979  -35.685 1.00 69.47  ?  141 PHE A CB    1 
ATOM   1085  C  CG    . PHE A 1 141 ? -59.862  50.224  -35.508 1.00 72.37  ?  141 PHE A CG    1 
ATOM   1086  C  CD1   . PHE A 1 141 ? -60.840  50.555  -36.422 1.00 69.48  ?  141 PHE A CD1   1 
ATOM   1087  C  CD2   . PHE A 1 141 ? -59.663  51.060  -34.419 1.00 79.48  ?  141 PHE A CD2   1 
ATOM   1088  C  CE1   . PHE A 1 141 ? -61.598  51.696  -36.264 1.00 68.60  ?  141 PHE A CE1   1 
ATOM   1089  C  CE2   . PHE A 1 141 ? -60.421  52.202  -34.259 1.00 76.67  ?  141 PHE A CE2   1 
ATOM   1090  C  CZ    . PHE A 1 141 ? -61.390  52.518  -35.187 1.00 72.07  ?  141 PHE A CZ    1 
ATOM   1091  N  N     . ALA A 1 142 ? -55.829  48.622  -35.695 1.00 74.85  ?  142 ALA A N     1 
ATOM   1092  C  CA    . ALA A 1 142 ? -54.731  47.772  -35.247 1.00 74.74  ?  142 ALA A CA    1 
ATOM   1093  C  C     . ALA A 1 142 ? -54.726  47.762  -33.742 1.00 80.03  ?  142 ALA A C     1 
ATOM   1094  O  O     . ALA A 1 142 ? -55.527  48.451  -33.119 1.00 85.40  ?  142 ALA A O     1 
ATOM   1095  C  CB    . ALA A 1 142 ? -53.428  48.293  -35.746 1.00 54.63  ?  142 ALA A CB    1 
ATOM   1096  N  N     . TRP A 1 143 ? -53.818  46.996  -33.152 1.00 82.06  ?  143 TRP A N     1 
ATOM   1097  C  CA    . TRP A 1 143 ? -53.659  47.033  -31.705 1.00 83.57  ?  143 TRP A CA    1 
ATOM   1098  C  C     . TRP A 1 143 ? -52.745  48.161  -31.305 1.00 80.12  ?  143 TRP A C     1 
ATOM   1099  O  O     . TRP A 1 143 ? -51.796  48.479  -32.021 1.00 82.80  ?  143 TRP A O     1 
ATOM   1100  C  CB    . TRP A 1 143 ? -53.093  45.720  -31.190 1.00 91.29  ?  143 TRP A CB    1 
ATOM   1101  C  CG    . TRP A 1 143 ? -54.091  44.634  -31.236 1.00 97.91  ?  143 TRP A CG    1 
ATOM   1102  C  CD1   . TRP A 1 143 ? -54.157  43.624  -32.141 1.00 100.71 ?  143 TRP A CD1   1 
ATOM   1103  C  CD2   . TRP A 1 143 ? -55.200  44.455  -30.348 1.00 95.26  ?  143 TRP A CD2   1 
ATOM   1104  N  NE1   . TRP A 1 143 ? -55.233  42.813  -31.865 1.00 99.63  ?  143 TRP A NE1   1 
ATOM   1105  C  CE2   . TRP A 1 143 ? -55.889  43.304  -30.769 1.00 94.37  ?  143 TRP A CE2   1 
ATOM   1106  C  CE3   . TRP A 1 143 ? -55.671  45.152  -29.234 1.00 92.67  ?  143 TRP A CE3   1 
ATOM   1107  C  CZ2   . TRP A 1 143 ? -57.018  42.834  -30.119 1.00 94.01  ?  143 TRP A CZ2   1 
ATOM   1108  C  CZ3   . TRP A 1 143 ? -56.795  44.685  -28.590 1.00 92.83  ?  143 TRP A CZ3   1 
ATOM   1109  C  CH2   . TRP A 1 143 ? -57.455  43.537  -29.032 1.00 93.36  ?  143 TRP A CH2   1 
ATOM   1110  N  N     . ASN A 1 144 ? -53.037  48.774  -30.163 1.00 78.57  ?  144 ASN A N     1 
ATOM   1111  C  CA    . ASN A 1 144 ? -52.117  49.749  -29.598 1.00 79.97  ?  144 ASN A CA    1 
ATOM   1112  C  C     . ASN A 1 144 ? -50.849  49.043  -29.124 1.00 81.31  ?  144 ASN A C     1 
ATOM   1113  O  O     . ASN A 1 144 ? -50.761  47.820  -29.181 1.00 85.86  ?  144 ASN A O     1 
ATOM   1114  C  CB    . ASN A 1 144 ? -52.774  50.563  -28.472 1.00 79.61  ?  144 ASN A CB    1 
ATOM   1115  C  CG    . ASN A 1 144 ? -53.167  49.712  -27.272 1.00 82.60  ?  144 ASN A CG    1 
ATOM   1116  O  OD1   . ASN A 1 144 ? -52.927  48.506  -27.245 1.00 82.79  ?  144 ASN A OD1   1 
ATOM   1117  N  ND2   . ASN A 1 144 ? -53.772  50.346  -26.268 1.00 82.53  ?  144 ASN A ND2   1 
ATOM   1118  N  N     . PHE A 1 145 ? -49.862  49.811  -28.679 1.00 77.67  ?  145 PHE A N     1 
ATOM   1119  C  CA    . PHE A 1 145 ? -48.637  49.238  -28.123 1.00 84.65  ?  145 PHE A CA    1 
ATOM   1120  C  C     . PHE A 1 145 ? -48.934  48.223  -26.997 1.00 92.25  ?  145 PHE A C     1 
ATOM   1121  O  O     . PHE A 1 145 ? -48.239  47.222  -26.848 1.00 92.99  ?  145 PHE A O     1 
ATOM   1122  C  CB    . PHE A 1 145 ? -47.715  50.361  -27.626 1.00 84.07  ?  145 PHE A CB    1 
ATOM   1123  C  CG    . PHE A 1 145 ? -48.342  51.233  -26.579 1.00 84.95  ?  145 PHE A CG    1 
ATOM   1124  C  CD1   . PHE A 1 145 ? -48.021  51.074  -25.240 1.00 83.93  ?  145 PHE A CD1   1 
ATOM   1125  C  CD2   . PHE A 1 145 ? -49.274  52.195  -26.927 1.00 89.58  ?  145 PHE A CD2   1 
ATOM   1126  C  CE1   . PHE A 1 145 ? -48.606  51.863  -24.279 1.00 84.83  ?  145 PHE A CE1   1 
ATOM   1127  C  CE2   . PHE A 1 145 ? -49.865  52.990  -25.964 1.00 89.57  ?  145 PHE A CE2   1 
ATOM   1128  C  CZ    . PHE A 1 145 ? -49.530  52.822  -24.641 1.00 86.71  ?  145 PHE A CZ    1 
ATOM   1129  N  N     . ASP A 1 146 ? -49.976  48.493  -26.218 1.00 97.04  ?  146 ASP A N     1 
ATOM   1130  C  CA    . ASP A 1 146 ? -50.359  47.660  -25.080 1.00 99.94  ?  146 ASP A CA    1 
ATOM   1131  C  C     . ASP A 1 146 ? -50.819  46.273  -25.498 1.00 99.23  ?  146 ASP A C     1 
ATOM   1132  O  O     . ASP A 1 146 ? -50.755  45.339  -24.706 1.00 104.31 ?  146 ASP A O     1 
ATOM   1133  C  CB    . ASP A 1 146 ? -51.537  48.310  -24.350 1.00 107.87 ?  146 ASP A CB    1 
ATOM   1134  C  CG    . ASP A 1 146 ? -51.154  48.905  -23.016 1.00 120.07 ?  146 ASP A CG    1 
ATOM   1135  O  OD1   . ASP A 1 146 ? -50.120  48.492  -22.450 1.00 125.30 ?  146 ASP A OD1   1 
ATOM   1136  O  OD2   . ASP A 1 146 ? -51.905  49.782  -22.529 1.00 124.75 ?  146 ASP A OD2   1 
ATOM   1137  N  N     . ASP A 1 147 ? -51.298  46.152  -26.736 1.00 98.55  ?  147 ASP A N     1 
ATOM   1138  C  CA    . ASP A 1 147 ? -52.193  45.053  -27.131 1.00 101.36 ?  147 ASP A CA    1 
ATOM   1139  C  C     . ASP A 1 147 ? -53.353  44.952  -26.138 1.00 104.73 ?  147 ASP A C     1 
ATOM   1140  O  O     . ASP A 1 147 ? -53.697  43.867  -25.674 1.00 111.01 ?  147 ASP A O     1 
ATOM   1141  C  CB    . ASP A 1 147 ? -51.465  43.710  -27.277 1.00 106.60 ?  147 ASP A CB    1 
ATOM   1142  C  CG    . ASP A 1 147 ? -50.475  43.700  -28.436 1.00 116.08 ?  147 ASP A CG    1 
ATOM   1143  O  OD1   . ASP A 1 147 ? -49.376  43.121  -28.275 1.00 123.85 ?  147 ASP A OD1   1 
ATOM   1144  O  OD2   . ASP A 1 147 ? -50.789  44.272  -29.505 1.00 116.83 ?  147 ASP A OD2   1 
ATOM   1145  N  N     . THR A 1 148 ? -53.938  46.103  -25.813 1.00 100.65 ?  148 THR A N     1 
ATOM   1146  C  CA    . THR A 1 148 ? -55.091  46.181  -24.918 1.00 95.61  ?  148 THR A CA    1 
ATOM   1147  C  C     . THR A 1 148 ? -56.252  46.914  -25.593 1.00 91.89  ?  148 THR A C     1 
ATOM   1148  O  O     . THR A 1 148 ? -57.415  46.691  -25.260 1.00 94.11  ?  148 THR A O     1 
ATOM   1149  C  CB    . THR A 1 148 ? -54.736  46.904  -23.609 1.00 95.72  ?  148 THR A CB    1 
ATOM   1150  O  OG1   . THR A 1 148 ? -54.655  48.319  -23.834 1.00 92.63  ?  148 THR A OG1   1 
ATOM   1151  C  CG2   . THR A 1 148 ? -53.402  46.414  -23.106 1.00 103.59 ?  148 THR A CG2   1 
ATOM   1152  N  N     . GLU A 1 149 ? -55.934  47.783  -26.548 1.00 84.76  ?  149 GLU A N     1 
ATOM   1153  C  CA    . GLU A 1 149 ? -56.959  48.549  -27.237 1.00 80.07  ?  149 GLU A CA    1 
ATOM   1154  C  C     . GLU A 1 149 ? -56.650  48.658  -28.726 1.00 78.68  ?  149 GLU A C     1 
ATOM   1155  O  O     . GLU A 1 149 ? -55.489  48.833  -29.114 1.00 79.34  ?  149 GLU A O     1 
ATOM   1156  C  CB    . GLU A 1 149 ? -57.060  49.941  -26.621 1.00 83.33  ?  149 GLU A CB    1 
ATOM   1157  C  CG    . GLU A 1 149 ? -58.384  50.637  -26.860 1.00 95.94  ?  149 GLU A CG    1 
ATOM   1158  C  CD    . GLU A 1 149 ? -58.464  51.978  -26.153 1.00 109.83 ?  149 GLU A CD    1 
ATOM   1159  O  OE1   . GLU A 1 149 ? -57.763  52.156  -25.130 1.00 110.73 ?  149 GLU A OE1   1 
ATOM   1160  O  OE2   . GLU A 1 149 ? -59.222  52.855  -26.626 1.00 118.19 ?  149 GLU A OE2   1 
ATOM   1161  N  N     . LYS A 1 150 ? -57.686  48.542  -29.559 1.00 78.26  ?  150 LYS A N     1 
ATOM   1162  C  CA    . LYS A 1 150 ? -57.545  48.799  -30.994 1.00 77.47  ?  150 LYS A CA    1 
ATOM   1163  C  C     . LYS A 1 150 ? -57.513  50.312  -31.250 1.00 73.50  ?  150 LYS A C     1 
ATOM   1164  O  O     . LYS A 1 150 ? -57.955  51.097  -30.409 1.00 80.17  ?  150 LYS A O     1 
ATOM   1165  C  CB    . LYS A 1 150 ? -58.665  48.123  -31.806 1.00 80.29  ?  150 LYS A CB    1 
ATOM   1166  C  CG    . LYS A 1 150 ? -58.572  46.580  -31.934 1.00 64.73  ?  150 LYS A CG    1 
ATOM   1167  N  N     . GLU A 1 151 ? -56.955  50.710  -32.390 1.00 66.04  ?  151 GLU A N     1 
ATOM   1168  C  CA    . GLU A 1 151 ? -56.918  52.112  -32.814 1.00 68.20  ?  151 GLU A CA    1 
ATOM   1169  C  C     . GLU A 1 151 ? -56.916  52.197  -34.335 1.00 79.11  ?  151 GLU A C     1 
ATOM   1170  O  O     . GLU A 1 151 ? -56.352  51.337  -35.007 1.00 87.87  ?  151 GLU A O     1 
ATOM   1171  C  CB    . GLU A 1 151 ? -55.684  52.836  -32.270 1.00 64.66  ?  151 GLU A CB    1 
ATOM   1172  C  CG    . GLU A 1 151 ? -54.351  52.252  -32.721 1.00 71.30  ?  151 GLU A CG    1 
ATOM   1173  C  CD    . GLU A 1 151 ? -53.207  53.243  -32.549 1.00 80.25  ?  151 GLU A CD    1 
ATOM   1174  O  OE1   . GLU A 1 151 ? -52.071  52.816  -32.214 1.00 83.30  ?  151 GLU A OE1   1 
ATOM   1175  O  OE2   . GLU A 1 151 ? -53.454  54.455  -32.766 1.00 81.89  ?  151 GLU A OE2   1 
ATOM   1176  N  N     . PRO A 1 152 ? -57.527  53.254  -34.886 1.00 73.14  ?  152 PRO A N     1 
ATOM   1177  C  CA    . PRO A 1 152 ? -57.693  53.318  -36.334 1.00 69.63  ?  152 PRO A CA    1 
ATOM   1178  C  C     . PRO A 1 152 ? -56.354  53.640  -36.996 1.00 71.98  ?  152 PRO A C     1 
ATOM   1179  O  O     . PRO A 1 152 ? -55.605  54.472  -36.469 1.00 74.84  ?  152 PRO A O     1 
ATOM   1180  C  CB    . PRO A 1 152 ? -58.658  54.489  -36.496 1.00 67.67  ?  152 PRO A CB    1 
ATOM   1181  C  CG    . PRO A 1 152 ? -58.229  55.432  -35.428 1.00 65.20  ?  152 PRO A CG    1 
ATOM   1182  C  CD    . PRO A 1 152 ? -57.838  54.547  -34.252 1.00 69.51  ?  152 PRO A CD    1 
ATOM   1183  N  N     . THR A 1 153 ? -56.067  52.987  -38.123 1.00 68.22  ?  153 THR A N     1 
ATOM   1184  C  CA    . THR A 1 153 ? -54.824  53.196  -38.878 1.00 63.28  ?  153 THR A CA    1 
ATOM   1185  C  C     . THR A 1 153 ? -54.909  54.395  -39.804 1.00 61.14  ?  153 THR A C     1 
ATOM   1186  O  O     . THR A 1 153 ? -53.890  55.010  -40.112 1.00 67.21  ?  153 THR A O     1 
ATOM   1187  C  CB    . THR A 1 153 ? -54.477  51.978  -39.728 1.00 70.76  ?  153 THR A CB    1 
ATOM   1188  O  OG1   . THR A 1 153 ? -55.583  51.668  -40.596 1.00 76.09  ?  153 THR A OG1   1 
ATOM   1189  C  CG2   . THR A 1 153 ? -54.205  50.798  -38.836 1.00 71.96  ?  153 THR A CG2   1 
ATOM   1190  N  N     . VAL A 1 154 ? -56.125  54.701  -40.259 1.00 56.17  ?  154 VAL A N     1 
ATOM   1191  C  CA    . VAL A 1 154 ? -56.421  55.905  -41.040 1.00 62.28  ?  154 VAL A CA    1 
ATOM   1192  C  C     . VAL A 1 154 ? -57.820  56.397  -40.643 1.00 65.25  ?  154 VAL A C     1 
ATOM   1193  O  O     . VAL A 1 154 ? -58.669  55.589  -40.274 1.00 68.67  ?  154 VAL A O     1 
ATOM   1194  C  CB    . VAL A 1 154 ? -56.408  55.597  -42.561 1.00 65.17  ?  154 VAL A CB    1 
ATOM   1195  C  CG1   . VAL A 1 154 ? -57.384  54.463  -42.894 1.00 59.41  ?  154 VAL A CG1   1 
ATOM   1196  C  CG2   . VAL A 1 154 ? -56.756  56.837  -43.372 1.00 63.52  ?  154 VAL A CG2   1 
ATOM   1197  N  N     . LEU A 1 155 ? -58.088  57.699  -40.710 1.00 60.01  ?  155 LEU A N     1 
ATOM   1198  C  CA    . LEU A 1 155 ? -59.463  58.143  -40.445 1.00 60.41  ?  155 LEU A CA    1 
ATOM   1199  C  C     . LEU A 1 155 ? -60.329  58.152  -41.705 1.00 68.66  ?  155 LEU A C     1 
ATOM   1200  O  O     . LEU A 1 155 ? -59.818  58.159  -42.815 1.00 74.04  ?  155 LEU A O     1 
ATOM   1201  C  CB    . LEU A 1 155 ? -59.498  59.509  -39.762 1.00 55.26  ?  155 LEU A CB    1 
ATOM   1202  C  CG    . LEU A 1 155 ? -58.652  59.646  -38.503 1.00 56.41  ?  155 LEU A CG    1 
ATOM   1203  C  CD1   . LEU A 1 155 ? -58.762  61.055  -37.967 1.00 52.69  ?  155 LEU A CD1   1 
ATOM   1204  C  CD2   . LEU A 1 155 ? -59.032  58.600  -37.421 1.00 46.42  ?  155 LEU A CD2   1 
ATOM   1205  N  N     . PRO A 1 156 ? -61.654  58.156  -41.529 1.00 65.17  ?  156 PRO A N     1 
ATOM   1206  C  CA    . PRO A 1 156 ? -62.640  58.149  -42.623 1.00 63.12  ?  156 PRO A CA    1 
ATOM   1207  C  C     . PRO A 1 156 ? -62.584  59.365  -43.559 1.00 62.02  ?  156 PRO A C     1 
ATOM   1208  O  O     . PRO A 1 156 ? -63.179  59.321  -44.633 1.00 71.28  ?  156 PRO A O     1 
ATOM   1209  C  CB    . PRO A 1 156 ? -63.981  58.128  -41.877 1.00 54.82  ?  156 PRO A CB    1 
ATOM   1210  C  CG    . PRO A 1 156 ? -63.661  57.480  -40.595 1.00 60.62  ?  156 PRO A CG    1 
ATOM   1211  C  CD    . PRO A 1 156 ? -62.298  58.006  -40.216 1.00 60.86  ?  156 PRO A CD    1 
ATOM   1212  N  N     . ALA A 1 157 ? -61.907  60.426  -43.136 1.00 50.05  ?  157 ALA A N     1 
ATOM   1213  C  CA    . ALA A 1 157 ? -61.734  61.660  -43.923 1.00 52.30  ?  157 ALA A CA    1 
ATOM   1214  C  C     . ALA A 1 157 ? -62.907  62.119  -44.816 1.00 54.51  ?  157 ALA A C     1 
ATOM   1215  O  O     . ALA A 1 157 ? -62.849  62.038  -46.046 1.00 60.42  ?  157 ALA A O     1 
ATOM   1216  C  CB    . ALA A 1 157 ? -60.416  61.609  -44.725 1.00 55.01  ?  157 ALA A CB    1 
ATOM   1217  N  N     . ALA A 1 158 ? -63.948  62.643  -44.184 1.00 51.24  ?  158 ALA A N     1 
ATOM   1218  C  CA    . ALA A 1 158 ? -65.105  63.191  -44.892 1.00 55.85  ?  158 ALA A CA    1 
ATOM   1219  C  C     . ALA A 1 158 ? -64.786  64.458  -45.688 1.00 63.42  ?  158 ALA A C     1 
ATOM   1220  O  O     . ALA A 1 158 ? -65.572  64.864  -46.536 1.00 70.88  ?  158 ALA A O     1 
ATOM   1221  C  CB    . ALA A 1 158 ? -66.240  63.453  -43.923 1.00 60.88  ?  158 ALA A CB    1 
ATOM   1222  N  N     . PHE A 1 159 ? -63.661  65.099  -45.397 1.00 62.73  ?  159 PHE A N     1 
ATOM   1223  C  CA    . PHE A 1 159 ? -63.087  66.063  -46.333 1.00 68.33  ?  159 PHE A CA    1 
ATOM   1224  C  C     . PHE A 1 159 ? -61.625  65.674  -46.577 1.00 72.61  ?  159 PHE A C     1 
ATOM   1225  O  O     . PHE A 1 159 ? -61.062  64.894  -45.800 1.00 75.76  ?  159 PHE A O     1 
ATOM   1226  C  CB    . PHE A 1 159 ? -63.254  67.520  -45.853 1.00 70.22  ?  159 PHE A CB    1 
ATOM   1227  C  CG    . PHE A 1 159 ? -62.345  67.909  -44.722 1.00 71.50  ?  159 PHE A CG    1 
ATOM   1228  C  CD1   . PHE A 1 159 ? -62.785  67.866  -43.413 1.00 68.70  ?  159 PHE A CD1   1 
ATOM   1229  C  CD2   . PHE A 1 159 ? -61.044  68.331  -44.970 1.00 78.58  ?  159 PHE A CD2   1 
ATOM   1230  C  CE1   . PHE A 1 159 ? -61.939  68.233  -42.361 1.00 70.83  ?  159 PHE A CE1   1 
ATOM   1231  C  CE2   . PHE A 1 159 ? -60.188  68.693  -43.922 1.00 78.34  ?  159 PHE A CE2   1 
ATOM   1232  C  CZ    . PHE A 1 159 ? -60.641  68.647  -42.622 1.00 74.09  ?  159 PHE A CZ    1 
ATOM   1233  N  N     . PRO A 1 160 ? -61.015  66.177  -47.669 1.00 72.05  ?  160 PRO A N     1 
ATOM   1234  C  CA    . PRO A 1 160 ? -59.631  65.801  -48.028 1.00 72.97  ?  160 PRO A CA    1 
ATOM   1235  C  C     . PRO A 1 160 ? -58.539  66.638  -47.334 1.00 74.09  ?  160 PRO A C     1 
ATOM   1236  O  O     . PRO A 1 160 ? -57.973  67.581  -47.912 1.00 71.76  ?  160 PRO A O     1 
ATOM   1237  C  CB    . PRO A 1 160 ? -59.599  65.965  -49.553 1.00 68.40  ?  160 PRO A CB    1 
ATOM   1238  C  CG    . PRO A 1 160 ? -60.647  67.000  -49.844 1.00 69.23  ?  160 PRO A CG    1 
ATOM   1239  C  CD    . PRO A 1 160 ? -61.676  66.962  -48.726 1.00 70.70  ?  160 PRO A CD    1 
ATOM   1240  N  N     . ASN A 1 161 ? -58.242  66.243  -46.096 1.00 73.74  ?  161 ASN A N     1 
ATOM   1241  C  CA    . ASN A 1 161 ? -57.355  66.976  -45.197 1.00 68.93  ?  161 ASN A CA    1 
ATOM   1242  C  C     . ASN A 1 161 ? -55.956  67.245  -45.764 1.00 73.73  ?  161 ASN A C     1 
ATOM   1243  O  O     . ASN A 1 161 ? -55.437  68.355  -45.623 1.00 81.71  ?  161 ASN A O     1 
ATOM   1244  C  CB    . ASN A 1 161 ? -57.288  66.271  -43.825 1.00 64.19  ?  161 ASN A CB    1 
ATOM   1245  C  CG    . ASN A 1 161 ? -56.554  67.091  -42.766 1.00 65.79  ?  161 ASN A CG    1 
ATOM   1246  O  OD1   . ASN A 1 161 ? -57.042  68.124  -42.296 1.00 62.58  ?  161 ASN A OD1   1 
ATOM   1247  N  ND2   . ASN A 1 161 ? -55.380  66.622  -42.376 1.00 71.67  ?  161 ASN A ND2   1 
ATOM   1248  N  N     . LEU A 1 162 ? -55.357  66.247  -46.416 1.00 68.93  ?  162 LEU A N     1 
ATOM   1249  C  CA    . LEU A 1 162 ? -53.971  66.364  -46.901 1.00 63.58  ?  162 LEU A CA    1 
ATOM   1250  C  C     . LEU A 1 162 ? -53.709  67.683  -47.608 1.00 61.88  ?  162 LEU A C     1 
ATOM   1251  O  O     . LEU A 1 162 ? -52.740  68.371  -47.323 1.00 62.82  ?  162 LEU A O     1 
ATOM   1252  C  CB    . LEU A 1 162 ? -53.617  65.225  -47.857 1.00 61.10  ?  162 LEU A CB    1 
ATOM   1253  C  CG    . LEU A 1 162 ? -52.196  64.670  -47.779 1.00 57.33  ?  162 LEU A CG    1 
ATOM   1254  C  CD1   . LEU A 1 162 ? -51.753  64.175  -49.151 1.00 53.32  ?  162 LEU A CD1   1 
ATOM   1255  C  CD2   . LEU A 1 162 ? -51.255  65.705  -47.238 1.00 55.58  ?  162 LEU A CD2   1 
ATOM   1256  N  N     . LEU A 1 163 ? -54.574  68.032  -48.546 1.00 60.49  ?  163 LEU A N     1 
ATOM   1257  C  CA    . LEU A 1 163 ? -54.374  69.253  -49.292 1.00 63.06  ?  163 LEU A CA    1 
ATOM   1258  C  C     . LEU A 1 163 ? -54.866  70.441  -48.508 1.00 64.25  ?  163 LEU A C     1 
ATOM   1259  O  O     . LEU A 1 163 ? -54.168  71.454  -48.428 1.00 72.30  ?  163 LEU A O     1 
ATOM   1260  C  CB    . LEU A 1 163 ? -55.122  69.191  -50.608 1.00 67.55  ?  163 LEU A CB    1 
ATOM   1261  C  CG    . LEU A 1 163 ? -54.577  68.284  -51.694 1.00 61.78  ?  163 LEU A CG    1 
ATOM   1262  C  CD1   . LEU A 1 163 ? -55.615  68.286  -52.794 1.00 62.09  ?  163 LEU A CD1   1 
ATOM   1263  C  CD2   . LEU A 1 163 ? -53.228  68.812  -52.153 1.00 53.68  ?  163 LEU A CD2   1 
ATOM   1264  N  N     . VAL A 1 164 ? -56.072  70.326  -47.945 1.00 57.03  ?  164 VAL A N     1 
ATOM   1265  C  CA    . VAL A 1 164 ? -56.651  71.423  -47.171 1.00 55.40  ?  164 VAL A CA    1 
ATOM   1266  C  C     . VAL A 1 164 ? -55.709  71.975  -46.111 1.00 60.31  ?  164 VAL A C     1 
ATOM   1267  O  O     . VAL A 1 164 ? -55.513  73.186  -46.031 1.00 63.53  ?  164 VAL A O     1 
ATOM   1268  C  CB    . VAL A 1 164 ? -57.939  71.048  -46.449 1.00 50.92  ?  164 VAL A CB    1 
ATOM   1269  C  CG1   . VAL A 1 164 ? -58.286  72.159  -45.478 1.00 50.28  ?  164 VAL A CG1   1 
ATOM   1270  C  CG2   . VAL A 1 164 ? -59.078  70.866  -47.433 1.00 48.15  ?  164 VAL A CG2   1 
ATOM   1271  N  N     . ASN A 1 165 ? -55.127  71.094  -45.301 1.00 61.17  ?  165 ASN A N     1 
ATOM   1272  C  CA    . ASN A 1 165 ? -54.328  71.539  -44.152 1.00 60.97  ?  165 ASN A CA    1 
ATOM   1273  C  C     . ASN A 1 165 ? -52.832  71.483  -44.322 1.00 69.28  ?  165 ASN A C     1 
ATOM   1274  O  O     . ASN A 1 165 ? -52.094  72.191  -43.630 1.00 76.42  ?  165 ASN A O     1 
ATOM   1275  C  CB    . ASN A 1 165 ? -54.723  70.790  -42.886 1.00 54.01  ?  165 ASN A CB    1 
ATOM   1276  C  CG    . ASN A 1 165 ? -55.830  71.484  -42.148 1.00 56.18  ?  165 ASN A CG    1 
ATOM   1277  O  OD1   . ASN A 1 165 ? -55.850  72.724  -42.077 1.00 57.16  ?  165 ASN A OD1   1 
ATOM   1278  N  ND2   . ASN A 1 165 ? -56.783  70.703  -41.615 1.00 58.02  ?  165 ASN A ND2   1 
ATOM   1279  N  N     . GLY A 1 166 ? -52.389  70.630  -45.233 1.00 65.56  ?  166 GLY A N     1 
ATOM   1280  C  CA    . GLY A 1 166 ? -50.978  70.533  -45.536 1.00 65.67  ?  166 GLY A CA    1 
ATOM   1281  C  C     . GLY A 1 166 ? -50.248  69.563  -44.637 1.00 63.31  ?  166 GLY A C     1 
ATOM   1282  O  O     . GLY A 1 166 ? -50.872  68.783  -43.912 1.00 66.02  ?  166 GLY A O     1 
ATOM   1283  N  N     . SER A 1 167 ? -48.918  69.623  -44.682 1.00 56.38  ?  167 SER A N     1 
ATOM   1284  C  CA    . SER A 1 167 ? -48.076  68.699  -43.939 1.00 54.59  ?  167 SER A CA    1 
ATOM   1285  C  C     . SER A 1 167 ? -46.625  69.086  -44.094 1.00 57.17  ?  167 SER A C     1 
ATOM   1286  O  O     . SER A 1 167 ? -46.204  69.496  -45.167 1.00 70.76  ?  167 SER A O     1 
ATOM   1287  C  CB    . SER A 1 167 ? -48.281  67.273  -44.458 1.00 63.03  ?  167 SER A CB    1 
ATOM   1288  O  OG    . SER A 1 167 ? -47.853  66.309  -43.512 1.00 75.98  ?  167 SER A OG    1 
ATOM   1289  N  N     . THR A 1 168 ? -45.862  68.931  -43.020 1.00 59.38  ?  168 THR A N     1 
ATOM   1290  C  CA    . THR A 1 168 ? -44.416  69.164  -43.014 1.00 48.82  ?  168 THR A CA    1 
ATOM   1291  C  C     . THR A 1 168 ? -43.935  68.466  -41.749 1.00 74.25  ?  168 THR A C     1 
ATOM   1292  O  O     . THR A 1 168 ? -44.506  68.723  -40.688 1.00 90.94  ?  168 THR A O     1 
ATOM   1293  C  CB    . THR A 1 168 ? -44.124  70.707  -43.005 1.00 72.55  ?  168 THR A CB    1 
ATOM   1294  O  OG1   . THR A 1 168 ? -43.043  71.024  -42.123 1.00 71.93  ?  168 THR A OG1   1 
ATOM   1295  C  CG2   . THR A 1 168 ? -45.354  71.490  -42.558 1.00 75.03  ?  168 THR A CG2   1 
ATOM   1296  N  N     . GLY A 1 169 ? -42.973  67.536  -41.809 1.00 61.88  ?  169 GLY A N     1 
ATOM   1297  C  CA    . GLY A 1 169 ? -42.368  66.992  -43.007 1.00 62.48  ?  169 GLY A CA    1 
ATOM   1298  C  C     . GLY A 1 169 ? -40.848  66.768  -42.976 1.00 74.78  ?  169 GLY A C     1 
ATOM   1299  O  O     . GLY A 1 169 ? -40.179  67.141  -43.945 1.00 92.87  ?  169 GLY A O     1 
ATOM   1300  N  N     . ILE A 1 170 ? -40.280  66.197  -41.903 1.00 60.64  ?  170 ILE A N     1 
ATOM   1301  C  CA    . ILE A 1 170 ? -38.868  65.740  -41.964 1.00 61.20  ?  170 ILE A CA    1 
ATOM   1302  C  C     . ILE A 1 170 ? -38.618  64.358  -41.374 1.00 73.28  ?  170 ILE A C     1 
ATOM   1303  O  O     . ILE A 1 170 ? -38.974  64.078  -40.238 1.00 92.63  ?  170 ILE A O     1 
ATOM   1304  C  CB    . ILE A 1 170 ? -37.851  66.659  -41.274 1.00 61.89  ?  170 ILE A CB    1 
ATOM   1305  C  CG1   . ILE A 1 170 ? -38.084  68.137  -41.593 1.00 63.37  ?  170 ILE A CG1   1 
ATOM   1306  C  CG2   . ILE A 1 170 ? -36.450  66.205  -41.637 1.00 58.36  ?  170 ILE A CG2   1 
ATOM   1307  C  CD1   . ILE A 1 170 ? -37.215  69.073  -40.740 1.00 57.54  ?  170 ILE A CD1   1 
ATOM   1308  N  N     . SER A 1 171 ? -37.938  63.520  -42.136 1.00 69.75  ?  171 SER A N     1 
ATOM   1309  C  CA    . SER A 1 171 ? -37.864  62.097  -41.857 1.00 75.44  ?  171 SER A CA    1 
ATOM   1310  C  C     . SER A 1 171 ? -36.437  61.587  -42.085 1.00 86.19  ?  171 SER A C     1 
ATOM   1311  O  O     . SER A 1 171 ? -35.465  62.220  -41.649 1.00 93.55  ?  171 SER A O     1 
ATOM   1312  C  CB    . SER A 1 171 ? -38.866  61.367  -42.760 1.00 76.61  ?  171 SER A CB    1 
ATOM   1313  O  OG    . SER A 1 171 ? -38.643  59.974  -42.795 1.00 82.44  ?  171 SER A OG    1 
ATOM   1314  N  N     . ALA A 1 172 ? -36.310  60.445  -42.758 1.00 84.07  ?  172 ALA A N     1 
ATOM   1315  C  CA    . ALA A 1 172 ? -34.998  59.911  -43.130 1.00 82.57  ?  172 ALA A CA    1 
ATOM   1316  C  C     . ALA A 1 172 ? -35.031  59.414  -44.578 1.00 90.58  ?  172 ALA A C     1 
ATOM   1317  O  O     . ALA A 1 172 ? -35.824  58.537  -44.931 1.00 92.98  ?  172 ALA A O     1 
ATOM   1318  C  CB    . ALA A 1 172 ? -34.566  58.794  -42.177 1.00 75.00  ?  172 ALA A CB    1 
ATOM   1319  N  N     . GLY A 1 173 ? -34.170  59.977  -45.416 1.00 89.12  ?  173 GLY A N     1 
ATOM   1320  C  CA    . GLY A 1 173 ? -34.191  59.655  -46.825 1.00 84.29  ?  173 GLY A CA    1 
ATOM   1321  C  C     . GLY A 1 173 ? -35.328  60.387  -47.517 1.00 85.00  ?  173 GLY A C     1 
ATOM   1322  O  O     . GLY A 1 173 ? -35.364  60.466  -48.751 1.00 93.09  ?  173 GLY A O     1 
ATOM   1323  N  N     . TYR A 1 174 ? -36.263  60.922  -46.730 1.00 81.27  ?  174 TYR A N     1 
ATOM   1324  C  CA    . TYR A 1 174 ? -37.371  61.689  -47.306 1.00 86.11  ?  174 TYR A CA    1 
ATOM   1325  C  C     . TYR A 1 174 ? -37.767  62.868  -46.431 1.00 83.69  ?  174 TYR A C     1 
ATOM   1326  O  O     . TYR A 1 174 ? -37.437  62.908  -45.254 1.00 81.98  ?  174 TYR A O     1 
ATOM   1327  C  CB    . TYR A 1 174 ? -38.601  60.809  -47.514 1.00 86.83  ?  174 TYR A CB    1 
ATOM   1328  C  CG    . TYR A 1 174 ? -38.373  59.571  -48.339 1.00 87.68  ?  174 TYR A CG    1 
ATOM   1329  C  CD1   . TYR A 1 174 ? -38.969  59.422  -49.572 1.00 83.82  ?  174 TYR A CD1   1 
ATOM   1330  C  CD2   . TYR A 1 174 ? -37.581  58.538  -47.872 1.00 94.30  ?  174 TYR A CD2   1 
ATOM   1331  C  CE1   . TYR A 1 174 ? -38.776  58.286  -50.322 1.00 89.25  ?  174 TYR A CE1   1 
ATOM   1332  C  CE2   . TYR A 1 174 ? -37.379  57.395  -48.621 1.00 96.73  ?  174 TYR A CE2   1 
ATOM   1333  C  CZ    . TYR A 1 174 ? -37.981  57.274  -49.844 1.00 95.95  ?  174 TYR A CZ    1 
ATOM   1334  O  OH    . TYR A 1 174 ? -37.783  56.140  -50.601 1.00 104.13 ?  174 TYR A OH    1 
ATOM   1335  N  N     . ALA A 1 175 ? -38.472  63.829  -47.023 1.00 79.68  ?  175 ALA A N     1 
ATOM   1336  C  CA    . ALA A 1 175 ? -39.102  64.904  -46.260 1.00 75.04  ?  175 ALA A CA    1 
ATOM   1337  C  C     . ALA A 1 175 ? -40.387  65.298  -46.971 1.00 74.56  ?  175 ALA A C     1 
ATOM   1338  O  O     . ALA A 1 175 ? -40.646  64.844  -48.087 1.00 81.22  ?  175 ALA A O     1 
ATOM   1339  C  CB    . ALA A 1 175 ? -38.183  66.096  -46.128 1.00 77.85  ?  175 ALA A CB    1 
ATOM   1340  N  N     . THR A 1 176 ? -41.208  66.119  -46.331 1.00 67.52  ?  176 THR A N     1 
ATOM   1341  C  CA    . THR A 1 176 ? -42.448  66.513  -46.974 1.00 68.85  ?  176 THR A CA    1 
ATOM   1342  C  C     . THR A 1 176 ? -42.861  67.940  -46.665 1.00 70.66  ?  176 THR A C     1 
ATOM   1343  O  O     . THR A 1 176 ? -42.834  68.377  -45.520 1.00 75.08  ?  176 THR A O     1 
ATOM   1344  C  CB    . THR A 1 176 ? -43.608  65.542  -46.673 1.00 72.98  ?  176 THR A CB    1 
ATOM   1345  O  OG1   . THR A 1 176 ? -44.609  65.678  -47.689 1.00 82.95  ?  176 THR A OG1   1 
ATOM   1346  C  CG2   . THR A 1 176 ? -44.237  65.840  -45.335 1.00 69.93  ?  176 THR A CG2   1 
ATOM   1347  N  N     . ASP A 1 177 ? -43.219  68.665  -47.717 1.00 72.49  ?  177 ASP A N     1 
ATOM   1348  C  CA    . ASP A 1 177 ? -43.798  69.987  -47.589 1.00 72.61  ?  177 ASP A CA    1 
ATOM   1349  C  C     . ASP A 1 177 ? -44.961  70.099  -48.543 1.00 68.61  ?  177 ASP A C     1 
ATOM   1350  O  O     . ASP A 1 177 ? -44.768  70.184  -49.750 1.00 75.27  ?  177 ASP A O     1 
ATOM   1351  C  CB    . ASP A 1 177 ? -42.762  71.071  -47.855 1.00 80.89  ?  177 ASP A CB    1 
ATOM   1352  C  CG    . ASP A 1 177 ? -41.894  71.337  -46.646 1.00 94.98  ?  177 ASP A CG    1 
ATOM   1353  O  OD1   . ASP A 1 177 ? -42.319  72.142  -45.784 1.00 101.33 ?  177 ASP A OD1   1 
ATOM   1354  O  OD2   . ASP A 1 177 ? -40.809  70.721  -46.546 1.00 102.44 ?  177 ASP A OD2   1 
ATOM   1355  N  N     . ILE A 1 178 ? -46.166  70.038  -47.982 1.00 62.45  ?  178 ILE A N     1 
ATOM   1356  C  CA    . ILE A 1 178 ? -47.403  70.244  -48.718 1.00 63.09  ?  178 ILE A CA    1 
ATOM   1357  C  C     . ILE A 1 178 ? -48.117  71.438  -48.107 1.00 66.50  ?  178 ILE A C     1 
ATOM   1358  O  O     . ILE A 1 178 ? -48.403  71.438  -46.910 1.00 66.81  ?  178 ILE A O     1 
ATOM   1359  C  CB    . ILE A 1 178 ? -48.341  69.047  -48.585 1.00 62.27  ?  178 ILE A CB    1 
ATOM   1360  C  CG1   . ILE A 1 178 ? -47.657  67.764  -49.051 1.00 62.24  ?  178 ILE A CG1   1 
ATOM   1361  C  CG2   . ILE A 1 178 ? -49.585  69.286  -49.389 1.00 66.86  ?  178 ILE A CG2   1 
ATOM   1362  C  CD1   . ILE A 1 178 ? -48.568  66.549  -49.020 1.00 56.74  ?  178 ILE A CD1   1 
ATOM   1363  N  N     . PRO A 1 179 ? -48.412  72.464  -48.921 1.00 68.11  ?  179 PRO A N     1 
ATOM   1364  C  CA    . PRO A 1 179 ? -49.052  73.675  -48.398 1.00 66.52  ?  179 PRO A CA    1 
ATOM   1365  C  C     . PRO A 1 179 ? -50.551  73.459  -48.287 1.00 62.41  ?  179 PRO A C     1 
ATOM   1366  O  O     . PRO A 1 179 ? -51.055  72.555  -48.932 1.00 64.47  ?  179 PRO A O     1 
ATOM   1367  C  CB    . PRO A 1 179 ? -48.738  74.716  -49.471 1.00 66.85  ?  179 PRO A CB    1 
ATOM   1368  C  CG    . PRO A 1 179 ? -48.669  73.926  -50.726 1.00 65.25  ?  179 PRO A CG    1 
ATOM   1369  C  CD    . PRO A 1 179 ? -48.188  72.537  -50.372 1.00 64.25  ?  179 PRO A CD    1 
ATOM   1370  N  N     . PRO A 1 180 ? -51.253  74.269  -47.475 1.00 60.61  ?  180 PRO A N     1 
ATOM   1371  C  CA    . PRO A 1 180 ? -52.713  74.146  -47.341 1.00 59.86  ?  180 PRO A CA    1 
ATOM   1372  C  C     . PRO A 1 180 ? -53.468  74.726  -48.549 1.00 63.39  ?  180 PRO A C     1 
ATOM   1373  O  O     . PRO A 1 180 ? -52.938  75.548  -49.310 1.00 65.98  ?  180 PRO A O     1 
ATOM   1374  C  CB    . PRO A 1 180 ? -53.012  74.998  -46.110 1.00 65.45  ?  180 PRO A CB    1 
ATOM   1375  C  CG    . PRO A 1 180 ? -51.924  76.066  -46.127 1.00 68.75  ?  180 PRO A CG    1 
ATOM   1376  C  CD    . PRO A 1 180 ? -50.698  75.348  -46.628 1.00 66.29  ?  180 PRO A CD    1 
ATOM   1377  N  N     . HIS A 1 181 ? -54.716  74.308  -48.716 1.00 60.53  ?  181 HIS A N     1 
ATOM   1378  C  CA    . HIS A 1 181 ? -55.521  74.805  -49.811 1.00 64.38  ?  181 HIS A CA    1 
ATOM   1379  C  C     . HIS A 1 181 ? -56.933  75.124  -49.368 1.00 65.93  ?  181 HIS A C     1 
ATOM   1380  O  O     . HIS A 1 181 ? -57.400  74.638  -48.346 1.00 74.54  ?  181 HIS A O     1 
ATOM   1381  C  CB    . HIS A 1 181 ? -55.616  73.757  -50.916 1.00 74.73  ?  181 HIS A CB    1 
ATOM   1382  C  CG    . HIS A 1 181 ? -54.304  73.394  -51.538 1.00 80.20  ?  181 HIS A CG    1 
ATOM   1383  N  ND1   . HIS A 1 181 ? -53.436  72.490  -50.969 1.00 76.90  ?  181 HIS A ND1   1 
ATOM   1384  C  CD2   . HIS A 1 181 ? -53.732  73.786  -52.704 1.00 80.86  ?  181 HIS A CD2   1 
ATOM   1385  C  CE1   . HIS A 1 181 ? -52.375  72.352  -51.748 1.00 78.50  ?  181 HIS A CE1   1 
ATOM   1386  N  NE2   . HIS A 1 181 ? -52.533  73.127  -52.807 1.00 79.01  ?  181 HIS A NE2   1 
ATOM   1387  N  N     . ASN A 1 182 ? -57.626  75.905  -50.184 1.00 62.25  ?  182 ASN A N     1 
ATOM   1388  C  CA    . ASN A 1 182 ? -59.032  76.198  -49.970 1.00 63.30  ?  182 ASN A CA    1 
ATOM   1389  C  C     . ASN A 1 182 ? -59.955  74.967  -50.008 1.00 65.29  ?  182 ASN A C     1 
ATOM   1390  O  O     . ASN A 1 182 ? -60.049  74.282  -51.025 1.00 63.14  ?  182 ASN A O     1 
ATOM   1391  C  CB    . ASN A 1 182 ? -59.499  77.204  -51.013 1.00 65.13  ?  182 ASN A CB    1 
ATOM   1392  C  CG    . ASN A 1 182 ? -60.817  77.833  -50.647 1.00 73.17  ?  182 ASN A CG    1 
ATOM   1393  O  OD1   . ASN A 1 182 ? -61.893  77.330  -51.014 1.00 78.33  ?  182 ASN A OD1   1 
ATOM   1394  N  ND2   . ASN A 1 182 ? -60.748  78.942  -49.893 1.00 71.62  ?  182 ASN A ND2   1 
ATOM   1395  N  N     . LEU A 1 183 ? -60.649  74.710  -48.897 1.00 69.58  ?  183 LEU A N     1 
ATOM   1396  C  CA    . LEU A 1 183 ? -61.599  73.599  -48.785 1.00 70.51  ?  183 LEU A CA    1 
ATOM   1397  C  C     . LEU A 1 183 ? -62.489  73.499  -50.016 1.00 72.68  ?  183 LEU A C     1 
ATOM   1398  O  O     . LEU A 1 183 ? -62.588  72.439  -50.636 1.00 74.75  ?  183 LEU A O     1 
ATOM   1399  C  CB    . LEU A 1 183 ? -62.466  73.783  -47.536 1.00 75.46  ?  183 LEU A CB    1 
ATOM   1400  C  CG    . LEU A 1 183 ? -63.294  72.668  -46.875 1.00 73.38  ?  183 LEU A CG    1 
ATOM   1401  C  CD1   . LEU A 1 183 ? -64.645  72.536  -47.508 1.00 75.08  ?  183 LEU A CD1   1 
ATOM   1402  C  CD2   . LEU A 1 183 ? -62.569  71.339  -46.903 1.00 72.59  ?  183 LEU A CD2   1 
ATOM   1403  N  N     . ALA A 1 184 ? -63.142  74.601  -50.374 1.00 72.16  ?  184 ALA A N     1 
ATOM   1404  C  CA    . ALA A 1 184 ? -64.055  74.576  -51.517 1.00 71.26  ?  184 ALA A CA    1 
ATOM   1405  C  C     . ALA A 1 184 ? -63.336  74.217  -52.823 1.00 73.35  ?  184 ALA A C     1 
ATOM   1406  O  O     . ALA A 1 184 ? -63.832  73.405  -53.603 1.00 79.79  ?  184 ALA A O     1 
ATOM   1407  C  CB    . ALA A 1 184 ? -64.794  75.893  -51.656 1.00 73.17  ?  184 ALA A CB    1 
ATOM   1408  N  N     . GLU A 1 185 ? -62.167  74.806  -53.064 1.00 67.42  ?  185 GLU A N     1 
ATOM   1409  C  CA    . GLU A 1 185 ? -61.461  74.521  -54.311 1.00 60.61  ?  185 GLU A CA    1 
ATOM   1410  C  C     . GLU A 1 185 ? -61.087  73.045  -54.411 1.00 65.60  ?  185 GLU A C     1 
ATOM   1411  O  O     . GLU A 1 185 ? -61.316  72.413  -55.435 1.00 67.71  ?  185 GLU A O     1 
ATOM   1412  C  CB    . GLU A 1 185 ? -60.244  75.438  -54.506 1.00 53.59  ?  185 GLU A CB    1 
ATOM   1413  C  CG    . GLU A 1 185 ? -60.593  76.923  -54.551 1.00 59.20  ?  185 GLU A CG    1 
ATOM   1414  C  CD    . GLU A 1 185 ? -59.366  77.814  -54.590 1.00 78.53  ?  185 GLU A CD    1 
ATOM   1415  O  OE1   . GLU A 1 185 ? -58.295  77.386  -54.083 1.00 89.14  ?  185 GLU A OE1   1 
ATOM   1416  O  OE2   . GLU A 1 185 ? -59.476  78.943  -55.121 1.00 79.78  ?  185 GLU A OE2   1 
ATOM   1417  N  N     . VAL A 1 186 ? -60.539  72.490  -53.337 1.00 66.94  ?  186 VAL A N     1 
ATOM   1418  C  CA    . VAL A 1 186 ? -60.161  71.084  -53.332 1.00 65.48  ?  186 VAL A CA    1 
ATOM   1419  C  C     . VAL A 1 186 ? -61.355  70.183  -53.598 1.00 70.35  ?  186 VAL A C     1 
ATOM   1420  O  O     . VAL A 1 186 ? -61.309  69.299  -54.453 1.00 75.63  ?  186 VAL A O     1 
ATOM   1421  C  CB    . VAL A 1 186 ? -59.516  70.671  -52.010 1.00 57.31  ?  186 VAL A CB    1 
ATOM   1422  C  CG1   . VAL A 1 186 ? -59.292  69.157  -51.992 1.00 56.37  ?  186 VAL A CG1   1 
ATOM   1423  C  CG2   . VAL A 1 186 ? -58.200  71.412  -51.832 1.00 55.03  ?  186 VAL A CG2   1 
ATOM   1424  N  N     . ILE A 1 187 ? -62.430  70.406  -52.863 1.00 66.92  ?  187 ILE A N     1 
ATOM   1425  C  CA    . ILE A 1 187 ? -63.638  69.631  -53.077 1.00 68.12  ?  187 ILE A CA    1 
ATOM   1426  C  C     . ILE A 1 187 ? -64.180  69.761  -54.517 1.00 63.31  ?  187 ILE A C     1 
ATOM   1427  O  O     . ILE A 1 187 ? -64.653  68.784  -55.109 1.00 58.55  ?  187 ILE A O     1 
ATOM   1428  C  CB    . ILE A 1 187 ? -64.693  69.955  -51.998 1.00 66.10  ?  187 ILE A CB    1 
ATOM   1429  C  CG1   . ILE A 1 187 ? -64.214  69.391  -50.660 1.00 60.03  ?  187 ILE A CG1   1 
ATOM   1430  C  CG2   . ILE A 1 187 ? -66.053  69.364  -52.358 1.00 62.68  ?  187 ILE A CG2   1 
ATOM   1431  C  CD1   . ILE A 1 187 ? -65.219  69.492  -49.558 1.00 66.93  ?  187 ILE A CD1   1 
ATOM   1432  N  N     . ASP A 1 188 ? -64.086  70.951  -55.096 1.00 65.40  ?  188 ASP A N     1 
ATOM   1433  C  CA    . ASP A 1 188 ? -64.527  71.119  -56.474 1.00 71.53  ?  188 ASP A CA    1 
ATOM   1434  C  C     . ASP A 1 188 ? -63.710  70.227  -57.424 1.00 66.64  ?  188 ASP A C     1 
ATOM   1435  O  O     . ASP A 1 188 ? -64.261  69.568  -58.307 1.00 65.13  ?  188 ASP A O     1 
ATOM   1436  C  CB    . ASP A 1 188 ? -64.480  72.596  -56.887 1.00 76.87  ?  188 ASP A CB    1 
ATOM   1437  C  CG    . ASP A 1 188 ? -65.543  73.432  -56.182 1.00 85.09  ?  188 ASP A CG    1 
ATOM   1438  O  OD1   . ASP A 1 188 ? -66.595  72.852  -55.817 1.00 88.81  ?  188 ASP A OD1   1 
ATOM   1439  O  OD2   . ASP A 1 188 ? -65.332  74.656  -55.989 1.00 87.55  ?  188 ASP A OD2   1 
ATOM   1440  N  N     . ALA A 1 189 ? -62.400  70.191  -57.213 1.00 62.16  ?  189 ALA A N     1 
ATOM   1441  C  CA    . ALA A 1 189 ? -61.519  69.347  -58.004 1.00 61.58  ?  189 ALA A CA    1 
ATOM   1442  C  C     . ALA A 1 189 ? -61.862  67.873  -57.832 1.00 66.91  ?  189 ALA A C     1 
ATOM   1443  O  O     . ALA A 1 189 ? -62.005  67.142  -58.810 1.00 72.05  ?  189 ALA A O     1 
ATOM   1444  C  CB    . ALA A 1 189 ? -60.061  69.599  -57.629 1.00 52.32  ?  189 ALA A CB    1 
ATOM   1445  N  N     . ALA A 1 190 ? -61.995  67.433  -56.587 1.00 65.40  ?  190 ALA A N     1 
ATOM   1446  C  CA    . ALA A 1 190 ? -62.292  66.032  -56.327 1.00 63.65  ?  190 ALA A CA    1 
ATOM   1447  C  C     . ALA A 1 190 ? -63.625  65.613  -56.960 1.00 68.95  ?  190 ALA A C     1 
ATOM   1448  O  O     . ALA A 1 190 ? -63.754  64.519  -57.514 1.00 71.34  ?  190 ALA A O     1 
ATOM   1449  C  CB    . ALA A 1 190 ? -62.302  65.765  -54.854 1.00 56.48  ?  190 ALA A CB    1 
ATOM   1450  N  N     . VAL A 1 191 ? -64.622  66.481  -56.872 1.00 69.46  ?  191 VAL A N     1 
ATOM   1451  C  CA    . VAL A 1 191 ? -65.898  66.196  -57.506 1.00 69.15  ?  191 VAL A CA    1 
ATOM   1452  C  C     . VAL A 1 191 ? -65.752  66.063  -59.030 1.00 74.85  ?  191 VAL A C     1 
ATOM   1453  O  O     . VAL A 1 191 ? -66.421  65.234  -59.657 1.00 78.90  ?  191 VAL A O     1 
ATOM   1454  C  CB    . VAL A 1 191 ? -66.961  67.247  -57.126 1.00 63.80  ?  191 VAL A CB    1 
ATOM   1455  C  CG1   . VAL A 1 191 ? -68.155  67.180  -58.049 1.00 60.11  ?  191 VAL A CG1   1 
ATOM   1456  C  CG2   . VAL A 1 191 ? -67.404  67.020  -55.707 1.00 63.62  ?  191 VAL A CG2   1 
ATOM   1457  N  N     . TYR A 1 192 ? -64.863  66.852  -59.626 1.00 74.57  ?  192 TYR A N     1 
ATOM   1458  C  CA    . TYR A 1 192 ? -64.643  66.753  -61.073 1.00 70.58  ?  192 TYR A CA    1 
ATOM   1459  C  C     . TYR A 1 192 ? -63.954  65.449  -61.444 1.00 76.70  ?  192 TYR A C     1 
ATOM   1460  O  O     . TYR A 1 192 ? -64.312  64.787  -62.411 1.00 86.60  ?  192 TYR A O     1 
ATOM   1461  C  CB    . TYR A 1 192 ? -63.821  67.928  -61.605 1.00 58.81  ?  192 TYR A CB    1 
ATOM   1462  C  CG    . TYR A 1 192 ? -63.678  67.926  -63.101 1.00 61.48  ?  192 TYR A CG    1 
ATOM   1463  C  CD1   . TYR A 1 192 ? -62.566  67.357  -63.709 1.00 65.44  ?  192 TYR A CD1   1 
ATOM   1464  C  CD2   . TYR A 1 192 ? -64.652  68.491  -63.913 1.00 60.70  ?  192 TYR A CD2   1 
ATOM   1465  C  CE1   . TYR A 1 192 ? -62.417  67.359  -65.087 1.00 70.78  ?  192 TYR A CE1   1 
ATOM   1466  C  CE2   . TYR A 1 192 ? -64.518  68.492  -65.304 1.00 72.41  ?  192 TYR A CE2   1 
ATOM   1467  C  CZ    . TYR A 1 192 ? -63.396  67.928  -65.881 1.00 75.92  ?  192 TYR A CZ    1 
ATOM   1468  O  OH    . TYR A 1 192 ? -63.253  67.920  -67.252 1.00 80.30  ?  192 TYR A OH    1 
ATOM   1469  N  N     . MET A 1 193 ? -62.950  65.090  -60.669 1.00 73.20  ?  193 MET A N     1 
ATOM   1470  C  CA    . MET A 1 193 ? -62.232  63.859  -60.898 1.00 72.73  ?  193 MET A CA    1 
ATOM   1471  C  C     . MET A 1 193 ? -63.146  62.642  -60.672 1.00 72.55  ?  193 MET A C     1 
ATOM   1472  O  O     . MET A 1 193 ? -62.947  61.572  -61.256 1.00 78.08  ?  193 MET A O     1 
ATOM   1473  C  CB    . MET A 1 193 ? -61.027  63.828  -59.961 1.00 72.23  ?  193 MET A CB    1 
ATOM   1474  C  CG    . MET A 1 193 ? -60.125  62.646  -60.140 1.00 74.60  ?  193 MET A CG    1 
ATOM   1475  S  SD    . MET A 1 193 ? -58.421  63.151  -60.026 1.00 86.64  ?  193 MET A SD    1 
ATOM   1476  C  CE    . MET A 1 193 ? -57.818  61.804  -59.007 1.00 107.86 ?  193 MET A CE    1 
ATOM   1477  N  N     . ILE A 1 194 ? -64.148  62.792  -59.815 1.00 64.91  ?  194 ILE A N     1 
ATOM   1478  C  CA    . ILE A 1 194 ? -65.016  61.665  -59.553 1.00 64.24  ?  194 ILE A CA    1 
ATOM   1479  C  C     . ILE A 1 194 ? -65.753  61.341  -60.840 1.00 68.29  ?  194 ILE A C     1 
ATOM   1480  O  O     . ILE A 1 194 ? -65.860  60.176  -61.226 1.00 68.89  ?  194 ILE A O     1 
ATOM   1481  C  CB    . ILE A 1 194 ? -66.009  61.941  -58.394 1.00 67.33  ?  194 ILE A CB    1 
ATOM   1482  C  CG1   . ILE A 1 194 ? -65.293  61.867  -57.046 1.00 51.66  ?  194 ILE A CG1   1 
ATOM   1483  C  CG2   . ILE A 1 194 ? -67.198  60.935  -58.405 1.00 54.40  ?  194 ILE A CG2   1 
ATOM   1484  C  CD1   . ILE A 1 194 ? -66.234  62.077  -55.891 1.00 75.53  ?  194 ILE A CD1   1 
ATOM   1485  N  N     . ASP A 1 195 ? -66.236  62.395  -61.497 1.00 67.10  ?  195 ASP A N     1 
ATOM   1486  C  CA    . ASP A 1 195 ? -66.984  62.310  -62.750 1.00 66.52  ?  195 ASP A CA    1 
ATOM   1487  C  C     . ASP A 1 195 ? -66.065  62.094  -63.945 1.00 72.42  ?  195 ASP A C     1 
ATOM   1488  O  O     . ASP A 1 195 ? -66.518  61.681  -64.999 1.00 86.59  ?  195 ASP A O     1 
ATOM   1489  C  CB    . ASP A 1 195 ? -67.784  63.608  -62.987 1.00 75.69  ?  195 ASP A CB    1 
ATOM   1490  C  CG    . ASP A 1 195 ? -69.079  63.676  -62.159 1.00 82.74  ?  195 ASP A CG    1 
ATOM   1491  O  OD1   . ASP A 1 195 ? -69.614  62.604  -61.793 1.00 87.43  ?  195 ASP A OD1   1 
ATOM   1492  O  OD2   . ASP A 1 195 ? -69.570  64.801  -61.884 1.00 80.21  ?  195 ASP A OD2   1 
ATOM   1493  N  N     . HIS A 1 196 ? -64.779  62.383  -63.778 1.00 70.36  ?  196 HIS A N     1 
ATOM   1494  C  CA    . HIS A 1 196 ? -63.813  62.355  -64.872 1.00 72.02  ?  196 HIS A CA    1 
ATOM   1495  C  C     . HIS A 1 196 ? -62.443  61.817  -64.457 1.00 69.52  ?  196 HIS A C     1 
ATOM   1496  O  O     . HIS A 1 196 ? -61.463  62.560  -64.458 1.00 72.50  ?  196 HIS A O     1 
ATOM   1497  C  CB    . HIS A 1 196 ? -63.607  63.767  -65.422 1.00 73.33  ?  196 HIS A CB    1 
ATOM   1498  C  CG    . HIS A 1 196 ? -64.844  64.388  -65.980 1.00 72.70  ?  196 HIS A CG    1 
ATOM   1499  N  ND1   . HIS A 1 196 ? -65.337  65.591  -65.526 1.00 75.14  ?  196 HIS A ND1   1 
ATOM   1500  C  CD2   . HIS A 1 196 ? -65.676  63.986  -66.963 1.00 75.05  ?  196 HIS A CD2   1 
ATOM   1501  C  CE1   . HIS A 1 196 ? -66.430  65.898  -66.197 1.00 79.36  ?  196 HIS A CE1   1 
ATOM   1502  N  NE2   . HIS A 1 196 ? -66.660  64.941  -67.075 1.00 79.72  ?  196 HIS A NE2   1 
ATOM   1503  N  N     . PRO A 1 197 ? -62.367  60.517  -64.139 1.00 67.46  ?  197 PRO A N     1 
ATOM   1504  C  CA    . PRO A 1 197 ? -61.162  59.874  -63.584 1.00 66.91  ?  197 PRO A CA    1 
ATOM   1505  C  C     . PRO A 1 197 ? -59.867  60.306  -64.262 1.00 74.17  ?  197 PRO A C     1 
ATOM   1506  O  O     . PRO A 1 197 ? -58.885  60.649  -63.601 1.00 78.22  ?  197 PRO A O     1 
ATOM   1507  C  CB    . PRO A 1 197 ? -61.408  58.386  -63.837 1.00 60.47  ?  197 PRO A CB    1 
ATOM   1508  C  CG    . PRO A 1 197 ? -62.911  58.241  -63.858 1.00 70.84  ?  197 PRO A CG    1 
ATOM   1509  C  CD    . PRO A 1 197 ? -63.491  59.571  -64.312 1.00 68.32  ?  197 PRO A CD    1 
ATOM   1510  N  N     . THR A 1 198 ? -59.864  60.293  -65.582 1.00 79.53  ?  198 THR A N     1 
ATOM   1511  C  CA    . THR A 1 198 ? -58.657  60.600  -66.338 1.00 79.84  ?  198 THR A CA    1 
ATOM   1512  C  C     . THR A 1 198 ? -58.461  62.087  -66.543 1.00 81.79  ?  198 THR A C     1 
ATOM   1513  O  O     . THR A 1 198 ? -57.971  62.495  -67.593 1.00 85.11  ?  198 THR A O     1 
ATOM   1514  C  CB    . THR A 1 198 ? -58.793  60.047  -67.723 1.00 80.39  ?  198 THR A CB    1 
ATOM   1515  O  OG1   . THR A 1 198 ? -60.084  60.431  -68.211 1.00 80.24  ?  198 THR A OG1   1 
ATOM   1516  C  CG2   . THR A 1 198 ? -58.693  58.532  -67.695 1.00 84.11  ?  198 THR A CG2   1 
ATOM   1517  N  N     . ALA A 1 199 ? -58.849  62.900  -65.568 1.00 81.70  ?  199 ALA A N     1 
ATOM   1518  C  CA    . ALA A 1 199 ? -58.772  64.346  -65.744 1.00 84.91  ?  199 ALA A CA    1 
ATOM   1519  C  C     . ALA A 1 199 ? -57.320  64.847  -65.760 1.00 87.89  ?  199 ALA A C     1 
ATOM   1520  O  O     . ALA A 1 199 ? -56.498  64.409  -64.949 1.00 89.07  ?  199 ALA A O     1 
ATOM   1521  C  CB    . ALA A 1 199 ? -59.590  65.061  -64.674 1.00 83.78  ?  199 ALA A CB    1 
ATOM   1522  N  N     . LYS A 1 200 ? -57.011  65.752  -66.689 1.00 87.49  ?  200 LYS A N     1 
ATOM   1523  C  CA    . LYS A 1 200 ? -55.658  66.306  -66.811 1.00 86.25  ?  200 LYS A CA    1 
ATOM   1524  C  C     . LYS A 1 200 ? -55.410  67.477  -65.831 1.00 87.74  ?  200 LYS A C     1 
ATOM   1525  O  O     . LYS A 1 200 ? -56.343  68.200  -65.466 1.00 88.26  ?  200 LYS A O     1 
ATOM   1526  C  CB    . LYS A 1 200 ? -55.390  66.738  -68.264 1.00 85.36  ?  200 LYS A CB    1 
ATOM   1527  N  N     . ILE A 1 201 ? -54.160  67.670  -65.407 1.00 84.24  ?  201 ILE A N     1 
ATOM   1528  C  CA    . ILE A 1 201 ? -53.864  68.748  -64.461 1.00 77.50  ?  201 ILE A CA    1 
ATOM   1529  C  C     . ILE A 1 201 ? -54.441  70.077  -64.910 1.00 79.03  ?  201 ILE A C     1 
ATOM   1530  O  O     . ILE A 1 201 ? -55.094  70.765  -64.129 1.00 82.46  ?  201 ILE A O     1 
ATOM   1531  C  CB    . ILE A 1 201 ? -52.361  68.961  -64.213 1.00 75.74  ?  201 ILE A CB    1 
ATOM   1532  C  CG1   . ILE A 1 201 ? -51.812  67.889  -63.271 1.00 86.43  ?  201 ILE A CG1   1 
ATOM   1533  C  CG2   . ILE A 1 201 ? -52.130  70.321  -63.593 1.00 65.74  ?  201 ILE A CG2   1 
ATOM   1534  C  CD1   . ILE A 1 201 ? -51.536  66.560  -63.963 1.00 96.96  ?  201 ILE A CD1   1 
ATOM   1535  N  N     . ASP A 1 202 ? -54.192  70.444  -66.162 1.00 74.55  ?  202 ASP A N     1 
ATOM   1536  C  CA    . ASP A 1 202 ? -54.620  71.744  -66.647 1.00 74.87  ?  202 ASP A CA    1 
ATOM   1537  C  C     . ASP A 1 202 ? -56.090  71.998  -66.343 1.00 77.51  ?  202 ASP A C     1 
ATOM   1538  O  O     . ASP A 1 202 ? -56.482  73.125  -66.050 1.00 84.91  ?  202 ASP A O     1 
ATOM   1539  C  CB    . ASP A 1 202 ? -54.333  71.891  -68.134 1.00 89.67  ?  202 ASP A CB    1 
ATOM   1540  C  CG    . ASP A 1 202 ? -52.947  72.455  -68.403 1.00 105.62 ?  202 ASP A CG    1 
ATOM   1541  O  OD1   . ASP A 1 202 ? -52.310  72.914  -67.419 1.00 109.56 ?  202 ASP A OD1   1 
ATOM   1542  O  OD2   . ASP A 1 202 ? -52.509  72.450  -69.589 1.00 109.74 ?  202 ASP A OD2   1 
ATOM   1543  N  N     . LYS A 1 203 ? -56.894  70.944  -66.383 1.00 74.49  ?  203 LYS A N     1 
ATOM   1544  C  CA    . LYS A 1 203 ? -58.333  71.074  -66.173 1.00 74.19  ?  203 LYS A CA    1 
ATOM   1545  C  C     . LYS A 1 203 ? -58.662  71.093  -64.674 1.00 80.85  ?  203 LYS A C     1 
ATOM   1546  O  O     . LYS A 1 203 ? -59.490  71.885  -64.227 1.00 86.00  ?  203 LYS A O     1 
ATOM   1547  C  CB    . LYS A 1 203 ? -59.085  69.952  -66.907 1.00 69.97  ?  203 LYS A CB    1 
ATOM   1548  C  CG    . LYS A 1 203 ? -60.602  69.958  -66.743 1.00 68.19  ?  203 LYS A CG    1 
ATOM   1549  C  CD    . LYS A 1 203 ? -61.215  71.198  -67.361 1.00 79.16  ?  203 LYS A CD    1 
ATOM   1550  C  CE    . LYS A 1 203 ? -62.739  71.151  -67.288 1.00 90.01  ?  203 LYS A CE    1 
ATOM   1551  N  NZ    . LYS A 1 203 ? -63.377  71.886  -68.436 1.00 94.63  ?  203 LYS A NZ    1 
ATOM   1552  N  N     . LEU A 1 204 ? -58.011  70.227  -63.900 1.00 78.64  ?  204 LEU A N     1 
ATOM   1553  C  CA    . LEU A 1 204 ? -58.147  70.273  -62.446 1.00 71.87  ?  204 LEU A CA    1 
ATOM   1554  C  C     . LEU A 1 204 ? -57.769  71.645  -61.894 1.00 77.04  ?  204 LEU A C     1 
ATOM   1555  O  O     . LEU A 1 204 ? -58.348  72.093  -60.917 1.00 83.57  ?  204 LEU A O     1 
ATOM   1556  C  CB    . LEU A 1 204 ? -57.303  69.190  -61.766 1.00 62.79  ?  204 LEU A CB    1 
ATOM   1557  C  CG    . LEU A 1 204 ? -57.670  67.739  -62.078 1.00 66.05  ?  204 LEU A CG    1 
ATOM   1558  C  CD1   . LEU A 1 204 ? -56.660  66.802  -61.471 1.00 69.59  ?  204 LEU A CD1   1 
ATOM   1559  C  CD2   . LEU A 1 204 ? -59.041  67.403  -61.556 1.00 67.35  ?  204 LEU A CD2   1 
ATOM   1560  N  N     . MET A 1 205 ? -56.810  72.319  -62.518 1.00 75.07  ?  205 MET A N     1 
ATOM   1561  C  CA    . MET A 1 205 ? -56.391  73.637  -62.036 1.00 75.95  ?  205 MET A CA    1 
ATOM   1562  C  C     . MET A 1 205 ? -57.395  74.761  -62.303 1.00 81.40  ?  205 MET A C     1 
ATOM   1563  O  O     . MET A 1 205 ? -57.194  75.886  -61.834 1.00 86.14  ?  205 MET A O     1 
ATOM   1564  C  CB    . MET A 1 205 ? -54.988  74.020  -62.545 1.00 71.64  ?  205 MET A CB    1 
ATOM   1565  C  CG    . MET A 1 205 ? -53.878  73.346  -61.758 1.00 61.42  ?  205 MET A CG    1 
ATOM   1566  S  SD    . MET A 1 205 ? -52.210  73.684  -62.313 1.00 91.59  ?  205 MET A SD    1 
ATOM   1567  C  CE    . MET A 1 205 ? -52.226  75.475  -62.267 1.00 60.87  ?  205 MET A CE    1 
ATOM   1568  N  N     . GLU A 1 206 ? -58.459  74.470  -63.054 1.00 79.34  ?  206 GLU A N     1 
ATOM   1569  C  CA    . GLU A 1 206 ? -59.562  75.426  -63.208 1.00 80.71  ?  206 GLU A CA    1 
ATOM   1570  C  C     . GLU A 1 206 ? -60.380  75.474  -61.911 1.00 81.33  ?  206 GLU A C     1 
ATOM   1571  O  O     . GLU A 1 206 ? -61.094  76.434  -61.632 1.00 81.65  ?  206 GLU A O     1 
ATOM   1572  C  CB    . GLU A 1 206 ? -60.477  75.044  -64.373 1.00 82.62  ?  206 GLU A CB    1 
ATOM   1573  C  CG    . GLU A 1 206 ? -59.981  75.416  -65.754 1.00 94.89  ?  206 GLU A CG    1 
ATOM   1574  C  CD    . GLU A 1 206 ? -60.959  74.994  -66.860 1.00 102.11 ?  206 GLU A CD    1 
ATOM   1575  O  OE1   . GLU A 1 206 ? -62.020  74.424  -66.517 1.00 103.10 ?  206 GLU A OE1   1 
ATOM   1576  O  OE2   . GLU A 1 206 ? -60.671  75.237  -68.062 1.00 101.74 ?  206 GLU A OE2   1 
ATOM   1577  N  N     . PHE A 1 207 ? -60.272  74.421  -61.119 1.00 79.54  ?  207 PHE A N     1 
ATOM   1578  C  CA    . PHE A 1 207 ? -61.033  74.326  -59.889 1.00 79.03  ?  207 PHE A CA    1 
ATOM   1579  C  C     . PHE A 1 207 ? -60.167  74.589  -58.672 1.00 74.69  ?  207 PHE A C     1 
ATOM   1580  O  O     . PHE A 1 207 ? -60.650  75.118  -57.669 1.00 72.39  ?  207 PHE A O     1 
ATOM   1581  C  CB    . PHE A 1 207 ? -61.611  72.930  -59.767 1.00 79.08  ?  207 PHE A CB    1 
ATOM   1582  C  CG    . PHE A 1 207 ? -62.465  72.540  -60.912 1.00 76.71  ?  207 PHE A CG    1 
ATOM   1583  C  CD1   . PHE A 1 207 ? -62.010  71.636  -61.852 1.00 77.88  ?  207 PHE A CD1   1 
ATOM   1584  C  CD2   . PHE A 1 207 ? -63.727  73.079  -61.056 1.00 70.76  ?  207 PHE A CD2   1 
ATOM   1585  C  CE1   . PHE A 1 207 ? -62.806  71.269  -62.915 1.00 77.28  ?  207 PHE A CE1   1 
ATOM   1586  C  CE2   . PHE A 1 207 ? -64.517  72.717  -62.103 1.00 71.67  ?  207 PHE A CE2   1 
ATOM   1587  C  CZ    . PHE A 1 207 ? -64.055  71.806  -63.037 1.00 75.70  ?  207 PHE A CZ    1 
ATOM   1588  N  N     . LEU A 1 208 ? -58.898  74.188  -58.788 1.00 70.30  ?  208 LEU A N     1 
ATOM   1589  C  CA    . LEU A 1 208 ? -57.919  74.184  -57.707 1.00 62.69  ?  208 LEU A CA    1 
ATOM   1590  C  C     . LEU A 1 208 ? -56.648  74.844  -58.213 1.00 63.18  ?  208 LEU A C     1 
ATOM   1591  O  O     . LEU A 1 208 ? -55.668  74.169  -58.500 1.00 61.37  ?  208 LEU A O     1 
ATOM   1592  C  CB    . LEU A 1 208 ? -57.601  72.746  -57.298 1.00 58.57  ?  208 LEU A CB    1 
ATOM   1593  C  CG    . LEU A 1 208 ? -56.944  72.450  -55.938 1.00 63.25  ?  208 LEU A CG    1 
ATOM   1594  C  CD1   . LEU A 1 208 ? -56.038  71.219  -56.025 1.00 58.00  ?  208 LEU A CD1   1 
ATOM   1595  C  CD2   . LEU A 1 208 ? -56.157  73.623  -55.436 1.00 71.69  ?  208 LEU A CD2   1 
ATOM   1596  N  N     . PRO A 1 209 ? -56.665  76.177  -58.324 1.00 64.44  ?  209 PRO A N     1 
ATOM   1597  C  CA    . PRO A 1 209 ? -55.632  76.958  -59.013 1.00 66.16  ?  209 PRO A CA    1 
ATOM   1598  C  C     . PRO A 1 209 ? -54.340  77.123  -58.232 1.00 69.30  ?  209 PRO A C     1 
ATOM   1599  O  O     . PRO A 1 209 ? -53.317  77.495  -58.821 1.00 78.79  ?  209 PRO A O     1 
ATOM   1600  C  CB    . PRO A 1 209 ? -56.300  78.317  -59.203 1.00 67.16  ?  209 PRO A CB    1 
ATOM   1601  C  CG    . PRO A 1 209 ? -57.287  78.393  -58.105 1.00 68.85  ?  209 PRO A CG    1 
ATOM   1602  C  CD    . PRO A 1 209 ? -57.800  77.014  -57.900 1.00 64.50  ?  209 PRO A CD    1 
ATOM   1603  N  N     . GLY A 1 210 ? -54.378  76.872  -56.927 1.00 65.66  ?  210 GLY A N     1 
ATOM   1604  C  CA    . GLY A 1 210 ? -53.163  76.952  -56.137 1.00 65.95  ?  210 GLY A CA    1 
ATOM   1605  C  C     . GLY A 1 210 ? -53.350  76.781  -54.645 1.00 67.13  ?  210 GLY A C     1 
ATOM   1606  O  O     . GLY A 1 210 ? -54.469  76.559  -54.158 1.00 73.62  ?  210 GLY A O     1 
ATOM   1607  N  N     . PRO A 1 211 ? -52.244  76.889  -53.896 1.00 63.54  ?  211 PRO A N     1 
ATOM   1608  C  CA    . PRO A 1 211 ? -52.327  76.813  -52.440 1.00 65.71  ?  211 PRO A CA    1 
ATOM   1609  C  C     . PRO A 1 211 ? -53.154  77.978  -51.931 1.00 72.27  ?  211 PRO A C     1 
ATOM   1610  O  O     . PRO A 1 211 ? -53.304  78.974  -52.635 1.00 77.75  ?  211 PRO A O     1 
ATOM   1611  C  CB    . PRO A 1 211 ? -50.864  76.972  -51.995 1.00 63.78  ?  211 PRO A CB    1 
ATOM   1612  C  CG    . PRO A 1 211 ? -50.031  76.676  -53.209 1.00 61.30  ?  211 PRO A CG    1 
ATOM   1613  C  CD    . PRO A 1 211 ? -50.872  77.159  -54.355 1.00 65.79  ?  211 PRO A CD    1 
ATOM   1614  N  N     . ASP A 1 212 ? -53.696  77.848  -50.726 1.00 69.26  ?  212 ASP A N     1 
ATOM   1615  C  CA    . ASP A 1 212 ? -54.382  78.952  -50.075 1.00 67.15  ?  212 ASP A CA    1 
ATOM   1616  C  C     . ASP A 1 212 ? -53.901  79.007  -48.634 1.00 70.69  ?  212 ASP A C     1 
ATOM   1617  O  O     . ASP A 1 212 ? -54.477  78.368  -47.752 1.00 71.77  ?  212 ASP A O     1 
ATOM   1618  C  CB    . ASP A 1 212 ? -55.887  78.740  -50.111 1.00 73.54  ?  212 ASP A CB    1 
ATOM   1619  C  CG    . ASP A 1 212 ? -56.646  79.963  -49.670 1.00 78.09  ?  212 ASP A CG    1 
ATOM   1620  O  OD1   . ASP A 1 212 ? -56.067  81.069  -49.815 1.00 78.90  ?  212 ASP A OD1   1 
ATOM   1621  O  OD2   . ASP A 1 212 ? -57.805  79.812  -49.193 1.00 77.18  ?  212 ASP A OD2   1 
ATOM   1622  N  N     . PHE A 1 213 ? -52.822  79.747  -48.404 1.00 70.60  ?  213 PHE A N     1 
ATOM   1623  C  CA    . PHE A 1 213 ? -52.276  79.894  -47.065 1.00 65.23  ?  213 PHE A CA    1 
ATOM   1624  C  C     . PHE A 1 213 ? -53.281  80.587  -46.142 1.00 71.67  ?  213 PHE A C     1 
ATOM   1625  O  O     . PHE A 1 213 ? -53.999  81.499  -46.559 1.00 70.29  ?  213 PHE A O     1 
ATOM   1626  C  CB    . PHE A 1 213 ? -50.991  80.701  -47.108 1.00 61.06  ?  213 PHE A CB    1 
ATOM   1627  C  CG    . PHE A 1 213 ? -49.909  80.090  -47.949 1.00 62.84  ?  213 PHE A CG    1 
ATOM   1628  C  CD1   . PHE A 1 213 ? -49.346  78.881  -47.604 1.00 61.90  ?  213 PHE A CD1   1 
ATOM   1629  C  CD2   . PHE A 1 213 ? -49.424  80.752  -49.060 1.00 68.84  ?  213 PHE A CD2   1 
ATOM   1630  C  CE1   . PHE A 1 213 ? -48.334  78.333  -48.366 1.00 64.58  ?  213 PHE A CE1   1 
ATOM   1631  C  CE2   . PHE A 1 213 ? -48.408  80.211  -49.828 1.00 68.86  ?  213 PHE A CE2   1 
ATOM   1632  C  CZ    . PHE A 1 213 ? -47.864  79.000  -49.482 1.00 66.17  ?  213 PHE A CZ    1 
ATOM   1633  N  N     . PRO A 1 214 ? -53.339  80.149  -44.876 1.00 75.06  ?  214 PRO A N     1 
ATOM   1634  C  CA    . PRO A 1 214 ? -54.267  80.747  -43.916 1.00 70.18  ?  214 PRO A CA    1 
ATOM   1635  C  C     . PRO A 1 214 ? -53.784  82.137  -43.507 1.00 67.84  ?  214 PRO A C     1 
ATOM   1636  O  O     . PRO A 1 214 ? -54.576  82.941  -43.046 1.00 76.00  ?  214 PRO A O     1 
ATOM   1637  C  CB    . PRO A 1 214 ? -54.203  79.779  -42.744 1.00 70.61  ?  214 PRO A CB    1 
ATOM   1638  C  CG    . PRO A 1 214 ? -52.814  79.268  -42.787 1.00 71.56  ?  214 PRO A CG    1 
ATOM   1639  C  CD    . PRO A 1 214 ? -52.513  79.101  -44.254 1.00 75.87  ?  214 PRO A CD    1 
ATOM   1640  N  N     . THR A 1 215 ? -52.499  82.410  -43.696 1.00 63.48  ?  215 THR A N     1 
ATOM   1641  C  CA    . THR A 1 215 ? -51.944  83.741  -43.477 1.00 68.33  ?  215 THR A CA    1 
ATOM   1642  C  C     . THR A 1 215 ? -52.107  84.611  -44.720 1.00 68.29  ?  215 THR A C     1 
ATOM   1643  O  O     . THR A 1 215 ? -51.555  85.725  -44.792 1.00 67.65  ?  215 THR A O     1 
ATOM   1644  C  CB    . THR A 1 215 ? -50.434  83.665  -43.181 1.00 76.54  ?  215 THR A CB    1 
ATOM   1645  O  OG1   . THR A 1 215 ? -49.799  82.841  -44.170 1.00 82.83  ?  215 THR A OG1   1 
ATOM   1646  C  CG2   . THR A 1 215 ? -50.165  83.095  -41.789 1.00 76.21  ?  215 THR A CG2   1 
ATOM   1647  N  N     . GLY A 1 216 ? -52.834  84.077  -45.703 1.00 64.73  ?  216 GLY A N     1 
ATOM   1648  C  CA    . GLY A 1 216 ? -52.991  84.701  -47.011 1.00 66.27  ?  216 GLY A CA    1 
ATOM   1649  C  C     . GLY A 1 216 ? -51.727  85.147  -47.747 1.00 68.95  ?  216 GLY A C     1 
ATOM   1650  O  O     . GLY A 1 216 ? -50.722  84.431  -47.828 1.00 67.73  ?  216 GLY A O     1 
ATOM   1651  N  N     . ALA A 1 217 ? -51.800  86.356  -48.293 1.00 71.68  ?  217 ALA A N     1 
ATOM   1652  C  CA    . ALA A 1 217 ? -50.721  86.953  -49.079 1.00 74.70  ?  217 ALA A CA    1 
ATOM   1653  C  C     . ALA A 1 217 ? -50.753  86.631  -50.588 1.00 78.02  ?  217 ALA A C     1 
ATOM   1654  O  O     . ALA A 1 217 ? -51.782  86.248  -51.145 1.00 86.22  ?  217 ALA A O     1 
ATOM   1655  C  CB    . ALA A 1 217 ? -49.387  86.621  -48.490 1.00 60.75  ?  217 ALA A CB    1 
ATOM   1656  N  N     . ILE A 1 218 ? -49.615  86.810  -51.243 1.00 75.55  ?  218 ILE A N     1 
ATOM   1657  C  CA    . ILE A 1 218 ? -49.532  86.696  -52.689 1.00 73.01  ?  218 ILE A CA    1 
ATOM   1658  C  C     . ILE A 1 218 ? -48.637  85.535  -53.130 1.00 74.05  ?  218 ILE A C     1 
ATOM   1659  O  O     . ILE A 1 218 ? -47.432  85.528  -52.827 1.00 76.82  ?  218 ILE A O     1 
ATOM   1660  C  CB    . ILE A 1 218 ? -48.920  87.972  -53.269 1.00 69.30  ?  218 ILE A CB    1 
ATOM   1661  C  CG1   . ILE A 1 218 ? -49.838  89.171  -53.039 1.00 68.38  ?  218 ILE A CG1   1 
ATOM   1662  C  CG2   . ILE A 1 218 ? -48.601  87.787  -54.725 1.00 67.69  ?  218 ILE A CG2   1 
ATOM   1663  C  CD1   . ILE A 1 218 ? -49.135  90.487  -53.282 1.00 73.57  ?  218 ILE A CD1   1 
ATOM   1664  N  N     . ILE A 1 219 ? -49.217  84.570  -53.851 1.00 69.01  ?  219 ILE A N     1 
ATOM   1665  C  CA    . ILE A 1 219 ? -48.445  83.462  -54.411 1.00 70.06  ?  219 ILE A CA    1 
ATOM   1666  C  C     . ILE A 1 219 ? -48.146  83.672  -55.896 1.00 76.22  ?  219 ILE A C     1 
ATOM   1667  O  O     . ILE A 1 219 ? -49.056  83.739  -56.711 1.00 82.18  ?  219 ILE A O     1 
ATOM   1668  C  CB    . ILE A 1 219 ? -49.174  82.124  -54.261 1.00 69.53  ?  219 ILE A CB    1 
ATOM   1669  C  CG1   . ILE A 1 219 ? -49.700  81.935  -52.839 1.00 65.51  ?  219 ILE A CG1   1 
ATOM   1670  C  CG2   . ILE A 1 219 ? -48.244  80.972  -54.609 1.00 74.37  ?  219 ILE A CG2   1 
ATOM   1671  C  CD1   . ILE A 1 219 ? -50.298  80.547  -52.620 1.00 57.14  ?  219 ILE A CD1   1 
ATOM   1672  N  N     . GLN A 1 220 ? -46.865  83.755  -56.240 1.00 75.53  ?  220 GLN A N     1 
ATOM   1673  C  CA    . GLN A 1 220 ? -46.438  84.057  -57.602 1.00 75.49  ?  220 GLN A CA    1 
ATOM   1674  C  C     . GLN A 1 220 ? -45.748  82.868  -58.289 1.00 83.03  ?  220 GLN A C     1 
ATOM   1675  O  O     . GLN A 1 220 ? -44.703  82.396  -57.826 1.00 84.91  ?  220 GLN A O     1 
ATOM   1676  C  CB    . GLN A 1 220 ? -45.474  85.255  -57.597 1.00 71.82  ?  220 GLN A CB    1 
ATOM   1677  C  CG    . GLN A 1 220 ? -46.111  86.614  -57.339 1.00 77.17  ?  220 GLN A CG    1 
ATOM   1678  C  CD    . GLN A 1 220 ? -45.083  87.755  -57.185 1.00 89.58  ?  220 GLN A CD    1 
ATOM   1679  O  OE1   . GLN A 1 220 ? -43.867  87.530  -57.093 1.00 88.09  ?  220 GLN A OE1   1 
ATOM   1680  N  NE2   . GLN A 1 220 ? -45.582  88.989  -57.155 1.00 99.45  ?  220 GLN A NE2   1 
ATOM   1681  N  N     . GLY A 1 221 ? -46.321  82.403  -59.402 1.00 86.83  ?  221 GLY A N     1 
ATOM   1682  C  CA    . GLY A 1 221 ? -45.667  81.421  -60.258 1.00 91.52  ?  221 GLY A CA    1 
ATOM   1683  C  C     . GLY A 1 221 ? -46.596  80.349  -60.790 1.00 92.46  ?  221 GLY A C     1 
ATOM   1684  O  O     . GLY A 1 221 ? -46.452  79.177  -60.448 1.00 85.21  ?  221 GLY A O     1 
ATOM   1685  N  N     . ARG A 1 222 ? -47.551  80.741  -61.631 1.00 96.67  ?  222 ARG A N     1 
ATOM   1686  C  CA    . ARG A 1 222 ? -48.544  79.789  -62.127 1.00 82.92  ?  222 ARG A CA    1 
ATOM   1687  C  C     . ARG A 1 222 ? -47.835  78.586  -62.738 1.00 75.77  ?  222 ARG A C     1 
ATOM   1688  O  O     . ARG A 1 222 ? -48.291  77.452  -62.588 1.00 67.31  ?  222 ARG A O     1 
ATOM   1689  C  CB    . ARG A 1 222 ? -49.524  80.432  -63.125 1.00 68.43  ?  222 ARG A CB    1 
ATOM   1690  N  N     . ASP A 1 223 ? -46.698  78.820  -63.393 1.00 78.85  ?  223 ASP A N     1 
ATOM   1691  C  CA    . ASP A 1 223 ? -45.999  77.708  -64.043 1.00 79.58  ?  223 ASP A CA    1 
ATOM   1692  C  C     . ASP A 1 223 ? -45.469  76.676  -63.031 1.00 81.66  ?  223 ASP A C     1 
ATOM   1693  O  O     . ASP A 1 223 ? -45.715  75.479  -63.177 1.00 79.84  ?  223 ASP A O     1 
ATOM   1694  C  CB    . ASP A 1 223 ? -44.918  78.194  -65.020 1.00 74.44  ?  223 ASP A CB    1 
ATOM   1695  N  N     . GLU A 1 224 ? -44.779  77.133  -61.989 1.00 85.15  ?  224 GLU A N     1 
ATOM   1696  C  CA    . GLU A 1 224 ? -44.283  76.207  -60.967 1.00 78.66  ?  224 GLU A CA    1 
ATOM   1697  C  C     . GLU A 1 224 ? -45.401  75.535  -60.143 1.00 72.71  ?  224 GLU A C     1 
ATOM   1698  O  O     . GLU A 1 224 ? -45.263  74.393  -59.686 1.00 68.61  ?  224 GLU A O     1 
ATOM   1699  C  CB    . GLU A 1 224 ? -43.268  76.898  -60.066 1.00 78.67  ?  224 GLU A CB    1 
ATOM   1700  C  CG    . GLU A 1 224 ? -41.929  77.167  -60.756 1.00 88.73  ?  224 GLU A CG    1 
ATOM   1701  C  CD    . GLU A 1 224 ? -40.969  75.984  -60.658 1.00 96.85  ?  224 GLU A CD    1 
ATOM   1702  O  OE1   . GLU A 1 224 ? -41.040  75.242  -59.647 1.00 98.20  ?  224 GLU A OE1   1 
ATOM   1703  O  OE2   . GLU A 1 224 ? -40.150  75.797  -61.592 1.00 97.89  ?  224 GLU A OE2   1 
ATOM   1704  N  N     . ILE A 1 225 ? -46.521  76.221  -59.957 1.00 71.31  ?  225 ILE A N     1 
ATOM   1705  C  CA    . ILE A 1 225 ? -47.646  75.562  -59.307 1.00 69.09  ?  225 ILE A CA    1 
ATOM   1706  C  C     . ILE A 1 225 ? -48.045  74.345  -60.136 1.00 77.97  ?  225 ILE A C     1 
ATOM   1707  O  O     . ILE A 1 225 ? -48.264  73.262  -59.587 1.00 83.28  ?  225 ILE A O     1 
ATOM   1708  C  CB    . ILE A 1 225 ? -48.837  76.508  -59.129 1.00 64.31  ?  225 ILE A CB    1 
ATOM   1709  C  CG1   . ILE A 1 225 ? -48.430  77.698  -58.249 1.00 66.18  ?  225 ILE A CG1   1 
ATOM   1710  C  CG2   . ILE A 1 225 ? -50.041  75.751  -58.560 1.00 58.77  ?  225 ILE A CG2   1 
ATOM   1711  C  CD1   . ILE A 1 225 ? -49.550  78.690  -57.979 1.00 62.40  ?  225 ILE A CD1   1 
ATOM   1712  N  N     . LYS A 1 226 ? -48.121  74.530  -61.459 1.00 77.98  ?  226 LYS A N     1 
ATOM   1713  C  CA    . LYS A 1 226 ? -48.400  73.436  -62.392 1.00 73.35  ?  226 LYS A CA    1 
ATOM   1714  C  C     . LYS A 1 226 ? -47.344  72.352  -62.194 1.00 72.45  ?  226 LYS A C     1 
ATOM   1715  O  O     . LYS A 1 226 ? -47.683  71.194  -61.926 1.00 70.44  ?  226 LYS A O     1 
ATOM   1716  C  CB    . LYS A 1 226 ? -48.406  73.947  -63.849 1.00 72.94  ?  226 LYS A CB    1 
ATOM   1717  C  CG    . LYS A 1 226 ? -48.800  72.940  -64.958 1.00 71.06  ?  226 LYS A CG    1 
ATOM   1718  N  N     . LYS A 1 227 ? -46.069  72.735  -62.304 1.00 74.63  ?  227 LYS A N     1 
ATOM   1719  C  CA    . LYS A 1 227 ? -44.964  71.778  -62.205 1.00 62.70  ?  227 LYS A CA    1 
ATOM   1720  C  C     . LYS A 1 227 ? -45.170  70.954  -60.946 1.00 67.71  ?  227 LYS A C     1 
ATOM   1721  O  O     . LYS A 1 227 ? -45.002  69.727  -60.939 1.00 67.01  ?  227 LYS A O     1 
ATOM   1722  C  CB    . LYS A 1 227 ? -43.585  72.474  -62.209 1.00 64.16  ?  227 LYS A CB    1 
ATOM   1723  C  CG    . LYS A 1 227 ? -42.375  71.516  -62.099 1.00 80.25  ?  227 LYS A CG    1 
ATOM   1724  C  CD    . LYS A 1 227 ? -40.989  72.215  -62.238 1.00 66.62  ?  227 LYS A CD    1 
ATOM   1725  N  N     . ALA A 1 228 ? -45.572  71.628  -59.875 1.00 69.35  ?  228 ALA A N     1 
ATOM   1726  C  CA    . ALA A 1 228 ? -45.651  70.955  -58.592 1.00 67.23  ?  228 ALA A CA    1 
ATOM   1727  C  C     . ALA A 1 228 ? -46.842  70.012  -58.575 1.00 72.21  ?  228 ALA A C     1 
ATOM   1728  O  O     . ALA A 1 228 ? -46.730  68.870  -58.138 1.00 81.53  ?  228 ALA A O     1 
ATOM   1729  C  CB    . ALA A 1 228 ? -45.726  71.956  -57.467 1.00 57.05  ?  228 ALA A CB    1 
ATOM   1730  N  N     . TYR A 1 229 ? -47.981  70.481  -59.068 1.00 66.71  ?  229 TYR A N     1 
ATOM   1731  C  CA    . TYR A 1 229 ? -49.154  69.636  -59.090 1.00 66.29  ?  229 TYR A CA    1 
ATOM   1732  C  C     . TYR A 1 229 ? -48.904  68.413  -59.976 1.00 76.54  ?  229 TYR A C     1 
ATOM   1733  O  O     . TYR A 1 229 ? -49.602  67.398  -59.863 1.00 83.26  ?  229 TYR A O     1 
ATOM   1734  C  CB    . TYR A 1 229 ? -50.381  70.422  -59.547 1.00 66.42  ?  229 TYR A CB    1 
ATOM   1735  C  CG    . TYR A 1 229 ? -50.942  71.366  -58.500 1.00 70.98  ?  229 TYR A CG    1 
ATOM   1736  C  CD1   . TYR A 1 229 ? -50.540  71.281  -57.172 1.00 68.92  ?  229 TYR A CD1   1 
ATOM   1737  C  CD2   . TYR A 1 229 ? -51.886  72.339  -58.838 1.00 74.88  ?  229 TYR A CD2   1 
ATOM   1738  C  CE1   . TYR A 1 229 ? -51.049  72.140  -56.216 1.00 68.21  ?  229 TYR A CE1   1 
ATOM   1739  C  CE2   . TYR A 1 229 ? -52.402  73.204  -57.888 1.00 70.55  ?  229 TYR A CE2   1 
ATOM   1740  C  CZ    . TYR A 1 229 ? -51.979  73.098  -56.573 1.00 71.85  ?  229 TYR A CZ    1 
ATOM   1741  O  OH    . TYR A 1 229 ? -52.481  73.948  -55.605 1.00 78.55  ?  229 TYR A OH    1 
ATOM   1742  N  N     . GLU A 1 230 ? -47.894  68.509  -60.843 1.00 76.59  ?  230 GLU A N     1 
ATOM   1743  C  CA    . GLU A 1 230 ? -47.579  67.424  -61.777 1.00 79.46  ?  230 GLU A CA    1 
ATOM   1744  C  C     . GLU A 1 230 ? -46.597  66.410  -61.200 1.00 79.44  ?  230 GLU A C     1 
ATOM   1745  O  O     . GLU A 1 230 ? -46.857  65.209  -61.222 1.00 86.37  ?  230 GLU A O     1 
ATOM   1746  C  CB    . GLU A 1 230 ? -47.030  67.974  -63.097 1.00 88.61  ?  230 GLU A CB    1 
ATOM   1747  C  CG    . GLU A 1 230 ? -48.080  68.320  -64.133 1.00 99.89  ?  230 GLU A CG    1 
ATOM   1748  C  CD    . GLU A 1 230 ? -47.507  69.122  -65.300 1.00 114.01 ?  230 GLU A CD    1 
ATOM   1749  O  OE1   . GLU A 1 230 ? -46.276  69.377  -65.306 1.00 117.53 ?  230 GLU A OE1   1 
ATOM   1750  O  OE2   . GLU A 1 230 ? -48.289  69.507  -66.204 1.00 117.72 ?  230 GLU A OE2   1 
ATOM   1751  N  N     . THR A 1 231 ? -45.469  66.899  -60.691 1.00 74.67  ?  231 THR A N     1 
ATOM   1752  C  CA    . THR A 1 231 ? -44.413  66.030  -60.182 1.00 71.35  ?  231 THR A CA    1 
ATOM   1753  C  C     . THR A 1 231 ? -44.328  66.028  -58.665 1.00 71.53  ?  231 THR A C     1 
ATOM   1754  O  O     . THR A 1 231 ? -43.562  65.262  -58.094 1.00 72.02  ?  231 THR A O     1 
ATOM   1755  C  CB    . THR A 1 231 ? -43.057  66.506  -60.652 1.00 73.64  ?  231 THR A CB    1 
ATOM   1756  O  OG1   . THR A 1 231 ? -42.818  67.822  -60.129 1.00 75.60  ?  231 THR A OG1   1 
ATOM   1757  C  CG2   . THR A 1 231 ? -43.023  66.548  -62.141 1.00 78.36  ?  231 THR A CG2   1 
ATOM   1758  N  N     . GLY A 1 232 ? -45.079  66.907  -58.014 1.00 74.22  ?  232 GLY A N     1 
ATOM   1759  C  CA    . GLY A 1 232 ? -45.029  67.010  -56.570 1.00 73.09  ?  232 GLY A CA    1 
ATOM   1760  C  C     . GLY A 1 232 ? -43.864  67.842  -56.051 1.00 73.18  ?  232 GLY A C     1 
ATOM   1761  O  O     . GLY A 1 232 ? -43.732  68.015  -54.845 1.00 78.89  ?  232 GLY A O     1 
ATOM   1762  N  N     . LYS A 1 233 ? -43.004  68.337  -56.941 1.00 62.90  ?  233 LYS A N     1 
ATOM   1763  C  CA    . LYS A 1 233 ? -41.981  69.306  -56.542 1.00 63.96  ?  233 LYS A CA    1 
ATOM   1764  C  C     . LYS A 1 233 ? -42.145  70.575  -57.377 1.00 76.64  ?  233 LYS A C     1 
ATOM   1765  O  O     . LYS A 1 233 ? -42.645  70.523  -58.495 1.00 88.66  ?  233 LYS A O     1 
ATOM   1766  C  CB    . LYS A 1 233 ? -40.567  68.753  -56.730 1.00 64.14  ?  233 LYS A CB    1 
ATOM   1767  C  CG    . LYS A 1 233 ? -39.974  67.936  -55.569 1.00 59.51  ?  233 LYS A CG    1 
ATOM   1768  C  CD    . LYS A 1 233 ? -38.437  67.745  -55.757 1.00 72.60  ?  233 LYS A CD    1 
ATOM   1769  C  CE    . LYS A 1 233 ? -37.794  66.708  -54.832 1.00 77.01  ?  233 LYS A CE    1 
ATOM   1770  N  NZ    . LYS A 1 233 ? -37.280  67.274  -53.538 1.00 85.32  ?  233 LYS A NZ    1 
ATOM   1771  N  N     . GLY A 1 234 ? -41.718  71.709  -56.832 1.00 76.15  ?  234 GLY A N     1 
ATOM   1772  C  CA    . GLY A 1 234 ? -41.902  73.004  -57.473 1.00 77.93  ?  234 GLY A CA    1 
ATOM   1773  C  C     . GLY A 1 234 ? -41.631  74.131  -56.479 1.00 75.16  ?  234 GLY A C     1 
ATOM   1774  O  O     . GLY A 1 234 ? -41.966  74.007  -55.301 1.00 75.51  ?  234 GLY A O     1 
ATOM   1775  N  N     . ARG A 1 235 ? -41.016  75.216  -56.953 1.00 73.50  ?  235 ARG A N     1 
ATOM   1776  C  CA    . ARG A 1 235 ? -40.594  76.338  -56.107 1.00 72.38  ?  235 ARG A CA    1 
ATOM   1777  C  C     . ARG A 1 235 ? -41.417  77.558  -56.502 1.00 71.92  ?  235 ARG A C     1 
ATOM   1778  O  O     . ARG A 1 235 ? -41.362  78.013  -57.635 1.00 79.98  ?  235 ARG A O     1 
ATOM   1779  C  CB    . ARG A 1 235 ? -39.075  76.592  -56.265 1.00 82.04  ?  235 ARG A CB    1 
ATOM   1780  C  CG    . ARG A 1 235 ? -38.476  77.865  -55.624 1.00 65.82  ?  235 ARG A CG    1 
ATOM   1781  N  N     . VAL A 1 236 ? -42.209  78.070  -55.572 1.00 73.08  ?  236 VAL A N     1 
ATOM   1782  C  CA    . VAL A 1 236 ? -43.086  79.192  -55.869 1.00 72.03  ?  236 VAL A CA    1 
ATOM   1783  C  C     . VAL A 1 236 ? -42.630  80.398  -55.039 1.00 76.41  ?  236 VAL A C     1 
ATOM   1784  O  O     . VAL A 1 236 ? -41.786  80.251  -54.163 1.00 85.54  ?  236 VAL A O     1 
ATOM   1785  C  CB    . VAL A 1 236 ? -44.565  78.806  -55.607 1.00 66.93  ?  236 VAL A CB    1 
ATOM   1786  C  CG1   . VAL A 1 236 ? -45.027  79.252  -54.208 1.00 59.02  ?  236 VAL A CG1   1 
ATOM   1787  C  CG2   . VAL A 1 236 ? -45.462  79.348  -56.719 1.00 66.30  ?  236 VAL A CG2   1 
ATOM   1788  N  N     . VAL A 1 237 ? -43.139  81.592  -55.324 1.00 71.04  ?  237 VAL A N     1 
ATOM   1789  C  CA    . VAL A 1 237 ? -42.804  82.750  -54.495 1.00 73.22  ?  237 VAL A CA    1 
ATOM   1790  C  C     . VAL A 1 237 ? -44.003  83.215  -53.669 1.00 77.33  ?  237 VAL A C     1 
ATOM   1791  O  O     . VAL A 1 237 ? -45.120  83.297  -54.179 1.00 83.63  ?  237 VAL A O     1 
ATOM   1792  C  CB    . VAL A 1 237 ? -42.291  83.930  -55.330 1.00 67.28  ?  237 VAL A CB    1 
ATOM   1793  C  CG1   . VAL A 1 237 ? -42.291  85.194  -54.502 1.00 71.77  ?  237 VAL A CG1   1 
ATOM   1794  C  CG2   . VAL A 1 237 ? -40.904  83.647  -55.810 1.00 68.78  ?  237 VAL A CG2   1 
ATOM   1795  N  N     . VAL A 1 238 ? -43.777  83.507  -52.391 1.00 75.89  ?  238 VAL A N     1 
ATOM   1796  C  CA    . VAL A 1 238 ? -44.832  84.086  -51.569 1.00 75.83  ?  238 VAL A CA    1 
ATOM   1797  C  C     . VAL A 1 238 ? -44.447  85.474  -51.073 1.00 86.02  ?  238 VAL A C     1 
ATOM   1798  O  O     . VAL A 1 238 ? -43.427  85.649  -50.388 1.00 88.78  ?  238 VAL A O     1 
ATOM   1799  C  CB    . VAL A 1 238 ? -45.160  83.230  -50.368 1.00 67.39  ?  238 VAL A CB    1 
ATOM   1800  C  CG1   . VAL A 1 238 ? -46.258  83.896  -49.589 1.00 70.77  ?  238 VAL A CG1   1 
ATOM   1801  C  CG2   . VAL A 1 238 ? -45.580  81.837  -50.803 1.00 60.52  ?  238 VAL A CG2   1 
ATOM   1802  N  N     . ARG A 1 239 ? -45.268  86.462  -51.416 1.00 72.99  ?  239 ARG A N     1 
ATOM   1803  C  CA    . ARG A 1 239 ? -44.928  87.840  -51.104 1.00 78.31  ?  239 ARG A CA    1 
ATOM   1804  C  C     . ARG A 1 239 ? -46.008  88.532  -50.293 1.00 78.77  ?  239 ARG A C     1 
ATOM   1805  O  O     . ARG A 1 239 ? -47.203  88.279  -50.485 1.00 76.67  ?  239 ARG A O     1 
ATOM   1806  C  CB    . ARG A 1 239 ? -44.673  88.630  -52.374 1.00 86.03  ?  239 ARG A CB    1 
ATOM   1807  C  CG    . ARG A 1 239 ? -44.820  90.112  -52.159 1.00 95.30  ?  239 ARG A CG    1 
ATOM   1808  C  CD    . ARG A 1 239 ? -44.704  90.828  -53.460 1.00 104.14 ?  239 ARG A CD    1 
ATOM   1809  N  NE    . ARG A 1 239 ? -43.428  90.525  -54.086 1.00 102.16 ?  239 ARG A NE    1 
ATOM   1810  C  CZ    . ARG A 1 239 ? -42.965  91.158  -55.150 1.00 102.27 ?  239 ARG A CZ    1 
ATOM   1811  N  NH1   . ARG A 1 239 ? -43.683  92.129  -55.701 1.00 102.33 ?  239 ARG A NH1   1 
ATOM   1812  N  NH2   . ARG A 1 239 ? -41.787  90.822  -55.655 1.00 106.19 ?  239 ARG A NH2   1 
ATOM   1813  N  N     . SER A 1 240 ? -45.574  89.423  -49.404 1.00 75.49  ?  240 SER A N     1 
ATOM   1814  C  CA    . SER A 1 240 ? -46.465  90.050  -48.435 1.00 75.80  ?  240 SER A CA    1 
ATOM   1815  C  C     . SER A 1 240 ? -47.420  91.066  -49.074 1.00 77.36  ?  240 SER A C     1 
ATOM   1816  O  O     . SER A 1 240 ? -47.056  91.730  -50.053 1.00 81.85  ?  240 SER A O     1 
ATOM   1817  C  CB    . SER A 1 240 ? -45.638  90.704  -47.325 1.00 77.45  ?  240 SER A CB    1 
ATOM   1818  O  OG    . SER A 1 240 ? -44.900  89.733  -46.603 1.00 79.18  ?  240 SER A OG    1 
ATOM   1819  N  N     . LYS A 1 241 ? -48.637  91.182  -48.526 1.00 74.02  ?  241 LYS A N     1 
ATOM   1820  C  CA    . LYS A 1 241 ? -49.597  92.163  -49.029 1.00 73.82  ?  241 LYS A CA    1 
ATOM   1821  C  C     . LYS A 1 241 ? -49.195  93.550  -48.547 1.00 78.45  ?  241 LYS A C     1 
ATOM   1822  O  O     . LYS A 1 241 ? -49.114  93.789  -47.349 1.00 76.97  ?  241 LYS A O     1 
ATOM   1823  C  CB    . LYS A 1 241 ? -51.057  91.848  -48.641 1.00 67.04  ?  241 LYS A CB    1 
ATOM   1824  C  CG    . LYS A 1 241 ? -52.101  92.545  -49.595 1.00 87.60  ?  241 LYS A CG    1 
ATOM   1825  C  CD    . LYS A 1 241 ? -53.576  92.567  -49.104 1.00 69.80  ?  241 LYS A CD    1 
ATOM   1826  N  N     . THR A 1 242 ? -48.938  94.457  -49.487 1.00 86.17  ?  242 THR A N     1 
ATOM   1827  C  CA    . THR A 1 242 ? -48.441  95.783  -49.143 1.00 89.58  ?  242 THR A CA    1 
ATOM   1828  C  C     . THR A 1 242 ? -49.245  96.937  -49.752 1.00 95.11  ?  242 THR A C     1 
ATOM   1829  O  O     . THR A 1 242 ? -49.472  96.992  -50.956 1.00 99.74  ?  242 THR A O     1 
ATOM   1830  C  CB    . THR A 1 242 ? -46.937  95.933  -49.496 1.00 91.46  ?  242 THR A CB    1 
ATOM   1831  O  OG1   . THR A 1 242 ? -46.712  95.573  -50.866 1.00 91.49  ?  242 THR A OG1   1 
ATOM   1832  C  CG2   . THR A 1 242 ? -46.091  95.038  -48.603 1.00 88.83  ?  242 THR A CG2   1 
ATOM   1833  N  N     . GLU A 1 243 ? -49.680  97.848  -48.892 1.00 98.03  ?  243 GLU A N     1 
ATOM   1834  C  CA    . GLU A 1 243 ? -50.310  99.091  -49.310 1.00 99.74  ?  243 GLU A CA    1 
ATOM   1835  C  C     . GLU A 1 243 ? -49.276  100.194 -49.095 1.00 96.21  ?  243 GLU A C     1 
ATOM   1836  O  O     . GLU A 1 243 ? -48.277  99.980  -48.407 1.00 94.23  ?  243 GLU A O     1 
ATOM   1837  C  CB    . GLU A 1 243 ? -51.569  99.362  -48.468 1.00 100.05 ?  243 GLU A CB    1 
ATOM   1838  N  N     . ILE A 1 244 ? -49.499  101.368 -49.678 1.00 93.76  ?  244 ILE A N     1 
ATOM   1839  C  CA    . ILE A 1 244 ? -48.624  102.504 -49.397 1.00 88.15  ?  244 ILE A CA    1 
ATOM   1840  C  C     . ILE A 1 244 ? -49.398  103.761 -49.004 1.00 93.39  ?  244 ILE A C     1 
ATOM   1841  O  O     . ILE A 1 244 ? -50.195  104.274 -49.786 1.00 101.99 ?  244 ILE A O     1 
ATOM   1842  C  CB    . ILE A 1 244 ? -47.677  102.800 -50.574 1.00 79.79  ?  244 ILE A CB    1 
ATOM   1843  C  CG1   . ILE A 1 244 ? -46.468  101.856 -50.515 1.00 73.75  ?  244 ILE A CG1   1 
ATOM   1844  C  CG2   . ILE A 1 244 ? -47.227  104.266 -50.550 1.00 75.79  ?  244 ILE A CG2   1 
ATOM   1845  C  CD1   . ILE A 1 244 ? -45.439  102.123 -51.585 1.00 73.14  ?  244 ILE A CD1   1 
ATOM   1846  N  N     . GLU A 1 245 ? -49.157  104.249 -47.788 1.00 92.28  ?  245 GLU A N     1 
ATOM   1847  C  CA    . GLU A 1 245 ? -49.849  105.436 -47.275 1.00 101.97 ?  245 GLU A CA    1 
ATOM   1848  C  C     . GLU A 1 245 ? -48.969  106.681 -47.327 1.00 107.22 ?  245 GLU A C     1 
ATOM   1849  O  O     . GLU A 1 245 ? -47.777  106.626 -47.015 1.00 105.82 ?  245 GLU A O     1 
ATOM   1850  C  CB    . GLU A 1 245 ? -50.324  105.214 -45.834 1.00 104.43 ?  245 GLU A CB    1 
ATOM   1851  C  CG    . GLU A 1 245 ? -51.425  104.179 -45.687 1.00 110.69 ?  245 GLU A CG    1 
ATOM   1852  C  CD    . GLU A 1 245 ? -51.605  103.708 -44.253 1.00 115.25 ?  245 GLU A CD    1 
ATOM   1853  O  OE1   . GLU A 1 245 ? -50.756  104.048 -43.396 1.00 116.55 ?  245 GLU A OE1   1 
ATOM   1854  O  OE2   . GLU A 1 245 ? -52.596  102.991 -43.986 1.00 114.76 ?  245 GLU A OE2   1 
ATOM   1855  N  N     . LYS A 1 246 ? -49.558  107.804 -47.724 1.00 112.65 ?  246 LYS A N     1 
ATOM   1856  C  CA    . LYS A 1 246 ? -48.830  109.066 -47.717 1.00 114.43 ?  246 LYS A CA    1 
ATOM   1857  C  C     . LYS A 1 246 ? -48.983  109.675 -46.321 1.00 121.05 ?  246 LYS A C     1 
ATOM   1858  O  O     . LYS A 1 246 ? -50.011  109.495 -45.666 1.00 123.50 ?  246 LYS A O     1 
ATOM   1859  C  CB    . LYS A 1 246 ? -49.335  110.007 -48.823 1.00 111.59 ?  246 LYS A CB    1 
ATOM   1860  N  N     . LEU A 1 247 ? -47.946  110.356 -45.850 1.00 122.12 ?  247 LEU A N     1 
ATOM   1861  C  CA    . LEU A 1 247 ? -47.979  110.971 -44.528 1.00 122.48 ?  247 LEU A CA    1 
ATOM   1862  C  C     . LEU A 1 247 ? -47.755  112.482 -44.657 1.00 132.19 ?  247 LEU A C     1 
ATOM   1863  O  O     . LEU A 1 247 ? -46.975  112.932 -45.504 1.00 132.92 ?  247 LEU A O     1 
ATOM   1864  C  CB    . LEU A 1 247 ? -46.923  110.335 -43.612 1.00 116.46 ?  247 LEU A CB    1 
ATOM   1865  C  CG    . LEU A 1 247 ? -47.048  108.852 -43.250 1.00 81.71  ?  247 LEU A CG    1 
ATOM   1866  N  N     . LYS A 1 248 ? -48.441  113.263 -43.825 1.00 138.27 ?  248 LYS A N     1 
ATOM   1867  C  CA    . LYS A 1 248 ? -48.346  114.724 -43.896 1.00 144.98 ?  248 LYS A CA    1 
ATOM   1868  C  C     . LYS A 1 248 ? -46.912  115.231 -43.717 1.00 147.18 ?  248 LYS A C     1 
ATOM   1869  O  O     . LYS A 1 248 ? -46.530  115.662 -42.628 1.00 151.54 ?  248 LYS A O     1 
ATOM   1870  C  CB    . LYS A 1 248 ? -49.272  115.390 -42.868 1.00 148.01 ?  248 LYS A CB    1 
ATOM   1871  N  N     . GLY A 1 249 ? -46.125  115.182 -44.789 1.00 144.42 ?  249 GLY A N     1 
ATOM   1872  C  CA    . GLY A 1 249 ? -44.774  115.716 -44.759 1.00 145.06 ?  249 GLY A CA    1 
ATOM   1873  C  C     . GLY A 1 249 ? -43.993  115.483 -46.040 1.00 144.21 ?  249 GLY A C     1 
ATOM   1874  O  O     . GLY A 1 249 ? -42.820  115.854 -46.138 1.00 142.66 ?  249 GLY A O     1 
ATOM   1875  N  N     . GLY A 1 250 ? -44.646  114.876 -47.027 1.00 144.36 ?  250 GLY A N     1 
ATOM   1876  C  CA    . GLY A 1 250 ? -43.973  114.471 -48.247 1.00 141.83 ?  250 GLY A CA    1 
ATOM   1877  C  C     . GLY A 1 250 ? -43.286  113.134 -48.038 1.00 134.72 ?  250 GLY A C     1 
ATOM   1878  O  O     . GLY A 1 250 ? -42.516  112.677 -48.883 1.00 133.56 ?  250 GLY A O     1 
ATOM   1879  N  N     . LYS A 1 251 ? -43.569  112.515 -46.895 1.00 129.12 ?  251 LYS A N     1 
ATOM   1880  C  CA    . LYS A 1 251 ? -43.029  111.204 -46.556 1.00 120.91 ?  251 LYS A CA    1 
ATOM   1881  C  C     . LYS A 1 251 ? -44.025  110.116 -46.956 1.00 118.29 ?  251 LYS A C     1 
ATOM   1882  O  O     . LYS A 1 251 ? -45.213  110.378 -47.139 1.00 123.28 ?  251 LYS A O     1 
ATOM   1883  C  CB    . LYS A 1 251 ? -42.745  111.112 -45.051 1.00 118.32 ?  251 LYS A CB    1 
ATOM   1884  C  CG    . LYS A 1 251 ? -41.840  112.206 -44.482 1.00 117.32 ?  251 LYS A CG    1 
ATOM   1885  C  CD    . LYS A 1 251 ? -41.756  112.112 -42.957 1.00 113.71 ?  251 LYS A CD    1 
ATOM   1886  N  N     . GLU A 1 252 ? -43.540  108.892 -47.092 1.00 110.41 ?  252 GLU A N     1 
ATOM   1887  C  CA    . GLU A 1 252 ? -44.419  107.782 -47.415 1.00 107.42 ?  252 GLU A CA    1 
ATOM   1888  C  C     . GLU A 1 252 ? -44.251  106.653 -46.401 1.00 105.83 ?  252 GLU A C     1 
ATOM   1889  O  O     . GLU A 1 252 ? -43.252  106.589 -45.683 1.00 106.92 ?  252 GLU A O     1 
ATOM   1890  C  CB    . GLU A 1 252 ? -44.147  107.269 -48.832 1.00 107.25 ?  252 GLU A CB    1 
ATOM   1891  C  CG    . GLU A 1 252 ? -44.590  108.207 -49.947 1.00 117.86 ?  252 GLU A CG    1 
ATOM   1892  C  CD    . GLU A 1 252 ? -44.597  107.533 -51.320 1.00 122.61 ?  252 GLU A CD    1 
ATOM   1893  O  OE1   . GLU A 1 252 ? -44.161  106.364 -51.416 1.00 121.85 ?  252 GLU A OE1   1 
ATOM   1894  O  OE2   . GLU A 1 252 ? -45.046  108.169 -52.301 1.00 124.96 ?  252 GLU A OE2   1 
ATOM   1895  N  N     . GLN A 1 253 ? -45.231  105.756 -46.361 1.00 101.90 ?  253 GLN A N     1 
ATOM   1896  C  CA    . GLN A 1 253 ? -45.225  104.631 -45.435 1.00 92.48  ?  253 GLN A CA    1 
ATOM   1897  C  C     . GLN A 1 253 ? -45.587  103.335 -46.160 1.00 88.66  ?  253 GLN A C     1 
ATOM   1898  O  O     . GLN A 1 253 ? -46.621  103.254 -46.832 1.00 90.33  ?  253 GLN A O     1 
ATOM   1899  C  CB    . GLN A 1 253 ? -46.240  104.890 -44.324 1.00 91.92  ?  253 GLN A CB    1 
ATOM   1900  C  CG    . GLN A 1 253 ? -45.803  104.429 -42.963 1.00 94.08  ?  253 GLN A CG    1 
ATOM   1901  C  CD    . GLN A 1 253 ? -46.842  104.720 -41.903 1.00 104.15 ?  253 GLN A CD    1 
ATOM   1902  O  OE1   . GLN A 1 253 ? -46.571  105.419 -40.922 1.00 111.72 ?  253 GLN A OE1   1 
ATOM   1903  N  NE2   . GLN A 1 253 ? -48.045  104.179 -42.091 1.00 105.20 ?  253 GLN A NE2   1 
ATOM   1904  N  N     . ILE A 1 254 ? -44.735  102.323 -46.037 1.00 82.45  ?  254 ILE A N     1 
ATOM   1905  C  CA    . ILE A 1 254 ? -45.064  100.994 -46.547 1.00 81.43  ?  254 ILE A CA    1 
ATOM   1906  C  C     . ILE A 1 254 ? -45.826  100.229 -45.471 1.00 87.07  ?  254 ILE A C     1 
ATOM   1907  O  O     . ILE A 1 254 ? -45.321  100.071 -44.361 1.00 89.48  ?  254 ILE A O     1 
ATOM   1908  C  CB    . ILE A 1 254 ? -43.804  100.191 -46.849 1.00 76.65  ?  254 ILE A CB    1 
ATOM   1909  C  CG1   . ILE A 1 254 ? -42.902  100.946 -47.816 1.00 83.96  ?  254 ILE A CG1   1 
ATOM   1910  C  CG2   . ILE A 1 254 ? -44.166  98.827  -47.402 1.00 74.47  ?  254 ILE A CG2   1 
ATOM   1911  C  CD1   . ILE A 1 254 ? -41.579  100.261 -48.025 1.00 87.10  ?  254 ILE A CD1   1 
ATOM   1912  N  N     . VAL A 1 255 ? -47.028  99.748  -45.780 1.00 84.23  ?  255 VAL A N     1 
ATOM   1913  C  CA    . VAL A 1 255 ? -47.826  99.074  -44.756 1.00 79.58  ?  255 VAL A CA    1 
ATOM   1914  C  C     . VAL A 1 255 ? -48.155  97.623  -45.082 1.00 79.40  ?  255 VAL A C     1 
ATOM   1915  O  O     . VAL A 1 255 ? -48.973  97.337  -45.952 1.00 82.26  ?  255 VAL A O     1 
ATOM   1916  C  CB    . VAL A 1 255 ? -49.127  99.842  -44.426 1.00 78.37  ?  255 VAL A CB    1 
ATOM   1917  C  CG1   . VAL A 1 255 ? -49.930  99.108  -43.349 1.00 71.87  ?  255 VAL A CG1   1 
ATOM   1918  C  CG2   . VAL A 1 255 ? -48.797  101.243 -43.959 1.00 81.57  ?  255 VAL A CG2   1 
ATOM   1919  N  N     . ILE A 1 256 ? -47.523  96.717  -44.346 1.00 77.02  ?  256 ILE A N     1 
ATOM   1920  C  CA    . ILE A 1 256 ? -47.709  95.286  -44.528 1.00 76.92  ?  256 ILE A CA    1 
ATOM   1921  C  C     . ILE A 1 256 ? -48.937  94.795  -43.762 1.00 83.11  ?  256 ILE A C     1 
ATOM   1922  O  O     . ILE A 1 256 ? -49.136  95.161  -42.605 1.00 90.14  ?  256 ILE A O     1 
ATOM   1923  C  CB    . ILE A 1 256 ? -46.464  94.535  -44.060 1.00 78.52  ?  256 ILE A CB    1 
ATOM   1924  C  CG1   . ILE A 1 256 ? -45.223  95.225  -44.634 1.00 81.99  ?  256 ILE A CG1   1 
ATOM   1925  C  CG2   . ILE A 1 256 ? -46.540  93.083  -44.485 1.00 78.19  ?  256 ILE A CG2   1 
ATOM   1926  C  CD1   . ILE A 1 256 ? -43.912  94.554  -44.310 1.00 81.33  ?  256 ILE A CD1   1 
ATOM   1927  N  N     . THR A 1 257 ? -49.764  93.977  -44.412 1.00 81.50  ?  257 THR A N     1 
ATOM   1928  C  CA    . THR A 1 257 ? -51.038  93.553  -43.831 1.00 80.14  ?  257 THR A CA    1 
ATOM   1929  C  C     . THR A 1 257 ? -51.172  92.028  -43.813 1.00 81.20  ?  257 THR A C     1 
ATOM   1930  O  O     . THR A 1 257 ? -51.895  91.469  -42.984 1.00 85.19  ?  257 THR A O     1 
ATOM   1931  C  CB    . THR A 1 257 ? -52.253  94.188  -44.564 1.00 75.55  ?  257 THR A CB    1 
ATOM   1932  O  OG1   . THR A 1 257 ? -52.583  93.412  -45.718 1.00 82.21  ?  257 THR A OG1   1 
ATOM   1933  C  CG2   . THR A 1 257 ? -51.948  95.619  -45.005 1.00 76.64  ?  257 THR A CG2   1 
ATOM   1934  N  N     . GLU A 1 258 ? -50.481  91.358  -44.731 1.00 78.87  ?  258 GLU A N     1 
ATOM   1935  C  CA    . GLU A 1 258 ? -50.400  89.900  -44.712 1.00 76.58  ?  258 GLU A CA    1 
ATOM   1936  C  C     . GLU A 1 258 ? -48.952  89.483  -44.937 1.00 73.90  ?  258 GLU A C     1 
ATOM   1937  O  O     . GLU A 1 258 ? -48.222  90.142  -45.679 1.00 70.83  ?  258 GLU A O     1 
ATOM   1938  C  CB    . GLU A 1 258 ? -51.311  89.279  -45.779 1.00 75.77  ?  258 GLU A CB    1 
ATOM   1939  C  CG    . GLU A 1 258 ? -52.770  89.708  -45.674 1.00 83.95  ?  258 GLU A CG    1 
ATOM   1940  C  CD    . GLU A 1 258 ? -53.662  89.055  -46.716 1.00 98.09  ?  258 GLU A CD    1 
ATOM   1941  O  OE1   . GLU A 1 258 ? -53.172  88.185  -47.465 1.00 100.05 ?  258 GLU A OE1   1 
ATOM   1942  O  OE2   . GLU A 1 258 ? -54.859  89.407  -46.786 1.00 108.46 ?  258 GLU A OE2   1 
ATOM   1943  N  N     . ILE A 1 259 ? -48.530  88.398  -44.293 1.00 73.49  ?  259 ILE A N     1 
ATOM   1944  C  CA    . ILE A 1 259 ? -47.188  87.874  -44.532 1.00 67.35  ?  259 ILE A CA    1 
ATOM   1945  C  C     . ILE A 1 259 ? -47.145  86.398  -44.953 1.00 70.11  ?  259 ILE A C     1 
ATOM   1946  O  O     . ILE A 1 259 ? -48.166  85.693  -44.970 1.00 78.92  ?  259 ILE A O     1 
ATOM   1947  C  CB    . ILE A 1 259 ? -46.214  88.172  -43.361 1.00 63.48  ?  259 ILE A CB    1 
ATOM   1948  C  CG1   . ILE A 1 259 ? -46.599  87.419  -42.082 1.00 68.83  ?  259 ILE A CG1   1 
ATOM   1949  C  CG2   . ILE A 1 259 ? -46.179  89.653  -43.089 1.00 63.06  ?  259 ILE A CG2   1 
ATOM   1950  C  CD1   . ILE A 1 259 ? -45.679  87.756  -40.893 1.00 68.41  ?  259 ILE A CD1   1 
ATOM   1951  N  N     . PRO A 1 260 ? -45.956  85.942  -45.343 1.00 63.90  ?  260 PRO A N     1 
ATOM   1952  C  CA    . PRO A 1 260 ? -45.746  84.606  -45.901 1.00 63.34  ?  260 PRO A CA    1 
ATOM   1953  C  C     . PRO A 1 260 ? -45.960  83.514  -44.872 1.00 60.24  ?  260 PRO A C     1 
ATOM   1954  O  O     . PRO A 1 260 ? -45.471  83.625  -43.736 1.00 56.04  ?  260 PRO A O     1 
ATOM   1955  C  CB    . PRO A 1 260 ? -44.272  84.629  -46.308 1.00 62.87  ?  260 PRO A CB    1 
ATOM   1956  C  CG    . PRO A 1 260 ? -43.920  86.065  -46.413 1.00 61.92  ?  260 PRO A CG    1 
ATOM   1957  C  CD    . PRO A 1 260 ? -44.743  86.766  -45.404 1.00 63.27  ?  260 PRO A CD    1 
ATOM   1958  N  N     . TYR A 1 261 ? -46.680  82.472  -45.273 1.00 58.88  ?  261 TYR A N     1 
ATOM   1959  C  CA    . TYR A 1 261 ? -46.840  81.270  -44.451 1.00 58.75  ?  261 TYR A CA    1 
ATOM   1960  C  C     . TYR A 1 261 ? -45.531  80.819  -43.811 1.00 67.13  ?  261 TYR A C     1 
ATOM   1961  O  O     . TYR A 1 261 ? -44.484  80.792  -44.473 1.00 71.14  ?  261 TYR A O     1 
ATOM   1962  C  CB    . TYR A 1 261 ? -47.383  80.147  -45.314 1.00 54.60  ?  261 TYR A CB    1 
ATOM   1963  C  CG    . TYR A 1 261 ? -47.761  78.876  -44.599 1.00 59.20  ?  261 TYR A CG    1 
ATOM   1964  C  CD1   . TYR A 1 261 ? -48.931  78.797  -43.836 1.00 61.24  ?  261 TYR A CD1   1 
ATOM   1965  C  CD2   . TYR A 1 261 ? -46.984  77.727  -44.734 1.00 62.87  ?  261 TYR A CD2   1 
ATOM   1966  C  CE1   . TYR A 1 261 ? -49.299  77.603  -43.200 1.00 60.37  ?  261 TYR A CE1   1 
ATOM   1967  C  CE2   . TYR A 1 261 ? -47.345  76.532  -44.108 1.00 65.06  ?  261 TYR A CE2   1 
ATOM   1968  C  CZ    . TYR A 1 261 ? -48.504  76.471  -43.344 1.00 62.22  ?  261 TYR A CZ    1 
ATOM   1969  O  OH    . TYR A 1 261 ? -48.854  75.279  -42.724 1.00 64.98  ?  261 TYR A OH    1 
ATOM   1970  N  N     . GLU A 1 262 ? -45.617  80.456  -42.528 1.00 71.40  ?  262 GLU A N     1 
ATOM   1971  C  CA    . GLU A 1 262 ? -44.494  79.940  -41.723 1.00 72.85  ?  262 GLU A CA    1 
ATOM   1972  C  C     . GLU A 1 262 ? -43.470  80.999  -41.335 1.00 69.04  ?  262 GLU A C     1 
ATOM   1973  O  O     . GLU A 1 262 ? -42.371  80.691  -40.880 1.00 74.77  ?  262 GLU A O     1 
ATOM   1974  C  CB    . GLU A 1 262 ? -43.830  78.716  -42.369 1.00 78.65  ?  262 GLU A CB    1 
ATOM   1975  C  CG    . GLU A 1 262 ? -44.675  77.451  -42.218 1.00 93.59  ?  262 GLU A CG    1 
ATOM   1976  C  CD    . GLU A 1 262 ? -44.022  76.204  -42.803 1.00 107.41 ?  262 GLU A CD    1 
ATOM   1977  O  OE1   . GLU A 1 262 ? -44.237  75.108  -42.228 1.00 114.05 ?  262 GLU A OE1   1 
ATOM   1978  O  OE2   . GLU A 1 262 ? -43.312  76.316  -43.835 1.00 108.31 ?  262 GLU A OE2   1 
ATOM   1979  N  N     . ILE A 1 263 ? -43.843  82.257  -41.501 1.00 61.97  ?  263 ILE A N     1 
ATOM   1980  C  CA    . ILE A 1 263 ? -42.941  83.335  -41.153 1.00 68.69  ?  263 ILE A CA    1 
ATOM   1981  C  C     . ILE A 1 263 ? -43.330  83.971  -39.836 1.00 77.29  ?  263 ILE A C     1 
ATOM   1982  O  O     . ILE A 1 263 ? -44.491  84.326  -39.616 1.00 86.08  ?  263 ILE A O     1 
ATOM   1983  C  CB    . ILE A 1 263 ? -42.843  84.388  -42.275 1.00 67.69  ?  263 ILE A CB    1 
ATOM   1984  C  CG1   . ILE A 1 263 ? -42.004  83.808  -43.393 1.00 64.59  ?  263 ILE A CG1   1 
ATOM   1985  C  CG2   . ILE A 1 263 ? -42.170  85.677  -41.775 1.00 59.39  ?  263 ILE A CG2   1 
ATOM   1986  C  CD1   . ILE A 1 263 ? -40.658  83.386  -42.896 1.00 60.41  ?  263 ILE A CD1   1 
ATOM   1987  N  N     . ASN A 1 264 ? -42.328  84.103  -38.973 1.00 74.39  ?  264 ASN A N     1 
ATOM   1988  C  CA    . ASN A 1 264 ? -42.466  84.659  -37.637 1.00 73.14  ?  264 ASN A CA    1 
ATOM   1989  C  C     . ASN A 1 264 ? -42.548  86.205  -37.618 1.00 70.85  ?  264 ASN A C     1 
ATOM   1990  O  O     . ASN A 1 264 ? -41.554  86.889  -37.893 1.00 73.11  ?  264 ASN A O     1 
ATOM   1991  C  CB    . ASN A 1 264 ? -41.244  84.206  -36.862 1.00 80.10  ?  264 ASN A CB    1 
ATOM   1992  C  CG    . ASN A 1 264 ? -41.421  84.321  -35.388 1.00 88.68  ?  264 ASN A CG    1 
ATOM   1993  O  OD1   . ASN A 1 264 ? -41.515  85.423  -34.853 1.00 90.47  ?  264 ASN A OD1   1 
ATOM   1994  N  ND2   . ASN A 1 264 ? -41.451  83.180  -34.705 1.00 94.34  ?  264 ASN A ND2   1 
ATOM   1995  N  N     . LYS A 1 265 ? -43.714  86.758  -37.283 1.00 67.01  ?  265 LYS A N     1 
ATOM   1996  C  CA    . LYS A 1 265 ? -43.927  88.209  -37.399 1.00 66.74  ?  265 LYS A CA    1 
ATOM   1997  C  C     . LYS A 1 265 ? -42.921  89.021  -36.581 1.00 70.87  ?  265 LYS A C     1 
ATOM   1998  O  O     . LYS A 1 265 ? -42.406  90.036  -37.051 1.00 70.76  ?  265 LYS A O     1 
ATOM   1999  C  CB    . LYS A 1 265 ? -45.364  88.603  -37.015 1.00 72.67  ?  265 LYS A CB    1 
ATOM   2000  C  CG    . LYS A 1 265 ? -45.686  90.101  -37.202 1.00 73.82  ?  265 LYS A CG    1 
ATOM   2001  C  CD    . LYS A 1 265 ? -47.113  90.442  -36.730 1.00 74.50  ?  265 LYS A CD    1 
ATOM   2002  C  CE    . LYS A 1 265 ? -47.214  90.592  -35.204 1.00 72.80  ?  265 LYS A CE    1 
ATOM   2003  N  N     . ALA A 1 266 ? -42.644  88.572  -35.358 1.00 71.14  ?  266 ALA A N     1 
ATOM   2004  C  CA    . ALA A 1 266 ? -41.718  89.270  -34.467 1.00 68.03  ?  266 ALA A CA    1 
ATOM   2005  C  C     . ALA A 1 266 ? -40.291  89.294  -35.016 1.00 77.43  ?  266 ALA A C     1 
ATOM   2006  O  O     . ALA A 1 266 ? -39.610  90.317  -34.925 1.00 85.27  ?  266 ALA A O     1 
ATOM   2007  C  CB    . ALA A 1 266 ? -41.745  88.653  -33.091 1.00 67.24  ?  266 ALA A CB    1 
ATOM   2008  N  N     . ASN A 1 267 ? -39.845  88.173  -35.587 1.00 80.95  ?  267 ASN A N     1 
ATOM   2009  C  CA    . ASN A 1 267 ? -38.497  88.081  -36.155 1.00 83.09  ?  267 ASN A CA    1 
ATOM   2010  C  C     . ASN A 1 267 ? -38.375  88.901  -37.431 1.00 74.43  ?  267 ASN A C     1 
ATOM   2011  O  O     . ASN A 1 267 ? -37.324  89.489  -37.700 1.00 73.55  ?  267 ASN A O     1 
ATOM   2012  C  CB    . ASN A 1 267 ? -38.071  86.624  -36.405 1.00 92.89  ?  267 ASN A CB    1 
ATOM   2013  C  CG    . ASN A 1 267 ? -37.888  85.830  -35.107 1.00 109.23 ?  267 ASN A CG    1 
ATOM   2014  O  OD1   . ASN A 1 267 ? -37.631  86.397  -34.036 1.00 116.15 ?  267 ASN A OD1   1 
ATOM   2015  N  ND2   . ASN A 1 267 ? -38.025  84.508  -35.202 1.00 113.64 ?  267 ASN A ND2   1 
ATOM   2016  N  N     . LEU A 1 268 ? -39.454  88.944  -38.211 1.00 69.16  ?  268 LEU A N     1 
ATOM   2017  C  CA    . LEU A 1 268 ? -39.477  89.759  -39.419 1.00 68.32  ?  268 LEU A CA    1 
ATOM   2018  C  C     . LEU A 1 268 ? -39.304  91.215  -39.041 1.00 74.06  ?  268 LEU A C     1 
ATOM   2019  O  O     . LEU A 1 268 ? -38.405  91.906  -39.542 1.00 73.32  ?  268 LEU A O     1 
ATOM   2020  C  CB    . LEU A 1 268 ? -40.803  89.608  -40.145 1.00 67.03  ?  268 LEU A CB    1 
ATOM   2021  C  CG    . LEU A 1 268 ? -40.811  89.723  -41.669 1.00 68.33  ?  268 LEU A CG    1 
ATOM   2022  C  CD1   . LEU A 1 268 ? -42.224  89.570  -42.165 1.00 68.18  ?  268 LEU A CD1   1 
ATOM   2023  C  CD2   . LEU A 1 268 ? -40.237  91.042  -42.123 1.00 78.90  ?  268 LEU A CD2   1 
ATOM   2024  N  N     . VAL A 1 269 ? -40.174  91.685  -38.150 1.00 74.90  ?  269 VAL A N     1 
ATOM   2025  C  CA    . VAL A 1 269 ? -40.100  93.071  -37.727 1.00 71.28  ?  269 VAL A CA    1 
ATOM   2026  C  C     . VAL A 1 269 ? -38.697  93.414  -37.255 1.00 71.37  ?  269 VAL A C     1 
ATOM   2027  O  O     . VAL A 1 269 ? -38.180  94.469  -37.608 1.00 71.29  ?  269 VAL A O     1 
ATOM   2028  C  CB    . VAL A 1 269 ? -41.111  93.407  -36.644 1.00 64.28  ?  269 VAL A CB    1 
ATOM   2029  C  CG1   . VAL A 1 269 ? -40.873  94.831  -36.169 1.00 65.59  ?  269 VAL A CG1   1 
ATOM   2030  C  CG2   . VAL A 1 269 ? -42.530  93.251  -37.182 1.00 60.15  ?  269 VAL A CG2   1 
ATOM   2031  N  N     . LYS A 1 270 ? -38.078  92.517  -36.482 1.00 68.25  ?  270 LYS A N     1 
ATOM   2032  C  CA    . LYS A 1 270 ? -36.699  92.722  -36.024 1.00 68.66  ?  270 LYS A CA    1 
ATOM   2033  C  C     . LYS A 1 270 ? -35.722  92.778  -37.196 1.00 71.73  ?  270 LYS A C     1 
ATOM   2034  O  O     . LYS A 1 270 ? -34.913  93.699  -37.275 1.00 80.22  ?  270 LYS A O     1 
ATOM   2035  C  CB    . LYS A 1 270 ? -36.256  91.655  -35.007 1.00 53.54  ?  270 LYS A CB    1 
ATOM   2036  C  CG    . LYS A 1 270 ? -34.731  91.622  -34.689 1.00 108.92 ?  270 LYS A CG    1 
ATOM   2037  C  CD    . LYS A 1 270 ? -34.273  92.602  -33.578 1.00 59.55  ?  270 LYS A CD    1 
ATOM   2038  N  N     . LYS A 1 271 ? -35.801  91.811  -38.107 1.00 68.69  ?  271 LYS A N     1 
ATOM   2039  C  CA    . LYS A 1 271 ? -34.836  91.742  -39.204 1.00 65.66  ?  271 LYS A CA    1 
ATOM   2040  C  C     . LYS A 1 271 ? -34.938  92.985  -40.099 1.00 72.73  ?  271 LYS A C     1 
ATOM   2041  O  O     . LYS A 1 271 ? -33.938  93.419  -40.701 1.00 74.13  ?  271 LYS A O     1 
ATOM   2042  C  CB    . LYS A 1 271 ? -34.964  90.432  -40.004 1.00 48.04  ?  271 LYS A CB    1 
ATOM   2043  N  N     . ILE A 1 272 ? -36.139  93.567  -40.159 1.00 70.24  ?  272 ILE A N     1 
ATOM   2044  C  CA    . ILE A 1 272 ? -36.362  94.791  -40.926 1.00 70.34  ?  272 ILE A CA    1 
ATOM   2045  C  C     . ILE A 1 272 ? -35.750  95.999  -40.232 1.00 75.84  ?  272 ILE A C     1 
ATOM   2046  O  O     . ILE A 1 272 ? -34.997  96.751  -40.844 1.00 84.57  ?  272 ILE A O     1 
ATOM   2047  C  CB    . ILE A 1 272 ? -37.847  95.058  -41.187 1.00 71.74  ?  272 ILE A CB    1 
ATOM   2048  C  CG1   . ILE A 1 272 ? -38.438  93.943  -42.065 1.00 65.80  ?  272 ILE A CG1   1 
ATOM   2049  C  CG2   . ILE A 1 272 ? -38.026  96.429  -41.851 1.00 68.23  ?  272 ILE A CG2   1 
ATOM   2050  C  CD1   . ILE A 1 272 ? -39.949  94.071  -42.337 1.00 55.19  ?  272 ILE A CD1   1 
ATOM   2051  N  N     . ASP A 1 273 ? -36.067  96.185  -38.955 1.00 79.57  ?  273 ASP A N     1 
ATOM   2052  C  CA    . ASP A 1 273 ? -35.425  97.229  -38.156 1.00 84.04  ?  273 ASP A CA    1 
ATOM   2053  C  C     . ASP A 1 273 ? -33.883  97.117  -38.229 1.00 88.99  ?  273 ASP A C     1 
ATOM   2054  O  O     . ASP A 1 273 ? -33.168  98.125  -38.171 1.00 89.46  ?  273 ASP A O     1 
ATOM   2055  C  CB    . ASP A 1 273 ? -35.936  97.190  -36.704 1.00 84.56  ?  273 ASP A CB    1 
ATOM   2056  C  CG    . ASP A 1 273 ? -35.539  98.436  -35.893 1.00 96.10  ?  273 ASP A CG    1 
ATOM   2057  O  OD1   . ASP A 1 273 ? -35.984  99.561  -36.247 1.00 96.25  ?  273 ASP A OD1   1 
ATOM   2058  O  OD2   . ASP A 1 273 ? -34.800  98.286  -34.884 1.00 103.56 ?  273 ASP A OD2   1 
ATOM   2059  N  N     . ASP A 1 274 ? -33.375  95.894  -38.377 1.00 93.67  ?  274 ASP A N     1 
ATOM   2060  C  CA    . ASP A 1 274 ? -31.935  95.685  -38.556 1.00 101.28 ?  274 ASP A CA    1 
ATOM   2061  C  C     . ASP A 1 274 ? -31.435  96.342  -39.838 1.00 94.37  ?  274 ASP A C     1 
ATOM   2062  O  O     . ASP A 1 274 ? -30.352  96.944  -39.856 1.00 96.26  ?  274 ASP A O     1 
ATOM   2063  C  CB    . ASP A 1 274 ? -31.569  94.194  -38.546 1.00 110.34 ?  274 ASP A CB    1 
ATOM   2064  C  CG    . ASP A 1 274 ? -31.490  93.617  -37.138 1.00 121.57 ?  274 ASP A CG    1 
ATOM   2065  O  OD1   . ASP A 1 274 ? -31.479  94.414  -36.169 1.00 128.85 ?  274 ASP A OD1   1 
ATOM   2066  O  OD2   . ASP A 1 274 ? -31.431  92.371  -37.005 1.00 123.71 ?  274 ASP A OD2   1 
ATOM   2067  N  N     . VAL A 1 275 ? -32.219  96.217  -40.909 1.00 82.56  ?  275 VAL A N     1 
ATOM   2068  C  CA    . VAL A 1 275 ? -31.943  96.972  -42.122 1.00 73.50  ?  275 VAL A CA    1 
ATOM   2069  C  C     . VAL A 1 275 ? -31.866  98.472  -41.797 1.00 76.76  ?  275 VAL A C     1 
ATOM   2070  O  O     . VAL A 1 275 ? -30.888  99.151  -42.129 1.00 85.17  ?  275 VAL A O     1 
ATOM   2071  C  CB    . VAL A 1 275 ? -33.012  96.747  -43.184 1.00 63.53  ?  275 VAL A CB    1 
ATOM   2072  C  CG1   . VAL A 1 275 ? -32.822  97.730  -44.323 1.00 69.08  ?  275 VAL A CG1   1 
ATOM   2073  C  CG2   . VAL A 1 275 ? -32.965  95.315  -43.685 1.00 56.62  ?  275 VAL A CG2   1 
ATOM   2074  N  N     . ARG A 1 276 ? -32.891  98.987  -41.132 1.00 69.12  ?  276 ARG A N     1 
ATOM   2075  C  CA    . ARG A 1 276 ? -32.877  100.377 -40.709 1.00 67.20  ?  276 ARG A CA    1 
ATOM   2076  C  C     . ARG A 1 276 ? -31.665  100.718 -39.836 1.00 72.73  ?  276 ARG A C     1 
ATOM   2077  O  O     . ARG A 1 276 ? -31.043  101.767 -40.000 1.00 78.99  ?  276 ARG A O     1 
ATOM   2078  C  CB    . ARG A 1 276 ? -34.149  100.710 -39.944 1.00 65.57  ?  276 ARG A CB    1 
ATOM   2079  C  CG    . ARG A 1 276 ? -34.273  102.183 -39.616 1.00 77.18  ?  276 ARG A CG    1 
ATOM   2080  C  CD    . ARG A 1 276 ? -35.359  102.431 -38.599 1.00 85.42  ?  276 ARG A CD    1 
ATOM   2081  N  NE    . ARG A 1 276 ? -34.954  101.937 -37.291 1.00 87.46  ?  276 ARG A NE    1 
ATOM   2082  C  CZ    . ARG A 1 276 ? -34.125  102.599 -36.502 1.00 95.52  ?  276 ARG A CZ    1 
ATOM   2083  N  NH1   . ARG A 1 276 ? -33.643  103.764 -36.911 1.00 102.37 ?  276 ARG A NH1   1 
ATOM   2084  N  NH2   . ARG A 1 276 ? -33.779  102.103 -35.321 1.00 99.50  ?  276 ARG A NH2   1 
ATOM   2085  N  N     . VAL A 1 277 ? -31.333  99.836  -38.903 1.00 75.72  ?  277 VAL A N     1 
ATOM   2086  C  CA    . VAL A 1 277 ? -30.302  100.155 -37.917 1.00 79.66  ?  277 VAL A CA    1 
ATOM   2087  C  C     . VAL A 1 277 ? -28.888  100.077 -38.490 1.00 82.72  ?  277 VAL A C     1 
ATOM   2088  O  O     . VAL A 1 277 ? -28.021  100.876 -38.122 1.00 71.02  ?  277 VAL A O     1 
ATOM   2089  C  CB    . VAL A 1 277 ? -30.423  99.278  -36.657 1.00 72.65  ?  277 VAL A CB    1 
ATOM   2090  C  CG1   . VAL A 1 277 ? -29.261  99.532  -35.739 1.00 75.84  ?  277 VAL A CG1   1 
ATOM   2091  C  CG2   . VAL A 1 277 ? -31.737  99.569  -35.942 1.00 70.72  ?  277 VAL A CG2   1 
ATOM   2092  N  N     . ASN A 1 278 ? -28.667  99.123  -39.396 1.00 78.49  ?  278 ASN A N     1 
ATOM   2093  C  CA    . ASN A 1 278 ? -27.388  99.017  -40.099 1.00 88.62  ?  278 ASN A CA    1 
ATOM   2094  C  C     . ASN A 1 278 ? -27.291  99.972  -41.290 1.00 95.52  ?  278 ASN A C     1 
ATOM   2095  O  O     . ASN A 1 278 ? -26.191  100.287 -41.762 1.00 101.16 ?  278 ASN A O     1 
ATOM   2096  C  CB    . ASN A 1 278 ? -27.140  97.584  -40.564 1.00 91.79  ?  278 ASN A CB    1 
ATOM   2097  C  CG    . ASN A 1 278 ? -26.935  96.617  -39.406 1.00 98.27  ?  278 ASN A CG    1 
ATOM   2098  O  OD1   . ASN A 1 278 ? -26.103  96.856  -38.515 1.00 101.66 ?  278 ASN A OD1   1 
ATOM   2099  N  ND2   . ASN A 1 278 ? -27.698  95.511  -39.412 1.00 95.76  ?  278 ASN A ND2   1 
ATOM   2100  N  N     . ASN A 1 279 ? -28.450  100.433 -41.760 1.00 93.52  ?  279 ASN A N     1 
ATOM   2101  C  CA    . ASN A 1 279 ? -28.529  101.325 -42.915 1.00 93.54  ?  279 ASN A CA    1 
ATOM   2102  C  C     . ASN A 1 279 ? -27.872  100.727 -44.181 1.00 93.48  ?  279 ASN A C     1 
ATOM   2103  O  O     . ASN A 1 279 ? -27.081  101.384 -44.870 1.00 95.79  ?  279 ASN A O     1 
ATOM   2104  C  CB    . ASN A 1 279 ? -27.967  102.707 -42.569 1.00 97.13  ?  279 ASN A CB    1 
ATOM   2105  C  CG    . ASN A 1 279 ? -28.596  103.809 -43.396 1.00 103.43 ?  279 ASN A CG    1 
ATOM   2106  O  OD1   . ASN A 1 279 ? -29.789  104.090 -43.264 1.00 103.21 ?  279 ASN A OD1   1 
ATOM   2107  N  ND2   . ASN A 1 279 ? -27.798  104.438 -44.259 1.00 111.36 ?  279 ASN A ND2   1 
ATOM   2108  N  N     . LYS A 1 280 ? -28.216  99.466  -44.458 1.00 88.94  ?  280 LYS A N     1 
ATOM   2109  C  CA    . LYS A 1 280 ? -27.760  98.729  -45.631 1.00 85.28  ?  280 LYS A CA    1 
ATOM   2110  C  C     . LYS A 1 280 ? -28.407  99.368  -46.833 1.00 89.26  ?  280 LYS A C     1 
ATOM   2111  O  O     . LYS A 1 280 ? -27.885  99.330  -47.961 1.00 94.97  ?  280 LYS A O     1 
ATOM   2112  C  CB    . LYS A 1 280 ? -28.266  97.292  -45.557 1.00 76.85  ?  280 LYS A CB    1 
ATOM   2113  C  CG    . LYS A 1 280 ? -27.918  96.571  -44.282 1.00 75.16  ?  280 LYS A CG    1 
ATOM   2114  C  CD    . LYS A 1 280 ? -26.525  95.979  -44.375 1.00 77.07  ?  280 LYS A CD    1 
ATOM   2115  C  CE    . LYS A 1 280 ? -26.469  94.886  -45.425 1.00 76.63  ?  280 LYS A CE    1 
ATOM   2116  N  NZ    . LYS A 1 280 ? -25.070  94.478  -45.689 1.00 85.73  ?  280 LYS A NZ    1 
ATOM   2117  N  N     . VAL A 1 281 ? -29.577  99.934  -46.561 1.00 84.37  ?  281 VAL A N     1 
ATOM   2118  C  CA    . VAL A 1 281 ? -30.399  100.580 -47.557 1.00 80.28  ?  281 VAL A CA    1 
ATOM   2119  C  C     . VAL A 1 281 ? -30.790  101.923 -46.974 1.00 77.14  ?  281 VAL A C     1 
ATOM   2120  O  O     . VAL A 1 281 ? -31.149  102.009 -45.800 1.00 78.97  ?  281 VAL A O     1 
ATOM   2121  C  CB    . VAL A 1 281 ? -31.638  99.730  -47.853 1.00 73.84  ?  281 VAL A CB    1 
ATOM   2122  C  CG1   . VAL A 1 281 ? -32.821  100.608 -48.147 1.00 77.49  ?  281 VAL A CG1   1 
ATOM   2123  C  CG2   . VAL A 1 281 ? -31.355  98.798  -49.016 1.00 71.06  ?  281 VAL A CG2   1 
ATOM   2124  N  N     . ALA A 1 282 ? -30.688  102.979 -47.774 1.00 72.94  ?  282 ALA A N     1 
ATOM   2125  C  CA    . ALA A 1 282 ? -30.990  104.314 -47.267 1.00 78.76  ?  282 ALA A CA    1 
ATOM   2126  C  C     . ALA A 1 282 ? -32.494  104.563 -47.218 1.00 82.95  ?  282 ALA A C     1 
ATOM   2127  O  O     . ALA A 1 282 ? -33.230  104.111 -48.102 1.00 81.35  ?  282 ALA A O     1 
ATOM   2128  C  CB    . ALA A 1 282 ? -30.319  105.359 -48.115 1.00 85.19  ?  282 ALA A CB    1 
ATOM   2129  N  N     . GLY A 1 283 ? -32.956  105.259 -46.179 1.00 84.92  ?  283 GLY A N     1 
ATOM   2130  C  CA    . GLY A 1 283 ? -34.311  105.780 -46.200 1.00 84.97  ?  283 GLY A CA    1 
ATOM   2131  C  C     . GLY A 1 283 ? -35.338  105.313 -45.191 1.00 89.19  ?  283 GLY A C     1 
ATOM   2132  O  O     . GLY A 1 283 ? -36.440  105.868 -45.161 1.00 94.11  ?  283 GLY A O     1 
ATOM   2133  N  N     . ILE A 1 284 ? -35.008  104.315 -44.369 1.00 89.17  ?  284 ILE A N     1 
ATOM   2134  C  CA    . ILE A 1 284 ? -35.947  103.846 -43.338 1.00 87.09  ?  284 ILE A CA    1 
ATOM   2135  C  C     . ILE A 1 284 ? -35.901  104.709 -42.060 1.00 92.29  ?  284 ILE A C     1 
ATOM   2136  O  O     . ILE A 1 284 ? -34.839  104.939 -41.464 1.00 92.72  ?  284 ILE A O     1 
ATOM   2137  C  CB    . ILE A 1 284 ? -35.771  102.339 -43.035 1.00 79.66  ?  284 ILE A CB    1 
ATOM   2138  C  CG1   . ILE A 1 284 ? -35.815  101.549 -44.345 1.00 83.32  ?  284 ILE A CG1   1 
ATOM   2139  C  CG2   . ILE A 1 284 ? -36.864  101.847 -42.109 1.00 67.13  ?  284 ILE A CG2   1 
ATOM   2140  C  CD1   . ILE A 1 284 ? -35.645  100.062 -44.198 1.00 75.29  ?  284 ILE A CD1   1 
ATOM   2141  N  N     . ALA A 1 285 ? -37.067  105.212 -41.663 1.00 92.46  ?  285 ALA A N     1 
ATOM   2142  C  CA    . ALA A 1 285 ? -37.152  106.163 -40.557 1.00 92.34  ?  285 ALA A CA    1 
ATOM   2143  C  C     . ALA A 1 285 ? -37.553  105.460 -39.272 1.00 93.16  ?  285 ALA A C     1 
ATOM   2144  O  O     . ALA A 1 285 ? -37.032  105.758 -38.204 1.00 101.75 ?  285 ALA A O     1 
ATOM   2145  C  CB    . ALA A 1 285 ? -38.142  107.276 -40.883 1.00 92.16  ?  285 ALA A CB    1 
ATOM   2146  N  N     . GLU A 1 286 ? -38.477  104.516 -39.384 1.00 86.55  ?  286 GLU A N     1 
ATOM   2147  C  CA    . GLU A 1 286 ? -38.933  103.775 -38.226 1.00 89.32  ?  286 GLU A CA    1 
ATOM   2148  C  C     . GLU A 1 286 ? -39.621  102.488 -38.669 1.00 89.13  ?  286 GLU A C     1 
ATOM   2149  O  O     . GLU A 1 286 ? -40.256  102.454 -39.722 1.00 88.40  ?  286 GLU A O     1 
ATOM   2150  C  CB    . GLU A 1 286 ? -39.887  104.647 -37.411 1.00 93.58  ?  286 GLU A CB    1 
ATOM   2151  C  CG    . GLU A 1 286 ? -40.451  103.985 -36.163 1.00 99.62  ?  286 GLU A CG    1 
ATOM   2152  C  CD    . GLU A 1 286 ? -41.247  104.953 -35.304 1.00 110.44 ?  286 GLU A CD    1 
ATOM   2153  O  OE1   . GLU A 1 286 ? -41.670  106.010 -35.825 1.00 118.80 ?  286 GLU A OE1   1 
ATOM   2154  O  OE2   . GLU A 1 286 ? -41.436  104.667 -34.102 1.00 110.99 ?  286 GLU A OE2   1 
ATOM   2155  N  N     . VAL A 1 287 ? -39.481  101.424 -37.881 1.00 88.83  ?  287 VAL A N     1 
ATOM   2156  C  CA    . VAL A 1 287 ? -40.281  100.216 -38.099 1.00 87.92  ?  287 VAL A CA    1 
ATOM   2157  C  C     . VAL A 1 287 ? -41.213  99.998  -36.908 1.00 89.56  ?  287 VAL A C     1 
ATOM   2158  O  O     . VAL A 1 287 ? -40.748  99.938  -35.775 1.00 97.35  ?  287 VAL A O     1 
ATOM   2159  C  CB    . VAL A 1 287 ? -39.410  98.960  -38.295 1.00 86.19  ?  287 VAL A CB    1 
ATOM   2160  C  CG1   . VAL A 1 287 ? -40.294  97.742  -38.499 1.00 84.32  ?  287 VAL A CG1   1 
ATOM   2161  C  CG2   . VAL A 1 287 ? -38.454  99.134  -39.470 1.00 83.71  ?  287 VAL A CG2   1 
ATOM   2162  N  N     . ARG A 1 288 ? -42.519  99.891  -37.171 1.00 86.87  ?  288 ARG A N     1 
ATOM   2163  C  CA    . ARG A 1 288 ? -43.548  99.791  -36.121 1.00 90.05  ?  288 ARG A CA    1 
ATOM   2164  C  C     . ARG A 1 288 ? -44.488  98.607  -36.315 1.00 91.12  ?  288 ARG A C     1 
ATOM   2165  O  O     . ARG A 1 288 ? -45.314  98.618  -37.229 1.00 93.25  ?  288 ARG A O     1 
ATOM   2166  C  CB    . ARG A 1 288 ? -44.414  101.056 -36.082 1.00 90.17  ?  288 ARG A CB    1 
ATOM   2167  C  CG    . ARG A 1 288 ? -43.916  102.159 -35.170 1.00 95.94  ?  288 ARG A CG    1 
ATOM   2168  C  CD    . ARG A 1 288 ? -44.877  103.347 -35.180 1.00 100.99 ?  288 ARG A CD    1 
ATOM   2169  N  NE    . ARG A 1 288 ? -44.652  104.230 -36.324 1.00 99.92  ?  288 ARG A NE    1 
ATOM   2170  C  CZ    . ARG A 1 288 ? -45.409  104.263 -37.417 1.00 100.58 ?  288 ARG A CZ    1 
ATOM   2171  N  NH1   . ARG A 1 288 ? -46.456  103.455 -37.526 1.00 103.44 ?  288 ARG A NH1   1 
ATOM   2172  N  NH2   . ARG A 1 288 ? -45.120  105.108 -38.402 1.00 99.58  ?  288 ARG A NH2   1 
ATOM   2173  N  N     . ASP A 1 289 ? -44.388  97.597  -35.454 1.00 90.43  ?  289 ASP A N     1 
ATOM   2174  C  CA    . ASP A 1 289 ? -45.388  96.539  -35.467 1.00 85.69  ?  289 ASP A CA    1 
ATOM   2175  C  C     . ASP A 1 289 ? -46.622  97.129  -34.804 1.00 88.39  ?  289 ASP A C     1 
ATOM   2176  O  O     . ASP A 1 289 ? -46.567  97.545  -33.641 1.00 91.04  ?  289 ASP A O     1 
ATOM   2177  C  CB    . ASP A 1 289 ? -44.914  95.289  -34.728 1.00 84.54  ?  289 ASP A CB    1 
ATOM   2178  C  CG    . ASP A 1 289 ? -45.853  94.107  -34.930 1.00 91.83  ?  289 ASP A CG    1 
ATOM   2179  O  OD1   . ASP A 1 289 ? -45.483  92.963  -34.579 1.00 96.35  ?  289 ASP A OD1   1 
ATOM   2180  O  OD2   . ASP A 1 289 ? -46.969  94.329  -35.452 1.00 94.76  ?  289 ASP A OD2   1 
ATOM   2181  N  N     . GLU A 1 290 ? -47.717  97.209  -35.558 1.00 86.02  ?  290 GLU A N     1 
ATOM   2182  C  CA    . GLU A 1 290 ? -48.922  97.894  -35.089 1.00 91.05  ?  290 GLU A CA    1 
ATOM   2183  C  C     . GLU A 1 290 ? -50.111  96.942  -35.044 1.00 92.79  ?  290 GLU A C     1 
ATOM   2184  O  O     . GLU A 1 290 ? -51.267  97.365  -35.030 1.00 95.30  ?  290 GLU A O     1 
ATOM   2185  C  CB    . GLU A 1 290 ? -49.236  99.117  -35.961 1.00 93.69  ?  290 GLU A CB    1 
ATOM   2186  C  CG    . GLU A 1 290 ? -48.201  100.242 -35.863 1.00 101.48 ?  290 GLU A CG    1 
ATOM   2187  C  CD    . GLU A 1 290 ? -48.630  101.522 -36.576 1.00 112.15 ?  290 GLU A CD    1 
ATOM   2188  O  OE1   . GLU A 1 290 ? -49.637  101.489 -37.319 1.00 114.41 ?  290 GLU A OE1   1 
ATOM   2189  O  OE2   . GLU A 1 290 ? -47.958  102.562 -36.389 1.00 117.33 ?  290 GLU A OE2   1 
ATOM   2190  N  N     . SER A 1 291 ? -49.804  95.650  -35.012 1.00 89.70  ?  291 SER A N     1 
ATOM   2191  C  CA    . SER A 1 291 ? -50.813  94.608  -34.944 1.00 88.73  ?  291 SER A CA    1 
ATOM   2192  C  C     . SER A 1 291 ? -51.490  94.585  -33.581 1.00 99.66  ?  291 SER A C     1 
ATOM   2193  O  O     . SER A 1 291 ? -50.827  94.619  -32.544 1.00 100.84 ?  291 SER A O     1 
ATOM   2194  C  CB    . SER A 1 291 ? -50.161  93.257  -35.196 1.00 81.38  ?  291 SER A CB    1 
ATOM   2195  O  OG    . SER A 1 291 ? -49.129  93.380  -36.153 1.00 72.14  ?  291 SER A OG    1 
ATOM   2196  N  N     . ASP A 1 292 ? -52.818  94.537  -33.595 1.00 110.80 ?  292 ASP A N     1 
ATOM   2197  C  CA    . ASP A 1 292 ? -53.597  94.346  -32.378 1.00 122.37 ?  292 ASP A CA    1 
ATOM   2198  C  C     . ASP A 1 292 ? -54.395  93.050  -32.482 1.00 121.81 ?  292 ASP A C     1 
ATOM   2199  O  O     . ASP A 1 292 ? -54.332  92.357  -33.502 1.00 114.81 ?  292 ASP A O     1 
ATOM   2200  C  CB    . ASP A 1 292 ? -54.514  95.546  -32.087 1.00 131.70 ?  292 ASP A CB    1 
ATOM   2201  C  CG    . ASP A 1 292 ? -55.447  95.880  -33.245 1.00 135.07 ?  292 ASP A CG    1 
ATOM   2202  O  OD1   . ASP A 1 292 ? -55.675  95.013  -34.120 1.00 133.32 ?  292 ASP A OD1   1 
ATOM   2203  O  OD2   . ASP A 1 292 ? -55.961  97.020  -33.269 1.00 138.63 ?  292 ASP A OD2   1 
ATOM   2204  N  N     . ARG A 1 293 ? -55.143  92.730  -31.428 1.00 128.30 ?  293 ARG A N     1 
ATOM   2205  C  CA    . ARG A 1 293 ? -55.806  91.431  -31.327 1.00 129.11 ?  293 ARG A CA    1 
ATOM   2206  C  C     . ARG A 1 293 ? -56.750  91.134  -32.497 1.00 131.36 ?  293 ARG A C     1 
ATOM   2207  O  O     . ARG A 1 293 ? -57.230  90.007  -32.639 1.00 136.66 ?  293 ARG A O     1 
ATOM   2208  C  CB    . ARG A 1 293 ? -56.522  91.275  -29.971 1.00 129.70 ?  293 ARG A CB    1 
ATOM   2209  C  CG    . ARG A 1 293 ? -58.003  91.619  -29.971 1.00 127.98 ?  293 ARG A CG    1 
ATOM   2210  C  CD    . ARG A 1 293 ? -58.506  91.902  -28.567 1.00 129.00 ?  293 ARG A CD    1 
ATOM   2211  N  NE    . ARG A 1 293 ? -58.445  93.325  -28.215 1.00 127.37 ?  293 ARG A NE    1 
ATOM   2212  C  CZ    . ARG A 1 293 ? -57.414  94.133  -28.463 1.00 119.73 ?  293 ARG A CZ    1 
ATOM   2213  N  NH1   . ARG A 1 293 ? -56.331  93.672  -29.079 1.00 109.51 ?  293 ARG A NH1   1 
ATOM   2214  N  NH2   . ARG A 1 293 ? -57.466  95.409  -28.096 1.00 120.64 ?  293 ARG A NH2   1 
ATOM   2215  N  N     . ASP A 1 294 ? -57.004  92.134  -33.339 1.00 126.32 ?  294 ASP A N     1 
ATOM   2216  C  CA    . ASP A 1 294 ? -57.901  91.949  -34.479 1.00 123.34 ?  294 ASP A CA    1 
ATOM   2217  C  C     . ASP A 1 294 ? -57.414  92.647  -35.744 1.00 117.22 ?  294 ASP A C     1 
ATOM   2218  O  O     . ASP A 1 294 ? -58.160  93.371  -36.397 1.00 121.77 ?  294 ASP A O     1 
ATOM   2219  C  CB    . ASP A 1 294 ? -59.341  92.369  -34.136 1.00 132.03 ?  294 ASP A CB    1 
ATOM   2220  C  CG    . ASP A 1 294 ? -59.414  93.690  -33.374 1.00 134.52 ?  294 ASP A CG    1 
ATOM   2221  O  OD1   . ASP A 1 294 ? -60.340  93.837  -32.543 1.00 140.51 ?  294 ASP A OD1   1 
ATOM   2222  O  OD2   . ASP A 1 294 ? -58.561  94.577  -33.607 1.00 128.74 ?  294 ASP A OD2   1 
ATOM   2223  N  N     . GLY A 1 295 ? -56.155  92.413  -36.089 1.00 111.77 ?  295 GLY A N     1 
ATOM   2224  C  CA    . GLY A 1 295 ? -55.579  92.993  -37.286 1.00 108.07 ?  295 GLY A CA    1 
ATOM   2225  C  C     . GLY A 1 295 ? -54.071  92.847  -37.317 1.00 100.67 ?  295 GLY A C     1 
ATOM   2226  O  O     . GLY A 1 295 ? -53.406  92.948  -36.285 1.00 102.76 ?  295 GLY A O     1 
ATOM   2227  N  N     . LEU A 1 296 ? -53.530  92.589  -38.504 1.00 90.23  ?  296 LEU A N     1 
ATOM   2228  C  CA    . LEU A 1 296 ? -52.083  92.590  -38.691 1.00 79.28  ?  296 LEU A CA    1 
ATOM   2229  C  C     . LEU A 1 296 ? -51.655  93.861  -39.433 1.00 82.12  ?  296 LEU A C     1 
ATOM   2230  O  O     . LEU A 1 296 ? -52.290  94.273  -40.403 1.00 88.46  ?  296 LEU A O     1 
ATOM   2231  C  CB    . LEU A 1 296 ? -51.625  91.334  -39.427 1.00 69.74  ?  296 LEU A CB    1 
ATOM   2232  C  CG    . LEU A 1 296 ? -50.109  91.128  -39.421 1.00 66.79  ?  296 LEU A CG    1 
ATOM   2233  C  CD1   . LEU A 1 296 ? -49.757  89.715  -39.882 1.00 70.93  ?  296 LEU A CD1   1 
ATOM   2234  C  CD2   . LEU A 1 296 ? -49.429  92.171  -40.302 1.00 63.19  ?  296 LEU A CD2   1 
ATOM   2235  N  N     . ARG A 1 297 ? -50.596  94.499  -38.954 1.00 80.85  ?  297 ARG A N     1 
ATOM   2236  C  CA    . ARG A 1 297 ? -50.181  95.775  -39.514 1.00 79.76  ?  297 ARG A CA    1 
ATOM   2237  C  C     . ARG A 1 297 ? -48.789  96.198  -39.077 1.00 85.39  ?  297 ARG A C     1 
ATOM   2238  O  O     . ARG A 1 297 ? -48.549  96.490  -37.903 1.00 89.74  ?  297 ARG A O     1 
ATOM   2239  C  CB    . ARG A 1 297 ? -51.175  96.879  -39.162 1.00 78.58  ?  297 ARG A CB    1 
ATOM   2240  C  CG    . ARG A 1 297 ? -50.615  98.286  -39.365 1.00 79.17  ?  297 ARG A CG    1 
ATOM   2241  C  CD    . ARG A 1 297 ? -51.719  99.319  -39.262 1.00 82.76  ?  297 ARG A CD    1 
ATOM   2242  N  NE    . ARG A 1 297 ? -51.912  100.030 -40.518 1.00 84.94  ?  297 ARG A NE    1 
ATOM   2243  C  CZ    . ARG A 1 297 ? -51.569  101.298 -40.699 1.00 95.43  ?  297 ARG A CZ    1 
ATOM   2244  N  NH1   . ARG A 1 297 ? -51.033  101.985 -39.699 1.00 102.47 ?  297 ARG A NH1   1 
ATOM   2245  N  NH2   . ARG A 1 297 ? -51.766  101.884 -41.870 1.00 98.82  ?  297 ARG A NH2   1 
ATOM   2246  N  N     . ILE A 1 298 ? -47.881  96.233  -40.045 1.00 85.67  ?  298 ILE A N     1 
ATOM   2247  C  CA    . ILE A 1 298 ? -46.531  96.713  -39.823 1.00 84.79  ?  298 ILE A CA    1 
ATOM   2248  C  C     . ILE A 1 298 ? -46.340  97.944  -40.688 1.00 85.08  ?  298 ILE A C     1 
ATOM   2249  O  O     . ILE A 1 298 ? -46.528  97.891  -41.900 1.00 82.65  ?  298 ILE A O     1 
ATOM   2250  C  CB    . ILE A 1 298 ? -45.489  95.652  -40.203 1.00 80.34  ?  298 ILE A CB    1 
ATOM   2251  C  CG1   . ILE A 1 298 ? -45.831  94.316  -39.541 1.00 81.55  ?  298 ILE A CG1   1 
ATOM   2252  C  CG2   . ILE A 1 298 ? -44.101  96.112  -39.800 1.00 76.91  ?  298 ILE A CG2   1 
ATOM   2253  C  CD1   . ILE A 1 298 ? -44.905  93.201  -39.915 1.00 78.17  ?  298 ILE A CD1   1 
ATOM   2254  N  N     . ALA A 1 299 ? -46.009  99.062  -40.052 1.00 85.49  ?  299 ALA A N     1 
ATOM   2255  C  CA    . ALA A 1 299 ? -45.764  100.302 -40.767 1.00 85.42  ?  299 ALA A CA    1 
ATOM   2256  C  C     . ALA A 1 299 ? -44.258  100.454 -40.906 1.00 89.78  ?  299 ALA A C     1 
ATOM   2257  O  O     . ALA A 1 299 ? -43.532  100.377 -39.916 1.00 92.78  ?  299 ALA A O     1 
ATOM   2258  N  N     . ILE A 1 300 ? -43.782  100.634 -42.135 1.00 88.09  ?  300 ILE A N     1 
ATOM   2259  C  CA    . ILE A 1 300 ? -42.398  101.031 -42.349 1.00 78.56  ?  300 ILE A CA    1 
ATOM   2260  C  C     . ILE A 1 300 ? -42.378  102.484 -42.819 1.00 82.86  ?  300 ILE A C     1 
ATOM   2261  O  O     . ILE A 1 300 ? -42.537  102.784 -44.009 1.00 86.11  ?  300 ILE A O     1 
ATOM   2262  C  CB    . ILE A 1 300 ? -41.676  100.138 -43.356 1.00 68.59  ?  300 ILE A CB    1 
ATOM   2263  C  CG1   . ILE A 1 300 ? -41.824  98.671  -42.977 1.00 64.65  ?  300 ILE A CG1   1 
ATOM   2264  C  CG2   . ILE A 1 300 ? -40.199  100.483 -43.404 1.00 68.97  ?  300 ILE A CG2   1 
ATOM   2265  C  CD1   . ILE A 1 300 ? -41.007  97.752  -43.874 1.00 64.07  ?  300 ILE A CD1   1 
ATOM   2266  N  N     . GLU A 1 301 ? -42.209  103.384 -41.856 1.00 82.81  ?  301 GLU A N     1 
ATOM   2267  C  CA    . GLU A 1 301 ? -42.136  104.806 -42.131 1.00 85.41  ?  301 GLU A CA    1 
ATOM   2268  C  C     . GLU A 1 301 ? -40.805  105.145 -42.812 1.00 90.06  ?  301 GLU A C     1 
ATOM   2269  O  O     . GLU A 1 301 ? -39.730  104.886 -42.261 1.00 92.73  ?  301 GLU A O     1 
ATOM   2270  C  CB    . GLU A 1 301 ? -42.314  105.600 -40.833 1.00 86.60  ?  301 GLU A CB    1 
ATOM   2271  C  CG    . GLU A 1 301 ? -41.925  107.063 -40.947 1.00 93.98  ?  301 GLU A CG    1 
ATOM   2272  C  CD    . GLU A 1 301 ? -42.739  107.962 -40.039 1.00 102.90 ?  301 GLU A CD    1 
ATOM   2273  O  OE1   . GLU A 1 301 ? -42.382  109.160 -39.928 1.00 111.73 ?  301 GLU A OE1   1 
ATOM   2274  O  OE2   . GLU A 1 301 ? -43.730  107.473 -39.448 1.00 101.33 ?  301 GLU A OE2   1 
ATOM   2275  N  N     . LEU A 1 302 ? -40.882  105.704 -44.019 1.00 88.19  ?  302 LEU A N     1 
ATOM   2276  C  CA    . LEU A 1 302 ? -39.685  106.142 -44.733 1.00 87.94  ?  302 LEU A CA    1 
ATOM   2277  C  C     . LEU A 1 302 ? -39.386  107.613 -44.471 1.00 94.65  ?  302 LEU A C     1 
ATOM   2278  O  O     . LEU A 1 302 ? -40.223  108.340 -43.930 1.00 98.34  ?  302 LEU A O     1 
ATOM   2279  C  CB    . LEU A 1 302 ? -39.843  105.898 -46.229 1.00 86.13  ?  302 LEU A CB    1 
ATOM   2280  C  CG    . LEU A 1 302 ? -40.200  104.449 -46.541 1.00 86.81  ?  302 LEU A CG    1 
ATOM   2281  C  CD1   . LEU A 1 302 ? -40.533  104.292 -48.001 1.00 90.77  ?  302 LEU A CD1   1 
ATOM   2282  C  CD2   . LEU A 1 302 ? -39.067  103.513 -46.151 1.00 88.28  ?  302 LEU A CD2   1 
ATOM   2283  N  N     . LYS A 1 303 ? -38.189  108.047 -44.851 1.00 97.26  ?  303 LYS A N     1 
ATOM   2284  C  CA    . LYS A 1 303 ? -37.809  109.449 -44.716 1.00 105.73 ?  303 LYS A CA    1 
ATOM   2285  C  C     . LYS A 1 303 ? -38.307  110.269 -45.908 1.00 116.36 ?  303 LYS A C     1 
ATOM   2286  O  O     . LYS A 1 303 ? -38.759  109.708 -46.911 1.00 117.39 ?  303 LYS A O     1 
ATOM   2287  C  CB    . LYS A 1 303 ? -36.286  109.580 -44.602 1.00 101.48 ?  303 LYS A CB    1 
ATOM   2288  C  CG    . LYS A 1 303 ? -35.645  108.746 -43.497 1.00 96.39  ?  303 LYS A CG    1 
ATOM   2289  C  CD    . LYS A 1 303 ? -34.123  108.890 -43.522 1.00 100.57 ?  303 LYS A CD    1 
ATOM   2290  C  CE    . LYS A 1 303 ? -33.426  107.978 -42.511 1.00 98.95  ?  303 LYS A CE    1 
ATOM   2291  N  NZ    . LYS A 1 303 ? -32.023  107.653 -42.926 1.00 99.97  ?  303 LYS A NZ    1 
ATOM   2292  N  N     . LYS A 1 304 ? -38.232  111.595 -45.797 1.00 123.38 ?  304 LYS A N     1 
ATOM   2293  C  CA    . LYS A 1 304 ? -38.471  112.463 -46.949 1.00 127.85 ?  304 LYS A CA    1 
ATOM   2294  C  C     . LYS A 1 304 ? -37.407  112.168 -48.007 1.00 133.35 ?  304 LYS A C     1 
ATOM   2295  O  O     . LYS A 1 304 ? -36.264  111.856 -47.669 1.00 135.77 ?  304 LYS A O     1 
ATOM   2296  C  CB    . LYS A 1 304 ? -38.429  113.945 -46.550 1.00 127.13 ?  304 LYS A CB    1 
ATOM   2297  N  N     . ASP A 1 305 ? -37.783  112.259 -49.281 1.00 133.67 ?  305 ASP A N     1 
ATOM   2298  C  CA    . ASP A 1 305 ? -36.849  112.008 -50.382 1.00 127.99 ?  305 ASP A CA    1 
ATOM   2299  C  C     . ASP A 1 305 ? -36.127  110.665 -50.191 1.00 116.86 ?  305 ASP A C     1 
ATOM   2300  O  O     . ASP A 1 305 ? -34.917  110.601 -49.950 1.00 115.60 ?  305 ASP A O     1 
ATOM   2301  C  CB    . ASP A 1 305 ? -35.857  113.175 -50.546 1.00 128.06 ?  305 ASP A CB    1 
ATOM   2302  N  N     . ALA A 1 306 ? -36.895  109.592 -50.303 1.00 108.24 ?  306 ALA A N     1 
ATOM   2303  C  CA    . ALA A 1 306 ? -36.406  108.260 -49.990 1.00 104.21 ?  306 ALA A CA    1 
ATOM   2304  C  C     . ALA A 1 306 ? -37.080  107.275 -50.924 1.00 102.10 ?  306 ALA A C     1 
ATOM   2305  O  O     . ALA A 1 306 ? -38.289  107.041 -50.828 1.00 97.85  ?  306 ALA A O     1 
ATOM   2306  C  CB    . ALA A 1 306 ? -36.713  107.921 -48.543 1.00 101.14 ?  306 ALA A CB    1 
ATOM   2307  N  N     . ASN A 1 307 ? -36.291  106.702 -51.826 1.00 105.46 ?  307 ASN A N     1 
ATOM   2308  C  CA    . ASN A 1 307 ? -36.834  105.964 -52.964 1.00 107.19 ?  307 ASN A CA    1 
ATOM   2309  C  C     . ASN A 1 307 ? -37.588  104.702 -52.536 1.00 101.12 ?  307 ASN A C     1 
ATOM   2310  O  O     . ASN A 1 307 ? -36.994  103.642 -52.351 1.00 105.03 ?  307 ASN A O     1 
ATOM   2311  C  CB    . ASN A 1 307 ? -35.720  105.676 -53.986 1.00 108.04 ?  307 ASN A CB    1 
ATOM   2312  C  CG    . ASN A 1 307 ? -36.106  104.623 -55.006 1.00 108.02 ?  307 ASN A CG    1 
ATOM   2313  O  OD1   . ASN A 1 307 ? -37.268  104.214 -55.106 1.00 112.12 ?  307 ASN A OD1   1 
ATOM   2314  N  ND2   . ASN A 1 307 ? -35.124  104.172 -55.773 1.00 104.99 ?  307 ASN A ND2   1 
ATOM   2315  N  N     . THR A 1 308 ? -38.904  104.816 -52.386 1.00 90.38  ?  308 THR A N     1 
ATOM   2316  C  CA    . THR A 1 308 ? -39.654  103.748 -51.745 1.00 84.41  ?  308 THR A CA    1 
ATOM   2317  C  C     . THR A 1 308 ? -39.740  102.470 -52.577 1.00 83.82  ?  308 THR A C     1 
ATOM   2318  O  O     . THR A 1 308 ? -39.960  101.397 -52.036 1.00 77.29  ?  308 THR A O     1 
ATOM   2319  C  CB    . THR A 1 308 ? -41.046  104.221 -51.229 1.00 80.95  ?  308 THR A CB    1 
ATOM   2320  O  OG1   . THR A 1 308 ? -42.099  103.459 -51.842 1.00 82.68  ?  308 THR A OG1   1 
ATOM   2321  C  CG2   . THR A 1 308 ? -41.239  105.740 -51.454 1.00 81.40  ?  308 THR A CG2   1 
ATOM   2322  N  N     . GLU A 1 309 ? -39.544  102.569 -53.885 1.00 92.79  ?  309 GLU A N     1 
ATOM   2323  C  CA    . GLU A 1 309 ? -39.489  101.357 -54.697 1.00 94.72  ?  309 GLU A CA    1 
ATOM   2324  C  C     . GLU A 1 309 ? -38.248  100.572 -54.293 1.00 96.72  ?  309 GLU A C     1 
ATOM   2325  O  O     . GLU A 1 309 ? -38.296  99.354  -54.076 1.00 95.47  ?  309 GLU A O     1 
ATOM   2326  C  CB    . GLU A 1 309 ? -39.430  101.699 -56.189 1.00 97.79  ?  309 GLU A CB    1 
ATOM   2327  N  N     . LEU A 1 310 ? -37.143  101.308 -54.179 1.00 96.87  ?  310 LEU A N     1 
ATOM   2328  C  CA    . LEU A 1 310 ? -35.817  100.759 -53.909 1.00 96.18  ?  310 LEU A CA    1 
ATOM   2329  C  C     . LEU A 1 310 ? -35.800  99.985  -52.596 1.00 92.00  ?  310 LEU A C     1 
ATOM   2330  O  O     . LEU A 1 310 ? -35.302  98.858  -52.532 1.00 89.27  ?  310 LEU A O     1 
ATOM   2331  C  CB    . LEU A 1 310 ? -34.788  101.904 -53.880 1.00 98.85  ?  310 LEU A CB    1 
ATOM   2332  C  CG    . LEU A 1 310 ? -33.268  101.690 -53.979 1.00 100.20 ?  310 LEU A CG    1 
ATOM   2333  C  CD1   . LEU A 1 310 ? -32.677  101.122 -52.687 1.00 93.25  ?  310 LEU A CD1   1 
ATOM   2334  C  CD2   . LEU A 1 310 ? -32.931  100.811 -55.182 1.00 107.24 ?  310 LEU A CD2   1 
ATOM   2335  N  N     . VAL A 1 311 ? -36.354  100.601 -51.557 1.00 89.50  ?  311 VAL A N     1 
ATOM   2336  C  CA    . VAL A 1 311 ? -36.435  99.993  -50.234 1.00 91.56  ?  311 VAL A CA    1 
ATOM   2337  C  C     . VAL A 1 311 ? -37.314  98.734  -50.243 1.00 95.44  ?  311 VAL A C     1 
ATOM   2338  O  O     . VAL A 1 311 ? -36.901  97.671  -49.781 1.00 95.84  ?  311 VAL A O     1 
ATOM   2339  C  CB    . VAL A 1 311 ? -36.970  101.004 -49.186 1.00 72.55  ?  311 VAL A CB    1 
ATOM   2340  C  CG1   . VAL A 1 311 ? -37.366  100.299 -47.886 1.00 72.58  ?  311 VAL A CG1   1 
ATOM   2341  C  CG2   . VAL A 1 311 ? -35.949  102.089 -48.922 1.00 67.84  ?  311 VAL A CG2   1 
ATOM   2342  N  N     . LEU A 1 312 ? -38.524  98.853  -50.777 1.00 95.21  ?  312 LEU A N     1 
ATOM   2343  C  CA    . LEU A 1 312 ? -39.444  97.724  -50.803 1.00 87.55  ?  312 LEU A CA    1 
ATOM   2344  C  C     . LEU A 1 312 ? -38.822  96.538  -51.521 1.00 87.37  ?  312 LEU A C     1 
ATOM   2345  O  O     . LEU A 1 312 ? -38.999  95.389  -51.111 1.00 83.59  ?  312 LEU A O     1 
ATOM   2346  C  CB    . LEU A 1 312 ? -40.759  98.100  -51.483 1.00 82.51  ?  312 LEU A CB    1 
ATOM   2347  C  CG    . LEU A 1 312 ? -41.871  97.082  -51.239 1.00 75.27  ?  312 LEU A CG    1 
ATOM   2348  C  CD1   . LEU A 1 312 ? -42.231  97.045  -49.760 1.00 72.15  ?  312 LEU A CD1   1 
ATOM   2349  C  CD2   . LEU A 1 312 ? -43.086  97.399  -52.091 1.00 77.97  ?  312 LEU A CD2   1 
ATOM   2350  N  N     . ASN A 1 313 ? -38.099  96.817  -52.600 1.00 85.84  ?  313 ASN A N     1 
ATOM   2351  C  CA    . ASN A 1 313 ? -37.444  95.750  -53.340 1.00 85.62  ?  313 ASN A CA    1 
ATOM   2352  C  C     . ASN A 1 313 ? -36.353  95.098  -52.506 1.00 84.01  ?  313 ASN A C     1 
ATOM   2353  O  O     . ASN A 1 313 ? -36.235  93.871  -52.458 1.00 83.92  ?  313 ASN A O     1 
ATOM   2354  C  CB    . ASN A 1 313 ? -36.877  96.270  -54.657 1.00 89.99  ?  313 ASN A CB    1 
ATOM   2355  C  CG    . ASN A 1 313 ? -37.796  95.996  -55.838 1.00 89.54  ?  313 ASN A CG    1 
ATOM   2356  O  OD1   . ASN A 1 313 ? -38.896  95.442  -55.677 1.00 81.11  ?  313 ASN A OD1   1 
ATOM   2357  N  ND2   . ASN A 1 313 ? -37.349  96.386  -57.038 1.00 96.14  ?  313 ASN A ND2   1 
ATOM   2358  N  N     . TYR A 1 314 ? -35.566  95.923  -51.827 1.00 84.09  ?  314 TYR A N     1 
ATOM   2359  C  CA    . TYR A 1 314 ? -34.513  95.392  -50.978 1.00 79.06  ?  314 TYR A CA    1 
ATOM   2360  C  C     . TYR A 1 314 ? -35.074  94.480  -49.892 1.00 76.03  ?  314 TYR A C     1 
ATOM   2361  O  O     . TYR A 1 314 ? -34.576  93.366  -49.703 1.00 80.64  ?  314 TYR A O     1 
ATOM   2362  C  CB    . TYR A 1 314 ? -33.677  96.506  -50.359 1.00 75.51  ?  314 TYR A CB    1 
ATOM   2363  C  CG    . TYR A 1 314 ? -32.539  95.977  -49.530 1.00 75.55  ?  314 TYR A CG    1 
ATOM   2364  C  CD1   . TYR A 1 314 ? -32.686  95.794  -48.158 1.00 74.72  ?  314 TYR A CD1   1 
ATOM   2365  C  CD2   . TYR A 1 314 ? -31.323  95.639  -50.115 1.00 79.87  ?  314 TYR A CD2   1 
ATOM   2366  C  CE1   . TYR A 1 314 ? -31.653  95.295  -47.386 1.00 75.74  ?  314 TYR A CE1   1 
ATOM   2367  C  CE2   . TYR A 1 314 ? -30.277  95.138  -49.346 1.00 84.56  ?  314 TYR A CE2   1 
ATOM   2368  C  CZ    . TYR A 1 314 ? -30.454  94.968  -47.979 1.00 82.10  ?  314 TYR A CZ    1 
ATOM   2369  O  OH    . TYR A 1 314 ? -29.435  94.483  -47.195 1.00 81.13  ?  314 TYR A OH    1 
ATOM   2370  N  N     . LEU A 1 315 ? -36.104  94.943  -49.181 1.00 68.54  ?  315 LEU A N     1 
ATOM   2371  C  CA    . LEU A 1 315 ? -36.723  94.115  -48.148 1.00 60.34  ?  315 LEU A CA    1 
ATOM   2372  C  C     . LEU A 1 315 ? -37.296  92.816  -48.732 1.00 67.88  ?  315 LEU A C     1 
ATOM   2373  O  O     . LEU A 1 315 ? -37.140  91.757  -48.131 1.00 73.86  ?  315 LEU A O     1 
ATOM   2374  C  CB    . LEU A 1 315 ? -37.767  94.886  -47.330 1.00 51.02  ?  315 LEU A CB    1 
ATOM   2375  C  CG    . LEU A 1 315 ? -37.266  96.168  -46.642 1.00 55.07  ?  315 LEU A CG    1 
ATOM   2376  C  CD1   . LEU A 1 315 ? -38.418  97.001  -46.107 1.00 55.62  ?  315 LEU A CD1   1 
ATOM   2377  C  CD2   . LEU A 1 315 ? -36.250  95.889  -45.519 1.00 58.10  ?  315 LEU A CD2   1 
ATOM   2378  N  N     . PHE A 1 316 ? -37.928  92.871  -49.904 1.00 69.47  ?  316 PHE A N     1 
ATOM   2379  C  CA    . PHE A 1 316 ? -38.409  91.629  -50.535 1.00 69.48  ?  316 PHE A CA    1 
ATOM   2380  C  C     . PHE A 1 316 ? -37.276  90.634  -50.774 1.00 68.12  ?  316 PHE A C     1 
ATOM   2381  O  O     . PHE A 1 316 ? -37.478  89.422  -50.692 1.00 66.04  ?  316 PHE A O     1 
ATOM   2382  C  CB    . PHE A 1 316 ? -39.130  91.888  -51.868 1.00 73.36  ?  316 PHE A CB    1 
ATOM   2383  C  CG    . PHE A 1 316 ? -40.540  92.386  -51.719 1.00 75.74  ?  316 PHE A CG    1 
ATOM   2384  C  CD1   . PHE A 1 316 ? -41.054  93.314  -52.608 1.00 74.58  ?  316 PHE A CD1   1 
ATOM   2385  C  CD2   . PHE A 1 316 ? -41.351  91.931  -50.696 1.00 78.24  ?  316 PHE A CD2   1 
ATOM   2386  C  CE1   . PHE A 1 316 ? -42.341  93.781  -52.475 1.00 75.76  ?  316 PHE A CE1   1 
ATOM   2387  C  CE2   . PHE A 1 316 ? -42.642  92.393  -50.562 1.00 78.39  ?  316 PHE A CE2   1 
ATOM   2388  C  CZ    . PHE A 1 316 ? -43.137  93.318  -51.453 1.00 79.03  ?  316 PHE A CZ    1 
ATOM   2389  N  N     . LYS A 1 317 ? -36.089  91.148  -51.087 1.00 68.98  ?  317 LYS A N     1 
ATOM   2390  C  CA    . LYS A 1 317 ? -34.953  90.283  -51.415 1.00 69.03  ?  317 LYS A CA    1 
ATOM   2391  C  C     . LYS A 1 317 ? -34.257  89.746  -50.171 1.00 69.96  ?  317 LYS A C     1 
ATOM   2392  O  O     . LYS A 1 317 ? -34.162  88.534  -49.990 1.00 71.38  ?  317 LYS A O     1 
ATOM   2393  C  CB    . LYS A 1 317 ? -33.928  91.004  -52.313 1.00 60.12  ?  317 LYS A CB    1 
ATOM   2394  C  CG    . LYS A 1 317 ? -32.846  90.065  -52.846 1.00 58.26  ?  317 LYS A CG    1 
ATOM   2395  C  CD    . LYS A 1 317 ? -31.732  90.751  -53.648 1.00 64.12  ?  317 LYS A CD    1 
ATOM   2396  C  CE    . LYS A 1 317 ? -30.726  89.701  -54.183 1.00 78.42  ?  317 LYS A CE    1 
ATOM   2397  N  NZ    . LYS A 1 317 ? -29.562  90.290  -54.930 1.00 89.55  ?  317 LYS A NZ    1 
ATOM   2398  N  N     . TYR A 1 318 ? -33.802  90.670  -49.321 1.00 65.56  ?  318 TYR A N     1 
ATOM   2399  C  CA    . TYR A 1 318 ? -32.949  90.374  -48.173 1.00 65.39  ?  318 TYR A CA    1 
ATOM   2400  C  C     . TYR A 1 318 ? -33.696  90.148  -46.824 1.00 66.50  ?  318 TYR A C     1 
ATOM   2401  O  O     . TYR A 1 318 ? -33.101  90.171  -45.743 1.00 66.29  ?  318 TYR A O     1 
ATOM   2402  C  CB    . TYR A 1 318 ? -31.874  91.470  -48.051 1.00 62.30  ?  318 TYR A CB    1 
ATOM   2403  C  CG    . TYR A 1 318 ? -30.846  91.405  -49.156 1.00 66.78  ?  318 TYR A CG    1 
ATOM   2404  C  CD1   . TYR A 1 318 ? -29.737  90.578  -49.053 1.00 71.85  ?  318 TYR A CD1   1 
ATOM   2405  C  CD2   . TYR A 1 318 ? -30.996  92.150  -50.312 1.00 72.02  ?  318 TYR A CD2   1 
ATOM   2406  C  CE1   . TYR A 1 318 ? -28.804  90.503  -50.063 1.00 71.49  ?  318 TYR A CE1   1 
ATOM   2407  C  CE2   . TYR A 1 318 ? -30.072  92.074  -51.335 1.00 73.43  ?  318 TYR A CE2   1 
ATOM   2408  C  CZ    . TYR A 1 318 ? -28.980  91.251  -51.206 1.00 74.98  ?  318 TYR A CZ    1 
ATOM   2409  O  OH    . TYR A 1 318 ? -28.060  91.182  -52.228 1.00 89.16  ?  318 TYR A OH    1 
ATOM   2410  N  N     . THR A 1 319 ? -35.001  89.937  -46.896 1.00 63.39  ?  319 THR A N     1 
ATOM   2411  C  CA    . THR A 1 319 ? -35.752  89.506  -45.736 1.00 72.03  ?  319 THR A CA    1 
ATOM   2412  C  C     . THR A 1 319 ? -36.780  88.470  -46.150 1.00 82.24  ?  319 THR A C     1 
ATOM   2413  O  O     . THR A 1 319 ? -36.743  87.948  -47.284 1.00 95.07  ?  319 THR A O     1 
ATOM   2414  C  CB    . THR A 1 319 ? -36.471  90.668  -44.999 1.00 62.50  ?  319 THR A CB    1 
ATOM   2415  O  OG1   . THR A 1 319 ? -37.588  91.120  -45.769 1.00 71.25  ?  319 THR A OG1   1 
ATOM   2416  C  CG2   . THR A 1 319 ? -35.520  91.822  -44.705 1.00 50.37  ?  319 THR A CG2   1 
ATOM   2417  N  N     . ASP A 1 320 ? -37.680  88.171  -45.218 1.00 74.79  ?  320 ASP A N     1 
ATOM   2418  C  CA    . ASP A 1 320 ? -38.695  87.161  -45.438 1.00 76.53  ?  320 ASP A CA    1 
ATOM   2419  C  C     . ASP A 1 320 ? -39.991  87.864  -45.772 1.00 78.30  ?  320 ASP A C     1 
ATOM   2420  O  O     . ASP A 1 320 ? -41.038  87.228  -45.905 1.00 78.32  ?  320 ASP A O     1 
ATOM   2421  C  CB    . ASP A 1 320 ? -38.865  86.262  -44.208 1.00 81.99  ?  320 ASP A CB    1 
ATOM   2422  C  CG    . ASP A 1 320 ? -37.772  85.205  -44.090 1.00 85.70  ?  320 ASP A CG    1 
ATOM   2423  O  OD1   . ASP A 1 320 ? -37.161  84.854  -45.125 1.00 83.98  ?  320 ASP A OD1   1 
ATOM   2424  O  OD2   . ASP A 1 320 ? -37.537  84.714  -42.958 1.00 88.78  ?  320 ASP A OD2   1 
ATOM   2425  N  N     . LEU A 1 321 ? -39.914  89.185  -45.901 1.00 76.86  ?  321 LEU A N     1 
ATOM   2426  C  CA    . LEU A 1 321 ? -41.038  89.960  -46.405 1.00 75.18  ?  321 LEU A CA    1 
ATOM   2427  C  C     . LEU A 1 321 ? -41.510  89.250  -47.667 1.00 72.92  ?  321 LEU A C     1 
ATOM   2428  O  O     . LEU A 1 321 ? -42.689  89.314  -48.043 1.00 70.14  ?  321 LEU A O     1 
ATOM   2429  C  CB    . LEU A 1 321 ? -40.594  91.386  -46.722 1.00 78.96  ?  321 LEU A CB    1 
ATOM   2430  C  CG    . LEU A 1 321 ? -41.546  92.532  -46.394 1.00 81.20  ?  321 LEU A CG    1 
ATOM   2431  C  CD1   . LEU A 1 321 ? -41.874  93.322  -47.662 1.00 82.98  ?  321 LEU A CD1   1 
ATOM   2432  C  CD2   . LEU A 1 321 ? -42.807  92.001  -45.738 1.00 78.95  ?  321 LEU A CD2   1 
ATOM   2433  N  N     . GLN A 1 322 ? -40.555  88.564  -48.303 1.00 72.56  ?  322 GLN A N     1 
ATOM   2434  C  CA    . GLN A 1 322 ? -40.802  87.669  -49.432 1.00 62.80  ?  322 GLN A CA    1 
ATOM   2435  C  C     . GLN A 1 322 ? -39.841  86.493  -49.381 1.00 59.57  ?  322 GLN A C     1 
ATOM   2436  O  O     . GLN A 1 322 ? -38.612  86.684  -49.264 1.00 69.19  ?  322 GLN A O     1 
ATOM   2437  C  CB    . GLN A 1 322 ? -40.604  88.388  -50.761 1.00 63.74  ?  322 GLN A CB    1 
ATOM   2438  C  CG    . GLN A 1 322 ? -40.902  87.522  -51.954 1.00 75.95  ?  322 GLN A CG    1 
ATOM   2439  C  CD    . GLN A 1 322 ? -40.259  88.059  -53.199 1.00 81.82  ?  322 GLN A CD    1 
ATOM   2440  O  OE1   . GLN A 1 322 ? -40.263  89.269  -53.428 1.00 87.83  ?  322 GLN A OE1   1 
ATOM   2441  N  NE2   . GLN A 1 322 ? -39.675  87.168  -54.006 1.00 78.44  ?  322 GLN A NE2   1 
ATOM   2442  N  N     . ILE A 1 323 ? -40.413  85.298  -49.516 1.00 73.02  ?  323 ILE A N     1 
ATOM   2443  C  CA    . ILE A 1 323 ? -39.688  84.038  -49.420 1.00 72.40  ?  323 ILE A CA    1 
ATOM   2444  C  C     . ILE A 1 323 ? -40.029  83.173  -50.614 1.00 76.31  ?  323 ILE A C     1 
ATOM   2445  O  O     . ILE A 1 323 ? -40.993  83.452  -51.337 1.00 79.27  ?  323 ILE A O     1 
ATOM   2446  C  CB    . ILE A 1 323 ? -40.163  83.213  -48.205 1.00 71.76  ?  323 ILE A CB    1 
ATOM   2447  C  CG1   . ILE A 1 323 ? -41.535  82.597  -48.499 1.00 62.15  ?  323 ILE A CG1   1 
ATOM   2448  C  CG2   . ILE A 1 323 ? -40.152  84.046  -46.909 1.00 70.05  ?  323 ILE A CG2   1 
ATOM   2449  C  CD1   . ILE A 1 323 ? -42.067  81.761  -47.378 1.00 67.25  ?  323 ILE A CD1   1 
ATOM   2450  N  N     . ASN A 1 324 ? -39.255  82.109  -50.811 1.00 77.44  ?  324 ASN A N     1 
ATOM   2451  C  CA    . ASN A 1 324 ? -39.664  81.064  -51.741 1.00 75.54  ?  324 ASN A CA    1 
ATOM   2452  C  C     . ASN A 1 324 ? -40.311  79.938  -50.959 1.00 78.87  ?  324 ASN A C     1 
ATOM   2453  O  O     . ASN A 1 324 ? -39.846  79.589  -49.878 1.00 86.69  ?  324 ASN A O     1 
ATOM   2454  C  CB    . ASN A 1 324 ? -38.475  80.500  -52.513 1.00 72.18  ?  324 ASN A CB    1 
ATOM   2455  C  CG    . ASN A 1 324 ? -37.624  81.574  -53.146 1.00 73.16  ?  324 ASN A CG    1 
ATOM   2456  O  OD1   . ASN A 1 324 ? -38.114  82.641  -53.520 1.00 78.56  ?  324 ASN A OD1   1 
ATOM   2457  N  ND2   . ASN A 1 324 ? -36.330  81.299  -53.266 1.00 73.83  ?  324 ASN A ND2   1 
ATOM   2458  N  N     . TYR A 1 325 ? -41.388  79.377  -51.491 1.00 78.37  ?  325 TYR A N     1 
ATOM   2459  C  CA    . TYR A 1 325 ? -41.985  78.187  -50.899 1.00 79.34  ?  325 TYR A CA    1 
ATOM   2460  C  C     . TYR A 1 325 ? -41.720  76.984  -51.795 1.00 79.56  ?  325 TYR A C     1 
ATOM   2461  O  O     . TYR A 1 325 ? -42.046  77.006  -52.981 1.00 81.30  ?  325 TYR A O     1 
ATOM   2462  C  CB    . TYR A 1 325 ? -43.495  78.359  -50.690 1.00 79.53  ?  325 TYR A CB    1 
ATOM   2463  C  CG    . TYR A 1 325 ? -44.135  77.124  -50.107 1.00 76.19  ?  325 TYR A CG    1 
ATOM   2464  C  CD1   . TYR A 1 325 ? -44.499  76.058  -50.913 1.00 79.75  ?  325 TYR A CD1   1 
ATOM   2465  C  CD2   . TYR A 1 325 ? -44.342  77.010  -48.745 1.00 78.13  ?  325 TYR A CD2   1 
ATOM   2466  C  CE1   . TYR A 1 325 ? -45.077  74.911  -50.370 1.00 82.29  ?  325 TYR A CE1   1 
ATOM   2467  C  CE2   . TYR A 1 325 ? -44.915  75.873  -48.189 1.00 80.29  ?  325 TYR A CE2   1 
ATOM   2468  C  CZ    . TYR A 1 325 ? -45.281  74.825  -49.003 1.00 80.19  ?  325 TYR A CZ    1 
ATOM   2469  O  OH    . TYR A 1 325 ? -45.846  73.697  -48.446 1.00 74.41  ?  325 TYR A OH    1 
ATOM   2470  N  N     . ASN A 1 326 ? -41.132  75.936  -51.231 1.00 77.97  ?  326 ASN A N     1 
ATOM   2471  C  CA    . ASN A 1 326 ? -40.870  74.719  -51.992 1.00 76.57  ?  326 ASN A CA    1 
ATOM   2472  C  C     . ASN A 1 326 ? -41.820  73.577  -51.689 1.00 71.53  ?  326 ASN A C     1 
ATOM   2473  O  O     . ASN A 1 326 ? -41.831  73.048  -50.576 1.00 79.84  ?  326 ASN A O     1 
ATOM   2474  C  CB    . ASN A 1 326 ? -39.439  74.233  -51.793 1.00 82.18  ?  326 ASN A CB    1 
ATOM   2475  C  CG    . ASN A 1 326 ? -38.438  75.080  -52.518 1.00 92.94  ?  326 ASN A CG    1 
ATOM   2476  O  OD1   . ASN A 1 326 ? -38.125  74.831  -53.686 1.00 98.60  ?  326 ASN A OD1   1 
ATOM   2477  N  ND2   . ASN A 1 326 ? -37.922  76.094  -51.837 1.00 94.63  ?  326 ASN A ND2   1 
ATOM   2478  N  N     . PHE A 1 327 ? -42.609  73.212  -52.695 1.00 63.90  ?  327 PHE A N     1 
ATOM   2479  C  CA    . PHE A 1 327 ? -43.386  71.983  -52.699 1.00 62.47  ?  327 PHE A CA    1 
ATOM   2480  C  C     . PHE A 1 327 ? -42.439  70.786  -52.604 1.00 68.09  ?  327 PHE A C     1 
ATOM   2481  O  O     . PHE A 1 327 ? -41.410  70.736  -53.295 1.00 77.50  ?  327 PHE A O     1 
ATOM   2482  C  CB    . PHE A 1 327 ? -44.165  71.868  -54.011 1.00 70.30  ?  327 PHE A CB    1 
ATOM   2483  C  CG    . PHE A 1 327 ? -45.383  72.760  -54.101 1.00 73.96  ?  327 PHE A CG    1 
ATOM   2484  C  CD1   . PHE A 1 327 ? -46.650  72.258  -53.812 1.00 71.64  ?  327 PHE A CD1   1 
ATOM   2485  C  CD2   . PHE A 1 327 ? -45.269  74.080  -54.523 1.00 70.02  ?  327 PHE A CD2   1 
ATOM   2486  C  CE1   . PHE A 1 327 ? -47.776  73.067  -53.914 1.00 65.38  ?  327 PHE A CE1   1 
ATOM   2487  C  CE2   . PHE A 1 327 ? -46.390  74.893  -54.628 1.00 62.78  ?  327 PHE A CE2   1 
ATOM   2488  C  CZ    . PHE A 1 327 ? -47.643  74.390  -54.312 1.00 61.15  ?  327 PHE A CZ    1 
ATOM   2489  N  N     . ASN A 1 328 ? -42.785  69.826  -51.753 1.00 65.95  ?  328 ASN A N     1 
ATOM   2490  C  CA    . ASN A 1 328 ? -42.102  68.534  -51.737 1.00 69.05  ?  328 ASN A CA    1 
ATOM   2491  C  C     . ASN A 1 328 ? -43.096  67.470  -51.282 1.00 72.55  ?  328 ASN A C     1 
ATOM   2492  O  O     . ASN A 1 328 ? -42.909  66.788  -50.280 1.00 73.50  ?  328 ASN A O     1 
ATOM   2493  C  CB    . ASN A 1 328 ? -40.862  68.576  -50.848 1.00 71.51  ?  328 ASN A CB    1 
ATOM   2494  C  CG    . ASN A 1 328 ? -40.036  67.305  -50.929 1.00 74.85  ?  328 ASN A CG    1 
ATOM   2495  O  OD1   . ASN A 1 328 ? -40.149  66.522  -51.887 1.00 73.85  ?  328 ASN A OD1   1 
ATOM   2496  N  ND2   . ASN A 1 328 ? -39.193  67.090  -49.913 1.00 77.93  ?  328 ASN A ND2   1 
ATOM   2497  N  N     . MET A 1 329 ? -44.167  67.347  -52.050 1.00 73.38  ?  329 MET A N     1 
ATOM   2498  C  CA    . MET A 1 329 ? -45.297  66.523  -51.672 1.00 69.79  ?  329 MET A CA    1 
ATOM   2499  C  C     . MET A 1 329 ? -44.972  65.031  -51.607 1.00 69.21  ?  329 MET A C     1 
ATOM   2500  O  O     . MET A 1 329 ? -45.050  64.311  -52.604 1.00 75.36  ?  329 MET A O     1 
ATOM   2501  C  CB    . MET A 1 329 ? -46.487  66.803  -52.598 1.00 71.71  ?  329 MET A CB    1 
ATOM   2502  C  CG    . MET A 1 329 ? -46.728  68.291  -52.816 1.00 73.10  ?  329 MET A CG    1 
ATOM   2503  S  SD    . MET A 1 329 ? -48.427  68.713  -53.215 1.00 77.89  ?  329 MET A SD    1 
ATOM   2504  C  CE    . MET A 1 329 ? -48.529  68.267  -54.947 1.00 85.75  ?  329 MET A CE    1 
ATOM   2505  N  N     . VAL A 1 330 ? -44.606  64.590  -50.410 1.00 68.31  ?  330 VAL A N     1 
ATOM   2506  C  CA    . VAL A 1 330 ? -44.435  63.177  -50.114 1.00 69.61  ?  330 VAL A CA    1 
ATOM   2507  C  C     . VAL A 1 330 ? -45.478  62.745  -49.075 1.00 66.68  ?  330 VAL A C     1 
ATOM   2508  O  O     . VAL A 1 330 ? -45.837  63.502  -48.181 1.00 70.55  ?  330 VAL A O     1 
ATOM   2509  C  CB    . VAL A 1 330 ? -43.005  62.890  -49.609 1.00 67.35  ?  330 VAL A CB    1 
ATOM   2510  C  CG1   . VAL A 1 330 ? -42.828  61.411  -49.285 1.00 63.27  ?  330 VAL A CG1   1 
ATOM   2511  C  CG2   . VAL A 1 330 ? -42.012  63.307  -50.663 1.00 72.07  ?  330 VAL A CG2   1 
ATOM   2512  N  N     . ALA A 1 331 ? -45.978  61.529  -49.208 1.00 57.91  ?  331 ALA A N     1 
ATOM   2513  C  CA    . ALA A 1 331 ? -47.011  61.049  -48.318 1.00 55.79  ?  331 ALA A CA    1 
ATOM   2514  C  C     . ALA A 1 331 ? -46.884  59.539  -48.269 1.00 61.05  ?  331 ALA A C     1 
ATOM   2515  O  O     . ALA A 1 331 ? -46.027  58.970  -48.960 1.00 60.16  ?  331 ALA A O     1 
ATOM   2516  C  CB    . ALA A 1 331 ? -48.378  61.459  -48.848 1.00 55.82  ?  331 ALA A CB    1 
ATOM   2517  N  N     . ILE A 1 332 ? -47.719  58.883  -47.468 1.00 61.47  ?  332 ILE A N     1 
ATOM   2518  C  CA    . ILE A 1 332 ? -47.708  57.423  -47.441 1.00 65.90  ?  332 ILE A CA    1 
ATOM   2519  C  C     . ILE A 1 332 ? -48.890  56.788  -48.192 1.00 70.28  ?  332 ILE A C     1 
ATOM   2520  O  O     . ILE A 1 332 ? -50.038  56.822  -47.740 1.00 67.09  ?  332 ILE A O     1 
ATOM   2521  C  CB    . ILE A 1 332 ? -47.610  56.839  -46.010 1.00 58.72  ?  332 ILE A CB    1 
ATOM   2522  C  CG1   . ILE A 1 332 ? -46.435  57.441  -45.247 1.00 49.29  ?  332 ILE A CG1   1 
ATOM   2523  C  CG2   . ILE A 1 332 ? -47.388  55.344  -46.095 1.00 58.46  ?  332 ILE A CG2   1 
ATOM   2524  C  CD1   . ILE A 1 332 ? -45.120  56.813  -45.618 1.00 64.25  ?  332 ILE A CD1   1 
ATOM   2525  N  N     . ASP A 1 333 ? -48.578  56.216  -49.351 1.00 71.64  ?  333 ASP A N     1 
ATOM   2526  C  CA    . ASP A 1 333 ? -49.515  55.425  -50.144 1.00 71.33  ?  333 ASP A CA    1 
ATOM   2527  C  C     . ASP A 1 333 ? -49.030  53.975  -50.017 1.00 73.15  ?  333 ASP A C     1 
ATOM   2528  O  O     . ASP A 1 333 ? -47.825  53.690  -50.148 1.00 70.55  ?  333 ASP A O     1 
ATOM   2529  C  CB    . ASP A 1 333 ? -49.515  55.925  -51.600 1.00 81.20  ?  333 ASP A CB    1 
ATOM   2530  C  CG    . ASP A 1 333 ? -50.435  55.126  -52.514 1.00 100.35 ?  333 ASP A CG    1 
ATOM   2531  O  OD1   . ASP A 1 333 ? -50.022  54.038  -52.976 1.00 111.49 ?  333 ASP A OD1   1 
ATOM   2532  O  OD2   . ASP A 1 333 ? -51.555  55.600  -52.807 1.00 104.36 ?  333 ASP A OD2   1 
ATOM   2533  N  N     . ASN A 1 334 ? -49.947  53.068  -49.697 1.00 75.21  ?  334 ASN A N     1 
ATOM   2534  C  CA    . ASN A 1 334 ? -49.592  51.662  -49.491 1.00 74.72  ?  334 ASN A CA    1 
ATOM   2535  C  C     . ASN A 1 334 ? -48.354  51.410  -48.600 1.00 75.77  ?  334 ASN A C     1 
ATOM   2536  O  O     . ASN A 1 334 ? -47.465  50.633  -48.958 1.00 78.72  ?  334 ASN A O     1 
ATOM   2537  C  CB    . ASN A 1 334 ? -49.426  50.961  -50.842 1.00 78.92  ?  334 ASN A CB    1 
ATOM   2538  C  CG    . ASN A 1 334 ? -49.274  49.464  -50.705 1.00 87.64  ?  334 ASN A CG    1 
ATOM   2539  O  OD1   . ASN A 1 334 ? -49.880  48.841  -49.828 1.00 93.54  ?  334 ASN A OD1   1 
ATOM   2540  N  ND2   . ASN A 1 334 ? -48.451  48.875  -51.566 1.00 88.27  ?  334 ASN A ND2   1 
ATOM   2541  N  N     . PHE A 1 335 ? -48.300  52.057  -47.441 1.00 74.75  ?  335 PHE A N     1 
ATOM   2542  C  CA    . PHE A 1 335 ? -47.246  51.764  -46.476 1.00 76.89  ?  335 PHE A CA    1 
ATOM   2543  C  C     . PHE A 1 335 ? -45.902  52.296  -46.922 1.00 76.23  ?  335 PHE A C     1 
ATOM   2544  O  O     . PHE A 1 335 ? -44.891  52.140  -46.240 1.00 72.84  ?  335 PHE A O     1 
ATOM   2545  C  CB    . PHE A 1 335 ? -47.157  50.259  -46.265 1.00 80.48  ?  335 PHE A CB    1 
ATOM   2546  C  CG    . PHE A 1 335 ? -48.413  49.668  -45.725 1.00 85.63  ?  335 PHE A CG    1 
ATOM   2547  C  CD1   . PHE A 1 335 ? -49.272  48.962  -46.553 1.00 86.32  ?  335 PHE A CD1   1 
ATOM   2548  C  CD2   . PHE A 1 335 ? -48.757  49.850  -44.390 1.00 89.67  ?  335 PHE A CD2   1 
ATOM   2549  C  CE1   . PHE A 1 335 ? -50.441  48.426  -46.058 1.00 84.47  ?  335 PHE A CE1   1 
ATOM   2550  C  CE2   . PHE A 1 335 ? -49.922  49.316  -43.886 1.00 89.17  ?  335 PHE A CE2   1 
ATOM   2551  C  CZ    . PHE A 1 335 ? -50.767  48.601  -44.722 1.00 87.03  ?  335 PHE A CZ    1 
ATOM   2552  N  N     . THR A 1 336 ? -45.910  52.946  -48.071 1.00 78.42  ?  336 THR A N     1 
ATOM   2553  C  CA    . THR A 1 336 ? -44.686  53.366  -48.714 1.00 81.61  ?  336 THR A CA    1 
ATOM   2554  C  C     . THR A 1 336 ? -44.633  54.893  -48.781 1.00 77.44  ?  336 THR A C     1 
ATOM   2555  O  O     . THR A 1 336 ? -45.657  55.554  -48.984 1.00 76.46  ?  336 THR A O     1 
ATOM   2556  C  CB    . THR A 1 336 ? -44.625  52.759  -50.134 1.00 81.71  ?  336 THR A CB    1 
ATOM   2557  O  OG1   . THR A 1 336 ? -45.173  51.438  -50.101 1.00 84.79  ?  336 THR A OG1   1 
ATOM   2558  C  CG2   . THR A 1 336 ? -43.210  52.677  -50.644 1.00 80.42  ?  336 THR A CG2   1 
ATOM   2559  N  N     . PRO A 1 337 ? -43.436  55.461  -48.589 1.00 70.43  ?  337 PRO A N     1 
ATOM   2560  C  CA    . PRO A 1 337 ? -43.223  56.880  -48.884 1.00 69.83  ?  337 PRO A CA    1 
ATOM   2561  C  C     . PRO A 1 337 ? -43.294  57.081  -50.400 1.00 74.06  ?  337 PRO A C     1 
ATOM   2562  O  O     . PRO A 1 337 ? -42.703  56.292  -51.136 1.00 74.32  ?  337 PRO A O     1 
ATOM   2563  C  CB    . PRO A 1 337 ? -41.800  57.126  -48.380 1.00 72.30  ?  337 PRO A CB    1 
ATOM   2564  C  CG    . PRO A 1 337 ? -41.122  55.796  -48.521 1.00 74.98  ?  337 PRO A CG    1 
ATOM   2565  C  CD    . PRO A 1 337 ? -42.186  54.758  -48.255 1.00 72.68  ?  337 PRO A CD    1 
ATOM   2566  N  N     . ARG A 1 338 ? -44.015  58.096  -50.865 1.00 72.62  ?  338 ARG A N     1 
ATOM   2567  C  CA    . ARG A 1 338 ? -44.247  58.264  -52.304 1.00 67.96  ?  338 ARG A CA    1 
ATOM   2568  C  C     . ARG A 1 338 ? -44.346  59.753  -52.652 1.00 73.18  ?  338 ARG A C     1 
ATOM   2569  O  O     . ARG A 1 338 ? -45.121  60.488  -52.042 1.00 81.87  ?  338 ARG A O     1 
ATOM   2570  C  CB    . ARG A 1 338 ? -45.533  57.532  -52.709 1.00 61.38  ?  338 ARG A CB    1 
ATOM   2571  C  CG    . ARG A 1 338 ? -45.557  56.972  -54.110 1.00 76.63  ?  338 ARG A CG    1 
ATOM   2572  C  CD    . ARG A 1 338 ? -46.583  57.676  -55.015 1.00 90.80  ?  338 ARG A CD    1 
ATOM   2573  N  NE    . ARG A 1 338 ? -47.914  57.050  -55.025 1.00 97.51  ?  338 ARG A NE    1 
ATOM   2574  C  CZ    . ARG A 1 338 ? -48.688  56.946  -56.111 1.00 98.86  ?  338 ARG A CZ    1 
ATOM   2575  N  NH1   . ARG A 1 338 ? -48.268  57.413  -57.284 1.00 93.51  ?  338 ARG A NH1   1 
ATOM   2576  N  NH2   . ARG A 1 338 ? -49.884  56.374  -56.031 1.00 101.78 ?  338 ARG A NH2   1 
ATOM   2577  N  N     . GLN A 1 339 ? -43.543  60.219  -53.602 1.00 72.14  ?  339 GLN A N     1 
ATOM   2578  C  CA    . GLN A 1 339 ? -43.686  61.601  -54.056 1.00 69.03  ?  339 GLN A CA    1 
ATOM   2579  C  C     . GLN A 1 339 ? -44.837  61.649  -55.041 1.00 68.91  ?  339 GLN A C     1 
ATOM   2580  O  O     . GLN A 1 339 ? -44.916  60.818  -55.948 1.00 82.61  ?  339 GLN A O     1 
ATOM   2581  C  CB    . GLN A 1 339 ? -42.418  62.098  -54.711 1.00 68.43  ?  339 GLN A CB    1 
ATOM   2582  C  CG    . GLN A 1 339 ? -42.497  63.519  -55.205 1.00 67.94  ?  339 GLN A CG    1 
ATOM   2583  C  CD    . GLN A 1 339 ? -41.122  64.033  -55.650 1.00 79.34  ?  339 GLN A CD    1 
ATOM   2584  O  OE1   . GLN A 1 339 ? -40.098  63.750  -55.009 1.00 90.52  ?  339 GLN A OE1   1 
ATOM   2585  N  NE2   . GLN A 1 339 ? -41.095  64.784  -56.750 1.00 76.57  ?  339 GLN A NE2   1 
ATOM   2586  N  N     . VAL A 1 340 ? -45.742  62.600  -54.848 1.00 61.86  ?  340 VAL A N     1 
ATOM   2587  C  CA    . VAL A 1 340 ? -46.998  62.586  -55.580 1.00 69.85  ?  340 VAL A CA    1 
ATOM   2588  C  C     . VAL A 1 340 ? -47.432  63.998  -55.858 1.00 72.31  ?  340 VAL A C     1 
ATOM   2589  O  O     . VAL A 1 340 ? -47.150  64.904  -55.085 1.00 78.11  ?  340 VAL A O     1 
ATOM   2590  C  CB    . VAL A 1 340 ? -48.125  61.905  -54.781 1.00 70.03  ?  340 VAL A CB    1 
ATOM   2591  C  CG1   . VAL A 1 340 ? -47.768  60.472  -54.447 1.00 70.85  ?  340 VAL A CG1   1 
ATOM   2592  C  CG2   . VAL A 1 340 ? -48.407  62.688  -53.511 1.00 66.35  ?  340 VAL A CG2   1 
ATOM   2593  N  N     . GLY A 1 341 ? -48.125  64.175  -56.970 1.00 70.11  ?  341 GLY A N     1 
ATOM   2594  C  CA    . GLY A 1 341 ? -48.657  65.466  -57.328 1.00 74.54  ?  341 GLY A CA    1 
ATOM   2595  C  C     . GLY A 1 341 ? -50.145  65.451  -57.081 1.00 78.42  ?  341 GLY A C     1 
ATOM   2596  O  O     . GLY A 1 341 ? -50.656  64.551  -56.417 1.00 75.83  ?  341 GLY A O     1 
ATOM   2597  N  N     . ILE A 1 342 ? -50.834  66.442  -57.636 1.00 81.67  ?  342 ILE A N     1 
ATOM   2598  C  CA    . ILE A 1 342 ? -52.262  66.638  -57.423 1.00 74.33  ?  342 ILE A CA    1 
ATOM   2599  C  C     . ILE A 1 342 ? -53.077  65.402  -57.748 1.00 70.83  ?  342 ILE A C     1 
ATOM   2600  O  O     . ILE A 1 342 ? -54.095  65.145  -57.121 1.00 67.32  ?  342 ILE A O     1 
ATOM   2601  C  CB    . ILE A 1 342 ? -52.775  67.855  -58.237 1.00 74.12  ?  342 ILE A CB    1 
ATOM   2602  C  CG1   . ILE A 1 342 ? -52.604  69.110  -57.395 1.00 81.18  ?  342 ILE A CG1   1 
ATOM   2603  C  CG2   . ILE A 1 342 ? -54.226  67.715  -58.592 1.00 66.20  ?  342 ILE A CG2   1 
ATOM   2604  C  CD1   . ILE A 1 342 ? -52.672  68.809  -55.896 1.00 83.22  ?  342 ILE A CD1   1 
ATOM   2605  N  N     . VAL A 1 343 ? -52.618  64.613  -58.708 1.00 69.18  ?  343 VAL A N     1 
ATOM   2606  C  CA    . VAL A 1 343 ? -53.469  63.557  -59.237 1.00 68.55  ?  343 VAL A CA    1 
ATOM   2607  C  C     . VAL A 1 343 ? -53.565  62.271  -58.407 1.00 73.74  ?  343 VAL A C     1 
ATOM   2608  O  O     . VAL A 1 343 ? -54.659  61.877  -58.023 1.00 73.63  ?  343 VAL A O     1 
ATOM   2609  C  CB    . VAL A 1 343 ? -53.179  63.294  -60.716 1.00 60.21  ?  343 VAL A CB    1 
ATOM   2610  C  CG1   . VAL A 1 343 ? -53.551  61.869  -61.089 1.00 58.55  ?  343 VAL A CG1   1 
ATOM   2611  C  CG2   . VAL A 1 343 ? -53.956  64.308  -61.542 1.00 53.93  ?  343 VAL A CG2   1 
ATOM   2612  N  N     . PRO A 1 344 ? -52.433  61.608  -58.128 1.00 76.78  ?  344 PRO A N     1 
ATOM   2613  C  CA    . PRO A 1 344 ? -52.552  60.446  -57.235 1.00 76.35  ?  344 PRO A CA    1 
ATOM   2614  C  C     . PRO A 1 344 ? -53.118  60.811  -55.856 1.00 73.22  ?  344 PRO A C     1 
ATOM   2615  O  O     . PRO A 1 344 ? -53.658  59.940  -55.188 1.00 75.90  ?  344 PRO A O     1 
ATOM   2616  C  CB    . PRO A 1 344 ? -51.104  59.927  -57.120 1.00 74.90  ?  344 PRO A CB    1 
ATOM   2617  C  CG    . PRO A 1 344 ? -50.254  61.077  -57.456 1.00 75.61  ?  344 PRO A CG    1 
ATOM   2618  C  CD    . PRO A 1 344 ? -51.038  61.844  -58.525 1.00 78.63  ?  344 PRO A CD    1 
ATOM   2619  N  N     . ILE A 1 345 ? -52.992  62.071  -55.445 1.00 68.06  ?  345 ILE A N     1 
ATOM   2620  C  CA    . ILE A 1 345 ? -53.551  62.527  -54.181 1.00 61.58  ?  345 ILE A CA    1 
ATOM   2621  C  C     . ILE A 1 345 ? -55.075  62.467  -54.224 1.00 61.04  ?  345 ILE A C     1 
ATOM   2622  O  O     . ILE A 1 345 ? -55.709  61.814  -53.401 1.00 62.03  ?  345 ILE A O     1 
ATOM   2623  C  CB    . ILE A 1 345 ? -53.084  63.960  -53.843 1.00 54.39  ?  345 ILE A CB    1 
ATOM   2624  C  CG1   . ILE A 1 345 ? -51.641  63.936  -53.328 1.00 50.28  ?  345 ILE A CG1   1 
ATOM   2625  C  CG2   . ILE A 1 345 ? -54.021  64.620  -52.818 1.00 51.49  ?  345 ILE A CG2   1 
ATOM   2626  C  CD1   . ILE A 1 345 ? -51.097  65.299  -52.924 1.00 48.47  ?  345 ILE A CD1   1 
ATOM   2627  N  N     . LEU A 1 346 ? -55.666  63.147  -55.192 1.00 59.83  ?  346 LEU A N     1 
ATOM   2628  C  CA    . LEU A 1 346 ? -57.113  63.131  -55.328 1.00 59.95  ?  346 LEU A CA    1 
ATOM   2629  C  C     . LEU A 1 346 ? -57.589  61.727  -55.633 1.00 64.56  ?  346 LEU A C     1 
ATOM   2630  O  O     . LEU A 1 346 ? -58.694  61.332  -55.277 1.00 65.63  ?  346 LEU A O     1 
ATOM   2631  C  CB    . LEU A 1 346 ? -57.563  64.087  -56.434 1.00 58.20  ?  346 LEU A CB    1 
ATOM   2632  C  CG    . LEU A 1 346 ? -57.313  65.554  -56.075 1.00 58.16  ?  346 LEU A CG    1 
ATOM   2633  C  CD1   . LEU A 1 346 ? -57.701  66.457  -57.229 1.00 58.14  ?  346 LEU A CD1   1 
ATOM   2634  C  CD2   . LEU A 1 346 ? -58.045  65.948  -54.771 1.00 46.03  ?  346 LEU A CD2   1 
ATOM   2635  N  N     . SER A 1 347 ? -56.746  60.966  -56.305 1.00 68.48  ?  347 SER A N     1 
ATOM   2636  C  CA    . SER A 1 347 ? -57.150  59.638  -56.710 1.00 71.85  ?  347 SER A CA    1 
ATOM   2637  C  C     . SER A 1 347 ? -57.247  58.774  -55.459 1.00 73.92  ?  347 SER A C     1 
ATOM   2638  O  O     . SER A 1 347 ? -58.241  58.083  -55.254 1.00 76.32  ?  347 SER A O     1 
ATOM   2639  C  CB    . SER A 1 347 ? -56.169  59.060  -57.732 1.00 71.59  ?  347 SER A CB    1 
ATOM   2640  O  OG    . SER A 1 347 ? -55.595  57.846  -57.258 1.00 79.78  ?  347 SER A OG    1 
ATOM   2641  N  N     . SER A 1 348 ? -56.223  58.854  -54.613 1.00 69.57  ?  348 SER A N     1 
ATOM   2642  C  CA    . SER A 1 348 ? -56.145  58.045  -53.404 1.00 70.88  ?  348 SER A CA    1 
ATOM   2643  C  C     . SER A 1 348 ? -57.240  58.426  -52.423 1.00 69.34  ?  348 SER A C     1 
ATOM   2644  O  O     . SER A 1 348 ? -57.774  57.576  -51.688 1.00 71.71  ?  348 SER A O     1 
ATOM   2645  C  CB    . SER A 1 348 ? -54.774  58.191  -52.744 1.00 77.80  ?  348 SER A CB    1 
ATOM   2646  O  OG    . SER A 1 348 ? -53.818  57.392  -53.426 1.00 92.49  ?  348 SER A OG    1 
ATOM   2647  N  N     . TYR A 1 349 ? -57.567  59.711  -52.418 1.00 63.76  ?  349 TYR A N     1 
ATOM   2648  C  CA    . TYR A 1 349 ? -58.620  60.196  -51.562 1.00 59.27  ?  349 TYR A CA    1 
ATOM   2649  C  C     . TYR A 1 349 ? -59.901  59.527  -52.005 1.00 61.59  ?  349 TYR A C     1 
ATOM   2650  O  O     . TYR A 1 349 ? -60.539  58.807  -51.239 1.00 63.61  ?  349 TYR A O     1 
ATOM   2651  C  CB    . TYR A 1 349 ? -58.757  61.719  -51.650 1.00 52.32  ?  349 TYR A CB    1 
ATOM   2652  C  CG    . TYR A 1 349 ? -59.900  62.234  -50.806 1.00 53.79  ?  349 TYR A CG    1 
ATOM   2653  C  CD1   . TYR A 1 349 ? -59.851  62.141  -49.411 1.00 60.16  ?  349 TYR A CD1   1 
ATOM   2654  C  CD2   . TYR A 1 349 ? -61.036  62.800  -51.395 1.00 58.84  ?  349 TYR A CD2   1 
ATOM   2655  C  CE1   . TYR A 1 349 ? -60.902  62.598  -48.626 1.00 65.34  ?  349 TYR A CE1   1 
ATOM   2656  C  CE2   . TYR A 1 349 ? -62.100  63.266  -50.614 1.00 65.67  ?  349 TYR A CE2   1 
ATOM   2657  C  CZ    . TYR A 1 349 ? -62.024  63.157  -49.230 1.00 68.53  ?  349 TYR A CZ    1 
ATOM   2658  O  OH    . TYR A 1 349 ? -63.054  63.607  -48.440 1.00 67.19  ?  349 TYR A OH    1 
ATOM   2659  N  N     . ILE A 1 350 ? -60.265  59.769  -53.256 1.00 59.90  ?  350 ILE A N     1 
ATOM   2660  C  CA    . ILE A 1 350 ? -61.478  59.213  -53.819 1.00 56.94  ?  350 ILE A CA    1 
ATOM   2661  C  C     . ILE A 1 350 ? -61.601  57.699  -53.590 1.00 59.69  ?  350 ILE A C     1 
ATOM   2662  O  O     . ILE A 1 350 ? -62.685  57.200  -53.249 1.00 60.82  ?  350 ILE A O     1 
ATOM   2663  C  CB    . ILE A 1 350 ? -61.579  59.540  -55.313 1.00 53.24  ?  350 ILE A CB    1 
ATOM   2664  C  CG1   . ILE A 1 350 ? -61.883  61.042  -55.490 1.00 48.10  ?  350 ILE A CG1   1 
ATOM   2665  C  CG2   . ILE A 1 350 ? -62.606  58.601  -55.998 1.00 48.57  ?  350 ILE A CG2   1 
ATOM   2666  C  CD1   . ILE A 1 350 ? -62.143  61.484  -56.947 1.00 52.72  ?  350 ILE A CD1   1 
ATOM   2667  N  N     . ALA A 1 351 ? -60.495  56.977  -53.758 1.00 55.53  ?  351 ALA A N     1 
ATOM   2668  C  CA    . ALA A 1 351 ? -60.496  55.523  -53.578 1.00 56.60  ?  351 ALA A CA    1 
ATOM   2669  C  C     . ALA A 1 351 ? -60.852  55.164  -52.161 1.00 65.57  ?  351 ALA A C     1 
ATOM   2670  O  O     . ALA A 1 351 ? -61.552  54.180  -51.921 1.00 73.94  ?  351 ALA A O     1 
ATOM   2671  C  CB    . ALA A 1 351 ? -59.150  54.946  -53.902 1.00 56.82  ?  351 ALA A CB    1 
ATOM   2672  N  N     . HIS A 1 352 ? -60.318  55.970  -51.243 1.00 65.39  ?  352 HIS A N     1 
ATOM   2673  C  CA    . HIS A 1 352 ? -60.533  55.859  -49.808 1.00 63.03  ?  352 HIS A CA    1 
ATOM   2674  C  C     . HIS A 1 352 ? -61.986  56.106  -49.449 1.00 62.78  ?  352 HIS A C     1 
ATOM   2675  O  O     . HIS A 1 352 ? -62.638  55.244  -48.870 1.00 74.83  ?  352 HIS A O     1 
ATOM   2676  C  CB    . HIS A 1 352 ? -59.658  56.884  -49.088 1.00 64.87  ?  352 HIS A CB    1 
ATOM   2677  C  CG    . HIS A 1 352 ? -59.788  56.845  -47.605 1.00 66.28  ?  352 HIS A CG    1 
ATOM   2678  N  ND1   . HIS A 1 352 ? -59.292  55.807  -46.843 1.00 67.92  ?  352 HIS A ND1   1 
ATOM   2679  C  CD2   . HIS A 1 352 ? -60.368  57.705  -46.734 1.00 68.46  ?  352 HIS A CD2   1 
ATOM   2680  C  CE1   . HIS A 1 352 ? -59.562  56.029  -45.571 1.00 71.56  ?  352 HIS A CE1   1 
ATOM   2681  N  NE2   . HIS A 1 352 ? -60.219  57.178  -45.477 1.00 70.91  ?  352 HIS A NE2   1 
ATOM   2682  N  N     . ARG A 1 353 ? -62.493  57.292  -49.781 1.00 55.78  ?  353 ARG A N     1 
ATOM   2683  C  CA    . ARG A 1 353 ? -63.912  57.577  -49.584 1.00 60.45  ?  353 ARG A CA    1 
ATOM   2684  C  C     . ARG A 1 353 ? -64.818  56.477  -50.131 1.00 72.64  ?  353 ARG A C     1 
ATOM   2685  O  O     . ARG A 1 353 ? -65.907  56.248  -49.603 1.00 80.18  ?  353 ARG A O     1 
ATOM   2686  C  CB    . ARG A 1 353 ? -64.299  58.910  -50.206 1.00 59.37  ?  353 ARG A CB    1 
ATOM   2687  C  CG    . ARG A 1 353 ? -63.764  60.095  -49.460 1.00 61.03  ?  353 ARG A CG    1 
ATOM   2688  C  CD    . ARG A 1 353 ? -64.240  60.065  -48.039 1.00 65.31  ?  353 ARG A CD    1 
ATOM   2689  N  NE    . ARG A 1 353 ? -65.685  60.228  -47.932 1.00 71.38  ?  353 ARG A NE    1 
ATOM   2690  C  CZ    . ARG A 1 353 ? -66.363  60.043  -46.803 1.00 82.69  ?  353 ARG A CZ    1 
ATOM   2691  N  NH1   . ARG A 1 353 ? -65.724  59.661  -45.695 1.00 80.17  ?  353 ARG A NH1   1 
ATOM   2692  N  NH2   . ARG A 1 353 ? -67.681  60.217  -46.786 1.00 91.12  ?  353 ARG A NH2   1 
ATOM   2693  N  N     . ARG A 1 354 ? -64.384  55.806  -51.192 1.00 71.03  ?  354 ARG A N     1 
ATOM   2694  C  CA    . ARG A 1 354 ? -65.160  54.696  -51.721 1.00 71.55  ?  354 ARG A CA    1 
ATOM   2695  C  C     . ARG A 1 354 ? -65.121  53.543  -50.722 1.00 72.44  ?  354 ARG A C     1 
ATOM   2696  O  O     . ARG A 1 354 ? -66.156  53.018  -50.326 1.00 74.09  ?  354 ARG A O     1 
ATOM   2697  C  CB    . ARG A 1 354 ? -64.626  54.250  -53.085 1.00 74.79  ?  354 ARG A CB    1 
ATOM   2698  C  CG    . ARG A 1 354 ? -65.345  53.043  -53.680 1.00 78.53  ?  354 ARG A CG    1 
ATOM   2699  C  CD    . ARG A 1 354 ? -64.574  52.425  -54.844 1.00 81.37  ?  354 ARG A CD    1 
ATOM   2700  N  NE    . ARG A 1 354 ? -65.160  51.151  -55.263 1.00 84.53  ?  354 ARG A NE    1 
ATOM   2701  C  CZ    . ARG A 1 354 ? -64.711  49.960  -54.865 1.00 86.43  ?  354 ARG A CZ    1 
ATOM   2702  N  NH1   . ARG A 1 354 ? -63.661  49.894  -54.053 1.00 93.99  ?  354 ARG A NH1   1 
ATOM   2703  N  NH2   . ARG A 1 354 ? -65.302  48.837  -55.273 1.00 76.94  ?  354 ARG A NH2   1 
ATOM   2704  N  N     . GLU A 1 355 ? -63.920  53.155  -50.313 1.00 72.11  ?  355 GLU A N     1 
ATOM   2705  C  CA    . GLU A 1 355 ? -63.749  52.096  -49.317 1.00 65.99  ?  355 GLU A CA    1 
ATOM   2706  C  C     . GLU A 1 355 ? -64.629  52.334  -48.096 1.00 65.86  ?  355 GLU A C     1 
ATOM   2707  O  O     . GLU A 1 355 ? -65.335  51.431  -47.646 1.00 72.33  ?  355 GLU A O     1 
ATOM   2708  C  CB    . GLU A 1 355 ? -62.285  51.992  -48.884 1.00 63.87  ?  355 GLU A CB    1 
ATOM   2709  C  CG    . GLU A 1 355 ? -61.487  51.023  -49.699 1.00 75.24  ?  355 GLU A CG    1 
ATOM   2710  C  CD    . GLU A 1 355 ? -62.195  49.703  -49.837 1.00 85.09  ?  355 GLU A CD    1 
ATOM   2711  O  OE1   . GLU A 1 355 ? -61.794  48.910  -50.720 1.00 83.69  ?  355 GLU A OE1   1 
ATOM   2712  O  OE2   . GLU A 1 355 ? -63.153  49.463  -49.055 1.00 92.46  ?  355 GLU A OE2   1 
ATOM   2713  N  N     . VAL A 1 356 ? -64.572  53.558  -47.579 1.00 56.47  ?  356 VAL A N     1 
ATOM   2714  C  CA    . VAL A 1 356 ? -65.371  53.977  -46.442 1.00 56.08  ?  356 VAL A CA    1 
ATOM   2715  C  C     . VAL A 1 356 ? -66.866  53.825  -46.718 1.00 59.69  ?  356 VAL A C     1 
ATOM   2716  O  O     . VAL A 1 356 ? -67.553  53.057  -46.045 1.00 68.04  ?  356 VAL A O     1 
ATOM   2717  C  CB    . VAL A 1 356 ? -65.036  55.431  -46.049 1.00 51.45  ?  356 VAL A CB    1 
ATOM   2718  C  CG1   . VAL A 1 356 ? -66.025  55.967  -45.016 1.00 45.19  ?  356 VAL A CG1   1 
ATOM   2719  C  CG2   . VAL A 1 356 ? -63.622  55.501  -45.512 1.00 55.12  ?  356 VAL A CG2   1 
ATOM   2720  N  N     . ILE A 1 357 ? -67.366  54.549  -47.710 1.00 52.02  ?  357 ILE A N     1 
ATOM   2721  C  CA    . ILE A 1 357 ? -68.784  54.474  -48.055 1.00 52.76  ?  357 ILE A CA    1 
ATOM   2722  C  C     . ILE A 1 357 ? -69.282  53.029  -48.284 1.00 55.49  ?  357 ILE A C     1 
ATOM   2723  O  O     . ILE A 1 357 ? -70.390  52.656  -47.857 1.00 54.18  ?  357 ILE A O     1 
ATOM   2724  C  CB    . ILE A 1 357 ? -69.099  55.350  -49.274 1.00 50.53  ?  357 ILE A CB    1 
ATOM   2725  C  CG1   . ILE A 1 357 ? -68.968  56.823  -48.900 1.00 53.94  ?  357 ILE A CG1   1 
ATOM   2726  C  CG2   . ILE A 1 357 ? -70.495  55.068  -49.794 1.00 46.01  ?  357 ILE A CG2   1 
ATOM   2727  C  CD1   . ILE A 1 357 ? -69.219  57.754  -50.065 1.00 65.56  ?  357 ILE A CD1   1 
ATOM   2728  N  N     . LEU A 1 358 ? -68.471  52.208  -48.942 1.00 51.78  ?  358 LEU A N     1 
ATOM   2729  C  CA    . LEU A 1 358 ? -68.825  50.802  -49.047 1.00 56.20  ?  358 LEU A CA    1 
ATOM   2730  C  C     . LEU A 1 358 ? -68.895  50.151  -47.660 1.00 67.74  ?  358 LEU A C     1 
ATOM   2731  O  O     . LEU A 1 358 ? -69.905  49.543  -47.300 1.00 71.10  ?  358 LEU A O     1 
ATOM   2732  C  CB    . LEU A 1 358 ? -67.849  50.057  -49.953 1.00 59.05  ?  358 LEU A CB    1 
ATOM   2733  C  CG    . LEU A 1 358 ? -68.056  50.365  -51.436 1.00 58.95  ?  358 LEU A CG    1 
ATOM   2734  C  CD1   . LEU A 1 358 ? -67.078  49.600  -52.316 1.00 54.56  ?  358 LEU A CD1   1 
ATOM   2735  C  CD2   . LEU A 1 358 ? -69.486  50.048  -51.815 1.00 63.14  ?  358 LEU A CD2   1 
ATOM   2736  N  N     . ALA A 1 359 ? -67.822  50.295  -46.886 1.00 70.37  ?  359 ALA A N     1 
ATOM   2737  C  CA    . ALA A 1 359 ? -67.745  49.716  -45.548 1.00 67.84  ?  359 ALA A CA    1 
ATOM   2738  C  C     . ALA A 1 359 ? -68.918  50.149  -44.670 1.00 68.97  ?  359 ALA A C     1 
ATOM   2739  O  O     . ALA A 1 359 ? -69.464  49.367  -43.877 1.00 75.94  ?  359 ALA A O     1 
ATOM   2740  C  CB    . ALA A 1 359 ? -66.453  50.132  -44.887 1.00 67.73  ?  359 ALA A CB    1 
ATOM   2741  N  N     . ARG A 1 360 ? -69.269  51.419  -44.798 1.00 62.86  ?  360 ARG A N     1 
ATOM   2742  C  CA    . ARG A 1 360 ? -70.231  52.032  -43.923 1.00 60.20  ?  360 ARG A CA    1 
ATOM   2743  C  C     . ARG A 1 360 ? -71.598  51.491  -44.274 1.00 64.71  ?  360 ARG A C     1 
ATOM   2744  O  O     . ARG A 1 360 ? -72.421  51.223  -43.407 1.00 66.82  ?  360 ARG A O     1 
ATOM   2745  C  CB    . ARG A 1 360 ? -70.185  53.548  -44.112 1.00 57.54  ?  360 ARG A CB    1 
ATOM   2746  C  CG    . ARG A 1 360 ? -71.009  54.318  -43.112 1.00 64.61  ?  360 ARG A CG    1 
ATOM   2747  C  CD    . ARG A 1 360 ? -72.065  55.106  -43.816 1.00 67.11  ?  360 ARG A CD    1 
ATOM   2748  N  NE    . ARG A 1 360 ? -71.550  56.346  -44.389 1.00 63.42  ?  360 ARG A NE    1 
ATOM   2749  C  CZ    . ARG A 1 360 ? -71.940  56.831  -45.563 1.00 67.51  ?  360 ARG A CZ    1 
ATOM   2750  N  NH1   . ARG A 1 360 ? -72.827  56.160  -46.294 1.00 75.81  ?  360 ARG A NH1   1 
ATOM   2751  N  NH2   . ARG A 1 360 ? -71.432  57.972  -46.015 1.00 65.59  ?  360 ARG A NH2   1 
ATOM   2752  N  N     . SER A 1 361 ? -71.837  51.326  -45.565 1.00 69.56  ?  361 SER A N     1 
ATOM   2753  C  CA    . SER A 1 361 ? -73.125  50.843  -46.026 1.00 71.36  ?  361 SER A CA    1 
ATOM   2754  C  C     . SER A 1 361 ? -73.320  49.358  -45.701 1.00 67.51  ?  361 SER A C     1 
ATOM   2755  O  O     . SER A 1 361 ? -74.444  48.925  -45.459 1.00 68.08  ?  361 SER A O     1 
ATOM   2756  C  CB    . SER A 1 361 ? -73.295  51.134  -47.522 1.00 72.73  ?  361 SER A CB    1 
ATOM   2757  O  OG    . SER A 1 361 ? -73.302  52.535  -47.759 1.00 72.38  ?  361 SER A OG    1 
ATOM   2758  N  N     . ARG A 1 362 ? -72.232  48.584  -45.694 1.00 64.07  ?  362 ARG A N     1 
ATOM   2759  C  CA    . ARG A 1 362 ? -72.311  47.170  -45.316 1.00 67.38  ?  362 ARG A CA    1 
ATOM   2760  C  C     . ARG A 1 362 ? -72.713  47.068  -43.861 1.00 70.18  ?  362 ARG A C     1 
ATOM   2761  O  O     . ARG A 1 362 ? -73.521  46.230  -43.478 1.00 72.01  ?  362 ARG A O     1 
ATOM   2762  C  CB    . ARG A 1 362 ? -70.982  46.435  -45.525 1.00 50.87  ?  362 ARG A CB    1 
ATOM   2763  C  CG    . ARG A 1 362 ? -70.529  46.345  -46.959 1.00 56.58  ?  362 ARG A CG    1 
ATOM   2764  C  CD    . ARG A 1 362 ? -69.324  45.420  -47.113 1.00 67.46  ?  362 ARG A CD    1 
ATOM   2765  N  NE    . ARG A 1 362 ? -68.468  45.838  -48.229 1.00 82.47  ?  362 ARG A NE    1 
ATOM   2766  C  CZ    . ARG A 1 362 ? -67.372  46.587  -48.090 1.00 94.54  ?  362 ARG A CZ    1 
ATOM   2767  N  NH1   . ARG A 1 362 ? -66.983  46.991  -46.877 1.00 93.44  ?  362 ARG A NH1   1 
ATOM   2768  N  NH2   . ARG A 1 362 ? -66.656  46.927  -49.161 1.00 97.67  ?  362 ARG A NH2   1 
ATOM   2769  N  N     . PHE A 1 363 ? -72.127  47.942  -43.057 1.00 71.80  ?  363 PHE A N     1 
ATOM   2770  C  CA    . PHE A 1 363 ? -72.389  48.003  -41.632 1.00 64.32  ?  363 PHE A CA    1 
ATOM   2771  C  C     . PHE A 1 363 ? -73.852  48.323  -41.357 1.00 59.35  ?  363 PHE A C     1 
ATOM   2772  O  O     . PHE A 1 363 ? -74.556  47.544  -40.724 1.00 65.59  ?  363 PHE A O     1 
ATOM   2773  C  CB    . PHE A 1 363 ? -71.498  49.065  -41.008 1.00 60.61  ?  363 PHE A CB    1 
ATOM   2774  C  CG    . PHE A 1 363 ? -71.648  49.183  -39.538 1.00 67.41  ?  363 PHE A CG    1 
ATOM   2775  C  CD1   . PHE A 1 363 ? -70.849  48.429  -38.690 1.00 64.02  ?  363 PHE A CD1   1 
ATOM   2776  C  CD2   . PHE A 1 363 ? -72.588  50.055  -38.996 1.00 71.31  ?  363 PHE A CD2   1 
ATOM   2777  C  CE1   . PHE A 1 363 ? -70.977  48.543  -37.333 1.00 60.55  ?  363 PHE A CE1   1 
ATOM   2778  C  CE2   . PHE A 1 363 ? -72.734  50.169  -37.635 1.00 66.19  ?  363 PHE A CE2   1 
ATOM   2779  C  CZ    . PHE A 1 363 ? -71.931  49.408  -36.797 1.00 62.22  ?  363 PHE A CZ    1 
ATOM   2780  N  N     . ASP A 1 364 ? -74.307  49.473  -41.835 1.00 54.52  ?  364 ASP A N     1 
ATOM   2781  C  CA    . ASP A 1 364 ? -75.680  49.884  -41.616 1.00 58.49  ?  364 ASP A CA    1 
ATOM   2782  C  C     . ASP A 1 364 ? -76.643  48.828  -42.133 1.00 63.92  ?  364 ASP A C     1 
ATOM   2783  O  O     . ASP A 1 364 ? -77.716  48.611  -41.567 1.00 69.87  ?  364 ASP A O     1 
ATOM   2784  C  CB    . ASP A 1 364 ? -75.954  51.198  -42.335 1.00 67.64  ?  364 ASP A CB    1 
ATOM   2785  C  CG    . ASP A 1 364 ? -75.481  52.409  -41.559 1.00 75.18  ?  364 ASP A CG    1 
ATOM   2786  O  OD1   . ASP A 1 364 ? -75.044  52.253  -40.395 1.00 81.43  ?  364 ASP A OD1   1 
ATOM   2787  O  OD2   . ASP A 1 364 ? -75.579  53.524  -42.125 1.00 74.42  ?  364 ASP A OD2   1 
ATOM   2788  N  N     . LYS A 1 365 ? -76.258  48.188  -43.229 1.00 62.47  ?  365 LYS A N     1 
ATOM   2789  C  CA    . LYS A 1 365 ? -77.088  47.172  -43.846 1.00 62.16  ?  365 LYS A CA    1 
ATOM   2790  C  C     . LYS A 1 365 ? -77.130  45.972  -42.913 1.00 59.64  ?  365 LYS A C     1 
ATOM   2791  O  O     . LYS A 1 365 ? -78.197  45.466  -42.588 1.00 66.27  ?  365 LYS A O     1 
ATOM   2792  C  CB    . LYS A 1 365 ? -76.549  46.779  -45.235 1.00 68.15  ?  365 LYS A CB    1 
ATOM   2793  C  CG    . LYS A 1 365 ? -77.595  46.120  -46.153 1.00 64.71  ?  365 LYS A CG    1 
ATOM   2794  C  CD    . LYS A 1 365 ? -76.986  45.435  -47.379 1.00 56.59  ?  365 LYS A CD    1 
ATOM   2795  C  CE    . LYS A 1 365 ? -75.987  44.367  -46.985 1.00 59.19  ?  365 LYS A CE    1 
ATOM   2796  N  NZ    . LYS A 1 365 ? -75.819  43.323  -48.056 1.00 70.82  ?  365 LYS A NZ    1 
ATOM   2797  N  N     . GLU A 1 366 ? -75.971  45.525  -42.453 1.00 60.36  ?  366 GLU A N     1 
ATOM   2798  C  CA    . GLU A 1 366 ? -75.964  44.356  -41.578 1.00 69.28  ?  366 GLU A CA    1 
ATOM   2799  C  C     . GLU A 1 366 ? -76.846  44.590  -40.344 1.00 68.07  ?  366 GLU A C     1 
ATOM   2800  O  O     . GLU A 1 366 ? -77.548  43.686  -39.908 1.00 63.61  ?  366 GLU A O     1 
ATOM   2801  C  CB    . GLU A 1 366 ? -74.546  43.906  -41.193 1.00 70.64  ?  366 GLU A CB    1 
ATOM   2802  C  CG    . GLU A 1 366 ? -74.544  42.645  -40.343 1.00 87.31  ?  366 GLU A CG    1 
ATOM   2803  C  CD    . GLU A 1 366 ? -73.149  42.234  -39.906 1.00 111.62 ?  366 GLU A CD    1 
ATOM   2804  O  OE1   . GLU A 1 366 ? -72.997  41.787  -38.743 1.00 117.98 ?  366 GLU A OE1   1 
ATOM   2805  O  OE2   . GLU A 1 366 ? -72.205  42.357  -40.724 1.00 120.72 ?  366 GLU A OE2   1 
ATOM   2806  N  N     . LYS A 1 367 ? -76.812  45.811  -39.809 1.00 67.36  ?  367 LYS A N     1 
ATOM   2807  C  CA    . LYS A 1 367 ? -77.667  46.207  -38.695 1.00 63.40  ?  367 LYS A CA    1 
ATOM   2808  C  C     . LYS A 1 367 ? -79.133  46.125  -39.076 1.00 64.91  ?  367 LYS A C     1 
ATOM   2809  O  O     . LYS A 1 367 ? -79.925  45.481  -38.392 1.00 70.95  ?  367 LYS A O     1 
ATOM   2810  C  CB    . LYS A 1 367 ? -77.355  47.630  -38.243 1.00 66.94  ?  367 LYS A CB    1 
ATOM   2811  C  CG    . LYS A 1 367 ? -76.777  47.734  -36.831 1.00 86.67  ?  367 LYS A CG    1 
ATOM   2812  C  CD    . LYS A 1 367 ? -76.943  49.156  -36.277 1.00 98.65  ?  367 LYS A CD    1 
ATOM   2813  C  CE    . LYS A 1 367 ? -78.360  49.679  -36.536 1.00 106.10 ?  367 LYS A CE    1 
ATOM   2814  N  NZ    . LYS A 1 367 ? -78.885  50.527  -35.420 1.00 108.84 ?  367 LYS A NZ    1 
ATOM   2815  N  N     . ALA A 1 368 ? -79.505  46.775  -40.170 1.00 63.86  ?  368 ALA A N     1 
ATOM   2816  C  CA    . ALA A 1 368 ? -80.903  46.769  -40.571 1.00 67.92  ?  368 ALA A CA    1 
ATOM   2817  C  C     . ALA A 1 368 ? -81.393  45.339  -40.727 1.00 77.55  ?  368 ALA A C     1 
ATOM   2818  O  O     . ALA A 1 368 ? -82.500  45.006  -40.301 1.00 85.83  ?  368 ALA A O     1 
ATOM   2819  C  CB    . ALA A 1 368 ? -81.108  47.541  -41.848 1.00 64.36  ?  368 ALA A CB    1 
ATOM   2820  N  N     . GLU A 1 369 ? -80.559  44.489  -41.317 1.00 73.77  ?  369 GLU A N     1 
ATOM   2821  C  CA    . GLU A 1 369 ? -80.967  43.119  -41.566 1.00 69.42  ?  369 GLU A CA    1 
ATOM   2822  C  C     . GLU A 1 369 ? -81.222  42.365  -40.258 1.00 74.43  ?  369 GLU A C     1 
ATOM   2823  O  O     . GLU A 1 369 ? -82.287  41.756  -40.084 1.00 74.58  ?  369 GLU A O     1 
ATOM   2824  C  CB    . GLU A 1 369 ? -79.936  42.396  -42.420 1.00 73.39  ?  369 GLU A CB    1 
ATOM   2825  C  CG    . GLU A 1 369 ? -80.347  40.977  -42.776 1.00 92.02  ?  369 GLU A CG    1 
ATOM   2826  C  CD    . GLU A 1 369 ? -79.344  40.297  -43.689 1.00 110.61 ?  369 GLU A CD    1 
ATOM   2827  O  OE1   . GLU A 1 369 ? -78.882  40.949  -44.658 1.00 115.48 ?  369 GLU A OE1   1 
ATOM   2828  O  OE2   . GLU A 1 369 ? -79.019  39.113  -43.431 1.00 116.61 ?  369 GLU A OE2   1 
ATOM   2829  N  N     . LYS A 1 370 ? -80.253  42.434  -39.339 1.00 72.60  ?  370 LYS A N     1 
ATOM   2830  C  CA    . LYS A 1 370 ? -80.323  41.703  -38.070 1.00 64.61  ?  370 LYS A CA    1 
ATOM   2831  C  C     . LYS A 1 370 ? -81.648  42.017  -37.385 1.00 58.09  ?  370 LYS A C     1 
ATOM   2832  O  O     . LYS A 1 370 ? -82.328  41.126  -36.843 1.00 59.76  ?  370 LYS A O     1 
ATOM   2833  C  CB    . LYS A 1 370 ? -79.080  41.948  -37.190 1.00 47.44  ?  370 LYS A CB    1 
ATOM   2834  C  CG    . LYS A 1 370 ? -78.004  40.870  -37.416 1.00 69.18  ?  370 LYS A CG    1 
ATOM   2835  C  CD    . LYS A 1 370 ? -76.681  41.123  -36.698 1.00 56.90  ?  370 LYS A CD    1 
ATOM   2836  N  N     . ARG A 1 371 ? -82.061  43.274  -37.471 1.00 51.38  ?  371 ARG A N     1 
ATOM   2837  C  CA    . ARG A 1 371 ? -83.350  43.631  -36.903 1.00 56.68  ?  371 ARG A CA    1 
ATOM   2838  C  C     . ARG A 1 371 ? -84.529  43.124  -37.716 1.00 61.20  ?  371 ARG A C     1 
ATOM   2839  O  O     . ARG A 1 371 ? -85.432  42.493  -37.156 1.00 61.37  ?  371 ARG A O     1 
ATOM   2840  C  CB    . ARG A 1 371 ? -83.493  45.132  -36.705 1.00 53.60  ?  371 ARG A CB    1 
ATOM   2841  C  CG    . ARG A 1 371 ? -84.916  45.507  -36.407 1.00 41.80  ?  371 ARG A CG    1 
ATOM   2842  C  CD    . ARG A 1 371 ? -84.971  46.444  -35.245 1.00 76.21  ?  371 ARG A CD    1 
ATOM   2843  N  NE    . ARG A 1 371 ? -86.288  46.391  -34.622 1.00 73.63  ?  371 ARG A NE    1 
ATOM   2844  C  CZ    . ARG A 1 371 ? -86.602  45.577  -33.623 1.00 65.54  ?  371 ARG A CZ    1 
ATOM   2845  N  NH1   . ARG A 1 371 ? -85.686  44.758  -33.116 1.00 59.53  ?  371 ARG A NH1   1 
ATOM   2846  N  NH2   . ARG A 1 371 ? -87.828  45.592  -33.133 1.00 65.03  ?  371 ARG A NH2   1 
ATOM   2847  N  N     . LEU A 1 372 ? -84.531  43.428  -39.019 1.00 58.12  ?  372 LEU A N     1 
ATOM   2848  C  CA    . LEU A 1 372 ? -85.631  43.043  -39.902 1.00 55.71  ?  372 LEU A CA    1 
ATOM   2849  C  C     . LEU A 1 372 ? -85.886  41.556  -39.687 1.00 56.58  ?  372 LEU A C     1 
ATOM   2850  O  O     . LEU A 1 372 ? -87.032  41.101  -39.696 1.00 52.42  ?  372 LEU A O     1 
ATOM   2851  C  CB    . LEU A 1 372 ? -85.295  43.374  -41.360 1.00 57.41  ?  372 LEU A CB    1 
ATOM   2852  C  CG    . LEU A 1 372 ? -86.148  43.037  -42.604 1.00 53.11  ?  372 LEU A CG    1 
ATOM   2853  C  CD1   . LEU A 1 372 ? -85.813  41.668  -43.059 1.00 51.36  ?  372 LEU A CD1   1 
ATOM   2854  C  CD2   . LEU A 1 372 ? -87.663  43.167  -42.412 1.00 50.87  ?  372 LEU A CD2   1 
ATOM   2855  N  N     . HIS A 1 373 ? -84.810  40.814  -39.427 1.00 58.32  ?  373 HIS A N     1 
ATOM   2856  C  CA    . HIS A 1 373 ? -84.914  39.387  -39.125 1.00 58.58  ?  373 HIS A CA    1 
ATOM   2857  C  C     . HIS A 1 373 ? -85.696  39.185  -37.831 1.00 58.89  ?  373 HIS A C     1 
ATOM   2858  O  O     . HIS A 1 373 ? -86.684  38.433  -37.823 1.00 54.98  ?  373 HIS A O     1 
ATOM   2859  C  CB    . HIS A 1 373 ? -83.519  38.768  -39.023 1.00 66.02  ?  373 HIS A CB    1 
ATOM   2860  C  CG    . HIS A 1 373 ? -83.509  37.274  -38.929 1.00 69.81  ?  373 HIS A CG    1 
ATOM   2861  N  ND1   . HIS A 1 373 ? -84.455  36.483  -39.539 1.00 76.56  ?  373 HIS A ND1   1 
ATOM   2862  C  CD2   . HIS A 1 373 ? -82.649  36.427  -38.315 1.00 72.22  ?  373 HIS A CD2   1 
ATOM   2863  C  CE1   . HIS A 1 373 ? -84.191  35.211  -39.283 1.00 80.36  ?  373 HIS A CE1   1 
ATOM   2864  N  NE2   . HIS A 1 373 ? -83.099  35.149  -38.544 1.00 74.71  ?  373 HIS A NE2   1 
ATOM   2865  N  N     . ILE A 1 374 ? -85.263  39.862  -36.753 1.00 61.50  ?  374 ILE A N     1 
ATOM   2866  C  CA    . ILE A 1 374 ? -85.973  39.827  -35.469 1.00 59.12  ?  374 ILE A CA    1 
ATOM   2867  C  C     . ILE A 1 374 ? -87.444  40.140  -35.671 1.00 60.70  ?  374 ILE A C     1 
ATOM   2868  O  O     . ILE A 1 374 ? -88.318  39.387  -35.227 1.00 67.01  ?  374 ILE A O     1 
ATOM   2869  C  CB    . ILE A 1 374 ? -85.477  40.899  -34.467 1.00 58.09  ?  374 ILE A CB    1 
ATOM   2870  C  CG1   . ILE A 1 374 ? -84.126  40.536  -33.849 1.00 44.46  ?  374 ILE A CG1   1 
ATOM   2871  C  CG2   . ILE A 1 374 ? -86.533  41.126  -33.370 1.00 54.75  ?  374 ILE A CG2   1 
ATOM   2872  C  CD1   . ILE A 1 374 ? -84.018  39.107  -33.547 1.00 61.51  ?  374 ILE A CD1   1 
ATOM   2873  N  N     . VAL A 1 375 ? -87.705  41.272  -36.323 1.00 56.13  ?  375 VAL A N     1 
ATOM   2874  C  CA    . VAL A 1 375 ? -89.066  41.748  -36.512 1.00 57.13  ?  375 VAL A CA    1 
ATOM   2875  C  C     . VAL A 1 375 ? -89.935  40.718  -37.204 1.00 63.04  ?  375 VAL A C     1 
ATOM   2876  O  O     . VAL A 1 375 ? -91.085  40.535  -36.828 1.00 67.53  ?  375 VAL A O     1 
ATOM   2877  C  CB    . VAL A 1 375 ? -89.121  43.057  -37.304 1.00 53.28  ?  375 VAL A CB    1 
ATOM   2878  C  CG1   . VAL A 1 375 ? -90.568  43.460  -37.541 1.00 54.36  ?  375 VAL A CG1   1 
ATOM   2879  C  CG2   . VAL A 1 375 ? -88.349  44.173  -36.566 1.00 46.50  ?  375 VAL A CG2   1 
ATOM   2880  N  N     . GLU A 1 376 ? -89.394  40.040  -38.212 1.00 67.30  ?  376 GLU A N     1 
ATOM   2881  C  CA    . GLU A 1 376 ? -90.127  38.937  -38.831 1.00 71.26  ?  376 GLU A CA    1 
ATOM   2882  C  C     . GLU A 1 376 ? -90.568  37.919  -37.774 1.00 69.87  ?  376 GLU A C     1 
ATOM   2883  O  O     . GLU A 1 376 ? -91.762  37.660  -37.619 1.00 69.52  ?  376 GLU A O     1 
ATOM   2884  C  CB    . GLU A 1 376 ? -89.295  38.258  -39.916 1.00 78.62  ?  376 GLU A CB    1 
ATOM   2885  C  CG    . GLU A 1 376 ? -89.203  39.030  -41.225 1.00 86.78  ?  376 GLU A CG    1 
ATOM   2886  C  CD    . GLU A 1 376 ? -88.093  38.512  -42.121 1.00 96.35  ?  376 GLU A CD    1 
ATOM   2887  O  OE1   . GLU A 1 376 ? -87.388  37.543  -41.731 1.00 92.76  ?  376 GLU A OE1   1 
ATOM   2888  O  OE2   . GLU A 1 376 ? -87.929  39.083  -43.219 1.00 105.83 ?  376 GLU A OE2   1 
ATOM   2889  N  N     . GLY A 1 377 ? -89.610  37.343  -37.050 1.00 70.92  ?  377 GLY A N     1 
ATOM   2890  C  CA    . GLY A 1 377 ? -89.929  36.485  -35.917 1.00 75.15  ?  377 GLY A CA    1 
ATOM   2891  C  C     . GLY A 1 377 ? -91.063  36.977  -35.006 1.00 74.12  ?  377 GLY A C     1 
ATOM   2892  O  O     . GLY A 1 377 ? -92.026  36.241  -34.743 1.00 73.16  ?  377 GLY A O     1 
ATOM   2893  N  N     . LEU A 1 378 ? -90.954  38.215  -34.519 1.00 67.13  ?  378 LEU A N     1 
ATOM   2894  C  CA    . LEU A 1 378 ? -91.987  38.792  -33.658 1.00 57.88  ?  378 LEU A CA    1 
ATOM   2895  C  C     . LEU A 1 378 ? -93.361  38.778  -34.318 1.00 63.50  ?  378 LEU A C     1 
ATOM   2896  O  O     . LEU A 1 378 ? -94.344  38.354  -33.716 1.00 71.34  ?  378 LEU A O     1 
ATOM   2897  C  CB    . LEU A 1 378 ? -91.626  40.215  -33.201 1.00 50.05  ?  378 LEU A CB    1 
ATOM   2898  C  CG    . LEU A 1 378 ? -90.336  40.334  -32.370 1.00 50.41  ?  378 LEU A CG    1 
ATOM   2899  C  CD1   . LEU A 1 378 ? -90.298  41.633  -31.653 1.00 52.87  ?  378 LEU A CD1   1 
ATOM   2900  C  CD2   . LEU A 1 378 ? -90.195  39.216  -31.354 1.00 43.75  ?  378 LEU A CD2   1 
ATOM   2901  N  N     . ILE A 1 379 ? -93.430  39.231  -35.559 1.00 58.14  ?  379 ILE A N     1 
ATOM   2902  C  CA    . ILE A 1 379 ? -94.703  39.263  -36.265 1.00 55.11  ?  379 ILE A CA    1 
ATOM   2903  C  C     . ILE A 1 379 ? -95.341  37.875  -36.261 1.00 57.95  ?  379 ILE A C     1 
ATOM   2904  O  O     . ILE A 1 379 ? -96.560  37.748  -36.155 1.00 66.50  ?  379 ILE A O     1 
ATOM   2905  C  CB    . ILE A 1 379 ? -94.548  39.797  -37.709 1.00 55.37  ?  379 ILE A CB    1 
ATOM   2906  C  CG1   . ILE A 1 379 ? -93.881  41.170  -37.696 1.00 57.84  ?  379 ILE A CG1   1 
ATOM   2907  C  CG2   . ILE A 1 379 ? -95.889  39.910  -38.391 1.00 50.23  ?  379 ILE A CG2   1 
ATOM   2908  C  CD1   . ILE A 1 379 ? -93.743  41.769  -39.075 1.00 66.27  ?  379 ILE A CD1   1 
ATOM   2909  N  N     . ARG A 1 380 ? -94.511  36.840  -36.360 1.00 57.40  ?  380 ARG A N     1 
ATOM   2910  C  CA    . ARG A 1 380 ? -94.989  35.463  -36.247 1.00 64.70  ?  380 ARG A CA    1 
ATOM   2911  C  C     . ARG A 1 380 ? -95.470  35.144  -34.843 1.00 76.97  ?  380 ARG A C     1 
ATOM   2912  O  O     . ARG A 1 380 ? -96.606  34.717  -34.640 1.00 81.62  ?  380 ARG A O     1 
ATOM   2913  C  CB    . ARG A 1 380 ? -93.881  34.479  -36.587 1.00 59.64  ?  380 ARG A CB    1 
ATOM   2914  C  CG    . ARG A 1 380 ? -93.892  34.034  -38.009 1.00 68.95  ?  380 ARG A CG    1 
ATOM   2915  C  CD    . ARG A 1 380 ? -93.828  32.537  -38.080 1.00 76.98  ?  380 ARG A CD    1 
ATOM   2916  N  NE    . ARG A 1 380 ? -92.471  32.054  -37.882 1.00 78.98  ?  380 ARG A NE    1 
ATOM   2917  C  CZ    . ARG A 1 380 ? -92.191  30.797  -37.572 1.00 83.05  ?  380 ARG A CZ    1 
ATOM   2918  N  NH1   . ARG A 1 380 ? -93.191  29.913  -37.424 1.00 79.17  ?  380 ARG A NH1   1 
ATOM   2919  N  NH2   . ARG A 1 380 ? -90.923  30.434  -37.404 1.00 87.62  ?  380 ARG A NH2   1 
ATOM   2920  N  N     . VAL A 1 381 ? -94.582  35.325  -33.874 1.00 78.59  ?  381 VAL A N     1 
ATOM   2921  C  CA    . VAL A 1 381 ? -94.898  35.008  -32.495 1.00 78.22  ?  381 VAL A CA    1 
ATOM   2922  C  C     . VAL A 1 381 ? -96.332  35.419  -32.132 1.00 76.94  ?  381 VAL A C     1 
ATOM   2923  O  O     . VAL A 1 381 ? -97.035  34.668  -31.453 1.00 82.21  ?  381 VAL A O     1 
ATOM   2924  C  CB    . VAL A 1 381 ? -93.843  35.609  -31.525 1.00 64.79  ?  381 VAL A CB    1 
ATOM   2925  C  CG1   . VAL A 1 381 ? -94.450  35.962  -30.198 1.00 64.17  ?  381 VAL A CG1   1 
ATOM   2926  C  CG2   . VAL A 1 381 ? -92.711  34.632  -31.324 1.00 69.69  ?  381 VAL A CG2   1 
ATOM   2927  N  N     . ILE A 1 382 ? -96.775  36.584  -32.608 1.00 67.20  ?  382 ILE A N     1 
ATOM   2928  C  CA    . ILE A 1 382 ? -98.119  37.080  -32.297 1.00 65.65  ?  382 ILE A CA    1 
ATOM   2929  C  C     . ILE A 1 382 ? -99.227  36.187  -32.864 1.00 73.44  ?  382 ILE A C     1 
ATOM   2930  O  O     . ILE A 1 382 ? -100.282 36.013  -32.250 1.00 70.38  ?  382 ILE A O     1 
ATOM   2931  C  CB    . ILE A 1 382 ? -98.325  38.494  -32.830 1.00 61.08  ?  382 ILE A CB    1 
ATOM   2932  C  CG1   . ILE A 1 382 ? -97.180  39.392  -32.390 1.00 56.15  ?  382 ILE A CG1   1 
ATOM   2933  C  CG2   . ILE A 1 382 ? -99.618  39.065  -32.314 1.00 67.53  ?  382 ILE A CG2   1 
ATOM   2934  C  CD1   . ILE A 1 382 ? -97.312  40.798  -32.894 1.00 55.32  ?  382 ILE A CD1   1 
ATOM   2935  N  N     . SER A 1 383 ? -98.982  35.632  -34.044 1.00 85.16  ?  383 SER A N     1 
ATOM   2936  C  CA    . SER A 1 383 ? -99.911  34.698  -34.672 1.00 79.64  ?  383 SER A CA    1 
ATOM   2937  C  C     . SER A 1 383 ? -100.052 33.441  -33.830 1.00 82.60  ?  383 SER A C     1 
ATOM   2938  O  O     . SER A 1 383 ? -101.023 32.703  -33.971 1.00 88.19  ?  383 SER A O     1 
ATOM   2939  C  CB    . SER A 1 383 ? -99.415  34.304  -36.072 1.00 72.80  ?  383 SER A CB    1 
ATOM   2940  N  N     . ILE A 1 384 ? -99.065  33.191  -32.970 1.00 78.99  ?  384 ILE A N     1 
ATOM   2941  C  CA    . ILE A 1 384 ? -99.019  31.958  -32.186 1.00 71.76  ?  384 ILE A CA    1 
ATOM   2942  C  C     . ILE A 1 384 ? -98.562  32.175  -30.759 1.00 70.58  ?  384 ILE A C     1 
ATOM   2943  O  O     . ILE A 1 384 ? -97.955  31.279  -30.159 1.00 69.93  ?  384 ILE A O     1 
ATOM   2944  C  CB    . ILE A 1 384 ? -98.100  30.901  -32.820 1.00 65.43  ?  384 ILE A CB    1 
ATOM   2945  C  CG1   . ILE A 1 384 ? -96.677  31.433  -33.005 1.00 63.19  ?  384 ILE A CG1   1 
ATOM   2946  C  CG2   . ILE A 1 384 ? -98.658  30.435  -34.142 1.00 60.62  ?  384 ILE A CG2   1 
ATOM   2947  C  CD1   . ILE A 1 384 ? -95.673  30.306  -33.327 1.00 63.17  ?  384 ILE A CD1   1 
ATOM   2948  N  N     . LEU A 1 385 ? -98.862  33.362  -30.230 1.00 72.20  ?  385 LEU A N     1 
ATOM   2949  C  CA    . LEU A 1 385 ? -98.496  33.776  -28.870 1.00 61.84  ?  385 LEU A CA    1 
ATOM   2950  C  C     . LEU A 1 385 ? -98.785  32.726  -27.824 1.00 65.67  ?  385 LEU A C     1 
ATOM   2951  O  O     . LEU A 1 385 ? -97.924  32.403  -27.008 1.00 68.65  ?  385 LEU A O     1 
ATOM   2952  C  CB    . LEU A 1 385 ? -99.300  34.997  -28.478 1.00 54.55  ?  385 LEU A CB    1 
ATOM   2953  C  CG    . LEU A 1 385 ? -98.532  36.164  -27.893 1.00 53.79  ?  385 LEU A CG    1 
ATOM   2954  C  CD1   . LEU A 1 385 ? -99.358  36.764  -26.758 1.00 58.63  ?  385 LEU A CD1   1 
ATOM   2955  C  CD2   . LEU A 1 385 ? -97.138  35.738  -27.454 1.00 48.53  ?  385 LEU A CD2   1 
ATOM   2956  N  N     . ASP A 1 386 ? -100.011 32.210  -27.838 1.00 72.10  ?  386 ASP A N     1 
ATOM   2957  C  CA    . ASP A 1 386 ? -100.439 31.294  -26.791 1.00 75.58  ?  386 ASP A CA    1 
ATOM   2958  C  C     . ASP A 1 386 ? -99.572  30.049  -26.762 1.00 77.76  ?  386 ASP A C     1 
ATOM   2959  O  O     . ASP A 1 386 ? -99.140  29.612  -25.690 1.00 85.42  ?  386 ASP A O     1 
ATOM   2960  C  CB    . ASP A 1 386 ? -101.926 30.950  -26.908 1.00 78.24  ?  386 ASP A CB    1 
ATOM   2961  C  CG    . ASP A 1 386 ? -102.823 32.063  -26.388 1.00 84.34  ?  386 ASP A CG    1 
ATOM   2962  O  OD1   . ASP A 1 386 ? -102.316 32.997  -25.711 1.00 78.31  ?  386 ASP A OD1   1 
ATOM   2963  O  OD2   . ASP A 1 386 ? -104.043 31.998  -26.656 1.00 96.82  ?  386 ASP A OD2   1 
ATOM   2964  N  N     . GLU A 1 387 ? -99.297  29.502  -27.938 1.00 75.79  ?  387 GLU A N     1 
ATOM   2965  C  CA    . GLU A 1 387 ? -98.474  28.301  -28.039 1.00 78.77  ?  387 GLU A CA    1 
ATOM   2966  C  C     . GLU A 1 387 ? -96.988  28.547  -27.737 1.00 81.71  ?  387 GLU A C     1 
ATOM   2967  O  O     . GLU A 1 387 ? -96.290  27.628  -27.306 1.00 92.64  ?  387 GLU A O     1 
ATOM   2968  C  CB    . GLU A 1 387 ? -98.652  27.625  -29.403 1.00 78.27  ?  387 GLU A CB    1 
ATOM   2969  C  CG    . GLU A 1 387 ? -99.275  28.517  -30.453 1.00 83.64  ?  387 GLU A CG    1 
ATOM   2970  C  CD    . GLU A 1 387 ? -100.604 27.986  -30.956 1.00 99.80  ?  387 GLU A CD    1 
ATOM   2971  O  OE1   . GLU A 1 387 ? -100.589 27.033  -31.771 1.00 110.04 ?  387 GLU A OE1   1 
ATOM   2972  O  OE2   . GLU A 1 387 ? -101.659 28.519  -30.540 1.00 105.02 ?  387 GLU A OE2   1 
ATOM   2973  N  N     . VAL A 1 388 ? -96.501  29.766  -27.957 1.00 75.66  ?  388 VAL A N     1 
ATOM   2974  C  CA    . VAL A 1 388 ? -95.087  30.056  -27.692 1.00 78.30  ?  388 VAL A CA    1 
ATOM   2975  C  C     . VAL A 1 388 ? -94.833  30.203  -26.188 1.00 78.18  ?  388 VAL A C     1 
ATOM   2976  O  O     . VAL A 1 388 ? -93.797  29.780  -25.674 1.00 84.12  ?  388 VAL A O     1 
ATOM   2977  C  CB    . VAL A 1 388 ? -94.571  31.305  -28.479 1.00 61.67  ?  388 VAL A CB    1 
ATOM   2978  C  CG1   . VAL A 1 388 ? -93.421  31.959  -27.760 1.00 57.79  ?  388 VAL A CG1   1 
ATOM   2979  C  CG2   . VAL A 1 388 ? -94.115  30.911  -29.847 1.00 68.30  ?  388 VAL A CG2   1 
ATOM   2980  N  N     . ILE A 1 389 ? -95.793  30.798  -25.489 1.00 71.54  ?  389 ILE A N     1 
ATOM   2981  C  CA    . ILE A 1 389 ? -95.708  30.952  -24.051 1.00 70.11  ?  389 ILE A CA    1 
ATOM   2982  C  C     . ILE A 1 389 ? -95.746  29.577  -23.395 1.00 77.94  ?  389 ILE A C     1 
ATOM   2983  O  O     . ILE A 1 389 ? -95.035  29.314  -22.417 1.00 85.46  ?  389 ILE A O     1 
ATOM   2984  C  CB    . ILE A 1 389 ? -96.874  31.802  -23.541 1.00 65.08  ?  389 ILE A CB    1 
ATOM   2985  C  CG1   . ILE A 1 389 ? -96.669  33.264  -23.947 1.00 69.07  ?  389 ILE A CG1   1 
ATOM   2986  C  CG2   . ILE A 1 389 ? -97.011  31.674  -22.041 1.00 59.95  ?  389 ILE A CG2   1 
ATOM   2987  C  CD1   . ILE A 1 389 ? -97.935  34.102  -23.844 1.00 73.24  ?  389 ILE A CD1   1 
ATOM   2988  N  N     . ALA A 1 390 ? -96.571  28.703  -23.959 1.00 71.59  ?  390 ALA A N     1 
ATOM   2989  C  CA    . ALA A 1 390 ? -96.739  27.344  -23.463 1.00 71.19  ?  390 ALA A CA    1 
ATOM   2990  C  C     . ALA A 1 390 ? -95.489  26.498  -23.652 1.00 76.96  ?  390 ALA A C     1 
ATOM   2991  O  O     . ALA A 1 390 ? -95.231  25.562  -22.886 1.00 85.82  ?  390 ALA A O     1 
ATOM   2992  C  CB    . ALA A 1 390 ? -97.911  26.678  -24.157 1.00 77.21  ?  390 ALA A CB    1 
ATOM   2993  N  N     . LEU A 1 391 ? -94.738  26.821  -24.695 1.00 76.77  ?  391 LEU A N     1 
ATOM   2994  C  CA    . LEU A 1 391 ? -93.528  26.096  -25.051 1.00 79.84  ?  391 LEU A CA    1 
ATOM   2995  C  C     . LEU A 1 391 ? -92.418  26.501  -24.087 1.00 80.58  ?  391 LEU A C     1 
ATOM   2996  O  O     . LEU A 1 391 ? -91.595  25.680  -23.662 1.00 83.02  ?  391 LEU A O     1 
ATOM   2997  C  CB    . LEU A 1 391 ? -93.129  26.437  -26.492 1.00 80.29  ?  391 LEU A CB    1 
ATOM   2998  C  CG    . LEU A 1 391 ? -92.036  25.604  -27.156 1.00 87.84  ?  391 LEU A CG    1 
ATOM   2999  C  CD1   . LEU A 1 391 ? -92.648  24.642  -28.155 1.00 99.02  ?  391 LEU A CD1   1 
ATOM   3000  C  CD2   . LEU A 1 391 ? -91.006  26.497  -27.820 1.00 83.06  ?  391 LEU A CD2   1 
ATOM   3001  N  N     . ILE A 1 392 ? -92.400  27.784  -23.750 1.00 78.72  ?  392 ILE A N     1 
ATOM   3002  C  CA    . ILE A 1 392 ? -91.457  28.290  -22.775 1.00 71.80  ?  392 ILE A CA    1 
ATOM   3003  C  C     . ILE A 1 392 ? -91.842  27.732  -21.415 1.00 72.79  ?  392 ILE A C     1 
ATOM   3004  O  O     . ILE A 1 392 ? -91.034  27.096  -20.738 1.00 73.83  ?  392 ILE A O     1 
ATOM   3005  C  CB    . ILE A 1 392 ? -91.463  29.802  -22.758 1.00 56.70  ?  392 ILE A CB    1 
ATOM   3006  C  CG1   . ILE A 1 392 ? -90.740  30.327  -23.994 1.00 49.94  ?  392 ILE A CG1   1 
ATOM   3007  C  CG2   . ILE A 1 392 ? -90.764  30.300  -21.535 1.00 58.57  ?  392 ILE A CG2   1 
ATOM   3008  C  CD1   . ILE A 1 392 ? -91.148  31.730  -24.356 1.00 51.18  ?  392 ILE A CD1   1 
ATOM   3009  N  N     . ARG A 1 393 ? -93.093  27.949  -21.030 1.00 69.41  ?  393 ARG A N     1 
ATOM   3010  C  CA    . ARG A 1 393 ? -93.611  27.338  -19.820 1.00 69.41  ?  393 ARG A CA    1 
ATOM   3011  C  C     . ARG A 1 393 ? -93.161  25.876  -19.702 1.00 79.12  ?  393 ARG A C     1 
ATOM   3012  O  O     . ARG A 1 393 ? -92.818  25.408  -18.614 1.00 86.99  ?  393 ARG A O     1 
ATOM   3013  C  CB    . ARG A 1 393 ? -95.133  27.433  -19.804 1.00 66.65  ?  393 ARG A CB    1 
ATOM   3014  C  CG    . ARG A 1 393 ? -95.788  26.942  -18.513 1.00 75.37  ?  393 ARG A CG    1 
ATOM   3015  C  CD    . ARG A 1 393 ? -95.711  27.972  -17.427 1.00 79.20  ?  393 ARG A CD    1 
ATOM   3016  N  NE    . ARG A 1 393 ? -95.352  27.346  -16.163 1.00 91.78  ?  393 ARG A NE    1 
ATOM   3017  C  CZ    . ARG A 1 393 ? -96.236  26.890  -15.288 1.00 93.92  ?  393 ARG A CZ    1 
ATOM   3018  N  NH1   . ARG A 1 393 ? -97.529  27.002  -15.543 1.00 99.74  ?  393 ARG A NH1   1 
ATOM   3019  N  NH2   . ARG A 1 393 ? -95.827  26.329  -14.164 1.00 88.88  ?  393 ARG A NH2   1 
ATOM   3020  N  N     . ALA A 1 394 ? -93.147  25.164  -20.826 1.00 78.92  ?  394 ALA A N     1 
ATOM   3021  C  CA    . ALA A 1 394 ? -92.807  23.734  -20.830 1.00 84.12  ?  394 ALA A CA    1 
ATOM   3022  C  C     . ALA A 1 394 ? -91.312  23.461  -20.948 1.00 85.04  ?  394 ALA A C     1 
ATOM   3023  O  O     . ALA A 1 394 ? -90.868  22.331  -20.704 1.00 91.24  ?  394 ALA A O     1 
ATOM   3024  C  CB    . ALA A 1 394 ? -93.562  22.983  -21.934 1.00 85.51  ?  394 ALA A CB    1 
ATOM   3025  N  N     . SER A 1 395 ? -90.541  24.480  -21.330 1.00 81.81  ?  395 SER A N     1 
ATOM   3026  C  CA    . SER A 1 395 ? -89.090  24.318  -21.447 1.00 85.02  ?  395 SER A CA    1 
ATOM   3027  C  C     . SER A 1 395 ? -88.429  24.291  -20.055 1.00 84.96  ?  395 SER A C     1 
ATOM   3028  O  O     . SER A 1 395 ? -89.083  24.529  -19.036 1.00 88.80  ?  395 SER A O     1 
ATOM   3029  C  CB    . SER A 1 395 ? -88.464  25.359  -22.402 1.00 56.49  ?  395 SER A CB    1 
ATOM   3030  N  N     . GLU A 1 396 ? -87.142  23.964  -20.018 1.00 82.09  ?  396 GLU A N     1 
ATOM   3031  C  CA    . GLU A 1 396 ? -86.441  23.705  -18.762 1.00 81.61  ?  396 GLU A CA    1 
ATOM   3032  C  C     . GLU A 1 396 ? -85.566  24.881  -18.347 1.00 76.10  ?  396 GLU A C     1 
ATOM   3033  O  O     . GLU A 1 396 ? -85.111  24.943  -17.215 1.00 81.16  ?  396 GLU A O     1 
ATOM   3034  C  CB    . GLU A 1 396 ? -85.558  22.459  -18.891 1.00 71.93  ?  396 GLU A CB    1 
ATOM   3035  C  CG    . GLU A 1 396 ? -86.297  21.177  -19.323 1.00 83.67  ?  396 GLU A CG    1 
ATOM   3036  C  CD    . GLU A 1 396 ? -85.332  20.034  -19.705 1.00 93.50  ?  396 GLU A CD    1 
ATOM   3037  O  OE1   . GLU A 1 396 ? -84.092  20.273  -19.810 1.00 89.78  ?  396 GLU A OE1   1 
ATOM   3038  O  OE2   . GLU A 1 396 ? -85.812  18.890  -19.915 1.00 101.46 ?  396 GLU A OE2   1 
ATOM   3039  N  N     . ASN A 1 397 ? -85.343  25.813  -19.266 1.00 71.64  ?  397 ASN A N     1 
ATOM   3040  C  CA    . ASN A 1 397 ? -84.336  26.857  -19.091 1.00 74.84  ?  397 ASN A CA    1 
ATOM   3041  C  C     . ASN A 1 397 ? -84.037  27.547  -20.405 1.00 76.39  ?  397 ASN A C     1 
ATOM   3042  O  O     . ASN A 1 397 ? -84.256  26.987  -21.472 1.00 74.83  ?  397 ASN A O     1 
ATOM   3043  C  CB    . ASN A 1 397 ? -83.041  26.268  -18.534 1.00 80.13  ?  397 ASN A CB    1 
ATOM   3044  C  CG    . ASN A 1 397 ? -82.527  25.110  -19.367 1.00 88.19  ?  397 ASN A CG    1 
ATOM   3045  O  OD1   . ASN A 1 397 ? -82.984  23.975  -19.219 1.00 92.93  ?  397 ASN A OD1   1 
ATOM   3046  N  ND2   . ASN A 1 397 ? -81.576  25.391  -20.254 1.00 93.26  ?  397 ASN A ND2   1 
ATOM   3047  N  N     . LYS A 1 398 ? -83.509  28.759  -20.323 1.00 78.85  ?  398 LYS A N     1 
ATOM   3048  C  CA    . LYS A 1 398 ? -83.297  29.560  -21.517 1.00 74.57  ?  398 LYS A CA    1 
ATOM   3049  C  C     . LYS A 1 398 ? -82.846  28.668  -22.672 1.00 78.67  ?  398 LYS A C     1 
ATOM   3050  O  O     . LYS A 1 398 ? -83.515  28.586  -23.698 1.00 78.45  ?  398 LYS A O     1 
ATOM   3051  C  CB    . LYS A 1 398 ? -82.286  30.676  -21.244 1.00 70.28  ?  398 LYS A CB    1 
ATOM   3052  C  CG    . LYS A 1 398 ? -82.233  31.745  -22.315 1.00 63.97  ?  398 LYS A CG    1 
ATOM   3053  C  CD    . LYS A 1 398 ? -81.329  32.896  -21.940 1.00 67.39  ?  398 LYS A CD    1 
ATOM   3054  C  CE    . LYS A 1 398 ? -81.131  33.846  -23.113 1.00 69.92  ?  398 LYS A CE    1 
ATOM   3055  N  NZ    . LYS A 1 398 ? -80.150  34.918  -22.789 1.00 72.17  ?  398 LYS A NZ    1 
ATOM   3056  N  N     . ALA A 1 399 ? -81.736  27.966  -22.485 1.00 82.39  ?  399 ALA A N     1 
ATOM   3057  C  CA    . ALA A 1 399 ? -81.205  27.101  -23.532 1.00 83.05  ?  399 ALA A CA    1 
ATOM   3058  C  C     . ALA A 1 399 ? -82.269  26.187  -24.140 1.00 78.07  ?  399 ALA A C     1 
ATOM   3059  O  O     . ALA A 1 399 ? -82.484  26.210  -25.347 1.00 79.42  ?  399 ALA A O     1 
ATOM   3060  C  CB    . ALA A 1 399 ? -80.041  26.288  -23.005 1.00 92.48  ?  399 ALA A CB    1 
ATOM   3061  N  N     . ASP A 1 400 ? -82.929  25.383  -23.312 1.00 78.64  ?  400 ASP A N     1 
ATOM   3062  C  CA    . ASP A 1 400 ? -83.934  24.435  -23.808 1.00 81.44  ?  400 ASP A CA    1 
ATOM   3063  C  C     . ASP A 1 400 ? -85.074  25.128  -24.564 1.00 79.89  ?  400 ASP A C     1 
ATOM   3064  O  O     . ASP A 1 400 ? -85.594  24.600  -25.552 1.00 79.02  ?  400 ASP A O     1 
ATOM   3065  C  CB    . ASP A 1 400 ? -84.516  23.573  -22.671 1.00 79.98  ?  400 ASP A CB    1 
ATOM   3066  C  CG    . ASP A 1 400 ? -85.302  22.373  -23.196 1.00 86.41  ?  400 ASP A CG    1 
ATOM   3067  O  OD1   . ASP A 1 400 ? -86.392  22.066  -22.660 1.00 87.82  ?  400 ASP A OD1   1 
ATOM   3068  O  OD2   . ASP A 1 400 ? -84.822  21.730  -24.156 1.00 94.95  ?  400 ASP A OD2   1 
ATOM   3069  N  N     . ALA A 1 401 ? -85.471  26.301  -24.085 1.00 79.69  ?  401 ALA A N     1 
ATOM   3070  C  CA    . ALA A 1 401 ? -86.569  27.038  -24.695 1.00 75.76  ?  401 ALA A CA    1 
ATOM   3071  C  C     . ALA A 1 401 ? -86.211  27.461  -26.130 1.00 71.90  ?  401 ALA A C     1 
ATOM   3072  O  O     . ALA A 1 401 ? -86.928  27.146  -27.084 1.00 70.43  ?  401 ALA A O     1 
ATOM   3073  C  CB    . ALA A 1 401 ? -86.941  28.237  -23.835 1.00 72.12  ?  401 ALA A CB    1 
ATOM   3074  N  N     . LYS A 1 402 ? -85.104  28.176  -26.273 1.00 69.34  ?  402 LYS A N     1 
ATOM   3075  C  CA    . LYS A 1 402 ? -84.551  28.461  -27.581 1.00 70.55  ?  402 LYS A CA    1 
ATOM   3076  C  C     . LYS A 1 402 ? -84.536  27.206  -28.466 1.00 76.99  ?  402 LYS A C     1 
ATOM   3077  O  O     . LYS A 1 402 ? -85.067  27.212  -29.575 1.00 82.32  ?  402 LYS A O     1 
ATOM   3078  C  CB    . LYS A 1 402 ? -83.146  29.039  -27.439 1.00 71.18  ?  402 LYS A CB    1 
ATOM   3079  C  CG    . LYS A 1 402 ? -83.123  30.294  -26.595 1.00 69.30  ?  402 LYS A CG    1 
ATOM   3080  C  CD    . LYS A 1 402 ? -82.058  31.276  -27.047 1.00 67.80  ?  402 LYS A CD    1 
ATOM   3081  C  CE    . LYS A 1 402 ? -80.691  30.643  -27.018 1.00 77.87  ?  402 LYS A CE    1 
ATOM   3082  N  NZ    . LYS A 1 402 ? -79.691  31.628  -27.476 1.00 84.50  ?  402 LYS A NZ    1 
ATOM   3083  N  N     . GLU A 1 403 ? -83.948  26.119  -27.992 1.00 81.21  ?  403 GLU A N     1 
ATOM   3084  C  CA    . GLU A 1 403 ? -83.971  24.908  -28.806 1.00 86.73  ?  403 GLU A CA    1 
ATOM   3085  C  C     . GLU A 1 403 ? -85.398  24.523  -29.254 1.00 81.98  ?  403 GLU A C     1 
ATOM   3086  O  O     . GLU A 1 403 ? -85.610  24.151  -30.407 1.00 87.65  ?  403 GLU A O     1 
ATOM   3087  C  CB    . GLU A 1 403 ? -83.275  23.735  -28.109 1.00 95.22  ?  403 GLU A CB    1 
ATOM   3088  C  CG    . GLU A 1 403 ? -82.940  22.577  -29.047 1.00 110.37 ?  403 GLU A CG    1 
ATOM   3089  C  CD    . GLU A 1 403 ? -81.951  22.971  -30.152 1.00 123.14 ?  403 GLU A CD    1 
ATOM   3090  O  OE1   . GLU A 1 403 ? -81.619  22.082  -30.981 1.00 126.87 ?  403 GLU A OE1   1 
ATOM   3091  O  OE2   . GLU A 1 403 ? -81.513  24.159  -30.185 1.00 125.03 ?  403 GLU A OE2   1 
ATOM   3092  N  N     . ASN A 1 404 ? -86.375  24.625  -28.359 1.00 73.42  ?  404 ASN A N     1 
ATOM   3093  C  CA    . ASN A 1 404 ? -87.738  24.238  -28.714 1.00 77.85  ?  404 ASN A CA    1 
ATOM   3094  C  C     . ASN A 1 404 ? -88.372  25.150  -29.754 1.00 74.69  ?  404 ASN A C     1 
ATOM   3095  O  O     . ASN A 1 404 ? -89.123  24.701  -30.614 1.00 73.10  ?  404 ASN A O     1 
ATOM   3096  C  CB    . ASN A 1 404 ? -88.649  24.182  -27.488 1.00 80.38  ?  404 ASN A CB    1 
ATOM   3097  C  CG    . ASN A 1 404 ? -88.377  22.986  -26.601 1.00 84.38  ?  404 ASN A CG    1 
ATOM   3098  O  OD1   . ASN A 1 404 ? -88.332  23.116  -25.379 1.00 89.61  ?  404 ASN A OD1   1 
ATOM   3099  N  ND2   . ASN A 1 404 ? -88.200  21.815  -27.208 1.00 85.53  ?  404 ASN A ND2   1 
ATOM   3100  N  N     . LEU A 1 405 ? -88.096  26.440  -29.658 1.00 71.88  ?  405 LEU A N     1 
ATOM   3101  C  CA    . LEU A 1 405 ? -88.659  27.375  -30.608 1.00 69.58  ?  405 LEU A CA    1 
ATOM   3102  C  C     . LEU A 1 405 ? -88.087  27.062  -31.979 1.00 76.88  ?  405 LEU A C     1 
ATOM   3103  O  O     . LEU A 1 405 ? -88.802  27.088  -32.982 1.00 84.09  ?  405 LEU A O     1 
ATOM   3104  C  CB    . LEU A 1 405 ? -88.329  28.804  -30.206 1.00 64.16  ?  405 LEU A CB    1 
ATOM   3105  C  CG    . LEU A 1 405 ? -89.050  29.326  -28.974 1.00 57.31  ?  405 LEU A CG    1 
ATOM   3106  C  CD1   . LEU A 1 405 ? -88.467  30.663  -28.544 1.00 53.61  ?  405 LEU A CD1   1 
ATOM   3107  C  CD2   . LEU A 1 405 ? -90.512  29.476  -29.309 1.00 61.82  ?  405 LEU A CD2   1 
ATOM   3108  N  N     . LYS A 1 406 ? -86.796  26.759  -32.026 1.00 74.93  ?  406 LYS A N     1 
ATOM   3109  C  CA    . LYS A 1 406 ? -86.178  26.355  -33.282 1.00 83.29  ?  406 LYS A CA    1 
ATOM   3110  C  C     . LYS A 1 406 ? -86.847  25.095  -33.846 1.00 91.28  ?  406 LYS A C     1 
ATOM   3111  O  O     . LYS A 1 406 ? -87.306  25.076  -34.990 1.00 92.99  ?  406 LYS A O     1 
ATOM   3112  C  CB    . LYS A 1 406 ? -84.692  26.077  -33.088 1.00 81.95  ?  406 LYS A CB    1 
ATOM   3113  C  CG    . LYS A 1 406 ? -83.834  27.265  -32.724 1.00 73.86  ?  406 LYS A CG    1 
ATOM   3114  C  CD    . LYS A 1 406 ? -82.517  26.740  -32.155 1.00 81.36  ?  406 LYS A CD    1 
ATOM   3115  C  CE    . LYS A 1 406 ? -81.420  27.788  -32.147 1.00 85.97  ?  406 LYS A CE    1 
ATOM   3116  N  NZ    . LYS A 1 406 ? -80.108  27.147  -31.836 1.00 93.68  ?  406 LYS A NZ    1 
ATOM   3117  N  N     . VAL A 1 407 ? -86.900  24.043  -33.039 1.00 89.45  ?  407 VAL A N     1 
ATOM   3118  C  CA    . VAL A 1 407 ? -87.345  22.749  -33.538 1.00 88.63  ?  407 VAL A CA    1 
ATOM   3119  C  C     . VAL A 1 407 ? -88.847  22.667  -33.774 1.00 88.49  ?  407 VAL A C     1 
ATOM   3120  O  O     . VAL A 1 407 ? -89.306  22.020  -34.717 1.00 96.02  ?  407 VAL A O     1 
ATOM   3121  C  CB    . VAL A 1 407 ? -86.933  21.604  -32.602 1.00 85.40  ?  407 VAL A CB    1 
ATOM   3122  C  CG1   . VAL A 1 407 ? -87.210  20.262  -33.282 1.00 87.98  ?  407 VAL A CG1   1 
ATOM   3123  C  CG2   . VAL A 1 407 ? -85.455  21.735  -32.220 1.00 84.64  ?  407 VAL A CG2   1 
ATOM   3124  N  N     . SER A 1 408 ? -89.621  23.304  -32.911 1.00 84.94  ?  408 SER A N     1 
ATOM   3125  C  CA    . SER A 1 408 ? -91.066  23.188  -33.017 1.00 87.51  ?  408 SER A CA    1 
ATOM   3126  C  C     . SER A 1 408 ? -91.656  24.210  -34.006 1.00 85.19  ?  408 SER A C     1 
ATOM   3127  O  O     . SER A 1 408 ? -92.682  23.940  -34.623 1.00 92.20  ?  408 SER A O     1 
ATOM   3128  C  CB    . SER A 1 408 ? -91.737  23.255  -31.630 1.00 70.09  ?  408 SER A CB    1 
ATOM   3129  N  N     . TYR A 1 409 ? -91.000  25.358  -34.185 1.00 77.40  ?  409 TYR A N     1 
ATOM   3130  C  CA    . TYR A 1 409 ? -91.582  26.431  -35.002 1.00 77.51  ?  409 TYR A CA    1 
ATOM   3131  C  C     . TYR A 1 409 ? -90.631  27.081  -36.021 1.00 79.45  ?  409 TYR A C     1 
ATOM   3132  O  O     . TYR A 1 409 ? -90.952  28.115  -36.614 1.00 81.06  ?  409 TYR A O     1 
ATOM   3133  C  CB    . TYR A 1 409 ? -92.224  27.508  -34.121 1.00 62.02  ?  409 TYR A CB    1 
ATOM   3134  C  CG    . TYR A 1 409 ? -93.454  27.056  -33.363 1.00 73.68  ?  409 TYR A CG    1 
ATOM   3135  C  CD1   . TYR A 1 409 ? -94.662  26.868  -34.013 1.00 80.17  ?  409 TYR A CD1   1 
ATOM   3136  C  CD2   . TYR A 1 409 ? -93.411  26.844  -31.983 1.00 72.19  ?  409 TYR A CD2   1 
ATOM   3137  C  CE1   . TYR A 1 409 ? -95.794  26.464  -33.320 1.00 86.73  ?  409 TYR A CE1   1 
ATOM   3138  C  CE2   . TYR A 1 409 ? -94.537  26.439  -31.277 1.00 74.28  ?  409 TYR A CE2   1 
ATOM   3139  C  CZ    . TYR A 1 409 ? -95.729  26.251  -31.948 1.00 82.16  ?  409 TYR A CZ    1 
ATOM   3140  O  OH    . TYR A 1 409 ? -96.856  25.840  -31.263 1.00 82.97  ?  409 TYR A OH    1 
ATOM   3141  N  N     . ASP A 1 410 ? -89.475  26.461  -36.232 1.00 80.40  ?  410 ASP A N     1 
ATOM   3142  C  CA    . ASP A 1 410 ? -88.483  26.944  -37.201 1.00 79.92  ?  410 ASP A CA    1 
ATOM   3143  C  C     . ASP A 1 410 ? -87.997  28.378  -36.973 1.00 75.43  ?  410 ASP A C     1 
ATOM   3144  O  O     . ASP A 1 410 ? -87.512  29.006  -37.906 1.00 83.32  ?  410 ASP A O     1 
ATOM   3145  C  CB    . ASP A 1 410 ? -88.974  26.847  -38.657 1.00 85.08  ?  410 ASP A CB    1 
ATOM   3146  C  CG    . ASP A 1 410 ? -89.652  25.541  -38.978 1.00 90.90  ?  410 ASP A CG    1 
ATOM   3147  O  OD1   . ASP A 1 410 ? -88.947  24.541  -39.274 1.00 89.15  ?  410 ASP A OD1   1 
ATOM   3148  O  OD2   . ASP A 1 410 ? -90.905  25.539  -38.968 1.00 95.58  ?  410 ASP A OD2   1 
ATOM   3149  N  N     . PHE A 1 411 ? -88.116  28.919  -35.768 1.00 66.41  ?  411 PHE A N     1 
ATOM   3150  C  CA    . PHE A 1 411 ? -87.405  30.166  -35.504 1.00 65.71  ?  411 PHE A CA    1 
ATOM   3151  C  C     . PHE A 1 411 ? -85.907  29.905  -35.597 1.00 70.34  ?  411 PHE A C     1 
ATOM   3152  O  O     . PHE A 1 411 ? -85.449  28.771  -35.466 1.00 78.89  ?  411 PHE A O     1 
ATOM   3153  C  CB    . PHE A 1 411 ? -87.760  30.736  -34.139 1.00 66.01  ?  411 PHE A CB    1 
ATOM   3154  C  CG    . PHE A 1 411 ? -89.155  31.269  -34.058 1.00 64.90  ?  411 PHE A CG    1 
ATOM   3155  C  CD1   . PHE A 1 411 ? -89.469  32.497  -34.605 1.00 67.85  ?  411 PHE A CD1   1 
ATOM   3156  C  CD2   . PHE A 1 411 ? -90.155  30.540  -33.439 1.00 64.40  ?  411 PHE A CD2   1 
ATOM   3157  C  CE1   . PHE A 1 411 ? -90.759  32.987  -34.542 1.00 66.97  ?  411 PHE A CE1   1 
ATOM   3158  C  CE2   . PHE A 1 411 ? -91.437  31.027  -33.375 1.00 67.25  ?  411 PHE A CE2   1 
ATOM   3159  C  CZ    . PHE A 1 411 ? -91.741  32.254  -33.926 1.00 66.70  ?  411 PHE A CZ    1 
ATOM   3160  N  N     . THR A 1 412 ? -85.137  30.947  -35.851 1.00 69.33  ?  412 THR A N     1 
ATOM   3161  C  CA    . THR A 1 412 ? -83.698  30.784  -35.907 1.00 74.83  ?  412 THR A CA    1 
ATOM   3162  C  C     . THR A 1 412 ? -83.160  31.119  -34.518 1.00 79.74  ?  412 THR A C     1 
ATOM   3163  O  O     . THR A 1 412 ? -83.909  31.570  -33.645 1.00 82.06  ?  412 THR A O     1 
ATOM   3164  C  CB    . THR A 1 412 ? -83.063  31.707  -36.959 1.00 80.03  ?  412 THR A CB    1 
ATOM   3165  O  OG1   . THR A 1 412 ? -82.412  32.799  -36.306 1.00 83.82  ?  412 THR A OG1   1 
ATOM   3166  C  CG2   . THR A 1 412 ? -84.124  32.272  -37.878 1.00 80.50  ?  412 THR A CG2   1 
ATOM   3167  N  N     . GLU A 1 413 ? -81.871  30.889  -34.307 1.00 83.70  ?  413 GLU A N     1 
ATOM   3168  C  CA    . GLU A 1 413 ? -81.239  31.300  -33.070 1.00 80.19  ?  413 GLU A CA    1 
ATOM   3169  C  C     . GLU A 1 413 ? -81.580  32.769  -32.788 1.00 75.00  ?  413 GLU A C     1 
ATOM   3170  O  O     . GLU A 1 413 ? -82.345  33.083  -31.858 1.00 67.74  ?  413 GLU A O     1 
ATOM   3171  C  CB    . GLU A 1 413 ? -79.726  31.114  -33.166 1.00 87.64  ?  413 GLU A CB    1 
ATOM   3172  C  CG    . GLU A 1 413 ? -78.938  31.774  -32.039 1.00 95.65  ?  413 GLU A CG    1 
ATOM   3173  C  CD    . GLU A 1 413 ? -78.976  30.989  -30.737 1.00 100.90 ?  413 GLU A CD    1 
ATOM   3174  O  OE1   . GLU A 1 413 ? -78.323  31.427  -29.767 1.00 100.83 ?  413 GLU A OE1   1 
ATOM   3175  O  OE2   . GLU A 1 413 ? -79.652  29.938  -30.684 1.00 103.46 ?  413 GLU A OE2   1 
ATOM   3176  N  N     . GLU A 1 414 ? -81.034  33.665  -33.609 1.00 74.04  ?  414 GLU A N     1 
ATOM   3177  C  CA    . GLU A 1 414 ? -81.199  35.099  -33.366 1.00 74.26  ?  414 GLU A CA    1 
ATOM   3178  C  C     . GLU A 1 414 ? -82.625  35.512  -32.935 1.00 71.65  ?  414 GLU A C     1 
ATOM   3179  O  O     . GLU A 1 414 ? -82.787  36.373  -32.064 1.00 75.48  ?  414 GLU A O     1 
ATOM   3180  C  CB    . GLU A 1 414 ? -80.689  35.927  -34.549 1.00 86.42  ?  414 GLU A CB    1 
ATOM   3181  C  CG    . GLU A 1 414 ? -80.177  35.092  -35.725 1.00 103.23 ?  414 GLU A CG    1 
ATOM   3182  C  CD    . GLU A 1 414 ? -78.939  34.265  -35.397 1.00 115.17 ?  414 GLU A CD    1 
ATOM   3183  O  OE1   . GLU A 1 414 ? -78.767  33.179  -36.000 1.00 117.57 ?  414 GLU A OE1   1 
ATOM   3184  O  OE2   . GLU A 1 414 ? -78.129  34.708  -34.554 1.00 122.31 ?  414 GLU A OE2   1 
ATOM   3185  N  N     . GLN A 1 415 ? -83.650  34.897  -33.517 1.00 67.46  ?  415 GLN A N     1 
ATOM   3186  C  CA    . GLN A 1 415 ? -85.025  35.258  -33.161 1.00 69.18  ?  415 GLN A CA    1 
ATOM   3187  C  C     . GLN A 1 415 ? -85.430  34.565  -31.873 1.00 68.05  ?  415 GLN A C     1 
ATOM   3188  O  O     . GLN A 1 415 ? -86.151  35.140  -31.042 1.00 65.26  ?  415 GLN A O     1 
ATOM   3189  C  CB    . GLN A 1 415 ? -86.016  34.895  -34.275 1.00 75.78  ?  415 GLN A CB    1 
ATOM   3190  C  CG    . GLN A 1 415 ? -85.376  34.406  -35.571 1.00 83.45  ?  415 GLN A CG    1 
ATOM   3191  C  CD    . GLN A 1 415 ? -86.365  34.380  -36.725 1.00 78.48  ?  415 GLN A CD    1 
ATOM   3192  O  OE1   . GLN A 1 415 ? -86.787  33.307  -37.167 1.00 82.56  ?  415 GLN A OE1   1 
ATOM   3193  N  NE2   . GLN A 1 415 ? -86.740  35.566  -37.220 1.00 67.42  ?  415 GLN A NE2   1 
ATOM   3194  N  N     . ALA A 1 416 ? -84.979  33.319  -31.722 1.00 70.29  ?  416 ALA A N     1 
ATOM   3195  C  CA    . ALA A 1 416 ? -85.253  32.556  -30.511 1.00 65.70  ?  416 ALA A CA    1 
ATOM   3196  C  C     . ALA A 1 416 ? -84.648  33.279  -29.319 1.00 67.82  ?  416 ALA A C     1 
ATOM   3197  O  O     . ALA A 1 416 ? -85.256  33.328  -28.252 1.00 69.22  ?  416 ALA A O     1 
ATOM   3198  C  CB    . ALA A 1 416 ? -84.710  31.167  -30.618 1.00 63.40  ?  416 ALA A CB    1 
ATOM   3199  N  N     . GLU A 1 417 ? -83.464  33.863  -29.501 1.00 59.05  ?  417 GLU A N     1 
ATOM   3200  C  CA    . GLU A 1 417 ? -82.929  34.734  -28.463 1.00 56.79  ?  417 GLU A CA    1 
ATOM   3201  C  C     . GLU A 1 417 ? -83.850  35.914  -28.213 1.00 58.81  ?  417 GLU A C     1 
ATOM   3202  O  O     . GLU A 1 417 ? -84.381  36.080  -27.108 1.00 62.64  ?  417 GLU A O     1 
ATOM   3203  C  CB    . GLU A 1 417 ? -81.539  35.249  -28.793 1.00 66.40  ?  417 GLU A CB    1 
ATOM   3204  C  CG    . GLU A 1 417 ? -80.946  36.130  -27.684 1.00 76.51  ?  417 GLU A CG    1 
ATOM   3205  C  CD    . GLU A 1 417 ? -80.317  35.343  -26.526 1.00 83.54  ?  417 GLU A CD    1 
ATOM   3206  O  OE1   . GLU A 1 417 ? -80.341  34.083  -26.519 1.00 84.18  ?  417 GLU A OE1   1 
ATOM   3207  O  OE2   . GLU A 1 417 ? -79.790  36.010  -25.613 1.00 86.09  ?  417 GLU A OE2   1 
ATOM   3208  N  N     . ALA A 1 418 ? -84.060  36.732  -29.233 1.00 60.34  ?  418 ALA A N     1 
ATOM   3209  C  CA    . ALA A 1 418 ? -84.961  37.867  -29.066 1.00 64.28  ?  418 ALA A CA    1 
ATOM   3210  C  C     . ALA A 1 418 ? -86.253  37.505  -28.314 1.00 71.64  ?  418 ALA A C     1 
ATOM   3211  O  O     . ALA A 1 418 ? -86.645  38.191  -27.368 1.00 77.57  ?  418 ALA A O     1 
ATOM   3212  C  CB    . ALA A 1 418 ? -85.285  38.493  -30.398 1.00 62.65  ?  418 ALA A CB    1 
ATOM   3213  N  N     . ILE A 1 419 ? -86.899  36.424  -28.738 1.00 69.38  ?  419 ILE A N     1 
ATOM   3214  C  CA    . ILE A 1 419 ? -88.219  36.063  -28.239 1.00 66.29  ?  419 ILE A CA    1 
ATOM   3215  C  C     . ILE A 1 419 ? -88.164  35.735  -26.767 1.00 71.70  ?  419 ILE A C     1 
ATOM   3216  O  O     . ILE A 1 419 ? -88.947  36.247  -25.962 1.00 79.39  ?  419 ILE A O     1 
ATOM   3217  C  CB    . ILE A 1 419 ? -88.765  34.836  -28.998 1.00 62.56  ?  419 ILE A CB    1 
ATOM   3218  C  CG1   . ILE A 1 419 ? -89.015  35.201  -30.467 1.00 66.60  ?  419 ILE A CG1   1 
ATOM   3219  C  CG2   . ILE A 1 419 ? -90.040  34.296  -28.330 1.00 49.89  ?  419 ILE A CG2   1 
ATOM   3220  C  CD1   . ILE A 1 419 ? -89.258  34.023  -31.355 1.00 69.33  ?  419 ILE A CD1   1 
ATOM   3221  N  N     . VAL A 1 420 ? -87.218  34.871  -26.433 1.00 66.62  ?  420 VAL A N     1 
ATOM   3222  C  CA    . VAL A 1 420 ? -87.057  34.350  -25.086 1.00 55.71  ?  420 VAL A CA    1 
ATOM   3223  C  C     . VAL A 1 420 ? -86.642  35.408  -24.060 1.00 52.72  ?  420 VAL A C     1 
ATOM   3224  O  O     . VAL A 1 420 ? -86.912  35.254  -22.885 1.00 55.27  ?  420 VAL A O     1 
ATOM   3225  C  CB    . VAL A 1 420 ? -86.008  33.242  -25.103 1.00 55.02  ?  420 VAL A CB    1 
ATOM   3226  C  CG1   . VAL A 1 420 ? -84.784  33.624  -24.237 1.00 53.16  ?  420 VAL A CG1   1 
ATOM   3227  C  CG2   . VAL A 1 420 ? -86.636  31.941  -24.697 1.00 55.60  ?  420 VAL A CG2   1 
ATOM   3228  N  N     . THR A 1 421 ? -85.989  36.475  -24.509 1.00 46.06  ?  421 THR A N     1 
ATOM   3229  C  CA    . THR A 1 421 ? -85.552  37.556  -23.621 1.00 44.34  ?  421 THR A CA    1 
ATOM   3230  C  C     . THR A 1 421 ? -86.471  38.792  -23.655 1.00 53.07  ?  421 THR A C     1 
ATOM   3231  O  O     . THR A 1 421 ? -86.062  39.888  -23.239 1.00 54.89  ?  421 THR A O     1 
ATOM   3232  C  CB    . THR A 1 421 ? -84.130  38.012  -23.984 1.00 51.95  ?  421 THR A CB    1 
ATOM   3233  O  OG1   . THR A 1 421 ? -84.123  38.638  -25.285 1.00 60.70  ?  421 THR A OG1   1 
ATOM   3234  C  CG2   . THR A 1 421 ? -83.189  36.813  -23.991 1.00 56.83  ?  421 THR A CG2   1 
ATOM   3235  N  N     . LEU A 1 422 ? -87.691  38.623  -24.176 1.00 59.82  ?  422 LEU A N     1 
ATOM   3236  C  CA    . LEU A 1 422 ? -88.716  39.666  -24.132 1.00 63.52  ?  422 LEU A CA    1 
ATOM   3237  C  C     . LEU A 1 422 ? -89.223  39.795  -22.694 1.00 65.80  ?  422 LEU A C     1 
ATOM   3238  O  O     . LEU A 1 422 ? -89.357  38.790  -21.985 1.00 71.61  ?  422 LEU A O     1 
ATOM   3239  C  CB    . LEU A 1 422 ? -89.909  39.293  -25.019 1.00 59.66  ?  422 LEU A CB    1 
ATOM   3240  C  CG    . LEU A 1 422 ? -89.889  39.389  -26.541 1.00 53.98  ?  422 LEU A CG    1 
ATOM   3241  C  CD1   . LEU A 1 422 ? -91.160  38.764  -27.109 1.00 48.39  ?  422 LEU A CD1   1 
ATOM   3242  C  CD2   . LEU A 1 422 ? -89.749  40.823  -26.997 1.00 52.05  ?  422 LEU A CD2   1 
ATOM   3243  N  N     . GLN A 1 423 ? -89.526  41.016  -22.268 1.00 61.63  ?  423 GLN A N     1 
ATOM   3244  C  CA    . GLN A 1 423 ? -90.059  41.217  -20.925 1.00 63.36  ?  423 GLN A CA    1 
ATOM   3245  C  C     . GLN A 1 423 ? -91.550  40.856  -20.895 1.00 63.50  ?  423 GLN A C     1 
ATOM   3246  O  O     . GLN A 1 423 ? -92.246  41.053  -21.893 1.00 62.47  ?  423 GLN A O     1 
ATOM   3247  C  CB    . GLN A 1 423 ? -89.832  42.667  -20.467 1.00 61.42  ?  423 GLN A CB    1 
ATOM   3248  C  CG    . GLN A 1 423 ? -88.364  43.050  -20.403 1.00 57.64  ?  423 GLN A CG    1 
ATOM   3249  C  CD    . GLN A 1 423 ? -88.119  44.418  -19.810 1.00 71.37  ?  423 GLN A CD    1 
ATOM   3250  O  OE1   . GLN A 1 423 ? -89.038  45.099  -19.360 1.00 77.67  ?  423 GLN A OE1   1 
ATOM   3251  N  NE2   . GLN A 1 423 ? -86.863  44.831  -19.812 1.00 82.74  ?  423 GLN A NE2   1 
ATOM   3252  N  N     . LEU A 1 424 ? -92.047  40.339  -19.767 1.00 60.66  ?  424 LEU A N     1 
ATOM   3253  C  CA    . LEU A 1 424 ? -93.439  39.880  -19.723 1.00 59.07  ?  424 LEU A CA    1 
ATOM   3254  C  C     . LEU A 1 424 ? -94.431  40.887  -20.304 1.00 56.87  ?  424 LEU A C     1 
ATOM   3255  O  O     . LEU A 1 424 ? -95.315  40.513  -21.072 1.00 58.31  ?  424 LEU A O     1 
ATOM   3256  C  CB    . LEU A 1 424 ? -93.865  39.453  -18.317 1.00 59.37  ?  424 LEU A CB    1 
ATOM   3257  C  CG    . LEU A 1 424 ? -93.376  38.063  -17.920 1.00 59.31  ?  424 LEU A CG    1 
ATOM   3258  C  CD1   . LEU A 1 424 ? -94.067  37.539  -16.676 1.00 48.70  ?  424 LEU A CD1   1 
ATOM   3259  C  CD2   . LEU A 1 424 ? -93.594  37.137  -19.082 1.00 67.03  ?  424 LEU A CD2   1 
ATOM   3260  N  N     . TYR A 1 425 ? -94.285  42.163  -19.963 1.00 56.74  ?  425 TYR A N     1 
ATOM   3261  C  CA    . TYR A 1 425 ? -95.267  43.137  -20.429 1.00 62.72  ?  425 TYR A CA    1 
ATOM   3262  C  C     . TYR A 1 425 ? -95.490  43.097  -21.959 1.00 65.28  ?  425 TYR A C     1 
ATOM   3263  O  O     . TYR A 1 425 ? -96.608  43.323  -22.435 1.00 65.96  ?  425 TYR A O     1 
ATOM   3264  C  CB    . TYR A 1 425 ? -94.982  44.558  -19.901 1.00 65.67  ?  425 TYR A CB    1 
ATOM   3265  C  CG    . TYR A 1 425 ? -93.861  45.310  -20.584 1.00 70.09  ?  425 TYR A CG    1 
ATOM   3266  C  CD1   . TYR A 1 425 ? -92.618  45.446  -19.984 1.00 72.53  ?  425 TYR A CD1   1 
ATOM   3267  C  CD2   . TYR A 1 425 ? -94.053  45.897  -21.821 1.00 72.21  ?  425 TYR A CD2   1 
ATOM   3268  C  CE1   . TYR A 1 425 ? -91.597  46.151  -20.609 1.00 77.67  ?  425 TYR A CE1   1 
ATOM   3269  C  CE2   . TYR A 1 425 ? -93.038  46.598  -22.457 1.00 69.95  ?  425 TYR A CE2   1 
ATOM   3270  C  CZ    . TYR A 1 425 ? -91.820  46.724  -21.847 1.00 74.09  ?  425 TYR A CZ    1 
ATOM   3271  O  OH    . TYR A 1 425 ? -90.820  47.418  -22.485 1.00 75.75  ?  425 TYR A OH    1 
ATOM   3272  N  N     . ARG A 1 426 ? -94.451  42.784  -22.727 1.00 60.20  ?  426 ARG A N     1 
ATOM   3273  C  CA    . ARG A 1 426 ? -94.636  42.624  -24.174 1.00 52.32  ?  426 ARG A CA    1 
ATOM   3274  C  C     . ARG A 1 426 ? -95.825  41.717  -24.519 1.00 55.82  ?  426 ARG A C     1 
ATOM   3275  O  O     . ARG A 1 426 ? -96.500  41.932  -25.516 1.00 67.11  ?  426 ARG A O     1 
ATOM   3276  C  CB    . ARG A 1 426 ? -93.372  42.090  -24.850 1.00 46.85  ?  426 ARG A CB    1 
ATOM   3277  C  CG    . ARG A 1 426 ? -92.137  42.938  -24.620 1.00 60.71  ?  426 ARG A CG    1 
ATOM   3278  C  CD    . ARG A 1 426 ? -92.288  44.348  -25.149 1.00 72.67  ?  426 ARG A CD    1 
ATOM   3279  N  NE    . ARG A 1 426 ? -90.994  45.026  -25.169 1.00 83.34  ?  426 ARG A NE    1 
ATOM   3280  C  CZ    . ARG A 1 426 ? -90.788  46.260  -25.630 1.00 93.10  ?  426 ARG A CZ    1 
ATOM   3281  N  NH1   . ARG A 1 426 ? -91.801  46.979  -26.121 1.00 94.07  ?  426 ARG A NH1   1 
ATOM   3282  N  NH2   . ARG A 1 426 ? -89.561  46.780  -25.597 1.00 95.91  ?  426 ARG A NH2   1 
ATOM   3283  N  N     . LEU A 1 427 ? -96.086  40.701  -23.705 1.00 48.15  ?  427 LEU A N     1 
ATOM   3284  C  CA    . LEU A 1 427 ? -97.255  39.855  -23.940 1.00 60.90  ?  427 LEU A CA    1 
ATOM   3285  C  C     . LEU A 1 427 ? -98.577  40.637  -24.022 1.00 72.07  ?  427 LEU A C     1 
ATOM   3286  O  O     . LEU A 1 427 ? -99.608  40.089  -24.452 1.00 79.57  ?  427 LEU A O     1 
ATOM   3287  C  CB    . LEU A 1 427 ? -97.379  38.786  -22.858 1.00 67.13  ?  427 LEU A CB    1 
ATOM   3288  C  CG    . LEU A 1 427 ? -96.251  37.767  -22.808 1.00 73.49  ?  427 LEU A CG    1 
ATOM   3289  C  CD1   . LEU A 1 427 ? -96.676  36.653  -21.878 1.00 75.13  ?  427 LEU A CD1   1 
ATOM   3290  C  CD2   . LEU A 1 427 ? -95.881  37.235  -24.210 1.00 73.12  ?  427 LEU A CD2   1 
ATOM   3291  N  N     . THR A 1 428 ? -98.571  41.900  -23.599 1.00 71.61  ?  428 THR A N     1 
ATOM   3292  C  CA    . THR A 1 428 ? -99.821  42.660  -23.576 1.00 75.01  ?  428 THR A CA    1 
ATOM   3293  C  C     . THR A 1 428 ? -100.233 42.979  -24.983 1.00 80.72  ?  428 THR A C     1 
ATOM   3294  O  O     . THR A 1 428 ? -101.417 42.979  -25.311 1.00 88.73  ?  428 THR A O     1 
ATOM   3295  C  CB    . THR A 1 428 ? -99.704  43.976  -22.811 1.00 74.87  ?  428 THR A CB    1 
ATOM   3296  O  OG1   . THR A 1 428 ? -98.388  44.498  -22.971 1.00 77.95  ?  428 THR A OG1   1 
ATOM   3297  C  CG2   . THR A 1 428 ? -99.945  43.745  -21.352 1.00 74.57  ?  428 THR A CG2   1 
ATOM   3298  N  N     . ASN A 1 429 ? -99.228  43.213  -25.816 1.00 84.57  ?  429 ASN A N     1 
ATOM   3299  C  CA    . ASN A 1 429 ? -99.425  43.701  -27.173 1.00 90.36  ?  429 ASN A CA    1 
ATOM   3300  C  C     . ASN A 1 429 ? -99.846  42.670  -28.216 1.00 81.61  ?  429 ASN A C     1 
ATOM   3301  O  O     . ASN A 1 429 ? -99.425  41.520  -28.172 1.00 75.72  ?  429 ASN A O     1 
ATOM   3302  C  CB    . ASN A 1 429 ? -98.155  44.376  -27.651 1.00 91.63  ?  429 ASN A CB    1 
ATOM   3303  C  CG    . ASN A 1 429 ? -98.256  44.791  -29.069 1.00 95.19  ?  429 ASN A CG    1 
ATOM   3304  O  OD1   . ASN A 1 429 ? -99.002  45.715  -29.391 1.00 101.11 ?  429 ASN A OD1   1 
ATOM   3305  N  ND2   . ASN A 1 429 ? -97.537  44.098  -29.945 1.00 95.79  ?  429 ASN A ND2   1 
ATOM   3306  N  N     . THR A 1 430 ? -100.669 43.098  -29.165 1.00 103.85 ?  430 THR A N     1 
ATOM   3307  C  CA    . THR A 1 430 ? -101.039 42.234  -30.288 1.00 108.68 ?  430 THR A CA    1 
ATOM   3308  C  C     . THR A 1 430 ? -101.049 42.997  -31.623 1.00 104.58 ?  430 THR A C     1 
ATOM   3309  O  O     . THR A 1 430 ? -101.464 42.465  -32.652 1.00 104.95 ?  430 THR A O     1 
ATOM   3310  C  CB    . THR A 1 430 ? -102.391 41.512  -30.047 1.00 111.54 ?  430 THR A CB    1 
ATOM   3311  O  OG1   . THR A 1 430 ? -103.329 42.428  -29.478 1.00 112.10 ?  430 THR A OG1   1 
ATOM   3312  C  CG2   . THR A 1 430 ? -102.213 40.352  -29.080 1.00 113.64 ?  430 THR A CG2   1 
ATOM   3313  N  N     . ASP A 1 431 ? -100.571 44.239  -31.597 1.00 100.11 ?  431 ASP A N     1 
ATOM   3314  C  CA    . ASP A 1 431 ? -100.532 45.076  -32.789 1.00 102.24 ?  431 ASP A CA    1 
ATOM   3315  C  C     . ASP A 1 431 ? -99.433  44.646  -33.735 1.00 96.03  ?  431 ASP A C     1 
ATOM   3316  O  O     . ASP A 1 431 ? -98.236  44.823  -33.467 1.00 96.60  ?  431 ASP A O     1 
ATOM   3317  C  CB    . ASP A 1 431 ? -100.360 46.559  -32.447 1.00 114.79 ?  431 ASP A CB    1 
ATOM   3318  C  CG    . ASP A 1 431 ? -100.149 47.418  -33.688 1.00 124.34 ?  431 ASP A CG    1 
ATOM   3319  O  OD1   . ASP A 1 431 ? -101.143 47.919  -34.261 1.00 124.96 ?  431 ASP A OD1   1 
ATOM   3320  O  OD2   . ASP A 1 431 ? -98.983  47.575  -34.105 1.00 129.72 ?  431 ASP A OD2   1 
ATOM   3321  N  N     . VAL A 1 432 ? -99.855  44.097  -34.861 1.00 87.21  ?  432 VAL A N     1 
ATOM   3322  C  CA    . VAL A 1 432 ? -98.919  43.618  -35.851 1.00 77.77  ?  432 VAL A CA    1 
ATOM   3323  C  C     . VAL A 1 432 ? -98.601  44.712  -36.868 1.00 86.25  ?  432 VAL A C     1 
ATOM   3324  O  O     . VAL A 1 432 ? -97.643  44.613  -37.624 1.00 92.34  ?  432 VAL A O     1 
ATOM   3325  C  CB    . VAL A 1 432 ? -99.454  42.339  -36.521 1.00 70.70  ?  432 VAL A CB    1 
ATOM   3326  C  CG1   . VAL A 1 432 ? -99.321  42.407  -38.029 1.00 69.30  ?  432 VAL A CG1   1 
ATOM   3327  C  CG2   . VAL A 1 432 ? -98.744  41.121  -35.945 1.00 72.21  ?  432 VAL A CG2   1 
ATOM   3328  N  N     . VAL A 1 433 ? -99.394  45.774  -36.866 1.00 88.27  ?  433 VAL A N     1 
ATOM   3329  C  CA    . VAL A 1 433 ? -99.201  46.844  -37.836 1.00 86.34  ?  433 VAL A CA    1 
ATOM   3330  C  C     . VAL A 1 433 ? -97.903  47.604  -37.603 1.00 85.01  ?  433 VAL A C     1 
ATOM   3331  O  O     . VAL A 1 433 ? -97.006  47.586  -38.440 1.00 91.13  ?  433 VAL A O     1 
ATOM   3332  C  CB    . VAL A 1 433 ? -100.371 47.835  -37.831 1.00 83.16  ?  433 VAL A CB    1 
ATOM   3333  C  CG1   . VAL A 1 433 ? -99.930  49.175  -38.421 1.00 88.39  ?  433 VAL A CG1   1 
ATOM   3334  C  CG2   . VAL A 1 433 ? -101.538 47.253  -38.597 1.00 80.26  ?  433 VAL A CG2   1 
ATOM   3335  N  N     . VAL A 1 434 ? -97.806  48.275  -36.465 1.00 76.33  ?  434 VAL A N     1 
ATOM   3336  C  CA    . VAL A 1 434 ? -96.600  49.018  -36.153 1.00 75.34  ?  434 VAL A CA    1 
ATOM   3337  C  C     . VAL A 1 434 ? -95.352  48.226  -36.556 1.00 78.57  ?  434 VAL A C     1 
ATOM   3338  O  O     . VAL A 1 434 ? -94.477  48.751  -37.234 1.00 81.27  ?  434 VAL A O     1 
ATOM   3339  C  CB    . VAL A 1 434 ? -96.533  49.389  -34.666 1.00 73.18  ?  434 VAL A CB    1 
ATOM   3340  C  CG1   . VAL A 1 434 ? -95.960  48.226  -33.844 1.00 77.26  ?  434 VAL A CG1   1 
ATOM   3341  C  CG2   . VAL A 1 434 ? -95.693  50.616  -34.493 1.00 69.82  ?  434 VAL A CG2   1 
ATOM   3342  N  N     . LEU A 1 435 ? -95.278  46.963  -36.145 1.00 77.31  ?  435 LEU A N     1 
ATOM   3343  C  CA    . LEU A 1 435 ? -94.179  46.099  -36.550 1.00 72.08  ?  435 LEU A CA    1 
ATOM   3344  C  C     . LEU A 1 435 ? -94.044  46.082  -38.077 1.00 72.05  ?  435 LEU A C     1 
ATOM   3345  O  O     . LEU A 1 435 ? -92.997  46.433  -38.623 1.00 76.48  ?  435 LEU A O     1 
ATOM   3346  C  CB    . LEU A 1 435 ? -94.366  44.687  -35.996 1.00 70.75  ?  435 LEU A CB    1 
ATOM   3347  C  CG    . LEU A 1 435 ? -93.923  44.565  -34.539 1.00 70.84  ?  435 LEU A CG    1 
ATOM   3348  C  CD1   . LEU A 1 435 ? -94.087  43.130  -33.972 1.00 60.89  ?  435 LEU A CD1   1 
ATOM   3349  C  CD2   . LEU A 1 435 ? -92.483  45.055  -34.444 1.00 67.49  ?  435 LEU A CD2   1 
ATOM   3350  N  N     . GLN A 1 436 ? -95.109  45.692  -38.763 1.00 65.37  ?  436 GLN A N     1 
ATOM   3351  C  CA    . GLN A 1 436 ? -95.137  45.755  -40.220 1.00 65.64  ?  436 GLN A CA    1 
ATOM   3352  C  C     . GLN A 1 436 ? -94.611  47.071  -40.829 1.00 66.59  ?  436 GLN A C     1 
ATOM   3353  O  O     . GLN A 1 436 ? -93.771  47.035  -41.722 1.00 69.78  ?  436 GLN A O     1 
ATOM   3354  C  CB    . GLN A 1 436 ? -96.529  45.407  -40.729 1.00 67.04  ?  436 GLN A CB    1 
ATOM   3355  C  CG    . GLN A 1 436 ? -96.864  43.958  -40.449 1.00 71.63  ?  436 GLN A CG    1 
ATOM   3356  C  CD    . GLN A 1 436 ? -98.254  43.577  -40.885 1.00 79.24  ?  436 GLN A CD    1 
ATOM   3357  O  OE1   . GLN A 1 436 ? -99.201  44.349  -40.721 1.00 83.48  ?  436 GLN A OE1   1 
ATOM   3358  N  NE2   . GLN A 1 436 ? -98.389  42.378  -41.449 1.00 80.91  ?  436 GLN A NE2   1 
ATOM   3359  N  N     . GLU A 1 437 ? -95.088  48.218  -40.351 1.00 68.67  ?  437 GLU A N     1 
ATOM   3360  C  CA    . GLU A 1 437 ? -94.506  49.505  -40.743 1.00 72.58  ?  437 GLU A CA    1 
ATOM   3361  C  C     . GLU A 1 437 ? -92.972  49.470  -40.612 1.00 73.57  ?  437 GLU A C     1 
ATOM   3362  O  O     . GLU A 1 437 ? -92.259  49.872  -41.526 1.00 81.54  ?  437 GLU A O     1 
ATOM   3363  C  CB    . GLU A 1 437 ? -95.096  50.681  -39.931 1.00 78.29  ?  437 GLU A CB    1 
ATOM   3364  C  CG    . GLU A 1 437 ? -96.589  50.994  -40.185 1.00 81.70  ?  437 GLU A CG    1 
ATOM   3365  N  N     . GLU A 1 438 ? -92.451  48.988  -39.488 1.00 71.11  ?  438 GLU A N     1 
ATOM   3366  C  CA    . GLU A 1 438 ? -90.994  48.900  -39.347 1.00 71.22  ?  438 GLU A CA    1 
ATOM   3367  C  C     . GLU A 1 438 ? -90.368  47.918  -40.355 1.00 73.10  ?  438 GLU A C     1 
ATOM   3368  O  O     . GLU A 1 438 ? -89.288  48.160  -40.879 1.00 78.22  ?  438 GLU A O     1 
ATOM   3369  C  CB    . GLU A 1 438 ? -90.566  48.550  -37.914 1.00 71.49  ?  438 GLU A CB    1 
ATOM   3370  C  CG    . GLU A 1 438 ? -89.056  48.333  -37.793 1.00 81.05  ?  438 GLU A CG    1 
ATOM   3371  C  CD    . GLU A 1 438 ? -88.563  48.058  -36.373 1.00 89.79  ?  438 GLU A CD    1 
ATOM   3372  O  OE1   . GLU A 1 438 ? -87.447  48.526  -36.048 1.00 88.94  ?  438 GLU A OE1   1 
ATOM   3373  O  OE2   . GLU A 1 438 ? -89.266  47.366  -35.598 1.00 92.62  ?  438 GLU A OE2   1 
ATOM   3374  N  N     . GLU A 1 439 ? -91.052  46.813  -40.620 1.00 73.06  ?  439 GLU A N     1 
ATOM   3375  C  CA    . GLU A 1 439 ? -90.582  45.816  -41.577 1.00 71.57  ?  439 GLU A CA    1 
ATOM   3376  C  C     . GLU A 1 439 ? -90.408  46.493  -42.949 1.00 69.11  ?  439 GLU A C     1 
ATOM   3377  O  O     . GLU A 1 439 ? -89.414  46.288  -43.631 1.00 74.06  ?  439 GLU A O     1 
ATOM   3378  C  CB    . GLU A 1 439 ? -91.593  44.661  -41.629 1.00 75.67  ?  439 GLU A CB    1 
ATOM   3379  C  CG    . GLU A 1 439 ? -91.122  43.334  -42.176 1.00 84.39  ?  439 GLU A CG    1 
ATOM   3380  C  CD    . GLU A 1 439 ? -92.302  42.366  -42.422 1.00 101.02 ?  439 GLU A CD    1 
ATOM   3381  O  OE1   . GLU A 1 439 ? -92.098  41.123  -42.486 1.00 108.82 ?  439 GLU A OE1   1 
ATOM   3382  O  OE2   . GLU A 1 439 ? -93.447  42.858  -42.560 1.00 104.67 ?  439 GLU A OE2   1 
ATOM   3383  N  N     . ALA A 1 440 ? -91.363  47.329  -43.339 1.00 65.75  ?  440 ALA A N     1 
ATOM   3384  C  CA    . ALA A 1 440 ? -91.245  48.080  -44.586 1.00 71.17  ?  440 ALA A CA    1 
ATOM   3385  C  C     . ALA A 1 440 ? -90.057  49.047  -44.556 1.00 71.80  ?  440 ALA A C     1 
ATOM   3386  O  O     . ALA A 1 440 ? -89.128  48.917  -45.351 1.00 76.88  ?  440 ALA A O     1 
ATOM   3387  C  CB    . ALA A 1 440 ? -92.534  48.828  -44.884 1.00 59.03  ?  440 ALA A CB    1 
ATOM   3388  N  N     . GLU A 1 441 ? -90.087  50.012  -43.638 1.00 67.34  ?  441 GLU A N     1 
ATOM   3389  C  CA    . GLU A 1 441 ? -88.997  50.976  -43.519 1.00 66.44  ?  441 GLU A CA    1 
ATOM   3390  C  C     . GLU A 1 441 ? -87.628  50.266  -43.609 1.00 66.15  ?  441 GLU A C     1 
ATOM   3391  O  O     . GLU A 1 441 ? -86.674  50.807  -44.171 1.00 69.31  ?  441 GLU A O     1 
ATOM   3392  C  CB    . GLU A 1 441 ? -89.135  51.843  -42.241 1.00 53.66  ?  441 GLU A CB    1 
ATOM   3393  N  N     . LEU A 1 442 ? -87.547  49.042  -43.095 1.00 59.37  ?  442 LEU A N     1 
ATOM   3394  C  CA    . LEU A 1 442 ? -86.273  48.330  -43.036 1.00 61.07  ?  442 LEU A CA    1 
ATOM   3395  C  C     . LEU A 1 442 ? -85.887  47.740  -44.379 1.00 67.64  ?  442 LEU A C     1 
ATOM   3396  O  O     . LEU A 1 442 ? -84.719  47.783  -44.798 1.00 67.63  ?  442 LEU A O     1 
ATOM   3397  C  CB    . LEU A 1 442 ? -86.297  47.236  -41.954 1.00 62.05  ?  442 LEU A CB    1 
ATOM   3398  C  CG    . LEU A 1 442 ? -86.028  47.813  -40.558 1.00 62.85  ?  442 LEU A CG    1 
ATOM   3399  C  CD1   . LEU A 1 442 ? -86.113  46.767  -39.471 1.00 63.27  ?  442 LEU A CD1   1 
ATOM   3400  C  CD2   . LEU A 1 442 ? -84.668  48.448  -40.551 1.00 63.66  ?  442 LEU A CD2   1 
ATOM   3401  N  N     . ARG A 1 443 ? -86.880  47.185  -45.055 1.00 69.11  ?  443 ARG A N     1 
ATOM   3402  C  CA    . ARG A 1 443 ? -86.659  46.620  -46.369 1.00 68.54  ?  443 ARG A CA    1 
ATOM   3403  C  C     . ARG A 1 443 ? -86.219  47.716  -47.338 1.00 75.21  ?  443 ARG A C     1 
ATOM   3404  O  O     . ARG A 1 443 ? -85.328  47.505  -48.160 1.00 85.92  ?  443 ARG A O     1 
ATOM   3405  C  CB    . ARG A 1 443 ? -87.929  45.936  -46.863 1.00 68.60  ?  443 ARG A CB    1 
ATOM   3406  C  CG    . ARG A 1 443 ? -88.420  44.812  -45.973 1.00 68.66  ?  443 ARG A CG    1 
ATOM   3407  C  CD    . ARG A 1 443 ? -89.476  43.980  -46.666 1.00 83.56  ?  443 ARG A CD    1 
ATOM   3408  N  NE    . ARG A 1 443 ? -89.024  42.601  -46.794 1.00 101.25 ?  443 ARG A NE    1 
ATOM   3409  C  CZ    . ARG A 1 443 ? -89.503  41.587  -46.078 1.00 112.67 ?  443 ARG A CZ    1 
ATOM   3410  N  NH1   . ARG A 1 443 ? -90.477  41.793  -45.191 1.00 106.26 ?  443 ARG A NH1   1 
ATOM   3411  N  NH2   . ARG A 1 443 ? -89.015  40.362  -46.260 1.00 123.87 ?  443 ARG A NH2   1 
ATOM   3412  N  N     . GLU A 1 444 ? -86.837  48.890  -47.231 1.00 69.83  ?  444 GLU A N     1 
ATOM   3413  C  CA    . GLU A 1 444 ? -86.478  50.006  -48.092 1.00 68.15  ?  444 GLU A CA    1 
ATOM   3414  C  C     . GLU A 1 444 ? -85.031  50.410  -47.824 1.00 66.31  ?  444 GLU A C     1 
ATOM   3415  O  O     . GLU A 1 444 ? -84.238  50.531  -48.745 1.00 67.81  ?  444 GLU A O     1 
ATOM   3416  C  CB    . GLU A 1 444 ? -87.431  51.190  -47.881 1.00 68.08  ?  444 GLU A CB    1 
ATOM   3417  C  CG    . GLU A 1 444 ? -88.003  51.776  -49.160 1.00 66.36  ?  444 GLU A CG    1 
ATOM   3418  N  N     . LYS A 1 445 ? -84.683  50.596  -46.555 1.00 66.02  ?  445 LYS A N     1 
ATOM   3419  C  CA    . LYS A 1 445 ? -83.334  51.018  -46.186 1.00 64.14  ?  445 LYS A CA    1 
ATOM   3420  C  C     . LYS A 1 445 ? -82.267  50.070  -46.754 1.00 60.77  ?  445 LYS A C     1 
ATOM   3421  O  O     . LYS A 1 445 ? -81.165  50.493  -47.126 1.00 58.85  ?  445 LYS A O     1 
ATOM   3422  C  CB    . LYS A 1 445 ? -83.203  51.125  -44.658 1.00 57.43  ?  445 LYS A CB    1 
ATOM   3423  C  CG    . LYS A 1 445 ? -81.995  51.955  -44.183 1.00 62.85  ?  445 LYS A CG    1 
ATOM   3424  C  CD    . LYS A 1 445 ? -82.020  52.214  -42.665 1.00 68.80  ?  445 LYS A CD    1 
ATOM   3425  N  N     . ILE A 1 446 ? -82.606  48.787  -46.826 1.00 57.16  ?  446 ILE A N     1 
ATOM   3426  C  CA    . ILE A 1 446 ? -81.646  47.776  -47.236 1.00 58.89  ?  446 ILE A CA    1 
ATOM   3427  C  C     . ILE A 1 446 ? -81.467  47.825  -48.740 1.00 62.88  ?  446 ILE A C     1 
ATOM   3428  O  O     . ILE A 1 446 ? -80.350  47.709  -49.260 1.00 61.54  ?  446 ILE A O     1 
ATOM   3429  C  CB    . ILE A 1 446 ? -82.089  46.368  -46.777 1.00 54.27  ?  446 ILE A CB    1 
ATOM   3430  C  CG1   . ILE A 1 446 ? -82.178  46.326  -45.244 1.00 56.55  ?  446 ILE A CG1   1 
ATOM   3431  C  CG2   . ILE A 1 446 ? -81.157  45.278  -47.344 1.00 63.64  ?  446 ILE A CG2   1 
ATOM   3432  C  CD1   . ILE A 1 446 ? -82.667  45.008  -44.700 1.00 59.92  ?  446 ILE A CD1   1 
ATOM   3433  N  N     . ALA A 1 447 ? -82.579  48.006  -49.441 1.00 63.03  ?  447 ALA A N     1 
ATOM   3434  C  CA    . ALA A 1 447 ? -82.534  48.151  -50.882 1.00 63.53  ?  447 ALA A CA    1 
ATOM   3435  C  C     . ALA A 1 447 ? -81.669  49.356  -51.212 1.00 65.93  ?  447 ALA A C     1 
ATOM   3436  O  O     . ALA A 1 447 ? -80.835  49.294  -52.106 1.00 66.83  ?  447 ALA A O     1 
ATOM   3437  C  CB    . ALA A 1 447 ? -83.920  48.328  -51.435 1.00 57.57  ?  447 ALA A CB    1 
ATOM   3438  N  N     . MET A 1 448 ? -81.848  50.452  -50.478 1.00 66.68  ?  448 MET A N     1 
ATOM   3439  C  CA    . MET A 1 448 ? -81.069  51.646  -50.778 1.00 64.46  ?  448 MET A CA    1 
ATOM   3440  C  C     . MET A 1 448 ? -79.599  51.361  -50.583 1.00 64.39  ?  448 MET A C     1 
ATOM   3441  O  O     . MET A 1 448 ? -78.780  51.705  -51.428 1.00 73.02  ?  448 MET A O     1 
ATOM   3442  C  CB    . MET A 1 448 ? -81.548  52.900  -50.014 1.00 60.45  ?  448 MET A CB    1 
ATOM   3443  C  CG    . MET A 1 448 ? -82.436  53.851  -50.898 1.00 68.42  ?  448 MET A CG    1 
ATOM   3444  N  N     . LEU A 1 449 ? -79.267  50.692  -49.491 1.00 60.25  ?  449 LEU A N     1 
ATOM   3445  C  CA    . LEU A 1 449 ? -77.871  50.452  -49.174 1.00 62.04  ?  449 LEU A CA    1 
ATOM   3446  C  C     . LEU A 1 449 ? -77.261  49.376  -50.072 1.00 64.44  ?  449 LEU A C     1 
ATOM   3447  O  O     . LEU A 1 449 ? -76.069  49.398  -50.379 1.00 62.88  ?  449 LEU A O     1 
ATOM   3448  C  CB    . LEU A 1 449 ? -77.728  50.083  -47.700 1.00 60.60  ?  449 LEU A CB    1 
ATOM   3449  C  CG    . LEU A 1 449 ? -77.962  51.229  -46.717 1.00 56.05  ?  449 LEU A CG    1 
ATOM   3450  C  CD1   . LEU A 1 449 ? -78.864  50.774  -45.581 1.00 55.32  ?  449 LEU A CD1   1 
ATOM   3451  C  CD2   . LEU A 1 449 ? -76.635  51.665  -46.170 1.00 54.19  ?  449 LEU A CD2   1 
ATOM   3452  N  N     . ALA A 1 450 ? -78.072  48.422  -50.491 1.00 55.71  ?  450 ALA A N     1 
ATOM   3453  C  CA    . ALA A 1 450 ? -77.537  47.375  -51.340 1.00 70.71  ?  450 ALA A CA    1 
ATOM   3454  C  C     . ALA A 1 450 ? -77.120  47.989  -52.677 1.00 71.75  ?  450 ALA A C     1 
ATOM   3455  O  O     . ALA A 1 450 ? -76.031  47.729  -53.180 1.00 72.07  ?  450 ALA A O     1 
ATOM   3456  C  CB    . ALA A 1 450 ? -78.556  46.279  -51.532 1.00 67.29  ?  450 ALA A CB    1 
ATOM   3457  N  N     . ALA A 1 451 ? -77.990  48.828  -53.230 1.00 71.70  ?  451 ALA A N     1 
ATOM   3458  C  CA    . ALA A 1 451 ? -77.697  49.561  -54.460 1.00 69.91  ?  451 ALA A CA    1 
ATOM   3459  C  C     . ALA A 1 451 ? -76.325  50.233  -54.387 1.00 68.60  ?  451 ALA A C     1 
ATOM   3460  O  O     . ALA A 1 451 ? -75.468  50.010  -55.231 1.00 73.99  ?  451 ALA A O     1 
ATOM   3461  C  CB    . ALA A 1 451 ? -78.785  50.595  -54.735 1.00 71.62  ?  451 ALA A CB    1 
ATOM   3462  N  N     . ILE A 1 452 ? -76.117  51.064  -53.378 1.00 62.73  ?  452 ILE A N     1 
ATOM   3463  C  CA    . ILE A 1 452 ? -74.809  51.666  -53.177 1.00 64.71  ?  452 ILE A CA    1 
ATOM   3464  C  C     . ILE A 1 452 ? -73.680  50.641  -53.325 1.00 70.79  ?  452 ILE A C     1 
ATOM   3465  O  O     . ILE A 1 452 ? -72.637  50.907  -53.928 1.00 74.85  ?  452 ILE A O     1 
ATOM   3466  C  CB    . ILE A 1 452 ? -74.709  52.308  -51.794 1.00 56.90  ?  452 ILE A CB    1 
ATOM   3467  C  CG1   . ILE A 1 452 ? -75.909  53.231  -51.569 1.00 56.11  ?  452 ILE A CG1   1 
ATOM   3468  C  CG2   . ILE A 1 452 ? -73.385  53.037  -51.651 1.00 57.97  ?  452 ILE A CG2   1 
ATOM   3469  C  CD1   . ILE A 1 452 ? -75.596  54.432  -50.708 1.00 56.29  ?  452 ILE A CD1   1 
ATOM   3470  N  N     . ILE A 1 453 ? -73.887  49.459  -52.780 1.00 59.25  ?  453 ILE A N     1 
ATOM   3471  C  CA    . ILE A 1 453 ? -72.778  48.548  -52.675 1.00 74.49  ?  453 ILE A CA    1 
ATOM   3472  C  C     . ILE A 1 453 ? -72.589  47.898  -54.020 1.00 72.68  ?  453 ILE A C     1 
ATOM   3473  O  O     . ILE A 1 453 ? -71.460  47.634  -54.432 1.00 78.55  ?  453 ILE A O     1 
ATOM   3474  C  CB    . ILE A 1 453 ? -73.002  47.512  -51.559 1.00 73.75  ?  453 ILE A CB    1 
ATOM   3475  C  CG1   . ILE A 1 453 ? -73.208  48.240  -50.225 1.00 73.56  ?  453 ILE A CG1   1 
ATOM   3476  C  CG2   . ILE A 1 453 ? -71.838  46.518  -51.498 1.00 67.29  ?  453 ILE A CG2   1 
ATOM   3477  C  CD1   . ILE A 1 453 ? -73.612  47.345  -49.072 1.00 76.66  ?  453 ILE A CD1   1 
ATOM   3478  N  N     . GLY A 1 454 ? -73.701  47.681  -54.716 1.00 70.86  ?  454 GLY A N     1 
ATOM   3479  C  CA    . GLY A 1 454 ? -73.702  46.950  -55.980 1.00 76.27  ?  454 GLY A CA    1 
ATOM   3480  C  C     . GLY A 1 454 ? -73.583  47.770  -57.261 1.00 76.03  ?  454 GLY A C     1 
ATOM   3481  O  O     . GLY A 1 454 ? -73.336  47.210  -58.331 1.00 85.68  ?  454 GLY A O     1 
ATOM   3482  N  N     . ASP A 1 455 ? -73.751  49.089  -57.142 1.00 69.55  ?  455 ASP A N     1 
ATOM   3483  C  CA    . ASP A 1 455 ? -73.671  50.011  -58.268 1.00 72.78  ?  455 ASP A CA    1 
ATOM   3484  C  C     . ASP A 1 455 ? -72.639  51.127  -58.080 1.00 75.62  ?  455 ASP A C     1 
ATOM   3485  O  O     . ASP A 1 455 ? -72.880  52.123  -57.388 1.00 63.33  ?  455 ASP A O     1 
ATOM   3486  C  CB    . ASP A 1 455 ? -75.039  50.619  -58.585 1.00 75.24  ?  455 ASP A CB    1 
ATOM   3487  C  CG    . ASP A 1 455 ? -74.970  51.658  -59.700 1.00 83.31  ?  455 ASP A CG    1 
ATOM   3488  O  OD1   . ASP A 1 455 ? -74.659  51.294  -60.858 1.00 85.15  ?  455 ASP A OD1   1 
ATOM   3489  O  OD2   . ASP A 1 455 ? -75.224  52.842  -59.409 1.00 89.51  ?  455 ASP A OD2   1 
ATOM   3490  N  N     . GLU A 1 456 ? -71.509  50.958  -58.754 1.00 76.07  ?  456 GLU A N     1 
ATOM   3491  C  CA    . GLU A 1 456 ? -70.405  51.902  -58.710 1.00 74.44  ?  456 GLU A CA    1 
ATOM   3492  C  C     . GLU A 1 456 ? -70.863  53.360  -58.890 1.00 70.49  ?  456 GLU A C     1 
ATOM   3493  O  O     . GLU A 1 456 ? -70.259  54.267  -58.331 1.00 69.47  ?  456 GLU A O     1 
ATOM   3494  C  CB    . GLU A 1 456 ? -69.358  51.508  -59.769 1.00 81.47  ?  456 GLU A CB    1 
ATOM   3495  C  CG    . GLU A 1 456 ? -67.897  51.803  -59.433 1.00 96.51  ?  456 GLU A CG    1 
ATOM   3496  C  CD    . GLU A 1 456 ? -67.357  50.977  -58.252 1.00 115.18 ?  456 GLU A CD    1 
ATOM   3497  O  OE1   . GLU A 1 456 ? -66.235  51.282  -57.774 1.00 122.40 ?  456 GLU A OE1   1 
ATOM   3498  O  OE2   . GLU A 1 456 ? -68.046  50.032  -57.801 1.00 118.48 ?  456 GLU A OE2   1 
ATOM   3499  N  N     . ARG A 1 457 ? -71.922  53.593  -59.663 1.00 68.13  ?  457 ARG A N     1 
ATOM   3500  C  CA    . ARG A 1 457 ? -72.336  54.970  -59.962 1.00 66.45  ?  457 ARG A CA    1 
ATOM   3501  C  C     . ARG A 1 457 ? -73.193  55.581  -58.859 1.00 65.31  ?  457 ARG A C     1 
ATOM   3502  O  O     . ARG A 1 457 ? -72.922  56.697  -58.413 1.00 62.79  ?  457 ARG A O     1 
ATOM   3503  C  CB    . ARG A 1 457 ? -73.064  55.049  -61.306 1.00 66.61  ?  457 ARG A CB    1 
ATOM   3504  C  CG    . ARG A 1 457 ? -73.575  56.447  -61.688 1.00 66.78  ?  457 ARG A CG    1 
ATOM   3505  C  CD    . ARG A 1 457 ? -74.347  56.366  -62.990 1.00 74.30  ?  457 ARG A CD    1 
ATOM   3506  N  NE    . ARG A 1 457 ? -75.086  57.571  -63.356 1.00 78.02  ?  457 ARG A NE    1 
ATOM   3507  C  CZ    . ARG A 1 457 ? -75.997  57.590  -64.332 1.00 79.93  ?  457 ARG A CZ    1 
ATOM   3508  N  NH1   . ARG A 1 457 ? -76.263  56.479  -65.011 1.00 79.14  ?  457 ARG A NH1   1 
ATOM   3509  N  NH2   . ARG A 1 457 ? -76.646  58.704  -64.635 1.00 82.70  ?  457 ARG A NH2   1 
ATOM   3510  N  N     . THR A 1 458 ? -74.237  54.856  -58.451 1.00 65.46  ?  458 THR A N     1 
ATOM   3511  C  CA    . THR A 1 458 ? -75.003  55.181  -57.257 1.00 65.92  ?  458 THR A CA    1 
ATOM   3512  C  C     . THR A 1 458 ? -74.030  55.557  -56.131 1.00 72.35  ?  458 THR A C     1 
ATOM   3513  O  O     . THR A 1 458 ? -74.198  56.580  -55.442 1.00 80.26  ?  458 THR A O     1 
ATOM   3514  C  CB    . THR A 1 458 ? -75.829  53.968  -56.779 1.00 70.61  ?  458 THR A CB    1 
ATOM   3515  O  OG1   . THR A 1 458 ? -77.065  53.899  -57.491 1.00 67.15  ?  458 THR A OG1   1 
ATOM   3516  C  CG2   . THR A 1 458 ? -76.160  54.105  -55.309 1.00 84.75  ?  458 THR A CG2   1 
ATOM   3517  N  N     . MET A 1 459 ? -73.015  54.715  -55.944 1.00 68.71  ?  459 MET A N     1 
ATOM   3518  C  CA    . MET A 1 459 ? -72.024  54.941  -54.905 1.00 70.32  ?  459 MET A CA    1 
ATOM   3519  C  C     . MET A 1 459 ? -71.304  56.285  -55.093 1.00 68.19  ?  459 MET A C     1 
ATOM   3520  O  O     . MET A 1 459 ? -71.409  57.181  -54.261 1.00 69.11  ?  459 MET A O     1 
ATOM   3521  C  CB    . MET A 1 459 ? -71.041  53.772  -54.837 1.00 71.39  ?  459 MET A CB    1 
ATOM   3522  C  CG    . MET A 1 459 ? -70.041  53.882  -53.707 1.00 59.31  ?  459 MET A CG    1 
ATOM   3523  S  SD    . MET A 1 459 ? -68.795  55.062  -54.161 1.00 78.26  ?  459 MET A SD    1 
ATOM   3524  C  CE    . MET A 1 459 ? -67.943  54.149  -55.451 1.00 58.40  ?  459 MET A CE    1 
ATOM   3525  N  N     . TYR A 1 460 ? -70.579  56.426  -56.190 1.00 68.26  ?  460 TYR A N     1 
ATOM   3526  C  CA    . TYR A 1 460 ? -69.944  57.695  -56.523 1.00 66.84  ?  460 TYR A CA    1 
ATOM   3527  C  C     . TYR A 1 460 ? -70.905  58.907  -56.433 1.00 66.41  ?  460 TYR A C     1 
ATOM   3528  O  O     . TYR A 1 460 ? -70.487  59.998  -56.044 1.00 69.90  ?  460 TYR A O     1 
ATOM   3529  C  CB    . TYR A 1 460 ? -69.271  57.606  -57.896 1.00 54.62  ?  460 TYR A CB    1 
ATOM   3530  C  CG    . TYR A 1 460 ? -67.917  56.947  -57.859 1.00 55.17  ?  460 TYR A CG    1 
ATOM   3531  C  CD1   . TYR A 1 460 ? -66.886  57.510  -57.132 1.00 75.85  ?  460 TYR A CD1   1 
ATOM   3532  C  CD2   . TYR A 1 460 ? -67.658  55.766  -58.551 1.00 57.19  ?  460 TYR A CD2   1 
ATOM   3533  C  CE1   . TYR A 1 460 ? -65.626  56.923  -57.087 1.00 75.15  ?  460 TYR A CE1   1 
ATOM   3534  C  CE2   . TYR A 1 460 ? -66.383  55.160  -58.510 1.00 58.36  ?  460 TYR A CE2   1 
ATOM   3535  C  CZ    . TYR A 1 460 ? -65.370  55.751  -57.772 1.00 69.61  ?  460 TYR A CZ    1 
ATOM   3536  O  OH    . TYR A 1 460 ? -64.092  55.196  -57.689 1.00 67.30  ?  460 TYR A OH    1 
ATOM   3537  N  N     . ASN A 1 461 ? -72.183  58.733  -56.767 1.00 61.14  ?  461 ASN A N     1 
ATOM   3538  C  CA    . ASN A 1 461 ? -73.111  59.862  -56.668 1.00 66.09  ?  461 ASN A CA    1 
ATOM   3539  C  C     . ASN A 1 461 ? -73.242  60.318  -55.244 1.00 68.65  ?  461 ASN A C     1 
ATOM   3540  O  O     . ASN A 1 461 ? -73.221  61.511  -54.977 1.00 66.19  ?  461 ASN A O     1 
ATOM   3541  C  CB    . ASN A 1 461 ? -74.513  59.496  -57.108 1.00 75.64  ?  461 ASN A CB    1 
ATOM   3542  C  CG    . ASN A 1 461 ? -74.660  59.407  -58.583 1.00 73.39  ?  461 ASN A CG    1 
ATOM   3543  O  OD1   . ASN A 1 461 ? -73.875  59.990  -59.345 1.00 76.49  ?  461 ASN A OD1   1 
ATOM   3544  N  ND2   . ASN A 1 461 ? -75.694  58.671  -59.015 1.00 76.34  ?  461 ASN A ND2   1 
ATOM   3545  N  N     . LEU A 1 462 ? -73.454  59.348  -54.351 1.00 69.94  ?  462 LEU A N     1 
ATOM   3546  C  CA    . LEU A 1 462 ? -73.501  59.578  -52.913 1.00 67.11  ?  462 LEU A CA    1 
ATOM   3547  C  C     . LEU A 1 462 ? -72.266  60.324  -52.460 1.00 64.32  ?  462 LEU A C     1 
ATOM   3548  O  O     . LEU A 1 462 ? -72.351  61.317  -51.735 1.00 66.13  ?  462 LEU A O     1 
ATOM   3549  C  CB    . LEU A 1 462 ? -73.528  58.245  -52.171 1.00 66.65  ?  462 LEU A CB    1 
ATOM   3550  C  CG    . LEU A 1 462 ? -74.431  58.169  -50.937 1.00 58.83  ?  462 LEU A CG    1 
ATOM   3551  C  CD1   . LEU A 1 462 ? -73.937  57.108  -49.992 1.00 70.02  ?  462 LEU A CD1   1 
ATOM   3552  C  CD2   . LEU A 1 462 ? -74.491  59.516  -50.294 1.00 58.22  ?  462 LEU A CD2   1 
ATOM   3553  N  N     . MET A 1 463 ? -71.110  59.827  -52.880 1.00 58.72  ?  463 MET A N     1 
ATOM   3554  C  CA    . MET A 1 463 ? -69.846  60.424  -52.486 1.00 53.45  ?  463 MET A CA    1 
ATOM   3555  C  C     . MET A 1 463 ? -69.791  61.903  -52.871 1.00 56.87  ?  463 MET A C     1 
ATOM   3556  O  O     . MET A 1 463 ? -69.392  62.741  -52.066 1.00 59.41  ?  463 MET A O     1 
ATOM   3557  C  CB    . MET A 1 463 ? -68.689  59.625  -53.076 1.00 51.26  ?  463 MET A CB    1 
ATOM   3558  C  CG    . MET A 1 463 ? -67.377  60.363  -53.172 1.00 50.07  ?  463 MET A CG    1 
ATOM   3559  S  SD    . MET A 1 463 ? -66.071  59.151  -53.458 1.00 65.47  ?  463 MET A SD    1 
ATOM   3560  C  CE    . MET A 1 463 ? -64.832  60.185  -54.221 1.00 65.11  ?  463 MET A CE    1 
ATOM   3561  N  N     . LYS A 1 464 ? -70.207  62.225  -54.092 1.00 59.09  ?  464 LYS A N     1 
ATOM   3562  C  CA    . LYS A 1 464 ? -70.279  63.624  -54.523 1.00 60.28  ?  464 LYS A CA    1 
ATOM   3563  C  C     . LYS A 1 464 ? -71.242  64.418  -53.634 1.00 62.39  ?  464 LYS A C     1 
ATOM   3564  O  O     . LYS A 1 464 ? -70.902  65.499  -53.151 1.00 66.85  ?  464 LYS A O     1 
ATOM   3565  C  CB    . LYS A 1 464 ? -70.719  63.738  -55.996 1.00 58.60  ?  464 LYS A CB    1 
ATOM   3566  C  CG    . LYS A 1 464 ? -69.622  63.522  -57.030 1.00 63.20  ?  464 LYS A CG    1 
ATOM   3567  C  CD    . LYS A 1 464 ? -70.181  62.828  -58.267 1.00 67.43  ?  464 LYS A CD    1 
ATOM   3568  C  CE    . LYS A 1 464 ? -71.496  63.470  -58.697 1.00 73.29  ?  464 LYS A CE    1 
ATOM   3569  N  NZ    . LYS A 1 464 ? -72.176  62.748  -59.806 1.00 76.57  ?  464 LYS A NZ    1 
ATOM   3570  N  N     . LYS A 1 465 ? -72.443  63.875  -53.440 1.00 60.06  ?  465 LYS A N     1 
ATOM   3571  C  CA    . LYS A 1 465 ? -73.466  64.516  -52.630 1.00 61.55  ?  465 LYS A CA    1 
ATOM   3572  C  C     . LYS A 1 465 ? -72.851  64.928  -51.306 1.00 69.79  ?  465 LYS A C     1 
ATOM   3573  O  O     . LYS A 1 465 ? -73.003  66.078  -50.878 1.00 75.06  ?  465 LYS A O     1 
ATOM   3574  C  CB    . LYS A 1 465 ? -74.691  63.597  -52.415 1.00 54.79  ?  465 LYS A CB    1 
ATOM   3575  C  CG    . LYS A 1 465 ? -75.673  64.105  -51.355 1.00 72.03  ?  465 LYS A CG    1 
ATOM   3576  C  CD    . LYS A 1 465 ? -77.124  63.655  -51.576 1.00 80.00  ?  465 LYS A CD    1 
ATOM   3577  C  CE    . LYS A 1 465 ? -77.552  62.542  -50.610 1.00 94.62  ?  465 LYS A CE    1 
ATOM   3578  N  NZ    . LYS A 1 465 ? -77.372  62.897  -49.158 1.00 103.28 ?  465 LYS A NZ    1 
ATOM   3579  N  N     . GLU A 1 466 ? -72.135  63.996  -50.674 1.00 70.12  ?  466 GLU A N     1 
ATOM   3580  C  CA    . GLU A 1 466 ? -71.580  64.241  -49.345 1.00 70.25  ?  466 GLU A CA    1 
ATOM   3581  C  C     . GLU A 1 466 ? -70.489  65.319  -49.394 1.00 74.10  ?  466 GLU A C     1 
ATOM   3582  O  O     . GLU A 1 466 ? -70.565  66.318  -48.689 1.00 76.64  ?  466 GLU A O     1 
ATOM   3583  C  CB    . GLU A 1 466 ? -71.111  62.932  -48.684 1.00 67.06  ?  466 GLU A CB    1 
ATOM   3584  C  CG    . GLU A 1 466 ? -72.261  61.952  -48.467 1.00 76.20  ?  466 GLU A CG    1 
ATOM   3585  C  CD    . GLU A 1 466 ? -71.964  60.795  -47.497 1.00 90.21  ?  466 GLU A CD    1 
ATOM   3586  O  OE1   . GLU A 1 466 ? -70.795  60.657  -47.050 1.00 95.53  ?  466 GLU A OE1   1 
ATOM   3587  O  OE2   . GLU A 1 466 ? -72.927  60.030  -47.177 1.00 93.58  ?  466 GLU A OE2   1 
ATOM   3588  N  N     . LEU A 1 467 ? -69.496  65.130  -50.250 1.00 73.44  ?  467 LEU A N     1 
ATOM   3589  C  CA    . LEU A 1 467 ? -68.493  66.161  -50.480 1.00 68.39  ?  467 LEU A CA    1 
ATOM   3590  C  C     . LEU A 1 467 ? -69.091  67.565  -50.593 1.00 74.80  ?  467 LEU A C     1 
ATOM   3591  O  O     . LEU A 1 467 ? -68.594  68.512  -49.979 1.00 84.53  ?  467 LEU A O     1 
ATOM   3592  C  CB    . LEU A 1 467 ? -67.676  65.821  -51.724 1.00 54.69  ?  467 LEU A CB    1 
ATOM   3593  C  CG    . LEU A 1 467 ? -66.622  64.788  -51.349 1.00 59.96  ?  467 LEU A CG    1 
ATOM   3594  C  CD1   . LEU A 1 467 ? -65.966  64.135  -52.557 1.00 66.63  ?  467 LEU A CD1   1 
ATOM   3595  C  CD2   . LEU A 1 467 ? -65.586  65.447  -50.458 1.00 58.55  ?  467 LEU A CD2   1 
ATOM   3596  N  N     . ARG A 1 468 ? -70.157  67.697  -51.372 1.00 67.53  ?  468 ARG A N     1 
ATOM   3597  C  CA    . ARG A 1 468 ? -70.787  68.995  -51.567 1.00 60.36  ?  468 ARG A CA    1 
ATOM   3598  C  C     . ARG A 1 468 ? -71.382  69.548  -50.276 1.00 68.87  ?  468 ARG A C     1 
ATOM   3599  O  O     . ARG A 1 468 ? -71.188  70.716  -49.960 1.00 73.77  ?  468 ARG A O     1 
ATOM   3600  C  CB    . ARG A 1 468 ? -71.861  68.917  -52.642 1.00 58.26  ?  468 ARG A CB    1 
ATOM   3601  C  CG    . ARG A 1 468 ? -71.345  68.495  -54.009 1.00 57.36  ?  468 ARG A CG    1 
ATOM   3602  C  CD    . ARG A 1 468 ? -72.434  68.688  -55.064 1.00 70.84  ?  468 ARG A CD    1 
ATOM   3603  N  NE    . ARG A 1 468 ? -71.926  68.535  -56.426 1.00 80.86  ?  468 ARG A NE    1 
ATOM   3604  C  CZ    . ARG A 1 468 ? -72.247  67.533  -57.239 1.00 83.00  ?  468 ARG A CZ    1 
ATOM   3605  N  NH1   . ARG A 1 468 ? -73.091  66.578  -56.836 1.00 76.61  ?  468 ARG A NH1   1 
ATOM   3606  N  NH2   . ARG A 1 468 ? -71.720  67.493  -58.458 1.00 85.52  ?  468 ARG A NH2   1 
ATOM   3607  N  N     . GLU A 1 469 ? -72.114  68.720  -49.534 1.00 71.18  ?  469 GLU A N     1 
ATOM   3608  C  CA    . GLU A 1 469 ? -72.624  69.140  -48.221 1.00 69.80  ?  469 GLU A CA    1 
ATOM   3609  C  C     . GLU A 1 469 ? -71.488  69.735  -47.356 1.00 64.44  ?  469 GLU A C     1 
ATOM   3610  O  O     . GLU A 1 469 ? -71.638  70.795  -46.749 1.00 63.73  ?  469 GLU A O     1 
ATOM   3611  C  CB    . GLU A 1 469 ? -73.335  67.983  -47.489 1.00 71.35  ?  469 GLU A CB    1 
ATOM   3612  C  CG    . GLU A 1 469 ? -74.781  67.746  -47.922 1.00 90.64  ?  469 GLU A CG    1 
ATOM   3613  C  CD    . GLU A 1 469 ? -75.260  66.310  -47.672 1.00 103.56 ?  469 GLU A CD    1 
ATOM   3614  O  OE1   . GLU A 1 469 ? -74.413  65.449  -47.351 1.00 102.86 ?  469 GLU A OE1   1 
ATOM   3615  O  OE2   . GLU A 1 469 ? -76.480  66.038  -47.805 1.00 112.09 ?  469 GLU A OE2   1 
ATOM   3616  N  N     . VAL A 1 470 ? -70.354  69.046  -47.321 1.00 61.02  ?  470 VAL A N     1 
ATOM   3617  C  CA    . VAL A 1 470 ? -69.201  69.492  -46.575 1.00 60.85  ?  470 VAL A CA    1 
ATOM   3618  C  C     . VAL A 1 470 ? -68.754  70.874  -47.046 1.00 62.66  ?  470 VAL A C     1 
ATOM   3619  O  O     . VAL A 1 470 ? -68.542  71.789  -46.239 1.00 69.31  ?  470 VAL A O     1 
ATOM   3620  C  CB    . VAL A 1 470 ? -68.064  68.466  -46.691 1.00 57.88  ?  470 VAL A CB    1 
ATOM   3621  C  CG1   . VAL A 1 470 ? -66.734  69.051  -46.202 1.00 54.39  ?  470 VAL A CG1   1 
ATOM   3622  C  CG2   . VAL A 1 470 ? -68.436  67.224  -45.909 1.00 66.21  ?  470 VAL A CG2   1 
ATOM   3623  N  N     . LYS A 1 471 ? -68.623  71.024  -48.357 1.00 56.98  ?  471 LYS A N     1 
ATOM   3624  C  CA    . LYS A 1 471 ? -68.327  72.324  -48.940 1.00 56.75  ?  471 LYS A CA    1 
ATOM   3625  C  C     . LYS A 1 471 ? -69.357  73.402  -48.573 1.00 57.52  ?  471 LYS A C     1 
ATOM   3626  O  O     . LYS A 1 471 ? -68.973  74.516  -48.253 1.00 64.94  ?  471 LYS A O     1 
ATOM   3627  C  CB    . LYS A 1 471 ? -68.203  72.208  -50.464 1.00 62.77  ?  471 LYS A CB    1 
ATOM   3628  C  CG    . LYS A 1 471 ? -68.404  73.518  -51.200 1.00 65.87  ?  471 LYS A CG    1 
ATOM   3629  C  CD    . LYS A 1 471 ? -67.777  73.466  -52.566 1.00 65.29  ?  471 LYS A CD    1 
ATOM   3630  C  CE    . LYS A 1 471 ? -68.134  74.706  -53.375 1.00 67.30  ?  471 LYS A CE    1 
ATOM   3631  N  NZ    . LYS A 1 471 ? -68.729  74.347  -54.691 1.00 66.17  ?  471 LYS A NZ    1 
ATOM   3632  N  N     . LYS A 1 472 ? -70.656  73.094  -48.621 1.00 54.98  ?  472 LYS A N     1 
ATOM   3633  C  CA    . LYS A 1 472 ? -71.650  74.133  -48.339 1.00 60.22  ?  472 LYS A CA    1 
ATOM   3634  C  C     . LYS A 1 472 ? -71.490  74.602  -46.911 1.00 68.40  ?  472 LYS A C     1 
ATOM   3635  O  O     . LYS A 1 472 ? -71.834  75.736  -46.567 1.00 80.00  ?  472 LYS A O     1 
ATOM   3636  C  CB    . LYS A 1 472 ? -73.099  73.668  -48.568 1.00 55.14  ?  472 LYS A CB    1 
ATOM   3637  C  CG    . LYS A 1 472 ? -74.141  74.791  -48.300 1.00 65.54  ?  472 LYS A CG    1 
ATOM   3638  C  CD    . LYS A 1 472 ? -75.609  74.417  -48.640 1.00 61.38  ?  472 LYS A CD    1 
ATOM   3639  N  N     . LYS A 1 473 ? -70.955  73.716  -46.081 1.00 63.66  ?  473 LYS A N     1 
ATOM   3640  C  CA    . LYS A 1 473 ? -71.004  73.923  -44.651 1.00 63.37  ?  473 LYS A CA    1 
ATOM   3641  C  C     . LYS A 1 473 ? -69.755  74.598  -44.127 1.00 68.90  ?  473 LYS A C     1 
ATOM   3642  O  O     . LYS A 1 473 ? -69.829  75.369  -43.169 1.00 74.94  ?  473 LYS A O     1 
ATOM   3643  C  CB    . LYS A 1 473 ? -71.244  72.600  -43.915 1.00 59.05  ?  473 LYS A CB    1 
ATOM   3644  C  CG    . LYS A 1 473 ? -71.217  72.744  -42.406 1.00 61.10  ?  473 LYS A CG    1 
ATOM   3645  C  CD    . LYS A 1 473 ? -71.790  71.562  -41.648 1.00 67.24  ?  473 LYS A CD    1 
ATOM   3646  C  CE    . LYS A 1 473 ? -71.909  71.928  -40.158 1.00 78.10  ?  473 LYS A CE    1 
ATOM   3647  N  NZ    . LYS A 1 473 ? -72.391  70.792  -39.317 1.00 86.38  ?  473 LYS A NZ    1 
ATOM   3648  N  N     . PHE A 1 474 ? -68.615  74.316  -44.753 1.00 67.15  ?  474 PHE A N     1 
ATOM   3649  C  CA    . PHE A 1 474 ? -67.337  74.758  -44.211 1.00 68.53  ?  474 PHE A CA    1 
ATOM   3650  C  C     . PHE A 1 474 ? -66.576  75.630  -45.169 1.00 73.53  ?  474 PHE A C     1 
ATOM   3651  O  O     . PHE A 1 474 ? -65.448  76.039  -44.880 1.00 87.42  ?  474 PHE A O     1 
ATOM   3652  C  CB    . PHE A 1 474 ? -66.462  73.564  -43.836 1.00 65.37  ?  474 PHE A CB    1 
ATOM   3653  C  CG    . PHE A 1 474 ? -67.020  72.729  -42.724 1.00 60.21  ?  474 PHE A CG    1 
ATOM   3654  C  CD1   . PHE A 1 474 ? -67.030  73.202  -41.427 1.00 58.62  ?  474 PHE A CD1   1 
ATOM   3655  C  CD2   . PHE A 1 474 ? -67.523  71.462  -42.977 1.00 62.18  ?  474 PHE A CD2   1 
ATOM   3656  C  CE1   . PHE A 1 474 ? -67.535  72.432  -40.402 1.00 68.56  ?  474 PHE A CE1   1 
ATOM   3657  C  CE2   . PHE A 1 474 ? -68.028  70.683  -41.958 1.00 64.55  ?  474 PHE A CE2   1 
ATOM   3658  C  CZ    . PHE A 1 474 ? -68.040  71.167  -40.668 1.00 68.31  ?  474 PHE A CZ    1 
ATOM   3659  N  N     . ALA A 1 475 ? -67.185  75.905  -46.312 1.00 69.77  ?  475 ALA A N     1 
ATOM   3660  C  CA    . ALA A 1 475 ? -66.493  76.630  -47.363 1.00 64.54  ?  475 ALA A CA    1 
ATOM   3661  C  C     . ALA A 1 475 ? -66.242  78.029  -46.888 1.00 66.99  ?  475 ALA A C     1 
ATOM   3662  O  O     . ALA A 1 475 ? -67.063  78.620  -46.178 1.00 67.48  ?  475 ALA A O     1 
ATOM   3663  C  CB    . ALA A 1 475 ? -67.310  76.656  -48.624 1.00 61.27  ?  475 ALA A CB    1 
ATOM   3664  N  N     . THR A 1 476 ? -65.090  78.551  -47.269 1.00 71.35  ?  476 THR A N     1 
ATOM   3665  C  CA    . THR A 1 476 ? -64.745  79.914  -46.929 1.00 74.81  ?  476 THR A CA    1 
ATOM   3666  C  C     . THR A 1 476 ? -63.882  80.428  -48.070 1.00 76.16  ?  476 THR A C     1 
ATOM   3667  O  O     . THR A 1 476 ? -63.285  79.638  -48.803 1.00 76.35  ?  476 THR A O     1 
ATOM   3668  C  CB    . THR A 1 476 ? -64.016  80.009  -45.555 1.00 63.53  ?  476 THR A CB    1 
ATOM   3669  O  OG1   . THR A 1 476 ? -62.625  80.296  -45.751 1.00 72.97  ?  476 THR A OG1   1 
ATOM   3670  C  CG2   . THR A 1 476 ? -64.141  78.708  -44.779 1.00 60.17  ?  476 THR A CG2   1 
ATOM   3671  N  N     . PRO A 1 477 ? -63.815  81.753  -48.221 1.00 71.32  ?  477 PRO A N     1 
ATOM   3672  C  CA    . PRO A 1 477 ? -63.169  82.431  -49.343 1.00 70.08  ?  477 PRO A CA    1 
ATOM   3673  C  C     . PRO A 1 477 ? -61.649  82.287  -49.321 1.00 72.70  ?  477 PRO A C     1 
ATOM   3674  O  O     . PRO A 1 477 ? -61.100  81.987  -48.253 1.00 80.02  ?  477 PRO A O     1 
ATOM   3675  C  CB    . PRO A 1 477 ? -63.554  83.899  -49.108 1.00 69.45  ?  477 PRO A CB    1 
ATOM   3676  C  CG    . PRO A 1 477 ? -64.698  83.868  -48.121 1.00 65.07  ?  477 PRO A CG    1 
ATOM   3677  C  CD    . PRO A 1 477 ? -64.346  82.720  -47.251 1.00 66.48  ?  477 PRO A CD    1 
ATOM   3678  N  N     . ARG A 1 478 ? -60.990  82.507  -50.466 1.00 68.25  ?  478 ARG A N     1 
ATOM   3679  C  CA    . ARG A 1 478 ? -59.522  82.567  -50.518 1.00 66.41  ?  478 ARG A CA    1 
ATOM   3680  C  C     . ARG A 1 478 ? -58.937  83.671  -49.641 1.00 74.66  ?  478 ARG A C     1 
ATOM   3681  O  O     . ARG A 1 478 ? -59.575  84.707  -49.370 1.00 76.97  ?  478 ARG A O     1 
ATOM   3682  C  CB    . ARG A 1 478 ? -59.001  82.800  -51.934 1.00 55.86  ?  478 ARG A CB    1 
ATOM   3683  C  CG    . ARG A 1 478 ? -58.817  81.549  -52.769 1.00 61.87  ?  478 ARG A CG    1 
ATOM   3684  C  CD    . ARG A 1 478 ? -57.944  81.805  -54.016 1.00 63.75  ?  478 ARG A CD    1 
ATOM   3685  N  NE    . ARG A 1 478 ? -56.556  81.442  -53.764 1.00 65.81  ?  478 ARG A NE    1 
ATOM   3686  C  CZ    . ARG A 1 478 ? -56.072  80.217  -53.939 1.00 71.98  ?  478 ARG A CZ    1 
ATOM   3687  N  NH1   . ARG A 1 478 ? -56.861  79.247  -54.373 1.00 64.76  ?  478 ARG A NH1   1 
ATOM   3688  N  NH2   . ARG A 1 478 ? -54.801  79.960  -53.679 1.00 81.47  ?  478 ARG A NH2   1 
ATOM   3689  N  N     . LEU A 1 479 ? -57.701  83.449  -49.219 1.00 71.45  ?  479 LEU A N     1 
ATOM   3690  C  CA    . LEU A 1 479 ? -56.983  84.451  -48.468 1.00 73.11  ?  479 LEU A CA    1 
ATOM   3691  C  C     . LEU A 1 479 ? -55.783  84.888  -49.295 1.00 78.74  ?  479 LEU A C     1 
ATOM   3692  O  O     . LEU A 1 479 ? -55.496  86.083  -49.431 1.00 85.44  ?  479 LEU A O     1 
ATOM   3693  C  CB    . LEU A 1 479 ? -56.520  83.873  -47.135 1.00 69.93  ?  479 LEU A CB    1 
ATOM   3694  C  CG    . LEU A 1 479 ? -57.572  83.209  -46.259 1.00 60.68  ?  479 LEU A CG    1 
ATOM   3695  C  CD1   . LEU A 1 479 ? -56.944  82.853  -44.928 1.00 65.37  ?  479 LEU A CD1   1 
ATOM   3696  C  CD2   . LEU A 1 479 ? -58.712  84.141  -46.067 1.00 49.34  ?  479 LEU A CD2   1 
ATOM   3697  N  N     . SER A 1 480 ? -55.078  83.899  -49.835 1.00 74.03  ?  480 SER A N     1 
ATOM   3698  C  CA    . SER A 1 480 ? -53.922  84.150  -50.675 1.00 71.00  ?  480 SER A CA    1 
ATOM   3699  C  C     . SER A 1 480 ? -54.391  84.375  -52.091 1.00 72.72  ?  480 SER A C     1 
ATOM   3700  O  O     . SER A 1 480 ? -55.172  83.579  -52.622 1.00 77.18  ?  480 SER A O     1 
ATOM   3701  C  CB    . SER A 1 480 ? -52.974  82.950  -50.648 1.00 69.37  ?  480 SER A CB    1 
ATOM   3702  O  OG    . SER A 1 480 ? -52.417  82.759  -49.370 1.00 69.16  ?  480 SER A OG    1 
ATOM   3703  N  N     . SER A 1 481 ? -53.905  85.451  -52.703 1.00 72.86  ?  481 SER A N     1 
ATOM   3704  C  CA    . SER A 1 481 ? -54.171  85.743  -54.113 1.00 74.54  ?  481 SER A CA    1 
ATOM   3705  C  C     . SER A 1 481 ? -53.143  85.065  -55.034 1.00 76.20  ?  481 SER A C     1 
ATOM   3706  O  O     . SER A 1 481 ? -52.019  84.780  -54.610 1.00 74.34  ?  481 SER A O     1 
ATOM   3707  C  CB    . SER A 1 481 ? -54.142  87.252  -54.332 1.00 72.98  ?  481 SER A CB    1 
ATOM   3708  O  OG    . SER A 1 481 ? -52.805  87.733  -54.318 1.00 79.21  ?  481 SER A OG    1 
ATOM   3709  N  N     . LEU A 1 482 ? -53.514  84.818  -56.292 1.00 77.27  ?  482 LEU A N     1 
ATOM   3710  C  CA    . LEU A 1 482 ? -52.562  84.241  -57.256 1.00 72.56  ?  482 LEU A CA    1 
ATOM   3711  C  C     . LEU A 1 482 ? -52.156  85.183  -58.400 1.00 83.16  ?  482 LEU A C     1 
ATOM   3712  O  O     . LEU A 1 482 ? -52.942  86.033  -58.824 1.00 86.91  ?  482 LEU A O     1 
ATOM   3713  C  CB    . LEU A 1 482 ? -53.089  82.919  -57.790 1.00 62.84  ?  482 LEU A CB    1 
ATOM   3714  C  CG    . LEU A 1 482 ? -53.496  81.983  -56.648 1.00 65.38  ?  482 LEU A CG    1 
ATOM   3715  C  CD1   . LEU A 1 482 ? -54.388  80.846  -57.120 1.00 63.02  ?  482 LEU A CD1   1 
ATOM   3716  C  CD2   . LEU A 1 482 ? -52.244  81.430  -56.005 1.00 76.43  ?  482 LEU A CD2   1 
ATOM   3717  N  N     . GLU A 1 483 ? -50.913  85.028  -58.868 1.00 90.09  ?  483 GLU A N     1 
ATOM   3718  C  CA    . GLU A 1 483 ? -50.331  85.830  -59.954 1.00 97.62  ?  483 GLU A CA    1 
ATOM   3719  C  C     . GLU A 1 483 ? -49.206  85.035  -60.624 1.00 103.92 ?  483 GLU A C     1 
ATOM   3720  O  O     . GLU A 1 483 ? -48.714  84.070  -60.038 1.00 110.52 ?  483 GLU A O     1 
ATOM   3721  C  CB    . GLU A 1 483 ? -49.707  87.105  -59.396 1.00 99.96  ?  483 GLU A CB    1 
ATOM   3722  C  CG    . GLU A 1 483 ? -50.569  87.915  -58.463 1.00 105.67 ?  483 GLU A CG    1 
ATOM   3723  C  CD    . GLU A 1 483 ? -49.836  89.148  -57.933 1.00 112.27 ?  483 GLU A CD    1 
ATOM   3724  O  OE1   . GLU A 1 483 ? -48.661  89.382  -58.334 1.00 103.66 ?  483 GLU A OE1   1 
ATOM   3725  O  OE2   . GLU A 1 483 ? -50.441  89.878  -57.109 1.00 119.28 ?  483 GLU A OE2   1 
ATOM   3726  N  N     . ASP A 1 484 ? -48.780  85.435  -61.827 1.00 97.63  ?  484 ASP A N     1 
ATOM   3727  C  CA    . ASP A 1 484 ? -47.509  84.931  -62.374 1.00 91.52  ?  484 ASP A CA    1 
ATOM   3728  C  C     . ASP A 1 484 ? -46.700  86.026  -63.078 1.00 99.93  ?  484 ASP A C     1 
ATOM   3729  O  O     . ASP A 1 484 ? -45.650  86.456  -62.586 1.00 99.33  ?  484 ASP A O     1 
ATOM   3730  C  CB    . ASP A 1 484 ? -47.708  83.705  -63.282 1.00 80.26  ?  484 ASP A CB    1 
ATOM   3731  N  N     . ASN B 1 3   ? -66.301  102.597 -12.932 1.00 165.53 ?  3   ASN B N     1 
ATOM   3732  C  CA    . ASN B 1 3   ? -65.039  102.373 -13.630 1.00 159.53 ?  3   ASN B CA    1 
ATOM   3733  C  C     . ASN B 1 3   ? -63.869  102.134 -12.673 1.00 157.81 ?  3   ASN B C     1 
ATOM   3734  O  O     . ASN B 1 3   ? -62.786  101.740 -13.101 1.00 155.90 ?  3   ASN B O     1 
ATOM   3735  C  CB    . ASN B 1 3   ? -64.725  103.542 -14.567 1.00 159.39 ?  3   ASN B CB    1 
ATOM   3736  N  N     . ILE B 1 4   ? -64.091  102.373 -11.381 1.00 157.72 ?  4   ILE B N     1 
ATOM   3737  C  CA    . ILE B 1 4   ? -63.058  102.153 -10.363 1.00 148.95 ?  4   ILE B CA    1 
ATOM   3738  C  C     . ILE B 1 4   ? -63.559  102.342 -8.920  1.00 148.96 ?  4   ILE B C     1 
ATOM   3739  O  O     . ILE B 1 4   ? -64.175  103.355 -8.592  1.00 155.74 ?  4   ILE B O     1 
ATOM   3740  C  CB    . ILE B 1 4   ? -61.803  103.032 -10.617 1.00 118.57 ?  4   ILE B CB    1 
ATOM   3741  C  CG1   . ILE B 1 4   ? -61.056  103.298 -9.306  1.00 114.24 ?  4   ILE B CG1   1 
ATOM   3742  C  CG2   . ILE B 1 4   ? -62.185  104.342 -11.283 1.00 129.47 ?  4   ILE B CG2   1 
ATOM   3743  C  CD1   . ILE B 1 4   ? -59.867  104.225 -9.451  1.00 112.22 ?  4   ILE B CD1   1 
ATOM   3744  N  N     . GLN B 1 5   ? -63.294  101.350 -8.070  1.00 142.76 ?  5   GLN B N     1 
ATOM   3745  C  CA    . GLN B 1 5   ? -63.664  101.397 -6.655  1.00 145.64 ?  5   GLN B CA    1 
ATOM   3746  C  C     . GLN B 1 5   ? -62.409  101.367 -5.782  1.00 142.57 ?  5   GLN B C     1 
ATOM   3747  O  O     . GLN B 1 5   ? -61.405  100.761 -6.155  1.00 138.83 ?  5   GLN B O     1 
ATOM   3748  C  CB    . GLN B 1 5   ? -64.586  100.227 -6.297  1.00 146.07 ?  5   GLN B CB    1 
ATOM   3749  N  N     . ASN B 1 6   ? -62.463  102.020 -4.623  1.00 143.81 ?  6   ASN B N     1 
ATOM   3750  C  CA    . ASN B 1 6   ? -61.287  102.130 -3.758  1.00 135.63 ?  6   ASN B CA    1 
ATOM   3751  C  C     . ASN B 1 6   ? -61.372  101.254 -2.509  1.00 129.49 ?  6   ASN B C     1 
ATOM   3752  O  O     . ASN B 1 6   ? -62.462  100.892 -2.064  1.00 131.89 ?  6   ASN B O     1 
ATOM   3753  C  CB    . ASN B 1 6   ? -61.027  103.591 -3.374  1.00 139.09 ?  6   ASN B CB    1 
ATOM   3754  C  CG    . ASN B 1 6   ? -61.339  104.559 -4.508  1.00 141.70 ?  6   ASN B CG    1 
ATOM   3755  O  OD1   . ASN B 1 6   ? -62.429  104.522 -5.086  1.00 147.98 ?  6   ASN B OD1   1 
ATOM   3756  N  ND2   . ASN B 1 6   ? -60.382  105.423 -4.838  1.00 136.59 ?  6   ASN B ND2   1 
ATOM   3757  N  N     . MET B 1 7   ? -60.213  100.916 -1.954  1.00 122.79 ?  7   MET B N     1 
ATOM   3758  C  CA    . MET B 1 7   ? -60.129  99.984  -0.831  1.00 123.55 ?  7   MET B CA    1 
ATOM   3759  C  C     . MET B 1 7   ? -58.986  100.380 0.105   1.00 122.83 ?  7   MET B C     1 
ATOM   3760  O  O     . MET B 1 7   ? -57.937  100.833 -0.354  1.00 119.47 ?  7   MET B O     1 
ATOM   3761  C  CB    . MET B 1 7   ? -59.912  98.544  -1.336  1.00 118.63 ?  7   MET B CB    1 
ATOM   3762  C  CG    . MET B 1 7   ? -61.180  97.695  -1.494  1.00 117.82 ?  7   MET B CG    1 
ATOM   3763  N  N     . SER B 1 8   ? -59.189  100.209 1.411   1.00 125.22 ?  8   SER B N     1 
ATOM   3764  C  CA    . SER B 1 8   ? -58.126  100.456 2.387   1.00 124.78 ?  8   SER B CA    1 
ATOM   3765  C  C     . SER B 1 8   ? -57.005  99.425  2.233   1.00 120.91 ?  8   SER B C     1 
ATOM   3766  O  O     . SER B 1 8   ? -57.255  98.294  1.815   1.00 121.70 ?  8   SER B O     1 
ATOM   3767  C  CB    . SER B 1 8   ? -58.683  100.418 3.816   1.00 128.20 ?  8   SER B CB    1 
ATOM   3768  O  OG    . SER B 1 8   ? -57.681  100.750 4.771   1.00 127.34 ?  8   SER B OG    1 
ATOM   3769  N  N     . LEU B 1 9   ? -55.772  99.806  2.561   1.00 118.42 ?  9   LEU B N     1 
ATOM   3770  C  CA    . LEU B 1 9   ? -54.681  98.832  2.607   1.00 112.58 ?  9   LEU B CA    1 
ATOM   3771  C  C     . LEU B 1 9   ? -54.972  97.790  3.694   1.00 117.31 ?  9   LEU B C     1 
ATOM   3772  O  O     . LEU B 1 9   ? -54.837  96.585  3.462   1.00 111.44 ?  9   LEU B O     1 
ATOM   3773  C  CB    . LEU B 1 9   ? -53.339  99.511  2.878   1.00 106.31 ?  9   LEU B CB    1 
ATOM   3774  C  CG    . LEU B 1 9   ? -52.128  98.830  2.245   1.00 95.73  ?  9   LEU B CG    1 
ATOM   3775  C  CD1   . LEU B 1 9   ? -50.871  99.012  3.081   1.00 94.08  ?  9   LEU B CD1   1 
ATOM   3776  C  CD2   . LEU B 1 9   ? -52.414  97.370  2.021   1.00 96.43  ?  9   LEU B CD2   1 
ATOM   3777  N  N     . GLU B 1 10  ? -55.377  98.264  4.875   1.00 126.64 ?  10  GLU B N     1 
ATOM   3778  C  CA    . GLU B 1 10  ? -55.799  97.381  5.962   1.00 126.41 ?  10  GLU B CA    1 
ATOM   3779  C  C     . GLU B 1 10  ? -56.964  96.509  5.500   1.00 126.18 ?  10  GLU B C     1 
ATOM   3780  O  O     . GLU B 1 10  ? -56.834  95.290  5.388   1.00 123.57 ?  10  GLU B O     1 
ATOM   3781  C  CB    . GLU B 1 10  ? -56.189  98.181  7.214   1.00 127.76 ?  10  GLU B CB    1 
ATOM   3782  N  N     . ASP B 1 11  ? -58.096  97.141  5.211   1.00 129.18 ?  11  ASP B N     1 
ATOM   3783  C  CA    . ASP B 1 11  ? -59.284  96.421  4.764   1.00 129.74 ?  11  ASP B CA    1 
ATOM   3784  C  C     . ASP B 1 11  ? -59.029  95.541  3.514   1.00 125.91 ?  11  ASP B C     1 
ATOM   3785  O  O     . ASP B 1 11  ? -59.953  94.946  2.957   1.00 128.16 ?  11  ASP B O     1 
ATOM   3786  C  CB    . ASP B 1 11  ? -60.450  97.400  4.540   1.00 131.12 ?  11  ASP B CB    1 
ATOM   3787  N  N     . ILE B 1 12  ? -57.777  95.447  3.079   1.00 121.57 ?  12  ILE B N     1 
ATOM   3788  C  CA    . ILE B 1 12  ? -57.464  94.622  1.913   1.00 120.51 ?  12  ILE B CA    1 
ATOM   3789  C  C     . ILE B 1 12  ? -56.594  93.426  2.263   1.00 119.85 ?  12  ILE B C     1 
ATOM   3790  O  O     . ILE B 1 12  ? -57.011  92.282  2.086   1.00 122.72 ?  12  ILE B O     1 
ATOM   3791  C  CB    . ILE B 1 12  ? -56.783  95.419  0.791   1.00 114.08 ?  12  ILE B CB    1 
ATOM   3792  C  CG1   . ILE B 1 12  ? -57.718  95.547  -0.408  1.00 115.43 ?  12  ILE B CG1   1 
ATOM   3793  C  CG2   . ILE B 1 12  ? -55.500  94.728  0.346   1.00 104.58 ?  12  ILE B CG2   1 
ATOM   3794  C  CD1   . ILE B 1 12  ? -56.997  95.356  -1.718  1.00 114.30 ?  12  ILE B CD1   1 
ATOM   3795  N  N     . MET B 1 13  ? -55.380  93.691  2.739   1.00 114.28 ?  13  MET B N     1 
ATOM   3796  C  CA    . MET B 1 13  ? -54.525  92.622  3.234   1.00 110.78 ?  13  MET B CA    1 
ATOM   3797  C  C     . MET B 1 13  ? -55.352  91.716  4.146   1.00 116.13 ?  13  MET B C     1 
ATOM   3798  O  O     . MET B 1 13  ? -55.222  90.488  4.116   1.00 115.79 ?  13  MET B O     1 
ATOM   3799  C  CB    . MET B 1 13  ? -53.329  93.197  3.984   1.00 103.80 ?  13  MET B CB    1 
ATOM   3800  C  CG    . MET B 1 13  ? -52.459  94.100  3.129   1.00 98.55  ?  13  MET B CG    1 
ATOM   3801  S  SD    . MET B 1 13  ? -51.137  93.268  2.213   1.00 125.58 ?  13  MET B SD    1 
ATOM   3802  C  CE    . MET B 1 13  ? -50.144  92.567  3.536   1.00 74.80  ?  13  MET B CE    1 
ATOM   3803  N  N     . GLY B 1 14  ? -56.213  92.328  4.948   1.00 118.74 ?  14  GLY B N     1 
ATOM   3804  C  CA    . GLY B 1 14  ? -57.154  91.566  5.737   1.00 118.36 ?  14  GLY B CA    1 
ATOM   3805  C  C     . GLY B 1 14  ? -57.810  90.531  4.853   1.00 113.59 ?  14  GLY B C     1 
ATOM   3806  O  O     . GLY B 1 14  ? -57.521  89.346  4.972   1.00 110.23 ?  14  GLY B O     1 
ATOM   3807  N  N     . GLU B 1 15  ? -58.667  90.990  3.942   1.00 114.78 ?  15  GLU B N     1 
ATOM   3808  C  CA    . GLU B 1 15  ? -59.448  90.107  3.073   1.00 116.07 ?  15  GLU B CA    1 
ATOM   3809  C  C     . GLU B 1 15  ? -58.573  89.140  2.276   1.00 116.14 ?  15  GLU B C     1 
ATOM   3810  O  O     . GLU B 1 15  ? -58.843  87.936  2.239   1.00 120.45 ?  15  GLU B O     1 
ATOM   3811  C  CB    . GLU B 1 15  ? -60.323  90.929  2.119   1.00 114.76 ?  15  GLU B CB    1 
ATOM   3812  C  CG    . GLU B 1 15  ? -61.577  90.205  1.618   1.00 121.21 ?  15  GLU B CG    1 
ATOM   3813  C  CD    . GLU B 1 15  ? -61.312  89.259  0.452   1.00 125.43 ?  15  GLU B CD    1 
ATOM   3814  O  OE1   . GLU B 1 15  ? -60.313  89.463  -0.273  1.00 126.39 ?  15  GLU B OE1   1 
ATOM   3815  O  OE2   . GLU B 1 15  ? -62.109  88.314  0.258   1.00 127.22 ?  15  GLU B OE2   1 
ATOM   3816  N  N     . ARG B 1 16  ? -57.532  89.669  1.637   1.00 108.94 ?  16  ARG B N     1 
ATOM   3817  C  CA    . ARG B 1 16  ? -56.649  88.847  0.817   1.00 99.95  ?  16  ARG B CA    1 
ATOM   3818  C  C     . ARG B 1 16  ? -55.972  87.753  1.630   1.00 96.50  ?  16  ARG B C     1 
ATOM   3819  O  O     . ARG B 1 16  ? -56.286  86.579  1.449   1.00 100.26 ?  16  ARG B O     1 
ATOM   3820  C  CB    . ARG B 1 16  ? -55.620  89.697  0.071   1.00 97.84  ?  16  ARG B CB    1 
ATOM   3821  C  CG    . ARG B 1 16  ? -55.955  89.903  -1.412  1.00 96.22  ?  16  ARG B CG    1 
ATOM   3822  C  CD    . ARG B 1 16  ? -57.237  90.700  -1.603  1.00 100.91 ?  16  ARG B CD    1 
ATOM   3823  N  NE    . ARG B 1 16  ? -57.879  90.398  -2.880  1.00 105.49 ?  16  ARG B NE    1 
ATOM   3824  C  CZ    . ARG B 1 16  ? -59.048  90.901  -3.272  1.00 108.91 ?  16  ARG B CZ    1 
ATOM   3825  N  NH1   . ARG B 1 16  ? -59.712  91.740  -2.486  1.00 111.24 ?  16  ARG B NH1   1 
ATOM   3826  N  NH2   . ARG B 1 16  ? -59.554  90.569  -4.452  1.00 107.76 ?  16  ARG B NH2   1 
ATOM   3827  N  N     . PHE B 1 17  ? -55.066  88.129  2.533   1.00 92.74  ?  17  PHE B N     1 
ATOM   3828  C  CA    . PHE B 1 17  ? -54.331  87.139  3.337   1.00 92.54  ?  17  PHE B CA    1 
ATOM   3829  C  C     . PHE B 1 17  ? -55.230  86.163  4.117   1.00 95.83  ?  17  PHE B C     1 
ATOM   3830  O  O     . PHE B 1 17  ? -54.892  84.986  4.303   1.00 94.33  ?  17  PHE B O     1 
ATOM   3831  C  CB    . PHE B 1 17  ? -53.359  87.822  4.298   1.00 87.77  ?  17  PHE B CB    1 
ATOM   3832  C  CG    . PHE B 1 17  ? -52.515  86.861  5.085   1.00 89.92  ?  17  PHE B CG    1 
ATOM   3833  C  CD1   . PHE B 1 17  ? -53.027  86.220  6.201   1.00 95.31  ?  17  PHE B CD1   1 
ATOM   3834  C  CD2   . PHE B 1 17  ? -51.207  86.602  4.708   1.00 90.75  ?  17  PHE B CD2   1 
ATOM   3835  C  CE1   . PHE B 1 17  ? -52.253  85.337  6.921   1.00 98.61  ?  17  PHE B CE1   1 
ATOM   3836  C  CE2   . PHE B 1 17  ? -50.423  85.724  5.428   1.00 93.36  ?  17  PHE B CE2   1 
ATOM   3837  C  CZ    . PHE B 1 17  ? -50.947  85.091  6.535   1.00 97.25  ?  17  PHE B CZ    1 
ATOM   3838  N  N     . GLY B 1 18  ? -56.367  86.664  4.582   1.00 86.29  ?  18  GLY B N     1 
ATOM   3839  C  CA    . GLY B 1 18  ? -57.340  85.825  5.257   1.00 82.53  ?  18  GLY B CA    1 
ATOM   3840  C  C     . GLY B 1 18  ? -57.851  84.732  4.344   1.00 85.16  ?  18  GLY B C     1 
ATOM   3841  O  O     . GLY B 1 18  ? -57.989  83.588  4.764   1.00 81.57  ?  18  GLY B O     1 
ATOM   3842  N  N     . ARG B 1 19  ? -58.123  85.088  3.089   1.00 94.09  ?  19  ARG B N     1 
ATOM   3843  C  CA    . ARG B 1 19  ? -58.519  84.113  2.067   1.00 89.50  ?  19  ARG B CA    1 
ATOM   3844  C  C     . ARG B 1 19  ? -57.467  82.991  1.925   1.00 86.53  ?  19  ARG B C     1 
ATOM   3845  O  O     . ARG B 1 19  ? -57.798  81.805  2.074   1.00 85.74  ?  19  ARG B O     1 
ATOM   3846  C  CB    . ARG B 1 19  ? -58.818  84.811  0.720   1.00 83.46  ?  19  ARG B CB    1 
ATOM   3847  N  N     . TYR B 1 20  ? -56.210  83.380  1.677   1.00 83.84  ?  20  TYR B N     1 
ATOM   3848  C  CA    . TYR B 1 20  ? -55.081  82.452  1.505   1.00 81.80  ?  20  TYR B CA    1 
ATOM   3849  C  C     . TYR B 1 20  ? -54.740  81.699  2.791   1.00 83.63  ?  20  TYR B C     1 
ATOM   3850  O  O     . TYR B 1 20  ? -54.416  80.507  2.754   1.00 81.77  ?  20  TYR B O     1 
ATOM   3851  C  CB    . TYR B 1 20  ? -53.851  83.214  0.992   1.00 85.23  ?  20  TYR B CB    1 
ATOM   3852  C  CG    . TYR B 1 20  ? -52.564  82.417  0.874   1.00 94.18  ?  20  TYR B CG    1 
ATOM   3853  C  CD1   . TYR B 1 20  ? -52.181  81.856  -0.334  1.00 105.18 ?  20  TYR B CD1   1 
ATOM   3854  C  CD2   . TYR B 1 20  ? -51.711  82.264  1.959   1.00 93.78  ?  20  TYR B CD2   1 
ATOM   3855  C  CE1   . TYR B 1 20  ? -50.988  81.140  -0.455  1.00 108.28 ?  20  TYR B CE1   1 
ATOM   3856  C  CE2   . TYR B 1 20  ? -50.523  81.549  1.851   1.00 97.31  ?  20  TYR B CE2   1 
ATOM   3857  C  CZ    . TYR B 1 20  ? -50.164  80.986  0.642   1.00 104.56 ?  20  TYR B CZ    1 
ATOM   3858  O  OH    . TYR B 1 20  ? -48.983  80.269  0.521   1.00 105.40 ?  20  TYR B OH    1 
ATOM   3859  N  N     . SER B 1 21  ? -54.804  82.399  3.924   1.00 85.53  ?  21  SER B N     1 
ATOM   3860  C  CA    . SER B 1 21  ? -54.621  81.764  5.228   1.00 80.64  ?  21  SER B CA    1 
ATOM   3861  C  C     . SER B 1 21  ? -55.592  80.587  5.402   1.00 78.48  ?  21  SER B C     1 
ATOM   3862  O  O     . SER B 1 21  ? -55.177  79.440  5.595   1.00 67.73  ?  21  SER B O     1 
ATOM   3863  C  CB    . SER B 1 21  ? -54.808  82.783  6.356   1.00 77.70  ?  21  SER B CB    1 
ATOM   3864  N  N     . LYS B 1 22  ? -56.886  80.873  5.310   1.00 84.02  ?  22  LYS B N     1 
ATOM   3865  C  CA    . LYS B 1 22  ? -57.905  79.840  5.470   1.00 82.01  ?  22  LYS B CA    1 
ATOM   3866  C  C     . LYS B 1 22  ? -57.679  78.638  4.563   1.00 82.07  ?  22  LYS B C     1 
ATOM   3867  O  O     . LYS B 1 22  ? -57.626  77.497  5.032   1.00 78.89  ?  22  LYS B O     1 
ATOM   3868  C  CB    . LYS B 1 22  ? -59.299  80.403  5.203   1.00 77.96  ?  22  LYS B CB    1 
ATOM   3869  C  CG    . LYS B 1 22  ? -60.405  79.425  5.552   1.00 74.41  ?  22  LYS B CG    1 
ATOM   3870  C  CD    . LYS B 1 22  ? -61.774  80.018  5.338   1.00 77.00  ?  22  LYS B CD    1 
ATOM   3871  C  CE    . LYS B 1 22  ? -62.856  78.995  5.643   1.00 81.69  ?  22  LYS B CE    1 
ATOM   3872  N  NZ    . LYS B 1 22  ? -64.060  79.202  4.786   1.00 88.58  ?  22  LYS B NZ    1 
ATOM   3873  N  N     . TYR B 1 23  ? -57.562  78.909  3.265   1.00 80.98  ?  23  TYR B N     1 
ATOM   3874  C  CA    . TYR B 1 23  ? -57.413  77.863  2.254   1.00 77.93  ?  23  TYR B CA    1 
ATOM   3875  C  C     . TYR B 1 23  ? -56.191  76.987  2.501   1.00 79.13  ?  23  TYR B C     1 
ATOM   3876  O  O     . TYR B 1 23  ? -56.310  75.762  2.608   1.00 83.22  ?  23  TYR B O     1 
ATOM   3877  C  CB    . TYR B 1 23  ? -57.341  78.475  0.854   1.00 71.30  ?  23  TYR B CB    1 
ATOM   3878  C  CG    . TYR B 1 23  ? -57.247  77.472  -0.285  1.00 65.76  ?  23  TYR B CG    1 
ATOM   3879  C  CD1   . TYR B 1 23  ? -56.041  77.240  -0.935  1.00 73.11  ?  23  TYR B CD1   1 
ATOM   3880  C  CD2   . TYR B 1 23  ? -58.364  76.769  -0.714  1.00 65.39  ?  23  TYR B CD2   1 
ATOM   3881  C  CE1   . TYR B 1 23  ? -55.947  76.327  -1.979  1.00 81.63  ?  23  TYR B CE1   1 
ATOM   3882  C  CE2   . TYR B 1 23  ? -58.286  75.853  -1.760  1.00 81.04  ?  23  TYR B CE2   1 
ATOM   3883  C  CZ    . TYR B 1 23  ? -57.073  75.635  -2.391  1.00 84.76  ?  23  TYR B CZ    1 
ATOM   3884  O  OH    . TYR B 1 23  ? -56.977  74.736  -3.437  1.00 88.77  ?  23  TYR B OH    1 
ATOM   3885  N  N     . ILE B 1 24  ? -55.019  77.607  2.594   1.00 76.22  ?  24  ILE B N     1 
ATOM   3886  C  CA    . ILE B 1 24  ? -53.786  76.833  2.689   1.00 71.18  ?  24  ILE B CA    1 
ATOM   3887  C  C     . ILE B 1 24  ? -53.723  76.031  4.001   1.00 68.96  ?  24  ILE B C     1 
ATOM   3888  O  O     . ILE B 1 24  ? -52.935  75.094  4.115   1.00 75.02  ?  24  ILE B O     1 
ATOM   3889  C  CB    . ILE B 1 24  ? -52.519  77.698  2.385   1.00 79.50  ?  24  ILE B CB    1 
ATOM   3890  C  CG1   . ILE B 1 24  ? -51.556  76.919  1.475   1.00 90.08  ?  24  ILE B CG1   1 
ATOM   3891  C  CG2   . ILE B 1 24  ? -51.855  78.230  3.665   1.00 54.87  ?  24  ILE B CG2   1 
ATOM   3892  C  CD1   . ILE B 1 24  ? -50.444  77.763  0.819   1.00 96.82  ?  24  ILE B CD1   1 
ATOM   3893  N  N     . ILE B 1 25  ? -54.591  76.371  4.960   1.00 60.59  ?  25  ILE B N     1 
ATOM   3894  C  CA    . ILE B 1 25  ? -54.757  75.592  6.201   1.00 59.52  ?  25  ILE B CA    1 
ATOM   3895  C  C     . ILE B 1 25  ? -55.741  74.422  6.095   1.00 66.87  ?  25  ILE B C     1 
ATOM   3896  O  O     . ILE B 1 25  ? -55.407  73.292  6.445   1.00 75.99  ?  25  ILE B O     1 
ATOM   3897  C  CB    . ILE B 1 25  ? -55.295  76.437  7.350   1.00 64.48  ?  25  ILE B CB    1 
ATOM   3898  C  CG1   . ILE B 1 25  ? -54.262  77.464  7.807   1.00 64.97  ?  25  ILE B CG1   1 
ATOM   3899  C  CG2   . ILE B 1 25  ? -55.679  75.528  8.503   1.00 62.37  ?  25  ILE B CG2   1 
ATOM   3900  C  CD1   . ILE B 1 25  ? -54.758  78.372  8.906   1.00 59.33  ?  25  ILE B CD1   1 
ATOM   3901  N  N     . GLN B 1 26  ? -56.961  74.698  5.641   1.00 67.48  ?  26  GLN B N     1 
ATOM   3902  C  CA    . GLN B 1 26  ? -57.986  73.654  5.532   1.00 73.24  ?  26  GLN B CA    1 
ATOM   3903  C  C     . GLN B 1 26  ? -57.824  72.697  4.351   1.00 80.23  ?  26  GLN B C     1 
ATOM   3904  O  O     . GLN B 1 26  ? -58.244  71.532  4.434   1.00 82.48  ?  26  GLN B O     1 
ATOM   3905  C  CB    . GLN B 1 26  ? -59.373  74.268  5.418   1.00 74.39  ?  26  GLN B CB    1 
ATOM   3906  C  CG    . GLN B 1 26  ? -59.706  75.287  6.453   1.00 74.61  ?  26  GLN B CG    1 
ATOM   3907  C  CD    . GLN B 1 26  ? -61.162  75.665  6.386   1.00 78.78  ?  26  GLN B CD    1 
ATOM   3908  O  OE1   . GLN B 1 26  ? -61.637  76.210  5.372   1.00 76.32  ?  26  GLN B OE1   1 
ATOM   3909  N  NE2   . GLN B 1 26  ? -61.903  75.344  7.454   1.00 79.79  ?  26  GLN B NE2   1 
ATOM   3910  N  N     . ASP B 1 27  ? -57.246  73.201  3.259   1.00 82.21  ?  27  ASP B N     1 
ATOM   3911  C  CA    . ASP B 1 27  ? -57.276  72.512  1.970   1.00 82.99  ?  27  ASP B CA    1 
ATOM   3912  C  C     . ASP B 1 27  ? -55.945  72.466  1.245   1.00 83.39  ?  27  ASP B C     1 
ATOM   3913  O  O     . ASP B 1 27  ? -55.921  72.517  0.010   1.00 81.86  ?  27  ASP B O     1 
ATOM   3914  C  CB    . ASP B 1 27  ? -58.274  73.189  1.036   1.00 91.81  ?  27  ASP B CB    1 
ATOM   3915  C  CG    . ASP B 1 27  ? -59.699  73.021  1.487   1.00 103.46 ?  27  ASP B CG    1 
ATOM   3916  O  OD1   . ASP B 1 27  ? -60.128  71.861  1.710   1.00 113.18 ?  27  ASP B OD1   1 
ATOM   3917  O  OD2   . ASP B 1 27  ? -60.385  74.061  1.617   1.00 101.10 ?  27  ASP B OD2   1 
ATOM   3918  N  N     . ARG B 1 28  ? -54.841  72.381  1.984   1.00 84.55  ?  28  ARG B N     1 
ATOM   3919  C  CA    . ARG B 1 28  ? -53.545  72.199  1.329   1.00 80.07  ?  28  ARG B CA    1 
ATOM   3920  C  C     . ARG B 1 28  ? -52.499  71.498  2.169   1.00 80.06  ?  28  ARG B C     1 
ATOM   3921  O  O     . ARG B 1 28  ? -52.113  70.359  1.868   1.00 82.99  ?  28  ARG B O     1 
ATOM   3922  C  CB    . ARG B 1 28  ? -52.957  73.519  0.820   1.00 73.89  ?  28  ARG B CB    1 
ATOM   3923  C  CG    . ARG B 1 28  ? -51.679  73.300  0.012   1.00 75.34  ?  28  ARG B CG    1 
ATOM   3924  C  CD    . ARG B 1 28  ? -51.215  74.543  -0.726  1.00 80.04  ?  28  ARG B CD    1 
ATOM   3925  N  NE    . ARG B 1 28  ? -52.209  75.023  -1.678  1.00 83.45  ?  28  ARG B NE    1 
ATOM   3926  C  CZ    . ARG B 1 28  ? -52.104  76.169  -2.335  1.00 81.72  ?  28  ARG B CZ    1 
ATOM   3927  N  NH1   . ARG B 1 28  ? -51.043  76.938  -2.137  1.00 84.74  ?  28  ARG B NH1   1 
ATOM   3928  N  NH2   . ARG B 1 28  ? -53.054  76.541  -3.180  1.00 75.95  ?  28  ARG B NH2   1 
ATOM   3929  N  N     . ALA B 1 29  ? -52.045  72.186  3.216   1.00 77.05  ?  29  ALA B N     1 
ATOM   3930  C  CA    . ALA B 1 29  ? -50.826  71.796  3.924   1.00 74.99  ?  29  ALA B CA    1 
ATOM   3931  C  C     . ALA B 1 29  ? -51.009  70.878  5.141   1.00 73.68  ?  29  ALA B C     1 
ATOM   3932  O  O     . ALA B 1 29  ? -50.034  70.305  5.628   1.00 76.61  ?  29  ALA B O     1 
ATOM   3933  C  CB    . ALA B 1 29  ? -50.033  73.030  4.303   1.00 75.69  ?  29  ALA B CB    1 
ATOM   3934  N  N     . LEU B 1 30  ? -52.245  70.727  5.616   1.00 65.66  ?  30  LEU B N     1 
ATOM   3935  C  CA    . LEU B 1 30  ? -52.510  69.933  6.809   1.00 56.20  ?  30  LEU B CA    1 
ATOM   3936  C  C     . LEU B 1 30  ? -53.507  68.805  6.564   1.00 60.75  ?  30  LEU B C     1 
ATOM   3937  O  O     . LEU B 1 30  ? -54.505  68.999  5.876   1.00 69.21  ?  30  LEU B O     1 
ATOM   3938  C  CB    . LEU B 1 30  ? -53.038  70.841  7.907   1.00 55.37  ?  30  LEU B CB    1 
ATOM   3939  C  CG    . LEU B 1 30  ? -52.182  72.083  8.135   1.00 59.26  ?  30  LEU B CG    1 
ATOM   3940  C  CD1   . LEU B 1 30  ? -52.824  72.997  9.179   1.00 63.16  ?  30  LEU B CD1   1 
ATOM   3941  C  CD2   . LEU B 1 30  ? -50.817  71.628  8.567   1.00 57.87  ?  30  LEU B CD2   1 
ATOM   3942  N  N     . PRO B 1 31  ? -53.251  67.628  7.161   1.00 53.30  ?  31  PRO B N     1 
ATOM   3943  C  CA    . PRO B 1 31  ? -54.064  66.416  7.024   1.00 52.43  ?  31  PRO B CA    1 
ATOM   3944  C  C     . PRO B 1 31  ? -55.359  66.482  7.814   1.00 53.40  ?  31  PRO B C     1 
ATOM   3945  O  O     . PRO B 1 31  ? -55.412  67.160  8.834   1.00 58.32  ?  31  PRO B O     1 
ATOM   3946  C  CB    . PRO B 1 31  ? -53.174  65.340  7.654   1.00 52.88  ?  31  PRO B CB    1 
ATOM   3947  C  CG    . PRO B 1 31  ? -52.453  66.058  8.710   1.00 52.87  ?  31  PRO B CG    1 
ATOM   3948  C  CD    . PRO B 1 31  ? -52.141  67.417  8.110   1.00 54.42  ?  31  PRO B CD    1 
ATOM   3949  N  N     . ASP B 1 32  ? -56.385  65.779  7.339   1.00 54.22  ?  32  ASP B N     1 
ATOM   3950  C  CA    . ASP B 1 32  ? -57.616  65.596  8.091   1.00 52.56  ?  32  ASP B CA    1 
ATOM   3951  C  C     . ASP B 1 32  ? -57.260  64.621  9.196   1.00 63.64  ?  32  ASP B C     1 
ATOM   3952  O  O     . ASP B 1 32  ? -56.508  63.680  8.967   1.00 70.14  ?  32  ASP B O     1 
ATOM   3953  C  CB    . ASP B 1 32  ? -58.736  65.039  7.195   1.00 52.93  ?  32  ASP B CB    1 
ATOM   3954  C  CG    . ASP B 1 32  ? -60.033  64.744  7.965   1.00 73.97  ?  32  ASP B CG    1 
ATOM   3955  O  OD1   . ASP B 1 32  ? -60.944  65.597  7.971   1.00 74.73  ?  32  ASP B OD1   1 
ATOM   3956  O  OD2   . ASP B 1 32  ? -60.148  63.650  8.562   1.00 88.26  ?  32  ASP B OD2   1 
ATOM   3957  N  N     . ILE B 1 33  ? -57.775  64.864  10.399  1.00 64.72  ?  33  ILE B N     1 
ATOM   3958  C  CA    . ILE B 1 33  ? -57.443  64.049  11.557  1.00 60.15  ?  33  ILE B CA    1 
ATOM   3959  C  C     . ILE B 1 33  ? -57.935  62.595  11.432  1.00 61.93  ?  33  ILE B C     1 
ATOM   3960  O  O     . ILE B 1 33  ? -57.448  61.711  12.152  1.00 68.71  ?  33  ILE B O     1 
ATOM   3961  C  CB    . ILE B 1 33  ? -58.031  64.644  12.826  1.00 61.56  ?  33  ILE B CB    1 
ATOM   3962  C  CG1   . ILE B 1 33  ? -57.371  64.007  14.061  1.00 65.13  ?  33  ILE B CG1   1 
ATOM   3963  C  CG2   . ILE B 1 33  ? -59.513  64.393  12.837  1.00 61.34  ?  33  ILE B CG2   1 
ATOM   3964  C  CD1   . ILE B 1 33  ? -57.510  64.804  15.353  1.00 61.26  ?  33  ILE B CD1   1 
ATOM   3965  N  N     . ARG B 1 34  ? -58.877  62.334  10.522  1.00 58.43  ?  34  ARG B N     1 
ATOM   3966  C  CA    . ARG B 1 34  ? -59.428  60.973  10.382  1.00 56.04  ?  34  ARG B CA    1 
ATOM   3967  C  C     . ARG B 1 34  ? -58.737  60.059  9.367   1.00 59.29  ?  34  ARG B C     1 
ATOM   3968  O  O     . ARG B 1 34  ? -58.425  58.914  9.688   1.00 64.05  ?  34  ARG B O     1 
ATOM   3969  C  CB    . ARG B 1 34  ? -60.923  61.009  10.090  1.00 48.12  ?  34  ARG B CB    1 
ATOM   3970  C  CG    . ARG B 1 34  ? -61.687  61.934  10.982  1.00 48.09  ?  34  ARG B CG    1 
ATOM   3971  C  CD    . ARG B 1 34  ? -63.006  62.315  10.376  1.00 49.76  ?  34  ARG B CD    1 
ATOM   3972  N  NE    . ARG B 1 34  ? -62.873  63.420  9.423   1.00 53.92  ?  34  ARG B NE    1 
ATOM   3973  C  CZ    . ARG B 1 34  ? -63.917  64.019  8.857   1.00 58.74  ?  34  ARG B CZ    1 
ATOM   3974  N  NH1   . ARG B 1 34  ? -65.153  63.628  9.173   1.00 58.79  ?  34  ARG B NH1   1 
ATOM   3975  N  NH2   . ARG B 1 34  ? -63.737  64.997  7.981   1.00 54.37  ?  34  ARG B NH2   1 
ATOM   3976  N  N     . ASP B 1 35  ? -58.519  60.539  8.145   1.00 56.08  ?  35  ASP B N     1 
ATOM   3977  C  CA    . ASP B 1 35  ? -57.905  59.683  7.124   1.00 57.22  ?  35  ASP B CA    1 
ATOM   3978  C  C     . ASP B 1 35  ? -56.399  59.967  6.943   1.00 58.65  ?  35  ASP B C     1 
ATOM   3979  O  O     . ASP B 1 35  ? -55.673  59.216  6.270   1.00 53.34  ?  35  ASP B O     1 
ATOM   3980  C  CB    . ASP B 1 35  ? -58.690  59.707  5.797   1.00 57.91  ?  35  ASP B CB    1 
ATOM   3981  C  CG    . ASP B 1 35  ? -58.647  61.062  5.096   1.00 66.02  ?  35  ASP B CG    1 
ATOM   3982  O  OD1   . ASP B 1 35  ? -57.684  61.826  5.331   1.00 73.00  ?  35  ASP B OD1   1 
ATOM   3983  O  OD2   . ASP B 1 35  ? -59.574  61.357  4.296   1.00 65.39  ?  35  ASP B OD2   1 
ATOM   3984  N  N     . GLY B 1 36  ? -55.927  61.028  7.588   1.00 57.24  ?  36  GLY B N     1 
ATOM   3985  C  CA    . GLY B 1 36  ? -54.511  61.338  7.596   1.00 56.01  ?  36  GLY B CA    1 
ATOM   3986  C  C     . GLY B 1 36  ? -53.990  61.866  6.272   1.00 60.18  ?  36  GLY B C     1 
ATOM   3987  O  O     . GLY B 1 36  ? -52.785  61.797  5.983   1.00 72.19  ?  36  GLY B O     1 
ATOM   3988  N  N     . LEU B 1 37  ? -54.890  62.417  5.466   1.00 55.34  ?  37  LEU B N     1 
ATOM   3989  C  CA    . LEU B 1 37  ? -54.531  62.850  4.120   1.00 56.96  ?  37  LEU B CA    1 
ATOM   3990  C  C     . LEU B 1 37  ? -54.655  64.354  3.971   1.00 58.29  ?  37  LEU B C     1 
ATOM   3991  O  O     . LEU B 1 37  ? -55.584  64.961  4.531   1.00 60.53  ?  37  LEU B O     1 
ATOM   3992  C  CB    . LEU B 1 37  ? -55.436  62.157  3.097   1.00 56.03  ?  37  LEU B CB    1 
ATOM   3993  C  CG    . LEU B 1 37  ? -55.415  60.631  3.212   1.00 56.94  ?  37  LEU B CG    1 
ATOM   3994  C  CD1   . LEU B 1 37  ? -56.483  59.942  2.345   1.00 53.48  ?  37  LEU B CD1   1 
ATOM   3995  C  CD2   . LEU B 1 37  ? -54.014  60.108  2.873   1.00 55.98  ?  37  LEU B CD2   1 
ATOM   3996  N  N     . LYS B 1 38  ? -53.722  64.957  3.229   1.00 53.74  ?  38  LYS B N     1 
ATOM   3997  C  CA    . LYS B 1 38  ? -53.961  66.299  2.703   1.00 54.82  ?  38  LYS B CA    1 
ATOM   3998  C  C     . LYS B 1 38  ? -54.809  66.113  1.445   1.00 61.91  ?  38  LYS B C     1 
ATOM   3999  O  O     . LYS B 1 38  ? -54.790  65.033  0.842   1.00 64.21  ?  38  LYS B O     1 
ATOM   4000  C  CB    . LYS B 1 38  ? -52.657  67.014  2.371   1.00 57.69  ?  38  LYS B CB    1 
ATOM   4001  C  CG    . LYS B 1 38  ? -51.433  66.436  3.046   1.00 60.16  ?  38  LYS B CG    1 
ATOM   4002  C  CD    . LYS B 1 38  ? -50.393  67.512  3.345   1.00 65.72  ?  38  LYS B CD    1 
ATOM   4003  C  CE    . LYS B 1 38  ? -49.033  66.866  3.587   1.00 71.91  ?  38  LYS B CE    1 
ATOM   4004  N  NZ    . LYS B 1 38  ? -47.924  67.842  3.724   1.00 74.93  ?  38  LYS B NZ    1 
ATOM   4005  N  N     . PRO B 1 39  ? -55.563  67.148  1.038   1.00 63.75  ?  39  PRO B N     1 
ATOM   4006  C  CA    . PRO B 1 39  ? -56.503  66.926  -0.073  1.00 60.97  ?  39  PRO B CA    1 
ATOM   4007  C  C     . PRO B 1 39  ? -55.814  66.413  -1.353  1.00 63.23  ?  39  PRO B C     1 
ATOM   4008  O  O     . PRO B 1 39  ? -56.340  65.507  -1.995  1.00 65.68  ?  39  PRO B O     1 
ATOM   4009  C  CB    . PRO B 1 39  ? -57.120  68.316  -0.314  1.00 57.98  ?  39  PRO B CB    1 
ATOM   4010  C  CG    . PRO B 1 39  ? -56.720  69.152  0.856   1.00 57.44  ?  39  PRO B CG    1 
ATOM   4011  C  CD    . PRO B 1 39  ? -55.432  68.571  1.378   1.00 60.85  ?  39  PRO B CD    1 
ATOM   4012  N  N     . VAL B 1 40  ? -54.656  66.952  -1.725  1.00 60.23  ?  40  VAL B N     1 
ATOM   4013  C  CA    . VAL B 1 40  ? -54.045  66.438  -2.938  1.00 62.59  ?  40  VAL B CA    1 
ATOM   4014  C  C     . VAL B 1 40  ? -53.856  64.931  -2.857  1.00 57.44  ?  40  VAL B C     1 
ATOM   4015  O  O     . VAL B 1 40  ? -54.151  64.224  -3.819  1.00 59.03  ?  40  VAL B O     1 
ATOM   4016  C  CB    . VAL B 1 40  ? -52.721  67.094  -3.294  1.00 60.49  ?  40  VAL B CB    1 
ATOM   4017  C  CG1   . VAL B 1 40  ? -51.579  66.395  -2.588  1.00 54.20  ?  40  VAL B CG1   1 
ATOM   4018  C  CG2   . VAL B 1 40  ? -52.534  66.999  -4.793  1.00 54.14  ?  40  VAL B CG2   1 
ATOM   4019  N  N     . GLN B 1 41  ? -53.380  64.435  -1.713  1.00 51.48  ?  41  GLN B N     1 
ATOM   4020  C  CA    . GLN B 1 41  ? -53.291  62.984  -1.529  1.00 53.76  ?  41  GLN B CA    1 
ATOM   4021  C  C     . GLN B 1 41  ? -54.652  62.284  -1.693  1.00 55.88  ?  41  GLN B C     1 
ATOM   4022  O  O     . GLN B 1 41  ? -54.756  61.333  -2.456  1.00 64.91  ?  41  GLN B O     1 
ATOM   4023  C  CB    . GLN B 1 41  ? -52.640  62.597  -0.193  1.00 55.92  ?  41  GLN B CB    1 
ATOM   4024  C  CG    . GLN B 1 41  ? -51.234  63.150  0.045   1.00 60.79  ?  41  GLN B CG    1 
ATOM   4025  C  CD    . GLN B 1 41  ? -50.815  63.078  1.512   1.00 72.56  ?  41  GLN B CD    1 
ATOM   4026  O  OE1   . GLN B 1 41  ? -51.641  63.212  2.425   1.00 80.75  ?  41  GLN B OE1   1 
ATOM   4027  N  NE2   . GLN B 1 41  ? -49.532  62.860  1.743   1.00 77.54  ?  41  GLN B NE2   1 
ATOM   4028  N  N     . ARG B 1 42  ? -55.684  62.748  -0.987  1.00 51.12  ?  42  ARG B N     1 
ATOM   4029  C  CA    . ARG B 1 42  ? -57.021  62.134  -1.067  1.00 55.77  ?  42  ARG B CA    1 
ATOM   4030  C  C     . ARG B 1 42  ? -57.534  62.050  -2.508  1.00 62.87  ?  42  ARG B C     1 
ATOM   4031  O  O     . ARG B 1 42  ? -58.159  61.064  -2.909  1.00 65.40  ?  42  ARG B O     1 
ATOM   4032  C  CB    . ARG B 1 42  ? -58.028  62.912  -0.211  1.00 57.27  ?  42  ARG B CB    1 
ATOM   4033  C  CG    . ARG B 1 42  ? -59.340  62.187  0.054   1.00 56.31  ?  42  ARG B CG    1 
ATOM   4034  C  CD    . ARG B 1 42  ? -60.250  62.993  1.010   1.00 63.17  ?  42  ARG B CD    1 
ATOM   4035  N  NE    . ARG B 1 42  ? -59.608  63.252  2.302   1.00 67.24  ?  42  ARG B NE    1 
ATOM   4036  C  CZ    . ARG B 1 42  ? -59.099  64.431  2.660   1.00 73.64  ?  42  ARG B CZ    1 
ATOM   4037  N  NH1   . ARG B 1 42  ? -59.176  65.463  1.831   1.00 81.37  ?  42  ARG B NH1   1 
ATOM   4038  N  NH2   . ARG B 1 42  ? -58.507  64.582  3.840   1.00 70.59  ?  42  ARG B NH2   1 
ATOM   4039  N  N     . ARG B 1 43  ? -57.267  63.089  -3.291  1.00 60.52  ?  43  ARG B N     1 
ATOM   4040  C  CA    . ARG B 1 43  ? -57.740  63.120  -4.664  1.00 57.05  ?  43  ARG B CA    1 
ATOM   4041  C  C     . ARG B 1 43  ? -57.013  62.115  -5.544  1.00 63.75  ?  43  ARG B C     1 
ATOM   4042  O  O     . ARG B 1 43  ? -57.646  61.299  -6.215  1.00 74.17  ?  43  ARG B O     1 
ATOM   4043  C  CB    . ARG B 1 43  ? -57.595  64.517  -5.223  1.00 52.70  ?  43  ARG B CB    1 
ATOM   4044  C  CG    . ARG B 1 43  ? -58.744  65.395  -4.836  1.00 54.97  ?  43  ARG B CG    1 
ATOM   4045  C  CD    . ARG B 1 43  ? -58.315  66.828  -4.826  1.00 58.80  ?  43  ARG B CD    1 
ATOM   4046  N  NE    . ARG B 1 43  ? -59.447  67.698  -4.553  1.00 61.67  ?  43  ARG B NE    1 
ATOM   4047  C  CZ    . ARG B 1 43  ? -59.323  68.986  -4.270  1.00 66.04  ?  43  ARG B CZ    1 
ATOM   4048  N  NH1   . ARG B 1 43  ? -58.108  69.533  -4.221  1.00 66.55  ?  43  ARG B NH1   1 
ATOM   4049  N  NH2   . ARG B 1 43  ? -60.409  69.717  -4.037  1.00 69.76  ?  43  ARG B NH2   1 
ATOM   4050  N  N     . ILE B 1 44  ? -55.686  62.175  -5.546  1.00 58.52  ?  44  ILE B N     1 
ATOM   4051  C  CA    . ILE B 1 44  ? -54.902  61.102  -6.139  1.00 59.59  ?  44  ILE B CA    1 
ATOM   4052  C  C     . ILE B 1 44  ? -55.533  59.734  -5.865  1.00 68.75  ?  44  ILE B C     1 
ATOM   4053  O  O     . ILE B 1 44  ? -55.795  58.971  -6.800  1.00 73.87  ?  44  ILE B O     1 
ATOM   4054  C  CB    . ILE B 1 44  ? -53.487  61.050  -5.575  1.00 51.89  ?  44  ILE B CB    1 
ATOM   4055  C  CG1   . ILE B 1 44  ? -52.712  62.310  -5.944  1.00 50.63  ?  44  ILE B CG1   1 
ATOM   4056  C  CG2   . ILE B 1 44  ? -52.779  59.784  -6.059  1.00 49.98  ?  44  ILE B CG2   1 
ATOM   4057  C  CD1   . ILE B 1 44  ? -51.364  62.388  -5.282  1.00 53.68  ?  44  ILE B CD1   1 
ATOM   4058  N  N     . LEU B 1 45  ? -55.767  59.421  -4.588  1.00 62.86  ?  45  LEU B N     1 
ATOM   4059  C  CA    . LEU B 1 45  ? -56.342  58.130  -4.228  1.00 57.81  ?  45  LEU B CA    1 
ATOM   4060  C  C     . LEU B 1 45  ? -57.752  57.941  -4.780  1.00 58.89  ?  45  LEU B C     1 
ATOM   4061  O  O     . LEU B 1 45  ? -58.023  56.954  -5.466  1.00 66.70  ?  45  LEU B O     1 
ATOM   4062  C  CB    . LEU B 1 45  ? -56.341  57.913  -2.719  1.00 57.78  ?  45  LEU B CB    1 
ATOM   4063  C  CG    . LEU B 1 45  ? -54.997  57.747  -2.023  1.00 63.39  ?  45  LEU B CG    1 
ATOM   4064  C  CD1   . LEU B 1 45  ? -55.215  57.499  -0.537  1.00 73.65  ?  45  LEU B CD1   1 
ATOM   4065  C  CD2   . LEU B 1 45  ? -54.235  56.618  -2.630  1.00 61.74  ?  45  LEU B CD2   1 
ATOM   4066  N  N     . TYR B 1 46  ? -58.655  58.871  -4.482  1.00 51.13  ?  46  TYR B N     1 
ATOM   4067  C  CA    . TYR B 1 46  ? -60.019  58.711  -4.961  1.00 51.51  ?  46  TYR B CA    1 
ATOM   4068  C  C     . TYR B 1 46  ? -59.996  58.528  -6.475  1.00 63.93  ?  46  TYR B C     1 
ATOM   4069  O  O     . TYR B 1 46  ? -60.705  57.678  -7.013  1.00 67.01  ?  46  TYR B O     1 
ATOM   4070  C  CB    . TYR B 1 46  ? -60.915  59.897  -4.584  1.00 44.58  ?  46  TYR B CB    1 
ATOM   4071  C  CG    . TYR B 1 46  ? -62.323  59.747  -5.135  1.00 50.68  ?  46  TYR B CG    1 
ATOM   4072  C  CD1   . TYR B 1 46  ? -62.792  60.581  -6.146  1.00 52.18  ?  46  TYR B CD1   1 
ATOM   4073  C  CD2   . TYR B 1 46  ? -63.170  58.737  -4.682  1.00 51.09  ?  46  TYR B CD2   1 
ATOM   4074  C  CE1   . TYR B 1 46  ? -64.078  60.430  -6.668  1.00 58.64  ?  46  TYR B CE1   1 
ATOM   4075  C  CE2   . TYR B 1 46  ? -64.445  58.579  -5.193  1.00 50.81  ?  46  TYR B CE2   1 
ATOM   4076  C  CZ    . TYR B 1 46  ? -64.896  59.426  -6.182  1.00 59.99  ?  46  TYR B CZ    1 
ATOM   4077  O  OH    . TYR B 1 46  ? -66.164  59.268  -6.708  1.00 65.57  ?  46  TYR B OH    1 
ATOM   4078  N  N     . SER B 1 47  ? -59.166  59.318  -7.157  1.00 65.70  ?  47  SER B N     1 
ATOM   4079  C  CA    . SER B 1 47  ? -59.147  59.314  -8.615  1.00 69.40  ?  47  SER B CA    1 
ATOM   4080  C  C     . SER B 1 47  ? -58.662  57.979  -9.165  1.00 65.52  ?  47  SER B C     1 
ATOM   4081  O  O     . SER B 1 47  ? -59.323  57.359  -10.007 1.00 65.84  ?  47  SER B O     1 
ATOM   4082  C  CB    . SER B 1 47  ? -58.298  60.461  -9.178  1.00 73.97  ?  47  SER B CB    1 
ATOM   4083  O  OG    . SER B 1 47  ? -58.354  60.473  -10.600 1.00 81.52  ?  47  SER B OG    1 
ATOM   4084  N  N     . MET B 1 48  ? -57.505  57.534  -8.693  1.00 60.48  ?  48  MET B N     1 
ATOM   4085  C  CA    . MET B 1 48  ? -56.950  56.292  -9.207  1.00 58.46  ?  48  MET B CA    1 
ATOM   4086  C  C     . MET B 1 48  ? -57.974  55.183  -8.990  1.00 64.16  ?  48  MET B C     1 
ATOM   4087  O  O     . MET B 1 48  ? -58.222  54.347  -9.864  1.00 67.59  ?  48  MET B O     1 
ATOM   4088  C  CB    . MET B 1 48  ? -55.584  55.982  -8.576  1.00 47.64  ?  48  MET B CB    1 
ATOM   4089  C  CG    . MET B 1 48  ? -54.505  56.960  -9.013  1.00 44.87  ?  48  MET B CG    1 
ATOM   4090  S  SD    . MET B 1 48  ? -52.829  56.615  -8.459  1.00 61.83  ?  48  MET B SD    1 
ATOM   4091  C  CE    . MET B 1 48  ? -52.614  54.933  -9.032  1.00 146.69 ?  48  MET B CE    1 
ATOM   4092  N  N     . ASN B 1 49  ? -58.607  55.208  -7.830  1.00 63.93  ?  49  ASN B N     1 
ATOM   4093  C  CA    . ASN B 1 49  ? -59.584  54.195  -7.515  1.00 64.09  ?  49  ASN B CA    1 
ATOM   4094  C  C     . ASN B 1 49  ? -60.783  54.218  -8.487  1.00 63.57  ?  49  ASN B C     1 
ATOM   4095  O  O     . ASN B 1 49  ? -61.292  53.165  -8.892  1.00 64.16  ?  49  ASN B O     1 
ATOM   4096  C  CB    . ASN B 1 49  ? -60.008  54.329  -6.053  1.00 60.76  ?  49  ASN B CB    1 
ATOM   4097  C  CG    . ASN B 1 49  ? -60.871  53.182  -5.597  1.00 62.98  ?  49  ASN B CG    1 
ATOM   4098  O  OD1   . ASN B 1 49  ? -62.078  53.352  -5.369  1.00 70.74  ?  49  ASN B OD1   1 
ATOM   4099  N  ND2   . ASN B 1 49  ? -60.263  51.992  -5.469  1.00 58.34  ?  49  ASN B ND2   1 
ATOM   4100  N  N     . LYS B 1 50  ? -61.225  55.414  -8.869  1.00 63.48  ?  50  LYS B N     1 
ATOM   4101  C  CA    . LYS B 1 50  ? -62.408  55.541  -9.727  1.00 65.52  ?  50  LYS B CA    1 
ATOM   4102  C  C     . LYS B 1 50  ? -62.026  54.921  -11.053 1.00 67.66  ?  50  LYS B C     1 
ATOM   4103  O  O     . LYS B 1 50  ? -62.825  54.243  -11.699 1.00 70.32  ?  50  LYS B O     1 
ATOM   4104  C  CB    . LYS B 1 50  ? -62.799  57.022  -9.923  1.00 62.94  ?  50  LYS B CB    1 
ATOM   4105  C  CG    . LYS B 1 50  ? -64.307  57.323  -10.055 1.00 61.77  ?  50  LYS B CG    1 
ATOM   4106  C  CD    . LYS B 1 50  ? -64.544  58.640  -10.820 1.00 62.28  ?  50  LYS B CD    1 
ATOM   4107  N  N     . ASP B 1 51  ? -60.773  55.154  -11.432 1.00 66.37  ?  51  ASP B N     1 
ATOM   4108  C  CA    . ASP B 1 51  ? -60.234  54.688  -12.694 1.00 72.01  ?  51  ASP B CA    1 
ATOM   4109  C  C     . ASP B 1 51  ? -59.829  53.206  -12.672 1.00 74.32  ?  51  ASP B C     1 
ATOM   4110  O  O     . ASP B 1 51  ? -59.243  52.705  -13.627 1.00 86.26  ?  51  ASP B O     1 
ATOM   4111  C  CB    . ASP B 1 51  ? -59.061  55.584  -13.119 1.00 83.36  ?  51  ASP B CB    1 
ATOM   4112  C  CG    . ASP B 1 51  ? -59.505  57.012  -13.483 1.00 99.41  ?  51  ASP B CG    1 
ATOM   4113  O  OD1   . ASP B 1 51  ? -60.726  57.233  -13.687 1.00 102.31 ?  51  ASP B OD1   1 
ATOM   4114  O  OD2   . ASP B 1 51  ? -58.629  57.908  -13.579 1.00 107.43 ?  51  ASP B OD2   1 
ATOM   4115  N  N     . SER B 1 52  ? -60.147  52.508  -11.587 1.00 69.83  ?  52  SER B N     1 
ATOM   4116  C  CA    . SER B 1 52  ? -59.921  51.065  -11.489 1.00 70.54  ?  52  SER B CA    1 
ATOM   4117  C  C     . SER B 1 52  ? -58.439  50.700  -11.444 1.00 73.47  ?  52  SER B C     1 
ATOM   4118  O  O     . SER B 1 52  ? -58.066  49.542  -11.655 1.00 78.45  ?  52  SER B O     1 
ATOM   4119  C  CB    . SER B 1 52  ? -60.593  50.338  -12.652 1.00 76.37  ?  52  SER B CB    1 
ATOM   4120  O  OG    . SER B 1 52  ? -61.991  50.570  -12.686 1.00 79.68  ?  52  SER B OG    1 
ATOM   4121  N  N     . ASN B 1 53  ? -57.606  51.696  -11.153 1.00 70.08  ?  53  ASN B N     1 
ATOM   4122  C  CA    . ASN B 1 53  ? -56.153  51.548  -11.149 1.00 66.40  ?  53  ASN B CA    1 
ATOM   4123  C  C     . ASN B 1 53  ? -55.639  51.030  -9.797  1.00 75.02  ?  53  ASN B C     1 
ATOM   4124  O  O     . ASN B 1 53  ? -55.088  51.781  -8.981  1.00 81.62  ?  53  ASN B O     1 
ATOM   4125  C  CB    . ASN B 1 53  ? -55.512  52.897  -11.496 1.00 60.56  ?  53  ASN B CB    1 
ATOM   4126  C  CG    . ASN B 1 53  ? -54.051  52.771  -11.829 1.00 66.96  ?  53  ASN B CG    1 
ATOM   4127  O  OD1   . ASN B 1 53  ? -53.561  51.660  -12.084 1.00 76.45  ?  53  ASN B OD1   1 
ATOM   4128  N  ND2   . ASN B 1 53  ? -53.334  53.903  -11.832 1.00 59.32  ?  53  ASN B ND2   1 
ATOM   4129  N  N     . THR B 1 54  ? -55.803  49.734  -9.574  1.00 72.67  ?  54  THR B N     1 
ATOM   4130  C  CA    . THR B 1 54  ? -55.617  49.162  -8.248  1.00 66.63  ?  54  THR B CA    1 
ATOM   4131  C  C     . THR B 1 54  ? -54.562  48.063  -8.243  1.00 73.30  ?  54  THR B C     1 
ATOM   4132  O  O     . THR B 1 54  ? -54.109  47.631  -9.297  1.00 76.05  ?  54  THR B O     1 
ATOM   4133  C  CB    . THR B 1 54  ? -56.949  48.626  -7.715  1.00 58.96  ?  54  THR B CB    1 
ATOM   4134  O  OG1   . THR B 1 54  ? -57.457  47.622  -8.607  1.00 55.91  ?  54  THR B OG1   1 
ATOM   4135  C  CG2   . THR B 1 54  ? -57.958  49.747  -7.655  1.00 56.73  ?  54  THR B CG2   1 
ATOM   4136  N  N     . PHE B 1 55  ? -54.181  47.613  -7.054  1.00 78.91  ?  55  PHE B N     1 
ATOM   4137  C  CA    . PHE B 1 55  ? -53.029  46.723  -6.894  1.00 78.81  ?  55  PHE B CA    1 
ATOM   4138  C  C     . PHE B 1 55  ? -53.202  45.436  -7.675  1.00 75.41  ?  55  PHE B C     1 
ATOM   4139  O  O     . PHE B 1 55  ? -52.226  44.811  -8.097  1.00 79.98  ?  55  PHE B O     1 
ATOM   4140  C  CB    . PHE B 1 55  ? -52.873  46.347  -5.431  1.00 77.47  ?  55  PHE B CB    1 
ATOM   4141  C  CG    . PHE B 1 55  ? -53.939  45.425  -4.956  1.00 74.95  ?  55  PHE B CG    1 
ATOM   4142  C  CD1   . PHE B 1 55  ? -55.226  45.898  -4.742  1.00 80.87  ?  55  PHE B CD1   1 
ATOM   4143  C  CD2   . PHE B 1 55  ? -53.678  44.078  -4.769  1.00 71.50  ?  55  PHE B CD2   1 
ATOM   4144  C  CE1   . PHE B 1 55  ? -56.235  45.045  -4.328  1.00 87.04  ?  55  PHE B CE1   1 
ATOM   4145  C  CE2   . PHE B 1 55  ? -54.679  43.222  -4.353  1.00 56.43  ?  55  PHE B CE2   1 
ATOM   4146  C  CZ    . PHE B 1 55  ? -55.961  43.707  -4.134  1.00 91.54  ?  55  PHE B CZ    1 
ATOM   4147  N  N     . ASP B 1 56  ? -54.455  45.035  -7.846  1.00 68.95  ?  56  ASP B N     1 
ATOM   4148  C  CA    . ASP B 1 56  ? -54.777  43.753  -8.450  1.00 73.65  ?  56  ASP B CA    1 
ATOM   4149  C  C     . ASP B 1 56  ? -54.810  43.814  -9.981  1.00 75.94  ?  56  ASP B C     1 
ATOM   4150  O  O     . ASP B 1 56  ? -54.930  42.779  -10.640 1.00 79.55  ?  56  ASP B O     1 
ATOM   4151  C  CB    . ASP B 1 56  ? -56.135  43.285  -7.942  1.00 82.66  ?  56  ASP B CB    1 
ATOM   4152  C  CG    . ASP B 1 56  ? -57.243  44.275  -8.256  1.00 88.46  ?  56  ASP B CG    1 
ATOM   4153  O  OD1   . ASP B 1 56  ? -57.088  45.471  -7.931  1.00 90.74  ?  56  ASP B OD1   1 
ATOM   4154  O  OD2   . ASP B 1 56  ? -58.263  43.861  -8.840  1.00 91.22  ?  56  ASP B OD2   1 
ATOM   4155  N  N     . LYS B 1 57  ? -54.725  45.022  -10.537 1.00 77.17  ?  57  LYS B N     1 
ATOM   4156  C  CA    . LYS B 1 57  ? -54.778  45.219  -11.985 1.00 75.12  ?  57  LYS B CA    1 
ATOM   4157  C  C     . LYS B 1 57  ? -53.502  45.869  -12.518 1.00 78.04  ?  57  LYS B C     1 
ATOM   4158  O  O     . LYS B 1 57  ? -52.688  46.358  -11.749 1.00 83.13  ?  57  LYS B O     1 
ATOM   4159  C  CB    . LYS B 1 57  ? -56.005  46.051  -12.373 1.00 70.60  ?  57  LYS B CB    1 
ATOM   4160  C  CG    . LYS B 1 57  ? -57.331  45.380  -12.074 1.00 70.47  ?  57  LYS B CG    1 
ATOM   4161  C  CD    . LYS B 1 57  ? -58.490  46.154  -12.682 1.00 83.23  ?  57  LYS B CD    1 
ATOM   4162  C  CE    . LYS B 1 57  ? -59.821  45.805  -12.009 1.00 94.98  ?  57  LYS B CE    1 
ATOM   4163  N  NZ    . LYS B 1 57  ? -59.961  46.504  -10.681 1.00 99.95  ?  57  LYS B NZ    1 
ATOM   4164  N  N     . SER B 1 58  ? -53.336  45.879  -13.837 1.00 80.01  ?  58  SER B N     1 
ATOM   4165  C  CA    . SER B 1 58  ? -52.124  46.415  -14.459 1.00 78.03  ?  58  SER B CA    1 
ATOM   4166  C  C     . SER B 1 58  ? -51.738  47.809  -13.984 1.00 74.86  ?  58  SER B C     1 
ATOM   4167  O  O     . SER B 1 58  ? -52.547  48.516  -13.382 1.00 83.86  ?  58  SER B O     1 
ATOM   4168  C  CB    . SER B 1 58  ? -52.279  46.420  -15.968 1.00 89.03  ?  58  SER B CB    1 
ATOM   4169  O  OG    . SER B 1 58  ? -52.435  45.095  -16.448 1.00 101.19 ?  58  SER B OG    1 
ATOM   4170  N  N     . TYR B 1 59  ? -50.488  48.189  -14.235 1.00 67.93  ?  59  TYR B N     1 
ATOM   4171  C  CA    . TYR B 1 59  ? -50.041  49.562  -13.988 1.00 72.21  ?  59  TYR B CA    1 
ATOM   4172  C  C     . TYR B 1 59  ? -50.529  50.512  -15.104 1.00 84.75  ?  59  TYR B C     1 
ATOM   4173  O  O     . TYR B 1 59  ? -50.579  50.132  -16.278 1.00 97.96  ?  59  TYR B O     1 
ATOM   4174  C  CB    . TYR B 1 59  ? -48.507  49.634  -13.878 1.00 71.72  ?  59  TYR B CB    1 
ATOM   4175  C  CG    . TYR B 1 59  ? -47.895  49.070  -12.606 1.00 78.88  ?  59  TYR B CG    1 
ATOM   4176  C  CD1   . TYR B 1 59  ? -47.517  47.735  -12.517 1.00 85.73  ?  59  TYR B CD1   1 
ATOM   4177  C  CD2   . TYR B 1 59  ? -47.659  49.886  -11.507 1.00 80.53  ?  59  TYR B CD2   1 
ATOM   4178  C  CE1   . TYR B 1 59  ? -46.948  47.221  -11.355 1.00 86.44  ?  59  TYR B CE1   1 
ATOM   4179  C  CE2   . TYR B 1 59  ? -47.093  49.386  -10.343 1.00 82.03  ?  59  TYR B CE2   1 
ATOM   4180  C  CZ    . TYR B 1 59  ? -46.737  48.052  -10.264 1.00 84.36  ?  59  TYR B CZ    1 
ATOM   4181  O  OH    . TYR B 1 59  ? -46.169  47.561  -9.088  1.00 84.56  ?  59  TYR B OH    1 
ATOM   4182  N  N     . ARG B 1 60  ? -50.889  51.739  -14.727 1.00 80.89  ?  60  ARG B N     1 
ATOM   4183  C  CA    . ARG B 1 60  ? -51.239  52.801  -15.673 1.00 82.23  ?  60  ARG B CA    1 
ATOM   4184  C  C     . ARG B 1 60  ? -50.061  53.767  -15.802 1.00 80.59  ?  60  ARG B C     1 
ATOM   4185  O  O     . ARG B 1 60  ? -49.420  54.103  -14.786 1.00 80.69  ?  60  ARG B O     1 
ATOM   4186  C  CB    . ARG B 1 60  ? -52.416  53.618  -15.141 1.00 88.19  ?  60  ARG B CB    1 
ATOM   4187  C  CG    . ARG B 1 60  ? -53.817  53.237  -15.580 1.00 96.07  ?  60  ARG B CG    1 
ATOM   4188  C  CD    . ARG B 1 60  ? -54.795  54.340  -15.114 1.00 102.67 ?  60  ARG B CD    1 
ATOM   4189  N  NE    . ARG B 1 60  ? -56.206  53.957  -15.144 1.00 113.76 ?  60  ARG B NE    1 
ATOM   4190  C  CZ    . ARG B 1 60  ? -56.706  52.932  -15.831 1.00 126.63 ?  60  ARG B CZ    1 
ATOM   4191  N  NH1   . ARG B 1 60  ? -55.918  52.167  -16.578 1.00 135.01 ?  60  ARG B NH1   1 
ATOM   4192  N  NH2   . ARG B 1 60  ? -58.006  52.677  -15.782 1.00 128.75 ?  60  ARG B NH2   1 
ATOM   4193  N  N     . LYS B 1 61  ? -49.790  54.240  -17.023 1.00 76.41  ?  61  LYS B N     1 
ATOM   4194  C  CA    . LYS B 1 61  ? -48.771  55.281  -17.205 1.00 71.66  ?  61  LYS B CA    1 
ATOM   4195  C  C     . LYS B 1 61  ? -49.143  56.444  -16.286 1.00 69.68  ?  61  LYS B C     1 
ATOM   4196  O  O     . LYS B 1 61  ? -50.313  56.785  -16.167 1.00 70.18  ?  61  LYS B O     1 
ATOM   4197  C  CB    . LYS B 1 61  ? -48.623  55.707  -18.682 1.00 68.33  ?  61  LYS B CB    1 
ATOM   4198  N  N     . SER B 1 62  ? -48.165  57.019  -15.595 1.00 65.62  ?  62  SER B N     1 
ATOM   4199  C  CA    . SER B 1 62  ? -48.467  57.995  -14.541 1.00 60.37  ?  62  SER B CA    1 
ATOM   4200  C  C     . SER B 1 62  ? -49.162  59.247  -15.067 1.00 64.44  ?  62  SER B C     1 
ATOM   4201  O  O     . SER B 1 62  ? -50.146  59.728  -14.483 1.00 62.00  ?  62  SER B O     1 
ATOM   4202  C  CB    . SER B 1 62  ? -47.197  58.372  -13.790 1.00 57.81  ?  62  SER B CB    1 
ATOM   4203  O  OG    . SER B 1 62  ? -46.650  57.228  -13.155 1.00 64.87  ?  62  SER B OG    1 
ATOM   4204  N  N     . ALA B 1 63  ? -48.638  59.758  -16.178 1.00 62.78  ?  63  ALA B N     1 
ATOM   4205  C  CA    . ALA B 1 63  ? -49.209  60.908  -16.868 1.00 59.44  ?  63  ALA B CA    1 
ATOM   4206  C  C     . ALA B 1 63  ? -50.719  60.808  -17.048 1.00 62.36  ?  63  ALA B C     1 
ATOM   4207  O  O     . ALA B 1 63  ? -51.419  61.807  -16.967 1.00 66.48  ?  63  ALA B O     1 
ATOM   4208  C  CB    . ALA B 1 63  ? -48.544  61.079  -18.216 1.00 61.24  ?  63  ALA B CB    1 
ATOM   4209  N  N     . LYS B 1 64  ? -51.210  59.607  -17.325 1.00 53.14  ?  64  LYS B N     1 
ATOM   4210  C  CA    . LYS B 1 64  ? -52.639  59.380  -17.453 1.00 53.72  ?  64  LYS B CA    1 
ATOM   4211  C  C     . LYS B 1 64  ? -53.313  59.583  -16.094 1.00 58.98  ?  64  LYS B C     1 
ATOM   4212  O  O     . LYS B 1 64  ? -54.314  60.280  -16.001 1.00 60.64  ?  64  LYS B O     1 
ATOM   4213  C  CB    . LYS B 1 64  ? -52.935  57.977  -18.020 1.00 61.92  ?  64  LYS B CB    1 
ATOM   4214  C  CG    . LYS B 1 64  ? -54.419  57.673  -18.256 1.00 56.40  ?  64  LYS B CG    1 
ATOM   4215  C  CD    . LYS B 1 64  ? -54.653  56.322  -18.904 1.00 78.88  ?  64  LYS B CD    1 
ATOM   4216  C  CE    . LYS B 1 64  ? -56.143  55.980  -18.897 1.00 89.18  ?  64  LYS B CE    1 
ATOM   4217  N  NZ    . LYS B 1 64  ? -56.451  54.623  -19.458 1.00 98.78  ?  64  LYS B NZ    1 
ATOM   4218  N  N     . SER B 1 65  ? -52.760  59.004  -15.035 1.00 54.13  ?  65  SER B N     1 
ATOM   4219  C  CA    . SER B 1 65  ? -53.391  59.135  -13.726 1.00 62.40  ?  65  SER B CA    1 
ATOM   4220  C  C     . SER B 1 65  ? -53.433  60.606  -13.337 1.00 67.50  ?  65  SER B C     1 
ATOM   4221  O  O     . SER B 1 65  ? -54.483  61.139  -12.970 1.00 70.32  ?  65  SER B O     1 
ATOM   4222  C  CB    . SER B 1 65  ? -52.649  58.315  -12.667 1.00 64.37  ?  65  SER B CB    1 
ATOM   4223  O  OG    . SER B 1 65  ? -52.709  56.914  -12.918 1.00 66.34  ?  65  SER B OG    1 
ATOM   4224  N  N     . VAL B 1 66  ? -52.278  61.259  -13.441 1.00 65.91  ?  66  VAL B N     1 
ATOM   4225  C  CA    . VAL B 1 66  ? -52.135  62.663  -13.060 1.00 64.26  ?  66  VAL B CA    1 
ATOM   4226  C  C     . VAL B 1 66  ? -53.148  63.557  -13.761 1.00 69.08  ?  66  VAL B C     1 
ATOM   4227  O  O     . VAL B 1 66  ? -53.985  64.184  -13.117 1.00 71.01  ?  66  VAL B O     1 
ATOM   4228  C  CB    . VAL B 1 66  ? -50.713  63.183  -13.365 1.00 56.87  ?  66  VAL B CB    1 
ATOM   4229  C  CG1   . VAL B 1 66  ? -50.720  64.698  -13.595 1.00 52.09  ?  66  VAL B CG1   1 
ATOM   4230  C  CG2   . VAL B 1 66  ? -49.761  62.797  -12.242 1.00 60.22  ?  66  VAL B CG2   1 
ATOM   4231  N  N     . GLY B 1 67  ? -53.060  63.616  -15.081 1.00 50.31  ?  67  GLY B N     1 
ATOM   4232  C  CA    . GLY B 1 67  ? -53.963  64.425  -15.860 1.00 67.98  ?  67  GLY B CA    1 
ATOM   4233  C  C     . GLY B 1 67  ? -55.431  64.202  -15.561 1.00 63.55  ?  67  GLY B C     1 
ATOM   4234  O  O     . GLY B 1 67  ? -56.234  65.131  -15.668 1.00 61.03  ?  67  GLY B O     1 
ATOM   4235  N  N     . ASN B 1 68  ? -55.804  62.981  -15.193 1.00 62.04  ?  68  ASN B N     1 
ATOM   4236  C  CA    . ASN B 1 68  ? -57.204  62.726  -14.870 1.00 59.09  ?  68  ASN B CA    1 
ATOM   4237  C  C     . ASN B 1 68  ? -57.537  63.368  -13.538 1.00 61.77  ?  68  ASN B C     1 
ATOM   4238  O  O     . ASN B 1 68  ? -58.608  63.953  -13.372 1.00 65.43  ?  68  ASN B O     1 
ATOM   4239  C  CB    . ASN B 1 68  ? -57.548  61.228  -14.894 1.00 58.74  ?  68  ASN B CB    1 
ATOM   4240  C  CG    . ASN B 1 68  ? -57.742  60.705  -16.296 1.00 73.15  ?  68  ASN B CG    1 
ATOM   4241  O  OD1   . ASN B 1 68  ? -58.864  60.544  -16.759 1.00 75.13  ?  68  ASN B OD1   1 
ATOM   4242  N  ND2   . ASN B 1 68  ? -56.640  60.471  -17.000 1.00 87.42  ?  68  ASN B ND2   1 
ATOM   4243  N  N     . ILE B 1 69  ? -56.603  63.265  -12.595 1.00 61.17  ?  69  ILE B N     1 
ATOM   4244  C  CA    . ILE B 1 69  ? -56.694  63.981  -11.328 1.00 58.82  ?  69  ILE B CA    1 
ATOM   4245  C  C     . ILE B 1 69  ? -56.861  65.475  -11.574 1.00 62.26  ?  69  ILE B C     1 
ATOM   4246  O  O     . ILE B 1 69  ? -57.782  66.114  -11.064 1.00 64.27  ?  69  ILE B O     1 
ATOM   4247  C  CB    . ILE B 1 69  ? -55.415  63.785  -10.507 1.00 52.19  ?  69  ILE B CB    1 
ATOM   4248  C  CG1   . ILE B 1 69  ? -55.423  62.424  -9.816  1.00 47.39  ?  69  ILE B CG1   1 
ATOM   4249  C  CG2   . ILE B 1 69  ? -55.269  64.883  -9.476  1.00 50.15  ?  69  ILE B CG2   1 
ATOM   4250  C  CD1   . ILE B 1 69  ? -54.048  61.966  -9.435  1.00 47.41  ?  69  ILE B CD1   1 
ATOM   4251  N  N     . MET B 1 70  ? -55.969  66.023  -12.382 1.00 58.28  ?  70  MET B N     1 
ATOM   4252  C  CA    . MET B 1 70  ? -55.930  67.453  -12.589 1.00 56.48  ?  70  MET B CA    1 
ATOM   4253  C  C     . MET B 1 70  ? -57.167  68.011  -13.327 1.00 61.07  ?  70  MET B C     1 
ATOM   4254  O  O     . MET B 1 70  ? -57.449  69.208  -13.271 1.00 71.02  ?  70  MET B O     1 
ATOM   4255  C  CB    . MET B 1 70  ? -54.613  67.831  -13.265 1.00 51.27  ?  70  MET B CB    1 
ATOM   4256  C  CG    . MET B 1 70  ? -54.723  69.000  -14.218 1.00 59.94  ?  70  MET B CG    1 
ATOM   4257  S  SD    . MET B 1 70  ? -53.080  69.504  -14.731 1.00 100.61 ?  70  MET B SD    1 
ATOM   4258  C  CE    . MET B 1 70  ? -52.154  68.028  -14.261 1.00 55.92  ?  70  MET B CE    1 
ATOM   4259  N  N     . GLY B 1 71  ? -57.928  67.154  -13.992 1.00 57.51  ?  71  GLY B N     1 
ATOM   4260  C  CA    . GLY B 1 71  ? -59.062  67.630  -14.774 1.00 60.48  ?  71  GLY B CA    1 
ATOM   4261  C  C     . GLY B 1 71  ? -60.367  67.239  -14.118 1.00 67.64  ?  71  GLY B C     1 
ATOM   4262  O  O     . GLY B 1 71  ? -61.450  67.721  -14.462 1.00 78.42  ?  71  GLY B O     1 
ATOM   4263  N  N     . ASN B 1 72  ? -60.273  66.356  -13.138 1.00 63.42  ?  72  ASN B N     1 
ATOM   4264  C  CA    . ASN B 1 72  ? -61.469  65.966  -12.425 1.00 72.76  ?  72  ASN B CA    1 
ATOM   4265  C  C     . ASN B 1 72  ? -61.567  66.529  -11.008 1.00 73.38  ?  72  ASN B C     1 
ATOM   4266  O  O     . ASN B 1 72  ? -62.670  66.831  -10.555 1.00 73.24  ?  72  ASN B O     1 
ATOM   4267  C  CB    . ASN B 1 72  ? -61.612  64.449  -12.415 1.00 81.54  ?  72  ASN B CB    1 
ATOM   4268  C  CG    . ASN B 1 72  ? -61.878  63.884  -13.789 1.00 87.84  ?  72  ASN B CG    1 
ATOM   4269  O  OD1   . ASN B 1 72  ? -62.435  64.559  -14.657 1.00 85.13  ?  72  ASN B OD1   1 
ATOM   4270  N  ND2   . ASN B 1 72  ? -61.489  62.628  -13.992 1.00 91.75  ?  72  ASN B ND2   1 
ATOM   4271  N  N     . PHE B 1 73  ? -60.436  66.692  -10.315 1.00 68.26  ?  73  PHE B N     1 
ATOM   4272  C  CA    . PHE B 1 73  ? -60.488  67.048  -8.883  1.00 65.10  ?  73  PHE B CA    1 
ATOM   4273  C  C     . PHE B 1 73  ? -59.538  68.143  -8.388  1.00 70.28  ?  73  PHE B C     1 
ATOM   4274  O  O     . PHE B 1 73  ? -59.944  69.014  -7.628  1.00 76.31  ?  73  PHE B O     1 
ATOM   4275  C  CB    . PHE B 1 73  ? -60.339  65.790  -8.028  1.00 59.19  ?  73  PHE B CB    1 
ATOM   4276  C  CG    . PHE B 1 73  ? -61.210  64.673  -8.491  1.00 58.58  ?  73  PHE B CG    1 
ATOM   4277  C  CD1   . PHE B 1 73  ? -60.684  63.637  -9.256  1.00 61.12  ?  73  PHE B CD1   1 
ATOM   4278  C  CD2   . PHE B 1 73  ? -62.571  64.695  -8.235  1.00 59.11  ?  73  PHE B CD2   1 
ATOM   4279  C  CE1   . PHE B 1 73  ? -61.487  62.619  -9.714  1.00 59.48  ?  73  PHE B CE1   1 
ATOM   4280  C  CE2   . PHE B 1 73  ? -63.385  63.686  -8.691  1.00 62.18  ?  73  PHE B CE2   1 
ATOM   4281  C  CZ    . PHE B 1 73  ? -62.845  62.643  -9.434  1.00 62.25  ?  73  PHE B CZ    1 
ATOM   4282  N  N     . HIS B 1 74  ? -58.289  68.100  -8.827  1.00 67.65  ?  74  HIS B N     1 
ATOM   4283  C  CA    . HIS B 1 74  ? -57.262  68.977  -8.291  1.00 69.09  ?  74  HIS B CA    1 
ATOM   4284  C  C     . HIS B 1 74  ? -56.780  69.961  -9.335  1.00 72.59  ?  74  HIS B C     1 
ATOM   4285  O  O     . HIS B 1 74  ? -56.022  69.588  -10.229 1.00 75.49  ?  74  HIS B O     1 
ATOM   4286  C  CB    . HIS B 1 74  ? -56.072  68.141  -7.817  1.00 71.03  ?  74  HIS B CB    1 
ATOM   4287  C  CG    . HIS B 1 74  ? -55.191  68.844  -6.830  1.00 69.75  ?  74  HIS B CG    1 
ATOM   4288  N  ND1   . HIS B 1 74  ? -55.604  69.150  -5.549  1.00 69.75  ?  74  HIS B ND1   1 
ATOM   4289  C  CD2   . HIS B 1 74  ? -53.919  69.295  -6.934  1.00 64.45  ?  74  HIS B CD2   1 
ATOM   4290  C  CE1   . HIS B 1 74  ? -54.625  69.766  -4.912  1.00 67.32  ?  74  HIS B CE1   1 
ATOM   4291  N  NE2   . HIS B 1 74  ? -53.589  69.861  -5.724  1.00 62.31  ?  74  HIS B NE2   1 
ATOM   4292  N  N     . PRO B 1 75  ? -57.194  71.233  -9.219  1.00 75.62  ?  75  PRO B N     1 
ATOM   4293  C  CA    . PRO B 1 75  ? -56.853  72.222  -10.250 1.00 81.36  ?  75  PRO B CA    1 
ATOM   4294  C  C     . PRO B 1 75  ? -55.521  72.899  -9.982  1.00 80.73  ?  75  PRO B C     1 
ATOM   4295  O  O     . PRO B 1 75  ? -55.528  74.096  -9.713  1.00 84.88  ?  75  PRO B O     1 
ATOM   4296  C  CB    . PRO B 1 75  ? -57.973  73.245  -10.107 1.00 79.03  ?  75  PRO B CB    1 
ATOM   4297  C  CG    . PRO B 1 75  ? -58.239  73.240  -8.625  1.00 75.49  ?  75  PRO B CG    1 
ATOM   4298  C  CD    . PRO B 1 75  ? -58.054  71.811  -8.171  1.00 71.87  ?  75  PRO B CD    1 
ATOM   4299  N  N     . HIS B 1 76  ? -54.414  72.162  -10.060 1.00 75.95  ?  76  HIS B N     1 
ATOM   4300  C  CA    . HIS B 1 76  ? -53.093  72.725  -9.771  1.00 75.88  ?  76  HIS B CA    1 
ATOM   4301  C  C     . HIS B 1 76  ? -52.026  72.112  -10.649 1.00 78.05  ?  76  HIS B C     1 
ATOM   4302  O  O     . HIS B 1 76  ? -52.332  71.312  -11.515 1.00 75.96  ?  76  HIS B O     1 
ATOM   4303  C  CB    . HIS B 1 76  ? -52.731  72.549  -8.296  1.00 70.98  ?  76  HIS B CB    1 
ATOM   4304  C  CG    . HIS B 1 76  ? -53.670  73.247  -7.363  1.00 75.71  ?  76  HIS B CG    1 
ATOM   4305  N  ND1   . HIS B 1 76  ? -53.602  74.605  -7.116  1.00 77.25  ?  76  HIS B ND1   1 
ATOM   4306  C  CD2   . HIS B 1 76  ? -54.713  72.786  -6.632  1.00 81.20  ?  76  HIS B CD2   1 
ATOM   4307  C  CE1   . HIS B 1 76  ? -54.560  74.942  -6.272  1.00 82.74  ?  76  HIS B CE1   1 
ATOM   4308  N  NE2   . HIS B 1 76  ? -55.248  73.860  -5.958  1.00 83.51  ?  76  HIS B NE2   1 
ATOM   4309  N  N     . GLY B 1 77  ? -50.774  72.496  -10.423 1.00 85.35  ?  77  GLY B N     1 
ATOM   4310  C  CA    . GLY B 1 77  ? -49.674  72.027  -11.247 1.00 89.51  ?  77  GLY B CA    1 
ATOM   4311  C  C     . GLY B 1 77  ? -49.699  70.525  -11.461 1.00 87.83  ?  77  GLY B C     1 
ATOM   4312  O  O     . GLY B 1 77  ? -49.947  69.743  -10.530 1.00 79.53  ?  77  GLY B O     1 
ATOM   4313  N  N     . ASP B 1 78  ? -49.452  70.101  -12.694 1.00 90.66  ?  78  ASP B N     1 
ATOM   4314  C  CA    . ASP B 1 78  ? -49.343  68.668  -12.934 1.00 88.30  ?  78  ASP B CA    1 
ATOM   4315  C  C     . ASP B 1 78  ? -48.194  68.098  -12.076 1.00 89.37  ?  78  ASP B C     1 
ATOM   4316  O  O     . ASP B 1 78  ? -48.325  67.034  -11.468 1.00 89.81  ?  78  ASP B O     1 
ATOM   4317  C  CB    . ASP B 1 78  ? -49.221  68.337  -14.436 1.00 81.87  ?  78  ASP B CB    1 
ATOM   4318  C  CG    . ASP B 1 78  ? -48.100  69.114  -15.139 1.00 95.63  ?  78  ASP B CG    1 
ATOM   4319  O  OD1   . ASP B 1 78  ? -46.932  68.660  -15.099 1.00 102.48 ?  78  ASP B OD1   1 
ATOM   4320  O  OD2   . ASP B 1 78  ? -48.387  70.163  -15.763 1.00 103.61 ?  78  ASP B OD2   1 
ATOM   4321  N  N     . SER B 1 79  ? -47.099  68.850  -11.983 1.00 85.66  ?  79  SER B N     1 
ATOM   4322  C  CA    . SER B 1 79  ? -45.908  68.425  -11.254 1.00 82.16  ?  79  SER B CA    1 
ATOM   4323  C  C     . SER B 1 79  ? -46.139  68.253  -9.759  1.00 80.82  ?  79  SER B C     1 
ATOM   4324  O  O     . SER B 1 79  ? -45.676  67.277  -9.181  1.00 87.11  ?  79  SER B O     1 
ATOM   4325  C  CB    . SER B 1 79  ? -44.791  69.426  -11.464 1.00 93.44  ?  79  SER B CB    1 
ATOM   4326  O  OG    . SER B 1 79  ? -45.296  70.715  -11.189 1.00 108.01 ?  79  SER B OG    1 
ATOM   4327  N  N     . SER B 1 80  ? -46.826  69.205  -9.128  1.00 77.31  ?  80  SER B N     1 
ATOM   4328  C  CA    . SER B 1 80  ? -47.211  69.047  -7.724  1.00 74.05  ?  80  SER B CA    1 
ATOM   4329  C  C     . SER B 1 80  ? -47.952  67.736  -7.526  1.00 65.64  ?  80  SER B C     1 
ATOM   4330  O  O     . SER B 1 80  ? -47.582  66.921  -6.677  1.00 63.58  ?  80  SER B O     1 
ATOM   4331  C  CB    . SER B 1 80  ? -48.070  70.213  -7.232  1.00 78.19  ?  80  SER B CB    1 
ATOM   4332  O  OG    . SER B 1 80  ? -47.273  71.371  -7.060  1.00 87.13  ?  80  SER B OG    1 
ATOM   4333  N  N     . ILE B 1 81  ? -48.989  67.521  -8.323  1.00 64.63  ?  81  ILE B N     1 
ATOM   4334  C  CA    . ILE B 1 81  ? -49.709  66.257  -8.267  1.00 58.76  ?  81  ILE B CA    1 
ATOM   4335  C  C     . ILE B 1 81  ? -48.773  65.045  -8.430  1.00 62.32  ?  81  ILE B C     1 
ATOM   4336  O  O     . ILE B 1 81  ? -48.802  64.121  -7.613  1.00 66.90  ?  81  ILE B O     1 
ATOM   4337  C  CB    . ILE B 1 81  ? -50.833  66.224  -9.298  1.00 54.62  ?  81  ILE B CB    1 
ATOM   4338  C  CG1   . ILE B 1 81  ? -51.625  67.531  -9.222  1.00 58.43  ?  81  ILE B CG1   1 
ATOM   4339  C  CG2   . ILE B 1 81  ? -51.750  65.035  -9.049  1.00 45.18  ?  81  ILE B CG2   1 
ATOM   4340  C  CD1   . ILE B 1 81  ? -52.845  67.557  -10.111 1.00 63.46  ?  81  ILE B CD1   1 
ATOM   4341  N  N     . TYR B 1 82  ? -47.933  65.049  -9.464  1.00 57.35  ?  82  TYR B N     1 
ATOM   4342  C  CA    . TYR B 1 82  ? -46.994  63.940  -9.648  1.00 55.45  ?  82  TYR B CA    1 
ATOM   4343  C  C     . TYR B 1 82  ? -46.053  63.757  -8.450  1.00 65.44  ?  82  TYR B C     1 
ATOM   4344  O  O     . TYR B 1 82  ? -45.882  62.652  -7.936  1.00 73.90  ?  82  TYR B O     1 
ATOM   4345  C  CB    . TYR B 1 82  ? -46.189  64.101  -10.943 1.00 52.30  ?  82  TYR B CB    1 
ATOM   4346  C  CG    . TYR B 1 82  ? -45.233  62.948  -11.254 1.00 51.60  ?  82  TYR B CG    1 
ATOM   4347  C  CD1   . TYR B 1 82  ? -45.689  61.649  -11.444 1.00 52.33  ?  82  TYR B CD1   1 
ATOM   4348  C  CD2   . TYR B 1 82  ? -43.878  63.172  -11.382 1.00 53.66  ?  82  TYR B CD2   1 
ATOM   4349  C  CE1   . TYR B 1 82  ? -44.805  60.611  -11.741 1.00 52.11  ?  82  TYR B CE1   1 
ATOM   4350  C  CE2   . TYR B 1 82  ? -42.996  62.150  -11.689 1.00 57.05  ?  82  TYR B CE2   1 
ATOM   4351  C  CZ    . TYR B 1 82  ? -43.459  60.871  -11.859 1.00 56.49  ?  82  TYR B CZ    1 
ATOM   4352  O  OH    . TYR B 1 82  ? -42.550  59.872  -12.159 1.00 63.37  ?  82  TYR B OH    1 
ATOM   4353  N  N     . ASP B 1 83  ? -45.439  64.849  -8.019  1.00 64.34  ?  83  ASP B N     1 
ATOM   4354  C  CA    . ASP B 1 83  ? -44.527  64.830  -6.885  1.00 65.87  ?  83  ASP B CA    1 
ATOM   4355  C  C     . ASP B 1 83  ? -45.182  64.160  -5.660  1.00 70.05  ?  83  ASP B C     1 
ATOM   4356  O  O     . ASP B 1 83  ? -44.569  63.303  -4.988  1.00 67.93  ?  83  ASP B O     1 
ATOM   4357  C  CB    . ASP B 1 83  ? -44.085  66.263  -6.561  1.00 65.73  ?  83  ASP B CB    1 
ATOM   4358  C  CG    . ASP B 1 83  ? -42.938  66.746  -7.441  1.00 75.10  ?  83  ASP B CG    1 
ATOM   4359  O  OD1   . ASP B 1 83  ? -42.586  66.018  -8.403  1.00 79.93  ?  83  ASP B OD1   1 
ATOM   4360  O  OD2   . ASP B 1 83  ? -42.402  67.860  -7.173  1.00 80.50  ?  83  ASP B OD2   1 
ATOM   4361  N  N     . ALA B 1 84  ? -46.424  64.555  -5.379  1.00 60.20  ?  84  ALA B N     1 
ATOM   4362  C  CA    . ALA B 1 84  ? -47.178  63.980  -4.275  1.00 52.78  ?  84  ALA B CA    1 
ATOM   4363  C  C     . ALA B 1 84  ? -47.313  62.483  -4.445  1.00 63.41  ?  84  ALA B C     1 
ATOM   4364  O  O     . ALA B 1 84  ? -46.992  61.710  -3.538  1.00 70.97  ?  84  ALA B O     1 
ATOM   4365  C  CB    . ALA B 1 84  ? -48.553  64.595  -4.202  1.00 44.16  ?  84  ALA B CB    1 
ATOM   4366  N  N     . MET B 1 85  ? -47.818  62.094  -5.615  1.00 62.62  ?  85  MET B N     1 
ATOM   4367  C  CA    . MET B 1 85  ? -48.019  60.693  -5.984  1.00 58.71  ?  85  MET B CA    1 
ATOM   4368  C  C     . MET B 1 85  ? -46.728  59.878  -5.834  1.00 56.00  ?  85  MET B C     1 
ATOM   4369  O  O     . MET B 1 85  ? -46.743  58.740  -5.346  1.00 57.52  ?  85  MET B O     1 
ATOM   4370  C  CB    . MET B 1 85  ? -48.578  60.622  -7.410  1.00 57.67  ?  85  MET B CB    1 
ATOM   4371  C  CG    . MET B 1 85  ? -48.497  59.267  -8.087  1.00 64.93  ?  85  MET B CG    1 
ATOM   4372  S  SD    . MET B 1 85  ? -49.440  59.240  -9.627  1.00 65.00  ?  85  MET B SD    1 
ATOM   4373  N  N     . VAL B 1 86  ? -45.608  60.475  -6.229  1.00 50.84  ?  86  VAL B N     1 
ATOM   4374  C  CA    . VAL B 1 86  ? -44.324  59.811  -6.120  1.00 53.83  ?  86  VAL B CA    1 
ATOM   4375  C  C     . VAL B 1 86  ? -43.973  59.510  -4.672  1.00 58.83  ?  86  VAL B C     1 
ATOM   4376  O  O     . VAL B 1 86  ? -43.557  58.398  -4.356  1.00 60.72  ?  86  VAL B O     1 
ATOM   4377  C  CB    . VAL B 1 86  ? -43.210  60.622  -6.796  1.00 56.33  ?  86  VAL B CB    1 
ATOM   4378  C  CG1   . VAL B 1 86  ? -41.830  60.242  -6.234  1.00 57.01  ?  86  VAL B CG1   1 
ATOM   4379  C  CG2   . VAL B 1 86  ? -43.260  60.409  -8.307  1.00 59.24  ?  86  VAL B CG2   1 
ATOM   4380  N  N     . ARG B 1 87  ? -44.147  60.497  -3.795  1.00 61.97  ?  87  ARG B N     1 
ATOM   4381  C  CA    . ARG B 1 87  ? -43.860  60.318  -2.371  1.00 64.57  ?  87  ARG B CA    1 
ATOM   4382  C  C     . ARG B 1 87  ? -44.660  59.152  -1.787  1.00 67.74  ?  87  ARG B C     1 
ATOM   4383  O  O     . ARG B 1 87  ? -44.081  58.255  -1.176  1.00 70.63  ?  87  ARG B O     1 
ATOM   4384  C  CB    . ARG B 1 87  ? -44.169  61.600  -1.593  1.00 65.07  ?  87  ARG B CB    1 
ATOM   4385  C  CG    . ARG B 1 87  ? -43.427  61.733  -0.276  1.00 66.66  ?  87  ARG B CG    1 
ATOM   4386  C  CD    . ARG B 1 87  ? -43.821  62.997  0.506   1.00 69.17  ?  87  ARG B CD    1 
ATOM   4387  N  NE    . ARG B 1 87  ? -43.087  63.049  1.770   1.00 77.54  ?  87  ARG B NE    1 
ATOM   4388  C  CZ    . ARG B 1 87  ? -43.532  62.574  2.935   1.00 74.35  ?  87  ARG B CZ    1 
ATOM   4389  N  NH1   . ARG B 1 87  ? -44.742  62.032  3.022   1.00 58.16  ?  87  ARG B NH1   1 
ATOM   4390  N  NH2   . ARG B 1 87  ? -42.767  62.655  4.022   1.00 82.38  ?  87  ARG B NH2   1 
ATOM   4391  N  N     . MET B 1 88  ? -45.981  59.161  -1.988  1.00 66.96  ?  88  MET B N     1 
ATOM   4392  C  CA    . MET B 1 88  ? -46.851  58.105  -1.467  1.00 62.62  ?  88  MET B CA    1 
ATOM   4393  C  C     . MET B 1 88  ? -46.366  56.716  -1.877  1.00 64.98  ?  88  MET B C     1 
ATOM   4394  O  O     . MET B 1 88  ? -46.854  55.705  -1.370  1.00 68.82  ?  88  MET B O     1 
ATOM   4395  C  CB    . MET B 1 88  ? -48.304  58.274  -1.944  1.00 58.42  ?  88  MET B CB    1 
ATOM   4396  C  CG    . MET B 1 88  ? -48.897  59.686  -1.903  1.00 55.32  ?  88  MET B CG    1 
ATOM   4397  S  SD    . MET B 1 88  ? -50.715  59.614  -1.925  1.00 61.35  ?  88  MET B SD    1 
ATOM   4398  C  CE    . MET B 1 88  ? -51.103  61.261  -2.499  1.00 140.16 ?  88  MET B CE    1 
ATOM   4399  N  N     . SER B 1 89  ? -45.413  56.673  -2.800  1.00 62.10  ?  89  SER B N     1 
ATOM   4400  C  CA    . SER B 1 89  ? -44.889  55.416  -3.316  1.00 63.67  ?  89  SER B CA    1 
ATOM   4401  C  C     . SER B 1 89  ? -43.488  55.111  -2.818  1.00 64.05  ?  89  SER B C     1 
ATOM   4402  O  O     . SER B 1 89  ? -42.963  54.027  -3.076  1.00 62.76  ?  89  SER B O     1 
ATOM   4403  C  CB    . SER B 1 89  ? -44.851  55.449  -4.850  1.00 71.79  ?  89  SER B CB    1 
ATOM   4404  O  OG    . SER B 1 89  ? -43.605  55.933  -5.343  1.00 74.07  ?  89  SER B OG    1 
ATOM   4405  N  N     . GLN B 1 90  ? -42.859  56.079  -2.156  1.00 71.41  ?  90  GLN B N     1 
ATOM   4406  C  CA    . GLN B 1 90  ? -41.487  55.889  -1.681  1.00 76.19  ?  90  GLN B CA    1 
ATOM   4407  C  C     . GLN B 1 90  ? -41.531  55.232  -0.320  1.00 75.41  ?  90  GLN B C     1 
ATOM   4408  O  O     . GLN B 1 90  ? -42.087  55.783  0.636   1.00 69.16  ?  90  GLN B O     1 
ATOM   4409  C  CB    . GLN B 1 90  ? -40.710  57.207  -1.616  1.00 70.17  ?  90  GLN B CB    1 
ATOM   4410  C  CG    . GLN B 1 90  ? -41.240  58.270  -2.556  1.00 65.57  ?  90  GLN B CG    1 
ATOM   4411  C  CD    . GLN B 1 90  ? -40.256  59.402  -2.768  1.00 64.18  ?  90  GLN B CD    1 
ATOM   4412  O  OE1   . GLN B 1 90  ? -40.408  60.505  -2.214  1.00 67.98  ?  90  GLN B OE1   1 
ATOM   4413  N  NE2   . GLN B 1 90  ? -39.243  59.143  -3.589  1.00 61.67  ?  90  GLN B NE2   1 
ATOM   4414  N  N     . ASN B 1 91  ? -40.956  54.041  -0.240  1.00 76.86  ?  91  ASN B N     1 
ATOM   4415  C  CA    . ASN B 1 91  ? -41.075  53.246  0.966   1.00 72.92  ?  91  ASN B CA    1 
ATOM   4416  C  C     . ASN B 1 91  ? -40.075  53.632  2.064   1.00 72.67  ?  91  ASN B C     1 
ATOM   4417  O  O     . ASN B 1 91  ? -39.998  52.962  3.093   1.00 81.49  ?  91  ASN B O     1 
ATOM   4418  C  CB    . ASN B 1 91  ? -40.967  51.764  0.624   1.00 74.86  ?  91  ASN B CB    1 
ATOM   4419  C  CG    . ASN B 1 91  ? -39.543  51.291  0.568   1.00 76.83  ?  91  ASN B CG    1 
ATOM   4420  O  OD1   . ASN B 1 91  ? -38.674  51.961  0.016   1.00 79.87  ?  91  ASN B OD1   1 
ATOM   4421  N  ND2   . ASN B 1 91  ? -39.285  50.141  1.170   1.00 79.46  ?  91  ASN B ND2   1 
ATOM   4422  N  N     . TRP B 1 92  ? -39.321  54.711  1.843   1.00 65.75  ?  92  TRP B N     1 
ATOM   4423  C  CA    . TRP B 1 92  ? -38.444  55.273  2.871   1.00 58.72  ?  92  TRP B CA    1 
ATOM   4424  C  C     . TRP B 1 92  ? -38.977  56.601  3.424   1.00 59.27  ?  92  TRP B C     1 
ATOM   4425  O  O     . TRP B 1 92  ? -38.282  57.279  4.194   1.00 65.60  ?  92  TRP B O     1 
ATOM   4426  C  CB    . TRP B 1 92  ? -37.015  55.451  2.351   1.00 61.72  ?  92  TRP B CB    1 
ATOM   4427  C  CG    . TRP B 1 92  ? -36.899  56.515  1.314   1.00 76.74  ?  92  TRP B CG    1 
ATOM   4428  C  CD1   . TRP B 1 92  ? -36.646  57.838  1.516   1.00 83.15  ?  92  TRP B CD1   1 
ATOM   4429  C  CD2   . TRP B 1 92  ? -37.046  56.350  -0.096  1.00 77.28  ?  92  TRP B CD2   1 
ATOM   4430  N  NE1   . TRP B 1 92  ? -36.626  58.510  0.315   1.00 80.98  ?  92  TRP B NE1   1 
ATOM   4431  C  CE2   . TRP B 1 92  ? -36.863  57.614  -0.687  1.00 74.67  ?  92  TRP B CE2   1 
ATOM   4432  C  CE3   . TRP B 1 92  ? -37.314  55.257  -0.915  1.00 71.37  ?  92  TRP B CE3   1 
ATOM   4433  C  CZ2   . TRP B 1 92  ? -36.930  57.804  -2.046  1.00 68.32  ?  92  TRP B CZ2   1 
ATOM   4434  C  CZ3   . TRP B 1 92  ? -37.383  55.454  -2.252  1.00 73.09  ?  92  TRP B CZ3   1 
ATOM   4435  C  CH2   . TRP B 1 92  ? -37.193  56.716  -2.813  1.00 69.20  ?  92  TRP B CH2   1 
ATOM   4436  N  N     . LYS B 1 93  ? -40.197  56.969  3.025   1.00 60.80  ?  93  LYS B N     1 
ATOM   4437  C  CA    . LYS B 1 93  ? -40.897  58.129  3.591   1.00 66.08  ?  93  LYS B CA    1 
ATOM   4438  C  C     . LYS B 1 93  ? -42.256  57.693  4.151   1.00 67.36  ?  93  LYS B C     1 
ATOM   4439  O  O     . LYS B 1 93  ? -42.724  58.211  5.166   1.00 76.15  ?  93  LYS B O     1 
ATOM   4440  C  CB    . LYS B 1 93  ? -41.083  59.277  2.572   1.00 66.87  ?  93  LYS B CB    1 
ATOM   4441  C  CG    . LYS B 1 93  ? -39.873  59.575  1.670   1.00 73.21  ?  93  LYS B CG    1 
ATOM   4442  C  CD    . LYS B 1 93  ? -39.577  61.077  1.519   1.00 78.22  ?  93  LYS B CD    1 
ATOM   4443  C  CE    . LYS B 1 93  ? -38.862  61.613  2.766   1.00 89.82  ?  93  LYS B CE    1 
ATOM   4444  N  NZ    . LYS B 1 93  ? -38.349  63.013  2.655   1.00 93.79  ?  93  LYS B NZ    1 
ATOM   4445  N  N     . ASN B 1 94  ? -42.895  56.735  3.497   1.00 63.31  ?  94  ASN B N     1 
ATOM   4446  C  CA    . ASN B 1 94  ? -44.131  56.191  4.043   1.00 65.13  ?  94  ASN B CA    1 
ATOM   4447  C  C     . ASN B 1 94  ? -43.905  54.832  4.712   1.00 70.98  ?  94  ASN B C     1 
ATOM   4448  O  O     . ASN B 1 94  ? -43.200  53.970  4.170   1.00 75.07  ?  94  ASN B O     1 
ATOM   4449  C  CB    . ASN B 1 94  ? -45.223  56.149  2.978   1.00 62.91  ?  94  ASN B CB    1 
ATOM   4450  C  CG    . ASN B 1 94  ? -45.769  57.541  2.651   1.00 70.94  ?  94  ASN B CG    1 
ATOM   4451  O  OD1   . ASN B 1 94  ? -45.467  58.111  1.607   1.00 76.68  ?  94  ASN B OD1   1 
ATOM   4452  N  ND2   . ASN B 1 94  ? -46.586  58.083  3.542   1.00 68.72  ?  94  ASN B ND2   1 
ATOM   4453  N  N     . ARG B 1 95  ? -44.449  54.664  5.917   1.00 66.88  ?  95  ARG B N     1 
ATOM   4454  C  CA    . ARG B 1 95  ? -44.237  53.424  6.663   1.00 66.21  ?  95  ARG B CA    1 
ATOM   4455  C  C     . ARG B 1 95  ? -44.981  52.324  5.952   1.00 68.57  ?  95  ARG B C     1 
ATOM   4456  O  O     . ARG B 1 95  ? -44.583  51.160  5.964   1.00 72.38  ?  95  ARG B O     1 
ATOM   4457  C  CB    . ARG B 1 95  ? -44.777  53.524  8.086   1.00 60.10  ?  95  ARG B CB    1 
ATOM   4458  C  CG    . ARG B 1 95  ? -44.651  52.216  8.862   1.00 50.97  ?  95  ARG B CG    1 
ATOM   4459  C  CD    . ARG B 1 95  ? -43.210  51.838  8.870   1.00 57.11  ?  95  ARG B CD    1 
ATOM   4460  N  NE    . ARG B 1 95  ? -42.905  50.688  9.700   1.00 66.98  ?  95  ARG B NE    1 
ATOM   4461  C  CZ    . ARG B 1 95  ? -43.249  49.443  9.400   1.00 72.23  ?  95  ARG B CZ    1 
ATOM   4462  N  NH1   . ARG B 1 95  ? -43.952  49.205  8.306   1.00 67.38  ?  95  ARG B NH1   1 
ATOM   4463  N  NH2   . ARG B 1 95  ? -42.909  48.439  10.205  1.00 79.38  ?  95  ARG B NH2   1 
ATOM   4464  N  N     . GLU B 1 96  ? -46.070  52.723  5.314   1.00 66.96  ?  96  GLU B N     1 
ATOM   4465  C  CA    . GLU B 1 96  ? -46.964  51.790  4.671   1.00 65.79  ?  96  GLU B CA    1 
ATOM   4466  C  C     . GLU B 1 96  ? -47.419  52.420  3.341   1.00 62.67  ?  96  GLU B C     1 
ATOM   4467  O  O     . GLU B 1 96  ? -48.443  53.096  3.301   1.00 52.86  ?  96  GLU B O     1 
ATOM   4468  C  CB    . GLU B 1 96  ? -48.139  51.546  5.616   1.00 64.67  ?  96  GLU B CB    1 
ATOM   4469  C  CG    . GLU B 1 96  ? -48.621  50.116  5.731   1.00 75.95  ?  96  GLU B CG    1 
ATOM   4470  C  CD    . GLU B 1 96  ? -47.520  49.134  6.071   1.00 95.47  ?  96  GLU B CD    1 
ATOM   4471  O  OE1   . GLU B 1 96  ? -47.462  48.686  7.236   1.00 96.02  ?  96  GLU B OE1   1 
ATOM   4472  O  OE2   . GLU B 1 96  ? -46.730  48.788  5.162   1.00 109.10 ?  96  GLU B OE2   1 
ATOM   4473  N  N     . ILE B 1 97  ? -46.664  52.202  2.257   1.00 65.20  ?  97  ILE B N     1 
ATOM   4474  C  CA    . ILE B 1 97  ? -46.869  52.988  1.029   1.00 64.18  ?  97  ILE B CA    1 
ATOM   4475  C  C     . ILE B 1 97  ? -48.239  52.822  0.374   1.00 63.79  ?  97  ILE B C     1 
ATOM   4476  O  O     . ILE B 1 97  ? -48.739  51.700  0.220   1.00 60.57  ?  97  ILE B O     1 
ATOM   4477  C  CB    . ILE B 1 97  ? -45.802  52.731  -0.058  1.00 61.36  ?  97  ILE B CB    1 
ATOM   4478  C  CG1   . ILE B 1 97  ? -46.045  51.394  -0.733  1.00 60.57  ?  97  ILE B CG1   1 
ATOM   4479  C  CG2   . ILE B 1 97  ? -44.395  52.806  0.498   1.00 65.70  ?  97  ILE B CG2   1 
ATOM   4480  C  CD1   . ILE B 1 97  ? -44.965  51.055  -1.668  1.00 60.58  ?  97  ILE B CD1   1 
ATOM   4481  N  N     . LEU B 1 98  ? -48.804  53.956  -0.046  1.00 64.83  ?  98  LEU B N     1 
ATOM   4482  C  CA    . LEU B 1 98  ? -50.160  54.029  -0.595  1.00 67.59  ?  98  LEU B CA    1 
ATOM   4483  C  C     . LEU B 1 98  ? -50.223  53.892  -2.116  1.00 70.41  ?  98  LEU B C     1 
ATOM   4484  O  O     . LEU B 1 98  ? -51.286  53.642  -2.682  1.00 74.68  ?  98  LEU B O     1 
ATOM   4485  C  CB    . LEU B 1 98  ? -50.834  55.335  -0.156  1.00 66.67  ?  98  LEU B CB    1 
ATOM   4486  C  CG    . LEU B 1 98  ? -51.134  55.302  1.344   1.00 61.10  ?  98  LEU B CG    1 
ATOM   4487  C  CD1   . LEU B 1 98  ? -52.295  56.192  1.723   1.00 54.87  ?  98  LEU B CD1   1 
ATOM   4488  C  CD2   . LEU B 1 98  ? -51.425  53.875  1.734   1.00 62.66  ?  98  LEU B CD2   1 
ATOM   4489  N  N     . VAL B 1 99  ? -49.083  54.049  -2.774  1.00 68.41  ?  99  VAL B N     1 
ATOM   4490  C  CA    . VAL B 1 99  ? -49.023  53.962  -4.228  1.00 65.00  ?  99  VAL B CA    1 
ATOM   4491  C  C     . VAL B 1 99  ? -47.826  53.115  -4.645  1.00 63.32  ?  99  VAL B C     1 
ATOM   4492  O  O     . VAL B 1 99  ? -46.722  53.308  -4.144  1.00 72.25  ?  99  VAL B O     1 
ATOM   4493  C  CB    . VAL B 1 99  ? -48.906  55.376  -4.858  1.00 61.72  ?  99  VAL B CB    1 
ATOM   4494  C  CG1   . VAL B 1 99  ? -48.464  55.292  -6.305  1.00 53.17  ?  99  VAL B CG1   1 
ATOM   4495  C  CG2   . VAL B 1 99  ? -50.225  56.160  -4.707  1.00 63.76  ?  99  VAL B CG2   1 
ATOM   4496  N  N     . GLU B 1 100 ? -48.045  52.155  -5.534  1.00 61.00  ?  100 GLU B N     1 
ATOM   4497  C  CA    . GLU B 1 100 ? -46.941  51.369  -6.076  1.00 62.95  ?  100 GLU B CA    1 
ATOM   4498  C  C     . GLU B 1 100 ? -46.565  51.923  -7.448  1.00 64.93  ?  100 GLU B C     1 
ATOM   4499  O  O     . GLU B 1 100 ? -47.438  52.255  -8.258  1.00 72.34  ?  100 GLU B O     1 
ATOM   4500  C  CB    . GLU B 1 100 ? -47.319  49.892  -6.195  1.00 62.78  ?  100 GLU B CB    1 
ATOM   4501  C  CG    . GLU B 1 100 ? -47.676  49.240  -4.890  1.00 67.03  ?  100 GLU B CG    1 
ATOM   4502  C  CD    . GLU B 1 100 ? -48.114  47.799  -5.068  1.00 83.64  ?  100 GLU B CD    1 
ATOM   4503  O  OE1   . GLU B 1 100 ? -48.649  47.215  -4.094  1.00 91.36  ?  100 GLU B OE1   1 
ATOM   4504  O  OE2   . GLU B 1 100 ? -47.920  47.252  -6.180  1.00 87.23  ?  100 GLU B OE2   1 
ATOM   4505  N  N     . MET B 1 101 ? -45.268  52.008  -7.716  1.00 55.83  ?  101 MET B N     1 
ATOM   4506  C  CA    . MET B 1 101 ? -44.810  52.637  -8.941  1.00 54.07  ?  101 MET B CA    1 
ATOM   4507  C  C     . MET B 1 101 ? -43.625  51.917  -9.596  1.00 66.26  ?  101 MET B C     1 
ATOM   4508  O  O     . MET B 1 101 ? -42.561  51.751  -8.991  1.00 77.67  ?  101 MET B O     1 
ATOM   4509  C  CB    . MET B 1 101 ? -44.516  54.126  -8.685  1.00 50.10  ?  101 MET B CB    1 
ATOM   4510  C  CG    . MET B 1 101 ? -43.765  54.864  -9.801  1.00 57.11  ?  101 MET B CG    1 
ATOM   4511  S  SD    . MET B 1 101 ? -43.681  56.648  -9.492  1.00 92.37  ?  101 MET B SD    1 
ATOM   4512  C  CE    . MET B 1 101 ? -45.364  56.981  -8.984  1.00 68.51  ?  101 MET B CE    1 
ATOM   4513  N  N     . HIS B 1 102 ? -43.836  51.483  -10.837 1.00 68.29  ?  102 HIS B N     1 
ATOM   4514  C  CA    . HIS B 1 102 ? -42.787  50.871  -11.643 1.00 76.47  ?  102 HIS B CA    1 
ATOM   4515  C  C     . HIS B 1 102 ? -41.845  51.942  -12.218 1.00 73.86  ?  102 HIS B C     1 
ATOM   4516  O  O     . HIS B 1 102 ? -42.294  52.979  -12.717 1.00 70.54  ?  102 HIS B O     1 
ATOM   4517  C  CB    . HIS B 1 102 ? -43.402  50.029  -12.767 1.00 88.90  ?  102 HIS B CB    1 
ATOM   4518  C  CG    . HIS B 1 102 ? -43.336  48.554  -12.523 1.00 102.25 ?  102 HIS B CG    1 
ATOM   4519  N  ND1   . HIS B 1 102 ? -44.333  47.861  -11.877 1.00 104.36 ?  102 HIS B ND1   1 
ATOM   4520  C  CD2   . HIS B 1 102 ? -42.381  47.642  -12.831 1.00 114.63 ?  102 HIS B CD2   1 
ATOM   4521  C  CE1   . HIS B 1 102 ? -43.999  46.583  -11.795 1.00 112.40 ?  102 HIS B CE1   1 
ATOM   4522  N  NE2   . HIS B 1 102 ? -42.818  46.425  -12.365 1.00 119.57 ?  102 HIS B NE2   1 
ATOM   4523  N  N     . GLY B 1 103 ? -40.540  51.698  -12.123 1.00 77.20  ?  103 GLY B N     1 
ATOM   4524  C  CA    . GLY B 1 103 ? -39.550  52.655  -12.598 1.00 81.77  ?  103 GLY B CA    1 
ATOM   4525  C  C     . GLY B 1 103 ? -38.929  53.585  -11.562 1.00 80.63  ?  103 GLY B C     1 
ATOM   4526  O  O     . GLY B 1 103 ? -39.380  53.661  -10.429 1.00 84.66  ?  103 GLY B O     1 
ATOM   4527  N  N     . ASN B 1 104 ? -37.887  54.303  -11.970 1.00 77.89  ?  104 ASN B N     1 
ATOM   4528  C  CA    . ASN B 1 104 ? -37.162  55.214  -11.086 1.00 73.57  ?  104 ASN B CA    1 
ATOM   4529  C  C     . ASN B 1 104 ? -38.048  56.199  -10.337 1.00 71.94  ?  104 ASN B C     1 
ATOM   4530  O  O     . ASN B 1 104 ? -38.487  57.199  -10.903 1.00 67.19  ?  104 ASN B O     1 
ATOM   4531  C  CB    . ASN B 1 104 ? -36.097  55.983  -11.871 1.00 74.86  ?  104 ASN B CB    1 
ATOM   4532  C  CG    . ASN B 1 104 ? -35.326  56.967  -11.004 1.00 87.20  ?  104 ASN B CG    1 
ATOM   4533  O  OD1   . ASN B 1 104 ? -35.511  57.026  -9.786  1.00 94.04  ?  104 ASN B OD1   1 
ATOM   4534  N  ND2   . ASN B 1 104 ? -34.441  57.735  -11.629 1.00 91.50  ?  104 ASN B ND2   1 
ATOM   4535  N  N     . ASN B 1 105 ? -38.279  55.927  -9.051  1.00 79.06  ?  105 ASN B N     1 
ATOM   4536  C  CA    . ASN B 1 105 ? -39.095  56.801  -8.197  1.00 71.74  ?  105 ASN B CA    1 
ATOM   4537  C  C     . ASN B 1 105 ? -38.278  57.417  -7.045  1.00 73.20  ?  105 ASN B C     1 
ATOM   4538  O  O     . ASN B 1 105 ? -38.754  57.575  -5.923  1.00 72.06  ?  105 ASN B O     1 
ATOM   4539  C  CB    . ASN B 1 105 ? -40.316  56.043  -7.665  1.00 62.23  ?  105 ASN B CB    1 
ATOM   4540  C  CG    . ASN B 1 105 ? -39.952  55.011  -6.579  1.00 68.81  ?  105 ASN B CG    1 
ATOM   4541  O  OD1   . ASN B 1 105 ? -38.971  54.266  -6.696  1.00 72.86  ?  105 ASN B OD1   1 
ATOM   4542  N  ND2   . ASN B 1 105 ? -40.747  54.984  -5.508  1.00 75.04  ?  105 ASN B ND2   1 
ATOM   4543  N  N     . GLY B 1 106 ? -37.034  57.763  -7.333  1.00 74.23  ?  106 GLY B N     1 
ATOM   4544  C  CA    . GLY B 1 106 ? -36.189  58.375  -6.332  1.00 78.27  ?  106 GLY B CA    1 
ATOM   4545  C  C     . GLY B 1 106 ? -35.389  57.363  -5.542  1.00 81.85  ?  106 GLY B C     1 
ATOM   4546  O  O     . GLY B 1 106 ? -35.375  56.170  -5.850  1.00 86.03  ?  106 GLY B O     1 
ATOM   4547  N  N     . SER B 1 107 ? -34.718  57.855  -4.511  1.00 78.56  ?  107 SER B N     1 
ATOM   4548  C  CA    . SER B 1 107 ? -33.886  57.017  -3.676  1.00 83.37  ?  107 SER B CA    1 
ATOM   4549  C  C     . SER B 1 107 ? -33.638  57.750  -2.374  1.00 83.22  ?  107 SER B C     1 
ATOM   4550  O  O     . SER B 1 107 ? -34.008  58.917  -2.242  1.00 78.96  ?  107 SER B O     1 
ATOM   4551  C  CB    . SER B 1 107 ? -32.553  56.745  -4.371  1.00 84.27  ?  107 SER B CB    1 
ATOM   4552  O  OG    . SER B 1 107 ? -31.783  57.932  -4.457  1.00 83.20  ?  107 SER B OG    1 
ATOM   4553  N  N     . MET B 1 108 ? -33.003  57.073  -1.421  1.00 81.16  ?  108 MET B N     1 
ATOM   4554  C  CA    . MET B 1 108 ? -32.640  57.719  -0.173  1.00 79.12  ?  108 MET B CA    1 
ATOM   4555  C  C     . MET B 1 108 ? -31.484  58.670  -0.381  1.00 85.16  ?  108 MET B C     1 
ATOM   4556  O  O     . MET B 1 108 ? -31.169  59.469  0.494   1.00 94.06  ?  108 MET B O     1 
ATOM   4557  C  CB    . MET B 1 108 ? -32.286  56.687  0.887   1.00 80.40  ?  108 MET B CB    1 
ATOM   4558  C  CG    . MET B 1 108 ? -33.504  56.028  1.496   1.00 79.58  ?  108 MET B CG    1 
ATOM   4559  S  SD    . MET B 1 108 ? -33.022  54.617  2.484   1.00 83.27  ?  108 MET B SD    1 
ATOM   4560  C  CE    . MET B 1 108 ? -32.118  55.420  3.821   1.00 78.75  ?  108 MET B CE    1 
ATOM   4561  N  N     . ASP B 1 109 ? -30.849  58.574  -1.542  1.00 80.75  ?  109 ASP B N     1 
ATOM   4562  C  CA    . ASP B 1 109 ? -29.736  59.452  -1.887  1.00 77.30  ?  109 ASP B CA    1 
ATOM   4563  C  C     . ASP B 1 109 ? -30.260  60.795  -2.393  1.00 69.45  ?  109 ASP B C     1 
ATOM   4564  O  O     . ASP B 1 109 ? -29.486  61.692  -2.750  1.00 71.38  ?  109 ASP B O     1 
ATOM   4565  C  CB    . ASP B 1 109 ? -28.837  58.789  -2.928  1.00 81.57  ?  109 ASP B CB    1 
ATOM   4566  C  CG    . ASP B 1 109 ? -27.728  57.991  -2.301  1.00 97.17  ?  109 ASP B CG    1 
ATOM   4567  O  OD1   . ASP B 1 109 ? -27.865  57.642  -1.106  1.00 101.63 ?  109 ASP B OD1   1 
ATOM   4568  O  OD2   . ASP B 1 109 ? -26.718  57.720  -2.994  1.00 107.16 ?  109 ASP B OD2   1 
ATOM   4569  N  N     . GLY B 1 110 ? -31.584  60.919  -2.432  1.00 61.48  ?  110 GLY B N     1 
ATOM   4570  C  CA    . GLY B 1 110 ? -32.215  62.186  -2.729  1.00 68.47  ?  110 GLY B CA    1 
ATOM   4571  C  C     . GLY B 1 110 ? -32.342  62.494  -4.203  1.00 78.61  ?  110 GLY B C     1 
ATOM   4572  O  O     . GLY B 1 110 ? -33.085  63.395  -4.585  1.00 85.95  ?  110 GLY B O     1 
ATOM   4573  N  N     . ASP B 1 111 ? -31.633  61.756  -5.047  1.00 81.25  ?  111 ASP B N     1 
ATOM   4574  C  CA    . ASP B 1 111 ? -31.722  62.024  -6.476  1.00 89.83  ?  111 ASP B CA    1 
ATOM   4575  C  C     . ASP B 1 111 ? -33.168  61.921  -6.977  1.00 88.25  ?  111 ASP B C     1 
ATOM   4576  O  O     . ASP B 1 111 ? -34.002  61.229  -6.383  1.00 88.39  ?  111 ASP B O     1 
ATOM   4577  C  CB    . ASP B 1 111 ? -30.742  61.163  -7.287  1.00 98.81  ?  111 ASP B CB    1 
ATOM   4578  C  CG    . ASP B 1 111 ? -30.854  59.690  -6.970  1.00 103.21 ?  111 ASP B CG    1 
ATOM   4579  O  OD1   . ASP B 1 111 ? -29.802  59.005  -6.973  1.00 109.75 ?  111 ASP B OD1   1 
ATOM   4580  O  OD2   . ASP B 1 111 ? -31.993  59.223  -6.729  1.00 97.52  ?  111 ASP B OD2   1 
ATOM   4581  N  N     . PRO B 1 112 ? -33.465  62.626  -8.075  1.00 85.01  ?  112 PRO B N     1 
ATOM   4582  C  CA    . PRO B 1 112 ? -34.837  62.899  -8.498  1.00 81.44  ?  112 PRO B CA    1 
ATOM   4583  C  C     . PRO B 1 112 ? -35.414  61.722  -9.247  1.00 78.41  ?  112 PRO B C     1 
ATOM   4584  O  O     . PRO B 1 112 ? -34.664  61.026  -9.956  1.00 85.11  ?  112 PRO B O     1 
ATOM   4585  C  CB    . PRO B 1 112 ? -34.653  64.060  -9.461  1.00 85.18  ?  112 PRO B CB    1 
ATOM   4586  C  CG    . PRO B 1 112 ? -33.330  63.760  -10.123 1.00 86.07  ?  112 PRO B CG    1 
ATOM   4587  C  CD    . PRO B 1 112 ? -32.480  63.091  -9.070  1.00 85.39  ?  112 PRO B CD    1 
ATOM   4588  N  N     . PRO B 1 113 ? -36.730  61.498  -9.100  1.00 68.47  ?  113 PRO B N     1 
ATOM   4589  C  CA    . PRO B 1 113 ? -37.421  60.402  -9.785  1.00 70.00  ?  113 PRO B CA    1 
ATOM   4590  C  C     . PRO B 1 113 ? -37.504  60.672  -11.283 1.00 80.98  ?  113 PRO B C     1 
ATOM   4591  O  O     . PRO B 1 113 ? -37.298  61.808  -11.719 1.00 86.38  ?  113 PRO B O     1 
ATOM   4592  C  CB    . PRO B 1 113 ? -38.823  60.416  -9.158  1.00 65.80  ?  113 PRO B CB    1 
ATOM   4593  C  CG    . PRO B 1 113 ? -39.035  61.815  -8.715  1.00 63.19  ?  113 PRO B CG    1 
ATOM   4594  C  CD    . PRO B 1 113 ? -37.651  62.322  -8.306  1.00 67.47  ?  113 PRO B CD    1 
ATOM   4595  N  N     . ALA B 1 114 ? -37.788  59.632  -12.059 1.00 87.57  ?  114 ALA B N     1 
ATOM   4596  C  CA    . ALA B 1 114 ? -37.969  59.790  -13.494 1.00 88.49  ?  114 ALA B CA    1 
ATOM   4597  C  C     . ALA B 1 114 ? -39.197  60.654  -13.736 1.00 83.19  ?  114 ALA B C     1 
ATOM   4598  O  O     . ALA B 1 114 ? -40.136  60.670  -12.916 1.00 76.98  ?  114 ALA B O     1 
ATOM   4599  C  CB    . ALA B 1 114 ? -38.117  58.422  -14.181 1.00 88.97  ?  114 ALA B CB    1 
ATOM   4600  N  N     . ALA B 1 115 ? -39.184  61.377  -14.856 1.00 77.34  ?  115 ALA B N     1 
ATOM   4601  C  CA    . ALA B 1 115 ? -40.289  62.272  -15.189 1.00 72.01  ?  115 ALA B CA    1 
ATOM   4602  C  C     . ALA B 1 115 ? -41.604  61.517  -15.365 1.00 66.48  ?  115 ALA B C     1 
ATOM   4603  O  O     . ALA B 1 115 ? -41.617  60.341  -15.720 1.00 66.36  ?  115 ALA B O     1 
ATOM   4604  C  CB    . ALA B 1 115 ? -39.961  63.081  -16.402 1.00 76.39  ?  115 ALA B CB    1 
ATOM   4605  N  N     . MET B 1 116 ? -42.706  62.205  -15.096 1.00 62.88  ?  116 MET B N     1 
ATOM   4606  C  CA    . MET B 1 116 ? -44.050  61.607  -15.109 1.00 60.48  ?  116 MET B CA    1 
ATOM   4607  C  C     . MET B 1 116 ? -44.406  60.829  -16.405 1.00 63.38  ?  116 MET B C     1 
ATOM   4608  O  O     . MET B 1 116 ? -45.368  60.064  -16.454 1.00 62.66  ?  116 MET B O     1 
ATOM   4609  C  CB    . MET B 1 116 ? -45.067  62.717  -14.794 1.00 61.11  ?  116 MET B CB    1 
ATOM   4610  C  CG    . MET B 1 116 ? -46.540  62.442  -15.062 1.00 60.67  ?  116 MET B CG    1 
ATOM   4611  S  SD    . MET B 1 116 ? -47.302  63.932  -15.774 1.00 74.71  ?  116 MET B SD    1 
ATOM   4612  C  CE    . MET B 1 116 ? -46.163  65.201  -15.207 1.00 130.39 ?  116 MET B CE    1 
ATOM   4613  N  N     . ARG B 1 117 ? -43.611  61.002  -17.450 1.00 65.28  ?  117 ARG B N     1 
ATOM   4614  C  CA    A ARG B 1 117 ? -43.874  60.354  -18.726 0.39 66.62  ?  117 ARG B CA    1 
ATOM   4615  C  CA    B ARG B 1 117 ? -43.911  60.342  -18.703 0.61 65.71  ?  117 ARG B CA    1 
ATOM   4616  C  C     . ARG B 1 117 ? -43.361  58.916  -18.757 1.00 70.04  ?  117 ARG B C     1 
ATOM   4617  O  O     . ARG B 1 117 ? -43.861  58.089  -19.520 1.00 76.85  ?  117 ARG B O     1 
ATOM   4618  C  CB    A ARG B 1 117 ? -43.223  61.150  -19.854 0.39 70.39  ?  117 ARG B CB    1 
ATOM   4619  C  CB    B ARG B 1 117 ? -43.453  61.199  -19.891 0.61 70.05  ?  117 ARG B CB    1 
ATOM   4620  C  CG    A ARG B 1 117 ? -41.839  60.653  -20.239 0.39 72.52  ?  117 ARG B CG    1 
ATOM   4621  C  CG    B ARG B 1 117 ? -42.059  60.945  -20.467 0.61 73.01  ?  117 ARG B CG    1 
ATOM   4622  C  CD    A ARG B 1 117 ? -41.131  61.671  -21.104 0.39 73.38  ?  117 ARG B CD    1 
ATOM   4623  C  CD    B ARG B 1 117 ? -42.072  61.434  -21.922 0.61 74.26  ?  117 ARG B CD    1 
ATOM   4624  N  NE    A ARG B 1 117 ? -41.082  62.962  -20.428 0.39 71.02  ?  117 ARG B NE    1 
ATOM   4625  N  NE    B ARG B 1 117 ? -40.768  61.661  -22.536 0.61 76.06  ?  117 ARG B NE    1 
ATOM   4626  C  CZ    A ARG B 1 117 ? -40.626  64.081  -20.976 0.39 69.88  ?  117 ARG B CZ    1 
ATOM   4627  C  CZ    B ARG B 1 117 ? -40.261  60.921  -23.518 0.61 80.32  ?  117 ARG B CZ    1 
ATOM   4628  N  NH1   A ARG B 1 117 ? -40.168  64.083  -22.223 0.39 68.98  ?  117 ARG B NH1   1 
ATOM   4629  N  NH1   B ARG B 1 117 ? -40.930  59.875  -23.989 0.61 70.64  ?  117 ARG B NH1   1 
ATOM   4630  N  NH2   A ARG B 1 117 ? -40.626  65.199  -20.265 0.39 70.91  ?  117 ARG B NH2   1 
ATOM   4631  N  NH2   B ARG B 1 117 ? -39.073  61.225  -24.016 0.61 82.27  ?  117 ARG B NH2   1 
ATOM   4632  N  N     . TYR B 1 118 ? -42.352  58.626  -17.927 1.00 72.20  ?  118 TYR B N     1 
ATOM   4633  C  CA    . TYR B 1 118 ? -41.702  57.302  -17.900 1.00 68.33  ?  118 TYR B CA    1 
ATOM   4634  C  C     . TYR B 1 118 ? -42.277  56.272  -16.920 1.00 68.66  ?  118 TYR B C     1 
ATOM   4635  O  O     . TYR B 1 118 ? -42.140  55.070  -17.140 1.00 76.90  ?  118 TYR B O     1 
ATOM   4636  C  CB    . TYR B 1 118 ? -40.221  57.432  -17.562 1.00 63.94  ?  118 TYR B CB    1 
ATOM   4637  C  CG    . TYR B 1 118 ? -39.432  58.315  -18.474 1.00 65.71  ?  118 TYR B CG    1 
ATOM   4638  C  CD1   . TYR B 1 118 ? -39.000  57.859  -19.723 1.00 71.01  ?  118 TYR B CD1   1 
ATOM   4639  C  CD2   . TYR B 1 118 ? -39.098  59.598  -18.089 1.00 72.15  ?  118 TYR B CD2   1 
ATOM   4640  C  CE1   . TYR B 1 118 ? -38.274  58.669  -20.563 1.00 77.90  ?  118 TYR B CE1   1 
ATOM   4641  C  CE2   . TYR B 1 118 ? -38.370  60.417  -18.927 1.00 81.64  ?  118 TYR B CE2   1 
ATOM   4642  C  CZ    . TYR B 1 118 ? -37.955  59.947  -20.160 1.00 83.66  ?  118 TYR B CZ    1 
ATOM   4643  O  OH    . TYR B 1 118 ? -37.246  60.782  -20.988 1.00 87.58  ?  118 TYR B OH    1 
ATOM   4644  N  N     . THR B 1 119 ? -42.876  56.733  -15.826 1.00 58.51  ?  119 THR B N     1 
ATOM   4645  C  CA    . THR B 1 119 ? -43.224  55.840  -14.744 1.00 59.62  ?  119 THR B CA    1 
ATOM   4646  C  C     . THR B 1 119 ? -44.641  55.301  -14.903 1.00 65.28  ?  119 THR B C     1 
ATOM   4647  O  O     . THR B 1 119 ? -45.472  55.930  -15.543 1.00 68.59  ?  119 THR B O     1 
ATOM   4648  C  CB    . THR B 1 119 ? -43.028  56.547  -13.377 1.00 64.36  ?  119 THR B CB    1 
ATOM   4649  O  OG1   . THR B 1 119 ? -43.990  57.603  -13.219 1.00 62.34  ?  119 THR B OG1   1 
ATOM   4650  C  CG2   . THR B 1 119 ? -41.600  57.129  -13.267 1.00 62.43  ?  119 THR B CG2   1 
ATOM   4651  N  N     . GLU B 1 120 ? -44.903  54.120  -14.347 1.00 69.14  ?  120 GLU B N     1 
ATOM   4652  C  CA    . GLU B 1 120 ? -46.244  53.531  -14.332 1.00 69.70  ?  120 GLU B CA    1 
ATOM   4653  C  C     . GLU B 1 120 ? -46.596  53.425  -12.876 1.00 69.90  ?  120 GLU B C     1 
ATOM   4654  O  O     . GLU B 1 120 ? -45.689  53.382  -12.052 1.00 71.04  ?  120 GLU B O     1 
ATOM   4655  C  CB    . GLU B 1 120 ? -46.243  52.114  -14.903 1.00 77.84  ?  120 GLU B CB    1 
ATOM   4656  C  CG    . GLU B 1 120 ? -45.579  51.939  -16.254 1.00 90.94  ?  120 GLU B CG    1 
ATOM   4657  C  CD    . GLU B 1 120 ? -46.139  50.752  -17.028 1.00 104.34 ?  120 GLU B CD    1 
ATOM   4658  O  OE1   . GLU B 1 120 ? -46.246  49.647  -16.442 1.00 109.98 ?  120 GLU B OE1   1 
ATOM   4659  O  OE2   . GLU B 1 120 ? -46.477  50.933  -18.223 1.00 108.67 ?  120 GLU B OE2   1 
ATOM   4660  N  N     . ALA B 1 121 ? -47.885  53.354  -12.544 1.00 67.87  ?  121 ALA B N     1 
ATOM   4661  C  CA    . ALA B 1 121 ? -48.276  53.253  -11.128 1.00 66.03  ?  121 ALA B CA    1 
ATOM   4662  C  C     . ALA B 1 121 ? -49.699  52.756  -10.894 1.00 69.24  ?  121 ALA B C     1 
ATOM   4663  O  O     . ALA B 1 121 ? -50.484  52.642  -11.840 1.00 66.65  ?  121 ALA B O     1 
ATOM   4664  C  CB    . ALA B 1 121 ? -48.045  54.585  -10.402 1.00 45.98  ?  121 ALA B CB    1 
ATOM   4665  N  N     . ARG B 1 122 ? -50.005  52.472  -9.624  1.00 73.12  ?  122 ARG B N     1 
ATOM   4666  C  CA    . ARG B 1 122 ? -51.311  51.961  -9.183  1.00 76.21  ?  122 ARG B CA    1 
ATOM   4667  C  C     . ARG B 1 122 ? -51.387  51.916  -7.651  1.00 81.01  ?  122 ARG B C     1 
ATOM   4668  O  O     . ARG B 1 122 ? -50.352  51.879  -6.974  1.00 91.31  ?  122 ARG B O     1 
ATOM   4669  C  CB    . ARG B 1 122 ? -51.535  50.558  -9.731  1.00 74.64  ?  122 ARG B CB    1 
ATOM   4670  C  CG    . ARG B 1 122 ? -50.360  49.615  -9.499  1.00 68.88  ?  122 ARG B CG    1 
ATOM   4671  C  CD    . ARG B 1 122 ? -50.843  48.260  -9.041  1.00 71.39  ?  122 ARG B CD    1 
ATOM   4672  N  NE    . ARG B 1 122 ? -49.743  47.352  -8.734  1.00 78.17  ?  122 ARG B NE    1 
ATOM   4673  C  CZ    . ARG B 1 122 ? -49.505  46.217  -9.384  1.00 76.69  ?  122 ARG B CZ    1 
ATOM   4674  N  NH1   . ARG B 1 122 ? -50.293  45.851  -10.376 1.00 67.84  ?  122 ARG B NH1   1 
ATOM   4675  N  NH2   . ARG B 1 122 ? -48.481  45.448  -9.039  1.00 85.26  ?  122 ARG B NH2   1 
ATOM   4676  N  N     . LEU B 1 123 ? -52.599  51.905  -7.099  1.00 76.73  ?  123 LEU B N     1 
ATOM   4677  C  CA    . LEU B 1 123 ? -52.762  51.876  -5.637  1.00 75.42  ?  123 LEU B CA    1 
ATOM   4678  C  C     . LEU B 1 123 ? -52.177  50.601  -5.041  1.00 79.02  ?  123 LEU B C     1 
ATOM   4679  O  O     . LEU B 1 123 ? -52.277  49.531  -5.630  1.00 83.04  ?  123 LEU B O     1 
ATOM   4680  C  CB    . LEU B 1 123 ? -54.239  51.992  -5.231  1.00 66.54  ?  123 LEU B CB    1 
ATOM   4681  C  CG    . LEU B 1 123 ? -55.023  53.184  -5.796  1.00 58.41  ?  123 LEU B CG    1 
ATOM   4682  C  CD1   . LEU B 1 123 ? -56.503  53.153  -5.405  1.00 53.75  ?  123 LEU B CD1   1 
ATOM   4683  C  CD2   . LEU B 1 123 ? -54.371  54.502  -5.398  1.00 57.06  ?  123 LEU B CD2   1 
ATOM   4684  N  N     . SER B 1 124 ? -51.558  50.725  -3.872  1.00 74.21  ?  124 SER B N     1 
ATOM   4685  C  CA    . SER B 1 124 ? -51.106  49.563  -3.122  1.00 73.63  ?  124 SER B CA    1 
ATOM   4686  C  C     . SER B 1 124 ? -52.324  48.864  -2.550  1.00 73.16  ?  124 SER B C     1 
ATOM   4687  O  O     . SER B 1 124 ? -53.383  49.481  -2.389  1.00 71.65  ?  124 SER B O     1 
ATOM   4688  C  CB    . SER B 1 124 ? -50.206  49.997  -1.977  1.00 76.41  ?  124 SER B CB    1 
ATOM   4689  O  OG    . SER B 1 124 ? -50.914  50.826  -1.076  1.00 75.17  ?  124 SER B OG    1 
ATOM   4690  N  N     . GLU B 1 125 ? -52.190  47.581  -2.236  1.00 72.40  ?  125 GLU B N     1 
ATOM   4691  C  CA    . GLU B 1 125 ? -53.324  46.866  -1.671  1.00 71.62  ?  125 GLU B CA    1 
ATOM   4692  C  C     . GLU B 1 125 ? -53.830  47.553  -0.380  1.00 70.67  ?  125 GLU B C     1 
ATOM   4693  O  O     . GLU B 1 125 ? -55.045  47.667  -0.167  1.00 68.45  ?  125 GLU B O     1 
ATOM   4694  C  CB    . GLU B 1 125 ? -52.979  45.392  -1.451  1.00 70.09  ?  125 GLU B CB    1 
ATOM   4695  C  CG    . GLU B 1 125 ? -54.088  44.561  -0.819  1.00 72.41  ?  125 GLU B CG    1 
ATOM   4696  C  CD    . GLU B 1 125 ? -53.779  43.066  -0.842  1.00 85.51  ?  125 GLU B CD    1 
ATOM   4697  O  OE1   . GLU B 1 125 ? -52.634  42.698  -1.200  1.00 84.40  ?  125 GLU B OE1   1 
ATOM   4698  O  OE2   . GLU B 1 125 ? -54.683  42.260  -0.513  1.00 95.76  ?  125 GLU B OE2   1 
ATOM   4699  N  N     . ILE B 1 126 ? -52.901  48.028  0.456   1.00 67.14  ?  126 ILE B N     1 
ATOM   4700  C  CA    . ILE B 1 126 ? -53.251  48.760  1.676   1.00 61.84  ?  126 ILE B CA    1 
ATOM   4701  C  C     . ILE B 1 126 ? -54.200  49.944  1.447   1.00 56.70  ?  126 ILE B C     1 
ATOM   4702  O  O     . ILE B 1 126 ? -55.153  50.132  2.201   1.00 51.70  ?  126 ILE B O     1 
ATOM   4703  C  CB    . ILE B 1 126 ? -51.995  49.308  2.379   1.00 63.59  ?  126 ILE B CB    1 
ATOM   4704  C  CG1   . ILE B 1 126 ? -52.265  49.561  3.863   1.00 49.00  ?  126 ILE B CG1   1 
ATOM   4705  C  CG2   . ILE B 1 126 ? -51.496  50.569  1.687   1.00 76.29  ?  126 ILE B CG2   1 
ATOM   4706  C  CD1   . ILE B 1 126 ? -52.469  48.305  4.615   1.00 45.97  ?  126 ILE B CD1   1 
ATOM   4707  N  N     . ALA B 1 127 ? -53.927  50.752  0.420   1.00 59.68  ?  127 ALA B N     1 
ATOM   4708  C  CA    . ALA B 1 127 ? -54.745  51.933  0.104   1.00 62.20  ?  127 ALA B CA    1 
ATOM   4709  C  C     . ALA B 1 127 ? -56.195  51.555  -0.191  1.00 58.83  ?  127 ALA B C     1 
ATOM   4710  O  O     . ALA B 1 127 ? -57.139  52.273  0.150   1.00 61.26  ?  127 ALA B O     1 
ATOM   4711  C  CB    . ALA B 1 127 ? -54.153  52.689  -1.066  1.00 59.92  ?  127 ALA B CB    1 
ATOM   4712  N  N     . GLY B 1 128 ? -56.362  50.417  -0.837  1.00 51.91  ?  128 GLY B N     1 
ATOM   4713  C  CA    . GLY B 1 128 ? -57.676  49.842  -0.990  1.00 55.83  ?  128 GLY B CA    1 
ATOM   4714  C  C     . GLY B 1 128 ? -58.481  49.907  0.286   1.00 59.39  ?  128 GLY B C     1 
ATOM   4715  O  O     . GLY B 1 128 ? -59.673  50.188  0.245   1.00 64.60  ?  128 GLY B O     1 
ATOM   4716  N  N     . TYR B 1 129 ? -57.847  49.642  1.424   1.00 58.35  ?  129 TYR B N     1 
ATOM   4717  C  CA    . TYR B 1 129 ? -58.586  49.658  2.688   1.00 58.07  ?  129 TYR B CA    1 
ATOM   4718  C  C     . TYR B 1 129 ? -58.925  51.093  3.103   1.00 63.27  ?  129 TYR B C     1 
ATOM   4719  O  O     . TYR B 1 129 ? -59.955  51.334  3.728   1.00 70.37  ?  129 TYR B O     1 
ATOM   4720  C  CB    . TYR B 1 129 ? -57.864  48.860  3.795   1.00 50.92  ?  129 TYR B CB    1 
ATOM   4721  C  CG    . TYR B 1 129 ? -58.075  47.358  3.665   1.00 53.08  ?  129 TYR B CG    1 
ATOM   4722  C  CD1   . TYR B 1 129 ? -58.871  46.659  4.562   1.00 57.70  ?  129 TYR B CD1   1 
ATOM   4723  C  CD2   . TYR B 1 129 ? -57.504  46.646  2.615   1.00 52.52  ?  129 TYR B CD2   1 
ATOM   4724  C  CE1   . TYR B 1 129 ? -59.075  45.282  4.423   1.00 64.62  ?  129 TYR B CE1   1 
ATOM   4725  C  CE2   . TYR B 1 129 ? -57.701  45.278  2.466   1.00 53.91  ?  129 TYR B CE2   1 
ATOM   4726  C  CZ    . TYR B 1 129 ? -58.483  44.601  3.368   1.00 62.72  ?  129 TYR B CZ    1 
ATOM   4727  O  OH    . TYR B 1 129 ? -58.664  43.242  3.203   1.00 71.55  ?  129 TYR B OH    1 
ATOM   4728  N  N     . LEU B 1 130 ? -58.076  52.045  2.724   1.00 57.51  ?  130 LEU B N     1 
ATOM   4729  C  CA    . LEU B 1 130 ? -58.399  53.454  2.917   1.00 60.49  ?  130 LEU B CA    1 
ATOM   4730  C  C     . LEU B 1 130 ? -59.672  53.871  2.169   1.00 64.43  ?  130 LEU B C     1 
ATOM   4731  O  O     . LEU B 1 130 ? -60.295  54.880  2.498   1.00 71.06  ?  130 LEU B O     1 
ATOM   4732  C  CB    . LEU B 1 130 ? -57.249  54.327  2.434   1.00 62.97  ?  130 LEU B CB    1 
ATOM   4733  C  CG    . LEU B 1 130 ? -56.259  54.838  3.462   1.00 68.21  ?  130 LEU B CG    1 
ATOM   4734  C  CD1   . LEU B 1 130 ? -55.417  55.927  2.830   1.00 70.73  ?  130 LEU B CD1   1 
ATOM   4735  C  CD2   . LEU B 1 130 ? -57.020  55.374  4.648   1.00 73.04  ?  130 LEU B CD2   1 
ATOM   4736  N  N     . LEU B 1 131 ? -60.044  53.100  1.153   1.00 59.32  ?  131 LEU B N     1 
ATOM   4737  C  CA    . LEU B 1 131 ? -61.158  53.457  0.283   1.00 57.89  ?  131 LEU B CA    1 
ATOM   4738  C  C     . LEU B 1 131 ? -62.380  52.559  0.447   1.00 65.57  ?  131 LEU B C     1 
ATOM   4739  O  O     . LEU B 1 131 ? -63.444  52.805  -0.129  1.00 72.54  ?  131 LEU B O     1 
ATOM   4740  C  CB    . LEU B 1 131 ? -60.694  53.402  -1.158  1.00 55.61  ?  131 LEU B CB    1 
ATOM   4741  C  CG    . LEU B 1 131 ? -59.901  54.612  -1.605  1.00 60.55  ?  131 LEU B CG    1 
ATOM   4742  C  CD1   . LEU B 1 131 ? -59.066  54.247  -2.818  1.00 66.93  ?  131 LEU B CD1   1 
ATOM   4743  C  CD2   . LEU B 1 131 ? -60.878  55.735  -1.927  1.00 63.26  ?  131 LEU B CD2   1 
ATOM   4744  N  N     . GLN B 1 132 ? -62.204  51.512  1.237   1.00 65.12  ?  132 GLN B N     1 
ATOM   4745  C  CA    . GLN B 1 132 ? -63.200  50.478  1.408   1.00 63.83  ?  132 GLN B CA    1 
ATOM   4746  C  C     . GLN B 1 132 ? -64.556  51.100  1.705   1.00 62.39  ?  132 GLN B C     1 
ATOM   4747  O  O     . GLN B 1 132 ? -64.646  52.035  2.486   1.00 65.48  ?  132 GLN B O     1 
ATOM   4748  C  CB    . GLN B 1 132 ? -62.735  49.606  2.558   1.00 64.40  ?  132 GLN B CB    1 
ATOM   4749  C  CG    . GLN B 1 132 ? -63.389  48.264  2.683   1.00 72.80  ?  132 GLN B CG    1 
ATOM   4750  C  CD    . GLN B 1 132 ? -63.063  47.647  4.021   1.00 85.24  ?  132 GLN B CD    1 
ATOM   4751  O  OE1   . GLN B 1 132 ? -63.485  48.149  5.075   1.00 93.69  ?  132 GLN B OE1   1 
ATOM   4752  N  NE2   . GLN B 1 132 ? -62.280  46.576  3.998   1.00 85.19  ?  132 GLN B NE2   1 
ATOM   4753  N  N     . ASP B 1 133 ? -65.605  50.601  1.061   1.00 69.62  ?  133 ASP B N     1 
ATOM   4754  C  CA    . ASP B 1 133 ? -66.979  51.014  1.372   1.00 76.12  ?  133 ASP B CA    1 
ATOM   4755  C  C     . ASP B 1 133 ? -67.391  52.379  0.805   1.00 69.86  ?  133 ASP B C     1 
ATOM   4756  O  O     . ASP B 1 133 ? -68.545  52.787  0.953   1.00 72.18  ?  133 ASP B O     1 
ATOM   4757  C  CB    . ASP B 1 133 ? -67.227  51.011  2.881   1.00 87.59  ?  133 ASP B CB    1 
ATOM   4758  C  CG    . ASP B 1 133 ? -67.073  49.639  3.498   1.00 95.02  ?  133 ASP B CG    1 
ATOM   4759  O  OD1   . ASP B 1 133 ? -67.622  48.672  2.917   1.00 95.05  ?  133 ASP B OD1   1 
ATOM   4760  O  OD2   . ASP B 1 133 ? -66.400  49.543  4.562   1.00 97.45  ?  133 ASP B OD2   1 
ATOM   4761  N  N     . ILE B 1 134 ? -66.466  53.081  0.158   1.00 62.72  ?  134 ILE B N     1 
ATOM   4762  C  CA    . ILE B 1 134 ? -66.779  54.398  -0.417  1.00 61.13  ?  134 ILE B CA    1 
ATOM   4763  C  C     . ILE B 1 134 ? -67.963  54.380  -1.388  1.00 61.35  ?  134 ILE B C     1 
ATOM   4764  O  O     . ILE B 1 134 ? -68.677  55.366  -1.530  1.00 60.81  ?  134 ILE B O     1 
ATOM   4765  C  CB    . ILE B 1 134 ? -65.582  54.972  -1.163  1.00 56.76  ?  134 ILE B CB    1 
ATOM   4766  C  CG1   . ILE B 1 134 ? -65.758  56.457  -1.409  1.00 48.91  ?  134 ILE B CG1   1 
ATOM   4767  C  CG2   . ILE B 1 134 ? -65.402  54.264  -2.476  1.00 48.34  ?  134 ILE B CG2   1 
ATOM   4768  C  CD1   . ILE B 1 134 ? -64.403  57.133  -1.450  1.00 50.95  ?  134 ILE B CD1   1 
ATOM   4769  N  N     . GLU B 1 135 ? -68.164  53.254  -2.058  1.00 64.05  ?  135 GLU B N     1 
ATOM   4770  C  CA    . GLU B 1 135 ? -69.297  53.104  -2.966  1.00 68.43  ?  135 GLU B CA    1 
ATOM   4771  C  C     . GLU B 1 135 ? -70.633  53.030  -2.231  1.00 73.08  ?  135 GLU B C     1 
ATOM   4772  O  O     . GLU B 1 135 ? -71.683  52.916  -2.872  1.00 79.19  ?  135 GLU B O     1 
ATOM   4773  C  CB    . GLU B 1 135 ? -69.123  51.845  -3.843  1.00 67.55  ?  135 GLU B CB    1 
ATOM   4774  C  CG    . GLU B 1 135 ? -69.405  50.468  -3.157  1.00 73.61  ?  135 GLU B CG    1 
ATOM   4775  C  CD    . GLU B 1 135 ? -68.240  49.947  -2.289  1.00 82.12  ?  135 GLU B CD    1 
ATOM   4776  O  OE1   . GLU B 1 135 ? -67.178  50.623  -2.191  1.00 72.66  ?  135 GLU B OE1   1 
ATOM   4777  O  OE2   . GLU B 1 135 ? -68.394  48.849  -1.696  1.00 92.56  ?  135 GLU B OE2   1 
ATOM   4778  N  N     . LYS B 1 136 ? -70.592  53.065  -0.896  1.00 70.84  ?  136 LYS B N     1 
ATOM   4779  C  CA    . LYS B 1 136 ? -71.775  52.751  -0.074  1.00 76.87  ?  136 LYS B CA    1 
ATOM   4780  C  C     . LYS B 1 136 ? -72.320  53.923  0.740   1.00 79.18  ?  136 LYS B C     1 
ATOM   4781  O  O     . LYS B 1 136 ? -72.979  53.707  1.754   1.00 73.45  ?  136 LYS B O     1 
ATOM   4782  C  CB    . LYS B 1 136 ? -71.502  51.588  0.888   1.00 74.60  ?  136 LYS B CB    1 
ATOM   4783  C  CG    . LYS B 1 136 ? -71.441  50.195  0.281   1.00 60.23  ?  136 LYS B CG    1 
ATOM   4784  C  CD    . LYS B 1 136 ? -71.174  49.176  1.388   1.00 68.60  ?  136 LYS B CD    1 
ATOM   4785  C  CE    . LYS B 1 136 ? -70.828  47.777  0.884   1.00 69.68  ?  136 LYS B CE    1 
ATOM   4786  N  NZ    . LYS B 1 136 ? -72.000  46.849  0.800   1.00 65.07  ?  136 LYS B NZ    1 
ATOM   4787  N  N     . LYS B 1 137 ? -72.053  55.151  0.299   1.00 82.01  ?  137 LYS B N     1 
ATOM   4788  C  CA    . LYS B 1 137 ? -72.629  56.333  0.940   1.00 73.76  ?  137 LYS B CA    1 
ATOM   4789  C  C     . LYS B 1 137 ? -72.228  56.413  2.418   1.00 70.72  ?  137 LYS B C     1 
ATOM   4790  O  O     . LYS B 1 137 ? -73.060  56.683  3.298   1.00 74.08  ?  137 LYS B O     1 
ATOM   4791  C  CB    . LYS B 1 137 ? -74.161  56.359  0.760   1.00 68.01  ?  137 LYS B CB    1 
ATOM   4792  C  CG    . LYS B 1 137 ? -74.626  56.958  -0.579  1.00 68.36  ?  137 LYS B CG    1 
ATOM   4793  C  CD    . LYS B 1 137 ? -76.161  57.033  -0.725  1.00 70.61  ?  137 LYS B CD    1 
ATOM   4794  N  N     . THR B 1 138 ? -70.938  56.190  2.667   1.00 65.65  ?  138 THR B N     1 
ATOM   4795  C  CA    . THR B 1 138 ? -70.396  56.095  4.020   1.00 71.43  ?  138 THR B CA    1 
ATOM   4796  C  C     . THR B 1 138 ? -69.628  57.341  4.401   1.00 69.86  ?  138 THR B C     1 
ATOM   4797  O  O     . THR B 1 138 ? -69.029  57.415  5.462   1.00 69.28  ?  138 THR B O     1 
ATOM   4798  C  CB    . THR B 1 138 ? -69.380  54.935  4.131   1.00 73.28  ?  138 THR B CB    1 
ATOM   4799  O  OG1   . THR B 1 138 ? -68.386  55.067  3.091   1.00 67.15  ?  138 THR B OG1   1 
ATOM   4800  C  CG2   . THR B 1 138 ? -70.083  53.554  4.066   1.00 66.10  ?  138 THR B CG2   1 
ATOM   4801  N  N     . VAL B 1 139 ? -69.617  58.316  3.520   1.00 72.56  ?  139 VAL B N     1 
ATOM   4802  C  CA    . VAL B 1 139 ? -68.762  59.466  3.712   1.00 66.51  ?  139 VAL B CA    1 
ATOM   4803  C  C     . VAL B 1 139 ? -69.347  60.660  2.967   1.00 74.28  ?  139 VAL B C     1 
ATOM   4804  O  O     . VAL B 1 139 ? -69.898  60.509  1.870   1.00 85.08  ?  139 VAL B O     1 
ATOM   4805  C  CB    . VAL B 1 139 ? -67.376  59.171  3.156   1.00 60.63  ?  139 VAL B CB    1 
ATOM   4806  C  CG1   . VAL B 1 139 ? -66.853  60.364  2.426   1.00 69.49  ?  139 VAL B CG1   1 
ATOM   4807  C  CG2   . VAL B 1 139 ? -66.441  58.772  4.251   1.00 57.91  ?  139 VAL B CG2   1 
ATOM   4808  N  N     . PRO B 1 140 ? -69.231  61.852  3.559   1.00 66.06  ?  140 PRO B N     1 
ATOM   4809  C  CA    . PRO B 1 140 ? -69.728  63.105  2.970   1.00 65.96  ?  140 PRO B CA    1 
ATOM   4810  C  C     . PRO B 1 140 ? -69.004  63.528  1.666   1.00 83.36  ?  140 PRO B C     1 
ATOM   4811  O  O     . PRO B 1 140 ? -67.784  63.702  1.647   1.00 76.39  ?  140 PRO B O     1 
ATOM   4812  C  CB    . PRO B 1 140 ? -69.458  64.129  4.076   1.00 57.13  ?  140 PRO B CB    1 
ATOM   4813  C  CG    . PRO B 1 140 ? -68.259  63.576  4.782   1.00 56.28  ?  140 PRO B CG    1 
ATOM   4814  C  CD    . PRO B 1 140 ? -68.476  62.082  4.801   1.00 59.95  ?  140 PRO B CD    1 
ATOM   4815  N  N     . PHE B 1 141 ? -69.763  63.713  0.588   1.00 85.80  ?  141 PHE B N     1 
ATOM   4816  C  CA    . PHE B 1 141 ? -69.191  64.185  -0.676  1.00 80.53  ?  141 PHE B CA    1 
ATOM   4817  C  C     . PHE B 1 141 ? -69.434  65.685  -0.890  1.00 79.10  ?  141 PHE B C     1 
ATOM   4818  O  O     . PHE B 1 141 ? -70.439  66.237  -0.443  1.00 83.81  ?  141 PHE B O     1 
ATOM   4819  C  CB    . PHE B 1 141 ? -69.771  63.388  -1.862  1.00 79.89  ?  141 PHE B CB    1 
ATOM   4820  C  CG    . PHE B 1 141 ? -68.978  62.152  -2.226  1.00 78.77  ?  141 PHE B CG    1 
ATOM   4821  C  CD1   . PHE B 1 141 ? -69.068  60.995  -1.467  1.00 80.94  ?  141 PHE B CD1   1 
ATOM   4822  C  CD2   . PHE B 1 141 ? -68.144  62.148  -3.330  1.00 79.10  ?  141 PHE B CD2   1 
ATOM   4823  C  CE1   . PHE B 1 141 ? -68.338  59.859  -1.793  1.00 74.08  ?  141 PHE B CE1   1 
ATOM   4824  C  CE2   . PHE B 1 141 ? -67.410  61.015  -3.654  1.00 75.64  ?  141 PHE B CE2   1 
ATOM   4825  C  CZ    . PHE B 1 141 ? -67.514  59.868  -2.881  1.00 69.86  ?  141 PHE B CZ    1 
ATOM   4826  N  N     . ALA B 1 142 ? -68.513  66.336  -1.588  1.00 72.89  ?  142 ALA B N     1 
ATOM   4827  C  CA    . ALA B 1 142 ? -68.714  67.716  -2.015  1.00 71.88  ?  142 ALA B CA    1 
ATOM   4828  C  C     . ALA B 1 142 ? -68.647  67.841  -3.544  1.00 80.78  ?  142 ALA B C     1 
ATOM   4829  O  O     . ALA B 1 142 ? -68.180  66.921  -4.219  1.00 84.14  ?  142 ALA B O     1 
ATOM   4830  C  CB    . ALA B 1 142 ? -67.677  68.585  -1.383  1.00 65.67  ?  142 ALA B CB    1 
ATOM   4831  N  N     . TRP B 1 143 ? -69.106  68.970  -4.089  1.00 81.08  ?  143 TRP B N     1 
ATOM   4832  C  CA    . TRP B 1 143 ? -68.884  69.267  -5.509  1.00 77.35  ?  143 TRP B CA    1 
ATOM   4833  C  C     . TRP B 1 143 ? -67.427  69.635  -5.807  1.00 78.31  ?  143 TRP B C     1 
ATOM   4834  O  O     . TRP B 1 143 ? -66.725  70.203  -4.957  1.00 75.80  ?  143 TRP B O     1 
ATOM   4835  C  CB    . TRP B 1 143 ? -69.810  70.377  -6.006  1.00 80.31  ?  143 TRP B CB    1 
ATOM   4836  C  CG    . TRP B 1 143 ? -71.234  69.940  -6.153  1.00 89.35  ?  143 TRP B CG    1 
ATOM   4837  C  CD1   . TRP B 1 143 ? -72.276  70.278  -5.349  1.00 92.01  ?  143 TRP B CD1   1 
ATOM   4838  C  CD2   . TRP B 1 143 ? -71.771  69.066  -7.160  1.00 93.80  ?  143 TRP B CD2   1 
ATOM   4839  N  NE1   . TRP B 1 143 ? -73.429  69.676  -5.787  1.00 93.66  ?  143 TRP B NE1   1 
ATOM   4840  C  CE2   . TRP B 1 143 ? -73.149  68.926  -6.897  1.00 93.55  ?  143 TRP B CE2   1 
ATOM   4841  C  CE3   . TRP B 1 143 ? -71.220  68.388  -8.257  1.00 92.21  ?  143 TRP B CE3   1 
ATOM   4842  C  CZ2   . TRP B 1 143 ? -73.992  68.142  -7.693  1.00 93.08  ?  143 TRP B CZ2   1 
ATOM   4843  C  CZ3   . TRP B 1 143 ? -72.060  67.603  -9.047  1.00 89.89  ?  143 TRP B CZ3   1 
ATOM   4844  C  CH2   . TRP B 1 143 ? -73.431  67.490  -8.757  1.00 88.02  ?  143 TRP B CH2   1 
ATOM   4845  N  N     . ASN B 1 144 ? -66.977  69.294  -7.016  1.00 79.22  ?  144 ASN B N     1 
ATOM   4846  C  CA    . ASN B 1 144 ? -65.624  69.614  -7.469  1.00 80.68  ?  144 ASN B CA    1 
ATOM   4847  C  C     . ASN B 1 144 ? -65.576  70.987  -8.137  1.00 83.64  ?  144 ASN B C     1 
ATOM   4848  O  O     . ASN B 1 144 ? -66.612  71.519  -8.548  1.00 89.07  ?  144 ASN B O     1 
ATOM   4849  C  CB    . ASN B 1 144 ? -65.118  68.540  -8.434  1.00 85.21  ?  144 ASN B CB    1 
ATOM   4850  C  CG    . ASN B 1 144 ? -65.776  68.624  -9.814  1.00 95.88  ?  144 ASN B CG    1 
ATOM   4851  O  OD1   . ASN B 1 144 ? -66.889  69.122  -9.956  1.00 98.17  ?  144 ASN B OD1   1 
ATOM   4852  N  ND2   . ASN B 1 144 ? -65.080  68.132  -10.835 1.00 101.33 ?  144 ASN B ND2   1 
ATOM   4853  N  N     . PHE B 1 145 ? -64.381  71.560  -8.252  1.00 78.42  ?  145 PHE B N     1 
ATOM   4854  C  CA    . PHE B 1 145 ? -64.224  72.908  -8.816  1.00 81.20  ?  145 PHE B CA    1 
ATOM   4855  C  C     . PHE B 1 145 ? -65.074  73.199  -10.093 1.00 91.81  ?  145 PHE B C     1 
ATOM   4856  O  O     . PHE B 1 145 ? -65.616  74.297  -10.258 1.00 87.25  ?  145 PHE B O     1 
ATOM   4857  C  CB    . PHE B 1 145 ? -62.741  73.173  -9.075  1.00 80.68  ?  145 PHE B CB    1 
ATOM   4858  C  CG    . PHE B 1 145 ? -62.150  72.293  -10.140 1.00 85.96  ?  145 PHE B CG    1 
ATOM   4859  C  CD1   . PHE B 1 145 ? -62.490  72.474  -11.478 1.00 85.89  ?  145 PHE B CD1   1 
ATOM   4860  C  CD2   . PHE B 1 145 ? -61.260  71.288  -9.812  1.00 91.36  ?  145 PHE B CD2   1 
ATOM   4861  C  CE1   . PHE B 1 145 ? -61.961  71.667  -12.461 1.00 84.19  ?  145 PHE B CE1   1 
ATOM   4862  C  CE2   . PHE B 1 145 ? -60.718  70.479  -10.799 1.00 92.77  ?  145 PHE B CE2   1 
ATOM   4863  C  CZ    . PHE B 1 145 ? -61.073  70.670  -12.123 1.00 87.43  ?  145 PHE B CZ    1 
ATOM   4864  N  N     . ASP B 1 146 ? -65.160  72.210  -10.987 1.00 95.23  ?  146 ASP B N     1 
ATOM   4865  C  CA    . ASP B 1 146 ? -66.001  72.233  -12.192 1.00 94.24  ?  146 ASP B CA    1 
ATOM   4866  C  C     . ASP B 1 146 ? -67.473  72.396  -11.860 1.00 92.52  ?  146 ASP B C     1 
ATOM   4867  O  O     . ASP B 1 146 ? -68.215  73.028  -12.604 1.00 98.32  ?  146 ASP B O     1 
ATOM   4868  C  CB    . ASP B 1 146 ? -65.899  70.876  -12.892 1.00 100.97 ?  146 ASP B CB    1 
ATOM   4869  C  CG    . ASP B 1 146 ? -65.069  70.915  -14.151 1.00 109.16 ?  146 ASP B CG    1 
ATOM   4870  O  OD1   . ASP B 1 146 ? -64.959  72.002  -14.749 1.00 114.87 ?  146 ASP B OD1   1 
ATOM   4871  O  OD2   . ASP B 1 146 ? -64.541  69.848  -14.550 1.00 110.42 ?  146 ASP B OD2   1 
ATOM   4872  N  N     . ASP B 1 147 ? -67.879  71.783  -10.747 1.00 90.57  ?  147 ASP B N     1 
ATOM   4873  C  CA    . ASP B 1 147 ? -69.283  71.478  -10.438 1.00 95.92  ?  147 ASP B CA    1 
ATOM   4874  C  C     . ASP B 1 147 ? -69.843  70.376  -11.338 1.00 97.93  ?  147 ASP B C     1 
ATOM   4875  O  O     . ASP B 1 147 ? -71.051  70.321  -11.585 1.00 97.91  ?  147 ASP B O     1 
ATOM   4876  C  CB    . ASP B 1 147 ? -70.176  72.719  -10.482 1.00 105.56 ?  147 ASP B CB    1 
ATOM   4877  C  CG    . ASP B 1 147 ? -70.115  73.522  -9.202  1.00 111.64 ?  147 ASP B CG    1 
ATOM   4878  O  OD1   . ASP B 1 147 ? -70.135  74.770  -9.280  1.00 118.39 ?  147 ASP B OD1   1 
ATOM   4879  O  OD2   . ASP B 1 147 ? -70.042  72.903  -8.116  1.00 110.70 ?  147 ASP B OD2   1 
ATOM   4880  N  N     . THR B 1 148 ? -68.958  69.489  -11.795 1.00 98.52  ?  148 THR B N     1 
ATOM   4881  C  CA    . THR B 1 148 ? -69.323  68.427  -12.730 1.00 102.13 ?  148 THR B CA    1 
ATOM   4882  C  C     . THR B 1 148 ? -69.340  67.034  -12.095 1.00 95.26  ?  148 THR B C     1 
ATOM   4883  O  O     . THR B 1 148 ? -69.955  66.106  -12.617 1.00 100.14 ?  148 THR B O     1 
ATOM   4884  C  CB    . THR B 1 148 ? -68.342  68.391  -13.906 1.00 108.56 ?  148 THR B CB    1 
ATOM   4885  O  OG1   . THR B 1 148 ? -67.061  67.938  -13.445 1.00 108.88 ?  148 THR B OG1   1 
ATOM   4886  C  CG2   . THR B 1 148 ? -68.203  69.772  -14.507 1.00 111.09 ?  148 THR B CG2   1 
ATOM   4887  N  N     . GLU B 1 149 ? -68.674  66.896  -10.962 1.00 86.86  ?  149 GLU B N     1 
ATOM   4888  C  CA    . GLU B 1 149 ? -68.471  65.592  -10.359 1.00 86.68  ?  149 GLU B CA    1 
ATOM   4889  C  C     . GLU B 1 149 ? -68.337  65.762  -8.835  1.00 83.31  ?  149 GLU B C     1 
ATOM   4890  O  O     . GLU B 1 149 ? -67.699  66.713  -8.362  1.00 82.11  ?  149 GLU B O     1 
ATOM   4891  C  CB    . GLU B 1 149 ? -67.198  64.996  -10.970 1.00 87.19  ?  149 GLU B CB    1 
ATOM   4892  C  CG    . GLU B 1 149 ? -66.987  63.500  -10.825 1.00 95.59  ?  149 GLU B CG    1 
ATOM   4893  C  CD    . GLU B 1 149 ? -65.753  63.020  -11.600 1.00 105.99 ?  149 GLU B CD    1 
ATOM   4894  O  OE1   . GLU B 1 149 ? -65.210  63.808  -12.412 1.00 102.67 ?  149 GLU B OE1   1 
ATOM   4895  O  OE2   . GLU B 1 149 ? -65.326  61.859  -11.402 1.00 114.88 ?  149 GLU B OE2   1 
ATOM   4896  N  N     . LYS B 1 150 ? -68.947  64.863  -8.064  1.00 77.89  ?  150 LYS B N     1 
ATOM   4897  C  CA    . LYS B 1 150 ? -68.751  64.873  -6.611  1.00 75.05  ?  150 LYS B CA    1 
ATOM   4898  C  C     . LYS B 1 150 ? -67.413  64.220  -6.244  1.00 72.73  ?  150 LYS B C     1 
ATOM   4899  O  O     . LYS B 1 150 ? -66.995  63.249  -6.904  1.00 75.10  ?  150 LYS B O     1 
ATOM   4900  C  CB    . LYS B 1 150 ? -69.887  64.136  -5.894  1.00 78.53  ?  150 LYS B CB    1 
ATOM   4901  C  CG    . LYS B 1 150 ? -71.295  64.729  -6.059  1.00 90.33  ?  150 LYS B CG    1 
ATOM   4902  C  CD    . LYS B 1 150 ? -71.528  65.953  -5.165  1.00 93.96  ?  150 LYS B CD    1 
ATOM   4903  C  CE    . LYS B 1 150 ? -73.005  66.094  -4.763  1.00 98.15  ?  150 LYS B CE    1 
ATOM   4904  N  NZ    . LYS B 1 150 ? -73.258  65.625  -3.347  1.00 97.74  ?  150 LYS B NZ    1 
ATOM   4905  N  N     . GLU B 1 151 ? -66.744  64.769  -5.218  1.00 69.10  ?  151 GLU B N     1 
ATOM   4906  C  CA    . GLU B 1 151 ? -65.577  64.122  -4.586  1.00 66.52  ?  151 GLU B CA    1 
ATOM   4907  C  C     . GLU B 1 151 ? -65.774  63.988  -3.095  1.00 71.72  ?  151 GLU B C     1 
ATOM   4908  O  O     . GLU B 1 151 ? -66.514  64.767  -2.497  1.00 74.14  ?  151 GLU B O     1 
ATOM   4909  C  CB    . GLU B 1 151 ? -64.263  64.870  -4.830  1.00 61.13  ?  151 GLU B CB    1 
ATOM   4910  C  CG    . GLU B 1 151 ? -64.226  66.298  -4.322  1.00 70.66  ?  151 GLU B CG    1 
ATOM   4911  C  CD    . GLU B 1 151 ? -62.853  66.944  -4.535  1.00 79.44  ?  151 GLU B CD    1 
ATOM   4912  O  OE1   . GLU B 1 151 ? -62.786  68.165  -4.840  1.00 81.83  ?  151 GLU B OE1   1 
ATOM   4913  O  OE2   . GLU B 1 151 ? -61.836  66.220  -4.398  1.00 79.50  ?  151 GLU B OE2   1 
ATOM   4914  N  N     . PRO B 1 152 ? -65.099  63.002  -2.484  1.00 72.00  ?  152 PRO B N     1 
ATOM   4915  C  CA    . PRO B 1 152 ? -65.158  62.792  -1.035  1.00 67.24  ?  152 PRO B CA    1 
ATOM   4916  C  C     . PRO B 1 152 ? -64.328  63.846  -0.284  1.00 67.64  ?  152 PRO B C     1 
ATOM   4917  O  O     . PRO B 1 152 ? -63.290  64.295  -0.796  1.00 67.52  ?  152 PRO B O     1 
ATOM   4918  C  CB    . PRO B 1 152 ? -64.560  61.395  -0.870  1.00 64.42  ?  152 PRO B CB    1 
ATOM   4919  C  CG    . PRO B 1 152 ? -63.589  61.280  -1.993  1.00 64.23  ?  152 PRO B CG    1 
ATOM   4920  C  CD    . PRO B 1 152 ? -64.217  62.026  -3.148  1.00 69.77  ?  152 PRO B CD    1 
ATOM   4921  N  N     . THR B 1 153 ? -64.811  64.249  0.895   1.00 69.87  ?  153 THR B N     1 
ATOM   4922  C  CA    . THR B 1 153 ? -64.155  65.258  1.729   1.00 66.07  ?  153 THR B CA    1 
ATOM   4923  C  C     . THR B 1 153 ? -63.220  64.552  2.690   1.00 60.79  ?  153 THR B C     1 
ATOM   4924  O  O     . THR B 1 153 ? -62.251  65.143  3.163   1.00 64.35  ?  153 THR B O     1 
ATOM   4925  C  CB    . THR B 1 153 ? -65.164  66.142  2.528   1.00 81.47  ?  153 THR B CB    1 
ATOM   4926  O  OG1   . THR B 1 153 ? -66.151  65.328  3.179   1.00 78.74  ?  153 THR B OG1   1 
ATOM   4927  C  CG2   . THR B 1 153 ? -65.871  67.120  1.613   1.00 87.12  ?  153 THR B CG2   1 
ATOM   4928  N  N     . VAL B 1 154 ? -63.520  63.275  2.943   1.00 51.94  ?  154 VAL B N     1 
ATOM   4929  C  CA    . VAL B 1 154 ? -62.709  62.388  3.782   1.00 55.12  ?  154 VAL B CA    1 
ATOM   4930  C  C     . VAL B 1 154 ? -62.926  60.929  3.316   1.00 56.81  ?  154 VAL B C     1 
ATOM   4931  O  O     . VAL B 1 154 ? -64.006  60.585  2.839   1.00 54.26  ?  154 VAL B O     1 
ATOM   4932  C  CB    . VAL B 1 154 ? -63.107  62.533  5.279   1.00 60.87  ?  154 VAL B CB    1 
ATOM   4933  C  CG1   . VAL B 1 154 ? -64.605  62.194  5.497   1.00 46.15  ?  154 VAL B CG1   1 
ATOM   4934  C  CG2   . VAL B 1 154 ? -62.227  61.661  6.159   1.00 55.15  ?  154 VAL B CG2   1 
ATOM   4935  N  N     . LEU B 1 155 ? -61.925  60.062  3.451   1.00 61.32  ?  155 LEU B N     1 
ATOM   4936  C  CA    . LEU B 1 155 ? -62.104  58.656  3.063   1.00 59.99  ?  155 LEU B CA    1 
ATOM   4937  C  C     . LEU B 1 155 ? -62.488  57.795  4.251   1.00 65.51  ?  155 LEU B C     1 
ATOM   4938  O  O     . LEU B 1 155 ? -62.175  58.129  5.384   1.00 78.24  ?  155 LEU B O     1 
ATOM   4939  C  CB    . LEU B 1 155 ? -60.821  58.096  2.458   1.00 57.24  ?  155 LEU B CB    1 
ATOM   4940  C  CG    . LEU B 1 155 ? -60.224  58.839  1.269   1.00 54.92  ?  155 LEU B CG    1 
ATOM   4941  C  CD1   . LEU B 1 155 ? -58.856  58.298  0.958   1.00 60.38  ?  155 LEU B CD1   1 
ATOM   4942  C  CD2   . LEU B 1 155 ? -61.135  58.667  0.100   1.00 46.86  ?  155 LEU B CD2   1 
ATOM   4943  N  N     . PRO B 1 156 ? -63.153  56.667  3.995   1.00 59.73  ?  156 PRO B N     1 
ATOM   4944  C  CA    . PRO B 1 156 ? -63.592  55.730  5.039   1.00 63.86  ?  156 PRO B CA    1 
ATOM   4945  C  C     . PRO B 1 156 ? -62.499  55.238  5.998   1.00 66.48  ?  156 PRO B C     1 
ATOM   4946  O  O     . PRO B 1 156 ? -62.816  54.863  7.124   1.00 68.16  ?  156 PRO B O     1 
ATOM   4947  C  CB    . PRO B 1 156 ? -64.152  54.559  4.231   1.00 56.97  ?  156 PRO B CB    1 
ATOM   4948  C  CG    . PRO B 1 156 ? -64.679  55.192  3.020   1.00 57.44  ?  156 PRO B CG    1 
ATOM   4949  C  CD    . PRO B 1 156 ? -63.692  56.297  2.679   1.00 56.05  ?  156 PRO B CD    1 
ATOM   4950  N  N     . ALA B 1 157 ? -61.249  55.226  5.554   1.00 62.68  ?  157 ALA B N     1 
ATOM   4951  C  CA    . ALA B 1 157 ? -60.116  54.785  6.384   1.00 58.85  ?  157 ALA B CA    1 
ATOM   4952  C  C     . ALA B 1 157 ? -60.367  53.529  7.221   1.00 66.83  ?  157 ALA B C     1 
ATOM   4953  O  O     . ALA B 1 157 ? -60.681  53.623  8.406   1.00 75.19  ?  157 ALA B O     1 
ATOM   4954  C  CB    . ALA B 1 157 ? -59.638  55.926  7.282   1.00 57.65  ?  157 ALA B CB    1 
ATOM   4955  N  N     . ALA B 1 158 ? -60.205  52.356  6.621   1.00 64.85  ?  158 ALA B N     1 
ATOM   4956  C  CA    . ALA B 1 158 ? -60.362  51.100  7.363   1.00 63.26  ?  158 ALA B CA    1 
ATOM   4957  C  C     . ALA B 1 158 ? -59.162  50.780  8.284   1.00 65.81  ?  158 ALA B C     1 
ATOM   4958  O  O     . ALA B 1 158 ? -59.231  49.864  9.112   1.00 65.71  ?  158 ALA B O     1 
ATOM   4959  C  CB    . ALA B 1 158 ? -60.659  49.939  6.411   1.00 62.52  ?  158 ALA B CB    1 
ATOM   4960  N  N     . PHE B 1 159 ? -58.066  51.518  8.118   1.00 69.25  ?  159 PHE B N     1 
ATOM   4961  C  CA    . PHE B 1 159 ? -57.045  51.623  9.166   1.00 75.10  ?  159 PHE B CA    1 
ATOM   4962  C  C     . PHE B 1 159 ? -56.796  53.109  9.438   1.00 79.99  ?  159 PHE B C     1 
ATOM   4963  O  O     . PHE B 1 159 ? -57.233  53.959  8.661   1.00 79.54  ?  159 PHE B O     1 
ATOM   4964  C  CB    . PHE B 1 159 ? -55.750  50.860  8.821   1.00 74.98  ?  159 PHE B CB    1 
ATOM   4965  C  CG    . PHE B 1 159 ? -54.911  51.506  7.752   1.00 71.27  ?  159 PHE B CG    1 
ATOM   4966  C  CD1   . PHE B 1 159 ? -55.197  51.311  6.413   1.00 67.49  ?  159 PHE B CD1   1 
ATOM   4967  C  CD2   . PHE B 1 159 ? -53.812  52.294  8.091   1.00 74.54  ?  159 PHE B CD2   1 
ATOM   4968  C  CE1   . PHE B 1 159 ? -54.412  51.908  5.431   1.00 72.16  ?  159 PHE B CE1   1 
ATOM   4969  C  CE2   . PHE B 1 159 ? -53.019  52.900  7.112   1.00 68.05  ?  159 PHE B CE2   1 
ATOM   4970  C  CZ    . PHE B 1 159 ? -53.320  52.706  5.786   1.00 69.99  ?  159 PHE B CZ    1 
ATOM   4971  N  N     . PRO B 1 160 ? -56.111  53.424  10.551  1.00 81.61  ?  160 PRO B N     1 
ATOM   4972  C  CA    . PRO B 1 160 ? -55.908  54.791  11.068  1.00 82.19  ?  160 PRO B CA    1 
ATOM   4973  C  C     . PRO B 1 160 ? -54.677  55.484  10.481  1.00 81.57  ?  160 PRO B C     1 
ATOM   4974  O  O     . PRO B 1 160 ? -53.657  55.640  11.167  1.00 73.88  ?  160 PRO B O     1 
ATOM   4975  C  CB    . PRO B 1 160 ? -55.704  54.554  12.564  1.00 77.28  ?  160 PRO B CB    1 
ATOM   4976  C  CG    . PRO B 1 160 ? -54.973  53.265  12.594  1.00 77.10  ?  160 PRO B CG    1 
ATOM   4977  C  CD    . PRO B 1 160 ? -55.535  52.416  11.453  1.00 76.83  ?  160 PRO B CD    1 
ATOM   4978  N  N     . ASN B 1 161 ? -54.801  55.912  9.227   1.00 86.05  ?  161 ASN B N     1 
ATOM   4979  C  CA    . ASN B 1 161 ? -53.668  56.358  8.421   1.00 79.60  ?  161 ASN B CA    1 
ATOM   4980  C  C     . ASN B 1 161 ? -52.827  57.451  9.088   1.00 74.83  ?  161 ASN B C     1 
ATOM   4981  O  O     . ASN B 1 161 ? -51.598  57.380  9.064   1.00 78.18  ?  161 ASN B O     1 
ATOM   4982  C  CB    . ASN B 1 161 ? -54.130  56.781  7.003   1.00 67.54  ?  161 ASN B CB    1 
ATOM   4983  C  CG    . ASN B 1 161 ? -52.965  57.012  6.046   1.00 74.66  ?  161 ASN B CG    1 
ATOM   4984  O  OD1   . ASN B 1 161 ? -52.273  56.068  5.661   1.00 79.95  ?  161 ASN B OD1   1 
ATOM   4985  N  ND2   . ASN B 1 161 ? -52.749  58.269  5.651   1.00 73.38  ?  161 ASN B ND2   1 
ATOM   4986  N  N     . LEU B 1 162 ? -53.474  58.447  9.693   1.00 66.36  ?  162 LEU B N     1 
ATOM   4987  C  CA    . LEU B 1 162 ? -52.737  59.599  10.221  1.00 60.04  ?  162 LEU B CA    1 
ATOM   4988  C  C     . LEU B 1 162 ? -51.502  59.195  11.032  1.00 65.17  ?  162 LEU B C     1 
ATOM   4989  O  O     . LEU B 1 162 ? -50.406  59.696  10.778  1.00 70.78  ?  162 LEU B O     1 
ATOM   4990  C  CB    . LEU B 1 162 ? -53.634  60.508  11.059  1.00 60.17  ?  162 LEU B CB    1 
ATOM   4991  C  CG    . LEU B 1 162 ? -53.237  61.983  11.059  1.00 57.61  ?  162 LEU B CG    1 
ATOM   4992  C  CD1   . LEU B 1 162 ? -53.574  62.663  12.372  1.00 51.34  ?  162 LEU B CD1   1 
ATOM   4993  C  CD2   . LEU B 1 162 ? -51.773  62.080  10.805  1.00 65.41  ?  162 LEU B CD2   1 
ATOM   4994  N  N     . LEU B 1 163 ? -51.669  58.288  11.995  1.00 63.77  ?  163 LEU B N     1 
ATOM   4995  C  CA    . LEU B 1 163 ? -50.531  57.843  12.801  1.00 61.98  ?  163 LEU B CA    1 
ATOM   4996  C  C     . LEU B 1 163 ? -49.581  56.928  12.049  1.00 62.86  ?  163 LEU B C     1 
ATOM   4997  O  O     . LEU B 1 163 ? -48.366  57.086  12.142  1.00 68.15  ?  163 LEU B O     1 
ATOM   4998  C  CB    . LEU B 1 163 ? -50.991  57.133  14.071  1.00 59.56  ?  163 LEU B CB    1 
ATOM   4999  C  CG    . LEU B 1 163 ? -51.566  58.038  15.153  1.00 57.01  ?  163 LEU B CG    1 
ATOM   5000  C  CD1   . LEU B 1 163 ? -52.216  57.158  16.188  1.00 58.07  ?  163 LEU B CD1   1 
ATOM   5001  C  CD2   . LEU B 1 163 ? -50.482  58.945  15.733  1.00 49.95  ?  163 LEU B CD2   1 
ATOM   5002  N  N     . VAL B 1 164 ? -50.136  55.972  11.308  1.00 60.52  ?  164 VAL B N     1 
ATOM   5003  C  CA    . VAL B 1 164 ? -49.328  54.985  10.586  1.00 61.87  ?  164 VAL B CA    1 
ATOM   5004  C  C     . VAL B 1 164 ? -48.331  55.553  9.561   1.00 64.25  ?  164 VAL B C     1 
ATOM   5005  O  O     . VAL B 1 164 ? -47.184  55.108  9.486   1.00 64.61  ?  164 VAL B O     1 
ATOM   5006  C  CB    . VAL B 1 164 ? -50.214  53.965  9.873   1.00 58.79  ?  164 VAL B CB    1 
ATOM   5007  C  CG1   . VAL B 1 164 ? -49.347  52.949  9.166   1.00 60.28  ?  164 VAL B CG1   1 
ATOM   5008  C  CG2   . VAL B 1 164 ? -51.131  53.278  10.869  1.00 54.79  ?  164 VAL B CG2   1 
ATOM   5009  N  N     . ASN B 1 165 ? -48.768  56.530  8.775   1.00 62.66  ?  165 ASN B N     1 
ATOM   5010  C  CA    . ASN B 1 165 ? -47.930  57.085  7.716   1.00 63.73  ?  165 ASN B CA    1 
ATOM   5011  C  C     . ASN B 1 165 ? -47.437  58.504  8.004   1.00 73.51  ?  165 ASN B C     1 
ATOM   5012  O  O     . ASN B 1 165 ? -46.571  59.041  7.297   1.00 82.65  ?  165 ASN B O     1 
ATOM   5013  C  CB    . ASN B 1 165 ? -48.666  57.030  6.369   1.00 60.01  ?  165 ASN B CB    1 
ATOM   5014  C  CG    . ASN B 1 165 ? -48.394  55.749  5.604   1.00 63.01  ?  165 ASN B CG    1 
ATOM   5015  O  OD1   . ASN B 1 165 ? -47.292  55.183  5.663   1.00 61.78  ?  165 ASN B OD1   1 
ATOM   5016  N  ND2   . ASN B 1 165 ? -49.399  55.286  4.869   1.00 68.52  ?  165 ASN B ND2   1 
ATOM   5017  N  N     . GLY B 1 166 ? -48.001  59.118  9.034   1.00 66.78  ?  166 GLY B N     1 
ATOM   5018  C  CA    . GLY B 1 166 ? -47.529  60.419  9.461   1.00 65.19  ?  166 GLY B CA    1 
ATOM   5019  C  C     . GLY B 1 166 ? -47.958  61.524  8.531   1.00 64.36  ?  166 GLY B C     1 
ATOM   5020  O  O     . GLY B 1 166 ? -48.806  61.299  7.670   1.00 64.87  ?  166 GLY B O     1 
ATOM   5021  N  N     . SER B 1 167 ? -47.378  62.711  8.723   1.00 61.49  ?  167 SER B N     1 
ATOM   5022  C  CA    . SER B 1 167 ? -47.667  63.899  7.920   1.00 64.29  ?  167 SER B CA    1 
ATOM   5023  C  C     . SER B 1 167 ? -46.587  64.924  8.165   1.00 70.94  ?  167 SER B C     1 
ATOM   5024  O  O     . SER B 1 167 ? -45.677  64.678  8.943   1.00 79.75  ?  167 SER B O     1 
ATOM   5025  C  CB    . SER B 1 167 ? -49.034  64.497  8.269   1.00 69.00  ?  167 SER B CB    1 
ATOM   5026  O  OG    . SER B 1 167 ? -49.709  64.948  7.097   1.00 75.95  ?  167 SER B OG    1 
ATOM   5027  N  N     . THR B 1 168 ? -46.715  66.088  7.532   1.00 75.23  ?  168 THR B N     1 
ATOM   5028  C  CA    . THR B 1 168 ? -45.629  67.066  7.435   1.00 69.51  ?  168 THR B CA    1 
ATOM   5029  C  C     . THR B 1 168 ? -45.805  67.770  6.088   1.00 69.17  ?  168 THR B C     1 
ATOM   5030  O  O     . THR B 1 168 ? -45.708  67.100  5.057   1.00 87.94  ?  168 THR B O     1 
ATOM   5031  C  CB    . THR B 1 168 ? -44.252  66.319  7.464   1.00 60.26  ?  168 THR B CB    1 
ATOM   5032  O  OG1   . THR B 1 168 ? -43.218  67.131  6.902   1.00 56.35  ?  168 THR B OG1   1 
ATOM   5033  C  CG2   . THR B 1 168 ? -44.318  64.978  6.671   1.00 70.53  ?  168 THR B CG2   1 
ATOM   5034  N  N     . GLY B 1 169 ? -46.147  69.063  6.045   1.00 57.15  ?  169 GLY B N     1 
ATOM   5035  C  CA    . GLY B 1 169 ? -46.604  69.851  7.171   1.00 57.78  ?  169 GLY B CA    1 
ATOM   5036  C  C     . GLY B 1 169 ? -46.067  71.280  7.259   1.00 68.86  ?  169 GLY B C     1 
ATOM   5037  O  O     . GLY B 1 169 ? -45.256  71.558  8.147   1.00 81.15  ?  169 GLY B O     1 
ATOM   5038  N  N     . ILE B 1 170 ? -46.491  72.183  6.367   1.00 57.85  ?  170 ILE B N     1 
ATOM   5039  C  CA    . ILE B 1 170 ? -46.204  73.632  6.537   1.00 59.14  ?  170 ILE B CA    1 
ATOM   5040  C  C     . ILE B 1 170 ? -47.253  74.569  5.933   1.00 64.22  ?  170 ILE B C     1 
ATOM   5041  O  O     . ILE B 1 170 ? -47.340  74.730  4.714   1.00 72.92  ?  170 ILE B O     1 
ATOM   5042  C  CB    . ILE B 1 170 ? -44.859  74.112  5.935   1.00 58.68  ?  170 ILE B CB    1 
ATOM   5043  C  CG1   . ILE B 1 170 ? -43.701  73.157  6.219   1.00 56.22  ?  170 ILE B CG1   1 
ATOM   5044  C  CG2   . ILE B 1 170 ? -44.551  75.500  6.455   1.00 50.16  ?  170 ILE B CG2   1 
ATOM   5045  C  CD1   . ILE B 1 170 ? -42.355  73.708  5.760   1.00 51.53  ?  170 ILE B CD1   1 
ATOM   5046  N  N     . SER B 1 171 ? -47.997  75.235  6.799   1.00 64.17  ?  171 SER B N     1 
ATOM   5047  C  CA    . SER B 1 171 ? -49.160  76.010  6.397   1.00 68.42  ?  171 SER B CA    1 
ATOM   5048  C  C     . SER B 1 171 ? -48.939  77.506  6.635   1.00 75.11  ?  171 SER B C     1 
ATOM   5049  O  O     . SER B 1 171 ? -47.922  78.064  6.225   1.00 78.64  ?  171 SER B O     1 
ATOM   5050  C  CB    . SER B 1 171 ? -50.377  75.511  7.182   1.00 71.55  ?  171 SER B CB    1 
ATOM   5051  O  OG    . SER B 1 171 ? -51.485  76.371  7.027   1.00 79.62  ?  171 SER B OG    1 
ATOM   5052  N  N     . ALA B 1 172 ? -49.898  78.147  7.296   1.00 77.14  ?  172 ALA B N     1 
ATOM   5053  C  CA    . ALA B 1 172 ? -49.765  79.544  7.705   1.00 80.49  ?  172 ALA B CA    1 
ATOM   5054  C  C     . ALA B 1 172 ? -50.261  79.717  9.140   1.00 86.90  ?  172 ALA B C     1 
ATOM   5055  O  O     . ALA B 1 172 ? -51.452  79.560  9.416   1.00 87.10  ?  172 ALA B O     1 
ATOM   5056  C  CB    . ALA B 1 172 ? -50.539  80.455  6.769   1.00 76.58  ?  172 ALA B CB    1 
ATOM   5057  N  N     . GLY B 1 173 ? -49.341  80.042  10.045  1.00 87.38  ?  173 GLY B N     1 
ATOM   5058  C  CA    . GLY B 1 173 ? -49.663  80.176  11.457  1.00 87.98  ?  173 GLY B CA    1 
ATOM   5059  C  C     . GLY B 1 173 ? -49.651  78.840  12.180  1.00 87.56  ?  173 GLY B C     1 
ATOM   5060  O  O     . GLY B 1 173 ? -49.716  78.785  13.413  1.00 89.52  ?  173 GLY B O     1 
ATOM   5061  N  N     . TYR B 1 174 ? -49.585  77.765  11.394  1.00 81.55  ?  174 TYR B N     1 
ATOM   5062  C  CA    . TYR B 1 174 ? -49.521  76.402  11.903  1.00 79.17  ?  174 TYR B CA    1 
ATOM   5063  C  C     . TYR B 1 174 ? -48.657  75.577  10.962  1.00 76.75  ?  174 TYR B C     1 
ATOM   5064  O  O     . TYR B 1 174 ? -48.627  75.824  9.759   1.00 74.39  ?  174 TYR B O     1 
ATOM   5065  C  CB    . TYR B 1 174 ? -50.916  75.766  11.950  1.00 75.93  ?  174 TYR B CB    1 
ATOM   5066  C  CG    . TYR B 1 174 ? -51.941  76.514  12.775  1.00 78.92  ?  174 TYR B CG    1 
ATOM   5067  C  CD1   . TYR B 1 174 ? -52.146  76.202  14.106  1.00 80.60  ?  174 TYR B CD1   1 
ATOM   5068  C  CD2   . TYR B 1 174 ? -52.716  77.517  12.217  1.00 80.01  ?  174 TYR B CD2   1 
ATOM   5069  C  CE1   . TYR B 1 174 ? -53.085  76.873  14.861  1.00 86.58  ?  174 TYR B CE1   1 
ATOM   5070  C  CE2   . TYR B 1 174 ? -53.660  78.195  12.966  1.00 81.25  ?  174 TYR B CE2   1 
ATOM   5071  C  CZ    . TYR B 1 174 ? -53.842  77.869  14.287  1.00 86.71  ?  174 TYR B CZ    1 
ATOM   5072  O  OH    . TYR B 1 174 ? -54.777  78.544  15.050  1.00 93.97  ?  174 TYR B OH    1 
ATOM   5073  N  N     . ALA B 1 175 ? -47.960  74.590  11.504  1.00 74.31  ?  175 ALA B N     1 
ATOM   5074  C  CA    . ALA B 1 175 ? -47.315  73.590  10.663  1.00 65.42  ?  175 ALA B CA    1 
ATOM   5075  C  C     . ALA B 1 175 ? -47.505  72.224  11.325  1.00 67.65  ?  175 ALA B C     1 
ATOM   5076  O  O     . ALA B 1 175 ? -48.023  72.139  12.452  1.00 73.36  ?  175 ALA B O     1 
ATOM   5077  C  CB    . ALA B 1 175 ? -45.850  73.915  10.487  1.00 63.77  ?  175 ALA B CB    1 
ATOM   5078  N  N     . THR B 1 176 ? -47.104  71.156  10.641  1.00 60.18  ?  176 THR B N     1 
ATOM   5079  C  CA    . THR B 1 176 ? -47.277  69.826  11.214  1.00 60.79  ?  176 THR B CA    1 
ATOM   5080  C  C     . THR B 1 176 ? -46.121  68.888  10.917  1.00 73.30  ?  176 THR B C     1 
ATOM   5081  O  O     . THR B 1 176 ? -45.578  68.879  9.808   1.00 78.52  ?  176 THR B O     1 
ATOM   5082  C  CB    . THR B 1 176 ? -48.612  69.167  10.774  1.00 73.80  ?  176 THR B CB    1 
ATOM   5083  O  OG1   . THR B 1 176 ? -48.948  68.112  11.681  1.00 78.00  ?  176 THR B OG1   1 
ATOM   5084  C  CG2   . THR B 1 176 ? -48.511  68.597  9.370   1.00 71.60  ?  176 THR B CG2   1 
ATOM   5085  N  N     . ASP B 1 177 ? -45.740  68.123  11.937  1.00 80.11  ?  177 ASP B N     1 
ATOM   5086  C  CA    . ASP B 1 177 ? -44.848  66.976  11.781  1.00 78.97  ?  177 ASP B CA    1 
ATOM   5087  C  C     . ASP B 1 177 ? -45.368  65.841  12.655  1.00 73.98  ?  177 ASP B C     1 
ATOM   5088  O  O     . ASP B 1 177 ? -45.443  65.970  13.869  1.00 74.01  ?  177 ASP B O     1 
ATOM   5089  C  CB    . ASP B 1 177 ? -43.400  67.330  12.133  1.00 84.22  ?  177 ASP B CB    1 
ATOM   5090  C  CG    . ASP B 1 177 ? -42.644  67.951  10.961  1.00 90.36  ?  177 ASP B CG    1 
ATOM   5091  O  OD1   . ASP B 1 177 ? -41.834  67.238  10.320  1.00 93.49  ?  177 ASP B OD1   1 
ATOM   5092  O  OD2   . ASP B 1 177 ? -42.863  69.153  10.681  1.00 95.00  ?  177 ASP B OD2   1 
ATOM   5093  N  N     . ILE B 1 178 ? -45.779  64.755  12.014  1.00 69.18  ?  178 ILE B N     1 
ATOM   5094  C  CA    . ILE B 1 178 ? -46.287  63.574  12.696  1.00 59.16  ?  178 ILE B CA    1 
ATOM   5095  C  C     . ILE B 1 178 ? -45.483  62.401  12.154  1.00 62.05  ?  178 ILE B C     1 
ATOM   5096  O  O     . ILE B 1 178 ? -45.426  62.174  10.941  1.00 63.80  ?  178 ILE B O     1 
ATOM   5097  C  CB    . ILE B 1 178 ? -47.776  63.349  12.376  1.00 56.81  ?  178 ILE B CB    1 
ATOM   5098  C  CG1   . ILE B 1 178 ? -48.645  64.453  12.977  1.00 57.90  ?  178 ILE B CG1   1 
ATOM   5099  C  CG2   . ILE B 1 178 ? -48.239  62.017  12.909  1.00 58.10  ?  178 ILE B CG2   1 
ATOM   5100  C  CD1   . ILE B 1 178 ? -50.137  64.293  12.679  1.00 46.65  ?  178 ILE B CD1   1 
ATOM   5101  N  N     . PRO B 1 179 ? -44.821  61.657  13.036  1.00 63.35  ?  179 PRO B N     1 
ATOM   5102  C  CA    . PRO B 1 179 ? -43.953  60.603  12.490  1.00 65.30  ?  179 PRO B CA    1 
ATOM   5103  C  C     . PRO B 1 179 ? -44.796  59.369  12.239  1.00 62.99  ?  179 PRO B C     1 
ATOM   5104  O  O     . PRO B 1 179 ? -45.861  59.259  12.832  1.00 61.87  ?  179 PRO B O     1 
ATOM   5105  C  CB    . PRO B 1 179 ? -42.952  60.357  13.621  1.00 66.49  ?  179 PRO B CB    1 
ATOM   5106  C  CG    . PRO B 1 179 ? -43.759  60.652  14.871  1.00 68.49  ?  179 PRO B CG    1 
ATOM   5107  C  CD    . PRO B 1 179 ? -44.812  61.703  14.504  1.00 64.07  ?  179 PRO B CD    1 
ATOM   5108  N  N     . PRO B 1 180 ? -44.344  58.466  11.362  1.00 63.64  ?  180 PRO B N     1 
ATOM   5109  C  CA    . PRO B 1 180 ? -45.076  57.217  11.095  1.00 64.69  ?  180 PRO B CA    1 
ATOM   5110  C  C     . PRO B 1 180 ? -44.990  56.218  12.253  1.00 61.10  ?  180 PRO B C     1 
ATOM   5111  O  O     . PRO B 1 180 ? -44.091  56.294  13.092  1.00 59.60  ?  180 PRO B O     1 
ATOM   5112  C  CB    . PRO B 1 180 ? -44.374  56.659  9.861   1.00 72.05  ?  180 PRO B CB    1 
ATOM   5113  C  CG    . PRO B 1 180 ? -42.980  57.252  9.922   1.00 75.00  ?  180 PRO B CG    1 
ATOM   5114  C  CD    . PRO B 1 180 ? -43.145  58.615  10.519  1.00 68.37  ?  180 PRO B CD    1 
ATOM   5115  N  N     . HIS B 1 181 ? -45.928  55.280  12.284  1.00 64.54  ?  181 HIS B N     1 
ATOM   5116  C  CA    . HIS B 1 181 ? -46.045  54.340  13.394  1.00 68.27  ?  181 HIS B CA    1 
ATOM   5117  C  C     . HIS B 1 181 ? -46.327  52.926  12.905  1.00 69.01  ?  181 HIS B C     1 
ATOM   5118  O  O     . HIS B 1 181 ? -47.020  52.731  11.903  1.00 76.82  ?  181 HIS B O     1 
ATOM   5119  C  CB    . HIS B 1 181 ? -47.186  54.760  14.327  1.00 69.71  ?  181 HIS B CB    1 
ATOM   5120  C  CG    . HIS B 1 181 ? -46.889  55.970  15.154  1.00 71.71  ?  181 HIS B CG    1 
ATOM   5121  N  ND1   . HIS B 1 181 ? -47.260  57.239  14.778  1.00 72.23  ?  181 HIS B ND1   1 
ATOM   5122  C  CD2   . HIS B 1 181 ? -46.266  56.101  16.351  1.00 74.17  ?  181 HIS B CD2   1 
ATOM   5123  C  CE1   . HIS B 1 181 ? -46.874  58.104  15.699  1.00 74.15  ?  181 HIS B CE1   1 
ATOM   5124  N  NE2   . HIS B 1 181 ? -46.270  57.436  16.664  1.00 75.58  ?  181 HIS B NE2   1 
ATOM   5125  N  N     . ASN B 1 182 ? -45.821  51.936  13.631  1.00 63.04  ?  182 ASN B N     1 
ATOM   5126  C  CA    . ASN B 1 182 ? -46.113  50.552  13.295  1.00 61.71  ?  182 ASN B CA    1 
ATOM   5127  C  C     . ASN B 1 182 ? -47.616  50.264  13.216  1.00 66.76  ?  182 ASN B C     1 
ATOM   5128  O  O     . ASN B 1 182 ? -48.308  50.310  14.235  1.00 68.84  ?  182 ASN B O     1 
ATOM   5129  C  CB    . ASN B 1 182 ? -45.487  49.629  14.319  1.00 63.11  ?  182 ASN B CB    1 
ATOM   5130  C  CG    . ASN B 1 182 ? -45.481  48.199  13.857  1.00 72.55  ?  182 ASN B CG    1 
ATOM   5131  O  OD1   . ASN B 1 182 ? -46.526  47.538  13.812  1.00 75.88  ?  182 ASN B OD1   1 
ATOM   5132  N  ND2   . ASN B 1 182 ? -44.302  47.708  13.490  1.00 75.53  ?  182 ASN B ND2   1 
ATOM   5133  N  N     . LEU B 1 183 ? -48.118  49.953  12.019  1.00 67.41  ?  183 LEU B N     1 
ATOM   5134  C  CA    . LEU B 1 183 ? -49.556  49.717  11.820  1.00 68.40  ?  183 LEU B CA    1 
ATOM   5135  C  C     . LEU B 1 183 ? -50.219  48.852  12.913  1.00 67.04  ?  183 LEU B C     1 
ATOM   5136  O  O     . LEU B 1 183 ? -51.265  49.225  13.458  1.00 58.07  ?  183 LEU B O     1 
ATOM   5137  C  CB    . LEU B 1 183 ? -49.801  49.138  10.426  1.00 69.02  ?  183 LEU B CB    1 
ATOM   5138  C  CG    . LEU B 1 183 ? -51.154  48.725  9.827   1.00 66.51  ?  183 LEU B CG    1 
ATOM   5139  C  CD1   . LEU B 1 183 ? -51.485  47.296  10.169  1.00 68.72  ?  183 LEU B CD1   1 
ATOM   5140  C  CD2   . LEU B 1 183 ? -52.280  49.648  10.249  1.00 64.36  ?  183 LEU B CD2   1 
ATOM   5141  N  N     . ALA B 1 184 ? -49.607  47.715  13.249  1.00 72.96  ?  184 ALA B N     1 
ATOM   5142  C  CA    . ALA B 1 184 ? -50.169  46.809  14.266  1.00 72.04  ?  184 ALA B CA    1 
ATOM   5143  C  C     . ALA B 1 184 ? -50.310  47.441  15.654  1.00 69.27  ?  184 ALA B C     1 
ATOM   5144  O  O     . ALA B 1 184 ? -51.346  47.312  16.290  1.00 71.85  ?  184 ALA B O     1 
ATOM   5145  C  CB    . ALA B 1 184 ? -49.358  45.536  14.359  1.00 75.32  ?  184 ALA B CB    1 
ATOM   5146  N  N     . GLU B 1 185 ? -49.264  48.107  16.128  1.00 65.07  ?  185 GLU B N     1 
ATOM   5147  C  CA    . GLU B 1 185 ? -49.357  48.861  17.375  1.00 60.56  ?  185 GLU B CA    1 
ATOM   5148  C  C     . GLU B 1 185 ? -50.505  49.894  17.387  1.00 65.39  ?  185 GLU B C     1 
ATOM   5149  O  O     . GLU B 1 185 ? -51.343  49.859  18.287  1.00 69.38  ?  185 GLU B O     1 
ATOM   5150  C  CB    . GLU B 1 185 ? -48.017  49.515  17.712  1.00 56.95  ?  185 GLU B CB    1 
ATOM   5151  C  CG    . GLU B 1 185 ? -46.902  48.507  17.928  1.00 65.15  ?  185 GLU B CG    1 
ATOM   5152  C  CD    . GLU B 1 185 ? -45.537  49.158  18.110  1.00 75.43  ?  185 GLU B CD    1 
ATOM   5153  O  OE1   . GLU B 1 185 ? -45.450  50.401  17.997  1.00 81.32  ?  185 GLU B OE1   1 
ATOM   5154  O  OE2   . GLU B 1 185 ? -44.548  48.424  18.353  1.00 75.64  ?  185 GLU B OE2   1 
ATOM   5155  N  N     . VAL B 1 186 ? -50.560  50.802  16.409  1.00 62.52  ?  186 VAL B N     1 
ATOM   5156  C  CA    . VAL B 1 186 ? -51.667  51.758  16.370  1.00 65.32  ?  186 VAL B CA    1 
ATOM   5157  C  C     . VAL B 1 186 ? -53.022  51.062  16.474  1.00 68.67  ?  186 VAL B C     1 
ATOM   5158  O  O     . VAL B 1 186 ? -53.899  51.515  17.212  1.00 72.88  ?  186 VAL B O     1 
ATOM   5159  C  CB    . VAL B 1 186 ? -51.676  52.660  15.115  1.00 60.78  ?  186 VAL B CB    1 
ATOM   5160  C  CG1   . VAL B 1 186 ? -52.928  53.561  15.112  1.00 52.24  ?  186 VAL B CG1   1 
ATOM   5161  C  CG2   . VAL B 1 186 ? -50.444  53.512  15.078  1.00 63.37  ?  186 VAL B CG2   1 
ATOM   5162  N  N     . ILE B 1 187 ? -53.205  49.970  15.738  1.00 64.54  ?  187 ILE B N     1 
ATOM   5163  C  CA    . ILE B 1 187 ? -54.467  49.248  15.834  1.00 64.27  ?  187 ILE B CA    1 
ATOM   5164  C  C     . ILE B 1 187 ? -54.682  48.685  17.253  1.00 68.25  ?  187 ILE B C     1 
ATOM   5165  O  O     . ILE B 1 187 ? -55.772  48.776  17.818  1.00 68.69  ?  187 ILE B O     1 
ATOM   5166  C  CB    . ILE B 1 187 ? -54.618  48.170  14.741  1.00 59.99  ?  187 ILE B CB    1 
ATOM   5167  C  CG1   . ILE B 1 187 ? -54.590  48.820  13.358  1.00 63.39  ?  187 ILE B CG1   1 
ATOM   5168  C  CG2   . ILE B 1 187 ? -55.939  47.453  14.869  1.00 53.41  ?  187 ILE B CG2   1 
ATOM   5169  C  CD1   . ILE B 1 187 ? -54.939  47.851  12.206  1.00 69.58  ?  187 ILE B CD1   1 
ATOM   5170  N  N     . ASP B 1 188 ? -53.637  48.138  17.849  1.00 71.73  ?  188 ASP B N     1 
ATOM   5171  C  CA    . ASP B 1 188 ? -53.749  47.665  19.223  1.00 77.04  ?  188 ASP B CA    1 
ATOM   5172  C  C     . ASP B 1 188 ? -54.232  48.779  20.171  1.00 76.02  ?  188 ASP B C     1 
ATOM   5173  O  O     . ASP B 1 188 ? -55.130  48.563  21.000  1.00 80.87  ?  188 ASP B O     1 
ATOM   5174  C  CB    . ASP B 1 188 ? -52.434  47.022  19.686  1.00 82.14  ?  188 ASP B CB    1 
ATOM   5175  C  CG    . ASP B 1 188 ? -52.172  45.680  18.998  1.00 85.73  ?  188 ASP B CG    1 
ATOM   5176  O  OD1   . ASP B 1 188 ? -53.142  45.119  18.425  1.00 82.06  ?  188 ASP B OD1   1 
ATOM   5177  O  OD2   . ASP B 1 188 ? -51.016  45.186  19.035  1.00 91.71  ?  188 ASP B OD2   1 
ATOM   5178  N  N     . ALA B 1 189 ? -53.660  49.970  20.024  1.00 65.87  ?  189 ALA B N     1 
ATOM   5179  C  CA    . ALA B 1 189 ? -54.086  51.120  20.814  1.00 65.91  ?  189 ALA B CA    1 
ATOM   5180  C  C     . ALA B 1 189 ? -55.553  51.464  20.571  1.00 67.25  ?  189 ALA B C     1 
ATOM   5181  O  O     . ALA B 1 189 ? -56.351  51.523  21.510  1.00 71.93  ?  189 ALA B O     1 
ATOM   5182  C  CB    . ALA B 1 189 ? -53.201  52.321  20.536  1.00 59.53  ?  189 ALA B CB    1 
ATOM   5183  N  N     . ALA B 1 190 ? -55.906  51.692  19.311  1.00 65.43  ?  190 ALA B N     1 
ATOM   5184  C  CA    . ALA B 1 190 ? -57.285  52.011  18.959  1.00 67.24  ?  190 ALA B CA    1 
ATOM   5185  C  C     . ALA B 1 190 ? -58.258  51.003  19.575  1.00 73.18  ?  190 ALA B C     1 
ATOM   5186  O  O     . ALA B 1 190 ? -59.324  51.356  20.083  1.00 71.01  ?  190 ALA B O     1 
ATOM   5187  C  CB    . ALA B 1 190 ? -57.455  52.045  17.446  1.00 55.76  ?  190 ALA B CB    1 
ATOM   5188  N  N     . VAL B 1 191 ? -57.889  49.736  19.529  1.00 76.69  ?  191 VAL B N     1 
ATOM   5189  C  CA    . VAL B 1 191 ? -58.797  48.709  19.989  1.00 78.22  ?  191 VAL B CA    1 
ATOM   5190  C  C     . VAL B 1 191 ? -59.010  48.795  21.492  1.00 82.55  ?  191 VAL B C     1 
ATOM   5191  O  O     . VAL B 1 191 ? -60.148  48.685  21.959  1.00 89.82  ?  191 VAL B O     1 
ATOM   5192  C  CB    . VAL B 1 191 ? -58.344  47.318  19.527  1.00 73.53  ?  191 VAL B CB    1 
ATOM   5193  C  CG1   . VAL B 1 191 ? -59.031  46.208  20.333  1.00 68.95  ?  191 VAL B CG1   1 
ATOM   5194  C  CG2   . VAL B 1 191 ? -58.629  47.183  18.024  1.00 67.31  ?  191 VAL B CG2   1 
ATOM   5195  N  N     . TYR B 1 192 ? -57.933  49.019  22.247  1.00 77.26  ?  192 TYR B N     1 
ATOM   5196  C  CA    . TYR B 1 192 ? -58.064  49.198  23.694  1.00 80.02  ?  192 TYR B CA    1 
ATOM   5197  C  C     . TYR B 1 192 ? -58.988  50.362  23.980  1.00 79.17  ?  192 TYR B C     1 
ATOM   5198  O  O     . TYR B 1 192 ? -59.969  50.225  24.705  1.00 85.44  ?  192 TYR B O     1 
ATOM   5199  C  CB    . TYR B 1 192 ? -56.709  49.465  24.336  1.00 78.29  ?  192 TYR B CB    1 
ATOM   5200  C  CG    . TYR B 1 192 ? -56.716  49.583  25.858  1.00 76.76  ?  192 TYR B CG    1 
ATOM   5201  C  CD1   . TYR B 1 192 ? -56.976  50.797  26.486  1.00 75.89  ?  192 TYR B CD1   1 
ATOM   5202  C  CD2   . TYR B 1 192 ? -56.416  48.487  26.660  1.00 73.51  ?  192 TYR B CD2   1 
ATOM   5203  C  CE1   . TYR B 1 192 ? -56.948  50.910  27.857  1.00 79.62  ?  192 TYR B CE1   1 
ATOM   5204  C  CE2   . TYR B 1 192 ? -56.394  48.586  28.035  1.00 79.57  ?  192 TYR B CE2   1 
ATOM   5205  C  CZ    . TYR B 1 192 ? -56.657  49.801  28.638  1.00 86.00  ?  192 TYR B CZ    1 
ATOM   5206  O  OH    . TYR B 1 192 ? -56.634  49.900  30.024  1.00 95.06  ?  192 TYR B OH    1 
ATOM   5207  N  N     . MET B 1 193 ? -58.668  51.511  23.397  1.00 72.32  ?  193 MET B N     1 
ATOM   5208  C  CA    . MET B 1 193 ? -59.473  52.715  23.574  1.00 71.82  ?  193 MET B CA    1 
ATOM   5209  C  C     . MET B 1 193 ? -60.966  52.533  23.230  1.00 72.11  ?  193 MET B C     1 
ATOM   5210  O  O     . MET B 1 193 ? -61.823  53.296  23.678  1.00 71.97  ?  193 MET B O     1 
ATOM   5211  C  CB    . MET B 1 193 ? -58.863  53.874  22.780  1.00 58.09  ?  193 MET B CB    1 
ATOM   5212  C  CG    . MET B 1 193 ? -59.598  55.179  22.966  1.00 63.72  ?  193 MET B CG    1 
ATOM   5213  S  SD    . MET B 1 193 ? -58.583  56.624  22.651  1.00 92.81  ?  193 MET B SD    1 
ATOM   5214  C  CE    . MET B 1 193 ? -59.860  57.882  22.569  1.00 95.33  ?  193 MET B CE    1 
ATOM   5215  N  N     . ILE B 1 194 ? -61.278  51.526  22.431  1.00 71.77  ?  194 ILE B N     1 
ATOM   5216  C  CA    . ILE B 1 194 ? -62.655  51.307  22.042  1.00 70.85  ?  194 ILE B CA    1 
ATOM   5217  C  C     . ILE B 1 194 ? -63.406  50.702  23.219  1.00 74.52  ?  194 ILE B C     1 
ATOM   5218  O  O     . ILE B 1 194 ? -64.573  51.015  23.450  1.00 78.68  ?  194 ILE B O     1 
ATOM   5219  C  CB    . ILE B 1 194 ? -62.742  50.401  20.799  1.00 64.85  ?  194 ILE B CB    1 
ATOM   5220  C  CG1   . ILE B 1 194 ? -62.069  51.097  19.604  1.00 60.19  ?  194 ILE B CG1   1 
ATOM   5221  C  CG2   . ILE B 1 194 ? -64.209  50.006  20.510  1.00 62.87  ?  194 ILE B CG2   1 
ATOM   5222  C  CD1   . ILE B 1 194 ? -62.541  50.617  18.247  1.00 66.40  ?  194 ILE B CD1   1 
ATOM   5223  N  N     . ASP B 1 195 ? -62.707  49.843  23.959  1.00 74.12  ?  195 ASP B N     1 
ATOM   5224  C  CA    . ASP B 1 195 ? -63.216  49.208  25.175  1.00 79.36  ?  195 ASP B CA    1 
ATOM   5225  C  C     . ASP B 1 195 ? -63.113  50.143  26.384  1.00 81.70  ?  195 ASP B C     1 
ATOM   5226  O  O     . ASP B 1 195 ? -63.767  49.938  27.414  1.00 87.92  ?  195 ASP B O     1 
ATOM   5227  C  CB    . ASP B 1 195 ? -62.403  47.943  25.492  1.00 80.18  ?  195 ASP B CB    1 
ATOM   5228  C  CG    . ASP B 1 195 ? -62.557  46.857  24.438  1.00 80.62  ?  195 ASP B CG    1 
ATOM   5229  O  OD1   . ASP B 1 195 ? -63.665  46.747  23.846  1.00 73.74  ?  195 ASP B OD1   1 
ATOM   5230  O  OD2   . ASP B 1 195 ? -61.564  46.114  24.215  1.00 84.08  ?  195 ASP B OD2   1 
ATOM   5231  N  N     . HIS B 1 196 ? -62.280  51.165  26.247  1.00 77.77  ?  196 HIS B N     1 
ATOM   5232  C  CA    . HIS B 1 196 ? -61.854  51.966  27.373  1.00 78.27  ?  196 HIS B CA    1 
ATOM   5233  C  C     . HIS B 1 196 ? -61.641  53.402  26.916  1.00 76.12  ?  196 HIS B C     1 
ATOM   5234  O  O     . HIS B 1 196 ? -60.502  53.876  26.870  1.00 75.53  ?  196 HIS B O     1 
ATOM   5235  C  CB    . HIS B 1 196 ? -60.529  51.421  27.915  1.00 79.02  ?  196 HIS B CB    1 
ATOM   5236  C  CG    . HIS B 1 196 ? -60.616  50.036  28.484  1.00 83.73  ?  196 HIS B CG    1 
ATOM   5237  N  ND1   . HIS B 1 196 ? -59.822  48.998  28.038  1.00 84.36  ?  196 HIS B ND1   1 
ATOM   5238  C  CD2   . HIS B 1 196 ? -61.369  49.526  29.489  1.00 88.16  ?  196 HIS B CD2   1 
ATOM   5239  C  CE1   . HIS B 1 196 ? -60.095  47.905  28.731  1.00 85.74  ?  196 HIS B CE1   1 
ATOM   5240  N  NE2   . HIS B 1 196 ? -61.032  48.196  29.614  1.00 86.86  ?  196 HIS B NE2   1 
ATOM   5241  N  N     . PRO B 1 197 ? -62.738  54.097  26.586  1.00 70.56  ?  197 PRO B N     1 
ATOM   5242  C  CA    . PRO B 1 197 ? -62.829  55.493  26.131  1.00 72.22  ?  197 PRO B CA    1 
ATOM   5243  C  C     . PRO B 1 197 ? -61.919  56.458  26.877  1.00 80.18  ?  197 PRO B C     1 
ATOM   5244  O  O     . PRO B 1 197 ? -61.285  57.327  26.279  1.00 88.41  ?  197 PRO B O     1 
ATOM   5245  C  CB    . PRO B 1 197 ? -64.274  55.850  26.438  1.00 65.35  ?  197 PRO B CB    1 
ATOM   5246  C  CG    . PRO B 1 197 ? -65.001  54.562  26.255  1.00 69.10  ?  197 PRO B CG    1 
ATOM   5247  C  CD    . PRO B 1 197 ? -64.062  53.460  26.681  1.00 66.14  ?  197 PRO B CD    1 
ATOM   5248  N  N     . THR B 1 198 ? -61.858  56.292  28.187  1.00 83.44  ?  198 THR B N     1 
ATOM   5249  C  CA    . THR B 1 198 ? -61.159  57.212  29.069  1.00 89.12  ?  198 THR B CA    1 
ATOM   5250  C  C     . THR B 1 198 ? -59.718  56.792  29.345  1.00 86.85  ?  198 THR B C     1 
ATOM   5251  O  O     . THR B 1 198 ? -59.179  57.066  30.422  1.00 90.96  ?  198 THR B O     1 
ATOM   5252  C  CB    . THR B 1 198 ? -61.901  57.279  30.408  1.00 95.94  ?  198 THR B CB    1 
ATOM   5253  O  OG1   . THR B 1 198 ? -62.549  56.017  30.633  1.00 95.75  ?  198 THR B OG1   1 
ATOM   5254  C  CG2   . THR B 1 198 ? -62.947  58.392  30.385  1.00 97.69  ?  198 THR B CG2   1 
ATOM   5255  N  N     . ALA B 1 199 ? -59.095  56.132  28.375  1.00 78.18  ?  199 ALA B N     1 
ATOM   5256  C  CA    . ALA B 1 199 ? -57.767  55.548  28.587  1.00 81.18  ?  199 ALA B CA    1 
ATOM   5257  C  C     . ALA B 1 199 ? -56.654  56.592  28.719  1.00 87.20  ?  199 ALA B C     1 
ATOM   5258  O  O     . ALA B 1 199 ? -56.524  57.485  27.886  1.00 79.60  ?  199 ALA B O     1 
ATOM   5259  C  CB    . ALA B 1 199 ? -57.439  54.522  27.492  1.00 75.43  ?  199 ALA B CB    1 
ATOM   5260  N  N     . LYS B 1 200 ? -55.862  56.472  29.779  1.00 96.92  ?  200 LYS B N     1 
ATOM   5261  C  CA    . LYS B 1 200 ? -54.785  57.421  30.054  1.00 101.67 ?  200 LYS B CA    1 
ATOM   5262  C  C     . LYS B 1 200 ? -53.637  57.179  29.084  1.00 94.96  ?  200 LYS B C     1 
ATOM   5263  O  O     . LYS B 1 200 ? -53.518  56.082  28.542  1.00 92.16  ?  200 LYS B O     1 
ATOM   5264  C  CB    . LYS B 1 200 ? -54.306  57.269  31.507  1.00 105.60 ?  200 LYS B CB    1 
ATOM   5265  N  N     . ILE B 1 201 ? -52.788  58.181  28.866  1.00 91.37  ?  201 ILE B N     1 
ATOM   5266  C  CA    . ILE B 1 201 ? -51.677  57.997  27.923  1.00 91.05  ?  201 ILE B CA    1 
ATOM   5267  C  C     . ILE B 1 201 ? -50.771  56.826  28.310  1.00 88.79  ?  201 ILE B C     1 
ATOM   5268  O  O     . ILE B 1 201 ? -50.398  56.005  27.455  1.00 81.41  ?  201 ILE B O     1 
ATOM   5269  C  CB    . ILE B 1 201 ? -50.821  59.273  27.719  1.00 85.76  ?  201 ILE B CB    1 
ATOM   5270  C  CG1   . ILE B 1 201 ? -51.510  60.237  26.747  1.00 93.35  ?  201 ILE B CG1   1 
ATOM   5271  C  CG2   . ILE B 1 201 ? -49.458  58.908  27.158  1.00 74.83  ?  201 ILE B CG2   1 
ATOM   5272  C  CD1   . ILE B 1 201 ? -52.726  60.936  27.324  1.00 101.27 ?  201 ILE B CD1   1 
ATOM   5273  N  N     . ASP B 1 202 ? -50.423  56.749  29.594  1.00 87.18  ?  202 ASP B N     1 
ATOM   5274  C  CA    . ASP B 1 202 ? -49.596  55.648  30.086  1.00 91.30  ?  202 ASP B CA    1 
ATOM   5275  C  C     . ASP B 1 202 ? -50.071  54.259  29.631  1.00 92.54  ?  202 ASP B C     1 
ATOM   5276  O  O     . ASP B 1 202 ? -49.247  53.411  29.293  1.00 96.80  ?  202 ASP B O     1 
ATOM   5277  C  CB    . ASP B 1 202 ? -49.473  55.679  31.610  1.00 102.58 ?  202 ASP B CB    1 
ATOM   5278  C  CG    . ASP B 1 202 ? -48.447  56.695  32.099  1.00 110.44 ?  202 ASP B CG    1 
ATOM   5279  O  OD1   . ASP B 1 202 ? -47.763  57.331  31.262  1.00 109.30 ?  202 ASP B OD1   1 
ATOM   5280  O  OD2   . ASP B 1 202 ? -48.314  56.844  33.334  1.00 112.60 ?  202 ASP B OD2   1 
ATOM   5281  N  N     . LYS B 1 203 ? -51.382  54.015  29.625  1.00 88.40  ?  203 LYS B N     1 
ATOM   5282  C  CA    . LYS B 1 203 ? -51.870  52.677  29.292  1.00 84.34  ?  203 LYS B CA    1 
ATOM   5283  C  C     . LYS B 1 203 ? -51.720  52.455  27.805  1.00 86.43  ?  203 LYS B C     1 
ATOM   5284  O  O     . LYS B 1 203 ? -51.201  51.420  27.376  1.00 86.95  ?  203 LYS B O     1 
ATOM   5285  C  CB    . LYS B 1 203 ? -53.323  52.445  29.746  1.00 82.04  ?  203 LYS B CB    1 
ATOM   5286  C  CG    . LYS B 1 203 ? -53.600  51.020  30.322  1.00 70.41  ?  203 LYS B CG    1 
ATOM   5287  N  N     . LEU B 1 204 ? -52.168  53.440  27.026  1.00 87.58  ?  204 LEU B N     1 
ATOM   5288  C  CA    . LEU B 1 204 ? -52.038  53.396  25.573  1.00 86.36  ?  204 LEU B CA    1 
ATOM   5289  C  C     . LEU B 1 204 ? -50.592  53.133  25.185  1.00 86.50  ?  204 LEU B C     1 
ATOM   5290  O  O     . LEU B 1 204 ? -50.326  52.420  24.223  1.00 87.40  ?  204 LEU B O     1 
ATOM   5291  C  CB    . LEU B 1 204 ? -52.483  54.710  24.939  1.00 60.50  ?  204 LEU B CB    1 
ATOM   5292  C  CG    . LEU B 1 204 ? -53.880  55.238  25.234  1.00 67.42  ?  204 LEU B CG    1 
ATOM   5293  C  CD1   . LEU B 1 204 ? -53.924  56.701  24.827  1.00 66.96  ?  204 LEU B CD1   1 
ATOM   5294  C  CD2   . LEU B 1 204 ? -54.938  54.443  24.494  1.00 61.89  ?  204 LEU B CD2   1 
ATOM   5295  N  N     . MET B 1 205 ? -49.650  53.701  25.929  1.00 81.77  ?  205 MET B N     1 
ATOM   5296  C  CA    . MET B 1 205 ? -48.250  53.491  25.583  1.00 79.00  ?  205 MET B CA    1 
ATOM   5297  C  C     . MET B 1 205 ? -47.741  52.053  25.795  1.00 83.20  ?  205 MET B C     1 
ATOM   5298  O  O     . MET B 1 205 ? -46.672  51.691  25.294  1.00 87.82  ?  205 MET B O     1 
ATOM   5299  C  CB    . MET B 1 205 ? -47.350  54.528  26.250  1.00 75.59  ?  205 MET B CB    1 
ATOM   5300  C  CG    . MET B 1 205 ? -47.250  55.814  25.444  1.00 62.70  ?  205 MET B CG    1 
ATOM   5301  S  SD    . MET B 1 205 ? -46.266  57.102  26.223  1.00 83.79  ?  205 MET B SD    1 
ATOM   5302  C  CE    . MET B 1 205 ? -44.607  56.490  25.954  1.00 72.23  ?  205 MET B CE    1 
ATOM   5303  N  N     . GLU B 1 206 ? -48.505  51.228  26.509  1.00 82.03  ?  206 GLU B N     1 
ATOM   5304  C  CA    . GLU B 1 206 ? -48.167  49.804  26.599  1.00 79.26  ?  206 GLU B CA    1 
ATOM   5305  C  C     . GLU B 1 206 ? -48.493  49.095  25.260  1.00 77.44  ?  206 GLU B C     1 
ATOM   5306  O  O     . GLU B 1 206 ? -47.968  48.022  24.959  1.00 77.90  ?  206 GLU B O     1 
ATOM   5307  C  CB    . GLU B 1 206 ? -48.825  49.130  27.826  1.00 76.00  ?  206 GLU B CB    1 
ATOM   5308  N  N     . PHE B 1 207 ? -49.335  49.724  24.446  1.00 75.57  ?  207 PHE B N     1 
ATOM   5309  C  CA    . PHE B 1 207 ? -49.660  49.200  23.125  1.00 76.36  ?  207 PHE B CA    1 
ATOM   5310  C  C     . PHE B 1 207 ? -48.946  49.950  22.003  1.00 83.33  ?  207 PHE B C     1 
ATOM   5311  O  O     . PHE B 1 207 ? -48.558  49.352  20.994  1.00 88.70  ?  207 PHE B O     1 
ATOM   5312  C  CB    . PHE B 1 207 ? -51.156  49.305  22.882  1.00 73.82  ?  207 PHE B CB    1 
ATOM   5313  C  CG    . PHE B 1 207 ? -51.976  48.569  23.874  1.00 76.89  ?  207 PHE B CG    1 
ATOM   5314  C  CD1   . PHE B 1 207 ? -52.490  49.219  24.978  1.00 72.92  ?  207 PHE B CD1   1 
ATOM   5315  C  CD2   . PHE B 1 207 ? -52.242  47.220  23.699  1.00 76.72  ?  207 PHE B CD2   1 
ATOM   5316  C  CE1   . PHE B 1 207 ? -53.251  48.536  25.896  1.00 67.80  ?  207 PHE B CE1   1 
ATOM   5317  C  CE2   . PHE B 1 207 ? -53.007  46.536  24.602  1.00 74.61  ?  207 PHE B CE2   1 
ATOM   5318  C  CZ    . PHE B 1 207 ? -53.510  47.196  25.708  1.00 71.01  ?  207 PHE B CZ    1 
ATOM   5319  N  N     . LEU B 1 208 ? -48.802  51.264  22.186  1.00 80.86  ?  208 LEU B N     1 
ATOM   5320  C  CA    . LEU B 1 208 ? -48.259  52.166  21.172  1.00 75.97  ?  208 LEU B CA    1 
ATOM   5321  C  C     . LEU B 1 208 ? -47.110  52.953  21.788  1.00 76.03  ?  208 LEU B C     1 
ATOM   5322  O  O     . LEU B 1 208 ? -47.269  54.117  22.119  1.00 80.17  ?  208 LEU B O     1 
ATOM   5323  C  CB    . LEU B 1 208 ? -49.359  53.124  20.696  1.00 74.29  ?  208 LEU B CB    1 
ATOM   5324  C  CG    . LEU B 1 208 ? -49.370  53.751  19.292  1.00 70.16  ?  208 LEU B CG    1 
ATOM   5325  C  CD1   . LEU B 1 208 ? -48.885  55.185  19.339  1.00 62.91  ?  208 LEU B CD1   1 
ATOM   5326  C  CD2   . LEU B 1 208 ? -48.545  52.932  18.290  1.00 72.54  ?  208 LEU B CD2   1 
ATOM   5327  N  N     . PRO B 1 209 ? -45.941  52.308  21.935  1.00 71.68  ?  209 PRO B N     1 
ATOM   5328  C  CA    . PRO B 1 209 ? -44.755  52.758  22.678  1.00 68.53  ?  209 PRO B CA    1 
ATOM   5329  C  C     . PRO B 1 209 ? -43.956  53.884  22.047  1.00 73.51  ?  209 PRO B C     1 
ATOM   5330  O  O     . PRO B 1 209 ? -43.040  54.397  22.698  1.00 77.68  ?  209 PRO B O     1 
ATOM   5331  C  CB    . PRO B 1 209 ? -43.874  51.520  22.678  1.00 66.52  ?  209 PRO B CB    1 
ATOM   5332  C  CG    . PRO B 1 209 ? -44.241  50.812  21.436  1.00 66.82  ?  209 PRO B CG    1 
ATOM   5333  C  CD    . PRO B 1 209 ? -45.709  51.004  21.288  1.00 69.07  ?  209 PRO B CD    1 
ATOM   5334  N  N     . GLY B 1 210 ? -44.273  54.238  20.804  1.00 77.29  ?  210 GLY B N     1 
ATOM   5335  C  CA    . GLY B 1 210 ? -43.507  55.229  20.067  1.00 80.12  ?  210 GLY B CA    1 
ATOM   5336  C  C     . GLY B 1 210 ? -43.542  55.025  18.560  1.00 76.19  ?  210 GLY B C     1 
ATOM   5337  O  O     . GLY B 1 210 ? -44.130  54.063  18.060  1.00 80.63  ?  210 GLY B O     1 
ATOM   5338  N  N     . PRO B 1 211 ? -42.903  55.938  17.819  1.00 67.33  ?  211 PRO B N     1 
ATOM   5339  C  CA    . PRO B 1 211 ? -42.918  55.908  16.352  1.00 70.79  ?  211 PRO B CA    1 
ATOM   5340  C  C     . PRO B 1 211 ? -42.124  54.729  15.760  1.00 75.86  ?  211 PRO B C     1 
ATOM   5341  O  O     . PRO B 1 211 ? -41.214  54.216  16.420  1.00 81.07  ?  211 PRO B O     1 
ATOM   5342  C  CB    . PRO B 1 211 ? -42.265  57.249  15.975  1.00 65.04  ?  211 PRO B CB    1 
ATOM   5343  C  CG    . PRO B 1 211 ? -42.349  58.091  17.223  1.00 59.71  ?  211 PRO B CG    1 
ATOM   5344  C  CD    . PRO B 1 211 ? -42.198  57.120  18.336  1.00 62.64  ?  211 PRO B CD    1 
ATOM   5345  N  N     . ASP B 1 212 ? -42.479  54.310  14.540  1.00 70.97  ?  212 ASP B N     1 
ATOM   5346  C  CA    . ASP B 1 212 ? -41.761  53.254  13.822  1.00 73.07  ?  212 ASP B CA    1 
ATOM   5347  C  C     . ASP B 1 212 ? -41.396  53.746  12.437  1.00 76.49  ?  212 ASP B C     1 
ATOM   5348  O  O     . ASP B 1 212 ? -42.200  53.656  11.512  1.00 82.11  ?  212 ASP B O     1 
ATOM   5349  C  CB    . ASP B 1 212 ? -42.627  52.002  13.683  1.00 78.22  ?  212 ASP B CB    1 
ATOM   5350  C  CG    . ASP B 1 212 ? -41.810  50.753  13.368  1.00 77.72  ?  212 ASP B CG    1 
ATOM   5351  O  OD1   . ASP B 1 212 ? -40.611  50.717  13.738  1.00 77.03  ?  212 ASP B OD1   1 
ATOM   5352  O  OD2   . ASP B 1 212 ? -42.374  49.804  12.768  1.00 74.33  ?  212 ASP B OD2   1 
ATOM   5353  N  N     . PHE B 1 213 ? -40.182  54.263  12.297  1.00 76.18  ?  213 PHE B N     1 
ATOM   5354  C  CA    . PHE B 1 213 ? -39.732  54.850  11.040  1.00 70.93  ?  213 PHE B CA    1 
ATOM   5355  C  C     . PHE B 1 213 ? -39.464  53.791  9.982   1.00 72.98  ?  213 PHE B C     1 
ATOM   5356  O  O     . PHE B 1 213 ? -38.867  52.757  10.265  1.00 71.47  ?  213 PHE B O     1 
ATOM   5357  C  CB    . PHE B 1 213 ? -38.456  55.630  11.276  1.00 66.53  ?  213 PHE B CB    1 
ATOM   5358  C  CG    . PHE B 1 213 ? -38.631  56.842  12.143  1.00 63.44  ?  213 PHE B CG    1 
ATOM   5359  C  CD1   . PHE B 1 213 ? -39.574  57.804  11.827  1.00 59.01  ?  213 PHE B CD1   1 
ATOM   5360  C  CD2   . PHE B 1 213 ? -37.840  57.024  13.267  1.00 65.09  ?  213 PHE B CD2   1 
ATOM   5361  C  CE1   . PHE B 1 213 ? -39.727  58.933  12.622  1.00 59.11  ?  213 PHE B CE1   1 
ATOM   5362  C  CE2   . PHE B 1 213 ? -37.986  58.152  14.060  1.00 65.31  ?  213 PHE B CE2   1 
ATOM   5363  C  CZ    . PHE B 1 213 ? -38.934  59.107  13.737  1.00 62.53  ?  213 PHE B CZ    1 
ATOM   5364  N  N     . PRO B 1 214 ? -39.905  54.047  8.746   1.00 74.24  ?  214 PRO B N     1 
ATOM   5365  C  CA    . PRO B 1 214 ? -39.637  53.096  7.666   1.00 72.42  ?  214 PRO B CA    1 
ATOM   5366  C  C     . PRO B 1 214 ? -38.140  52.980  7.451   1.00 68.36  ?  214 PRO B C     1 
ATOM   5367  O  O     . PRO B 1 214 ? -37.656  51.955  6.975   1.00 68.02  ?  214 PRO B O     1 
ATOM   5368  C  CB    . PRO B 1 214 ? -40.304  53.749  6.460   1.00 70.14  ?  214 PRO B CB    1 
ATOM   5369  C  CG    . PRO B 1 214 ? -40.424  55.185  6.819   1.00 72.00  ?  214 PRO B CG    1 
ATOM   5370  C  CD    . PRO B 1 214 ? -40.654  55.223  8.277   1.00 74.13  ?  214 PRO B CD    1 
ATOM   5371  N  N     . THR B 1 215 ? -37.420  54.025  7.843   1.00 64.58  ?  215 THR B N     1 
ATOM   5372  C  CA    . THR B 1 215 ? -35.978  54.089  7.681   1.00 67.15  ?  215 THR B CA    1 
ATOM   5373  C  C     . THR B 1 215 ? -35.257  53.338  8.786   1.00 72.68  ?  215 THR B C     1 
ATOM   5374  O  O     . THR B 1 215 ? -34.031  53.203  8.749   1.00 85.47  ?  215 THR B O     1 
ATOM   5375  C  CB    . THR B 1 215 ? -35.513  55.533  7.731   1.00 75.34  ?  215 THR B CB    1 
ATOM   5376  O  OG1   . THR B 1 215 ? -36.049  56.143  8.909   1.00 83.00  ?  215 THR B OG1   1 
ATOM   5377  C  CG2   . THR B 1 215 ? -36.003  56.304  6.513   1.00 71.87  ?  215 THR B CG2   1 
ATOM   5378  N  N     . GLY B 1 216 ? -36.015  52.875  9.779   1.00 67.65  ?  216 GLY B N     1 
ATOM   5379  C  CA    . GLY B 1 216 ? -35.473  52.101  10.890  1.00 65.35  ?  216 GLY B CA    1 
ATOM   5380  C  C     . GLY B 1 216 ? -34.797  52.910  11.990  1.00 70.38  ?  216 GLY B C     1 
ATOM   5381  O  O     . GLY B 1 216 ? -35.213  54.021  12.316  1.00 73.60  ?  216 GLY B O     1 
ATOM   5382  N  N     . ALA B 1 217 ? -33.752  52.329  12.570  1.00 76.26  ?  217 ALA B N     1 
ATOM   5383  C  CA    . ALA B 1 217 ? -32.861  53.023  13.508  1.00 75.43  ?  217 ALA B CA    1 
ATOM   5384  C  C     . ALA B 1 217 ? -33.343  53.073  14.952  1.00 78.70  ?  217 ALA B C     1 
ATOM   5385  O  O     . ALA B 1 217 ? -34.381  52.514  15.305  1.00 87.50  ?  217 ALA B O     1 
ATOM   5386  C  CB    . ALA B 1 217 ? -32.536  54.424  13.023  1.00 68.59  ?  217 ALA B CB    1 
ATOM   5387  N  N     . ILE B 1 218 ? -32.573  53.780  15.769  1.00 73.45  ?  218 ILE B N     1 
ATOM   5388  C  CA    . ILE B 1 218 ? -32.772  53.830  17.204  1.00 73.37  ?  218 ILE B CA    1 
ATOM   5389  C  C     . ILE B 1 218 ? -33.410  55.138  17.667  1.00 75.84  ?  218 ILE B C     1 
ATOM   5390  O  O     . ILE B 1 218 ? -32.879  56.220  17.414  1.00 79.23  ?  218 ILE B O     1 
ATOM   5391  C  CB    . ILE B 1 218 ? -31.424  53.686  17.894  1.00 74.83  ?  218 ILE B CB    1 
ATOM   5392  C  CG1   . ILE B 1 218 ? -30.881  52.274  17.664  1.00 79.13  ?  218 ILE B CG1   1 
ATOM   5393  C  CG2   . ILE B 1 218 ? -31.544  54.017  19.358  1.00 69.63  ?  218 ILE B CG2   1 
ATOM   5394  C  CD1   . ILE B 1 218 ? -29.363  52.180  17.733  1.00 83.29  ?  218 ILE B CD1   1 
ATOM   5395  N  N     . ILE B 1 219 ? -34.543  55.030  18.357  1.00 77.37  ?  219 ILE B N     1 
ATOM   5396  C  CA    . ILE B 1 219 ? -35.228  56.189  18.927  1.00 78.24  ?  219 ILE B CA    1 
ATOM   5397  C  C     . ILE B 1 219 ? -35.043  56.260  20.436  1.00 84.01  ?  219 ILE B C     1 
ATOM   5398  O  O     . ILE B 1 219 ? -35.241  55.267  21.133  1.00 88.78  ?  219 ILE B O     1 
ATOM   5399  C  CB    . ILE B 1 219 ? -36.725  56.117  18.693  1.00 75.24  ?  219 ILE B CB    1 
ATOM   5400  C  CG1   . ILE B 1 219 ? -37.039  55.913  17.206  1.00 74.05  ?  219 ILE B CG1   1 
ATOM   5401  C  CG2   . ILE B 1 219 ? -37.384  57.365  19.239  1.00 76.48  ?  219 ILE B CG2   1 
ATOM   5402  C  CD1   . ILE B 1 219 ? -38.521  56.081  16.874  1.00 71.42  ?  219 ILE B CD1   1 
ATOM   5403  N  N     . GLN B 1 220 ? -34.696  57.443  20.940  1.00 83.33  ?  220 GLN B N     1 
ATOM   5404  C  CA    . GLN B 1 220 ? -34.380  57.620  22.354  1.00 88.40  ?  220 GLN B CA    1 
ATOM   5405  C  C     . GLN B 1 220 ? -35.172  58.746  23.014  1.00 92.09  ?  220 GLN B C     1 
ATOM   5406  O  O     . GLN B 1 220 ? -35.102  59.892  22.574  1.00 92.57  ?  220 GLN B O     1 
ATOM   5407  C  CB    . GLN B 1 220 ? -32.891  57.915  22.522  1.00 95.78  ?  220 GLN B CB    1 
ATOM   5408  C  CG    . GLN B 1 220 ? -31.991  56.705  22.367  1.00 105.39 ?  220 GLN B CG    1 
ATOM   5409  C  CD    . GLN B 1 220 ? -30.507  57.034  22.550  1.00 114.25 ?  220 GLN B CD    1 
ATOM   5410  O  OE1   . GLN B 1 220 ? -30.080  58.177  22.351  1.00 114.83 ?  220 GLN B OE1   1 
ATOM   5411  N  NE2   . GLN B 1 220 ? -29.716  56.024  22.926  1.00 118.99 ?  220 GLN B NE2   1 
ATOM   5412  N  N     . GLY B 1 221 ? -35.903  58.422  24.082  1.00 95.13  ?  221 GLY B N     1 
ATOM   5413  C  CA    . GLY B 1 221 ? -36.564  59.429  24.898  1.00 96.48  ?  221 GLY B CA    1 
ATOM   5414  C  C     . GLY B 1 221 ? -37.998  59.106  25.289  1.00 97.03  ?  221 GLY B C     1 
ATOM   5415  O  O     . GLY B 1 221 ? -38.918  59.845  24.920  1.00 90.94  ?  221 GLY B O     1 
ATOM   5416  N  N     . ARG B 1 222 ? -38.201  58.021  26.040  1.00 99.41  ?  222 ARG B N     1 
ATOM   5417  C  CA    . ARG B 1 222 ? -39.545  57.673  26.509  1.00 90.02  ?  222 ARG B CA    1 
ATOM   5418  C  C     . ARG B 1 222 ? -40.239  58.914  27.076  1.00 84.28  ?  222 ARG B C     1 
ATOM   5419  O  O     . ARG B 1 222 ? -41.398  59.178  26.753  1.00 76.34  ?  222 ARG B O     1 
ATOM   5420  C  CB    . ARG B 1 222 ? -39.520  56.531  27.543  1.00 92.06  ?  222 ARG B CB    1 
ATOM   5421  C  CG    . ARG B 1 222 ? -40.919  55.985  27.954  1.00 71.39  ?  222 ARG B CG    1 
ATOM   5422  N  N     . ASP B 1 223 ? -39.521  59.682  27.898  1.00 89.88  ?  223 ASP B N     1 
ATOM   5423  C  CA    . ASP B 1 223 ? -40.065  60.918  28.479  1.00 90.15  ?  223 ASP B CA    1 
ATOM   5424  C  C     . ASP B 1 223 ? -40.683  61.863  27.413  1.00 89.30  ?  223 ASP B C     1 
ATOM   5425  O  O     . ASP B 1 223 ? -41.885  62.160  27.457  1.00 80.24  ?  223 ASP B O     1 
ATOM   5426  C  CB    . ASP B 1 223 ? -39.011  61.643  29.338  1.00 86.86  ?  223 ASP B CB    1 
ATOM   5427  N  N     . GLU B 1 224 ? -39.884  62.323  26.451  1.00 90.31  ?  224 GLU B N     1 
ATOM   5428  C  CA    . GLU B 1 224 ? -40.416  63.234  25.435  1.00 83.94  ?  224 GLU B CA    1 
ATOM   5429  C  C     . GLU B 1 224 ? -41.536  62.593  24.579  1.00 80.80  ?  224 GLU B C     1 
ATOM   5430  O  O     . GLU B 1 224 ? -42.483  63.277  24.137  1.00 77.45  ?  224 GLU B O     1 
ATOM   5431  C  CB    . GLU B 1 224 ? -39.296  63.838  24.575  1.00 79.94  ?  224 GLU B CB    1 
ATOM   5432  C  CG    . GLU B 1 224 ? -38.400  64.826  25.319  1.00 91.70  ?  224 GLU B CG    1 
ATOM   5433  C  CD    . GLU B 1 224 ? -39.031  66.214  25.558  1.00 99.17  ?  224 GLU B CD    1 
ATOM   5434  O  OE1   . GLU B 1 224 ? -39.593  66.801  24.604  1.00 101.05 ?  224 GLU B OE1   1 
ATOM   5435  O  OE2   . GLU B 1 224 ? -38.939  66.727  26.704  1.00 101.46 ?  224 GLU B OE2   1 
ATOM   5436  N  N     . ILE B 1 225 ? -41.442  61.285  24.357  1.00 76.60  ?  225 ILE B N     1 
ATOM   5437  C  CA    . ILE B 1 225 ? -42.491  60.597  23.618  1.00 71.93  ?  225 ILE B CA    1 
ATOM   5438  C  C     . ILE B 1 225 ? -43.829  60.750  24.346  1.00 75.59  ?  225 ILE B C     1 
ATOM   5439  O  O     . ILE B 1 225 ? -44.852  61.050  23.716  1.00 74.76  ?  225 ILE B O     1 
ATOM   5440  C  CB    . ILE B 1 225 ? -42.151  59.115  23.387  1.00 68.96  ?  225 ILE B CB    1 
ATOM   5441  C  CG1   . ILE B 1 225 ? -40.930  58.997  22.485  1.00 65.66  ?  225 ILE B CG1   1 
ATOM   5442  C  CG2   . ILE B 1 225 ? -43.308  58.368  22.752  1.00 60.54  ?  225 ILE B CG2   1 
ATOM   5443  C  CD1   . ILE B 1 225 ? -40.600  57.566  22.173  1.00 64.18  ?  225 ILE B CD1   1 
ATOM   5444  N  N     . LYS B 1 226 ? -43.827  60.557  25.668  1.00 73.90  ?  226 LYS B N     1 
ATOM   5445  C  CA    . LYS B 1 226 ? -45.041  60.814  26.445  1.00 70.03  ?  226 LYS B CA    1 
ATOM   5446  C  C     . LYS B 1 226 ? -45.469  62.276  26.257  1.00 68.84  ?  226 LYS B C     1 
ATOM   5447  O  O     . LYS B 1 226 ? -46.596  62.543  25.840  1.00 68.71  ?  226 LYS B O     1 
ATOM   5448  C  CB    . LYS B 1 226 ? -44.886  60.451  27.935  1.00 68.07  ?  226 LYS B CB    1 
ATOM   5449  N  N     . LYS B 1 227 ? -44.566  63.215  26.537  1.00 67.85  ?  227 LYS B N     1 
ATOM   5450  C  CA    . LYS B 1 227 ? -44.878  64.634  26.372  1.00 70.39  ?  227 LYS B CA    1 
ATOM   5451  C  C     . LYS B 1 227 ? -45.524  64.873  25.006  1.00 75.20  ?  227 LYS B C     1 
ATOM   5452  O  O     . LYS B 1 227 ? -46.503  65.621  24.894  1.00 74.60  ?  227 LYS B O     1 
ATOM   5453  C  CB    . LYS B 1 227 ? -43.629  65.514  26.571  1.00 74.79  ?  227 LYS B CB    1 
ATOM   5454  C  CG    . LYS B 1 227 ? -43.861  67.041  26.479  1.00 78.05  ?  227 LYS B CG    1 
ATOM   5455  C  CD    . LYS B 1 227 ? -42.577  67.842  26.806  1.00 70.11  ?  227 LYS B CD    1 
ATOM   5456  N  N     . ALA B 1 228 ? -45.000  64.218  23.973  1.00 77.26  ?  228 ALA B N     1 
ATOM   5457  C  CA    . ALA B 1 228 ? -45.550  64.403  22.628  1.00 70.96  ?  228 ALA B CA    1 
ATOM   5458  C  C     . ALA B 1 228 ? -46.933  63.803  22.526  1.00 73.58  ?  228 ALA B C     1 
ATOM   5459  O  O     . ALA B 1 228 ? -47.859  64.443  22.047  1.00 79.25  ?  228 ALA B O     1 
ATOM   5460  C  CB    . ALA B 1 228 ? -44.646  63.801  21.584  1.00 65.80  ?  228 ALA B CB    1 
ATOM   5461  N  N     . TYR B 1 229 ? -47.070  62.566  22.980  1.00 71.71  ?  229 TYR B N     1 
ATOM   5462  C  CA    . TYR B 1 229 ? -48.345  61.877  22.880  1.00 70.31  ?  229 TYR B CA    1 
ATOM   5463  C  C     . TYR B 1 229 ? -49.408  62.561  23.732  1.00 74.39  ?  229 TYR B C     1 
ATOM   5464  O  O     . TYR B 1 229 ? -50.600  62.276  23.594  1.00 73.50  ?  229 TYR B O     1 
ATOM   5465  C  CB    . TYR B 1 229 ? -48.196  60.412  23.275  1.00 71.17  ?  229 TYR B CB    1 
ATOM   5466  C  CG    . TYR B 1 229 ? -47.591  59.533  22.199  1.00 74.15  ?  229 TYR B CG    1 
ATOM   5467  C  CD1   . TYR B 1 229 ? -47.160  60.063  20.991  1.00 72.51  ?  229 TYR B CD1   1 
ATOM   5468  C  CD2   . TYR B 1 229 ? -47.472  58.168  22.387  1.00 78.30  ?  229 TYR B CD2   1 
ATOM   5469  C  CE1   . TYR B 1 229 ? -46.612  59.250  20.006  1.00 74.84  ?  229 TYR B CE1   1 
ATOM   5470  C  CE2   . TYR B 1 229 ? -46.934  57.350  21.415  1.00 80.29  ?  229 TYR B CE2   1 
ATOM   5471  C  CZ    . TYR B 1 229 ? -46.505  57.889  20.223  1.00 76.53  ?  229 TYR B CZ    1 
ATOM   5472  O  OH    . TYR B 1 229 ? -45.971  57.056  19.257  1.00 75.49  ?  229 TYR B OH    1 
ATOM   5473  N  N     . GLU B 1 230 ? -48.963  63.469  24.598  1.00 80.17  ?  230 GLU B N     1 
ATOM   5474  C  CA    . GLU B 1 230 ? -49.856  64.199  25.495  1.00 87.76  ?  230 GLU B CA    1 
ATOM   5475  C  C     . GLU B 1 230 ? -50.190  65.590  24.960  1.00 86.98  ?  230 GLU B C     1 
ATOM   5476  O  O     . GLU B 1 230 ? -51.343  66.007  24.978  1.00 90.62  ?  230 GLU B O     1 
ATOM   5477  C  CB    . GLU B 1 230 ? -49.254  64.315  26.902  1.00 100.55 ?  230 GLU B CB    1 
ATOM   5478  C  CG    . GLU B 1 230 ? -49.665  63.214  27.892  1.00 114.94 ?  230 GLU B CG    1 
ATOM   5479  C  CD    . GLU B 1 230 ? -49.152  63.472  29.323  1.00 129.16 ?  230 GLU B CD    1 
ATOM   5480  O  OE1   . GLU B 1 230 ? -49.415  64.574  29.860  1.00 135.61 ?  230 GLU B OE1   1 
ATOM   5481  O  OE2   . GLU B 1 230 ? -48.482  62.580  29.907  1.00 131.43 ?  230 GLU B OE2   1 
ATOM   5482  N  N     . THR B 1 231 ? -49.192  66.313  24.476  1.00 83.54  ?  231 THR B N     1 
ATOM   5483  C  CA    . THR B 1 231 ? -49.438  67.688  24.060  1.00 84.32  ?  231 THR B CA    1 
ATOM   5484  C  C     . THR B 1 231 ? -49.370  67.915  22.553  1.00 85.93  ?  231 THR B C     1 
ATOM   5485  O  O     . THR B 1 231 ? -49.727  68.986  22.071  1.00 84.37  ?  231 THR B O     1 
ATOM   5486  C  CB    . THR B 1 231 ? -48.469  68.651  24.763  1.00 82.01  ?  231 THR B CB    1 
ATOM   5487  O  OG1   . THR B 1 231 ? -47.151  68.540  24.196  1.00 79.81  ?  231 THR B OG1   1 
ATOM   5488  C  CG2   . THR B 1 231 ? -48.417  68.307  26.220  1.00 86.58  ?  231 THR B CG2   1 
ATOM   5489  N  N     . GLY B 1 232 ? -48.910  66.913  21.812  1.00 83.77  ?  232 GLY B N     1 
ATOM   5490  C  CA    . GLY B 1 232 ? -48.709  67.069  20.382  1.00 82.87  ?  232 GLY B CA    1 
ATOM   5491  C  C     . GLY B 1 232 ? -47.302  67.524  20.024  1.00 85.92  ?  232 GLY B C     1 
ATOM   5492  O  O     . GLY B 1 232 ? -46.875  67.371  18.876  1.00 93.30  ?  232 GLY B O     1 
ATOM   5493  N  N     . LYS B 1 233 ? -46.582  68.091  20.993  1.00 75.15  ?  233 LYS B N     1 
ATOM   5494  C  CA    . LYS B 1 233 ? -45.178  68.454  20.791  1.00 76.30  ?  233 LYS B CA    1 
ATOM   5495  C  C     . LYS B 1 233 ? -44.238  67.673  21.719  1.00 84.80  ?  233 LYS B C     1 
ATOM   5496  O  O     . LYS B 1 233 ? -44.581  67.365  22.863  1.00 93.74  ?  233 LYS B O     1 
ATOM   5497  C  CB    . LYS B 1 233 ? -44.934  69.956  21.005  1.00 80.79  ?  233 LYS B CB    1 
ATOM   5498  C  CG    . LYS B 1 233 ? -45.504  70.929  19.972  1.00 59.51  ?  233 LYS B CG    1 
ATOM   5499  C  CD    . LYS B 1 233 ? -44.908  72.336  20.240  1.00 78.54  ?  233 LYS B CD    1 
ATOM   5500  C  CE    . LYS B 1 233 ? -45.691  73.490  19.593  1.00 80.17  ?  233 LYS B CE    1 
ATOM   5501  N  NZ    . LYS B 1 233 ? -45.268  73.856  18.191  1.00 78.90  ?  233 LYS B NZ    1 
ATOM   5502  N  N     . GLY B 1 234 ? -43.040  67.390  21.216  1.00 82.41  ?  234 GLY B N     1 
ATOM   5503  C  CA    . GLY B 1 234 ? -41.999  66.700  21.958  1.00 79.39  ?  234 GLY B CA    1 
ATOM   5504  C  C     . GLY B 1 234 ? -40.738  66.615  21.108  1.00 76.69  ?  234 GLY B C     1 
ATOM   5505  O  O     . GLY B 1 234 ? -40.798  66.772  19.888  1.00 76.61  ?  234 GLY B O     1 
ATOM   5506  N  N     . ARG B 1 235 ? -39.601  66.375  21.756  1.00 73.76  ?  235 ARG B N     1 
ATOM   5507  C  CA    . ARG B 1 235 ? -38.296  66.340  21.100  1.00 77.08  ?  235 ARG B CA    1 
ATOM   5508  C  C     . ARG B 1 235 ? -37.677  65.007  21.470  1.00 79.76  ?  235 ARG B C     1 
ATOM   5509  O  O     . ARG B 1 235 ? -37.304  64.783  22.621  1.00 91.38  ?  235 ARG B O     1 
ATOM   5510  C  CB    . ARG B 1 235 ? -37.411  67.510  21.590  1.00 88.99  ?  235 ARG B CB    1 
ATOM   5511  C  CG    . ARG B 1 235 ? -36.054  67.709  20.894  1.00 66.00  ?  235 ARG B CG    1 
ATOM   5512  N  N     . VAL B 1 236 ? -37.598  64.109  20.501  1.00 73.49  ?  236 VAL B N     1 
ATOM   5513  C  CA    . VAL B 1 236 ? -36.959  62.817  20.707  1.00 75.29  ?  236 VAL B CA    1 
ATOM   5514  C  C     . VAL B 1 236 ? -35.627  62.771  19.933  1.00 76.15  ?  236 VAL B C     1 
ATOM   5515  O  O     . VAL B 1 236 ? -35.353  63.646  19.113  1.00 85.13  ?  236 VAL B O     1 
ATOM   5516  C  CB    . VAL B 1 236 ? -37.890  61.684  20.247  1.00 73.29  ?  236 VAL B CB    1 
ATOM   5517  C  CG1   . VAL B 1 236 ? -37.877  61.577  18.731  1.00 70.81  ?  236 VAL B CG1   1 
ATOM   5518  C  CG2   . VAL B 1 236 ? -37.478  60.374  20.864  1.00 78.32  ?  236 VAL B CG2   1 
ATOM   5519  N  N     . VAL B 1 237 ? -34.791  61.773  20.198  1.00 68.98  ?  237 VAL B N     1 
ATOM   5520  C  CA    . VAL B 1 237 ? -33.518  61.648  19.490  1.00 69.36  ?  237 VAL B CA    1 
ATOM   5521  C  C     . VAL B 1 237 ? -33.501  60.417  18.603  1.00 74.01  ?  237 VAL B C     1 
ATOM   5522  O  O     . VAL B 1 237 ? -33.883  59.330  19.042  1.00 82.42  ?  237 VAL B O     1 
ATOM   5523  C  CB    . VAL B 1 237 ? -32.319  61.530  20.461  1.00 68.39  ?  237 VAL B CB    1 
ATOM   5524  C  CG1   . VAL B 1 237 ? -31.098  61.024  19.725  1.00 69.02  ?  237 VAL B CG1   1 
ATOM   5525  C  CG2   . VAL B 1 237 ? -32.022  62.857  21.113  1.00 69.87  ?  237 VAL B CG2   1 
ATOM   5526  N  N     . VAL B 1 238 ? -33.057  60.578  17.359  1.00 72.89  ?  238 VAL B N     1 
ATOM   5527  C  CA    . VAL B 1 238 ? -32.872  59.425  16.482  1.00 74.56  ?  238 VAL B CA    1 
ATOM   5528  C  C     . VAL B 1 238 ? -31.409  59.170  16.144  1.00 80.35  ?  238 VAL B C     1 
ATOM   5529  O  O     . VAL B 1 238 ? -30.721  60.051  15.616  1.00 80.92  ?  238 VAL B O     1 
ATOM   5530  C  CB    . VAL B 1 238 ? -33.637  59.551  15.171  1.00 73.50  ?  238 VAL B CB    1 
ATOM   5531  C  CG1   . VAL B 1 238 ? -33.352  58.330  14.334  1.00 76.32  ?  238 VAL B CG1   1 
ATOM   5532  C  CG2   . VAL B 1 238 ? -35.137  59.684  15.417  1.00 58.36  ?  238 VAL B CG2   1 
ATOM   5533  N  N     . ARG B 1 239 ? -30.946  57.957  16.442  1.00 73.48  ?  239 ARG B N     1 
ATOM   5534  C  CA    . ARG B 1 239 ? -29.548  57.578  16.226  1.00 76.95  ?  239 ARG B CA    1 
ATOM   5535  C  C     . ARG B 1 239 ? -29.394  56.397  15.255  1.00 76.44  ?  239 ARG B C     1 
ATOM   5536  O  O     . ARG B 1 239 ? -30.180  55.446  15.273  1.00 78.77  ?  239 ARG B O     1 
ATOM   5537  C  CB    . ARG B 1 239 ? -28.885  57.255  17.570  1.00 88.07  ?  239 ARG B CB    1 
ATOM   5538  C  CG    . ARG B 1 239 ? -27.515  56.586  17.484  1.00 97.06  ?  239 ARG B CG    1 
ATOM   5539  C  CD    . ARG B 1 239 ? -26.988  56.235  18.874  1.00 107.53 ?  239 ARG B CD    1 
ATOM   5540  N  NE    . ARG B 1 239 ? -26.667  57.431  19.645  1.00 114.68 ?  239 ARG B NE    1 
ATOM   5541  C  CZ    . ARG B 1 239 ? -25.586  57.559  20.409  1.00 123.00 ?  239 ARG B CZ    1 
ATOM   5542  N  NH1   . ARG B 1 239 ? -24.723  56.556  20.510  1.00 125.52 ?  239 ARG B NH1   1 
ATOM   5543  N  NH2   . ARG B 1 239 ? -25.368  58.688  21.074  1.00 127.63 ?  239 ARG B NH2   1 
ATOM   5544  N  N     . SER B 1 240 ? -28.368  56.466  14.415  1.00 71.14  ?  240 SER B N     1 
ATOM   5545  C  CA    . SER B 1 240 ? -28.119  55.441  13.407  1.00 70.16  ?  240 SER B CA    1 
ATOM   5546  C  C     . SER B 1 240 ? -27.720  54.086  13.990  1.00 72.31  ?  240 SER B C     1 
ATOM   5547  O  O     . SER B 1 240 ? -27.007  54.011  14.998  1.00 83.34  ?  240 SER B O     1 
ATOM   5548  C  CB    . SER B 1 240 ? -27.046  55.921  12.423  1.00 73.55  ?  240 SER B CB    1 
ATOM   5549  O  OG    . SER B 1 240 ? -27.515  56.996  11.623  1.00 76.49  ?  240 SER B OG    1 
ATOM   5550  N  N     . LYS B 1 241 ? -28.174  53.015  13.341  1.00 66.84  ?  241 LYS B N     1 
ATOM   5551  C  CA    . LYS B 1 241 ? -27.793  51.654  13.726  1.00 71.86  ?  241 LYS B CA    1 
ATOM   5552  C  C     . LYS B 1 241 ? -26.392  51.368  13.206  1.00 81.79  ?  241 LYS B C     1 
ATOM   5553  O  O     . LYS B 1 241 ? -26.111  51.605  12.025  1.00 80.49  ?  241 LYS B O     1 
ATOM   5554  C  CB    . LYS B 1 241 ? -28.797  50.635  13.182  1.00 73.21  ?  241 LYS B CB    1 
ATOM   5555  C  CG    . LYS B 1 241 ? -28.432  49.175  13.414  1.00 83.41  ?  241 LYS B CG    1 
ATOM   5556  C  CD    . LYS B 1 241 ? -29.598  48.412  14.045  1.00 94.63  ?  241 LYS B CD    1 
ATOM   5557  C  CE    . LYS B 1 241 ? -29.501  46.910  13.804  1.00 98.60  ?  241 LYS B CE    1 
ATOM   5558  N  NZ    . LYS B 1 241 ? -29.897  46.562  12.404  1.00 97.93  ?  241 LYS B NZ    1 
ATOM   5559  N  N     . THR B 1 242 ? -25.513  50.879  14.086  1.00 89.77  ?  242 THR B N     1 
ATOM   5560  C  CA    . THR B 1 242 ? -24.090  50.758  13.751  1.00 90.82  ?  242 THR B CA    1 
ATOM   5561  C  C     . THR B 1 242 ? -23.366  49.535  14.311  1.00 97.97  ?  242 THR B C     1 
ATOM   5562  O  O     . THR B 1 242 ? -23.212  49.391  15.521  1.00 111.71 ?  242 THR B O     1 
ATOM   5563  C  CB    . THR B 1 242 ? -23.276  52.032  14.152  1.00 84.02  ?  242 THR B CB    1 
ATOM   5564  O  OG1   . THR B 1 242 ? -23.484  52.347  15.540  1.00 80.59  ?  242 THR B OG1   1 
ATOM   5565  C  CG2   . THR B 1 242 ? -23.660  53.225  13.273  1.00 81.29  ?  242 THR B CG2   1 
ATOM   5566  N  N     . GLU B 1 243 ? -22.893  48.686  13.403  1.00 94.29  ?  243 GLU B N     1 
ATOM   5567  C  CA    . GLU B 1 243 ? -22.040  47.545  13.729  1.00 93.74  ?  243 GLU B CA    1 
ATOM   5568  C  C     . GLU B 1 243 ? -20.548  47.975  13.713  1.00 83.88  ?  243 GLU B C     1 
ATOM   5569  O  O     . GLU B 1 243 ? -20.219  49.054  13.211  1.00 82.30  ?  243 GLU B O     1 
ATOM   5570  C  CB    . GLU B 1 243 ? -22.315  46.396  12.733  1.00 91.78  ?  243 GLU B CB    1 
ATOM   5571  N  N     . ILE B 1 244 ? -19.655  47.149  14.268  1.00 88.20  ?  244 ILE B N     1 
ATOM   5572  C  CA    . ILE B 1 244 ? -18.207  47.391  14.175  1.00 87.11  ?  244 ILE B CA    1 
ATOM   5573  C  C     . ILE B 1 244 ? -17.440  46.169  13.668  1.00 93.51  ?  244 ILE B C     1 
ATOM   5574  O  O     . ILE B 1 244 ? -17.285  45.192  14.402  1.00 103.41 ?  244 ILE B O     1 
ATOM   5575  C  CB    . ILE B 1 244 ? -17.591  47.785  15.541  1.00 86.24  ?  244 ILE B CB    1 
ATOM   5576  C  CG1   . ILE B 1 244 ? -18.254  49.045  16.100  1.00 81.42  ?  244 ILE B CG1   1 
ATOM   5577  C  CG2   . ILE B 1 244 ? -16.085  47.978  15.418  1.00 68.30  ?  244 ILE B CG2   1 
ATOM   5578  C  CD1   . ILE B 1 244 ? -18.049  50.275  15.254  1.00 78.06  ?  244 ILE B CD1   1 
ATOM   5579  N  N     . GLU B 1 245 ? -16.934  46.226  12.437  1.00 91.85  ?  245 GLU B N     1 
ATOM   5580  C  CA    . GLU B 1 245 ? -16.191  45.093  11.865  1.00 101.62 ?  245 GLU B CA    1 
ATOM   5581  C  C     . GLU B 1 245 ? -14.675  45.239  12.001  1.00 100.01 ?  245 GLU B C     1 
ATOM   5582  O  O     . GLU B 1 245 ? -14.127  46.323  11.788  1.00 98.32  ?  245 GLU B O     1 
ATOM   5583  C  CB    . GLU B 1 245 ? -16.552  44.890  10.391  1.00 108.67 ?  245 GLU B CB    1 
ATOM   5584  C  CG    . GLU B 1 245 ? -18.028  44.632  10.133  1.00 115.61 ?  245 GLU B CG    1 
ATOM   5585  C  CD    . GLU B 1 245 ? -18.392  44.706  8.651   1.00 119.23 ?  245 GLU B CD    1 
ATOM   5586  O  OE1   . GLU B 1 245 ? -17.637  45.332  7.873   1.00 120.70 ?  245 GLU B OE1   1 
ATOM   5587  O  OE2   . GLU B 1 245 ? -19.438  44.138  8.264   1.00 119.28 ?  245 GLU B OE2   1 
ATOM   5588  N  N     . LYS B 1 246 ? -14.007  44.142  12.359  1.00 100.74 ?  246 LYS B N     1 
ATOM   5589  C  CA    . LYS B 1 246 ? -12.542  44.104  12.396  1.00 103.36 ?  246 LYS B CA    1 
ATOM   5590  C  C     . LYS B 1 246 ? -12.029  43.873  10.978  1.00 102.76 ?  246 LYS B C     1 
ATOM   5591  O  O     . LYS B 1 246 ? -12.639  43.135  10.209  1.00 103.49 ?  246 LYS B O     1 
ATOM   5592  C  CB    . LYS B 1 246 ? -12.022  43.007  13.346  1.00 88.94  ?  246 LYS B CB    1 
ATOM   5593  N  N     . LEU B 1 247 ? -10.925  44.523  10.626  1.00 103.79 ?  247 LEU B N     1 
ATOM   5594  C  CA    . LEU B 1 247 ? -10.292  44.313  9.327   1.00 105.04 ?  247 LEU B CA    1 
ATOM   5595  C  C     . LEU B 1 247 ? -8.877   43.769  9.525   1.00 111.17 ?  247 LEU B C     1 
ATOM   5596  O  O     . LEU B 1 247 ? -8.285   43.927  10.596  1.00 109.69 ?  247 LEU B O     1 
ATOM   5597  C  CB    . LEU B 1 247 ? -10.237  45.619  8.533   1.00 101.59 ?  247 LEU B CB    1 
ATOM   5598  C  CG    . LEU B 1 247 ? -11.471  46.528  8.554   1.00 99.50  ?  247 LEU B CG    1 
ATOM   5599  C  CD1   . LEU B 1 247 ? -11.194  47.842  7.816   1.00 97.87  ?  247 LEU B CD1   1 
ATOM   5600  C  CD2   . LEU B 1 247 ? -12.701  45.831  7.977   1.00 100.28 ?  247 LEU B CD2   1 
ATOM   5601  N  N     . LYS B 1 248 ? -8.334   43.127  8.498   1.00 118.31 ?  248 LYS B N     1 
ATOM   5602  C  CA    . LYS B 1 248 ? -6.966   42.631  8.578   1.00 123.44 ?  248 LYS B CA    1 
ATOM   5603  C  C     . LYS B 1 248 ? -6.037   43.808  8.856   1.00 123.58 ?  248 LYS B C     1 
ATOM   5604  O  O     . LYS B 1 248 ? -6.311   44.935  8.438   1.00 118.13 ?  248 LYS B O     1 
ATOM   5605  C  CB    . LYS B 1 248 ? -6.564   41.907  7.287   1.00 123.61 ?  248 LYS B CB    1 
ATOM   5606  N  N     . GLY B 1 249 ? -4.954   43.554  9.581   1.00 129.81 ?  249 GLY B N     1 
ATOM   5607  C  CA    . GLY B 1 249 ? -3.973   44.588  9.848   1.00 132.59 ?  249 GLY B CA    1 
ATOM   5608  C  C     . GLY B 1 249 ? -4.301   45.461  11.045  1.00 133.55 ?  249 GLY B C     1 
ATOM   5609  O  O     . GLY B 1 249 ? -3.793   46.577  11.163  1.00 134.19 ?  249 GLY B O     1 
ATOM   5610  N  N     . GLY B 1 250 ? -5.150   44.957  11.936  1.00 134.58 ?  250 GLY B N     1 
ATOM   5611  C  CA    . GLY B 1 250 ? -5.454   45.654  13.174  1.00 133.62 ?  250 GLY B CA    1 
ATOM   5612  C  C     . GLY B 1 250 ? -6.266   46.918  12.977  1.00 129.11 ?  250 GLY B C     1 
ATOM   5613  O  O     . GLY B 1 250 ? -6.327   47.774  13.861  1.00 133.41 ?  250 GLY B O     1 
ATOM   5614  N  N     . LYS B 1 251 ? -6.891   47.040  11.811  1.00 119.48 ?  251 LYS B N     1 
ATOM   5615  C  CA    . LYS B 1 251 ? -7.749   48.179  11.522  1.00 106.58 ?  251 LYS B CA    1 
ATOM   5616  C  C     . LYS B 1 251 ? -9.226   47.796  11.744  1.00 106.81 ?  251 LYS B C     1 
ATOM   5617  O  O     . LYS B 1 251 ? -9.628   46.662  11.492  1.00 110.96 ?  251 LYS B O     1 
ATOM   5618  C  CB    . LYS B 1 251 ? -7.487   48.698  10.099  1.00 97.96  ?  251 LYS B CB    1 
ATOM   5619  N  N     . GLU B 1 252 ? -10.019  48.737  12.251  1.00 102.70 ?  252 GLU B N     1 
ATOM   5620  C  CA    . GLU B 1 252 ? -11.445  48.521  12.503  1.00 96.41  ?  252 GLU B CA    1 
ATOM   5621  C  C     . GLU B 1 252 ? -12.266  49.348  11.537  1.00 93.94  ?  252 GLU B C     1 
ATOM   5622  O  O     . GLU B 1 252 ? -11.732  50.227  10.861  1.00 93.54  ?  252 GLU B O     1 
ATOM   5623  C  CB    . GLU B 1 252 ? -11.822  48.927  13.928  1.00 97.82  ?  252 GLU B CB    1 
ATOM   5624  C  CG    . GLU B 1 252 ? -11.044  48.219  15.016  1.00 111.66 ?  252 GLU B CG    1 
ATOM   5625  C  CD    . GLU B 1 252 ? -11.581  48.529  16.401  1.00 113.82 ?  252 GLU B CD    1 
ATOM   5626  O  OE1   . GLU B 1 252 ? -12.597  49.256  16.496  1.00 106.20 ?  252 GLU B OE1   1 
ATOM   5627  O  OE2   . GLU B 1 252 ? -10.986  48.041  17.391  1.00 119.81 ?  252 GLU B OE2   1 
ATOM   5628  N  N     . GLN B 1 253 ? -13.570  49.089  11.498  1.00 92.89  ?  253 GLN B N     1 
ATOM   5629  C  CA    . GLN B 1 253 ? -14.443  49.718  10.513  1.00 86.55  ?  253 GLN B CA    1 
ATOM   5630  C  C     . GLN B 1 253 ? -15.815  49.971  11.108  1.00 84.60  ?  253 GLN B C     1 
ATOM   5631  O  O     . GLN B 1 253 ? -16.485  49.032  11.540  1.00 90.28  ?  253 GLN B O     1 
ATOM   5632  C  CB    . GLN B 1 253 ? -14.578  48.796  9.300   1.00 90.20  ?  253 GLN B CB    1 
ATOM   5633  C  CG    . GLN B 1 253 ? -15.033  49.491  8.046   1.00 95.24  ?  253 GLN B CG    1 
ATOM   5634  C  CD    . GLN B 1 253 ? -15.128  48.554  6.859   1.00 101.57 ?  253 GLN B CD    1 
ATOM   5635  O  OE1   . GLN B 1 253 ? -14.420  48.721  5.868   1.00 104.76 ?  253 GLN B OE1   1 
ATOM   5636  N  NE2   . GLN B 1 253 ? -16.015  47.570  6.949   1.00 103.55 ?  253 GLN B NE2   1 
ATOM   5637  N  N     . ILE B 1 254 ? -16.239  51.231  11.148  1.00 80.51  ?  254 ILE B N     1 
ATOM   5638  C  CA    . ILE B 1 254 ? -17.606  51.532  11.584  1.00 84.53  ?  254 ILE B CA    1 
ATOM   5639  C  C     . ILE B 1 254 ? -18.581  51.384  10.416  1.00 85.75  ?  254 ILE B C     1 
ATOM   5640  O  O     . ILE B 1 254 ? -18.448  52.052  9.390   1.00 91.09  ?  254 ILE B O     1 
ATOM   5641  C  CB    . ILE B 1 254 ? -17.762  52.959  12.128  1.00 83.58  ?  254 ILE B CB    1 
ATOM   5642  C  CG1   . ILE B 1 254 ? -16.913  53.172  13.371  1.00 90.32  ?  254 ILE B CG1   1 
ATOM   5643  C  CG2   . ILE B 1 254 ? -19.205  53.216  12.487  1.00 82.31  ?  254 ILE B CG2   1 
ATOM   5644  C  CD1   . ILE B 1 254 ? -17.015  54.578  13.920  1.00 92.11  ?  254 ILE B CD1   1 
ATOM   5645  N  N     . VAL B 1 255 ? -19.572  50.522  10.576  1.00 78.54  ?  255 VAL B N     1 
ATOM   5646  C  CA    . VAL B 1 255 ? -20.492  50.245  9.486   1.00 76.58  ?  255 VAL B CA    1 
ATOM   5647  C  C     . VAL B 1 255 ? -21.894  50.712  9.861   1.00 80.82  ?  255 VAL B C     1 
ATOM   5648  O  O     . VAL B 1 255 ? -22.415  50.360  10.921  1.00 82.01  ?  255 VAL B O     1 
ATOM   5649  C  CB    . VAL B 1 255 ? -20.494  48.738  9.146   1.00 73.87  ?  255 VAL B CB    1 
ATOM   5650  C  CG1   . VAL B 1 255 ? -21.491  48.428  8.055   1.00 67.37  ?  255 VAL B CG1   1 
ATOM   5651  C  CG2   . VAL B 1 255 ? -19.094  48.288  8.732   1.00 79.34  ?  255 VAL B CG2   1 
ATOM   5652  N  N     . ILE B 1 256 ? -22.503  51.517  8.997   1.00 78.84  ?  256 ILE B N     1 
ATOM   5653  C  CA    . ILE B 1 256 ? -23.849  52.006  9.261   1.00 75.47  ?  256 ILE B CA    1 
ATOM   5654  C  C     . ILE B 1 256 ? -24.866  51.262  8.419   1.00 81.31  ?  256 ILE B C     1 
ATOM   5655  O  O     . ILE B 1 256 ? -24.704  51.146  7.208   1.00 91.62  ?  256 ILE B O     1 
ATOM   5656  C  CB    . ILE B 1 256 ? -23.957  53.491  8.982   1.00 71.99  ?  256 ILE B CB    1 
ATOM   5657  C  CG1   . ILE B 1 256 ? -22.858  54.235  9.750   1.00 77.41  ?  256 ILE B CG1   1 
ATOM   5658  C  CG2   . ILE B 1 256 ? -25.343  53.975  9.372   1.00 71.48  ?  256 ILE B CG2   1 
ATOM   5659  C  CD1   . ILE B 1 256 ? -22.822  55.738  9.513   1.00 79.54  ?  256 ILE B CD1   1 
ATOM   5660  N  N     . THR B 1 257 ? -25.917  50.760  9.059   1.00 76.84  ?  257 THR B N     1 
ATOM   5661  C  CA    . THR B 1 257 ? -26.875  49.906  8.364   1.00 75.42  ?  257 THR B CA    1 
ATOM   5662  C  C     . THR B 1 257 ? -28.276  50.526  8.313   1.00 77.36  ?  257 THR B C     1 
ATOM   5663  O  O     . THR B 1 257 ? -29.109  50.128  7.492   1.00 81.82  ?  257 THR B O     1 
ATOM   5664  C  CB    . THR B 1 257 ? -26.924  48.500  8.981   1.00 79.08  ?  257 THR B CB    1 
ATOM   5665  O  OG1   . THR B 1 257 ? -27.866  48.472  10.059  1.00 86.69  ?  257 THR B OG1   1 
ATOM   5666  C  CG2   . THR B 1 257 ? -25.570  48.132  9.530   1.00 82.09  ?  257 THR B CG2   1 
ATOM   5667  N  N     . GLU B 1 258 ? -28.528  51.505  9.177   1.00 76.51  ?  258 GLU B N     1 
ATOM   5668  C  CA    . GLU B 1 258 ? -29.797  52.238  9.164   1.00 77.35  ?  258 GLU B CA    1 
ATOM   5669  C  C     . GLU B 1 258 ? -29.548  53.691  9.545   1.00 77.29  ?  258 GLU B C     1 
ATOM   5670  O  O     . GLU B 1 258 ? -28.650  53.983  10.334  1.00 80.12  ?  258 GLU B O     1 
ATOM   5671  C  CB    . GLU B 1 258 ? -30.815  51.608  10.127  1.00 76.23  ?  258 GLU B CB    1 
ATOM   5672  C  CG    . GLU B 1 258 ? -30.933  50.091  10.000  1.00 80.16  ?  258 GLU B CG    1 
ATOM   5673  C  CD    . GLU B 1 258 ? -31.948  49.474  10.955  1.00 89.55  ?  258 GLU B CD    1 
ATOM   5674  O  OE1   . GLU B 1 258 ? -32.854  50.190  11.436  1.00 94.54  ?  258 GLU B OE1   1 
ATOM   5675  O  OE2   . GLU B 1 258 ? -31.834  48.260  11.224  1.00 93.74  ?  258 GLU B OE2   1 
ATOM   5676  N  N     . ILE B 1 259 ? -30.339  54.600  8.986   1.00 75.75  ?  259 ILE B N     1 
ATOM   5677  C  CA    . ILE B 1 259 ? -30.197  56.019  9.307   1.00 66.59  ?  259 ILE B CA    1 
ATOM   5678  C  C     . ILE B 1 259 ? -31.513  56.705  9.728   1.00 67.84  ?  259 ILE B C     1 
ATOM   5679  O  O     . ILE B 1 259 ? -32.605  56.115  9.685   1.00 76.64  ?  259 ILE B O     1 
ATOM   5680  C  CB    . ILE B 1 259 ? -29.514  56.785  8.165   1.00 62.99  ?  259 ILE B CB    1 
ATOM   5681  C  CG1   . ILE B 1 259 ? -30.405  56.814  6.920   1.00 73.38  ?  259 ILE B CG1   1 
ATOM   5682  C  CG2   . ILE B 1 259 ? -28.203  56.131  7.816   1.00 58.13  ?  259 ILE B CG2   1 
ATOM   5683  C  CD1   . ILE B 1 259 ? -29.812  57.620  5.754   1.00 74.33  ?  259 ILE B CD1   1 
ATOM   5684  N  N     . PRO B 1 260 ? -31.408  57.953  10.176  1.00 61.42  ?  260 PRO B N     1 
ATOM   5685  C  CA    . PRO B 1 260 ? -32.564  58.644  10.750  1.00 62.15  ?  260 PRO B CA    1 
ATOM   5686  C  C     . PRO B 1 260 ? -33.547  59.122  9.689   1.00 64.91  ?  260 PRO B C     1 
ATOM   5687  O  O     . PRO B 1 260 ? -33.144  59.579  8.611   1.00 66.60  ?  260 PRO B O     1 
ATOM   5688  C  CB    . PRO B 1 260 ? -31.937  59.852  11.452  1.00 59.49  ?  260 PRO B CB    1 
ATOM   5689  C  CG    . PRO B 1 260 ? -30.486  59.547  11.544  1.00 61.00  ?  260 PRO B CG    1 
ATOM   5690  C  CD    . PRO B 1 260 ? -30.166  58.707  10.359  1.00 61.97  ?  260 PRO B CD    1 
ATOM   5691  N  N     . TYR B 1 261 ? -34.831  59.015  10.014  1.00 60.82  ?  261 TYR B N     1 
ATOM   5692  C  CA    . TYR B 1 261 ? -35.907  59.498  9.155   1.00 61.64  ?  261 TYR B CA    1 
ATOM   5693  C  C     . TYR B 1 261 ? -35.625  60.890  8.579   1.00 66.87  ?  261 TYR B C     1 
ATOM   5694  O  O     . TYR B 1 261 ? -35.031  61.734  9.247   1.00 66.64  ?  261 TYR B O     1 
ATOM   5695  C  CB    . TYR B 1 261 ? -37.190  59.526  9.964   1.00 57.43  ?  261 TYR B CB    1 
ATOM   5696  C  CG    . TYR B 1 261 ? -38.468  59.686  9.178   1.00 61.61  ?  261 TYR B CG    1 
ATOM   5697  C  CD1   . TYR B 1 261 ? -38.879  58.723  8.265   1.00 61.61  ?  261 TYR B CD1   1 
ATOM   5698  C  CD2   . TYR B 1 261 ? -39.303  60.776  9.400   1.00 67.89  ?  261 TYR B CD2   1 
ATOM   5699  C  CE1   . TYR B 1 261 ? -40.083  58.862  7.572   1.00 64.32  ?  261 TYR B CE1   1 
ATOM   5700  C  CE2   . TYR B 1 261 ? -40.502  60.921  8.718   1.00 71.12  ?  261 TYR B CE2   1 
ATOM   5701  C  CZ    . TYR B 1 261 ? -40.887  59.964  7.807   1.00 69.37  ?  261 TYR B CZ    1 
ATOM   5702  O  OH    . TYR B 1 261 ? -42.079  60.121  7.134   1.00 73.57  ?  261 TYR B OH    1 
ATOM   5703  N  N     . GLU B 1 262 ? -36.053  61.109  7.335   1.00 71.94  ?  262 GLU B N     1 
ATOM   5704  C  CA    . GLU B 1 262 ? -35.961  62.413  6.664   1.00 74.01  ?  262 GLU B CA    1 
ATOM   5705  C  C     . GLU B 1 262 ? -34.524  62.871  6.376   1.00 67.17  ?  262 GLU B C     1 
ATOM   5706  O  O     . GLU B 1 262 ? -34.263  64.065  6.196   1.00 75.83  ?  262 GLU B O     1 
ATOM   5707  C  CB    . GLU B 1 262 ? -36.721  63.500  7.446   1.00 86.35  ?  262 GLU B CB    1 
ATOM   5708  C  CG    . GLU B 1 262 ? -38.208  63.206  7.694   1.00 100.33 ?  262 GLU B CG    1 
ATOM   5709  C  CD    . GLU B 1 262 ? -39.024  64.455  8.041   1.00 112.62 ?  262 GLU B CD    1 
ATOM   5710  O  OE1   . GLU B 1 262 ? -39.563  65.079  7.099   1.00 122.90 ?  262 GLU B OE1   1 
ATOM   5711  O  OE2   . GLU B 1 262 ? -39.138  64.806  9.243   1.00 110.71 ?  262 GLU B OE2   1 
ATOM   5712  N  N     . ILE B 1 263 ? -33.595  61.927  6.315   1.00 57.96  ?  263 ILE B N     1 
ATOM   5713  C  CA    . ILE B 1 263 ? -32.184  62.283  6.166   1.00 61.45  ?  263 ILE B CA    1 
ATOM   5714  C  C     . ILE B 1 263 ? -31.642  61.758  4.855   1.00 66.57  ?  263 ILE B C     1 
ATOM   5715  O  O     . ILE B 1 263 ? -31.817  60.583  4.530   1.00 67.54  ?  263 ILE B O     1 
ATOM   5716  C  CB    . ILE B 1 263 ? -31.311  61.752  7.358   1.00 64.48  ?  263 ILE B CB    1 
ATOM   5717  C  CG1   . ILE B 1 263 ? -31.664  62.509  8.625   1.00 68.17  ?  263 ILE B CG1   1 
ATOM   5718  C  CG2   . ILE B 1 263 ? -29.811  61.945  7.092   1.00 55.42  ?  263 ILE B CG2   1 
ATOM   5719  C  CD1   . ILE B 1 263 ? -31.300  63.984  8.522   1.00 71.15  ?  263 ILE B CD1   1 
ATOM   5720  N  N     . ASN B 1 264 ? -30.975  62.634  4.111   1.00 68.72  ?  264 ASN B N     1 
ATOM   5721  C  CA    . ASN B 1 264 ? -30.470  62.282  2.794   1.00 67.69  ?  264 ASN B CA    1 
ATOM   5722  C  C     . ASN B 1 264 ? -29.169  61.482  2.872   1.00 71.81  ?  264 ASN B C     1 
ATOM   5723  O  O     . ASN B 1 264 ? -28.131  62.031  3.245   1.00 79.56  ?  264 ASN B O     1 
ATOM   5724  C  CB    . ASN B 1 264 ? -30.259  63.562  1.991   1.00 69.71  ?  264 ASN B CB    1 
ATOM   5725  C  CG    . ASN B 1 264 ? -29.778  63.294  0.586   1.00 75.83  ?  264 ASN B CG    1 
ATOM   5726  O  OD1   . ASN B 1 264 ? -28.651  62.831  0.371   1.00 79.98  ?  264 ASN B OD1   1 
ATOM   5727  N  ND2   . ASN B 1 264 ? -30.625  63.598  -0.387  1.00 77.71  ?  264 ASN B ND2   1 
ATOM   5728  N  N     . LYS B 1 265 ? -29.216  60.196  2.515   1.00 68.35  ?  265 LYS B N     1 
ATOM   5729  C  CA    . LYS B 1 265 ? -28.045  59.321  2.666   1.00 68.18  ?  265 LYS B CA    1 
ATOM   5730  C  C     . LYS B 1 265 ? -26.803  59.893  2.004   1.00 72.81  ?  265 LYS B C     1 
ATOM   5731  O  O     . LYS B 1 265 ? -25.694  59.785  2.539   1.00 67.78  ?  265 LYS B O     1 
ATOM   5732  C  CB    . LYS B 1 265 ? -28.296  57.917  2.115   1.00 70.06  ?  265 LYS B CB    1 
ATOM   5733  C  CG    . LYS B 1 265 ? -27.075  56.993  2.264   1.00 72.39  ?  265 LYS B CG    1 
ATOM   5734  C  CD    . LYS B 1 265 ? -27.381  55.513  1.899   1.00 62.61  ?  265 LYS B CD    1 
ATOM   5735  C  CE    . LYS B 1 265 ? -27.421  55.263  0.382   1.00 56.38  ?  265 LYS B CE    1 
ATOM   5736  N  N     . ALA B 1 266 ? -26.996  60.501  0.837   1.00 76.09  ?  266 ALA B N     1 
ATOM   5737  C  CA    . ALA B 1 266 ? -25.877  60.967  0.028   1.00 66.16  ?  266 ALA B CA    1 
ATOM   5738  C  C     . ALA B 1 266 ? -25.170  62.147  0.674   1.00 69.66  ?  266 ALA B C     1 
ATOM   5739  O  O     . ALA B 1 266 ? -23.936  62.175  0.707   1.00 71.40  ?  266 ALA B O     1 
ATOM   5740  C  CB    . ALA B 1 266 ? -26.340  61.314  -1.361  1.00 61.14  ?  266 ALA B CB    1 
ATOM   5741  N  N     . ASN B 1 267 ? -25.949  63.111  1.182   1.00 72.02  ?  267 ASN B N     1 
ATOM   5742  C  CA    . ASN B 1 267 ? -25.385  64.259  1.901   1.00 75.89  ?  267 ASN B CA    1 
ATOM   5743  C  C     . ASN B 1 267 ? -24.672  63.787  3.134   1.00 79.24  ?  267 ASN B C     1 
ATOM   5744  O  O     . ASN B 1 267 ? -23.501  64.103  3.329   1.00 87.05  ?  267 ASN B O     1 
ATOM   5745  C  CB    . ASN B 1 267 ? -26.447  65.278  2.303   1.00 82.57  ?  267 ASN B CB    1 
ATOM   5746  C  CG    . ASN B 1 267 ? -27.115  65.929  1.104   1.00 101.55 ?  267 ASN B CG    1 
ATOM   5747  O  OD1   . ASN B 1 267 ? -26.639  65.811  -0.034  1.00 108.86 ?  267 ASN B OD1   1 
ATOM   5748  N  ND2   . ASN B 1 267 ? -28.226  66.623  1.351   1.00 108.20 ?  267 ASN B ND2   1 
ATOM   5749  N  N     . LEU B 1 268 ? -25.387  63.023  3.960   1.00 74.85  ?  268 LEU B N     1 
ATOM   5750  C  CA    . LEU B 1 268 ? -24.810  62.423  5.160   1.00 71.66  ?  268 LEU B CA    1 
ATOM   5751  C  C     . LEU B 1 268 ? -23.431  61.847  4.857   1.00 77.92  ?  268 LEU B C     1 
ATOM   5752  O  O     . LEU B 1 268 ? -22.449  62.188  5.529   1.00 84.25  ?  268 LEU B O     1 
ATOM   5753  C  CB    . LEU B 1 268 ? -25.709  61.315  5.689   1.00 66.60  ?  268 LEU B CB    1 
ATOM   5754  C  CG    . LEU B 1 268 ? -25.616  60.995  7.185   1.00 65.00  ?  268 LEU B CG    1 
ATOM   5755  C  CD1   . LEU B 1 268 ? -26.302  59.672  7.492   1.00 67.05  ?  268 LEU B CD1   1 
ATOM   5756  C  CD2   . LEU B 1 268 ? -24.181  60.982  7.674   1.00 63.94  ?  268 LEU B CD2   1 
ATOM   5757  N  N     . VAL B 1 269 ? -23.349  60.976  3.851   1.00 69.74  ?  269 VAL B N     1 
ATOM   5758  C  CA    . VAL B 1 269 ? -22.046  60.457  3.454   1.00 61.74  ?  269 VAL B CA    1 
ATOM   5759  C  C     . VAL B 1 269 ? -21.012  61.563  3.148   1.00 63.07  ?  269 VAL B C     1 
ATOM   5760  O  O     . VAL B 1 269 ? -19.870  61.456  3.583   1.00 66.72  ?  269 VAL B O     1 
ATOM   5761  C  CB    . VAL B 1 269 ? -22.126  59.448  2.284   1.00 58.41  ?  269 VAL B CB    1 
ATOM   5762  C  CG1   . VAL B 1 269 ? -20.741  59.165  1.750   1.00 57.64  ?  269 VAL B CG1   1 
ATOM   5763  C  CG2   . VAL B 1 269 ? -22.763  58.167  2.741   1.00 53.96  ?  269 VAL B CG2   1 
ATOM   5764  N  N     . LYS B 1 270 ? -21.387  62.619  2.420   1.00 65.18  ?  270 LYS B N     1 
ATOM   5765  C  CA    . LYS B 1 270 ? -20.401  63.679  2.130   1.00 70.39  ?  270 LYS B CA    1 
ATOM   5766  C  C     . LYS B 1 270 ? -20.010  64.360  3.429   1.00 75.36  ?  270 LYS B C     1 
ATOM   5767  O  O     . LYS B 1 270 ? -18.826  64.469  3.754   1.00 74.91  ?  270 LYS B O     1 
ATOM   5768  C  CB    . LYS B 1 270 ? -20.885  64.726  1.099   1.00 60.32  ?  270 LYS B CB    1 
ATOM   5769  N  N     . LYS B 1 271 ? -21.021  64.787  4.178   1.00 77.49  ?  271 LYS B N     1 
ATOM   5770  C  CA    . LYS B 1 271 ? -20.811  65.554  5.397   1.00 75.54  ?  271 LYS B CA    1 
ATOM   5771  C  C     . LYS B 1 271 ? -19.898  64.799  6.378   1.00 78.56  ?  271 LYS B C     1 
ATOM   5772  O  O     . LYS B 1 271 ? -19.097  65.412  7.091   1.00 81.51  ?  271 LYS B O     1 
ATOM   5773  C  CB    . LYS B 1 271 ? -22.157  65.963  6.014   1.00 65.52  ?  271 LYS B CB    1 
ATOM   5774  N  N     . ILE B 1 272 ? -19.988  63.469  6.379   1.00 75.28  ?  272 ILE B N     1 
ATOM   5775  C  CA    . ILE B 1 272 ? -19.026  62.644  7.117   1.00 71.51  ?  272 ILE B CA    1 
ATOM   5776  C  C     . ILE B 1 272 ? -17.637  62.678  6.492   1.00 71.62  ?  272 ILE B C     1 
ATOM   5777  O  O     . ILE B 1 272 ? -16.690  63.060  7.166   1.00 79.48  ?  272 ILE B O     1 
ATOM   5778  C  CB    . ILE B 1 272 ? -19.459  61.183  7.231   1.00 64.04  ?  272 ILE B CB    1 
ATOM   5779  C  CG1   . ILE B 1 272 ? -20.655  61.062  8.174   1.00 58.58  ?  272 ILE B CG1   1 
ATOM   5780  C  CG2   . ILE B 1 272 ? -18.291  60.332  7.726   1.00 56.29  ?  272 ILE B CG2   1 
ATOM   5781  C  CD1   . ILE B 1 272 ? -21.209  59.666  8.264   1.00 54.07  ?  272 ILE B CD1   1 
ATOM   5782  N  N     . ASP B 1 273 ? -17.502  62.284  5.222   1.00 68.39  ?  273 ASP B N     1 
ATOM   5783  C  CA    . ASP B 1 273 ? -16.208  62.421  4.543   1.00 75.11  ?  273 ASP B CA    1 
ATOM   5784  C  C     . ASP B 1 273 ? -15.653  63.829  4.768   1.00 83.68  ?  273 ASP B C     1 
ATOM   5785  O  O     . ASP B 1 273 ? -14.434  64.040  4.799   1.00 82.78  ?  273 ASP B O     1 
ATOM   5786  C  CB    . ASP B 1 273 ? -16.300  62.134  3.045   1.00 74.27  ?  273 ASP B CB    1 
ATOM   5787  C  CG    . ASP B 1 273 ? -14.911  62.021  2.371   1.00 88.83  ?  273 ASP B CG    1 
ATOM   5788  O  OD1   . ASP B 1 273 ? -14.042  61.265  2.881   1.00 91.62  ?  273 ASP B OD1   1 
ATOM   5789  O  OD2   . ASP B 1 273 ? -14.689  62.685  1.320   1.00 97.25  ?  273 ASP B OD2   1 
ATOM   5790  N  N     . ASP B 1 274 ? -16.562  64.784  4.945   1.00 87.76  ?  274 ASP B N     1 
ATOM   5791  C  CA    . ASP B 1 274 ? -16.186  66.165  5.215   1.00 88.35  ?  274 ASP B CA    1 
ATOM   5792  C  C     . ASP B 1 274 ? -15.419  66.316  6.516   1.00 78.66  ?  274 ASP B C     1 
ATOM   5793  O  O     . ASP B 1 274 ? -14.468  67.094  6.597   1.00 77.69  ?  274 ASP B O     1 
ATOM   5794  C  CB    . ASP B 1 274 ? -17.417  67.064  5.219   1.00 96.99  ?  274 ASP B CB    1 
ATOM   5795  C  CG    . ASP B 1 274 ? -17.434  68.016  4.039   1.00 109.32 ?  274 ASP B CG    1 
ATOM   5796  O  OD1   . ASP B 1 274 ? -16.598  67.841  3.113   1.00 112.79 ?  274 ASP B OD1   1 
ATOM   5797  O  OD2   . ASP B 1 274 ? -18.281  68.936  4.044   1.00 114.26 ?  274 ASP B OD2   1 
ATOM   5798  N  N     . VAL B 1 275 ? -15.842  65.573  7.534   1.00 74.75  ?  275 VAL B N     1 
ATOM   5799  C  CA    . VAL B 1 275 ? -15.104  65.492  8.790   1.00 72.83  ?  275 VAL B CA    1 
ATOM   5800  C  C     . VAL B 1 275 ? -13.715  64.941  8.522   1.00 77.82  ?  275 VAL B C     1 
ATOM   5801  O  O     . VAL B 1 275 ? -12.723  65.596  8.832   1.00 82.98  ?  275 VAL B O     1 
ATOM   5802  C  CB    . VAL B 1 275 ? -15.815  64.584  9.779   1.00 62.57  ?  275 VAL B CB    1 
ATOM   5803  C  CG1   . VAL B 1 275 ? -14.905  64.249  10.950  1.00 68.39  ?  275 VAL B CG1   1 
ATOM   5804  C  CG2   . VAL B 1 275 ? -17.139  65.219  10.222  1.00 56.40  ?  275 VAL B CG2   1 
ATOM   5805  N  N     . ARG B 1 276 ? -13.638  63.754  7.919   1.00 73.74  ?  276 ARG B N     1 
ATOM   5806  C  CA    . ARG B 1 276 ? -12.336  63.174  7.581   1.00 73.36  ?  276 ARG B CA    1 
ATOM   5807  C  C     . ARG B 1 276 ? -11.412  64.156  6.864   1.00 77.71  ?  276 ARG B C     1 
ATOM   5808  O  O     . ARG B 1 276 ? -10.230  64.276  7.211   1.00 79.62  ?  276 ARG B O     1 
ATOM   5809  C  CB    . ARG B 1 276 ? -12.462  61.919  6.723   1.00 69.35  ?  276 ARG B CB    1 
ATOM   5810  C  CG    . ARG B 1 276 ? -11.090  61.307  6.391   1.00 76.61  ?  276 ARG B CG    1 
ATOM   5811  C  CD    . ARG B 1 276 ? -11.142  60.425  5.160   1.00 80.86  ?  276 ARG B CD    1 
ATOM   5812  N  NE    . ARG B 1 276 ? -11.539  61.180  3.972   1.00 83.29  ?  276 ARG B NE    1 
ATOM   5813  C  CZ    . ARG B 1 276 ? -10.685  61.799  3.157   1.00 87.06  ?  276 ARG B CZ    1 
ATOM   5814  N  NH1   . ARG B 1 276 ? -9.372   61.753  3.398   1.00 90.69  ?  276 ARG B NH1   1 
ATOM   5815  N  NH2   . ARG B 1 276 ? -11.144  62.465  2.100   1.00 82.35  ?  276 ARG B NH2   1 
ATOM   5816  N  N     . VAL B 1 277 ? -11.943  64.840  5.853   1.00 76.64  ?  277 VAL B N     1 
ATOM   5817  C  CA    . VAL B 1 277 ? -11.119  65.734  5.040   1.00 77.13  ?  277 VAL B CA    1 
ATOM   5818  C  C     . VAL B 1 277 ? -10.602  66.887  5.875   1.00 76.30  ?  277 VAL B C     1 
ATOM   5819  O  O     . VAL B 1 277 ? -9.459   67.338  5.702   1.00 73.81  ?  277 VAL B O     1 
ATOM   5820  C  CB    . VAL B 1 277 ? -11.881  66.313  3.826   1.00 71.03  ?  277 VAL B CB    1 
ATOM   5821  C  CG1   . VAL B 1 277 ? -11.091  67.448  3.215   1.00 72.21  ?  277 VAL B CG1   1 
ATOM   5822  C  CG2   . VAL B 1 277 ? -12.127  65.237  2.791   1.00 76.02  ?  277 VAL B CG2   1 
ATOM   5823  N  N     . ASN B 1 278 ? -11.459  67.357  6.776   1.00 72.82  ?  278 ASN B N     1 
ATOM   5824  C  CA    . ASN B 1 278 ? -11.119  68.481  7.621   1.00 81.79  ?  278 ASN B CA    1 
ATOM   5825  C  C     . ASN B 1 278 ? -10.393  68.031  8.878   1.00 83.00  ?  278 ASN B C     1 
ATOM   5826  O  O     . ASN B 1 278 ? -10.043  68.843  9.725   1.00 87.58  ?  278 ASN B O     1 
ATOM   5827  C  CB    . ASN B 1 278 ? -12.372  69.298  7.955   1.00 85.98  ?  278 ASN B CB    1 
ATOM   5828  C  CG    . ASN B 1 278 ? -12.827  70.167  6.788   1.00 89.56  ?  278 ASN B CG    1 
ATOM   5829  O  OD1   . ASN B 1 278 ? -12.004  70.765  6.091   1.00 93.33  ?  278 ASN B OD1   1 
ATOM   5830  N  ND2   . ASN B 1 278 ? -14.138  70.234  6.568   1.00 87.61  ?  278 ASN B ND2   1 
ATOM   5831  N  N     . ASN B 1 279 ? -10.161  66.728  8.989   1.00 79.74  ?  279 ASN B N     1 
ATOM   5832  C  CA    . ASN B 1 279 ? -9.462   66.163  10.140  1.00 72.59  ?  279 ASN B CA    1 
ATOM   5833  C  C     . ASN B 1 279 ? -10.077  66.616  11.462  1.00 79.77  ?  279 ASN B C     1 
ATOM   5834  O  O     . ASN B 1 279 ? -9.391   66.676  12.483  1.00 90.68  ?  279 ASN B O     1 
ATOM   5835  C  CB    . ASN B 1 279 ? -7.986   66.534  10.092  1.00 70.52  ?  279 ASN B CB    1 
ATOM   5836  C  CG    . ASN B 1 279 ? -7.111   65.508  10.763  1.00 79.90  ?  279 ASN B CG    1 
ATOM   5837  O  OD1   . ASN B 1 279 ? -7.602   64.675  11.520  1.00 85.67  ?  279 ASN B OD1   1 
ATOM   5838  N  ND2   . ASN B 1 279 ? -5.797   65.565  10.500  1.00 82.09  ?  279 ASN B ND2   1 
ATOM   5839  N  N     . LYS B 1 280 ? -11.375  66.918  11.435  1.00 80.44  ?  280 LYS B N     1 
ATOM   5840  C  CA    . LYS B 1 280 ? -12.100  67.431  12.598  1.00 87.42  ?  280 LYS B CA    1 
ATOM   5841  C  C     . LYS B 1 280 ? -11.993  66.480  13.788  1.00 85.94  ?  280 LYS B C     1 
ATOM   5842  O  O     . LYS B 1 280 ? -11.940  66.920  14.937  1.00 92.88  ?  280 LYS B O     1 
ATOM   5843  C  CB    . LYS B 1 280 ? -13.574  67.731  12.249  1.00 91.13  ?  280 LYS B CB    1 
ATOM   5844  C  CG    . LYS B 1 280 ? -13.863  69.188  11.795  1.00 67.26  ?  280 LYS B CG    1 
ATOM   5845  N  N     . VAL B 1 281 ? -11.947  65.180  13.505  1.00 79.88  ?  281 VAL B N     1 
ATOM   5846  C  CA    . VAL B 1 281 ? -11.718  64.158  14.531  1.00 77.81  ?  281 VAL B CA    1 
ATOM   5847  C  C     . VAL B 1 281 ? -10.639  63.176  14.086  1.00 79.09  ?  281 VAL B C     1 
ATOM   5848  O  O     . VAL B 1 281 ? -10.651  62.700  12.949  1.00 75.19  ?  281 VAL B O     1 
ATOM   5849  C  CB    . VAL B 1 281 ? -13.008  63.383  14.855  1.00 73.57  ?  281 VAL B CB    1 
ATOM   5850  C  CG1   . VAL B 1 281 ? -12.698  61.988  15.287  1.00 70.00  ?  281 VAL B CG1   1 
ATOM   5851  C  CG2   . VAL B 1 281 ? -13.772  64.084  15.945  1.00 75.37  ?  281 VAL B CG2   1 
ATOM   5852  N  N     . ALA B 1 282 ? -9.712   62.862  14.984  1.00 82.96  ?  282 ALA B N     1 
ATOM   5853  C  CA    . ALA B 1 282 ? -8.558   62.035  14.630  1.00 87.87  ?  282 ALA B CA    1 
ATOM   5854  C  C     . ALA B 1 282 ? -8.906   60.614  14.162  1.00 86.87  ?  282 ALA B C     1 
ATOM   5855  O  O     . ALA B 1 282 ? -9.729   59.941  14.775  1.00 81.68  ?  282 ALA B O     1 
ATOM   5856  C  CB    . ALA B 1 282 ? -7.600   61.975  15.803  1.00 96.38  ?  282 ALA B CB    1 
ATOM   5857  N  N     . GLY B 1 283 ? -8.286   60.164  13.072  1.00 94.40  ?  283 GLY B N     1 
ATOM   5858  C  CA    . GLY B 1 283 ? -8.281   58.746  12.736  1.00 99.56  ?  283 GLY B CA    1 
ATOM   5859  C  C     . GLY B 1 283 ? -9.182   58.148  11.658  1.00 101.41 ?  283 GLY B C     1 
ATOM   5860  O  O     . GLY B 1 283 ? -9.278   56.921  11.576  1.00 105.99 ?  283 GLY B O     1 
ATOM   5861  N  N     . ILE B 1 284 ? -9.833   58.964  10.828  1.00 95.86  ?  284 ILE B N     1 
ATOM   5862  C  CA    . ILE B 1 284 ? -10.636  58.397  9.737   1.00 86.89  ?  284 ILE B CA    1 
ATOM   5863  C  C     . ILE B 1 284 ? -9.839   58.126  8.452   1.00 87.54  ?  284 ILE B C     1 
ATOM   5864  O  O     . ILE B 1 284 ? -9.244   59.033  7.861   1.00 90.09  ?  284 ILE B O     1 
ATOM   5865  C  CB    . ILE B 1 284 ? -11.878  59.243  9.402   1.00 81.77  ?  284 ILE B CB    1 
ATOM   5866  C  CG1   . ILE B 1 284 ? -12.809  59.338  10.612  1.00 79.53  ?  284 ILE B CG1   1 
ATOM   5867  C  CG2   . ILE B 1 284 ? -12.644  58.604  8.264   1.00 82.80  ?  284 ILE B CG2   1 
ATOM   5868  C  CD1   . ILE B 1 284 ? -14.167  59.945  10.297  1.00 68.46  ?  284 ILE B CD1   1 
ATOM   5869  N  N     . ALA B 1 285 ? -9.848   56.870  8.020   1.00 84.09  ?  285 ALA B N     1 
ATOM   5870  C  CA    . ALA B 1 285 ? -9.115   56.456  6.822   1.00 85.18  ?  285 ALA B CA    1 
ATOM   5871  C  C     . ALA B 1 285 ? -9.858   56.774  5.527   1.00 85.86  ?  285 ALA B C     1 
ATOM   5872  O  O     . ALA B 1 285 ? -9.274   57.305  4.588   1.00 93.51  ?  285 ALA B O     1 
ATOM   5873  C  CB    . ALA B 1 285 ? -8.776   54.959  6.881   1.00 83.97  ?  285 ALA B CB    1 
ATOM   5874  N  N     . GLU B 1 286 ? -11.144  56.449  5.476   1.00 79.40  ?  286 GLU B N     1 
ATOM   5875  C  CA    . GLU B 1 286 ? -11.899  56.593  4.242   1.00 81.05  ?  286 GLU B CA    1 
ATOM   5876  C  C     . GLU B 1 286 ? -13.395  56.390  4.472   1.00 86.85  ?  286 GLU B C     1 
ATOM   5877  O  O     . GLU B 1 286 ? -13.796  55.537  5.255   1.00 91.31  ?  286 GLU B O     1 
ATOM   5878  C  CB    . GLU B 1 286 ? -11.370  55.590  3.211   1.00 80.40  ?  286 GLU B CB    1 
ATOM   5879  C  CG    . GLU B 1 286 ? -12.272  55.356  2.001   1.00 86.90  ?  286 GLU B CG    1 
ATOM   5880  C  CD    . GLU B 1 286 ? -11.699  54.327  1.024   1.00 101.98 ?  286 GLU B CD    1 
ATOM   5881  O  OE1   . GLU B 1 286 ? -10.912  53.452  1.455   1.00 110.71 ?  286 GLU B OE1   1 
ATOM   5882  O  OE2   . GLU B 1 286 ? -12.034  54.399  -0.179  1.00 106.93 ?  286 GLU B OE2   1 
ATOM   5883  N  N     . VAL B 1 287 ? -14.222  57.178  3.799   1.00 85.68  ?  287 VAL B N     1 
ATOM   5884  C  CA    . VAL B 1 287 ? -15.656  56.939  3.838   1.00 85.42  ?  287 VAL B CA    1 
ATOM   5885  C  C     . VAL B 1 287 ? -16.122  56.329  2.525   1.00 89.26  ?  287 VAL B C     1 
ATOM   5886  O  O     . VAL B 1 287 ? -15.640  56.697  1.458   1.00 100.42 ?  287 VAL B O     1 
ATOM   5887  C  CB    . VAL B 1 287 ? -16.438  58.223  4.060   1.00 85.11  ?  287 VAL B CB    1 
ATOM   5888  C  CG1   . VAL B 1 287 ? -17.931  57.951  3.881   1.00 80.57  ?  287 VAL B CG1   1 
ATOM   5889  C  CG2   . VAL B 1 287 ? -16.140  58.796  5.435   1.00 84.91  ?  287 VAL B CG2   1 
ATOM   5890  N  N     . ARG B 1 288 ? -17.070  55.405  2.602   1.00 83.36  ?  288 ARG B N     1 
ATOM   5891  C  CA    . ARG B 1 288 ? -17.517  54.681  1.416   1.00 88.30  ?  288 ARG B CA    1 
ATOM   5892  C  C     . ARG B 1 288 ? -18.983  54.307  1.505   1.00 90.85  ?  288 ARG B C     1 
ATOM   5893  O  O     . ARG B 1 288 ? -19.374  53.549  2.395   1.00 96.37  ?  288 ARG B O     1 
ATOM   5894  C  CB    . ARG B 1 288 ? -16.718  53.387  1.251   1.00 89.93  ?  288 ARG B CB    1 
ATOM   5895  C  CG    . ARG B 1 288 ? -15.422  53.532  0.502   1.00 90.89  ?  288 ARG B CG    1 
ATOM   5896  C  CD    . ARG B 1 288 ? -14.707  52.201  0.460   1.00 92.63  ?  288 ARG B CD    1 
ATOM   5897  N  NE    . ARG B 1 288 ? -14.073  51.892  1.735   1.00 90.32  ?  288 ARG B NE    1 
ATOM   5898  C  CZ    . ARG B 1 288 ? -14.204  50.740  2.384   1.00 93.96  ?  288 ARG B CZ    1 
ATOM   5899  N  NH1   . ARG B 1 288 ? -14.957  49.768  1.880   1.00 96.92  ?  288 ARG B NH1   1 
ATOM   5900  N  NH2   . ARG B 1 288 ? -13.576  50.564  3.545   1.00 94.49  ?  288 ARG B NH2   1 
ATOM   5901  N  N     . ASP B 1 289 ? -19.801  54.810  0.587   1.00 85.07  ?  289 ASP B N     1 
ATOM   5902  C  CA    . ASP B 1 289 ? -21.169  54.321  0.548   1.00 81.87  ?  289 ASP B CA    1 
ATOM   5903  C  C     . ASP B 1 289 ? -21.174  52.995  -0.222  1.00 84.71  ?  289 ASP B C     1 
ATOM   5904  O  O     . ASP B 1 289 ? -20.882  52.950  -1.416  1.00 93.05  ?  289 ASP B O     1 
ATOM   5905  C  CB    . ASP B 1 289 ? -22.140  55.354  -0.026  1.00 82.58  ?  289 ASP B CB    1 
ATOM   5906  C  CG    . ASP B 1 289 ? -23.600  54.934  0.139   1.00 88.59  ?  289 ASP B CG    1 
ATOM   5907  O  OD1   . ASP B 1 289 ? -24.514  55.787  -0.021  1.00 90.31  ?  289 ASP B OD1   1 
ATOM   5908  O  OD2   . ASP B 1 289 ? -23.827  53.738  0.429   1.00 91.39  ?  289 ASP B OD2   1 
ATOM   5909  N  N     . GLU B 1 290 ? -21.450  51.906  0.486   1.00 75.95  ?  290 GLU B N     1 
ATOM   5910  C  CA    . GLU B 1 290 ? -21.413  50.584  -0.119  1.00 75.65  ?  290 GLU B CA    1 
ATOM   5911  C  C     . GLU B 1 290 ? -22.811  50.005  -0.242  1.00 77.90  ?  290 GLU B C     1 
ATOM   5912  O  O     . GLU B 1 290 ? -22.977  48.801  -0.454  1.00 84.77  ?  290 GLU B O     1 
ATOM   5913  C  CB    . GLU B 1 290 ? -20.549  49.629  0.691   1.00 78.78  ?  290 GLU B CB    1 
ATOM   5914  C  CG    . GLU B 1 290 ? -19.074  49.950  0.714   1.00 86.70  ?  290 GLU B CG    1 
ATOM   5915  C  CD    . GLU B 1 290 ? -18.275  48.840  1.373   1.00 98.73  ?  290 GLU B CD    1 
ATOM   5916  O  OE1   . GLU B 1 290 ? -18.914  47.894  1.886   1.00 99.67  ?  290 GLU B OE1   1 
ATOM   5917  O  OE2   . GLU B 1 290 ? -17.024  48.911  1.376   1.00 106.43 ?  290 GLU B OE2   1 
ATOM   5918  N  N     . SER B 1 291 ? -23.815  50.864  -0.105  1.00 73.72  ?  291 SER B N     1 
ATOM   5919  C  CA    . SER B 1 291 ? -25.184  50.456  -0.374  1.00 76.94  ?  291 SER B CA    1 
ATOM   5920  C  C     . SER B 1 291 ? -25.298  49.896  -1.789  1.00 88.52  ?  291 SER B C     1 
ATOM   5921  O  O     . SER B 1 291 ? -24.577  50.310  -2.700  1.00 97.53  ?  291 SER B O     1 
ATOM   5922  C  CB    . SER B 1 291 ? -26.131  51.635  -0.207  1.00 73.75  ?  291 SER B CB    1 
ATOM   5923  O  OG    . SER B 1 291 ? -25.989  52.215  1.076   1.00 70.93  ?  291 SER B OG    1 
ATOM   5924  N  N     . ASP B 1 292 ? -26.199  48.938  -1.963  1.00 89.48  ?  292 ASP B N     1 
ATOM   5925  C  CA    . ASP B 1 292 ? -26.499  48.407  -3.282  1.00 98.56  ?  292 ASP B CA    1 
ATOM   5926  C  C     . ASP B 1 292 ? -27.971  47.993  -3.327  1.00 103.35 ?  292 ASP B C     1 
ATOM   5927  O  O     . ASP B 1 292 ? -28.636  47.924  -2.288  1.00 97.42  ?  292 ASP B O     1 
ATOM   5928  C  CB    . ASP B 1 292 ? -25.569  47.242  -3.643  1.00 100.60 ?  292 ASP B CB    1 
ATOM   5929  C  CG    . ASP B 1 292 ? -25.975  45.953  -2.980  1.00 101.90 ?  292 ASP B CG    1 
ATOM   5930  O  OD1   . ASP B 1 292 ? -26.615  46.036  -1.915  1.00 102.92 ?  292 ASP B OD1   1 
ATOM   5931  O  OD2   . ASP B 1 292 ? -25.667  44.863  -3.518  1.00 102.49 ?  292 ASP B OD2   1 
ATOM   5932  N  N     . ARG B 1 293 ? -28.470  47.726  -4.533  1.00 109.94 ?  293 ARG B N     1 
ATOM   5933  C  CA    . ARG B 1 293 ? -29.897  47.485  -4.762  1.00 110.07 ?  293 ARG B CA    1 
ATOM   5934  C  C     . ARG B 1 293 ? -30.640  46.719  -3.645  1.00 111.91 ?  293 ARG B C     1 
ATOM   5935  O  O     . ARG B 1 293 ? -31.851  46.876  -3.485  1.00 115.16 ?  293 ARG B O     1 
ATOM   5936  C  CB    . ARG B 1 293 ? -30.124  46.834  -6.139  1.00 108.82 ?  293 ARG B CB    1 
ATOM   5937  C  CG    . ARG B 1 293 ? -29.953  45.324  -6.186  1.00 106.09 ?  293 ARG B CG    1 
ATOM   5938  C  CD    . ARG B 1 293 ? -29.620  44.869  -7.594  1.00 110.12 ?  293 ARG B CD    1 
ATOM   5939  N  NE    . ARG B 1 293 ? -28.304  44.237  -7.643  1.00 113.83 ?  293 ARG B NE    1 
ATOM   5940  C  CZ    . ARG B 1 293 ? -27.165  44.853  -7.337  1.00 112.55 ?  293 ARG B CZ    1 
ATOM   5941  N  NH1   . ARG B 1 293 ? -27.180  46.127  -6.955  1.00 107.37 ?  293 ARG B NH1   1 
ATOM   5942  N  NH2   . ARG B 1 293 ? -26.011  44.196  -7.405  1.00 114.19 ?  293 ARG B NH2   1 
ATOM   5943  N  N     . ASP B 1 294 ? -29.931  45.905  -2.870  1.00 109.18 ?  294 ASP B N     1 
ATOM   5944  C  CA    . ASP B 1 294 ? -30.583  45.208  -1.765  1.00 106.80 ?  294 ASP B CA    1 
ATOM   5945  C  C     . ASP B 1 294 ? -29.855  45.355  -0.420  1.00 100.56 ?  294 ASP B C     1 
ATOM   5946  O  O     . ASP B 1 294 ? -29.411  44.376  0.185   1.00 102.01 ?  294 ASP B O     1 
ATOM   5947  C  CB    . ASP B 1 294 ? -30.886  43.735  -2.114  1.00 117.31 ?  294 ASP B CB    1 
ATOM   5948  C  CG    . ASP B 1 294 ? -29.703  43.009  -2.761  1.00 123.79 ?  294 ASP B CG    1 
ATOM   5949  O  OD1   . ASP B 1 294 ? -29.939  42.260  -3.744  1.00 130.10 ?  294 ASP B OD1   1 
ATOM   5950  O  OD2   . ASP B 1 294 ? -28.553  43.167  -2.278  1.00 119.25 ?  294 ASP B OD2   1 
ATOM   5951  N  N     . GLY B 1 295 ? -29.750  46.595  0.047   1.00 97.44  ?  295 GLY B N     1 
ATOM   5952  C  CA    . GLY B 1 295 ? -29.186  46.860  1.358   1.00 91.70  ?  295 GLY B CA    1 
ATOM   5953  C  C     . GLY B 1 295 ? -28.439  48.176  1.485   1.00 87.83  ?  295 GLY B C     1 
ATOM   5954  O  O     . GLY B 1 295 ? -27.623  48.536  0.641   1.00 95.86  ?  295 GLY B O     1 
ATOM   5955  N  N     . LEU B 1 296 ? -28.720  48.899  2.561   1.00 77.02  ?  296 LEU B N     1 
ATOM   5956  C  CA    . LEU B 1 296 ? -27.957  50.092  2.918   1.00 69.97  ?  296 LEU B CA    1 
ATOM   5957  C  C     . LEU B 1 296 ? -26.683  49.735  3.712   1.00 78.52  ?  296 LEU B C     1 
ATOM   5958  O  O     . LEU B 1 296 ? -26.686  48.823  4.545   1.00 85.90  ?  296 LEU B O     1 
ATOM   5959  C  CB    . LEU B 1 296 ? -28.847  51.049  3.715   1.00 63.90  ?  296 LEU B CB    1 
ATOM   5960  C  CG    . LEU B 1 296 ? -28.212  52.349  4.195   1.00 66.92  ?  296 LEU B CG    1 
ATOM   5961  C  CD1   . LEU B 1 296 ? -29.270  53.475  4.303   1.00 69.01  ?  296 LEU B CD1   1 
ATOM   5962  C  CD2   . LEU B 1 296 ? -27.457  52.115  5.515   1.00 64.15  ?  296 LEU B CD2   1 
ATOM   5963  N  N     . ARG B 1 297 ? -25.591  50.444  3.440   1.00 80.01  ?  297 ARG B N     1 
ATOM   5964  C  CA    . ARG B 1 297 ? -24.310  50.150  4.083   1.00 76.74  ?  297 ARG B CA    1 
ATOM   5965  C  C     . ARG B 1 297 ? -23.272  51.244  3.847   1.00 75.42  ?  297 ARG B C     1 
ATOM   5966  O  O     . ARG B 1 297 ? -22.877  51.503  2.711   1.00 81.74  ?  297 ARG B O     1 
ATOM   5967  C  CB    . ARG B 1 297 ? -23.759  48.796  3.616   1.00 77.70  ?  297 ARG B CB    1 
ATOM   5968  C  CG    . ARG B 1 297 ? -22.295  48.568  3.982   1.00 73.65  ?  297 ARG B CG    1 
ATOM   5969  C  CD    . ARG B 1 297 ? -21.883  47.134  3.722   1.00 75.55  ?  297 ARG B CD    1 
ATOM   5970  N  NE    . ARG B 1 297 ? -21.286  46.537  4.911   1.00 81.28  ?  297 ARG B NE    1 
ATOM   5971  C  CZ    . ARG B 1 297 ? -19.982  46.349  5.064   1.00 87.59  ?  297 ARG B CZ    1 
ATOM   5972  N  NH1   . ARG B 1 297 ? -19.150  46.695  4.092   1.00 90.57  ?  297 ARG B NH1   1 
ATOM   5973  N  NH2   . ARG B 1 297 ? -19.509  45.812  6.184   1.00 85.25  ?  297 ARG B NH2   1 
ATOM   5974  N  N     . ILE B 1 298 ? -22.838  51.877  4.932   1.00 73.18  ?  298 ILE B N     1 
ATOM   5975  C  CA    . ILE B 1 298 ? -21.830  52.929  4.880   1.00 73.96  ?  298 ILE B CA    1 
ATOM   5976  C  C     . ILE B 1 298 ? -20.644  52.491  5.730   1.00 77.52  ?  298 ILE B C     1 
ATOM   5977  O  O     . ILE B 1 298 ? -20.770  52.334  6.940   1.00 75.04  ?  298 ILE B O     1 
ATOM   5978  C  CB    . ILE B 1 298 ? -22.395  54.267  5.416   1.00 69.30  ?  298 ILE B CB    1 
ATOM   5979  C  CG1   . ILE B 1 298 ? -23.787  54.518  4.846   1.00 72.65  ?  298 ILE B CG1   1 
ATOM   5980  C  CG2   . ILE B 1 298 ? -21.492  55.438  5.072   1.00 62.99  ?  298 ILE B CG2   1 
ATOM   5981  C  CD1   . ILE B 1 298 ? -24.333  55.868  5.208   1.00 71.28  ?  298 ILE B CD1   1 
ATOM   5982  N  N     . ALA B 1 299 ? -19.506  52.256  5.079   1.00 77.72  ?  299 ALA B N     1 
ATOM   5983  C  CA    . ALA B 1 299 ? -18.284  51.843  5.754   1.00 71.14  ?  299 ALA B CA    1 
ATOM   5984  C  C     . ALA B 1 299 ? -17.502  53.108  6.080   1.00 75.67  ?  299 ALA B C     1 
ATOM   5985  O  O     . ALA B 1 299 ? -17.205  53.903  5.189   1.00 83.87  ?  299 ALA B O     1 
ATOM   5986  N  N     . ILE B 1 300 ? -17.205  53.309  7.363   1.00 72.58  ?  300 ILE B N     1 
ATOM   5987  C  CA    . ILE B 1 300 ? -16.298  54.367  7.800   1.00 66.82  ?  300 ILE B CA    1 
ATOM   5988  C  C     . ILE B 1 300 ? -15.027  53.732  8.384   1.00 72.36  ?  300 ILE B C     1 
ATOM   5989  O  O     . ILE B 1 300 ? -14.816  53.706  9.608   1.00 81.53  ?  300 ILE B O     1 
ATOM   5990  C  CB    . ILE B 1 300 ? -16.945  55.282  8.858   1.00 59.95  ?  300 ILE B CB    1 
ATOM   5991  C  CG1   . ILE B 1 300 ? -18.320  55.740  8.405   1.00 64.32  ?  300 ILE B CG1   1 
ATOM   5992  C  CG2   . ILE B 1 300 ? -16.064  56.488  9.131   1.00 59.00  ?  300 ILE B CG2   1 
ATOM   5993  C  CD1   . ILE B 1 300 ? -18.982  56.685  9.379   1.00 69.73  ?  300 ILE B CD1   1 
ATOM   5994  N  N     . GLU B 1 301 ? -14.187  53.211  7.498   1.00 71.21  ?  301 GLU B N     1 
ATOM   5995  C  CA    . GLU B 1 301 ? -12.978  52.520  7.917   1.00 82.21  ?  301 GLU B CA    1 
ATOM   5996  C  C     . GLU B 1 301 ? -11.972  53.517  8.471   1.00 83.50  ?  301 GLU B C     1 
ATOM   5997  O  O     . GLU B 1 301 ? -11.763  54.577  7.877   1.00 84.67  ?  301 GLU B O     1 
ATOM   5998  C  CB    . GLU B 1 301 ? -12.391  51.738  6.746   1.00 91.45  ?  301 GLU B CB    1 
ATOM   5999  C  CG    . GLU B 1 301 ? -11.009  52.154  6.338   1.00 99.35  ?  301 GLU B CG    1 
ATOM   6000  C  CD    . GLU B 1 301 ? -10.391  51.138  5.419   1.00 105.87 ?  301 GLU B CD    1 
ATOM   6001  O  OE1   . GLU B 1 301 ? -9.216   51.309  5.034   1.00 111.70 ?  301 GLU B OE1   1 
ATOM   6002  O  OE2   . GLU B 1 301 ? -11.093  50.159  5.087   1.00 105.48 ?  301 GLU B OE2   1 
ATOM   6003  N  N     . LEU B 1 302 ? -11.374  53.183  9.619   1.00 80.98  ?  302 LEU B N     1 
ATOM   6004  C  CA    . LEU B 1 302 ? -10.465  54.098  10.308  1.00 81.97  ?  302 LEU B CA    1 
ATOM   6005  C  C     . LEU B 1 302 ? -9.047   53.570  10.282  1.00 89.30  ?  302 LEU B C     1 
ATOM   6006  O  O     . LEU B 1 302 ? -8.819   52.415  9.946   1.00 98.61  ?  302 LEU B O     1 
ATOM   6007  C  CB    . LEU B 1 302 ? -10.902  54.337  11.751  1.00 81.49  ?  302 LEU B CB    1 
ATOM   6008  C  CG    . LEU B 1 302 ? -12.374  54.097  12.060  1.00 80.86  ?  302 LEU B CG    1 
ATOM   6009  C  CD1   . LEU B 1 302 ? -12.561  52.636  12.401  1.00 88.54  ?  302 LEU B CD1   1 
ATOM   6010  C  CD2   . LEU B 1 302 ? -12.862  54.982  13.190  1.00 79.00  ?  302 LEU B CD2   1 
ATOM   6011  N  N     . LYS B 1 303 ? -8.093   54.422  10.642  1.00 85.34  ?  303 LYS B N     1 
ATOM   6012  C  CA    . LYS B 1 303 ? -6.685   54.066  10.556  1.00 92.03  ?  303 LYS B CA    1 
ATOM   6013  C  C     . LYS B 1 303 ? -6.310   53.148  11.712  1.00 100.24 ?  303 LYS B C     1 
ATOM   6014  O  O     . LYS B 1 303 ? -7.095   52.988  12.647  1.00 99.50  ?  303 LYS B O     1 
ATOM   6015  C  CB    . LYS B 1 303 ? -5.826   55.329  10.576  1.00 95.34  ?  303 LYS B CB    1 
ATOM   6016  C  CG    . LYS B 1 303 ? -6.470   56.545  9.900   1.00 91.71  ?  303 LYS B CG    1 
ATOM   6017  C  CD    . LYS B 1 303 ? -5.586   57.785  10.045  1.00 96.37  ?  303 LYS B CD    1 
ATOM   6018  C  CE    . LYS B 1 303 ? -6.209   59.031  9.434   1.00 91.70  ?  303 LYS B CE    1 
ATOM   6019  N  NZ    . LYS B 1 303 ? -5.369   60.240  9.695   1.00 95.67  ?  303 LYS B NZ    1 
ATOM   6020  N  N     . LYS B 1 304 ? -5.121   52.542  11.641  1.00 107.79 ?  304 LYS B N     1 
ATOM   6021  C  CA    . LYS B 1 304 ? -4.575   51.755  12.757  1.00 109.58 ?  304 LYS B CA    1 
ATOM   6022  C  C     . LYS B 1 304 ? -4.443   52.621  14.023  1.00 113.63 ?  304 LYS B C     1 
ATOM   6023  O  O     . LYS B 1 304 ? -4.366   53.853  13.943  1.00 110.34 ?  304 LYS B O     1 
ATOM   6024  C  CB    . LYS B 1 304 ? -3.214   51.125  12.383  1.00 109.95 ?  304 LYS B CB    1 
ATOM   6025  N  N     . ASP B 1 305 ? -4.428   51.978  15.188  1.00 122.38 ?  305 ASP B N     1 
ATOM   6026  C  CA    . ASP B 1 305 ? -4.224   52.691  16.452  1.00 127.90 ?  305 ASP B CA    1 
ATOM   6027  C  C     . ASP B 1 305 ? -5.133   53.947  16.574  1.00 95.47  ?  305 ASP B C     1 
ATOM   6028  O  O     . ASP B 1 305 ? -4.692   55.022  16.995  1.00 97.92  ?  305 ASP B O     1 
ATOM   6029  C  CB    . ASP B 1 305 ? -2.720   53.013  16.662  1.00 92.64  ?  305 ASP B CB    1 
ATOM   6030  N  N     . ALA B 1 306 ? -6.406   53.798  16.215  1.00 89.87  ?  306 ALA B N     1 
ATOM   6031  C  CA    . ALA B 1 306 ? -7.356   54.915  16.269  1.00 88.69  ?  306 ALA B CA    1 
ATOM   6032  C  C     . ALA B 1 306 ? -8.520   54.681  17.247  1.00 95.21  ?  306 ALA B C     1 
ATOM   6033  O  O     . ALA B 1 306 ? -9.143   53.615  17.242  1.00 93.96  ?  306 ALA B O     1 
ATOM   6034  C  CB    . ALA B 1 306 ? -7.889   55.227  14.872  1.00 79.98  ?  306 ALA B CB    1 
ATOM   6035  N  N     . ASN B 1 307 ? -8.826   55.682  18.072  1.00 102.93 ?  307 ASN B N     1 
ATOM   6036  C  CA    . ASN B 1 307 ? -9.880   55.528  19.078  1.00 107.15 ?  307 ASN B CA    1 
ATOM   6037  C  C     . ASN B 1 307 ? -11.254  55.444  18.450  1.00 101.54 ?  307 ASN B C     1 
ATOM   6038  O  O     . ASN B 1 307 ? -11.871  56.469  18.173  1.00 103.68 ?  307 ASN B O     1 
ATOM   6039  C  CB    . ASN B 1 307 ? -9.865   56.666  20.107  1.00 111.49 ?  307 ASN B CB    1 
ATOM   6040  C  CG    . ASN B 1 307 ? -10.896  56.460  21.220  1.00 115.55 ?  307 ASN B CG    1 
ATOM   6041  O  OD1   . ASN B 1 307 ? -10.708  55.642  22.120  1.00 121.44 ?  307 ASN B OD1   1 
ATOM   6042  N  ND2   . ASN B 1 307 ? -11.988  57.202  21.156  1.00 115.62 ?  307 ASN B ND2   1 
ATOM   6043  N  N     . THR B 1 308 ? -11.751  54.234  18.233  1.00 100.03 ?  308 THR B N     1 
ATOM   6044  C  CA    . THR B 1 308 ? -12.983  54.118  17.459  1.00 98.53  ?  308 THR B CA    1 
ATOM   6045  C  C     . THR B 1 308 ? -14.212  54.700  18.179  1.00 92.41  ?  308 THR B C     1 
ATOM   6046  O  O     . THR B 1 308 ? -15.113  55.224  17.529  1.00 80.88  ?  308 THR B O     1 
ATOM   6047  C  CB    . THR B 1 308 ? -13.196  52.681  16.863  1.00 86.73  ?  308 THR B CB    1 
ATOM   6048  O  OG1   . THR B 1 308 ? -14.481  52.152  17.244  1.00 81.96  ?  308 THR B OG1   1 
ATOM   6049  C  CG2   . THR B 1 308 ? -12.033  51.735  17.269  1.00 78.27  ?  308 THR B CG2   1 
ATOM   6050  N  N     . GLU B 1 309 ? -14.223  54.663  19.512  1.00 98.49  ?  309 GLU B N     1 
ATOM   6051  C  CA    . GLU B 1 309 ? -15.320  55.281  20.266  1.00 102.38 ?  309 GLU B CA    1 
ATOM   6052  C  C     . GLU B 1 309 ? -15.317  56.821  20.182  1.00 107.21 ?  309 GLU B C     1 
ATOM   6053  O  O     . GLU B 1 309 ? -16.365  57.451  20.304  1.00 115.85 ?  309 GLU B O     1 
ATOM   6054  C  CB    . GLU B 1 309 ? -15.344  54.802  21.725  1.00 105.77 ?  309 GLU B CB    1 
ATOM   6055  N  N     . LEU B 1 310 ? -14.150  57.421  19.961  1.00 101.46 ?  310 LEU B N     1 
ATOM   6056  C  CA    . LEU B 1 310 ? -14.054  58.872  19.781  1.00 93.68  ?  310 LEU B CA    1 
ATOM   6057  C  C     . LEU B 1 310 ? -14.666  59.312  18.458  1.00 89.31  ?  310 LEU B C     1 
ATOM   6058  O  O     . LEU B 1 310 ? -15.420  60.283  18.408  1.00 91.44  ?  310 LEU B O     1 
ATOM   6059  C  CB    . LEU B 1 310 ? -12.599  59.334  19.818  1.00 90.55  ?  310 LEU B CB    1 
ATOM   6060  C  CG    . LEU B 1 310 ? -12.271  60.521  20.729  1.00 88.55  ?  310 LEU B CG    1 
ATOM   6061  C  CD1   . LEU B 1 310 ? -10.930  61.157  20.319  1.00 76.88  ?  310 LEU B CD1   1 
ATOM   6062  C  CD2   . LEU B 1 310 ? -13.424  61.545  20.768  1.00 91.15  ?  310 LEU B CD2   1 
ATOM   6063  N  N     . VAL B 1 311 ? -14.319  58.598  17.389  1.00 84.95  ?  311 VAL B N     1 
ATOM   6064  C  CA    . VAL B 1 311 ? -14.852  58.872  16.059  1.00 85.54  ?  311 VAL B CA    1 
ATOM   6065  C  C     . VAL B 1 311 ? -16.378  58.754  16.017  1.00 88.49  ?  311 VAL B C     1 
ATOM   6066  O  O     . VAL B 1 311 ? -17.081  59.629  15.485  1.00 81.65  ?  311 VAL B O     1 
ATOM   6067  C  CB    . VAL B 1 311 ? -14.260  57.900  15.017  1.00 79.92  ?  311 VAL B CB    1 
ATOM   6068  C  CG1   . VAL B 1 311 ? -14.755  58.242  13.600  1.00 73.68  ?  311 VAL B CG1   1 
ATOM   6069  C  CG2   . VAL B 1 311 ? -12.759  57.940  15.072  1.00 81.63  ?  311 VAL B CG2   1 
ATOM   6070  N  N     . LEU B 1 312 ? -16.889  57.661  16.573  1.00 89.55  ?  312 LEU B N     1 
ATOM   6071  C  CA    . LEU B 1 312 ? -18.313  57.402  16.516  1.00 81.68  ?  312 LEU B CA    1 
ATOM   6072  C  C     . LEU B 1 312 ? -19.057  58.490  17.267  1.00 83.87  ?  312 LEU B C     1 
ATOM   6073  O  O     . LEU B 1 312 ? -20.042  59.027  16.766  1.00 85.24  ?  312 LEU B O     1 
ATOM   6074  C  CB    . LEU B 1 312 ? -18.643  56.030  17.093  1.00 77.55  ?  312 LEU B CB    1 
ATOM   6075  C  CG    . LEU B 1 312 ? -20.012  55.510  16.665  1.00 78.40  ?  312 LEU B CG    1 
ATOM   6076  C  CD1   . LEU B 1 312 ? -20.084  55.399  15.143  1.00 78.78  ?  312 LEU B CD1   1 
ATOM   6077  C  CD2   . LEU B 1 312 ? -20.284  54.177  17.306  1.00 85.25  ?  312 LEU B CD2   1 
ATOM   6078  N  N     . ASN B 1 313 ? -18.580  58.831  18.461  1.00 83.67  ?  313 ASN B N     1 
ATOM   6079  C  CA    . ASN B 1 313 ? -19.239  59.870  19.252  1.00 82.57  ?  313 ASN B CA    1 
ATOM   6080  C  C     . ASN B 1 313 ? -19.259  61.221  18.568  1.00 78.52  ?  313 ASN B C     1 
ATOM   6081  O  O     . ASN B 1 313 ? -20.261  61.934  18.618  1.00 80.55  ?  313 ASN B O     1 
ATOM   6082  C  CB    . ASN B 1 313 ? -18.607  59.996  20.626  1.00 89.40  ?  313 ASN B CB    1 
ATOM   6083  C  CG    . ASN B 1 313 ? -18.984  58.855  21.528  1.00 93.56  ?  313 ASN B CG    1 
ATOM   6084  O  OD1   . ASN B 1 313 ? -20.022  58.213  21.318  1.00 88.93  ?  313 ASN B OD1   1 
ATOM   6085  N  ND2   . ASN B 1 313 ? -18.150  58.584  22.542  1.00 99.07  ?  313 ASN B ND2   1 
ATOM   6086  N  N     . TYR B 1 314 ? -18.151  61.569  17.923  1.00 77.50  ?  314 TYR B N     1 
ATOM   6087  C  CA    . TYR B 1 314 ? -18.065  62.842  17.225  1.00 77.12  ?  314 TYR B CA    1 
ATOM   6088  C  C     . TYR B 1 314 ? -19.081  62.869  16.101  1.00 79.35  ?  314 TYR B C     1 
ATOM   6089  O  O     . TYR B 1 314 ? -19.825  63.841  15.959  1.00 84.42  ?  314 TYR B O     1 
ATOM   6090  C  CB    . TYR B 1 314 ? -16.664  63.084  16.661  1.00 74.93  ?  314 TYR B CB    1 
ATOM   6091  C  CG    . TYR B 1 314 ? -16.516  64.460  16.067  1.00 72.70  ?  314 TYR B CG    1 
ATOM   6092  C  CD1   . TYR B 1 314 ? -16.871  64.721  14.746  1.00 77.43  ?  314 TYR B CD1   1 
ATOM   6093  C  CD2   . TYR B 1 314 ? -16.033  65.506  16.831  1.00 70.01  ?  314 TYR B CD2   1 
ATOM   6094  C  CE1   . TYR B 1 314 ? -16.740  65.994  14.214  1.00 80.47  ?  314 TYR B CE1   1 
ATOM   6095  C  CE2   . TYR B 1 314 ? -15.895  66.775  16.307  1.00 75.25  ?  314 TYR B CE2   1 
ATOM   6096  C  CZ    . TYR B 1 314 ? -16.250  67.016  15.007  1.00 81.39  ?  314 TYR B CZ    1 
ATOM   6097  O  OH    . TYR B 1 314 ? -16.104  68.288  14.520  1.00 86.48  ?  314 TYR B OH    1 
ATOM   6098  N  N     . LEU B 1 315 ? -19.106  61.803  15.303  1.00 74.10  ?  315 LEU B N     1 
ATOM   6099  C  CA    . LEU B 1 315 ? -20.047  61.727  14.192  1.00 72.50  ?  315 LEU B CA    1 
ATOM   6100  C  C     . LEU B 1 315 ? -21.494  61.868  14.679  1.00 78.84  ?  315 LEU B C     1 
ATOM   6101  O  O     . LEU B 1 315 ? -22.267  62.638  14.106  1.00 85.22  ?  315 LEU B O     1 
ATOM   6102  C  CB    . LEU B 1 315 ? -19.836  60.457  13.358  1.00 67.96  ?  315 LEU B CB    1 
ATOM   6103  C  CG    . LEU B 1 315 ? -18.434  60.325  12.741  1.00 69.00  ?  315 LEU B CG    1 
ATOM   6104  C  CD1   . LEU B 1 315 ? -18.238  59.001  12.010  1.00 65.05  ?  315 LEU B CD1   1 
ATOM   6105  C  CD2   . LEU B 1 315 ? -18.110  61.487  11.801  1.00 71.78  ?  315 LEU B CD2   1 
ATOM   6106  N  N     . PHE B 1 316 ? -21.856  61.159  15.745  1.00 75.07  ?  316 PHE B N     1 
ATOM   6107  C  CA    . PHE B 1 316 ? -23.204  61.294  16.305  1.00 70.65  ?  316 PHE B CA    1 
ATOM   6108  C  C     . PHE B 1 316 ? -23.541  62.740  16.652  1.00 71.55  ?  316 PHE B C     1 
ATOM   6109  O  O     . PHE B 1 316 ? -24.660  63.192  16.414  1.00 81.96  ?  316 PHE B O     1 
ATOM   6110  C  CB    . PHE B 1 316 ? -23.403  60.412  17.545  1.00 74.12  ?  316 PHE B CB    1 
ATOM   6111  C  CG    . PHE B 1 316 ? -23.621  58.966  17.228  1.00 75.76  ?  316 PHE B CG    1 
ATOM   6112  C  CD1   . PHE B 1 316 ? -22.990  57.977  17.970  1.00 73.02  ?  316 PHE B CD1   1 
ATOM   6113  C  CD2   . PHE B 1 316 ? -24.448  58.593  16.178  1.00 79.25  ?  316 PHE B CD2   1 
ATOM   6114  C  CE1   . PHE B 1 316 ? -23.173  56.643  17.672  1.00 72.90  ?  316 PHE B CE1   1 
ATOM   6115  C  CE2   . PHE B 1 316 ? -24.644  57.261  15.877  1.00 79.11  ?  316 PHE B CE2   1 
ATOM   6116  C  CZ    . PHE B 1 316 ? -24.008  56.283  16.623  1.00 75.82  ?  316 PHE B CZ    1 
ATOM   6117  N  N     . LYS B 1 317 ? -22.584  63.466  17.223  1.00 63.93  ?  317 LYS B N     1 
ATOM   6118  C  CA    . LYS B 1 317 ? -22.873  64.818  17.699  1.00 68.75  ?  317 LYS B CA    1 
ATOM   6119  C  C     . LYS B 1 317 ? -22.905  65.811  16.532  1.00 76.19  ?  317 LYS B C     1 
ATOM   6120  O  O     . LYS B 1 317 ? -23.928  66.461  16.303  1.00 74.08  ?  317 LYS B O     1 
ATOM   6121  C  CB    . LYS B 1 317 ? -21.882  65.233  18.805  1.00 64.78  ?  317 LYS B CB    1 
ATOM   6122  C  CG    . LYS B 1 317 ? -22.150  66.580  19.484  1.00 69.21  ?  317 LYS B CG    1 
ATOM   6123  C  CD    . LYS B 1 317 ? -21.203  66.847  20.702  1.00 58.16  ?  317 LYS B CD    1 
ATOM   6124  N  N     . TYR B 1 318 ? -21.809  65.861  15.767  1.00 82.19  ?  318 TYR B N     1 
ATOM   6125  C  CA    . TYR B 1 318 ? -21.569  66.905  14.760  1.00 78.22  ?  318 TYR B CA    1 
ATOM   6126  C  C     . TYR B 1 318 ? -22.068  66.609  13.344  1.00 77.54  ?  318 TYR B C     1 
ATOM   6127  O  O     . TYR B 1 318 ? -21.990  67.467  12.459  1.00 77.41  ?  318 TYR B O     1 
ATOM   6128  C  CB    . TYR B 1 318 ? -20.089  67.309  14.751  1.00 70.43  ?  318 TYR B CB    1 
ATOM   6129  C  CG    . TYR B 1 318 ? -19.704  67.950  16.051  1.00 71.16  ?  318 TYR B CG    1 
ATOM   6130  C  CD1   . TYR B 1 318 ? -19.992  69.282  16.298  1.00 76.12  ?  318 TYR B CD1   1 
ATOM   6131  C  CD2   . TYR B 1 318 ? -19.105  67.215  17.052  1.00 75.95  ?  318 TYR B CD2   1 
ATOM   6132  C  CE1   . TYR B 1 318 ? -19.666  69.876  17.505  1.00 80.33  ?  318 TYR B CE1   1 
ATOM   6133  C  CE2   . TYR B 1 318 ? -18.774  67.793  18.262  1.00 83.32  ?  318 TYR B CE2   1 
ATOM   6134  C  CZ    . TYR B 1 318 ? -19.055  69.125  18.490  1.00 78.94  ?  318 TYR B CZ    1 
ATOM   6135  O  OH    . TYR B 1 318 ? -18.719  69.696  19.703  1.00 73.94  ?  318 TYR B OH    1 
ATOM   6136  N  N     . THR B 1 319 ? -22.593  65.409  13.129  1.00 75.64  ?  319 THR B N     1 
ATOM   6137  C  CA    . THR B 1 319 ? -23.305  65.141  11.890  1.00 72.72  ?  319 THR B CA    1 
ATOM   6138  C  C     . THR B 1 319 ? -24.733  64.662  12.140  1.00 79.37  ?  319 THR B C     1 
ATOM   6139  O  O     . THR B 1 319 ? -25.284  64.796  13.259  1.00 93.69  ?  319 THR B O     1 
ATOM   6140  C  CB    . THR B 1 319 ? -22.536  64.166  10.980  1.00 62.65  ?  319 THR B CB    1 
ATOM   6141  O  OG1   . THR B 1 319 ? -22.740  62.810  11.406  1.00 62.10  ?  319 THR B OG1   1 
ATOM   6142  C  CG2   . THR B 1 319 ? -21.069  64.498  11.008  1.00 51.74  ?  319 THR B CG2   1 
ATOM   6143  N  N     . ASP B 1 320 ? -25.352  64.157  11.082  1.00 73.39  ?  320 ASP B N     1 
ATOM   6144  C  CA    . ASP B 1 320 ? -26.747  63.757  11.150  1.00 79.28  ?  320 ASP B CA    1 
ATOM   6145  C  C     . ASP B 1 320 ? -26.872  62.257  11.333  1.00 81.63  ?  320 ASP B C     1 
ATOM   6146  O  O     . ASP B 1 320 ? -27.968  61.706  11.245  1.00 79.03  ?  320 ASP B O     1 
ATOM   6147  C  CB    . ASP B 1 320 ? -27.515  64.220  9.904   1.00 83.62  ?  320 ASP B CB    1 
ATOM   6148  C  CG    . ASP B 1 320 ? -27.967  65.675  9.994   1.00 86.79  ?  320 ASP B CG    1 
ATOM   6149  O  OD1   . ASP B 1 320 ? -28.112  66.194  11.131  1.00 83.86  ?  320 ASP B OD1   1 
ATOM   6150  O  OD2   . ASP B 1 320 ? -28.194  66.289  8.923   1.00 90.17  ?  320 ASP B OD2   1 
ATOM   6151  N  N     . LEU B 1 321 ? -25.741  61.599  11.575  1.00 84.11  ?  321 LEU B N     1 
ATOM   6152  C  CA    . LEU B 1 321 ? -25.746  60.197  11.973  1.00 83.99  ?  321 LEU B CA    1 
ATOM   6153  C  C     . LEU B 1 321 ? -26.659  60.042  13.178  1.00 79.21  ?  321 LEU B C     1 
ATOM   6154  O  O     . LEU B 1 321 ? -27.095  58.940  13.512  1.00 78.11  ?  321 LEU B O     1 
ATOM   6155  C  CB    . LEU B 1 321 ? -24.346  59.755  12.361  1.00 85.92  ?  321 LEU B CB    1 
ATOM   6156  C  CG    . LEU B 1 321 ? -23.697  58.662  11.531  1.00 84.75  ?  321 LEU B CG    1 
ATOM   6157  C  CD1   . LEU B 1 321 ? -22.756  57.886  12.431  1.00 90.44  ?  321 LEU B CD1   1 
ATOM   6158  C  CD2   . LEU B 1 321 ? -24.748  57.770  10.921  1.00 79.38  ?  321 LEU B CD2   1 
ATOM   6159  N  N     . GLN B 1 322 ? -26.915  61.164  13.843  1.00 72.58  ?  322 GLN B N     1 
ATOM   6160  C  CA    . GLN B 1 322 ? -27.931  61.247  14.877  1.00 72.95  ?  322 GLN B CA    1 
ATOM   6161  C  C     . GLN B 1 322 ? -28.469  62.663  14.960  1.00 72.49  ?  322 GLN B C     1 
ATOM   6162  O  O     . GLN B 1 322 ? -27.681  63.637  14.958  1.00 84.14  ?  322 GLN B O     1 
ATOM   6163  C  CB    . GLN B 1 322 ? -27.369  60.872  16.231  1.00 80.23  ?  322 GLN B CB    1 
ATOM   6164  C  CG    . GLN B 1 322 ? -28.254  61.367  17.347  1.00 83.14  ?  322 GLN B CG    1 
ATOM   6165  C  CD    . GLN B 1 322 ? -27.665  61.156  18.718  1.00 80.68  ?  322 GLN B CD    1 
ATOM   6166  O  OE1   . GLN B 1 322 ? -26.565  60.608  18.879  1.00 77.83  ?  322 GLN B OE1   1 
ATOM   6167  N  NE2   . GLN B 1 322 ? -28.402  61.589  19.728  1.00 86.29  ?  322 GLN B NE2   1 
ATOM   6168  N  N     . ILE B 1 323 ? -29.791  62.749  15.102  1.00 76.33  ?  323 ILE B N     1 
ATOM   6169  C  CA    . ILE B 1 323 ? -30.520  64.002  14.991  1.00 77.15  ?  323 ILE B CA    1 
ATOM   6170  C  C     . ILE B 1 323 ? -31.636  64.072  16.013  1.00 80.61  ?  323 ILE B C     1 
ATOM   6171  O  O     . ILE B 1 323 ? -31.923  63.081  16.679  1.00 85.51  ?  323 ILE B O     1 
ATOM   6172  C  CB    . ILE B 1 323 ? -31.234  64.077  13.638  1.00 76.45  ?  323 ILE B CB    1 
ATOM   6173  C  CG1   . ILE B 1 323 ? -32.408  63.088  13.636  1.00 69.83  ?  323 ILE B CG1   1 
ATOM   6174  C  CG2   . ILE B 1 323 ? -30.259  63.827  12.497  1.00 78.71  ?  323 ILE B CG2   1 
ATOM   6175  C  CD1   . ILE B 1 323 ? -33.083  62.916  12.319  1.00 69.15  ?  323 ILE B CD1   1 
ATOM   6176  N  N     . ASN B 1 324 ? -32.283  65.240  16.098  1.00 78.58  ?  324 ASN B N     1 
ATOM   6177  C  CA    . ASN B 1 324 ? -33.543  65.402  16.835  1.00 78.15  ?  324 ASN B CA    1 
ATOM   6178  C  C     . ASN B 1 324 ? -34.784  65.367  15.934  1.00 83.31  ?  324 ASN B C     1 
ATOM   6179  O  O     . ASN B 1 324 ? -34.899  66.178  15.017  1.00 91.70  ?  324 ASN B O     1 
ATOM   6180  C  CB    . ASN B 1 324 ? -33.576  66.741  17.580  1.00 77.07  ?  324 ASN B CB    1 
ATOM   6181  C  CG    . ASN B 1 324 ? -32.404  66.931  18.525  1.00 82.66  ?  324 ASN B CG    1 
ATOM   6182  O  OD1   . ASN B 1 324 ? -31.879  65.978  19.116  1.00 85.63  ?  324 ASN B OD1   1 
ATOM   6183  N  ND2   . ASN B 1 324 ? -31.992  68.182  18.681  1.00 84.20  ?  324 ASN B ND2   1 
ATOM   6184  N  N     . TYR B 1 325 ? -35.716  64.449  16.200  1.00 79.81  ?  325 TYR B N     1 
ATOM   6185  C  CA    . TYR B 1 325 ? -37.055  64.534  15.611  1.00 72.17  ?  325 TYR B CA    1 
ATOM   6186  C  C     . TYR B 1 325 ? -37.983  65.315  16.546  1.00 71.44  ?  325 TYR B C     1 
ATOM   6187  O  O     . TYR B 1 325 ? -38.065  64.993  17.726  1.00 74.42  ?  325 TYR B O     1 
ATOM   6188  C  CB    . TYR B 1 325 ? -37.662  63.149  15.355  1.00 65.48  ?  325 TYR B CB    1 
ATOM   6189  C  CG    . TYR B 1 325 ? -38.994  63.271  14.660  1.00 65.30  ?  325 TYR B CG    1 
ATOM   6190  C  CD1   . TYR B 1 325 ? -40.137  63.635  15.362  1.00 76.01  ?  325 TYR B CD1   1 
ATOM   6191  C  CD2   . TYR B 1 325 ? -39.104  63.084  13.290  1.00 61.73  ?  325 TYR B CD2   1 
ATOM   6192  C  CE1   . TYR B 1 325 ? -41.364  63.783  14.716  1.00 79.42  ?  325 TYR B CE1   1 
ATOM   6193  C  CE2   . TYR B 1 325 ? -40.314  63.240  12.634  1.00 68.80  ?  325 TYR B CE2   1 
ATOM   6194  C  CZ    . TYR B 1 325 ? -41.442  63.585  13.346  1.00 75.29  ?  325 TYR B CZ    1 
ATOM   6195  O  OH    . TYR B 1 325 ? -42.640  63.730  12.682  1.00 75.94  ?  325 TYR B OH    1 
ATOM   6196  N  N     . ASN B 1 326 ? -38.678  66.332  16.037  1.00 70.22  ?  326 ASN B N     1 
ATOM   6197  C  CA    . ASN B 1 326 ? -39.649  67.059  16.870  1.00 71.34  ?  326 ASN B CA    1 
ATOM   6198  C  C     . ASN B 1 326 ? -41.094  66.778  16.496  1.00 68.83  ?  326 ASN B C     1 
ATOM   6199  O  O     . ASN B 1 326 ? -41.531  67.075  15.387  1.00 67.46  ?  326 ASN B O     1 
ATOM   6200  C  CB    . ASN B 1 326 ? -39.434  68.576  16.826  1.00 74.63  ?  326 ASN B CB    1 
ATOM   6201  C  CG    . ASN B 1 326 ? -38.231  69.024  17.616  1.00 81.42  ?  326 ASN B CG    1 
ATOM   6202  O  OD1   . ASN B 1 326 ? -38.348  69.412  18.780  1.00 94.31  ?  326 ASN B OD1   1 
ATOM   6203  N  ND2   . ASN B 1 326 ? -37.065  68.986  16.987  1.00 72.52  ?  326 ASN B ND2   1 
ATOM   6204  N  N     . PHE B 1 327 ? -41.851  66.219  17.427  1.00 69.83  ?  327 PHE B N     1 
ATOM   6205  C  CA    . PHE B 1 327 ? -43.269  66.066  17.197  1.00 67.64  ?  327 PHE B CA    1 
ATOM   6206  C  C     . PHE B 1 327 ? -43.874  67.452  17.130  1.00 70.33  ?  327 PHE B C     1 
ATOM   6207  O  O     . PHE B 1 327 ? -43.563  68.309  17.961  1.00 77.12  ?  327 PHE B O     1 
ATOM   6208  C  CB    . PHE B 1 327 ? -43.909  65.313  18.346  1.00 67.28  ?  327 PHE B CB    1 
ATOM   6209  C  CG    . PHE B 1 327 ? -43.503  63.872  18.441  1.00 65.65  ?  327 PHE B CG    1 
ATOM   6210  C  CD1   . PHE B 1 327 ? -44.340  62.870  17.966  1.00 63.81  ?  327 PHE B CD1   1 
ATOM   6211  C  CD2   . PHE B 1 327 ? -42.310  63.516  19.043  1.00 63.85  ?  327 PHE B CD2   1 
ATOM   6212  C  CE1   . PHE B 1 327 ? -43.983  61.537  18.069  1.00 59.39  ?  327 PHE B CE1   1 
ATOM   6213  C  CE2   . PHE B 1 327 ? -41.941  62.182  19.148  1.00 63.28  ?  327 PHE B CE2   1 
ATOM   6214  C  CZ    . PHE B 1 327 ? -42.776  61.193  18.656  1.00 59.50  ?  327 PHE B CZ    1 
ATOM   6215  N  N     . ASN B 1 328 ? -44.712  67.682  16.129  1.00 69.92  ?  328 ASN B N     1 
ATOM   6216  C  CA    . ASN B 1 328 ? -45.572  68.862  16.106  1.00 71.21  ?  328 ASN B CA    1 
ATOM   6217  C  C     . ASN B 1 328 ? -46.934  68.490  15.543  1.00 70.69  ?  328 ASN B C     1 
ATOM   6218  O  O     . ASN B 1 328 ? -47.366  69.012  14.526  1.00 74.47  ?  328 ASN B O     1 
ATOM   6219  C  CB    . ASN B 1 328 ? -44.949  69.981  15.283  1.00 73.94  ?  328 ASN B CB    1 
ATOM   6220  C  CG    . ASN B 1 328 ? -45.685  71.291  15.445  1.00 73.12  ?  328 ASN B CG    1 
ATOM   6221  O  OD1   . ASN B 1 328 ? -46.462  71.468  16.393  1.00 67.08  ?  328 ASN B OD1   1 
ATOM   6222  N  ND2   . ASN B 1 328 ? -45.448  72.224  14.519  1.00 77.44  ?  328 ASN B ND2   1 
ATOM   6223  N  N     . MET B 1 329 ? -47.603  67.576  16.223  1.00 68.81  ?  329 MET B N     1 
ATOM   6224  C  CA    . MET B 1 329 ? -48.782  66.929  15.682  1.00 68.14  ?  329 MET B CA    1 
ATOM   6225  C  C     . MET B 1 329 ? -49.983  67.859  15.557  1.00 70.57  ?  329 MET B C     1 
ATOM   6226  O  O     . MET B 1 329 ? -50.761  68.040  16.498  1.00 68.40  ?  329 MET B O     1 
ATOM   6227  C  CB    . MET B 1 329 ? -49.133  65.722  16.538  1.00 66.76  ?  329 MET B CB    1 
ATOM   6228  C  CG    . MET B 1 329 ? -47.908  64.998  17.059  1.00 66.04  ?  329 MET B CG    1 
ATOM   6229  S  SD    . MET B 1 329 ? -48.277  63.258  17.279  1.00 78.28  ?  329 MET B SD    1 
ATOM   6230  C  CE    . MET B 1 329 ? -49.740  63.336  18.313  1.00 95.23  ?  329 MET B CE    1 
ATOM   6231  N  N     . VAL B 1 330 ? -50.131  68.425  14.366  1.00 71.49  ?  330 VAL B N     1 
ATOM   6232  C  CA    . VAL B 1 330 ? -51.255  69.284  14.045  1.00 69.03  ?  330 VAL B CA    1 
ATOM   6233  C  C     . VAL B 1 330 ? -52.059  68.688  12.903  1.00 64.39  ?  330 VAL B C     1 
ATOM   6234  O  O     . VAL B 1 330 ? -51.502  68.082  11.991  1.00 67.59  ?  330 VAL B O     1 
ATOM   6235  C  CB    . VAL B 1 330 ? -50.784  70.677  13.656  1.00 66.58  ?  330 VAL B CB    1 
ATOM   6236  C  CG1   . VAL B 1 330 ? -51.933  71.464  13.093  1.00 66.95  ?  330 VAL B CG1   1 
ATOM   6237  C  CG2   . VAL B 1 330 ? -50.224  71.357  14.864  1.00 72.61  ?  330 VAL B CG2   1 
ATOM   6238  N  N     . ALA B 1 331 ? -53.373  68.865  12.964  1.00 60.54  ?  331 ALA B N     1 
ATOM   6239  C  CA    . ALA B 1 331 ? -54.275  68.276  11.987  1.00 60.27  ?  331 ALA B CA    1 
ATOM   6240  C  C     . ALA B 1 331 ? -55.611  69.008  12.011  1.00 60.93  ?  331 ALA B C     1 
ATOM   6241  O  O     . ALA B 1 331 ? -55.818  69.924  12.811  1.00 61.62  ?  331 ALA B O     1 
ATOM   6242  C  CB    . ALA B 1 331 ? -54.469  66.794  12.260  1.00 47.46  ?  331 ALA B CB    1 
ATOM   6243  N  N     . ILE B 1 332 ? -56.514  68.611  11.125  1.00 60.12  ?  332 ILE B N     1 
ATOM   6244  C  CA    . ILE B 1 332 ? -57.736  69.362  10.945  1.00 60.86  ?  332 ILE B CA    1 
ATOM   6245  C  C     . ILE B 1 332 ? -58.890  68.580  11.521  1.00 67.87  ?  332 ILE B C     1 
ATOM   6246  O  O     . ILE B 1 332 ? -59.201  67.481  11.072  1.00 65.72  ?  332 ILE B O     1 
ATOM   6247  C  CB    . ILE B 1 332 ? -57.980  69.721  9.462   1.00 57.15  ?  332 ILE B CB    1 
ATOM   6248  C  CG1   . ILE B 1 332 ? -56.738  70.389  8.879   1.00 59.04  ?  332 ILE B CG1   1 
ATOM   6249  C  CG2   . ILE B 1 332 ? -59.129  70.697  9.329   1.00 49.58  ?  332 ILE B CG2   1 
ATOM   6250  C  CD1   . ILE B 1 332 ? -56.684  71.885  9.127   1.00 60.08  ?  332 ILE B CD1   1 
ATOM   6251  N  N     . ASP B 1 333 ? -59.494  69.164  12.548  1.00 73.28  ?  333 ASP B N     1 
ATOM   6252  C  CA    . ASP B 1 333 ? -60.619  68.580  13.257  1.00 71.83  ?  333 ASP B CA    1 
ATOM   6253  C  C     . ASP B 1 333 ? -61.738  69.591  13.161  1.00 71.38  ?  333 ASP B C     1 
ATOM   6254  O  O     . ASP B 1 333 ? -61.489  70.795  13.183  1.00 78.82  ?  333 ASP B O     1 
ATOM   6255  C  CB    . ASP B 1 333 ? -60.258  68.357  14.723  1.00 83.37  ?  333 ASP B CB    1 
ATOM   6256  C  CG    . ASP B 1 333 ? -61.264  67.489  15.439  1.00 98.57  ?  333 ASP B CG    1 
ATOM   6257  O  OD1   . ASP B 1 333 ? -61.616  67.800  16.607  1.00 101.83 ?  333 ASP B OD1   1 
ATOM   6258  O  OD2   . ASP B 1 333 ? -61.697  66.487  14.826  1.00 103.14 ?  333 ASP B OD2   1 
ATOM   6259  N  N     . ASN B 1 334 ? -62.971  69.119  13.062  1.00 64.25  ?  334 ASN B N     1 
ATOM   6260  C  CA    . ASN B 1 334 ? -64.079  70.021  12.768  1.00 62.05  ?  334 ASN B CA    1 
ATOM   6261  C  C     . ASN B 1 334 ? -63.651  71.285  12.005  1.00 64.86  ?  334 ASN B C     1 
ATOM   6262  O  O     . ASN B 1 334 ? -63.920  72.406  12.451  1.00 64.98  ?  334 ASN B O     1 
ATOM   6263  C  CB    . ASN B 1 334 ? -64.824  70.402  14.041  1.00 67.61  ?  334 ASN B CB    1 
ATOM   6264  C  CG    . ASN B 1 334 ? -66.167  71.020  13.751  1.00 83.46  ?  334 ASN B CG    1 
ATOM   6265  O  OD1   . ASN B 1 334 ? -66.759  70.767  12.703  1.00 88.02  ?  334 ASN B OD1   1 
ATOM   6266  N  ND2   . ASN B 1 334 ? -66.657  71.838  14.671  1.00 91.58  ?  334 ASN B ND2   1 
ATOM   6267  N  N     . PHE B 1 335 ? -62.970  71.091  10.871  1.00 65.00  ?  335 PHE B N     1 
ATOM   6268  C  CA    . PHE B 1 335 ? -62.571  72.182  9.979   1.00 70.84  ?  335 PHE B CA    1 
ATOM   6269  C  C     . PHE B 1 335 ? -61.505  73.148  10.517  1.00 77.14  ?  335 PHE B C     1 
ATOM   6270  O  O     . PHE B 1 335 ? -61.172  74.139  9.868   1.00 76.81  ?  335 PHE B O     1 
ATOM   6271  C  CB    . PHE B 1 335 ? -63.801  72.981  9.560   1.00 74.30  ?  335 PHE B CB    1 
ATOM   6272  C  CG    . PHE B 1 335 ? -64.901  72.134  9.035   1.00 83.26  ?  335 PHE B CG    1 
ATOM   6273  C  CD1   . PHE B 1 335 ? -65.866  71.627  9.889   1.00 88.47  ?  335 PHE B CD1   1 
ATOM   6274  C  CD2   . PHE B 1 335 ? -64.963  71.817  7.689   1.00 86.88  ?  335 PHE B CD2   1 
ATOM   6275  C  CE1   . PHE B 1 335 ? -66.888  70.828  9.411   1.00 87.37  ?  335 PHE B CE1   1 
ATOM   6276  C  CE2   . PHE B 1 335 ? -65.981  71.021  7.207   1.00 89.95  ?  335 PHE B CE2   1 
ATOM   6277  C  CZ    . PHE B 1 335 ? -66.948  70.525  8.075   1.00 88.41  ?  335 PHE B CZ    1 
ATOM   6278  N  N     . THR B 1 336 ? -60.974  72.879  11.700  1.00 76.07  ?  336 THR B N     1 
ATOM   6279  C  CA    . THR B 1 336 ? -60.043  73.822  12.303  1.00 76.17  ?  336 THR B CA    1 
ATOM   6280  C  C     . THR B 1 336 ? -58.695  73.168  12.534  1.00 71.76  ?  336 THR B C     1 
ATOM   6281  O  O     . THR B 1 336 ? -58.613  71.965  12.762  1.00 70.45  ?  336 THR B O     1 
ATOM   6282  C  CB    . THR B 1 336 ? -60.562  74.371  13.654  1.00 82.48  ?  336 THR B CB    1 
ATOM   6283  O  OG1   . THR B 1 336 ? -61.946  74.745  13.543  1.00 81.70  ?  336 THR B OG1   1 
ATOM   6284  C  CG2   . THR B 1 336 ? -59.728  75.575  14.076  1.00 90.61  ?  336 THR B CG2   1 
ATOM   6285  N  N     . PRO B 1 337 ? -57.619  73.953  12.452  1.00 68.71  ?  337 PRO B N     1 
ATOM   6286  C  CA    . PRO B 1 337 ? -56.355  73.316  12.816  1.00 66.88  ?  337 PRO B CA    1 
ATOM   6287  C  C     . PRO B 1 337 ? -56.395  73.089  14.320  1.00 70.96  ?  337 PRO B C     1 
ATOM   6288  O  O     . PRO B 1 337 ? -57.057  73.856  15.017  1.00 71.30  ?  337 PRO B O     1 
ATOM   6289  C  CB    . PRO B 1 337 ? -55.308  74.358  12.423  1.00 65.88  ?  337 PRO B CB    1 
ATOM   6290  C  CG    . PRO B 1 337 ? -56.044  75.662  12.436  1.00 69.11  ?  337 PRO B CG    1 
ATOM   6291  C  CD    . PRO B 1 337 ? -57.453  75.352  12.024  1.00 69.40  ?  337 PRO B CD    1 
ATOM   6292  N  N     . ARG B 1 338 ? -55.724  72.046  14.800  1.00 72.07  ?  338 ARG B N     1 
ATOM   6293  C  CA    . ARG B 1 338 ? -55.852  71.617  16.184  1.00 73.29  ?  338 ARG B CA    1 
ATOM   6294  C  C     . ARG B 1 338 ? -54.586  70.864  16.581  1.00 78.36  ?  338 ARG B C     1 
ATOM   6295  O  O     . ARG B 1 338 ? -54.285  69.813  16.022  1.00 83.77  ?  338 ARG B O     1 
ATOM   6296  C  CB    . ARG B 1 338 ? -57.077  70.701  16.326  1.00 73.61  ?  338 ARG B CB    1 
ATOM   6297  C  CG    . ARG B 1 338 ? -57.989  70.988  17.507  1.00 85.06  ?  338 ARG B CG    1 
ATOM   6298  C  CD    . ARG B 1 338 ? -57.770  69.997  18.659  1.00 98.89  ?  338 ARG B CD    1 
ATOM   6299  N  NE    . ARG B 1 338 ? -58.829  68.986  18.744  1.00 107.42 ?  338 ARG B NE    1 
ATOM   6300  C  CZ    . ARG B 1 338 ? -59.165  68.321  19.852  1.00 108.53 ?  338 ARG B CZ    1 
ATOM   6301  N  NH1   . ARG B 1 338 ? -58.535  68.550  21.002  1.00 105.20 ?  338 ARG B NH1   1 
ATOM   6302  N  NH2   . ARG B 1 338 ? -60.144  67.426  19.808  1.00 110.57 ?  338 ARG B NH2   1 
ATOM   6303  N  N     . GLN B 1 339 ? -53.830  71.404  17.530  1.00 78.60  ?  339 GLN B N     1 
ATOM   6304  C  CA    . GLN B 1 339 ? -52.687  70.674  18.063  1.00 72.65  ?  339 GLN B CA    1 
ATOM   6305  C  C     . GLN B 1 339 ? -53.239  69.510  18.877  1.00 72.20  ?  339 GLN B C     1 
ATOM   6306  O  O     . GLN B 1 339 ? -54.121  69.693  19.708  1.00 77.56  ?  339 GLN B O     1 
ATOM   6307  C  CB    . GLN B 1 339 ? -51.832  71.582  18.928  1.00 69.63  ?  339 GLN B CB    1 
ATOM   6308  C  CG    . GLN B 1 339 ? -50.593  70.915  19.456  1.00 72.14  ?  339 GLN B CG    1 
ATOM   6309  C  CD    . GLN B 1 339 ? -49.456  71.897  19.626  1.00 79.34  ?  339 GLN B CD    1 
ATOM   6310  O  OE1   . GLN B 1 339 ? -49.082  72.605  18.681  1.00 88.56  ?  339 GLN B OE1   1 
ATOM   6311  N  NE2   . GLN B 1 339 ? -48.901  71.954  20.827  1.00 73.74  ?  339 GLN B NE2   1 
ATOM   6312  N  N     . VAL B 1 340 ? -52.751  68.305  18.624  1.00 67.73  ?  340 VAL B N     1 
ATOM   6313  C  CA    . VAL B 1 340 ? -53.428  67.138  19.165  1.00 70.60  ?  340 VAL B CA    1 
ATOM   6314  C  C     . VAL B 1 340 ? -52.462  66.034  19.488  1.00 75.31  ?  340 VAL B C     1 
ATOM   6315  O  O     . VAL B 1 340 ? -51.444  65.863  18.817  1.00 84.89  ?  340 VAL B O     1 
ATOM   6316  C  CB    . VAL B 1 340 ? -54.476  66.583  18.186  1.00 67.28  ?  340 VAL B CB    1 
ATOM   6317  C  CG1   . VAL B 1 340 ? -55.487  67.676  17.797  1.00 65.83  ?  340 VAL B CG1   1 
ATOM   6318  C  CG2   . VAL B 1 340 ? -53.788  65.991  16.950  1.00 61.18  ?  340 VAL B CG2   1 
ATOM   6319  N  N     . GLY B 1 341 ? -52.800  65.286  20.525  1.00 70.16  ?  341 GLY B N     1 
ATOM   6320  C  CA    . GLY B 1 341 ? -51.981  64.190  20.987  1.00 73.34  ?  341 GLY B CA    1 
ATOM   6321  C  C     . GLY B 1 341 ? -52.692  62.884  20.715  1.00 76.79  ?  341 GLY B C     1 
ATOM   6322  O  O     . GLY B 1 341 ? -53.721  62.853  20.027  1.00 75.74  ?  341 GLY B O     1 
ATOM   6323  N  N     . ILE B 1 342 ? -52.153  61.807  21.271  1.00 78.63  ?  342 ILE B N     1 
ATOM   6324  C  CA    . ILE B 1 342 ? -52.611  60.472  20.936  1.00 74.19  ?  342 ILE B CA    1 
ATOM   6325  C  C     . ILE B 1 342 ? -54.115  60.288  21.084  1.00 75.98  ?  342 ILE B C     1 
ATOM   6326  O  O     . ILE B 1 342 ? -54.732  59.542  20.330  1.00 80.43  ?  342 ILE B O     1 
ATOM   6327  C  CB    . ILE B 1 342 ? -51.859  59.415  21.746  1.00 78.24  ?  342 ILE B CB    1 
ATOM   6328  C  CG1   . ILE B 1 342 ? -50.586  59.072  21.012  1.00 81.26  ?  342 ILE B CG1   1 
ATOM   6329  C  CG2   . ILE B 1 342 ? -52.662  58.152  21.835  1.00 80.90  ?  342 ILE B CG2   1 
ATOM   6330  C  CD1   . ILE B 1 342 ? -50.843  58.916  19.514  1.00 82.80  ?  342 ILE B CD1   1 
ATOM   6331  N  N     . VAL B 1 343 ? -54.714  60.983  22.038  1.00 68.23  ?  343 VAL B N     1 
ATOM   6332  C  CA    . VAL B 1 343 ? -56.109  60.726  22.366  1.00 66.81  ?  343 VAL B CA    1 
ATOM   6333  C  C     . VAL B 1 343 ? -57.132  61.435  21.470  1.00 69.69  ?  343 VAL B C     1 
ATOM   6334  O  O     . VAL B 1 343 ? -58.056  60.806  20.946  1.00 72.61  ?  343 VAL B O     1 
ATOM   6335  C  CB    . VAL B 1 343 ? -56.366  61.029  23.835  1.00 57.09  ?  343 VAL B CB    1 
ATOM   6336  C  CG1   . VAL B 1 343 ? -57.850  61.345  24.079  1.00 52.58  ?  343 VAL B CG1   1 
ATOM   6337  C  CG2   . VAL B 1 343 ? -55.876  59.864  24.654  1.00 51.31  ?  343 VAL B CG2   1 
ATOM   6338  N  N     . PRO B 1 344 ? -56.989  62.749  21.305  1.00 66.04  ?  344 PRO B N     1 
ATOM   6339  C  CA    . PRO B 1 344 ? -57.796  63.422  20.276  1.00 69.71  ?  344 PRO B CA    1 
ATOM   6340  C  C     . PRO B 1 344 ? -57.688  62.723  18.914  1.00 70.04  ?  344 PRO B C     1 
ATOM   6341  O  O     . PRO B 1 344 ? -58.659  62.718  18.165  1.00 74.91  ?  344 PRO B O     1 
ATOM   6342  C  CB    . PRO B 1 344 ? -57.220  64.855  20.223  1.00 70.00  ?  344 PRO B CB    1 
ATOM   6343  C  CG    . PRO B 1 344 ? -55.993  64.828  21.099  1.00 74.37  ?  344 PRO B CG    1 
ATOM   6344  C  CD    . PRO B 1 344 ? -56.169  63.683  22.076  1.00 68.26  ?  344 PRO B CD    1 
ATOM   6345  N  N     . ILE B 1 345 ? -56.537  62.131  18.605  1.00 64.12  ?  345 ILE B N     1 
ATOM   6346  C  CA    . ILE B 1 345 ? -56.382  61.384  17.359  1.00 64.28  ?  345 ILE B CA    1 
ATOM   6347  C  C     . ILE B 1 345 ? -57.240  60.114  17.392  1.00 65.09  ?  345 ILE B C     1 
ATOM   6348  O  O     . ILE B 1 345 ? -58.313  60.069  16.781  1.00 72.65  ?  345 ILE B O     1 
ATOM   6349  C  CB    . ILE B 1 345 ? -54.891  61.056  17.069  1.00 61.19  ?  345 ILE B CB    1 
ATOM   6350  C  CG1   . ILE B 1 345 ? -54.166  62.291  16.537  1.00 59.96  ?  345 ILE B CG1   1 
ATOM   6351  C  CG2   . ILE B 1 345 ? -54.748  59.901  16.074  1.00 63.99  ?  345 ILE B CG2   1 
ATOM   6352  C  CD1   . ILE B 1 345 ? -52.670  62.179  16.607  1.00 54.53  ?  345 ILE B CD1   1 
ATOM   6353  N  N     . LEU B 1 346 ? -56.791  59.089  18.113  1.00 55.80  ?  346 LEU B N     1 
ATOM   6354  C  CA    . LEU B 1 346 ? -57.557  57.842  18.172  1.00 60.14  ?  346 LEU B CA    1 
ATOM   6355  C  C     . LEU B 1 346 ? -59.069  58.042  18.411  1.00 66.46  ?  346 LEU B C     1 
ATOM   6356  O  O     . LEU B 1 346 ? -59.904  57.344  17.838  1.00 67.69  ?  346 LEU B O     1 
ATOM   6357  C  CB    . LEU B 1 346 ? -56.977  56.912  19.223  1.00 56.51  ?  346 LEU B CB    1 
ATOM   6358  C  CG    . LEU B 1 346 ? -55.542  56.490  18.949  1.00 55.01  ?  346 LEU B CG    1 
ATOM   6359  C  CD1   . LEU B 1 346 ? -54.976  55.702  20.159  1.00 53.88  ?  346 LEU B CD1   1 
ATOM   6360  C  CD2   . LEU B 1 346 ? -55.474  55.686  17.644  1.00 52.70  ?  346 LEU B CD2   1 
ATOM   6361  N  N     . SER B 1 347 ? -59.422  58.989  19.267  1.00 67.44  ?  347 SER B N     1 
ATOM   6362  C  CA    . SER B 1 347 ? -60.824  59.256  19.518  1.00 71.00  ?  347 SER B CA    1 
ATOM   6363  C  C     . SER B 1 347 ? -61.496  59.651  18.189  1.00 73.84  ?  347 SER B C     1 
ATOM   6364  O  O     . SER B 1 347 ? -62.436  58.994  17.743  1.00 69.94  ?  347 SER B O     1 
ATOM   6365  C  CB    . SER B 1 347 ? -60.978  60.334  20.600  1.00 75.78  ?  347 SER B CB    1 
ATOM   6366  O  OG    . SER B 1 347 ? -61.716  61.452  20.125  1.00 83.28  ?  347 SER B OG    1 
ATOM   6367  N  N     . SER B 1 348 ? -60.981  60.699  17.549  1.00 77.04  ?  348 SER B N     1 
ATOM   6368  C  CA    . SER B 1 348 ? -61.508  61.170  16.273  1.00 74.59  ?  348 SER B CA    1 
ATOM   6369  C  C     . SER B 1 348 ? -61.610  60.067  15.230  1.00 69.11  ?  348 SER B C     1 
ATOM   6370  O  O     . SER B 1 348 ? -62.516  60.090  14.382  1.00 71.23  ?  348 SER B O     1 
ATOM   6371  C  CB    . SER B 1 348 ? -60.653  62.309  15.723  1.00 76.58  ?  348 SER B CB    1 
ATOM   6372  O  OG    . SER B 1 348 ? -61.098  63.554  16.230  1.00 86.54  ?  348 SER B OG    1 
ATOM   6373  N  N     . TYR B 1 349 ? -60.677  59.115  15.299  1.00 60.06  ?  349 TYR B N     1 
ATOM   6374  C  CA    . TYR B 1 349 ? -60.628  58.015  14.346  1.00 59.19  ?  349 TYR B CA    1 
ATOM   6375  C  C     . TYR B 1 349 ? -61.784  57.063  14.593  1.00 60.32  ?  349 TYR B C     1 
ATOM   6376  O  O     . TYR B 1 349 ? -62.642  56.856  13.731  1.00 57.57  ?  349 TYR B O     1 
ATOM   6377  C  CB    . TYR B 1 349 ? -59.291  57.258  14.419  1.00 58.66  ?  349 TYR B CB    1 
ATOM   6378  C  CG    . TYR B 1 349 ? -59.292  56.031  13.536  1.00 57.20  ?  349 TYR B CG    1 
ATOM   6379  C  CD1   . TYR B 1 349 ? -59.090  56.144  12.165  1.00 64.10  ?  349 TYR B CD1   1 
ATOM   6380  C  CD2   . TYR B 1 349 ? -59.549  54.772  14.060  1.00 60.46  ?  349 TYR B CD2   1 
ATOM   6381  C  CE1   . TYR B 1 349 ? -59.114  55.031  11.342  1.00 72.81  ?  349 TYR B CE1   1 
ATOM   6382  C  CE2   . TYR B 1 349 ? -59.566  53.646  13.251  1.00 67.87  ?  349 TYR B CE2   1 
ATOM   6383  C  CZ    . TYR B 1 349 ? -59.356  53.784  11.889  1.00 74.61  ?  349 TYR B CZ    1 
ATOM   6384  O  OH    . TYR B 1 349 ? -59.384  52.686  11.065  1.00 73.62  ?  349 TYR B OH    1 
ATOM   6385  N  N     . ILE B 1 350 ? -61.783  56.480  15.781  1.00 62.96  ?  350 ILE B N     1 
ATOM   6386  C  CA    . ILE B 1 350 ? -62.920  55.732  16.297  1.00 58.29  ?  350 ILE B CA    1 
ATOM   6387  C  C     . ILE B 1 350 ? -64.270  56.406  15.985  1.00 59.34  ?  350 ILE B C     1 
ATOM   6388  O  O     . ILE B 1 350 ? -65.213  55.751  15.514  1.00 57.56  ?  350 ILE B O     1 
ATOM   6389  C  CB    . ILE B 1 350 ? -62.756  55.527  17.821  1.00 54.20  ?  350 ILE B CB    1 
ATOM   6390  C  CG1   . ILE B 1 350 ? -61.495  54.682  18.084  1.00 56.16  ?  350 ILE B CG1   1 
ATOM   6391  C  CG2   . ILE B 1 350 ? -64.026  54.934  18.433  1.00 42.98  ?  350 ILE B CG2   1 
ATOM   6392  C  CD1   . ILE B 1 350 ? -61.565  53.830  19.310  1.00 57.18  ?  350 ILE B CD1   1 
ATOM   6393  N  N     . ALA B 1 351 ? -64.347  57.713  16.234  1.00 58.47  ?  351 ALA B N     1 
ATOM   6394  C  CA    . ALA B 1 351 ? -65.572  58.491  16.010  1.00 60.71  ?  351 ALA B CA    1 
ATOM   6395  C  C     . ALA B 1 351 ? -66.037  58.293  14.615  1.00 64.49  ?  351 ALA B C     1 
ATOM   6396  O  O     . ALA B 1 351 ? -67.213  58.005  14.371  1.00 67.57  ?  351 ALA B O     1 
ATOM   6397  C  CB    . ALA B 1 351 ? -65.306  59.981  16.202  1.00 64.43  ?  351 ALA B CB    1 
ATOM   6398  N  N     . HIS B 1 352 ? -65.076  58.511  13.714  1.00 67.28  ?  352 HIS B N     1 
ATOM   6399  C  CA    . HIS B 1 352 ? -65.245  58.463  12.276  1.00 65.55  ?  352 HIS B CA    1 
ATOM   6400  C  C     . HIS B 1 352 ? -65.547  57.040  11.787  1.00 64.04  ?  352 HIS B C     1 
ATOM   6401  O  O     . HIS B 1 352 ? -66.520  56.812  11.047  1.00 67.24  ?  352 HIS B O     1 
ATOM   6402  C  CB    . HIS B 1 352 ? -63.970  59.001  11.638  1.00 64.91  ?  352 HIS B CB    1 
ATOM   6403  C  CG    . HIS B 1 352 ? -63.948  58.885  10.155  1.00 68.42  ?  352 HIS B CG    1 
ATOM   6404  N  ND1   . HIS B 1 352 ? -64.698  59.700  9.340   1.00 74.08  ?  352 HIS B ND1   1 
ATOM   6405  C  CD2   . HIS B 1 352 ? -63.283  58.027  9.343   1.00 67.29  ?  352 HIS B CD2   1 
ATOM   6406  C  CE1   . HIS B 1 352 ? -64.485  59.357  8.078   1.00 76.33  ?  352 HIS B CE1   1 
ATOM   6407  N  NE2   . HIS B 1 352 ? -63.640  58.344  8.055   1.00 72.31  ?  352 HIS B NE2   1 
ATOM   6408  N  N     . ARG B 1 353 ? -64.720  56.084  12.215  1.00 60.86  ?  353 ARG B N     1 
ATOM   6409  C  CA    . ARG B 1 353 ? -64.995  54.677  11.948  1.00 59.94  ?  353 ARG B CA    1 
ATOM   6410  C  C     . ARG B 1 353 ? -66.415  54.302  12.344  1.00 68.07  ?  353 ARG B C     1 
ATOM   6411  O  O     . ARG B 1 353 ? -66.982  53.343  11.817  1.00 75.11  ?  353 ARG B O     1 
ATOM   6412  C  CB    . ARG B 1 353 ? -64.014  53.777  12.687  1.00 58.13  ?  353 ARG B CB    1 
ATOM   6413  C  CG    . ARG B 1 353 ? -62.681  53.573  11.982  1.00 59.33  ?  353 ARG B CG    1 
ATOM   6414  C  CD    . ARG B 1 353 ? -62.871  53.278  10.507  1.00 61.94  ?  353 ARG B CD    1 
ATOM   6415  N  NE    . ARG B 1 353 ? -63.487  51.982  10.260  1.00 66.31  ?  353 ARG B NE    1 
ATOM   6416  C  CZ    . ARG B 1 353 ? -63.819  51.532  9.053   1.00 68.87  ?  353 ARG B CZ    1 
ATOM   6417  N  NH1   . ARG B 1 353 ? -63.608  52.276  7.973   1.00 60.63  ?  353 ARG B NH1   1 
ATOM   6418  N  NH2   . ARG B 1 353 ? -64.368  50.333  8.930   1.00 75.71  ?  353 ARG B NH2   1 
ATOM   6419  N  N     . ARG B 1 354 ? -66.982  55.048  13.285  1.00 68.22  ?  354 ARG B N     1 
ATOM   6420  C  CA    . ARG B 1 354 ? -68.349  54.807  13.730  1.00 71.01  ?  354 ARG B CA    1 
ATOM   6421  C  C     . ARG B 1 354 ? -69.361  55.304  12.692  1.00 69.48  ?  354 ARG B C     1 
ATOM   6422  O  O     . ARG B 1 354 ? -70.159  54.538  12.144  1.00 67.90  ?  354 ARG B O     1 
ATOM   6423  C  CB    . ARG B 1 354 ? -68.592  55.503  15.063  1.00 73.09  ?  354 ARG B CB    1 
ATOM   6424  C  CG    . ARG B 1 354 ? -69.945  55.191  15.675  1.00 73.65  ?  354 ARG B CG    1 
ATOM   6425  C  CD    . ARG B 1 354 ? -70.426  56.286  16.626  1.00 72.53  ?  354 ARG B CD    1 
ATOM   6426  N  NE    . ARG B 1 354 ? -71.822  56.057  16.968  1.00 73.75  ?  354 ARG B NE    1 
ATOM   6427  C  CZ    . ARG B 1 354 ? -72.802  56.934  16.779  1.00 73.55  ?  354 ARG B CZ    1 
ATOM   6428  N  NH1   . ARG B 1 354 ? -72.530  58.130  16.275  1.00 79.44  ?  354 ARG B NH1   1 
ATOM   6429  N  NH2   . ARG B 1 354 ? -74.051  56.617  17.110  1.00 63.40  ?  354 ARG B NH2   1 
ATOM   6430  N  N     . GLU B 1 355 ? -69.323  56.599  12.428  1.00 66.82  ?  355 GLU B N     1 
ATOM   6431  C  CA    . GLU B 1 355 ? -70.153  57.187  11.393  1.00 64.65  ?  355 GLU B CA    1 
ATOM   6432  C  C     . GLU B 1 355 ? -70.156  56.357  10.102  1.00 66.92  ?  355 GLU B C     1 
ATOM   6433  O  O     . GLU B 1 355 ? -71.204  56.207  9.472   1.00 70.91  ?  355 GLU B O     1 
ATOM   6434  C  CB    . GLU B 1 355 ? -69.695  58.613  11.120  1.00 66.87  ?  355 GLU B CB    1 
ATOM   6435  C  CG    . GLU B 1 355 ? -70.067  59.574  12.222  1.00 81.04  ?  355 GLU B CG    1 
ATOM   6436  C  CD    . GLU B 1 355 ? -71.565  59.713  12.382  1.00 95.28  ?  355 GLU B CD    1 
ATOM   6437  O  OE1   . GLU B 1 355 ? -72.025  60.060  13.497  1.00 101.09 ?  355 GLU B OE1   1 
ATOM   6438  O  OE2   . GLU B 1 355 ? -72.279  59.476  11.383  1.00 100.39 ?  355 GLU B OE2   1 
ATOM   6439  N  N     . VAL B 1 356 ? -68.995  55.810  9.735   1.00 59.51  ?  356 VAL B N     1 
ATOM   6440  C  CA    . VAL B 1 356 ? -68.846  55.016  8.508   1.00 55.99  ?  356 VAL B CA    1 
ATOM   6441  C  C     . VAL B 1 356 ? -69.555  53.665  8.561   1.00 62.20  ?  356 VAL B C     1 
ATOM   6442  O  O     . VAL B 1 356 ? -70.395  53.375  7.716   1.00 72.04  ?  356 VAL B O     1 
ATOM   6443  C  CB    . VAL B 1 356 ? -67.360  54.808  8.122   1.00 55.11  ?  356 VAL B CB    1 
ATOM   6444  C  CG1   . VAL B 1 356 ? -67.201  53.595  7.231   1.00 44.71  ?  356 VAL B CG1   1 
ATOM   6445  C  CG2   . VAL B 1 356 ? -66.803  56.065  7.452   1.00 57.22  ?  356 VAL B CG2   1 
ATOM   6446  N  N     . ILE B 1 357 ? -69.214  52.842  9.545   1.00 57.10  ?  357 ILE B N     1 
ATOM   6447  C  CA    . ILE B 1 357 ? -69.907  51.580  9.770   1.00 53.94  ?  357 ILE B CA    1 
ATOM   6448  C  C     . ILE B 1 357 ? -71.437  51.744  9.933   1.00 57.15  ?  357 ILE B C     1 
ATOM   6449  O  O     . ILE B 1 357 ? -72.236  50.927  9.457   1.00 54.00  ?  357 ILE B O     1 
ATOM   6450  C  CB    . ILE B 1 357 ? -69.378  50.936  11.031  1.00 48.77  ?  357 ILE B CB    1 
ATOM   6451  C  CG1   . ILE B 1 357 ? -67.930  50.509  10.822  1.00 54.88  ?  357 ILE B CG1   1 
ATOM   6452  C  CG2   . ILE B 1 357 ? -70.296  49.779  11.468  1.00 46.04  ?  357 ILE B CG2   1 
ATOM   6453  C  CD1   . ILE B 1 357 ? -67.368  49.697  11.976  1.00 64.17  ?  357 ILE B CD1   1 
ATOM   6454  N  N     . LEU B 1 358 ? -71.853  52.798  10.619  1.00 55.11  ?  358 LEU B N     1 
ATOM   6455  C  CA    . LEU B 1 358 ? -73.274  53.076  10.702  1.00 55.75  ?  358 LEU B CA    1 
ATOM   6456  C  C     . LEU B 1 358 ? -73.857  53.406  9.327   1.00 65.53  ?  358 LEU B C     1 
ATOM   6457  O  O     . LEU B 1 358 ? -74.841  52.806  8.909   1.00 71.50  ?  358 LEU B O     1 
ATOM   6458  C  CB    . LEU B 1 358 ? -73.542  54.203  11.689  1.00 58.36  ?  358 LEU B CB    1 
ATOM   6459  C  CG    . LEU B 1 358 ? -73.348  53.785  13.152  1.00 54.36  ?  358 LEU B CG    1 
ATOM   6460  C  CD1   . LEU B 1 358 ? -73.717  54.905  14.122  1.00 51.78  ?  358 LEU B CD1   1 
ATOM   6461  C  CD2   . LEU B 1 358 ? -74.137  52.511  13.437  1.00 62.82  ?  358 LEU B CD2   1 
ATOM   6462  N  N     . ALA B 1 359 ? -73.243  54.358  8.630   1.00 69.56  ?  359 ALA B N     1 
ATOM   6463  C  CA    . ALA B 1 359 ? -73.652  54.717  7.274   1.00 68.34  ?  359 ALA B CA    1 
ATOM   6464  C  C     . ALA B 1 359 ? -73.682  53.527  6.324   1.00 64.32  ?  359 ALA B C     1 
ATOM   6465  O  O     . ALA B 1 359 ? -74.596  53.385  5.509   1.00 69.84  ?  359 ALA B O     1 
ATOM   6466  C  CB    . ALA B 1 359 ? -72.724  55.748  6.723   1.00 71.15  ?  359 ALA B CB    1 
ATOM   6467  N  N     . ARG B 1 360 ? -72.653  52.696  6.407   1.00 56.93  ?  360 ARG B N     1 
ATOM   6468  C  CA    . ARG B 1 360 ? -72.543  51.546  5.533   1.00 57.45  ?  360 ARG B CA    1 
ATOM   6469  C  C     . ARG B 1 360 ? -73.689  50.621  5.826   1.00 61.02  ?  360 ARG B C     1 
ATOM   6470  O  O     . ARG B 1 360 ? -74.366  50.145  4.930   1.00 69.07  ?  360 ARG B O     1 
ATOM   6471  C  CB    . ARG B 1 360 ? -71.239  50.814  5.800   1.00 57.49  ?  360 ARG B CB    1 
ATOM   6472  C  CG    . ARG B 1 360 ? -70.997  49.640  4.899   1.00 60.32  ?  360 ARG B CG    1 
ATOM   6473  C  CD    . ARG B 1 360 ? -70.585  48.459  5.723   1.00 67.91  ?  360 ARG B CD    1 
ATOM   6474  N  NE    . ARG B 1 360 ? -69.161  48.442  6.059   1.00 66.38  ?  360 ARG B NE    1 
ATOM   6475  C  CZ    . ARG B 1 360 ? -68.668  47.941  7.195   1.00 63.66  ?  360 ARG B CZ    1 
ATOM   6476  N  NH1   . ARG B 1 360 ? -69.479  47.445  8.137   1.00 55.13  ?  360 ARG B NH1   1 
ATOM   6477  N  NH2   . ARG B 1 360 ? -67.360  47.948  7.394   1.00 72.62  ?  360 ARG B NH2   1 
ATOM   6478  N  N     . SER B 1 361 ? -73.920  50.378  7.106   1.00 64.44  ?  361 SER B N     1 
ATOM   6479  C  CA    . SER B 1 361 ? -74.897  49.378  7.505   1.00 64.66  ?  361 SER B CA    1 
ATOM   6480  C  C     . SER B 1 361 ? -76.340  49.743  7.169   1.00 59.37  ?  361 SER B C     1 
ATOM   6481  O  O     . SER B 1 361 ? -77.184  48.856  7.053   1.00 62.00  ?  361 SER B O     1 
ATOM   6482  C  CB    . SER B 1 361 ? -74.714  49.030  8.971   1.00 65.94  ?  361 SER B CB    1 
ATOM   6483  O  OG    . SER B 1 361 ? -73.454  48.399  9.145   1.00 76.92  ?  361 SER B OG    1 
ATOM   6484  N  N     . ARG B 1 362 ? -76.619  51.034  6.988   1.00 52.60  ?  362 ARG B N     1 
ATOM   6485  C  CA    . ARG B 1 362 ? -77.947  51.448  6.562   1.00 58.33  ?  362 ARG B CA    1 
ATOM   6486  C  C     . ARG B 1 362 ? -78.054  51.126  5.096   1.00 68.13  ?  362 ARG B C     1 
ATOM   6487  O  O     . ARG B 1 362 ? -79.008  50.498  4.641   1.00 78.26  ?  362 ARG B O     1 
ATOM   6488  C  CB    . ARG B 1 362 ? -78.166  52.947  6.752   1.00 62.35  ?  362 ARG B CB    1 
ATOM   6489  C  CG    . ARG B 1 362 ? -78.082  53.424  8.177   1.00 66.30  ?  362 ARG B CG    1 
ATOM   6490  C  CD    . ARG B 1 362 ? -78.064  54.939  8.244   1.00 78.74  ?  362 ARG B CD    1 
ATOM   6491  N  NE    . ARG B 1 362 ? -77.950  55.385  9.629   1.00 90.48  ?  362 ARG B NE    1 
ATOM   6492  C  CZ    . ARG B 1 362 ? -76.830  55.846  10.176  1.00 96.42  ?  362 ARG B CZ    1 
ATOM   6493  N  NH1   . ARG B 1 362 ? -75.722  55.935  9.434   1.00 97.01  ?  362 ARG B NH1   1 
ATOM   6494  N  NH2   . ARG B 1 362 ? -76.827  56.226  11.459  1.00 94.48  ?  362 ARG B NH2   1 
ATOM   6495  N  N     . PHE B 1 363 ? -77.046  51.567  4.362   1.00 66.48  ?  363 PHE B N     1 
ATOM   6496  C  CA    . PHE B 1 363 ? -76.986  51.354  2.926   1.00 61.88  ?  363 PHE B CA    1 
ATOM   6497  C  C     . PHE B 1 363 ? -77.285  49.910  2.558   1.00 60.22  ?  363 PHE B C     1 
ATOM   6498  O  O     . PHE B 1 363 ? -78.130  49.645  1.705   1.00 66.11  ?  363 PHE B O     1 
ATOM   6499  C  CB    . PHE B 1 363 ? -75.606  51.728  2.420   1.00 58.45  ?  363 PHE B CB    1 
ATOM   6500  C  CG    . PHE B 1 363 ? -75.462  51.631  0.960   1.00 64.96  ?  363 PHE B CG    1 
ATOM   6501  C  CD1   . PHE B 1 363 ? -75.656  52.752  0.163   1.00 65.81  ?  363 PHE B CD1   1 
ATOM   6502  C  CD2   . PHE B 1 363 ? -75.118  50.428  0.370   1.00 59.66  ?  363 PHE B CD2   1 
ATOM   6503  C  CE1   . PHE B 1 363 ? -75.509  52.678  -1.199  1.00 53.80  ?  363 PHE B CE1   1 
ATOM   6504  C  CE2   . PHE B 1 363 ? -74.979  50.338  -0.995  1.00 55.89  ?  363 PHE B CE2   1 
ATOM   6505  C  CZ    . PHE B 1 363 ? -75.171  51.463  -1.780  1.00 55.22  ?  363 PHE B CZ    1 
ATOM   6506  N  N     . ASP B 1 364 ? -76.590  48.985  3.211   1.00 56.45  ?  364 ASP B N     1 
ATOM   6507  C  CA    . ASP B 1 364 ? -76.727  47.562  2.919   1.00 64.42  ?  364 ASP B CA    1 
ATOM   6508  C  C     . ASP B 1 364 ? -78.073  47.023  3.371   1.00 66.29  ?  364 ASP B C     1 
ATOM   6509  O  O     . ASP B 1 364 ? -78.668  46.165  2.707   1.00 69.63  ?  364 ASP B O     1 
ATOM   6510  C  CB    . ASP B 1 364 ? -75.617  46.768  3.607   1.00 72.18  ?  364 ASP B CB    1 
ATOM   6511  C  CG    . ASP B 1 364 ? -74.287  46.882  2.895   1.00 77.55  ?  364 ASP B CG    1 
ATOM   6512  O  OD1   . ASP B 1 364 ? -74.204  47.612  1.877   1.00 77.63  ?  364 ASP B OD1   1 
ATOM   6513  O  OD2   . ASP B 1 364 ? -73.326  46.235  3.369   1.00 78.47  ?  364 ASP B OD2   1 
ATOM   6514  N  N     . LYS B 1 365 ? -78.539  47.509  4.517   1.00 65.47  ?  365 LYS B N     1 
ATOM   6515  C  CA    . LYS B 1 365 ? -79.838  47.100  5.006   1.00 61.26  ?  365 LYS B CA    1 
ATOM   6516  C  C     . LYS B 1 365 ? -80.862  47.477  3.942   1.00 63.84  ?  365 LYS B C     1 
ATOM   6517  O  O     . LYS B 1 365 ? -81.601  46.624  3.441   1.00 67.96  ?  365 LYS B O     1 
ATOM   6518  C  CB    . LYS B 1 365 ? -80.163  47.775  6.338   1.00 61.00  ?  365 LYS B CB    1 
ATOM   6519  C  CG    . LYS B 1 365 ? -81.340  47.131  7.094   1.00 64.24  ?  365 LYS B CG    1 
ATOM   6520  C  CD    . LYS B 1 365 ? -81.493  47.690  8.507   1.00 63.59  ?  365 LYS B CD    1 
ATOM   6521  C  CE    . LYS B 1 365 ? -82.600  48.715  8.584   1.00 66.13  ?  365 LYS B CE    1 
ATOM   6522  N  NZ    . LYS B 1 365 ? -83.948  48.073  8.510   1.00 68.70  ?  365 LYS B NZ    1 
ATOM   6523  N  N     . GLU B 1 366 ? -80.872  48.753  3.570   1.00 59.54  ?  366 GLU B N     1 
ATOM   6524  C  CA    . GLU B 1 366 ? -81.852  49.242  2.613   1.00 57.53  ?  366 GLU B CA    1 
ATOM   6525  C  C     . GLU B 1 366 ? -81.823  48.439  1.301   1.00 68.41  ?  366 GLU B C     1 
ATOM   6526  O  O     . GLU B 1 366 ? -82.874  48.069  0.785   1.00 74.84  ?  366 GLU B O     1 
ATOM   6527  C  CB    . GLU B 1 366 ? -81.685  50.741  2.370   1.00 55.79  ?  366 GLU B CB    1 
ATOM   6528  C  CG    . GLU B 1 366 ? -82.747  51.318  1.445   1.00 81.33  ?  366 GLU B CG    1 
ATOM   6529  C  CD    . GLU B 1 366 ? -82.404  52.719  0.953   1.00 109.23 ?  366 GLU B CD    1 
ATOM   6530  O  OE1   . GLU B 1 366 ? -82.447  52.941  -0.284  1.00 118.85 ?  366 GLU B OE1   1 
ATOM   6531  O  OE2   . GLU B 1 366 ? -82.090  53.590  1.805   1.00 115.01 ?  366 GLU B OE2   1 
ATOM   6532  N  N     . LYS B 1 367 ? -80.629  48.152  0.776   1.00 70.27  ?  367 LYS B N     1 
ATOM   6533  C  CA    . LYS B 1 367 ? -80.506  47.264  -0.386  1.00 59.84  ?  367 LYS B CA    1 
ATOM   6534  C  C     . LYS B 1 367 ? -81.230  45.966  -0.122  1.00 59.06  ?  367 LYS B C     1 
ATOM   6535  O  O     . LYS B 1 367 ? -82.113  45.576  -0.888  1.00 68.00  ?  367 LYS B O     1 
ATOM   6536  C  CB    . LYS B 1 367 ? -79.048  46.939  -0.705  1.00 58.01  ?  367 LYS B CB    1 
ATOM   6537  C  CG    . LYS B 1 367 ? -78.514  47.551  -1.999  1.00 75.57  ?  367 LYS B CG    1 
ATOM   6538  C  CD    . LYS B 1 367 ? -77.326  46.728  -2.559  1.00 83.38  ?  367 LYS B CD    1 
ATOM   6539  N  N     . ALA B 1 368 ? -80.858  45.307  0.974   1.00 53.17  ?  368 ALA B N     1 
ATOM   6540  C  CA    . ALA B 1 368 ? -81.390  43.990  1.296   1.00 55.98  ?  368 ALA B CA    1 
ATOM   6541  C  C     . ALA B 1 368 ? -82.891  43.989  1.537   1.00 62.10  ?  368 ALA B C     1 
ATOM   6542  O  O     . ALA B 1 368 ? -83.562  43.018  1.197   1.00 61.63  ?  368 ALA B O     1 
ATOM   6543  C  CB    . ALA B 1 368 ? -80.668  43.400  2.469   1.00 57.84  ?  368 ALA B CB    1 
ATOM   6544  N  N     . GLU B 1 369 ? -83.407  45.063  2.135   1.00 66.13  ?  369 GLU B N     1 
ATOM   6545  C  CA    . GLU B 1 369 ? -84.848  45.229  2.337   1.00 66.18  ?  369 GLU B CA    1 
ATOM   6546  C  C     . GLU B 1 369 ? -85.579  45.194  0.999   1.00 72.22  ?  369 GLU B C     1 
ATOM   6547  O  O     . GLU B 1 369 ? -86.572  44.479  0.835   1.00 78.24  ?  369 GLU B O     1 
ATOM   6548  C  CB    . GLU B 1 369 ? -85.145  46.588  2.962   1.00 67.72  ?  369 GLU B CB    1 
ATOM   6549  C  CG    . GLU B 1 369 ? -85.003  46.720  4.452   1.00 73.48  ?  369 GLU B CG    1 
ATOM   6550  C  CD    . GLU B 1 369 ? -85.040  48.186  4.877   1.00 90.00  ?  369 GLU B CD    1 
ATOM   6551  O  OE1   . GLU B 1 369 ? -84.157  48.613  5.650   1.00 95.63  ?  369 GLU B OE1   1 
ATOM   6552  O  OE2   . GLU B 1 369 ? -85.942  48.923  4.421   1.00 96.03  ?  369 GLU B OE2   1 
ATOM   6553  N  N     . LYS B 1 370 ? -85.085  45.999  0.054   1.00 69.79  ?  370 LYS B N     1 
ATOM   6554  C  CA    . LYS B 1 370 ? -85.744  46.202  -1.236  1.00 71.21  ?  370 LYS B CA    1 
ATOM   6555  C  C     . LYS B 1 370 ? -85.825  44.905  -1.999  1.00 67.38  ?  370 LYS B C     1 
ATOM   6556  O  O     . LYS B 1 370 ? -86.858  44.576  -2.583  1.00 71.69  ?  370 LYS B O     1 
ATOM   6557  C  CB    . LYS B 1 370 ? -85.049  47.295  -2.063  1.00 44.18  ?  370 LYS B CB    1 
ATOM   6558  C  CG    . LYS B 1 370 ? -85.454  48.711  -1.591  1.00 67.45  ?  370 LYS B CG    1 
ATOM   6559  C  CD    . LYS B 1 370 ? -84.856  49.849  -2.421  1.00 64.90  ?  370 LYS B CD    1 
ATOM   6560  N  N     . ARG B 1 371 ? -84.735  44.157  -1.967  1.00 57.70  ?  371 ARG B N     1 
ATOM   6561  C  CA    . ARG B 1 371 ? -84.690  42.885  -2.659  1.00 59.22  ?  371 ARG B CA    1 
ATOM   6562  C  C     . ARG B 1 371 ? -85.514  41.803  -1.974  1.00 66.15  ?  371 ARG B C     1 
ATOM   6563  O  O     . ARG B 1 371 ? -86.070  40.914  -2.629  1.00 67.02  ?  371 ARG B O     1 
ATOM   6564  C  CB    . ARG B 1 371 ? -83.263  42.396  -2.760  1.00 49.88  ?  371 ARG B CB    1 
ATOM   6565  C  CG    . ARG B 1 371 ? -83.221  40.937  -3.024  1.00 46.48  ?  371 ARG B CG    1 
ATOM   6566  C  CD    . ARG B 1 371 ? -82.579  40.708  -4.337  1.00 67.07  ?  371 ARG B CD    1 
ATOM   6567  N  NE    . ARG B 1 371 ? -82.871  39.374  -4.837  1.00 76.22  ?  371 ARG B NE    1 
ATOM   6568  C  CZ    . ARG B 1 371 ? -83.631  39.134  -5.895  1.00 67.30  ?  371 ARG B CZ    1 
ATOM   6569  N  NH1   . ARG B 1 371 ? -84.175  40.167  -6.576  1.00 55.13  ?  371 ARG B NH1   1 
ATOM   6570  N  NH2   . ARG B 1 371 ? -83.821  37.865  -6.266  1.00 62.74  ?  371 ARG B NH2   1 
ATOM   6571  N  N     . LEU B 1 372 ? -85.543  41.852  -0.648  1.00 68.44  ?  372 LEU B N     1 
ATOM   6572  C  CA    . LEU B 1 372 ? -86.350  40.929  0.131   1.00 62.04  ?  372 LEU B CA    1 
ATOM   6573  C  C     . LEU B 1 372 ? -87.777  41.136  -0.326  1.00 63.20  ?  372 LEU B C     1 
ATOM   6574  O  O     . LEU B 1 372 ? -88.539  40.183  -0.491  1.00 68.21  ?  372 LEU B O     1 
ATOM   6575  C  CB    . LEU B 1 372 ? -86.253  41.276  1.604   1.00 56.83  ?  372 LEU B CB    1 
ATOM   6576  C  CG    . LEU B 1 372 ? -86.676  40.213  2.613   1.00 53.31  ?  372 LEU B CG    1 
ATOM   6577  C  CD1   . LEU B 1 372 ? -87.552  40.846  3.680   1.00 51.68  ?  372 LEU B CD1   1 
ATOM   6578  C  CD2   . LEU B 1 372 ? -87.351  39.030  1.943   1.00 54.03  ?  372 LEU B CD2   1 
ATOM   6579  N  N     . HIS B 1 373 ? -88.123  42.401  -0.548  1.00 57.22  ?  373 HIS B N     1 
ATOM   6580  C  CA    . HIS B 1 373 ? -89.472  42.753  -0.950  1.00 56.09  ?  373 HIS B CA    1 
ATOM   6581  C  C     . HIS B 1 373 ? -89.792  42.096  -2.281  1.00 58.06  ?  373 HIS B C     1 
ATOM   6582  O  O     . HIS B 1 373 ? -90.886  41.546  -2.449  1.00 59.54  ?  373 HIS B O     1 
ATOM   6583  C  CB    . HIS B 1 373 ? -89.633  44.266  -1.050  1.00 59.04  ?  373 HIS B CB    1 
ATOM   6584  C  CG    . HIS B 1 373 ? -91.045  44.715  -1.233  1.00 61.62  ?  373 HIS B CG    1 
ATOM   6585  N  ND1   . HIS B 1 373 ? -92.099  44.169  -0.542  1.00 69.88  ?  373 HIS B ND1   1 
ATOM   6586  C  CD2   . HIS B 1 373 ? -91.579  45.693  -2.009  1.00 63.45  ?  373 HIS B CD2   1 
ATOM   6587  C  CE1   . HIS B 1 373 ? -93.222  44.770  -0.894  1.00 71.70  ?  373 HIS B CE1   1 
ATOM   6588  N  NE2   . HIS B 1 373 ? -92.930  45.705  -1.780  1.00 63.87  ?  373 HIS B NE2   1 
ATOM   6589  N  N     . ILE B 1 374 ? -88.840  42.151  -3.218  1.00 58.43  ?  374 ILE B N     1 
ATOM   6590  C  CA    . ILE B 1 374 ? -89.066  41.610  -4.549  1.00 59.15  ?  374 ILE B CA    1 
ATOM   6591  C  C     . ILE B 1 374 ? -89.179  40.104  -4.441  1.00 64.40  ?  374 ILE B C     1 
ATOM   6592  O  O     . ILE B 1 374 ? -90.013  39.471  -5.093  1.00 73.70  ?  374 ILE B O     1 
ATOM   6593  C  CB    . ILE B 1 374 ? -87.909  41.918  -5.519  1.00 53.34  ?  374 ILE B CB    1 
ATOM   6594  C  CG1   . ILE B 1 374 ? -87.786  43.412  -5.779  1.00 47.76  ?  374 ILE B CG1   1 
ATOM   6595  C  CG2   . ILE B 1 374 ? -88.109  41.178  -6.844  1.00 54.85  ?  374 ILE B CG2   1 
ATOM   6596  C  CD1   . ILE B 1 374 ? -88.966  43.981  -6.469  1.00 50.40  ?  374 ILE B CD1   1 
ATOM   6597  N  N     . VAL B 1 375 ? -88.317  39.525  -3.623  1.00 60.40  ?  375 VAL B N     1 
ATOM   6598  C  CA    . VAL B 1 375 ? -88.305  38.087  -3.496  1.00 61.70  ?  375 VAL B CA    1 
ATOM   6599  C  C     . VAL B 1 375 ? -89.605  37.582  -2.875  1.00 64.55  ?  375 VAL B C     1 
ATOM   6600  O  O     . VAL B 1 375 ? -90.118  36.531  -3.263  1.00 62.77  ?  375 VAL B O     1 
ATOM   6601  C  CB    . VAL B 1 375 ? -87.108  37.615  -2.686  1.00 53.34  ?  375 VAL B CB    1 
ATOM   6602  C  CG1   . VAL B 1 375 ? -87.350  36.195  -2.165  1.00 43.48  ?  375 VAL B CG1   1 
ATOM   6603  C  CG2   . VAL B 1 375 ? -85.843  37.726  -3.539  1.00 40.08  ?  375 VAL B CG2   1 
ATOM   6604  N  N     . GLU B 1 376 ? -90.145  38.334  -1.920  1.00 66.09  ?  376 GLU B N     1 
ATOM   6605  C  CA    . GLU B 1 376 ? -91.400  37.926  -1.296  1.00 63.84  ?  376 GLU B CA    1 
ATOM   6606  C  C     . GLU B 1 376 ? -92.476  37.833  -2.386  1.00 68.03  ?  376 GLU B C     1 
ATOM   6607  O  O     . GLU B 1 376 ? -93.256  36.869  -2.440  1.00 73.30  ?  376 GLU B O     1 
ATOM   6608  C  CB    . GLU B 1 376 ? -91.798  38.865  -0.132  1.00 61.21  ?  376 GLU B CB    1 
ATOM   6609  C  CG    . GLU B 1 376 ? -90.803  38.835  1.052   1.00 72.79  ?  376 GLU B CG    1 
ATOM   6610  C  CD    . GLU B 1 376 ? -90.982  39.967  2.085   1.00 90.72  ?  376 GLU B CD    1 
ATOM   6611  O  OE1   . GLU B 1 376 ? -91.543  41.042  1.743   1.00 93.59  ?  376 GLU B OE1   1 
ATOM   6612  O  OE2   . GLU B 1 376 ? -90.542  39.769  3.248   1.00 98.23  ?  376 GLU B OE2   1 
ATOM   6613  N  N     . GLY B 1 377 ? -92.491  38.830  -3.266  1.00 66.84  ?  377 GLY B N     1 
ATOM   6614  C  CA    . GLY B 1 377 ? -93.432  38.868  -4.372  1.00 68.19  ?  377 GLY B CA    1 
ATOM   6615  C  C     . GLY B 1 377 ? -93.253  37.713  -5.345  1.00 66.61  ?  377 GLY B C     1 
ATOM   6616  O  O     . GLY B 1 377 ? -94.238  37.077  -5.728  1.00 65.97  ?  377 GLY B O     1 
ATOM   6617  N  N     . LEU B 1 378 ? -92.003  37.440  -5.739  1.00 59.75  ?  378 LEU B N     1 
ATOM   6618  C  CA    . LEU B 1 378 ? -91.692  36.330  -6.650  1.00 58.90  ?  378 LEU B CA    1 
ATOM   6619  C  C     . LEU B 1 378 ? -92.100  34.961  -6.110  1.00 66.03  ?  378 LEU B C     1 
ATOM   6620  O  O     . LEU B 1 378 ? -92.413  34.046  -6.877  1.00 67.89  ?  378 LEU B O     1 
ATOM   6621  C  CB    . LEU B 1 378 ? -90.208  36.314  -7.001  1.00 48.61  ?  378 LEU B CB    1 
ATOM   6622  C  CG    . LEU B 1 378 ? -89.815  37.561  -7.771  1.00 48.53  ?  378 LEU B CG    1 
ATOM   6623  C  CD1   . LEU B 1 378 ? -88.415  37.447  -8.286  1.00 44.74  ?  378 LEU B CD1   1 
ATOM   6624  C  CD2   . LEU B 1 378 ? -90.778  37.781  -8.913  1.00 56.51  ?  378 LEU B CD2   1 
ATOM   6625  N  N     . ILE B 1 379 ? -92.094  34.818  -4.792  1.00 61.73  ?  379 ILE B N     1 
ATOM   6626  C  CA    . ILE B 1 379 ? -92.515  33.565  -4.193  1.00 57.75  ?  379 ILE B CA    1 
ATOM   6627  C  C     . ILE B 1 379 ? -94.013  33.330  -4.406  1.00 58.01  ?  379 ILE B C     1 
ATOM   6628  O  O     . ILE B 1 379 ? -94.399  32.230  -4.810  1.00 67.14  ?  379 ILE B O     1 
ATOM   6629  C  CB    . ILE B 1 379 ? -92.052  33.439  -2.710  1.00 60.98  ?  379 ILE B CB    1 
ATOM   6630  C  CG1   . ILE B 1 379 ? -90.529  33.451  -2.681  1.00 58.18  ?  379 ILE B CG1   1 
ATOM   6631  C  CG2   . ILE B 1 379 ? -92.548  32.145  -2.058  1.00 45.80  ?  379 ILE B CG2   1 
ATOM   6632  C  CD1   . ILE B 1 379 ? -89.960  33.456  -1.323  1.00 61.92  ?  379 ILE B CD1   1 
ATOM   6633  N  N     . ARG B 1 380 ? -94.847  34.351  -4.174  1.00 50.54  ?  380 ARG B N     1 
ATOM   6634  C  CA    . ARG B 1 380 ? -96.290  34.248  -4.463  1.00 57.97  ?  380 ARG B CA    1 
ATOM   6635  C  C     . ARG B 1 380 ? -96.548  33.988  -5.951  1.00 68.37  ?  380 ARG B C     1 
ATOM   6636  O  O     . ARG B 1 380 ? -97.440  33.213  -6.337  1.00 73.76  ?  380 ARG B O     1 
ATOM   6637  C  CB    . ARG B 1 380 ? -97.024  35.552  -4.164  1.00 55.50  ?  380 ARG B CB    1 
ATOM   6638  C  CG    . ARG B 1 380 ? -96.933  36.080  -2.802  1.00 58.44  ?  380 ARG B CG    1 
ATOM   6639  C  CD    . ARG B 1 380 ? -98.288  36.616  -2.361  1.00 61.02  ?  380 ARG B CD    1 
ATOM   6640  N  NE    . ARG B 1 380 ? -98.524  37.965  -2.845  1.00 64.72  ?  380 ARG B NE    1 
ATOM   6641  C  CZ    . ARG B 1 380 ? -99.684  38.359  -3.359  1.00 75.94  ?  380 ARG B CZ    1 
ATOM   6642  N  NH1   . ARG B 1 380 ? -100.709 37.502  -3.446  1.00 71.31  ?  380 ARG B NH1   1 
ATOM   6643  N  NH2   . ARG B 1 380 ? -99.822  39.609  -3.785  1.00 86.58  ?  380 ARG B NH2   1 
ATOM   6644  N  N     . VAL B 1 381 ? -95.800  34.700  -6.784  1.00 66.06  ?  381 VAL B N     1 
ATOM   6645  C  CA    . VAL B 1 381 ? -96.039  34.666  -8.209  1.00 67.99  ?  381 VAL B CA    1 
ATOM   6646  C  C     . VAL B 1 381 ? -96.020  33.217  -8.653  1.00 73.04  ?  381 VAL B C     1 
ATOM   6647  O  O     . VAL B 1 381 ? -96.951  32.748  -9.309  1.00 85.78  ?  381 VAL B O     1 
ATOM   6648  C  CB    . VAL B 1 381 ? -95.003  35.521  -8.971  1.00 59.94  ?  381 VAL B CB    1 
ATOM   6649  C  CG1   . VAL B 1 381 ? -94.518  34.810  -10.201 1.00 54.52  ?  381 VAL B CG1   1 
ATOM   6650  C  CG2   . VAL B 1 381 ? -95.610  36.873  -9.337  1.00 61.03  ?  381 VAL B CG2   1 
ATOM   6651  N  N     . ILE B 1 382 ? -94.978  32.503  -8.247  1.00 60.72  ?  382 ILE B N     1 
ATOM   6652  C  CA    . ILE B 1 382 ? -94.807  31.103  -8.617  1.00 58.91  ?  382 ILE B CA    1 
ATOM   6653  C  C     . ILE B 1 382 ? -96.054  30.220  -8.448  1.00 63.45  ?  382 ILE B C     1 
ATOM   6654  O  O     . ILE B 1 382 ? -96.347  29.376  -9.292  1.00 70.35  ?  382 ILE B O     1 
ATOM   6655  C  CB    . ILE B 1 382 ? -93.631  30.481  -7.851  1.00 55.35  ?  382 ILE B CB    1 
ATOM   6656  C  CG1   . ILE B 1 382 ? -92.322  31.064  -8.381  1.00 56.51  ?  382 ILE B CG1   1 
ATOM   6657  C  CG2   . ILE B 1 382 ? -93.648  28.946  -7.967  1.00 52.16  ?  382 ILE B CG2   1 
ATOM   6658  C  CD1   . ILE B 1 382 ? -91.092  30.390  -7.826  1.00 55.82  ?  382 ILE B CD1   1 
ATOM   6659  N  N     . SER B 1 383 ? -96.790  30.407  -7.366  1.00 61.35  ?  383 SER B N     1 
ATOM   6660  C  CA    . SER B 1 383 ? -97.937  29.546  -7.087  1.00 72.08  ?  383 SER B CA    1 
ATOM   6661  C  C     . SER B 1 383 ? -99.147  29.990  -7.904  1.00 69.62  ?  383 SER B C     1 
ATOM   6662  O  O     . SER B 1 383 ? -100.145 29.274  -8.010  1.00 74.44  ?  383 SER B O     1 
ATOM   6663  C  CB    . SER B 1 383 ? -98.275  29.553  -5.587  1.00 81.62  ?  383 SER B CB    1 
ATOM   6664  O  OG    . SER B 1 383 ? -98.988  30.741  -5.245  1.00 86.39  ?  383 SER B OG    1 
ATOM   6665  N  N     . ILE B 1 384 ? -99.055  31.187  -8.468  1.00 63.64  ?  384 ILE B N     1 
ATOM   6666  C  CA    . ILE B 1 384 ? -100.103 31.679  -9.340  1.00 59.12  ?  384 ILE B CA    1 
ATOM   6667  C  C     . ILE B 1 384 ? -99.614  32.018  -10.749 1.00 57.69  ?  384 ILE B C     1 
ATOM   6668  O  O     . ILE B 1 384 ? -100.269 32.802  -11.465 1.00 53.97  ?  384 ILE B O     1 
ATOM   6669  C  CB    . ILE B 1 384 ? -100.813 32.886  -8.736  1.00 53.24  ?  384 ILE B CB    1 
ATOM   6670  C  CG1   . ILE B 1 384 ? -99.818  33.981  -8.331  1.00 56.27  ?  384 ILE B CG1   1 
ATOM   6671  C  CG2   . ILE B 1 384 ? -101.589 32.454  -7.569  1.00 44.50  ?  384 ILE B CG2   1 
ATOM   6672  C  CD1   . ILE B 1 384 ? -100.533 35.304  -7.948  1.00 49.40  ?  384 ILE B CD1   1 
ATOM   6673  N  N     . LEU B 1 385 ? -98.488  31.404  -11.137 1.00 59.42  ?  385 LEU B N     1 
ATOM   6674  C  CA    . LEU B 1 385 ? -97.812  31.672  -12.416 1.00 65.59  ?  385 LEU B CA    1 
ATOM   6675  C  C     . LEU B 1 385 ? -98.771  31.862  -13.577 1.00 70.87  ?  385 LEU B C     1 
ATOM   6676  O  O     . LEU B 1 385 ? -98.873  32.956  -14.151 1.00 68.91  ?  385 LEU B O     1 
ATOM   6677  C  CB    . LEU B 1 385 ? -96.873  30.530  -12.775 1.00 65.88  ?  385 LEU B CB    1 
ATOM   6678  C  CG    . LEU B 1 385 ? -95.422  30.917  -13.043 1.00 60.75  ?  385 LEU B CG    1 
ATOM   6679  C  CD1   . LEU B 1 385 ? -94.795  29.883  -13.954 1.00 63.23  ?  385 LEU B CD1   1 
ATOM   6680  C  CD2   . LEU B 1 385 ? -95.317  32.312  -13.628 1.00 49.79  ?  385 LEU B CD2   1 
ATOM   6681  N  N     . ASP B 1 386 ? -99.452  30.773  -13.922 1.00 73.03  ?  386 ASP B N     1 
ATOM   6682  C  CA    . ASP B 1 386 ? -100.457 30.765  -14.978 1.00 76.61  ?  386 ASP B CA    1 
ATOM   6683  C  C     . ASP B 1 386 ? -101.439 31.941  -14.915 1.00 73.28  ?  386 ASP B C     1 
ATOM   6684  O  O     . ASP B 1 386 ? -101.608 32.671  -15.905 1.00 72.12  ?  386 ASP B O     1 
ATOM   6685  C  CB    . ASP B 1 386 ? -101.221 29.443  -14.949 1.00 81.89  ?  386 ASP B CB    1 
ATOM   6686  C  CG    . ASP B 1 386 ? -100.329 28.250  -15.226 1.00 89.63  ?  386 ASP B CG    1 
ATOM   6687  O  OD1   . ASP B 1 386 ? -100.344 27.306  -14.405 1.00 102.09 ?  386 ASP B OD1   1 
ATOM   6688  O  OD2   . ASP B 1 386 ? -99.621  28.252  -16.262 1.00 85.97  ?  386 ASP B OD2   1 
ATOM   6689  N  N     . GLU B 1 387 ? -102.091 32.108  -13.763 1.00 64.01  ?  387 GLU B N     1 
ATOM   6690  C  CA    . GLU B 1 387 ? -103.027 33.213  -13.556 1.00 61.66  ?  387 GLU B CA    1 
ATOM   6691  C  C     . GLU B 1 387 ? -102.352 34.550  -13.847 1.00 58.69  ?  387 GLU B C     1 
ATOM   6692  O  O     . GLU B 1 387 ? -102.988 35.482  -14.351 1.00 62.83  ?  387 GLU B O     1 
ATOM   6693  C  CB    . GLU B 1 387 ? -103.585 33.231  -12.121 1.00 68.48  ?  387 GLU B CB    1 
ATOM   6694  C  CG    . GLU B 1 387 ? -104.442 32.034  -11.725 1.00 86.00  ?  387 GLU B CG    1 
ATOM   6695  C  CD    . GLU B 1 387 ? -103.622 30.799  -11.363 1.00 102.43 ?  387 GLU B CD    1 
ATOM   6696  O  OE1   . GLU B 1 387 ? -102.431 30.727  -11.746 1.00 109.54 ?  387 GLU B OE1   1 
ATOM   6697  O  OE2   . GLU B 1 387 ? -104.171 29.894  -10.694 1.00 106.29 ?  387 GLU B OE2   1 
ATOM   6698  N  N     . VAL B 1 388 ? -101.071 34.652  -13.509 1.00 53.12  ?  388 VAL B N     1 
ATOM   6699  C  CA    . VAL B 1 388 ? -100.368 35.912  -13.680 1.00 55.84  ?  388 VAL B CA    1 
ATOM   6700  C  C     . VAL B 1 388 ? -100.117 36.155  -15.156 1.00 69.86  ?  388 VAL B C     1 
ATOM   6701  O  O     . VAL B 1 388 ? -100.426 37.232  -15.683 1.00 75.06  ?  388 VAL B O     1 
ATOM   6702  C  CB    . VAL B 1 388 ? -99.060  35.957  -12.879 1.00 52.39  ?  388 VAL B CB    1 
ATOM   6703  C  CG1   . VAL B 1 388 ? -98.232  37.158  -13.287 1.00 46.54  ?  388 VAL B CG1   1 
ATOM   6704  C  CG2   . VAL B 1 388 ? -99.382  36.034  -11.410 1.00 57.97  ?  388 VAL B CG2   1 
ATOM   6705  N  N     . ILE B 1 389 ? -99.572  35.142  -15.823 1.00 72.10  ?  389 ILE B N     1 
ATOM   6706  C  CA    . ILE B 1 389 ? -99.408  35.193  -17.264 1.00 66.09  ?  389 ILE B CA    1 
ATOM   6707  C  C     . ILE B 1 389 ? -100.742 35.572  -17.910 1.00 67.36  ?  389 ILE B C     1 
ATOM   6708  O  O     . ILE B 1 389 ? -100.851 36.577  -18.606 1.00 69.97  ?  389 ILE B O     1 
ATOM   6709  C  CB    . ILE B 1 389 ? -98.953  33.850  -17.821 1.00 64.35  ?  389 ILE B CB    1 
ATOM   6710  C  CG1   . ILE B 1 389 ? -97.556  33.514  -17.304 1.00 66.97  ?  389 ILE B CG1   1 
ATOM   6711  C  CG2   . ILE B 1 389 ? -98.957  33.902  -19.341 1.00 63.90  ?  389 ILE B CG2   1 
ATOM   6712  C  CD1   . ILE B 1 389 ? -97.100  32.079  -17.605 1.00 72.89  ?  389 ILE B CD1   1 
ATOM   6713  N  N     . ALA B 1 390 ? -101.763 34.769  -17.656 1.00 64.34  ?  390 ALA B N     1 
ATOM   6714  C  CA    . ALA B 1 390 ? -103.101 35.062  -18.152 1.00 65.14  ?  390 ALA B CA    1 
ATOM   6715  C  C     . ALA B 1 390 ? -103.535 36.519  -17.943 1.00 68.91  ?  390 ALA B C     1 
ATOM   6716  O  O     . ALA B 1 390 ? -104.132 37.136  -18.839 1.00 71.33  ?  390 ALA B O     1 
ATOM   6717  C  CB    . ALA B 1 390 ? -104.090 34.131  -17.497 1.00 64.41  ?  390 ALA B CB    1 
ATOM   6718  N  N     . LEU B 1 391 ? -103.250 37.046  -16.752 1.00 69.03  ?  391 LEU B N     1 
ATOM   6719  C  CA    . LEU B 1 391 ? -103.641 38.394  -16.369 1.00 69.71  ?  391 LEU B CA    1 
ATOM   6720  C  C     . LEU B 1 391 ? -102.905 39.434  -17.197 1.00 71.14  ?  391 LEU B C     1 
ATOM   6721  O  O     . LEU B 1 391 ? -103.501 40.413  -17.670 1.00 82.06  ?  391 LEU B O     1 
ATOM   6722  C  CB    . LEU B 1 391 ? -103.336 38.628  -14.898 1.00 68.08  ?  391 LEU B CB    1 
ATOM   6723  C  CG    . LEU B 1 391 ? -103.722 40.019  -14.402 1.00 70.84  ?  391 LEU B CG    1 
ATOM   6724  C  CD1   . LEU B 1 391 ? -105.055 39.946  -13.711 1.00 76.17  ?  391 LEU B CD1   1 
ATOM   6725  C  CD2   . LEU B 1 391 ? -102.660 40.614  -13.482 1.00 72.06  ?  391 LEU B CD2   1 
ATOM   6726  N  N     . ILE B 1 392 ? -101.603 39.228  -17.358 1.00 62.75  ?  392 ILE B N     1 
ATOM   6727  C  CA    . ILE B 1 392 ? -100.816 40.080  -18.240 1.00 64.48  ?  392 ILE B CA    1 
ATOM   6728  C  C     . ILE B 1 392 ? -101.294 40.014  -19.703 1.00 72.29  ?  392 ILE B C     1 
ATOM   6729  O  O     . ILE B 1 392 ? -101.631 41.042  -20.309 1.00 74.09  ?  392 ILE B O     1 
ATOM   6730  C  CB    . ILE B 1 392 ? -99.345  39.726  -18.168 1.00 56.69  ?  392 ILE B CB    1 
ATOM   6731  C  CG1   . ILE B 1 392 ? -98.844  39.912  -16.735 1.00 52.60  ?  392 ILE B CG1   1 
ATOM   6732  C  CG2   . ILE B 1 392 ? -98.565  40.586  -19.150 1.00 55.15  ?  392 ILE B CG2   1 
ATOM   6733  C  CD1   . ILE B 1 392 ? -97.407  39.473  -16.515 1.00 49.21  ?  392 ILE B CD1   1 
ATOM   6734  N  N     . ARG B 1 393 ? -101.325 38.809  -20.268 1.00 75.26  ?  393 ARG B N     1 
ATOM   6735  C  CA    . ARG B 1 393 ? -101.919 38.611  -21.592 1.00 82.57  ?  393 ARG B CA    1 
ATOM   6736  C  C     . ARG B 1 393 ? -103.206 39.412  -21.757 1.00 89.68  ?  393 ARG B C     1 
ATOM   6737  O  O     . ARG B 1 393 ? -103.456 39.974  -22.825 1.00 101.50 ?  393 ARG B O     1 
ATOM   6738  C  CB    . ARG B 1 393 ? -102.206 37.127  -21.874 1.00 77.75  ?  393 ARG B CB    1 
ATOM   6739  C  CG    . ARG B 1 393 ? -101.164 36.425  -22.750 1.00 75.85  ?  393 ARG B CG    1 
ATOM   6740  C  CD    . ARG B 1 393 ? -101.784 35.868  -24.016 1.00 80.89  ?  393 ARG B CD    1 
ATOM   6741  N  NE    . ARG B 1 393 ? -102.064 36.938  -24.967 1.00 91.75  ?  393 ARG B NE    1 
ATOM   6742  C  CZ    . ARG B 1 393 ? -102.683 36.760  -26.126 1.00 101.70 ?  393 ARG B CZ    1 
ATOM   6743  N  NH1   . ARG B 1 393 ? -102.894 37.801  -26.928 1.00 105.61 ?  393 ARG B NH1   1 
ATOM   6744  N  NH2   . ARG B 1 393 ? -103.093 35.542  -26.471 1.00 101.65 ?  393 ARG B NH2   1 
ATOM   6745  N  N     . ALA B 1 394 ? -104.017 39.458  -20.703 1.00 80.04  ?  394 ALA B N     1 
ATOM   6746  C  CA    . ALA B 1 394 ? -105.302 40.146  -20.766 1.00 77.69  ?  394 ALA B CA    1 
ATOM   6747  C  C     . ALA B 1 394 ? -105.214 41.668  -20.583 1.00 77.59  ?  394 ALA B C     1 
ATOM   6748  O  O     . ALA B 1 394 ? -106.182 42.384  -20.900 1.00 83.10  ?  394 ALA B O     1 
ATOM   6749  C  CB    . ALA B 1 394 ? -106.286 39.543  -19.779 1.00 74.53  ?  394 ALA B CB    1 
ATOM   6750  N  N     . SER B 1 395 ? -104.076 42.166  -20.085 1.00 67.75  ?  395 SER B N     1 
ATOM   6751  C  CA    . SER B 1 395 ? -103.886 43.621  -19.939 1.00 73.68  ?  395 SER B CA    1 
ATOM   6752  C  C     . SER B 1 395 ? -103.639 44.303  -21.291 1.00 77.02  ?  395 SER B C     1 
ATOM   6753  O  O     . SER B 1 395 ? -103.201 43.655  -22.241 1.00 80.29  ?  395 SER B O     1 
ATOM   6754  C  CB    . SER B 1 395 ? -102.740 43.934  -18.978 1.00 72.08  ?  395 SER B CB    1 
ATOM   6755  O  OG    . SER B 1 395 ? -102.868 43.181  -17.793 1.00 76.49  ?  395 SER B OG    1 
ATOM   6756  N  N     . GLU B 1 396 ? -103.911 45.603  -21.378 1.00 80.02  ?  396 GLU B N     1 
ATOM   6757  C  CA    . GLU B 1 396 ? -103.768 46.310  -22.656 1.00 88.66  ?  396 GLU B CA    1 
ATOM   6758  C  C     . GLU B 1 396 ? -102.322 46.776  -22.897 1.00 86.67  ?  396 GLU B C     1 
ATOM   6759  O  O     . GLU B 1 396 ? -101.872 46.861  -24.042 1.00 95.72  ?  396 GLU B O     1 
ATOM   6760  C  CB    . GLU B 1 396 ? -104.803 47.460  -22.819 1.00 72.19  ?  396 GLU B CB    1 
ATOM   6761  N  N     . ASN B 1 397 ? -101.591 47.042  -21.819 1.00 76.12  ?  397 ASN B N     1 
ATOM   6762  C  CA    . ASN B 1 397 ? -100.194 47.473  -21.921 1.00 76.14  ?  397 ASN B CA    1 
ATOM   6763  C  C     . ASN B 1 397 ? -99.434  47.316  -20.605 1.00 75.22  ?  397 ASN B C     1 
ATOM   6764  O  O     . ASN B 1 397 ? -99.926  46.682  -19.679 1.00 79.57  ?  397 ASN B O     1 
ATOM   6765  C  CB    . ASN B 1 397 ? -100.119 48.922  -22.378 1.00 82.47  ?  397 ASN B CB    1 
ATOM   6766  C  CG    . ASN B 1 397 ? -100.591 49.888  -21.318 1.00 83.61  ?  397 ASN B CG    1 
ATOM   6767  O  OD1   . ASN B 1 397 ? -99.815  50.300  -20.451 1.00 89.79  ?  397 ASN B OD1   1 
ATOM   6768  N  ND2   . ASN B 1 397 ? -101.866 50.263  -21.380 1.00 76.40  ?  397 ASN B ND2   1 
ATOM   6769  N  N     . LYS B 1 398 ? -98.246  47.906  -20.508 1.00 73.51  ?  398 LYS B N     1 
ATOM   6770  C  CA    . LYS B 1 398 ? -97.419  47.711  -19.314 1.00 69.12  ?  398 LYS B CA    1 
ATOM   6771  C  C     . LYS B 1 398 ? -98.070  48.254  -18.047 1.00 71.83  ?  398 LYS B C     1 
ATOM   6772  O  O     . LYS B 1 398 ? -98.295  47.508  -17.093 1.00 63.00  ?  398 LYS B O     1 
ATOM   6773  C  CB    . LYS B 1 398 ? -96.017  48.308  -19.488 1.00 61.95  ?  398 LYS B CB    1 
ATOM   6774  C  CG    . LYS B 1 398 ? -95.152  48.164  -18.256 1.00 52.47  ?  398 LYS B CG    1 
ATOM   6775  C  CD    . LYS B 1 398 ? -93.670  48.364  -18.538 1.00 58.45  ?  398 LYS B CD    1 
ATOM   6776  C  CE    . LYS B 1 398 ? -92.935  48.883  -17.270 1.00 67.17  ?  398 LYS B CE    1 
ATOM   6777  N  NZ    . LYS B 1 398 ? -91.450  48.893  -17.388 1.00 64.26  ?  398 LYS B NZ    1 
ATOM   6778  N  N     . ALA B 1 399 ? -98.364  49.552  -18.039 1.00 77.33  ?  399 ALA B N     1 
ATOM   6779  C  CA    . ALA B 1 399 ? -99.010  50.182  -16.890 1.00 73.78  ?  399 ALA B CA    1 
ATOM   6780  C  C     . ALA B 1 399 ? -100.244 49.406  -16.461 1.00 72.42  ?  399 ALA B C     1 
ATOM   6781  O  O     . ALA B 1 399 ? -100.378 49.015  -15.295 1.00 72.05  ?  399 ALA B O     1 
ATOM   6782  C  CB    . ALA B 1 399 ? -99.388  51.605  -17.207 1.00 71.93  ?  399 ALA B CB    1 
ATOM   6783  N  N     . ASP B 1 400 ? -101.154 49.185  -17.399 1.00 64.11  ?  400 ASP B N     1 
ATOM   6784  C  CA    . ASP B 1 400 ? -102.371 48.463  -17.063 1.00 69.76  ?  400 ASP B CA    1 
ATOM   6785  C  C     . ASP B 1 400 ? -102.084 47.078  -16.445 1.00 75.27  ?  400 ASP B C     1 
ATOM   6786  O  O     . ASP B 1 400 ? -102.792 46.624  -15.548 1.00 81.99  ?  400 ASP B O     1 
ATOM   6787  C  CB    . ASP B 1 400 ? -103.263 48.336  -18.288 1.00 76.00  ?  400 ASP B CB    1 
ATOM   6788  C  CG    . ASP B 1 400 ? -104.616 47.763  -17.957 1.00 84.45  ?  400 ASP B CG    1 
ATOM   6789  O  OD1   . ASP B 1 400 ? -104.974 46.746  -18.589 1.00 87.11  ?  400 ASP B OD1   1 
ATOM   6790  O  OD2   . ASP B 1 400 ? -105.314 48.325  -17.075 1.00 88.82  ?  400 ASP B OD2   1 
ATOM   6791  N  N     . ALA B 1 401 ? -101.046 46.404  -16.919 1.00 70.66  ?  401 ALA B N     1 
ATOM   6792  C  CA    . ALA B 1 401 ? -100.683 45.128  -16.331 1.00 61.25  ?  401 ALA B CA    1 
ATOM   6793  C  C     . ALA B 1 401 ? -100.375 45.289  -14.834 1.00 71.63  ?  401 ALA B C     1 
ATOM   6794  O  O     . ALA B 1 401 ? -100.699 44.419  -14.021 1.00 76.94  ?  401 ALA B O     1 
ATOM   6795  C  CB    . ALA B 1 401 ? -99.505  44.520  -17.061 1.00 48.88  ?  401 ALA B CB    1 
ATOM   6796  N  N     . LYS B 1 402 ? -99.759  46.404  -14.462 1.00 73.69  ?  402 LYS B N     1 
ATOM   6797  C  CA    . LYS B 1 402 ? -99.461  46.634  -13.056 1.00 67.38  ?  402 LYS B CA    1 
ATOM   6798  C  C     . LYS B 1 402 ? -100.706 46.973  -12.220 1.00 67.61  ?  402 LYS B C     1 
ATOM   6799  O  O     . LYS B 1 402 ? -100.962 46.283  -11.241 1.00 65.97  ?  402 LYS B O     1 
ATOM   6800  C  CB    . LYS B 1 402 ? -98.325  47.643  -12.886 1.00 65.18  ?  402 LYS B CB    1 
ATOM   6801  C  CG    . LYS B 1 402 ? -97.123  47.276  -13.731 1.00 67.77  ?  402 LYS B CG    1 
ATOM   6802  C  CD    . LYS B 1 402 ? -95.856  47.975  -13.285 1.00 66.82  ?  402 LYS B CD    1 
ATOM   6803  C  CE    . LYS B 1 402 ? -96.092  49.446  -13.053 1.00 71.21  ?  402 LYS B CE    1 
ATOM   6804  N  NZ    . LYS B 1 402 ? -94.769  50.067  -12.844 1.00 74.25  ?  402 LYS B NZ    1 
ATOM   6805  N  N     . GLU B 1 403 ? -101.498 47.985  -12.591 1.00 68.92  ?  403 GLU B N     1 
ATOM   6806  C  CA    . GLU B 1 403 ? -102.714 48.228  -11.798 1.00 75.79  ?  403 GLU B CA    1 
ATOM   6807  C  C     . GLU B 1 403 ? -103.451 46.891  -11.643 1.00 70.32  ?  403 GLU B C     1 
ATOM   6808  O  O     . GLU B 1 403 ? -104.086 46.621  -10.627 1.00 80.96  ?  403 GLU B O     1 
ATOM   6809  C  CB    . GLU B 1 403 ? -103.640 49.356  -12.335 1.00 61.20  ?  403 GLU B CB    1 
ATOM   6810  N  N     . ASN B 1 404 ? -103.320 46.030  -12.632 1.00 59.21  ?  404 ASN B N     1 
ATOM   6811  C  CA    . ASN B 1 404 ? -104.029 44.757  -12.591 1.00 64.70  ?  404 ASN B CA    1 
ATOM   6812  C  C     . ASN B 1 404 ? -103.375 43.778  -11.626 1.00 66.41  ?  404 ASN B C     1 
ATOM   6813  O  O     . ASN B 1 404 ? -104.046 43.021  -10.944 1.00 66.11  ?  404 ASN B O     1 
ATOM   6814  C  CB    . ASN B 1 404 ? -104.125 44.145  -13.993 1.00 69.27  ?  404 ASN B CB    1 
ATOM   6815  C  CG    . ASN B 1 404 ? -105.463 44.394  -14.645 1.00 79.45  ?  404 ASN B CG    1 
ATOM   6816  O  OD1   . ASN B 1 404 ? -106.086 45.457  -14.467 1.00 82.18  ?  404 ASN B OD1   1 
ATOM   6817  N  ND2   . ASN B 1 404 ? -105.926 43.409  -15.408 1.00 83.27  ?  404 ASN B ND2   1 
ATOM   6818  N  N     . LEU B 1 405 ? -102.052 43.785  -11.589 1.00 66.72  ?  405 LEU B N     1 
ATOM   6819  C  CA    . LEU B 1 405 ? -101.330 42.919  -10.681 1.00 65.24  ?  405 LEU B CA    1 
ATOM   6820  C  C     . LEU B 1 405 ? -101.595 43.377  -9.244  1.00 75.08  ?  405 LEU B C     1 
ATOM   6821  O  O     . LEU B 1 405 ? -101.727 42.566  -8.319  1.00 78.57  ?  405 LEU B O     1 
ATOM   6822  C  CB    . LEU B 1 405 ? -99.831  42.949  -11.001 1.00 56.77  ?  405 LEU B CB    1 
ATOM   6823  C  CG    . LEU B 1 405 ? -99.398  41.910  -12.030 1.00 58.36  ?  405 LEU B CG    1 
ATOM   6824  C  CD1   . LEU B 1 405 ? -97.894  41.942  -12.205 1.00 65.01  ?  405 LEU B CD1   1 
ATOM   6825  C  CD2   . LEU B 1 405 ? -99.858  40.513  -11.626 1.00 53.92  ?  405 LEU B CD2   1 
ATOM   6826  N  N     . LYS B 1 406 ? -101.666 44.691  -9.069  1.00 73.10  ?  406 LYS B N     1 
ATOM   6827  C  CA    . LYS B 1 406 ? -101.974 45.276  -7.778  1.00 66.05  ?  406 LYS B CA    1 
ATOM   6828  C  C     . LYS B 1 406 ? -103.406 44.918  -7.390  1.00 69.47  ?  406 LYS B C     1 
ATOM   6829  O  O     . LYS B 1 406 ? -103.645 44.026  -6.573  1.00 80.98  ?  406 LYS B O     1 
ATOM   6830  C  CB    . LYS B 1 406 ? -101.805 46.794  -7.848  1.00 62.41  ?  406 LYS B CB    1 
ATOM   6831  C  CG    . LYS B 1 406 ? -100.396 47.250  -8.238  1.00 59.86  ?  406 LYS B CG    1 
ATOM   6832  C  CD    . LYS B 1 406 ? -100.374 48.757  -8.449  1.00 72.28  ?  406 LYS B CD    1 
ATOM   6833  C  CE    . LYS B 1 406 ? -98.959  49.305  -8.486  1.00 80.13  ?  406 LYS B CE    1 
ATOM   6834  N  NZ    . LYS B 1 406 ? -98.951  50.786  -8.271  1.00 88.99  ?  406 LYS B NZ    1 
ATOM   6835  N  N     . VAL B 1 407 ? -104.356 45.616  -7.994  1.00 63.05  ?  407 VAL B N     1 
ATOM   6836  C  CA    . VAL B 1 407 ? -105.773 45.398  -7.732  1.00 64.04  ?  407 VAL B CA    1 
ATOM   6837  C  C     . VAL B 1 407 ? -106.191 43.936  -7.544  1.00 65.52  ?  407 VAL B C     1 
ATOM   6838  O  O     . VAL B 1 407 ? -106.977 43.612  -6.660  1.00 73.40  ?  407 VAL B O     1 
ATOM   6839  C  CB    . VAL B 1 407 ? -106.608 46.004  -8.853  1.00 62.98  ?  407 VAL B CB    1 
ATOM   6840  C  CG1   . VAL B 1 407 ? -108.016 45.441  -8.822  1.00 64.74  ?  407 VAL B CG1   1 
ATOM   6841  C  CG2   . VAL B 1 407 ? -106.580 47.547  -8.762  1.00 66.74  ?  407 VAL B CG2   1 
ATOM   6842  N  N     . SER B 1 408 ? -105.658 43.050  -8.362  1.00 66.58  ?  408 SER B N     1 
ATOM   6843  C  CA    . SER B 1 408 ? -106.106 41.665  -8.334  1.00 72.16  ?  408 SER B CA    1 
ATOM   6844  C  C     . SER B 1 408 ? -105.344 40.778  -7.357  1.00 68.09  ?  408 SER B C     1 
ATOM   6845  O  O     . SER B 1 408 ? -105.840 39.735  -6.968  1.00 70.73  ?  408 SER B O     1 
ATOM   6846  C  CB    . SER B 1 408 ? -106.071 41.045  -9.744  1.00 76.20  ?  408 SER B CB    1 
ATOM   6847  O  OG    . SER B 1 408 ? -107.039 41.645  -10.598 1.00 81.49  ?  408 SER B OG    1 
ATOM   6848  N  N     . TYR B 1 409 ? -104.138 41.168  -6.971  1.00 68.54  ?  409 TYR B N     1 
ATOM   6849  C  CA    . TYR B 1 409 ? -103.310 40.282  -6.153  1.00 64.94  ?  409 TYR B CA    1 
ATOM   6850  C  C     . TYR B 1 409 ? -102.530 41.021  -5.078  1.00 68.26  ?  409 TYR B C     1 
ATOM   6851  O  O     . TYR B 1 409 ? -101.639 40.458  -4.445  1.00 67.49  ?  409 TYR B O     1 
ATOM   6852  C  CB    . TYR B 1 409 ? -102.367 39.460  -7.029  1.00 58.07  ?  409 TYR B CB    1 
ATOM   6853  C  CG    . TYR B 1 409 ? -103.082 38.386  -7.798  1.00 65.41  ?  409 TYR B CG    1 
ATOM   6854  C  CD1   . TYR B 1 409 ? -103.451 37.213  -7.184  1.00 70.51  ?  409 TYR B CD1   1 
ATOM   6855  C  CD2   . TYR B 1 409 ? -103.402 38.554  -9.135  1.00 76.37  ?  409 TYR B CD2   1 
ATOM   6856  C  CE1   . TYR B 1 409 ? -104.113 36.226  -7.876  1.00 77.32  ?  409 TYR B CE1   1 
ATOM   6857  C  CE2   . TYR B 1 409 ? -104.066 37.571  -9.841  1.00 78.33  ?  409 TYR B CE2   1 
ATOM   6858  C  CZ    . TYR B 1 409 ? -104.424 36.406  -9.202  1.00 77.42  ?  409 TYR B CZ    1 
ATOM   6859  O  OH    . TYR B 1 409 ? -105.089 35.409  -9.880  1.00 73.10  ?  409 TYR B OH    1 
ATOM   6860  N  N     . ASP B 1 410 ? -102.885 42.282  -4.872  1.00 72.69  ?  410 ASP B N     1 
ATOM   6861  C  CA    . ASP B 1 410 ? -102.240 43.117  -3.866  1.00 67.71  ?  410 ASP B CA    1 
ATOM   6862  C  C     . ASP B 1 410 ? -100.718 43.061  -3.887  1.00 62.16  ?  410 ASP B C     1 
ATOM   6863  O  O     . ASP B 1 410 ? -100.089 43.090  -2.842  1.00 71.32  ?  410 ASP B O     1 
ATOM   6864  C  CB    . ASP B 1 410 ? -102.752 42.768  -2.471  1.00 76.23  ?  410 ASP B CB    1 
ATOM   6865  C  CG    . ASP B 1 410 ? -104.241 42.971  -2.340  1.00 103.74 ?  410 ASP B CG    1 
ATOM   6866  O  OD1   . ASP B 1 410 ? -104.714 44.101  -2.615  1.00 115.92 ?  410 ASP B OD1   1 
ATOM   6867  O  OD2   . ASP B 1 410 ? -104.938 41.993  -1.980  1.00 113.67 ?  410 ASP B OD2   1 
ATOM   6868  N  N     . PHE B 1 411 ? -100.113 42.981  -5.063  1.00 53.07  ?  411 PHE B N     1 
ATOM   6869  C  CA    . PHE B 1 411 ? -98.685  43.248  -5.135  1.00 54.03  ?  411 PHE B CA    1 
ATOM   6870  C  C     . PHE B 1 411 ? -98.471  44.746  -4.965  1.00 57.60  ?  411 PHE B C     1 
ATOM   6871  O  O     . PHE B 1 411 ? -99.380  45.544  -5.193  1.00 59.98  ?  411 PHE B O     1 
ATOM   6872  C  CB    . PHE B 1 411 ? -98.102  42.789  -6.467  1.00 53.68  ?  411 PHE B CB    1 
ATOM   6873  C  CG    . PHE B 1 411 ? -98.075  41.303  -6.636  1.00 57.41  ?  411 PHE B CG    1 
ATOM   6874  C  CD1   . PHE B 1 411 ? -97.021  40.548  -6.117  1.00 59.27  ?  411 PHE B CD1   1 
ATOM   6875  C  CD2   . PHE B 1 411 ? -99.092  40.652  -7.321  1.00 60.00  ?  411 PHE B CD2   1 
ATOM   6876  C  CE1   . PHE B 1 411 ? -96.990  39.162  -6.258  1.00 57.07  ?  411 PHE B CE1   1 
ATOM   6877  C  CE2   . PHE B 1 411 ? -99.064  39.266  -7.472  1.00 62.48  ?  411 PHE B CE2   1 
ATOM   6878  C  CZ    . PHE B 1 411 ? -98.011  38.520  -6.928  1.00 58.69  ?  411 PHE B CZ    1 
ATOM   6879  N  N     . THR B 1 412 ? -97.273  45.130  -4.554  1.00 55.34  ?  412 THR B N     1 
ATOM   6880  C  CA    . THR B 1 412 ? -96.933  46.539  -4.508  1.00 60.19  ?  412 THR B CA    1 
ATOM   6881  C  C     . THR B 1 412 ? -96.420  46.971  -5.879  1.00 60.92  ?  412 THR B C     1 
ATOM   6882  O  O     . THR B 1 412 ? -95.966  46.142  -6.666  1.00 62.77  ?  412 THR B O     1 
ATOM   6883  C  CB    . THR B 1 412 ? -95.847  46.818  -3.451  1.00 61.27  ?  412 THR B CB    1 
ATOM   6884  O  OG1   . THR B 1 412 ? -94.550  46.584  -4.007  1.00 65.83  ?  412 THR B OG1   1 
ATOM   6885  C  CG2   . THR B 1 412 ? -96.020  45.896  -2.322  1.00 56.21  ?  412 THR B CG2   1 
ATOM   6886  N  N     . GLU B 1 413 ? -96.505  48.267  -6.155  1.00 58.58  ?  413 GLU B N     1 
ATOM   6887  C  CA    . GLU B 1 413 ? -95.852  48.857  -7.311  1.00 59.86  ?  413 GLU B CA    1 
ATOM   6888  C  C     . GLU B 1 413 ? -94.479  48.235  -7.582  1.00 58.46  ?  413 GLU B C     1 
ATOM   6889  O  O     . GLU B 1 413 ? -94.222  47.734  -8.680  1.00 58.15  ?  413 GLU B O     1 
ATOM   6890  C  CB    . GLU B 1 413 ? -95.689  50.362  -7.116  1.00 65.32  ?  413 GLU B CB    1 
ATOM   6891  C  CG    . GLU B 1 413 ? -94.670  50.979  -8.045  1.00 73.95  ?  413 GLU B CG    1 
ATOM   6892  C  CD    . GLU B 1 413 ? -95.175  51.125  -9.485  1.00 83.41  ?  413 GLU B CD    1 
ATOM   6893  O  OE1   . GLU B 1 413 ? -94.328  51.382  -10.366 1.00 90.46  ?  413 GLU B OE1   1 
ATOM   6894  O  OE2   . GLU B 1 413 ? -96.400  51.001  -9.737  1.00 79.69  ?  413 GLU B OE2   1 
ATOM   6895  N  N     . GLU B 1 414 ? -93.603  48.265  -6.583  1.00 55.42  ?  414 GLU B N     1 
ATOM   6896  C  CA    . GLU B 1 414 ? -92.239  47.788  -6.773  1.00 60.47  ?  414 GLU B CA    1 
ATOM   6897  C  C     . GLU B 1 414 ? -92.207  46.308  -7.132  1.00 58.72  ?  414 GLU B C     1 
ATOM   6898  O  O     . GLU B 1 414 ? -91.318  45.850  -7.878  1.00 59.88  ?  414 GLU B O     1 
ATOM   6899  C  CB    . GLU B 1 414 ? -91.323  48.097  -5.572  1.00 67.71  ?  414 GLU B CB    1 
ATOM   6900  C  CG    . GLU B 1 414 ? -92.030  48.600  -4.316  1.00 81.32  ?  414 GLU B CG    1 
ATOM   6901  C  CD    . GLU B 1 414 ? -92.598  49.994  -4.460  1.00 92.56  ?  414 GLU B CD    1 
ATOM   6902  O  OE1   . GLU B 1 414 ? -93.738  50.205  -3.991  1.00 101.55 ?  414 GLU B OE1   1 
ATOM   6903  O  OE2   . GLU B 1 414 ? -91.909  50.872  -5.028  1.00 91.34  ?  414 GLU B OE2   1 
ATOM   6904  N  N     . GLN B 1 415 ? -93.179  45.559  -6.623  1.00 53.94  ?  415 GLN B N     1 
ATOM   6905  C  CA    . GLN B 1 415 ? -93.233  44.137  -6.946  1.00 60.79  ?  415 GLN B CA    1 
ATOM   6906  C  C     . GLN B 1 415 ? -93.783  43.972  -8.339  1.00 60.83  ?  415 GLN B C     1 
ATOM   6907  O  O     . GLN B 1 415 ? -93.227  43.222  -9.143  1.00 61.71  ?  415 GLN B O     1 
ATOM   6908  C  CB    . GLN B 1 415 ? -94.073  43.366  -5.935  1.00 66.55  ?  415 GLN B CB    1 
ATOM   6909  C  CG    . GLN B 1 415 ? -93.689  43.696  -4.522  1.00 70.51  ?  415 GLN B CG    1 
ATOM   6910  C  CD    . GLN B 1 415 ? -94.416  42.862  -3.515  1.00 63.81  ?  415 GLN B CD    1 
ATOM   6911  O  OE1   . GLN B 1 415 ? -95.636  42.982  -3.349  1.00 67.76  ?  415 GLN B OE1   1 
ATOM   6912  N  NE2   . GLN B 1 415 ? -93.673  41.997  -2.831  1.00 54.80  ?  415 GLN B NE2   1 
ATOM   6913  N  N     . ALA B 1 416 ? -94.869  44.690  -8.626  1.00 56.87  ?  416 ALA B N     1 
ATOM   6914  C  CA    . ALA B 1 416 ? -95.501  44.612  -9.933  1.00 54.44  ?  416 ALA B CA    1 
ATOM   6915  C  C     . ALA B 1 416 ? -94.474  44.903  -11.018 1.00 61.61  ?  416 ALA B C     1 
ATOM   6916  O  O     . ALA B 1 416 ? -94.315  44.127  -11.980 1.00 66.86  ?  416 ALA B O     1 
ATOM   6917  C  CB    . ALA B 1 416 ? -96.624  45.556  -10.021 1.00 55.05  ?  416 ALA B CB    1 
ATOM   6918  N  N     . GLU B 1 417 ? -93.759  46.009  -10.849 1.00 57.27  ?  417 GLU B N     1 
ATOM   6919  C  CA    . GLU B 1 417 ? -92.713  46.364  -11.803 1.00 55.66  ?  417 GLU B CA    1 
ATOM   6920  C  C     . GLU B 1 417 ? -91.732  45.235  -12.039 1.00 59.50  ?  417 GLU B C     1 
ATOM   6921  O  O     . GLU B 1 417 ? -91.421  44.917  -13.183 1.00 60.12  ?  417 GLU B O     1 
ATOM   6922  C  CB    . GLU B 1 417 ? -91.925  47.573  -11.352 1.00 54.74  ?  417 GLU B CB    1 
ATOM   6923  C  CG    . GLU B 1 417 ? -90.831  47.903  -12.308 1.00 62.42  ?  417 GLU B CG    1 
ATOM   6924  C  CD    . GLU B 1 417 ? -91.319  48.691  -13.521 1.00 75.33  ?  417 GLU B CD    1 
ATOM   6925  O  OE1   . GLU B 1 417 ? -92.532  49.081  -13.568 1.00 76.98  ?  417 GLU B OE1   1 
ATOM   6926  O  OE2   . GLU B 1 417 ? -90.462  48.914  -14.417 1.00 78.79  ?  417 GLU B OE2   1 
ATOM   6927  N  N     . ALA B 1 418 ? -91.235  44.643  -10.958 1.00 62.24  ?  418 ALA B N     1 
ATOM   6928  C  CA    . ALA B 1 418 ? -90.267  43.555  -11.065 1.00 59.98  ?  418 ALA B CA    1 
ATOM   6929  C  C     . ALA B 1 418 ? -90.800  42.410  -11.919 1.00 62.43  ?  418 ALA B C     1 
ATOM   6930  O  O     . ALA B 1 418 ? -90.109  41.887  -12.809 1.00 75.87  ?  418 ALA B O     1 
ATOM   6931  C  CB    . ALA B 1 418 ? -89.904  43.046  -9.696  1.00 58.48  ?  418 ALA B CB    1 
ATOM   6932  N  N     . ILE B 1 419 ? -92.033  42.027  -11.620 1.00 50.75  ?  419 ILE B N     1 
ATOM   6933  C  CA    . ILE B 1 419 ? -92.681  40.894  -12.247 1.00 56.78  ?  419 ILE B CA    1 
ATOM   6934  C  C     . ILE B 1 419 ? -92.847  41.177  -13.733 1.00 67.67  ?  419 ILE B C     1 
ATOM   6935  O  O     . ILE B 1 419 ? -92.400  40.427  -14.610 1.00 75.04  ?  419 ILE B O     1 
ATOM   6936  C  CB    . ILE B 1 419 ? -94.067  40.675  -11.590 1.00 54.89  ?  419 ILE B CB    1 
ATOM   6937  C  CG1   . ILE B 1 419 ? -93.898  40.272  -10.116 1.00 57.88  ?  419 ILE B CG1   1 
ATOM   6938  C  CG2   . ILE B 1 419 ? -94.875  39.627  -12.334 1.00 52.11  ?  419 ILE B CG2   1 
ATOM   6939  C  CD1   . ILE B 1 419 ? -95.203  40.084  -9.369  1.00 59.60  ?  419 ILE B CD1   1 
ATOM   6940  N  N     . VAL B 1 420 ? -93.481  42.301  -14.002 1.00 60.87  ?  420 VAL B N     1 
ATOM   6941  C  CA    . VAL B 1 420 ? -93.825  42.694  -15.349 1.00 53.26  ?  420 VAL B CA    1 
ATOM   6942  C  C     . VAL B 1 420 ? -92.607  42.915  -16.274 1.00 55.20  ?  420 VAL B C     1 
ATOM   6943  O  O     . VAL B 1 420 ? -92.732  42.897  -17.506 1.00 61.97  ?  420 VAL B O     1 
ATOM   6944  C  CB    . VAL B 1 420 ? -94.713  43.932  -15.259 1.00 51.02  ?  420 VAL B CB    1 
ATOM   6945  C  CG1   . VAL B 1 420 ? -94.089  45.118  -15.991 1.00 47.41  ?  420 VAL B CG1   1 
ATOM   6946  C  CG2   . VAL B 1 420 ? -96.127  43.584  -15.718 1.00 49.97  ?  420 VAL B CG2   1 
ATOM   6947  N  N     . THR B 1 421 ? -91.428  43.088  -15.688 1.00 46.40  ?  421 THR B N     1 
ATOM   6948  C  CA    . THR B 1 421 ? -90.224  43.312  -16.484 1.00 47.84  ?  421 THR B CA    1 
ATOM   6949  C  C     . THR B 1 421 ? -89.315  42.093  -16.534 1.00 57.09  ?  421 THR B C     1 
ATOM   6950  O  O     . THR B 1 421 ? -88.168  42.182  -17.008 1.00 62.32  ?  421 THR B O     1 
ATOM   6951  C  CB    . THR B 1 421 ? -89.436  44.537  -15.993 1.00 46.84  ?  421 THR B CB    1 
ATOM   6952  O  OG1   . THR B 1 421 ? -88.844  44.263  -14.714 1.00 58.08  ?  421 THR B OG1   1 
ATOM   6953  C  CG2   . THR B 1 421 ? -90.378  45.725  -15.846 1.00 48.88  ?  421 THR B CG2   1 
ATOM   6954  N  N     . LEU B 1 422 ? -89.833  40.969  -16.032 1.00 61.26  ?  422 LEU B N     1 
ATOM   6955  C  CA    . LEU B 1 422 ? -89.152  39.672  -16.077 1.00 66.11  ?  422 LEU B CA    1 
ATOM   6956  C  C     . LEU B 1 422 ? -89.045  39.162  -17.515 1.00 66.25  ?  422 LEU B C     1 
ATOM   6957  O  O     . LEU B 1 422 ? -90.030  39.193  -18.261 1.00 72.55  ?  422 LEU B O     1 
ATOM   6958  C  CB    . LEU B 1 422 ? -89.945  38.640  -15.269 1.00 62.67  ?  422 LEU B CB    1 
ATOM   6959  C  CG    . LEU B 1 422 ? -89.788  38.400  -13.768 1.00 54.17  ?  422 LEU B CG    1 
ATOM   6960  C  CD1   . LEU B 1 422 ? -90.865  37.405  -13.272 1.00 50.51  ?  422 LEU B CD1   1 
ATOM   6961  C  CD2   . LEU B 1 422 ? -88.412  37.858  -13.485 1.00 54.06  ?  422 LEU B CD2   1 
ATOM   6962  N  N     . GLN B 1 423 ? -87.873  38.673  -17.908 1.00 57.47  ?  423 GLN B N     1 
ATOM   6963  C  CA    . GLN B 1 423 ? -87.729  38.113  -19.255 1.00 57.97  ?  423 GLN B CA    1 
ATOM   6964  C  C     . GLN B 1 423 ? -88.450  36.756  -19.392 1.00 62.11  ?  423 GLN B C     1 
ATOM   6965  O  O     . GLN B 1 423 ? -88.407  35.944  -18.483 1.00 66.23  ?  423 GLN B O     1 
ATOM   6966  C  CB    . GLN B 1 423 ? -86.251  38.001  -19.637 1.00 53.39  ?  423 GLN B CB    1 
ATOM   6967  C  CG    . GLN B 1 423 ? -85.583  39.348  -19.857 1.00 53.61  ?  423 GLN B CG    1 
ATOM   6968  C  CD    . GLN B 1 423 ? -84.065  39.267  -19.865 1.00 66.99  ?  423 GLN B CD    1 
ATOM   6969  O  OE1   . GLN B 1 423 ? -83.464  38.590  -20.703 1.00 73.49  ?  423 GLN B OE1   1 
ATOM   6970  N  NE2   . GLN B 1 423 ? -83.438  39.956  -18.922 1.00 75.09  ?  423 GLN B NE2   1 
ATOM   6971  N  N     . LEU B 1 424 ? -89.116  36.510  -20.519 1.00 61.10  ?  424 LEU B N     1 
ATOM   6972  C  CA    . LEU B 1 424 ? -89.869  35.263  -20.697 1.00 60.20  ?  424 LEU B CA    1 
ATOM   6973  C  C     . LEU B 1 424 ? -89.166  34.005  -20.150 1.00 58.43  ?  424 LEU B C     1 
ATOM   6974  O  O     . LEU B 1 424 ? -89.774  33.225  -19.435 1.00 64.40  ?  424 LEU B O     1 
ATOM   6975  C  CB    . LEU B 1 424 ? -90.251  35.051  -22.168 1.00 61.68  ?  424 LEU B CB    1 
ATOM   6976  C  CG    . LEU B 1 424 ? -91.371  35.918  -22.740 1.00 64.65  ?  424 LEU B CG    1 
ATOM   6977  C  CD1   . LEU B 1 424 ? -91.646  35.619  -24.207 1.00 62.31  ?  424 LEU B CD1   1 
ATOM   6978  C  CD2   . LEU B 1 424 ? -92.627  35.723  -21.924 1.00 71.53  ?  424 LEU B CD2   1 
ATOM   6979  N  N     . TYR B 1 425 ? -87.898  33.803  -20.484 1.00 55.27  ?  425 TYR B N     1 
ATOM   6980  C  CA    . TYR B 1 425 ? -87.211  32.582  -20.107 1.00 63.36  ?  425 TYR B CA    1 
ATOM   6981  C  C     . TYR B 1 425 ? -87.232  32.328  -18.596 1.00 72.13  ?  425 TYR B C     1 
ATOM   6982  O  O     . TYR B 1 425 ? -87.043  31.197  -18.134 1.00 73.68  ?  425 TYR B O     1 
ATOM   6983  C  CB    . TYR B 1 425 ? -85.774  32.571  -20.643 1.00 71.28  ?  425 TYR B CB    1 
ATOM   6984  C  CG    . TYR B 1 425 ? -84.787  33.436  -19.884 1.00 78.35  ?  425 TYR B CG    1 
ATOM   6985  C  CD1   . TYR B 1 425 ? -84.547  34.744  -20.269 1.00 84.75  ?  425 TYR B CD1   1 
ATOM   6986  C  CD2   . TYR B 1 425 ? -84.082  32.938  -18.805 1.00 79.66  ?  425 TYR B CD2   1 
ATOM   6987  C  CE1   . TYR B 1 425 ? -83.639  35.537  -19.599 1.00 88.17  ?  425 TYR B CE1   1 
ATOM   6988  C  CE2   . TYR B 1 425 ? -83.175  33.723  -18.125 1.00 84.05  ?  425 TYR B CE2   1 
ATOM   6989  C  CZ    . TYR B 1 425 ? -82.954  35.023  -18.528 1.00 87.99  ?  425 TYR B CZ    1 
ATOM   6990  O  OH    . TYR B 1 425 ? -82.053  35.823  -17.859 1.00 90.78  ?  425 TYR B OH    1 
ATOM   6991  N  N     . ARG B 1 426 ? -87.463  33.377  -17.822 1.00 76.75  ?  426 ARG B N     1 
ATOM   6992  C  CA    . ARG B 1 426 ? -87.599  33.209  -16.381 1.00 73.18  ?  426 ARG B CA    1 
ATOM   6993  C  C     . ARG B 1 426 ? -88.699  32.204  -15.992 1.00 72.32  ?  426 ARG B C     1 
ATOM   6994  O  O     . ARG B 1 426 ? -88.578  31.528  -14.974 1.00 86.53  ?  426 ARG B O     1 
ATOM   6995  C  CB    . ARG B 1 426 ? -87.813  34.556  -15.697 1.00 60.14  ?  426 ARG B CB    1 
ATOM   6996  C  CG    . ARG B 1 426 ? -86.585  35.442  -15.718 1.00 58.70  ?  426 ARG B CG    1 
ATOM   6997  C  CD    . ARG B 1 426 ? -85.453  34.869  -14.887 1.00 66.33  ?  426 ARG B CD    1 
ATOM   6998  N  NE    . ARG B 1 426 ? -84.730  35.945  -14.210 1.00 73.43  ?  426 ARG B NE    1 
ATOM   6999  C  CZ    . ARG B 1 426 ? -83.412  36.109  -14.254 1.00 88.27  ?  426 ARG B CZ    1 
ATOM   7000  N  NH1   . ARG B 1 426 ? -82.648  35.264  -14.932 1.00 98.80  ?  426 ARG B NH1   1 
ATOM   7001  N  NH2   . ARG B 1 426 ? -82.852  37.118  -13.612 1.00 90.93  ?  426 ARG B NH2   1 
ATOM   7002  N  N     . LEU B 1 427 ? -89.749  32.088  -16.800 1.00 57.57  ?  427 LEU B N     1 
ATOM   7003  C  CA    . LEU B 1 427 ? -90.798  31.087  -16.563 1.00 61.25  ?  427 LEU B CA    1 
ATOM   7004  C  C     . LEU B 1 427 ? -90.336  29.616  -16.613 1.00 68.47  ?  427 LEU B C     1 
ATOM   7005  O  O     . LEU B 1 427 ? -91.165  28.698  -16.585 1.00 74.79  ?  427 LEU B O     1 
ATOM   7006  C  CB    . LEU B 1 427 ? -91.930  31.275  -17.566 1.00 62.84  ?  427 LEU B CB    1 
ATOM   7007  C  CG    . LEU B 1 427 ? -92.297  32.743  -17.708 1.00 64.77  ?  427 LEU B CG    1 
ATOM   7008  C  CD1   . LEU B 1 427 ? -93.331  32.932  -18.822 1.00 62.07  ?  427 LEU B CD1   1 
ATOM   7009  C  CD2   . LEU B 1 427 ? -92.776  33.306  -16.361 1.00 69.13  ?  427 LEU B CD2   1 
ATOM   7010  N  N     . THR B 1 428 ? -89.030  29.393  -16.703 1.00 68.15  ?  428 THR B N     1 
ATOM   7011  C  CA    . THR B 1 428 ? -88.472  28.045  -16.668 1.00 82.51  ?  428 THR B CA    1 
ATOM   7012  C  C     . THR B 1 428 ? -87.692  27.860  -15.372 1.00 99.87  ?  428 THR B C     1 
ATOM   7013  O  O     . THR B 1 428 ? -87.053  26.829  -15.147 1.00 109.70 ?  428 THR B O     1 
ATOM   7014  C  CB    . THR B 1 428 ? -87.503  27.807  -17.847 1.00 84.13  ?  428 THR B CB    1 
ATOM   7015  O  OG1   . THR B 1 428 ? -86.404  28.722  -17.755 1.00 86.05  ?  428 THR B OG1   1 
ATOM   7016  C  CG2   . THR B 1 428 ? -88.206  28.006  -19.183 1.00 77.18  ?  428 THR B CG2   1 
ATOM   7017  N  N     . ASN B 1 429 ? -87.744  28.885  -14.531 1.00 107.28 ?  429 ASN B N     1 
ATOM   7018  C  CA    . ASN B 1 429 ? -86.958  28.952  -13.307 1.00 121.96 ?  429 ASN B CA    1 
ATOM   7019  C  C     . ASN B 1 429 ? -87.902  28.906  -12.115 1.00 116.91 ?  429 ASN B C     1 
ATOM   7020  O  O     . ASN B 1 429 ? -87.660  29.503  -11.065 1.00 125.82 ?  429 ASN B O     1 
ATOM   7021  C  CB    . ASN B 1 429 ? -86.125  30.241  -13.304 1.00 132.85 ?  429 ASN B CB    1 
ATOM   7022  C  CG    . ASN B 1 429 ? -85.566  30.581  -11.936 1.00 142.47 ?  429 ASN B CG    1 
ATOM   7023  O  OD1   . ASN B 1 429 ? -85.003  29.724  -11.244 1.00 145.06 ?  429 ASN B OD1   1 
ATOM   7024  N  ND2   . ASN B 1 429 ? -85.740  31.837  -11.527 1.00 143.91 ?  429 ASN B ND2   1 
ATOM   7025  N  N     . THR B 1 430 ? -88.994  28.181  -12.297 1.00 124.89 ?  430 THR B N     1 
ATOM   7026  C  CA    . THR B 1 430 ? -90.052  28.138  -11.308 1.00 112.70 ?  430 THR B CA    1 
ATOM   7027  C  C     . THR B 1 430 ? -89.671  27.254  -10.106 1.00 114.01 ?  430 THR B C     1 
ATOM   7028  O  O     . THR B 1 430 ? -90.204  26.161  -9.926  1.00 120.10 ?  430 THR B O     1 
ATOM   7029  C  CB    . THR B 1 430 ? -91.376  27.698  -11.974 1.00 112.59 ?  430 THR B CB    1 
ATOM   7030  O  OG1   . THR B 1 430 ? -92.329  27.349  -10.970 1.00 118.52 ?  430 THR B OG1   1 
ATOM   7031  C  CG2   . THR B 1 430 ? -91.155  26.507  -12.901 1.00 113.93 ?  430 THR B CG2   1 
ATOM   7032  N  N     . ASP B 1 431 ? -88.735  27.744  -9.291  1.00 108.68 ?  431 ASP B N     1 
ATOM   7033  C  CA    . ASP B 1 431 ? -88.241  27.019  -8.116  1.00 104.00 ?  431 ASP B CA    1 
ATOM   7034  C  C     . ASP B 1 431 ? -88.337  27.842  -6.824  1.00 94.60  ?  431 ASP B C     1 
ATOM   7035  O  O     . ASP B 1 431 ? -87.484  28.695  -6.552  1.00 91.28  ?  431 ASP B O     1 
ATOM   7036  C  CB    . ASP B 1 431 ? -86.788  26.592  -8.322  1.00 114.34 ?  431 ASP B CB    1 
ATOM   7037  C  CG    . ASP B 1 431 ? -86.162  26.007  -7.054  1.00 125.42 ?  431 ASP B CG    1 
ATOM   7038  O  OD1   . ASP B 1 431 ? -85.876  26.771  -6.105  1.00 125.44 ?  431 ASP B OD1   1 
ATOM   7039  O  OD2   . ASP B 1 431 ? -85.946  24.779  -7.004  1.00 132.97 ?  431 ASP B OD2   1 
ATOM   7040  N  N     . VAL B 1 432 ? -89.359  27.565  -6.020  1.00 86.53  ?  432 VAL B N     1 
ATOM   7041  C  CA    . VAL B 1 432 ? -89.591  28.299  -4.774  1.00 76.39  ?  432 VAL B CA    1 
ATOM   7042  C  C     . VAL B 1 432 ? -88.462  28.169  -3.749  1.00 81.80  ?  432 VAL B C     1 
ATOM   7043  O  O     . VAL B 1 432 ? -88.086  29.137  -3.094  1.00 90.76  ?  432 VAL B O     1 
ATOM   7044  C  CB    . VAL B 1 432 ? -90.900  27.837  -4.092  1.00 72.84  ?  432 VAL B CB    1 
ATOM   7045  C  CG1   . VAL B 1 432 ? -90.708  27.786  -2.611  1.00 80.81  ?  432 VAL B CG1   1 
ATOM   7046  C  CG2   . VAL B 1 432 ? -92.037  28.754  -4.431  1.00 69.45  ?  432 VAL B CG2   1 
ATOM   7047  N  N     . VAL B 1 433 ? -87.932  26.966  -3.596  1.00 77.82  ?  433 VAL B N     1 
ATOM   7048  C  CA    . VAL B 1 433 ? -86.987  26.697  -2.518  1.00 70.93  ?  433 VAL B CA    1 
ATOM   7049  C  C     . VAL B 1 433 ? -85.663  27.458  -2.620  1.00 71.43  ?  433 VAL B C     1 
ATOM   7050  O  O     . VAL B 1 433 ? -84.996  27.661  -1.615  1.00 70.86  ?  433 VAL B O     1 
ATOM   7051  C  CB    . VAL B 1 433 ? -86.738  25.176  -2.361  1.00 69.91  ?  433 VAL B CB    1 
ATOM   7052  C  CG1   . VAL B 1 433 ? -85.471  24.881  -1.538  1.00 69.53  ?  433 VAL B CG1   1 
ATOM   7053  C  CG2   . VAL B 1 433 ? -87.976  24.508  -1.770  1.00 71.58  ?  433 VAL B CG2   1 
ATOM   7054  N  N     . VAL B 1 434 ? -85.264  27.869  -3.818  1.00 75.57  ?  434 VAL B N     1 
ATOM   7055  C  CA    . VAL B 1 434 ? -84.064  28.697  -3.920  1.00 79.43  ?  434 VAL B CA    1 
ATOM   7056  C  C     . VAL B 1 434 ? -84.389  30.110  -3.465  1.00 81.97  ?  434 VAL B C     1 
ATOM   7057  O  O     . VAL B 1 434 ? -83.593  30.760  -2.786  1.00 85.67  ?  434 VAL B O     1 
ATOM   7058  C  CB    . VAL B 1 434 ? -83.481  28.746  -5.342  1.00 77.20  ?  434 VAL B CB    1 
ATOM   7059  C  CG1   . VAL B 1 434 ? -83.038  30.170  -5.684  1.00 75.50  ?  434 VAL B CG1   1 
ATOM   7060  C  CG2   . VAL B 1 434 ? -82.328  27.772  -5.468  1.00 78.95  ?  434 VAL B CG2   1 
ATOM   7061  N  N     . LEU B 1 435 ? -85.567  30.583  -3.851  1.00 76.73  ?  435 LEU B N     1 
ATOM   7062  C  CA    . LEU B 1 435 ? -86.048  31.861  -3.373  1.00 66.81  ?  435 LEU B CA    1 
ATOM   7063  C  C     . LEU B 1 435 ? -86.214  31.826  -1.856  1.00 70.99  ?  435 LEU B C     1 
ATOM   7064  O  O     . LEU B 1 435 ? -85.754  32.730  -1.159  1.00 78.24  ?  435 LEU B O     1 
ATOM   7065  C  CB    . LEU B 1 435 ? -87.363  32.217  -4.042  1.00 58.56  ?  435 LEU B CB    1 
ATOM   7066  C  CG    . LEU B 1 435 ? -87.187  32.685  -5.474  1.00 61.08  ?  435 LEU B CG    1 
ATOM   7067  C  CD1   . LEU B 1 435 ? -88.539  32.965  -6.122  1.00 58.38  ?  435 LEU B CD1   1 
ATOM   7068  C  CD2   . LEU B 1 435 ? -86.315  33.920  -5.467  1.00 63.87  ?  435 LEU B CD2   1 
ATOM   7069  N  N     . GLN B 1 436 ? -86.853  30.779  -1.340  1.00 66.06  ?  436 GLN B N     1 
ATOM   7070  C  CA    . GLN B 1 436 ? -87.002  30.656  0.110   1.00 64.39  ?  436 GLN B CA    1 
ATOM   7071  C  C     . GLN B 1 436 ? -85.659  30.670  0.843   1.00 67.29  ?  436 GLN B C     1 
ATOM   7072  O  O     . GLN B 1 436 ? -85.592  31.134  1.974   1.00 70.32  ?  436 GLN B O     1 
ATOM   7073  C  CB    . GLN B 1 436 ? -87.851  29.442  0.494   1.00 59.25  ?  436 GLN B CB    1 
ATOM   7074  C  CG    . GLN B 1 436 ? -89.289  29.555  0.001   1.00 69.21  ?  436 GLN B CG    1 
ATOM   7075  C  CD    . GLN B 1 436 ? -90.191  28.433  0.485   1.00 74.87  ?  436 GLN B CD    1 
ATOM   7076  O  OE1   . GLN B 1 436 ? -89.735  27.312  0.740   1.00 77.92  ?  436 GLN B OE1   1 
ATOM   7077  N  NE2   . GLN B 1 436 ? -91.487  28.731  0.613   1.00 78.72  ?  436 GLN B NE2   1 
ATOM   7078  N  N     . GLU B 1 437 ? -84.597  30.198  0.188   1.00 67.60  ?  437 GLU B N     1 
ATOM   7079  C  CA    . GLU B 1 437 ? -83.245  30.237  0.758   1.00 71.14  ?  437 GLU B CA    1 
ATOM   7080  C  C     . GLU B 1 437 ? -82.676  31.653  0.757   1.00 72.99  ?  437 GLU B C     1 
ATOM   7081  O  O     . GLU B 1 437 ? -81.959  32.035  1.673   1.00 75.78  ?  437 GLU B O     1 
ATOM   7082  C  CB    . GLU B 1 437 ? -82.280  29.298  0.016   1.00 76.50  ?  437 GLU B CB    1 
ATOM   7083  C  CG    . GLU B 1 437 ? -82.486  27.796  0.280   1.00 84.21  ?  437 GLU B CG    1 
ATOM   7084  C  CD    . GLU B 1 437 ? -81.549  26.914  -0.542  1.00 84.84  ?  437 GLU B CD    1 
ATOM   7085  N  N     . GLU B 1 438 ? -82.982  32.428  -0.278  1.00 76.45  ?  438 GLU B N     1 
ATOM   7086  C  CA    . GLU B 1 438 ? -82.496  33.803  -0.358  1.00 74.94  ?  438 GLU B CA    1 
ATOM   7087  C  C     . GLU B 1 438 ? -83.276  34.653  0.646   1.00 76.04  ?  438 GLU B C     1 
ATOM   7088  O  O     . GLU B 1 438 ? -82.709  35.420  1.424   1.00 73.67  ?  438 GLU B O     1 
ATOM   7089  C  CB    . GLU B 1 438 ? -82.651  34.340  -1.786  1.00 71.06  ?  438 GLU B CB    1 
ATOM   7090  C  CG    . GLU B 1 438 ? -82.033  35.710  -2.046  1.00 76.49  ?  438 GLU B CG    1 
ATOM   7091  C  CD    . GLU B 1 438 ? -82.316  36.229  -3.456  1.00 88.34  ?  438 GLU B CD    1 
ATOM   7092  O  OE1   . GLU B 1 438 ? -81.787  37.303  -3.816  1.00 92.63  ?  438 GLU B OE1   1 
ATOM   7093  O  OE2   . GLU B 1 438 ? -83.064  35.563  -4.208  1.00 90.93  ?  438 GLU B OE2   1 
ATOM   7094  N  N     . GLU B 1 439 ? -84.589  34.496  0.642   1.00 75.01  ?  439 GLU B N     1 
ATOM   7095  C  CA    . GLU B 1 439 ? -85.410  35.207  1.600   1.00 68.82  ?  439 GLU B CA    1 
ATOM   7096  C  C     . GLU B 1 439 ? -84.856  34.977  3.011   1.00 69.42  ?  439 GLU B C     1 
ATOM   7097  O  O     . GLU B 1 439 ? -84.913  35.859  3.856   1.00 71.95  ?  439 GLU B O     1 
ATOM   7098  C  CB    . GLU B 1 439 ? -86.861  34.753  1.483   1.00 66.13  ?  439 GLU B CB    1 
ATOM   7099  C  CG    . GLU B 1 439 ? -87.827  35.398  2.439   1.00 68.71  ?  439 GLU B CG    1 
ATOM   7100  C  CD    . GLU B 1 439 ? -89.080  34.552  2.596   1.00 79.69  ?  439 GLU B CD    1 
ATOM   7101  O  OE1   . GLU B 1 439 ? -90.217  35.099  2.502   1.00 77.42  ?  439 GLU B OE1   1 
ATOM   7102  O  OE2   . GLU B 1 439 ? -88.911  33.324  2.802   1.00 90.95  ?  439 GLU B OE2   1 
ATOM   7103  N  N     . ALA B 1 440 ? -84.291  33.808  3.273   1.00 67.41  ?  440 ALA B N     1 
ATOM   7104  C  CA    . ALA B 1 440 ? -83.744  33.576  4.614   1.00 68.38  ?  440 ALA B CA    1 
ATOM   7105  C  C     . ALA B 1 440 ? -82.392  34.262  4.767   1.00 66.98  ?  440 ALA B C     1 
ATOM   7106  O  O     . ALA B 1 440 ? -82.209  35.059  5.676   1.00 72.92  ?  440 ALA B O     1 
ATOM   7107  C  CB    . ALA B 1 440 ? -83.654  32.092  4.945   1.00 56.64  ?  440 ALA B CB    1 
ATOM   7108  N  N     . GLU B 1 441 ? -81.453  33.953  3.877   1.00 62.40  ?  441 GLU B N     1 
ATOM   7109  C  CA    . GLU B 1 441 ? -80.216  34.723  3.782   1.00 66.70  ?  441 GLU B CA    1 
ATOM   7110  C  C     . GLU B 1 441 ? -80.534  36.191  4.083   1.00 67.57  ?  441 GLU B C     1 
ATOM   7111  O  O     . GLU B 1 441 ? -79.864  36.836  4.885   1.00 71.53  ?  441 GLU B O     1 
ATOM   7112  C  CB    . GLU B 1 441 ? -79.604  34.603  2.371   1.00 75.08  ?  441 GLU B CB    1 
ATOM   7113  C  CG    . GLU B 1 441 ? -78.272  33.849  2.271   1.00 77.20  ?  441 GLU B CG    1 
ATOM   7114  N  N     . LEU B 1 442 ? -81.581  36.706  3.453   1.00 65.15  ?  442 LEU B N     1 
ATOM   7115  C  CA    . LEU B 1 442 ? -81.886  38.132  3.505   1.00 62.76  ?  442 LEU B CA    1 
ATOM   7116  C  C     . LEU B 1 442 ? -82.386  38.626  4.861   1.00 66.24  ?  442 LEU B C     1 
ATOM   7117  O  O     . LEU B 1 442 ? -81.927  39.644  5.378   1.00 66.99  ?  442 LEU B O     1 
ATOM   7118  C  CB    . LEU B 1 442 ? -82.895  38.487  2.411   1.00 57.72  ?  442 LEU B CB    1 
ATOM   7119  C  CG    . LEU B 1 442 ? -82.181  38.796  1.108   1.00 53.65  ?  442 LEU B CG    1 
ATOM   7120  C  CD1   . LEU B 1 442 ? -83.148  39.324  0.084   1.00 54.08  ?  442 LEU B CD1   1 
ATOM   7121  C  CD2   . LEU B 1 442 ? -81.079  39.801  1.398   1.00 48.15  ?  442 LEU B CD2   1 
ATOM   7122  N  N     . ARG B 1 443 ? -83.349  37.916  5.424   1.00 63.38  ?  443 ARG B N     1 
ATOM   7123  C  CA    . ARG B 1 443 ? -83.848  38.258  6.745   1.00 61.04  ?  443 ARG B CA    1 
ATOM   7124  C  C     . ARG B 1 443 ? -82.727  38.291  7.778   1.00 68.73  ?  443 ARG B C     1 
ATOM   7125  O  O     . ARG B 1 443 ? -82.630  39.241  8.542   1.00 80.12  ?  443 ARG B O     1 
ATOM   7126  C  CB    . ARG B 1 443 ? -84.951  37.298  7.155   1.00 52.44  ?  443 ARG B CB    1 
ATOM   7127  C  CG    . ARG B 1 443 ? -86.235  37.492  6.369   1.00 52.59  ?  443 ARG B CG    1 
ATOM   7128  C  CD    . ARG B 1 443 ? -87.241  36.423  6.722   1.00 66.20  ?  443 ARG B CD    1 
ATOM   7129  N  NE    . ARG B 1 443 ? -88.128  36.843  7.794   1.00 78.41  ?  443 ARG B NE    1 
ATOM   7130  C  CZ    . ARG B 1 443 ? -89.173  37.637  7.596   1.00 89.85  ?  443 ARG B CZ    1 
ATOM   7131  N  NH1   . ARG B 1 443 ? -89.423  38.076  6.360   1.00 94.19  ?  443 ARG B NH1   1 
ATOM   7132  N  NH2   . ARG B 1 443 ? -89.960  37.988  8.619   1.00 89.66  ?  443 ARG B NH2   1 
ATOM   7133  N  N     . GLU B 1 444 ? -81.878  37.268  7.793   1.00 63.90  ?  444 GLU B N     1 
ATOM   7134  C  CA    . GLU B 1 444 ? -80.708  37.259  8.667   1.00 62.18  ?  444 GLU B CA    1 
ATOM   7135  C  C     . GLU B 1 444 ? -79.826  38.512  8.432   1.00 62.25  ?  444 GLU B C     1 
ATOM   7136  O  O     . GLU B 1 444 ? -79.501  39.234  9.373   1.00 54.82  ?  444 GLU B O     1 
ATOM   7137  C  CB    . GLU B 1 444 ? -79.908  35.949  8.497   1.00 62.92  ?  444 GLU B CB    1 
ATOM   7138  C  CG    . GLU B 1 444 ? -79.088  35.513  9.731   1.00 67.26  ?  444 GLU B CG    1 
ATOM   7139  N  N     . LYS B 1 445 ? -79.449  38.783  7.186   1.00 66.58  ?  445 LYS B N     1 
ATOM   7140  C  CA    . LYS B 1 445 ? -78.635  39.966  6.899   1.00 62.45  ?  445 LYS B CA    1 
ATOM   7141  C  C     . LYS B 1 445 ? -79.294  41.211  7.505   1.00 62.25  ?  445 LYS B C     1 
ATOM   7142  O  O     . LYS B 1 445 ? -78.655  42.008  8.193   1.00 64.51  ?  445 LYS B O     1 
ATOM   7143  C  CB    . LYS B 1 445 ? -78.408  40.140  5.384   1.00 58.96  ?  445 LYS B CB    1 
ATOM   7144  C  CG    . LYS B 1 445 ? -77.336  41.175  4.996   1.00 61.57  ?  445 LYS B CG    1 
ATOM   7145  C  CD    . LYS B 1 445 ? -76.627  40.851  3.639   1.00 66.53  ?  445 LYS B CD    1 
ATOM   7146  N  N     . ILE B 1 446 ? -80.584  41.371  7.268   1.00 59.30  ?  446 ILE B N     1 
ATOM   7147  C  CA    . ILE B 1 446 ? -81.271  42.541  7.783   1.00 60.20  ?  446 ILE B CA    1 
ATOM   7148  C  C     . ILE B 1 446 ? -81.236  42.576  9.309   1.00 68.55  ?  446 ILE B C     1 
ATOM   7149  O  O     . ILE B 1 446 ? -81.025  43.630  9.905   1.00 74.52  ?  446 ILE B O     1 
ATOM   7150  C  CB    . ILE B 1 446 ? -82.709  42.606  7.263   1.00 57.01  ?  446 ILE B CB    1 
ATOM   7151  C  CG1   . ILE B 1 446 ? -82.689  42.917  5.761   1.00 58.32  ?  446 ILE B CG1   1 
ATOM   7152  C  CG2   . ILE B 1 446 ? -83.527  43.640  8.051   1.00 49.95  ?  446 ILE B CG2   1 
ATOM   7153  C  CD1   . ILE B 1 446 ? -83.970  42.540  5.045   1.00 58.48  ?  446 ILE B CD1   1 
ATOM   7154  N  N     . ALA B 1 447 ? -81.429  41.418  9.931   1.00 65.62  ?  447 ALA B N     1 
ATOM   7155  C  CA    . ALA B 1 447 ? -81.356  41.285  11.382  1.00 64.77  ?  447 ALA B CA    1 
ATOM   7156  C  C     . ALA B 1 447 ? -80.004  41.772  11.890  1.00 73.11  ?  447 ALA B C     1 
ATOM   7157  O  O     . ALA B 1 447 ? -79.947  42.663  12.745  1.00 82.78  ?  447 ALA B O     1 
ATOM   7158  C  CB    . ALA B 1 447 ? -81.573  39.850  11.781  1.00 54.59  ?  447 ALA B CB    1 
ATOM   7159  N  N     . MET B 1 448 ? -78.922  41.199  11.350  1.00 69.01  ?  448 MET B N     1 
ATOM   7160  C  CA    . MET B 1 448 ? -77.562  41.560  11.759  1.00 67.27  ?  448 MET B CA    1 
ATOM   7161  C  C     . MET B 1 448 ? -77.303  43.062  11.622  1.00 69.71  ?  448 MET B C     1 
ATOM   7162  O  O     . MET B 1 448 ? -76.828  43.708  12.546  1.00 74.46  ?  448 MET B O     1 
ATOM   7163  C  CB    . MET B 1 448 ? -76.496  40.721  11.020  1.00 61.97  ?  448 MET B CB    1 
ATOM   7164  C  CG    . MET B 1 448 ? -76.052  39.454  11.808  1.00 66.84  ?  448 MET B CG    1 
ATOM   7165  N  N     . LEU B 1 449 ? -77.637  43.626  10.477  1.00 67.62  ?  449 LEU B N     1 
ATOM   7166  C  CA    . LEU B 1 449 ? -77.408  45.042  10.268  1.00 67.30  ?  449 LEU B CA    1 
ATOM   7167  C  C     . LEU B 1 449 ? -78.271  45.896  11.191  1.00 62.61  ?  449 LEU B C     1 
ATOM   7168  O  O     . LEU B 1 449 ? -77.844  46.955  11.629  1.00 66.08  ?  449 LEU B O     1 
ATOM   7169  C  CB    . LEU B 1 449 ? -77.683  45.421  8.809   1.00 65.71  ?  449 LEU B CB    1 
ATOM   7170  C  CG    . LEU B 1 449 ? -76.836  44.770  7.721   1.00 63.59  ?  449 LEU B CG    1 
ATOM   7171  C  CD1   . LEU B 1 449 ? -77.555  44.923  6.421   1.00 67.45  ?  449 LEU B CD1   1 
ATOM   7172  C  CD2   . LEU B 1 449 ? -75.500  45.440  7.638   1.00 64.79  ?  449 LEU B CD2   1 
ATOM   7173  N  N     . ALA B 1 450 ? -79.494  45.472  11.473  1.00 56.56  ?  450 ALA B N     1 
ATOM   7174  C  CA    . ALA B 1 450 ? -80.349  46.317  12.303  1.00 66.37  ?  450 ALA B CA    1 
ATOM   7175  C  C     . ALA B 1 450 ? -79.731  46.389  13.692  1.00 68.82  ?  450 ALA B C     1 
ATOM   7176  O  O     . ALA B 1 450 ? -79.687  47.457  14.321  1.00 66.07  ?  450 ALA B O     1 
ATOM   7177  C  CB    . ALA B 1 450 ? -81.793  45.798  12.358  1.00 53.84  ?  450 ALA B CB    1 
ATOM   7178  N  N     . ALA B 1 451 ? -79.226  45.246  14.147  1.00 68.84  ?  451 ALA B N     1 
ATOM   7179  C  CA    . ALA B 1 451 ? -78.550  45.163  15.436  1.00 68.25  ?  451 ALA B CA    1 
ATOM   7180  C  C     . ALA B 1 451 ? -77.397  46.164  15.522  1.00 67.95  ?  451 ALA B C     1 
ATOM   7181  O  O     . ALA B 1 451 ? -77.271  46.888  16.502  1.00 74.40  ?  451 ALA B O     1 
ATOM   7182  C  CB    . ALA B 1 451 ? -78.054  43.752  15.679  1.00 68.52  ?  451 ALA B CB    1 
ATOM   7183  N  N     . ILE B 1 452 ? -76.561  46.194  14.488  1.00 64.29  ?  452 ILE B N     1 
ATOM   7184  C  CA    . ILE B 1 452 ? -75.463  47.158  14.393  1.00 59.82  ?  452 ILE B CA    1 
ATOM   7185  C  C     . ILE B 1 452 ? -75.971  48.586  14.576  1.00 65.90  ?  452 ILE B C     1 
ATOM   7186  O  O     . ILE B 1 452 ? -75.308  49.433  15.176  1.00 71.69  ?  452 ILE B O     1 
ATOM   7187  C  CB    . ILE B 1 452 ? -74.760  47.101  13.014  1.00 53.74  ?  452 ILE B CB    1 
ATOM   7188  C  CG1   . ILE B 1 452 ? -74.436  45.669  12.611  1.00 50.88  ?  452 ILE B CG1   1 
ATOM   7189  C  CG2   . ILE B 1 452 ? -73.497  47.919  13.032  1.00 57.89  ?  452 ILE B CG2   1 
ATOM   7190  C  CD1   . ILE B 1 452 ? -73.010  45.490  12.165  1.00 52.51  ?  452 ILE B CD1   1 
ATOM   7191  N  N     . ILE B 1 453 ? -77.157  48.848  14.052  1.00 53.12  ?  453 ILE B N     1 
ATOM   7192  C  CA    . ILE B 1 453 ? -77.621  50.214  13.921  1.00 67.74  ?  453 ILE B CA    1 
ATOM   7193  C  C     . ILE B 1 453 ? -78.235  50.702  15.217  1.00 69.15  ?  453 ILE B C     1 
ATOM   7194  O  O     . ILE B 1 453 ? -78.241  51.902  15.498  1.00 72.90  ?  453 ILE B O     1 
ATOM   7195  C  CB    . ILE B 1 453 ? -78.640  50.327  12.774  1.00 69.10  ?  453 ILE B CB    1 
ATOM   7196  C  CG1   . ILE B 1 453 ? -77.930  50.092  11.442  1.00 62.58  ?  453 ILE B CG1   1 
ATOM   7197  C  CG2   . ILE B 1 453 ? -79.347  51.673  12.797  1.00 73.44  ?  453 ILE B CG2   1 
ATOM   7198  C  CD1   . ILE B 1 453 ? -78.772  50.409  10.223  1.00 65.30  ?  453 ILE B CD1   1 
ATOM   7199  N  N     . GLY B 1 454 ? -78.736  49.760  16.008  1.00 65.68  ?  454 GLY B N     1 
ATOM   7200  C  CA    . GLY B 1 454 ? -79.472  50.093  17.216  1.00 75.95  ?  454 GLY B CA    1 
ATOM   7201  C  C     . GLY B 1 454 ? -78.800  49.720  18.530  1.00 81.25  ?  454 GLY B C     1 
ATOM   7202  O  O     . GLY B 1 454 ? -79.425  49.810  19.593  1.00 89.18  ?  454 GLY B O     1 
ATOM   7203  N  N     . ASP B 1 455 ? -77.532  49.315  18.465  1.00 72.78  ?  455 ASP B N     1 
ATOM   7204  C  CA    . ASP B 1 455 ? -76.778  48.966  19.662  1.00 82.59  ?  455 ASP B CA    1 
ATOM   7205  C  C     . ASP B 1 455 ? -75.282  49.328  19.540  1.00 81.54  ?  455 ASP B C     1 
ATOM   7206  O  O     . ASP B 1 455 ? -74.485  48.629  18.902  1.00 73.31  ?  455 ASP B O     1 
ATOM   7207  C  CB    . ASP B 1 455 ? -77.010  47.488  20.025  1.00 89.38  ?  455 ASP B CB    1 
ATOM   7208  C  CG    . ASP B 1 455 ? -76.031  46.960  21.086  1.00 93.08  ?  455 ASP B CG    1 
ATOM   7209  O  OD1   . ASP B 1 455 ? -76.207  47.246  22.306  1.00 90.18  ?  455 ASP B OD1   1 
ATOM   7210  O  OD2   . ASP B 1 455 ? -75.095  46.224  20.679  1.00 91.81  ?  455 ASP B OD2   1 
ATOM   7211  N  N     . GLU B 1 456 ? -74.917  50.434  20.179  1.00 77.48  ?  456 GLU B N     1 
ATOM   7212  C  CA    . GLU B 1 456 ? -73.551  50.934  20.165  1.00 70.38  ?  456 GLU B CA    1 
ATOM   7213  C  C     . GLU B 1 456 ? -72.485  49.858  20.447  1.00 67.88  ?  456 GLU B C     1 
ATOM   7214  O  O     . GLU B 1 456 ? -71.423  49.866  19.820  1.00 71.47  ?  456 GLU B O     1 
ATOM   7215  C  CB    . GLU B 1 456 ? -73.421  52.082  21.164  1.00 73.40  ?  456 GLU B CB    1 
ATOM   7216  C  CG    . GLU B 1 456 ? -72.591  53.251  20.709  1.00 84.56  ?  456 GLU B CG    1 
ATOM   7217  C  CD    . GLU B 1 456 ? -73.316  54.123  19.704  1.00 98.36  ?  456 GLU B CD    1 
ATOM   7218  O  OE1   . GLU B 1 456 ? -72.667  55.056  19.185  1.00 110.15 ?  456 GLU B OE1   1 
ATOM   7219  O  OE2   . GLU B 1 456 ? -74.518  53.883  19.434  1.00 91.98  ?  456 GLU B OE2   1 
ATOM   7220  N  N     . ARG B 1 457 ? -72.742  48.946  21.387  1.00 67.96  ?  457 ARG B N     1 
ATOM   7221  C  CA    . ARG B 1 457 ? -71.751  47.893  21.672  1.00 70.29  ?  457 ARG B CA    1 
ATOM   7222  C  C     . ARG B 1 457 ? -71.569  47.007  20.429  1.00 68.62  ?  457 ARG B C     1 
ATOM   7223  O  O     . ARG B 1 457 ? -70.468  46.945  19.870  1.00 75.98  ?  457 ARG B O     1 
ATOM   7224  C  CB    . ARG B 1 457 ? -72.039  47.079  22.973  1.00 60.29  ?  457 ARG B CB    1 
ATOM   7225  N  N     . THR B 1 458 ? -72.643  46.348  19.990  1.00 60.55  ?  458 THR B N     1 
ATOM   7226  C  CA    . THR B 1 458 ? -72.630  45.576  18.739  1.00 61.72  ?  458 THR B CA    1 
ATOM   7227  C  C     . THR B 1 458 ? -71.854  46.238  17.563  1.00 63.78  ?  458 THR B C     1 
ATOM   7228  O  O     . THR B 1 458 ? -71.060  45.580  16.865  1.00 63.81  ?  458 THR B O     1 
ATOM   7229  C  CB    . THR B 1 458 ? -74.060  45.251  18.295  1.00 60.14  ?  458 THR B CB    1 
ATOM   7230  O  OG1   . THR B 1 458 ? -74.489  44.055  18.945  1.00 59.64  ?  458 THR B OG1   1 
ATOM   7231  C  CG2   . THR B 1 458 ? -74.123  45.044  16.806  1.00 59.96  ?  458 THR B CG2   1 
ATOM   7232  N  N     . MET B 1 459 ? -72.087  47.533  17.358  1.00 57.96  ?  459 MET B N     1 
ATOM   7233  C  CA    . MET B 1 459 ? -71.334  48.306  16.376  1.00 58.93  ?  459 MET B CA    1 
ATOM   7234  C  C     . MET B 1 459 ? -69.835  48.388  16.698  1.00 68.58  ?  459 MET B C     1 
ATOM   7235  O  O     . MET B 1 459 ? -69.006  48.163  15.828  1.00 76.42  ?  459 MET B O     1 
ATOM   7236  C  CB    . MET B 1 459 ? -71.942  49.705  16.207  1.00 56.88  ?  459 MET B CB    1 
ATOM   7237  C  CG    . MET B 1 459 ? -71.136  50.655  15.344  1.00 52.60  ?  459 MET B CG    1 
ATOM   7238  S  SD    . MET B 1 459 ? -69.647  51.275  16.155  1.00 87.48  ?  459 MET B SD    1 
ATOM   7239  C  CE    . MET B 1 459 ? -70.362  52.242  17.482  1.00 74.30  ?  459 MET B CE    1 
ATOM   7240  N  N     . TYR B 1 460 ? -69.470  48.715  17.932  1.00 71.52  ?  460 TYR B N     1 
ATOM   7241  C  CA    . TYR B 1 460 ? -68.044  48.773  18.272  1.00 70.25  ?  460 TYR B CA    1 
ATOM   7242  C  C     . TYR B 1 460 ? -67.333  47.421  18.107  1.00 75.24  ?  460 TYR B C     1 
ATOM   7243  O  O     . TYR B 1 460 ? -66.159  47.386  17.733  1.00 79.43  ?  460 TYR B O     1 
ATOM   7244  C  CB    . TYR B 1 460 ? -67.805  49.337  19.680  1.00 58.99  ?  460 TYR B CB    1 
ATOM   7245  C  CG    . TYR B 1 460 ? -67.921  50.838  19.763  1.00 63.18  ?  460 TYR B CG    1 
ATOM   7246  C  CD1   . TYR B 1 460 ? -67.058  51.657  19.042  1.00 69.80  ?  460 TYR B CD1   1 
ATOM   7247  C  CD2   . TYR B 1 460 ? -68.890  51.448  20.564  1.00 55.75  ?  460 TYR B CD2   1 
ATOM   7248  C  CE1   . TYR B 1 460 ? -67.155  53.050  19.108  1.00 70.25  ?  460 TYR B CE1   1 
ATOM   7249  C  CE2   . TYR B 1 460 ? -68.995  52.847  20.639  1.00 56.26  ?  460 TYR B CE2   1 
ATOM   7250  C  CZ    . TYR B 1 460 ? -68.125  53.637  19.905  1.00 65.90  ?  460 TYR B CZ    1 
ATOM   7251  O  OH    . TYR B 1 460 ? -68.213  55.011  19.946  1.00 62.68  ?  460 TYR B OH    1 
ATOM   7252  N  N     . ASN B 1 461 ? -68.022  46.312  18.380  1.00 69.51  ?  461 ASN B N     1 
ATOM   7253  C  CA    . ASN B 1 461 ? -67.378  45.011  18.191  1.00 70.19  ?  461 ASN B CA    1 
ATOM   7254  C  C     . ASN B 1 461 ? -67.139  44.708  16.727  1.00 72.72  ?  461 ASN B C     1 
ATOM   7255  O  O     . ASN B 1 461 ? -66.137  44.088  16.378  1.00 73.14  ?  461 ASN B O     1 
ATOM   7256  C  CB    . ASN B 1 461 ? -68.142  43.866  18.849  1.00 73.31  ?  461 ASN B CB    1 
ATOM   7257  C  CG    . ASN B 1 461 ? -68.358  44.092  20.322  1.00 78.82  ?  461 ASN B CG    1 
ATOM   7258  O  OD1   . ASN B 1 461 ? -67.449  43.937  21.141  1.00 85.02  ?  461 ASN B OD1   1 
ATOM   7259  N  ND2   . ASN B 1 461 ? -69.569  44.472  20.670  1.00 83.63  ?  461 ASN B ND2   1 
ATOM   7260  N  N     . LEU B 1 462 ? -68.061  45.144  15.874  1.00 77.73  ?  462 LEU B N     1 
ATOM   7261  C  CA    . LEU B 1 462 ? -67.834  45.113  14.430  1.00 76.31  ?  462 LEU B CA    1 
ATOM   7262  C  C     . LEU B 1 462 ? -66.535  45.830  14.124  1.00 69.05  ?  462 LEU B C     1 
ATOM   7263  O  O     . LEU B 1 462 ? -65.650  45.289  13.456  1.00 68.66  ?  462 LEU B O     1 
ATOM   7264  C  CB    . LEU B 1 462 ? -68.957  45.842  13.703  1.00 77.36  ?  462 LEU B CB    1 
ATOM   7265  C  CG    . LEU B 1 462 ? -69.454  45.161  12.441  1.00 53.41  ?  462 LEU B CG    1 
ATOM   7266  C  CD1   . LEU B 1 462 ? -69.493  46.139  11.303  1.00 89.63  ?  462 LEU B CD1   1 
ATOM   7267  C  CD2   . LEU B 1 462 ? -68.555  43.973  12.160  1.00 55.81  ?  462 LEU B CD2   1 
ATOM   7268  N  N     . MET B 1 463 ? -66.443  47.057  14.634  1.00 58.91  ?  463 MET B N     1 
ATOM   7269  C  CA    . MET B 1 463 ? -65.297  47.934  14.442  1.00 56.02  ?  463 MET B CA    1 
ATOM   7270  C  C     . MET B 1 463 ? -63.999  47.325  14.996  1.00 67.05  ?  463 MET B C     1 
ATOM   7271  O  O     . MET B 1 463 ? -62.902  47.677  14.565  1.00 77.63  ?  463 MET B O     1 
ATOM   7272  C  CB    . MET B 1 463 ? -65.605  49.312  15.060  1.00 59.60  ?  463 MET B CB    1 
ATOM   7273  C  CG    . MET B 1 463 ? -64.426  50.259  15.326  1.00 50.45  ?  463 MET B CG    1 
ATOM   7274  S  SD    . MET B 1 463 ? -65.120  51.901  15.613  1.00 64.35  ?  463 MET B SD    1 
ATOM   7275  C  CE    . MET B 1 463 ? -63.755  52.657  16.473  1.00 81.56  ?  463 MET B CE    1 
ATOM   7276  N  N     . LYS B 1 464 ? -64.108  46.411  15.951  1.00 66.35  ?  464 LYS B N     1 
ATOM   7277  C  CA    . LYS B 1 464 ? -62.901  45.756  16.427  1.00 59.36  ?  464 LYS B CA    1 
ATOM   7278  C  C     . LYS B 1 464 ? -62.598  44.531  15.574  1.00 59.33  ?  464 LYS B C     1 
ATOM   7279  O  O     . LYS B 1 464 ? -61.447  44.329  15.179  1.00 67.58  ?  464 LYS B O     1 
ATOM   7280  C  CB    . LYS B 1 464 ? -62.977  45.433  17.922  1.00 59.28  ?  464 LYS B CB    1 
ATOM   7281  C  CG    . LYS B 1 464 ? -62.764  46.655  18.819  1.00 64.72  ?  464 LYS B CG    1 
ATOM   7282  C  CD    . LYS B 1 464 ? -63.624  46.588  20.091  1.00 72.17  ?  464 LYS B CD    1 
ATOM   7283  C  CE    . LYS B 1 464 ? -63.373  45.305  20.889  1.00 76.46  ?  464 LYS B CE    1 
ATOM   7284  N  NZ    . LYS B 1 464 ? -64.487  44.962  21.817  1.00 57.95  ?  464 LYS B NZ    1 
ATOM   7285  N  N     . LYS B 1 465 ? -63.626  43.737  15.260  1.00 54.48  ?  465 LYS B N     1 
ATOM   7286  C  CA    . LYS B 1 465 ? -63.449  42.580  14.373  1.00 59.75  ?  465 LYS B CA    1 
ATOM   7287  C  C     . LYS B 1 465 ? -62.695  43.029  13.139  1.00 63.68  ?  465 LYS B C     1 
ATOM   7288  O  O     . LYS B 1 465 ? -61.780  42.350  12.670  1.00 65.53  ?  465 LYS B O     1 
ATOM   7289  C  CB    . LYS B 1 465 ? -64.786  41.942  13.953  1.00 54.83  ?  465 LYS B CB    1 
ATOM   7290  C  CG    . LYS B 1 465 ? -64.633  40.642  13.128  1.00 62.32  ?  465 LYS B CG    1 
ATOM   7291  C  CD    . LYS B 1 465 ? -65.974  40.016  12.672  1.00 60.34  ?  465 LYS B CD    1 
ATOM   7292  N  N     . GLU B 1 466 ? -63.077  44.192  12.627  1.00 63.15  ?  466 GLU B N     1 
ATOM   7293  C  CA    . GLU B 1 466 ? -62.516  44.679  11.385  1.00 69.19  ?  466 GLU B CA    1 
ATOM   7294  C  C     . GLU B 1 466 ? -61.101  45.227  11.546  1.00 69.57  ?  466 GLU B C     1 
ATOM   7295  O  O     . GLU B 1 466 ? -60.215  44.903  10.754  1.00 74.59  ?  466 GLU B O     1 
ATOM   7296  C  CB    . GLU B 1 466 ? -63.449  45.705  10.740  1.00 75.08  ?  466 GLU B CB    1 
ATOM   7297  C  CG    . GLU B 1 466 ? -64.714  45.092  10.123  1.00 78.04  ?  466 GLU B CG    1 
ATOM   7298  C  CD    . GLU B 1 466 ? -65.622  46.136  9.491   1.00 84.98  ?  466 GLU B CD    1 
ATOM   7299  O  OE1   . GLU B 1 466 ? -65.146  47.269  9.252   1.00 82.71  ?  466 GLU B OE1   1 
ATOM   7300  O  OE2   . GLU B 1 466 ? -66.808  45.824  9.230   1.00 93.93  ?  466 GLU B OE2   1 
ATOM   7301  N  N     . LEU B 1 467 ? -60.879  46.048  12.565  1.00 66.21  ?  467 LEU B N     1 
ATOM   7302  C  CA    . LEU B 1 467 ? -59.539  46.585  12.803  1.00 68.20  ?  467 LEU B CA    1 
ATOM   7303  C  C     . LEU B 1 467 ? -58.527  45.450  12.933  1.00 79.43  ?  467 LEU B C     1 
ATOM   7304  O  O     . LEU B 1 467 ? -57.418  45.528  12.377  1.00 88.88  ?  467 LEU B O     1 
ATOM   7305  C  CB    . LEU B 1 467 ? -59.507  47.504  14.030  1.00 55.80  ?  467 LEU B CB    1 
ATOM   7306  C  CG    . LEU B 1 467 ? -60.074  48.904  13.767  1.00 55.53  ?  467 LEU B CG    1 
ATOM   7307  C  CD1   . LEU B 1 467 ? -60.176  49.744  15.017  1.00 53.22  ?  467 LEU B CD1   1 
ATOM   7308  C  CD2   . LEU B 1 467 ? -59.259  49.628  12.714  1.00 61.00  ?  467 LEU B CD2   1 
ATOM   7309  N  N     . ARG B 1 468 ? -58.917  44.394  13.649  1.00 70.60  ?  468 ARG B N     1 
ATOM   7310  C  CA    . ARG B 1 468 ? -58.071  43.215  13.785  1.00 65.72  ?  468 ARG B CA    1 
ATOM   7311  C  C     . ARG B 1 468 ? -57.786  42.529  12.436  1.00 73.39  ?  468 ARG B C     1 
ATOM   7312  O  O     . ARG B 1 468 ? -56.627  42.305  12.079  1.00 79.75  ?  468 ARG B O     1 
ATOM   7313  C  CB    . ARG B 1 468 ? -58.694  42.224  14.747  1.00 68.36  ?  468 ARG B CB    1 
ATOM   7314  C  CG    . ARG B 1 468 ? -58.928  42.758  16.150  1.00 69.22  ?  468 ARG B CG    1 
ATOM   7315  C  CD    . ARG B 1 468 ? -59.314  41.603  17.083  1.00 77.61  ?  468 ARG B CD    1 
ATOM   7316  N  NE    . ARG B 1 468 ? -59.452  42.012  18.480  1.00 89.11  ?  468 ARG B NE    1 
ATOM   7317  C  CZ    . ARG B 1 468 ? -60.621  42.245  19.076  1.00 91.91  ?  468 ARG B CZ    1 
ATOM   7318  N  NH1   . ARG B 1 468 ? -61.755  42.124  18.370  1.00 91.83  ?  468 ARG B NH1   1 
ATOM   7319  N  NH2   . ARG B 1 468 ? -60.657  42.588  20.374  1.00 89.51  ?  468 ARG B NH2   1 
ATOM   7320  N  N     . GLU B 1 469 ? -58.839  42.192  11.696  1.00 71.32  ?  469 GLU B N     1 
ATOM   7321  C  CA    . GLU B 1 469 ? -58.681  41.639  10.350  1.00 68.25  ?  469 GLU B CA    1 
ATOM   7322  C  C     . GLU B 1 469 ? -57.593  42.391  9.560   1.00 66.64  ?  469 GLU B C     1 
ATOM   7323  O  O     . GLU B 1 469 ? -56.707  41.766  8.958   1.00 69.79  ?  469 GLU B O     1 
ATOM   7324  C  CB    . GLU B 1 469 ? -60.023  41.635  9.606   1.00 72.44  ?  469 GLU B CB    1 
ATOM   7325  C  CG    . GLU B 1 469 ? -60.695  40.255  9.579   1.00 91.26  ?  469 GLU B CG    1 
ATOM   7326  C  CD    . GLU B 1 469 ? -62.240  40.288  9.536   1.00 99.50  ?  469 GLU B CD    1 
ATOM   7327  O  OE1   . GLU B 1 469 ? -62.828  41.200  8.892   1.00 94.56  ?  469 GLU B OE1   1 
ATOM   7328  O  OE2   . GLU B 1 469 ? -62.862  39.381  10.155  1.00 103.83 ?  469 GLU B OE2   1 
ATOM   7329  N  N     . VAL B 1 470 ? -57.658  43.725  9.588   1.00 60.09  ?  470 VAL B N     1 
ATOM   7330  C  CA    . VAL B 1 470 ? -56.659  44.579  8.943   1.00 61.66  ?  470 VAL B CA    1 
ATOM   7331  C  C     . VAL B 1 470 ? -55.265  44.367  9.529   1.00 66.83  ?  470 VAL B C     1 
ATOM   7332  O  O     . VAL B 1 470 ? -54.290  44.221  8.782   1.00 66.83  ?  470 VAL B O     1 
ATOM   7333  C  CB    . VAL B 1 470 ? -57.036  46.101  9.012   1.00 57.57  ?  470 VAL B CB    1 
ATOM   7334  C  CG1   . VAL B 1 470 ? -55.828  46.977  8.804   1.00 52.01  ?  470 VAL B CG1   1 
ATOM   7335  C  CG2   . VAL B 1 470 ? -58.060  46.446  7.973   1.00 61.91  ?  470 VAL B CG2   1 
ATOM   7336  N  N     . LYS B 1 471 ? -55.170  44.360  10.861  1.00 67.01  ?  471 LYS B N     1 
ATOM   7337  C  CA    . LYS B 1 471 ? -53.906  44.044  11.528  1.00 65.35  ?  471 LYS B CA    1 
ATOM   7338  C  C     . LYS B 1 471 ? -53.344  42.679  11.136  1.00 67.04  ?  471 LYS B C     1 
ATOM   7339  O  O     . LYS B 1 471 ? -52.160  42.578  10.827  1.00 67.75  ?  471 LYS B O     1 
ATOM   7340  C  CB    . LYS B 1 471 ? -54.032  44.126  13.048  1.00 63.74  ?  471 LYS B CB    1 
ATOM   7341  C  CG    . LYS B 1 471 ? -52.957  43.331  13.776  1.00 66.27  ?  471 LYS B CG    1 
ATOM   7342  C  CD    . LYS B 1 471 ? -52.814  43.771  15.226  1.00 70.27  ?  471 LYS B CD    1 
ATOM   7343  C  CE    . LYS B 1 471 ? -53.088  42.620  16.214  1.00 73.65  ?  471 LYS B CE    1 
ATOM   7344  N  NZ    . LYS B 1 471 ? -52.076  42.605  17.322  1.00 79.90  ?  471 LYS B NZ    1 
ATOM   7345  N  N     . LYS B 1 472 ? -54.178  41.634  11.146  1.00 68.53  ?  472 LYS B N     1 
ATOM   7346  C  CA    . LYS B 1 472 ? -53.709  40.299  10.743  1.00 65.66  ?  472 LYS B CA    1 
ATOM   7347  C  C     . LYS B 1 472 ? -53.223  40.350  9.322   1.00 68.17  ?  472 LYS B C     1 
ATOM   7348  O  O     . LYS B 1 472 ? -52.233  39.721  8.982   1.00 79.12  ?  472 LYS B O     1 
ATOM   7349  C  CB    . LYS B 1 472 ? -54.784  39.206  10.873  1.00 57.35  ?  472 LYS B CB    1 
ATOM   7350  C  CG    . LYS B 1 472 ? -54.224  37.769  10.808  1.00 70.09  ?  472 LYS B CG    1 
ATOM   7351  C  CD    . LYS B 1 472 ? -55.281  36.667  11.033  1.00 61.45  ?  472 LYS B CD    1 
ATOM   7352  N  N     . LYS B 1 473 ? -53.910  41.115  8.486   1.00 66.72  ?  473 LYS B N     1 
ATOM   7353  C  CA    . LYS B 1 473 ? -53.554  41.139  7.072   1.00 69.88  ?  473 LYS B CA    1 
ATOM   7354  C  C     . LYS B 1 473 ? -52.321  41.971  6.733   1.00 71.40  ?  473 LYS B C     1 
ATOM   7355  O  O     . LYS B 1 473 ? -51.597  41.618  5.815   1.00 78.67  ?  473 LYS B O     1 
ATOM   7356  C  CB    . LYS B 1 473 ? -54.738  41.549  6.185   1.00 67.72  ?  473 LYS B CB    1 
ATOM   7357  C  CG    . LYS B 1 473 ? -54.406  41.568  4.698   1.00 71.86  ?  473 LYS B CG    1 
ATOM   7358  C  CD    . LYS B 1 473 ? -55.630  41.876  3.827   1.00 77.77  ?  473 LYS B CD    1 
ATOM   7359  C  CE    . LYS B 1 473 ? -55.492  41.336  2.389   1.00 83.94  ?  473 LYS B CE    1 
ATOM   7360  N  NZ    . LYS B 1 473 ? -56.501  40.259  2.088   1.00 90.54  ?  473 LYS B NZ    1 
ATOM   7361  N  N     . PHE B 1 474 ? -52.070  43.059  7.454   1.00 68.47  ?  474 PHE B N     1 
ATOM   7362  C  CA    . PHE B 1 474 ? -51.001  43.975  7.040   1.00 73.19  ?  474 PHE B CA    1 
ATOM   7363  C  C     . PHE B 1 474 ? -49.925  44.181  8.097   1.00 72.91  ?  474 PHE B C     1 
ATOM   7364  O  O     . PHE B 1 474 ? -49.027  45.020  7.937   1.00 71.59  ?  474 PHE B O     1 
ATOM   7365  C  CB    . PHE B 1 474 ? -51.576  45.334  6.627   1.00 72.65  ?  474 PHE B CB    1 
ATOM   7366  C  CG    . PHE B 1 474 ? -52.578  45.254  5.525   1.00 68.87  ?  474 PHE B CG    1 
ATOM   7367  C  CD1   . PHE B 1 474 ? -52.171  45.174  4.209   1.00 64.26  ?  474 PHE B CD1   1 
ATOM   7368  C  CD2   . PHE B 1 474 ? -53.935  45.268  5.800   1.00 72.84  ?  474 PHE B CD2   1 
ATOM   7369  C  CE1   . PHE B 1 474 ? -53.099  45.099  3.179   1.00 67.58  ?  474 PHE B CE1   1 
ATOM   7370  C  CE2   . PHE B 1 474 ? -54.874  45.192  4.773   1.00 72.94  ?  474 PHE B CE2   1 
ATOM   7371  C  CZ    . PHE B 1 474 ? -54.451  45.104  3.463   1.00 70.48  ?  474 PHE B CZ    1 
ATOM   7372  N  N     . ALA B 1 475 ? -50.018  43.422  9.179   1.00 72.20  ?  475 ALA B N     1 
ATOM   7373  C  CA    . ALA B 1 475 ? -49.106  43.621  10.298  1.00 67.91  ?  475 ALA B CA    1 
ATOM   7374  C  C     . ALA B 1 475 ? -47.688  43.324  9.880   1.00 69.16  ?  475 ALA B C     1 
ATOM   7375  O  O     . ALA B 1 475 ? -47.418  42.319  9.218   1.00 67.86  ?  475 ALA B O     1 
ATOM   7376  C  CB    . ALA B 1 475 ? -49.490  42.739  11.460  1.00 63.89  ?  475 ALA B CB    1 
ATOM   7377  N  N     . THR B 1 476 ? -46.770  44.194  10.266  1.00 69.55  ?  476 THR B N     1 
ATOM   7378  C  CA    . THR B 1 476 ? -45.363  43.865  10.090  1.00 72.51  ?  476 THR B CA    1 
ATOM   7379  C  C     . THR B 1 476 ? -44.540  44.310  11.301  1.00 76.75  ?  476 THR B C     1 
ATOM   7380  O  O     . THR B 1 476 ? -44.948  45.194  12.049  1.00 81.01  ?  476 THR B O     1 
ATOM   7381  C  CB    . THR B 1 476 ? -44.812  44.449  8.786   1.00 67.49  ?  476 THR B CB    1 
ATOM   7382  O  OG1   . THR B 1 476 ? -44.059  45.628  9.073   1.00 80.80  ?  476 THR B OG1   1 
ATOM   7383  C  CG2   . THR B 1 476 ? -45.949  44.823  7.892   1.00 63.30  ?  476 THR B CG2   1 
ATOM   7384  N  N     . PRO B 1 477 ? -43.380  43.681  11.494  1.00 73.16  ?  477 PRO B N     1 
ATOM   7385  C  CA    . PRO B 1 477 ? -42.447  43.908  12.605  1.00 72.47  ?  477 PRO B CA    1 
ATOM   7386  C  C     . PRO B 1 477 ? -42.002  45.372  12.766  1.00 72.09  ?  477 PRO B C     1 
ATOM   7387  O  O     . PRO B 1 477 ? -41.983  46.119  11.774  1.00 74.47  ?  477 PRO B O     1 
ATOM   7388  C  CB    . PRO B 1 477 ? -41.240  43.054  12.212  1.00 72.44  ?  477 PRO B CB    1 
ATOM   7389  C  CG    . PRO B 1 477 ? -41.782  42.022  11.297  1.00 70.01  ?  477 PRO B CG    1 
ATOM   7390  C  CD    . PRO B 1 477 ? -42.868  42.692  10.532  1.00 71.96  ?  477 PRO B CD    1 
ATOM   7391  N  N     . ARG B 1 478 ? -41.650  45.763  13.998  1.00 65.15  ?  478 ARG B N     1 
ATOM   7392  C  CA    . ARG B 1 478 ? -41.045  47.069  14.257  1.00 61.58  ?  478 ARG B CA    1 
ATOM   7393  C  C     . ARG B 1 478 ? -39.772  47.194  13.456  1.00 69.51  ?  478 ARG B C     1 
ATOM   7394  O  O     . ARG B 1 478 ? -39.092  46.199  13.203  1.00 73.43  ?  478 ARG B O     1 
ATOM   7395  C  CB    . ARG B 1 478 ? -40.658  47.219  15.718  1.00 61.74  ?  478 ARG B CB    1 
ATOM   7396  C  CG    . ARG B 1 478 ? -41.633  48.007  16.546  1.00 77.24  ?  478 ARG B CG    1 
ATOM   7397  C  CD    . ARG B 1 478 ? -40.949  48.620  17.758  1.00 75.08  ?  478 ARG B CD    1 
ATOM   7398  N  NE    . ARG B 1 478 ? -40.710  50.040  17.541  1.00 78.35  ?  478 ARG B NE    1 
ATOM   7399  C  CZ    . ARG B 1 478 ? -41.615  50.986  17.770  1.00 78.43  ?  478 ARG B CZ    1 
ATOM   7400  N  NH1   . ARG B 1 478 ? -42.814  50.654  18.232  1.00 72.49  ?  478 ARG B NH1   1 
ATOM   7401  N  NH2   . ARG B 1 478 ? -41.321  52.261  17.536  1.00 81.96  ?  478 ARG B NH2   1 
ATOM   7402  N  N     . LEU B 1 479 ? -39.433  48.416  13.073  1.00 70.08  ?  479 LEU B N     1 
ATOM   7403  C  CA    . LEU B 1 479 ? -38.183  48.645  12.369  1.00 68.89  ?  479 LEU B CA    1 
ATOM   7404  C  C     . LEU B 1 479 ? -37.263  49.471  13.254  1.00 76.69  ?  479 LEU B C     1 
ATOM   7405  O  O     . LEU B 1 479 ? -36.070  49.189  13.363  1.00 82.84  ?  479 LEU B O     1 
ATOM   7406  C  CB    . LEU B 1 479 ? -38.423  49.341  11.027  1.00 63.59  ?  479 LEU B CB    1 
ATOM   7407  C  CG    . LEU B 1 479 ? -39.259  48.567  10.014  1.00 64.82  ?  479 LEU B CG    1 
ATOM   7408  C  CD1   . LEU B 1 479 ? -39.529  49.424  8.771   1.00 69.12  ?  479 LEU B CD1   1 
ATOM   7409  C  CD2   . LEU B 1 479 ? -38.555  47.271  9.652   1.00 62.98  ?  479 LEU B CD2   1 
ATOM   7410  N  N     . SER B 1 480 ? -37.826  50.495  13.887  1.00 77.53  ?  480 SER B N     1 
ATOM   7411  C  CA    . SER B 1 480 ? -37.063  51.316  14.816  1.00 76.72  ?  480 SER B CA    1 
ATOM   7412  C  C     . SER B 1 480 ? -37.124  50.713  16.228  1.00 77.08  ?  480 SER B C     1 
ATOM   7413  O  O     . SER B 1 480 ? -38.201  50.394  16.740  1.00 80.00  ?  480 SER B O     1 
ATOM   7414  C  CB    . SER B 1 480 ? -37.585  52.762  14.827  1.00 75.02  ?  480 SER B CB    1 
ATOM   7415  O  OG    . SER B 1 480 ? -37.581  53.359  13.543  1.00 68.33  ?  480 SER B OG    1 
ATOM   7416  N  N     . SER B 1 481 ? -35.963  50.541  16.842  1.00 74.96  ?  481 SER B N     1 
ATOM   7417  C  CA    . SER B 1 481 ? -35.891  50.137  18.240  1.00 76.61  ?  481 SER B CA    1 
ATOM   7418  C  C     . SER B 1 481 ? -36.087  51.352  19.165  1.00 85.91  ?  481 SER B C     1 
ATOM   7419  O  O     . SER B 1 481 ? -35.848  52.489  18.761  1.00 91.48  ?  481 SER B O     1 
ATOM   7420  C  CB    . SER B 1 481 ? -34.544  49.454  18.518  1.00 77.28  ?  481 SER B CB    1 
ATOM   7421  O  OG    . SER B 1 481 ? -33.454  50.329  18.268  1.00 80.32  ?  481 SER B OG    1 
ATOM   7422  N  N     . LEU B 1 482 ? -36.522  51.118  20.401  1.00 87.18  ?  482 LEU B N     1 
ATOM   7423  C  CA    . LEU B 1 482 ? -36.634  52.213  21.370  1.00 86.32  ?  482 LEU B CA    1 
ATOM   7424  C  C     . LEU B 1 482 ? -35.637  52.099  22.536  1.00 97.87  ?  482 LEU B C     1 
ATOM   7425  O  O     . LEU B 1 482 ? -35.088  51.026  22.791  1.00 100.25 ?  482 LEU B O     1 
ATOM   7426  C  CB    . LEU B 1 482 ? -38.073  52.339  21.865  1.00 78.81  ?  482 LEU B CB    1 
ATOM   7427  C  CG    . LEU B 1 482 ? -39.047  52.554  20.702  1.00 77.91  ?  482 LEU B CG    1 
ATOM   7428  C  CD1   . LEU B 1 482 ? -40.481  52.354  21.104  1.00 70.54  ?  482 LEU B CD1   1 
ATOM   7429  C  CD2   . LEU B 1 482 ? -38.873  53.947  20.149  1.00 84.38  ?  482 LEU B CD2   1 
ATOM   7430  N  N     . GLU B 1 483 ? -35.377  53.226  23.200  1.00 95.17  ?  483 GLU B N     1 
ATOM   7431  C  CA    . GLU B 1 483 ? -34.513  53.297  24.389  1.00 104.23 ?  483 GLU B CA    1 
ATOM   7432  C  C     . GLU B 1 483 ? -34.954  54.544  25.172  1.00 110.98 ?  483 GLU B C     1 
ATOM   7433  O  O     . GLU B 1 483 ? -35.682  55.380  24.631  1.00 114.56 ?  483 GLU B O     1 
ATOM   7434  C  CB    . GLU B 1 483 ? -33.028  53.432  24.000  1.00 102.67 ?  483 GLU B CB    1 
ATOM   7435  C  CG    . GLU B 1 483 ? -32.457  52.345  23.058  1.00 97.90  ?  483 GLU B CG    1 
ATOM   7436  C  CD    . GLU B 1 483 ? -30.929  52.493  22.763  1.00 113.77 ?  483 GLU B CD    1 
ATOM   7437  O  OE1   . GLU B 1 483 ? -30.272  53.467  23.225  1.00 112.94 ?  483 GLU B OE1   1 
ATOM   7438  O  OE2   . GLU B 1 483 ? -30.380  51.614  22.056  1.00 116.41 ?  483 GLU B OE2   1 
ATOM   7439  N  N     . ASP B 1 484 ? -34.534  54.693  26.426  1.00 108.31 ?  484 ASP B N     1 
ATOM   7440  C  CA    . ASP B 1 484 ? -34.802  55.955  27.132  1.00 99.23  ?  484 ASP B CA    1 
ATOM   7441  C  C     . ASP B 1 484 ? -33.544  56.557  27.784  1.00 107.46 ?  484 ASP B C     1 
ATOM   7442  O  O     . ASP B 1 484 ? -32.794  57.311  27.145  1.00 107.29 ?  484 ASP B O     1 
ATOM   7443  C  CB    . ASP B 1 484 ? -35.944  55.794  28.143  1.00 87.44  ?  484 ASP B CB    1 
ATOM   7444  N  N     . LYS C 2 36  ? -22.923  65.235  -14.369 1.00 112.22 ?  415 LYS C N     1 
ATOM   7445  C  CA    . LYS C 2 36  ? -23.102  64.287  -15.464 1.00 107.80 ?  415 LYS C CA    1 
ATOM   7446  C  C     . LYS C 2 36  ? -22.727  62.866  -15.030 1.00 109.99 ?  415 LYS C C     1 
ATOM   7447  O  O     . LYS C 2 36  ? -23.603  62.061  -14.712 1.00 112.26 ?  415 LYS C O     1 
ATOM   7448  C  CB    . LYS C 2 36  ? -22.290  64.714  -16.697 1.00 104.65 ?  415 LYS C CB    1 
ATOM   7449  N  N     . LEU C 2 37  ? -21.426  62.579  -14.987 1.00 107.71 ?  416 LEU C N     1 
ATOM   7450  C  CA    . LEU C 2 37  ? -20.907  61.228  -14.719 1.00 104.91 ?  416 LEU C CA    1 
ATOM   7451  C  C     . LEU C 2 37  ? -21.030  60.749  -13.270 1.00 105.80 ?  416 LEU C C     1 
ATOM   7452  O  O     . LEU C 2 37  ? -20.671  61.467  -12.335 1.00 111.39 ?  416 LEU C O     1 
ATOM   7453  C  CB    . LEU C 2 37  ? -19.431  61.155  -15.125 1.00 103.60 ?  416 LEU C CB    1 
ATOM   7454  C  CG    . LEU C 2 37  ? -18.777  59.790  -15.366 1.00 98.53  ?  416 LEU C CG    1 
ATOM   7455  C  CD1   . LEU C 2 37  ? -17.499  59.955  -16.186 1.00 103.35 ?  416 LEU C CD1   1 
ATOM   7456  C  CD2   . LEU C 2 37  ? -18.472  59.084  -14.079 1.00 90.15  ?  416 LEU C CD2   1 
ATOM   7457  N  N     . THR C 2 38  ? -21.530  59.527  -13.096 1.00 101.61 ?  417 THR C N     1 
ATOM   7458  C  CA    . THR C 2 38  ? -21.473  58.835  -11.805 1.00 103.04 ?  417 THR C CA    1 
ATOM   7459  C  C     . THR C 2 38  ? -20.392  57.771  -11.937 1.00 104.02 ?  417 THR C C     1 
ATOM   7460  O  O     . THR C 2 38  ? -20.563  56.804  -12.685 1.00 103.93 ?  417 THR C O     1 
ATOM   7461  C  CB    . THR C 2 38  ? -22.816  58.142  -11.423 1.00 113.85 ?  417 THR C CB    1 
ATOM   7462  O  OG1   . THR C 2 38  ? -23.927  59.014  -11.681 1.00 113.87 ?  417 THR C OG1   1 
ATOM   7463  C  CG2   . THR C 2 38  ? -22.819  57.740  -9.951  1.00 114.49 ?  417 THR C CG2   1 
ATOM   7464  N  N     . PRO C 2 39  ? -19.264  57.954  -11.226 1.00 104.41 ?  418 PRO C N     1 
ATOM   7465  C  CA    . PRO C 2 39  ? -18.052  57.137  -11.411 1.00 105.09 ?  418 PRO C CA    1 
ATOM   7466  C  C     . PRO C 2 39  ? -18.013  55.833  -10.612 1.00 108.60 ?  418 PRO C C     1 
ATOM   7467  O  O     . PRO C 2 39  ? -18.690  55.701  -9.595  1.00 115.05 ?  418 PRO C O     1 
ATOM   7468  C  CB    . PRO C 2 39  ? -16.945  58.065  -10.927 1.00 102.74 ?  418 PRO C CB    1 
ATOM   7469  C  CG    . PRO C 2 39  ? -17.608  58.877  -9.860  1.00 101.42 ?  418 PRO C CG    1 
ATOM   7470  C  CD    . PRO C 2 39  ? -19.036  59.073  -10.294 1.00 101.46 ?  418 PRO C CD    1 
ATOM   7471  N  N     . ALA C 2 40  ? -17.227  54.873  -11.085 1.00 107.28 ?  419 ALA C N     1 
ATOM   7472  C  CA    . ALA C 2 40  ? -16.990  53.664  -10.317 1.00 112.01 ?  419 ALA C CA    1 
ATOM   7473  C  C     . ALA C 2 40  ? -16.264  54.047  -9.021  1.00 115.57 ?  419 ALA C C     1 
ATOM   7474  O  O     . ALA C 2 40  ? -15.603  55.087  -8.952  1.00 117.47 ?  419 ALA C O     1 
ATOM   7475  C  CB    . ALA C 2 40  ? -16.175  52.674  -11.129 1.00 112.54 ?  419 ALA C CB    1 
ATOM   7476  N  N     . GLN C 2 41  ? -16.393  53.228  -7.984  1.00 112.24 ?  420 GLN C N     1 
ATOM   7477  C  CA    . GLN C 2 41  ? -15.763  53.571  -6.725  1.00 114.55 ?  420 GLN C CA    1 
ATOM   7478  C  C     . GLN C 2 41  ? -14.240  53.469  -6.865  1.00 119.28 ?  420 GLN C C     1 
ATOM   7479  O  O     . GLN C 2 41  ? -13.516  54.421  -6.565  1.00 121.74 ?  420 GLN C O     1 
ATOM   7480  C  CB    . GLN C 2 41  ? -16.298  52.688  -5.593  1.00 120.54 ?  420 GLN C CB    1 
ATOM   7481  C  CG    . GLN C 2 41  ? -16.396  53.400  -4.234  1.00 131.10 ?  420 GLN C CG    1 
ATOM   7482  C  CD    . GLN C 2 41  ? -17.414  52.761  -3.294  1.00 137.08 ?  420 GLN C CD    1 
ATOM   7483  O  OE1   . GLN C 2 41  ? -17.316  51.578  -2.958  1.00 138.55 ?  420 GLN C OE1   1 
ATOM   7484  N  NE2   . GLN C 2 41  ? -18.401  53.546  -2.870  1.00 138.08 ?  420 GLN C NE2   1 
ATOM   7485  N  N     . SER C 2 42  ? -13.766  52.322  -7.350  1.00 122.98 ?  421 SER C N     1 
ATOM   7486  C  CA    . SER C 2 42  ? -12.331  52.071  -7.508  1.00 126.64 ?  421 SER C CA    1 
ATOM   7487  C  C     . SER C 2 42  ? -11.885  52.086  -8.980  1.00 134.00 ?  421 SER C C     1 
ATOM   7488  O  O     . SER C 2 42  ? -12.508  51.449  -9.829  1.00 135.21 ?  421 SER C O     1 
ATOM   7489  C  CB    . SER C 2 42  ? -11.952  50.738  -6.854  1.00 122.52 ?  421 SER C CB    1 
ATOM   7490  N  N     . LYS C 2 43  ? -10.803  52.814  -9.267  1.00 135.73 ?  422 LYS C N     1 
ATOM   7491  C  CA    . LYS C 2 43  ? -10.247  52.910  -10.621 1.00 125.42 ?  422 LYS C CA    1 
ATOM   7492  C  C     . LYS C 2 43  ? -9.563   51.611  -11.033 1.00 122.00 ?  422 LYS C C     1 
ATOM   7493  O  O     . LYS C 2 43  ? -8.584   51.207  -10.420 1.00 114.10 ?  422 LYS C O     1 
ATOM   7494  C  CB    . LYS C 2 43  ? -9.245   54.068  -10.714 1.00 117.63 ?  422 LYS C CB    1 
ATOM   7495  N  N     . ASN C 2 44  ? -10.078  50.962  -12.075 1.00 128.14 ?  423 ASN C N     1 
ATOM   7496  C  CA    . ASN C 2 44  ? -9.526   49.691  -12.547 1.00 132.11 ?  423 ASN C CA    1 
ATOM   7497  C  C     . ASN C 2 44  ? -9.771   49.440  -14.038 1.00 134.07 ?  423 ASN C C     1 
ATOM   7498  O  O     . ASN C 2 44  ? -10.846  48.976  -14.426 1.00 135.44 ?  423 ASN C O     1 
ATOM   7499  C  CB    . ASN C 2 44  ? -10.079  48.521  -11.723 1.00 131.93 ?  423 ASN C CB    1 
ATOM   7500  C  CG    . ASN C 2 44  ? -9.591   47.163  -12.224 1.00 134.15 ?  423 ASN C CG    1 
ATOM   7501  O  OD1   . ASN C 2 44  ? -8.545   47.066  -12.867 1.00 136.27 ?  423 ASN C OD1   1 
ATOM   7502  N  ND2   . ASN C 2 44  ? -10.351  46.109  -11.927 1.00 134.14 ?  423 ASN C ND2   1 
ATOM   7503  N  N     . PRO C 2 45  ? -8.769   49.749  -14.880 1.00 133.42 ?  424 PRO C N     1 
ATOM   7504  C  CA    . PRO C 2 45  ? -8.835   49.504  -16.328 1.00 131.87 ?  424 PRO C CA    1 
ATOM   7505  C  C     . PRO C 2 45  ? -9.227   48.071  -16.728 1.00 130.55 ?  424 PRO C C     1 
ATOM   7506  O  O     . PRO C 2 45  ? -9.979   47.911  -17.687 1.00 130.97 ?  424 PRO C O     1 
ATOM   7507  C  CB    . PRO C 2 45  ? -7.410   49.823  -16.791 1.00 133.09 ?  424 PRO C CB    1 
ATOM   7508  C  CG    . PRO C 2 45  ? -6.965   50.886  -15.849 1.00 133.09 ?  424 PRO C CG    1 
ATOM   7509  C  CD    . PRO C 2 45  ? -7.576   50.533  -14.512 1.00 133.57 ?  424 PRO C CD    1 
ATOM   7510  N  N     . ALA C 2 46  ? -8.738   47.060  -16.012 1.00 126.65 ?  425 ALA C N     1 
ATOM   7511  C  CA    . ALA C 2 46  ? -8.996   45.658  -16.369 1.00 123.99 ?  425 ALA C CA    1 
ATOM   7512  C  C     . ALA C 2 46  ? -10.450  45.200  -16.155 1.00 122.62 ?  425 ALA C C     1 
ATOM   7513  O  O     . ALA C 2 46  ? -10.950  44.338  -16.888 1.00 119.06 ?  425 ALA C O     1 
ATOM   7514  C  CB    . ALA C 2 46  ? -8.025   44.728  -15.627 1.00 105.95 ?  425 ALA C CB    1 
ATOM   7515  N  N     . LYS C 2 47  ? -11.120  45.769  -15.152 1.00 122.90 ?  426 LYS C N     1 
ATOM   7516  C  CA    . LYS C 2 47  ? -12.490  45.374  -14.814 1.00 119.13 ?  426 LYS C CA    1 
ATOM   7517  C  C     . LYS C 2 47  ? -13.521  46.459  -15.139 1.00 118.88 ?  426 LYS C C     1 
ATOM   7518  O  O     . LYS C 2 47  ? -14.541  46.178  -15.773 1.00 120.29 ?  426 LYS C O     1 
ATOM   7519  C  CB    . LYS C 2 47  ? -12.600  44.958  -13.339 1.00 115.33 ?  426 LYS C CB    1 
ATOM   7520  N  N     . ASN C 2 48  ? -13.248  47.690  -14.709 1.00 117.64 ?  427 ASN C N     1 
ATOM   7521  C  CA    . ASN C 2 48  ? -14.174  48.817  -14.894 1.00 118.48 ?  427 ASN C CA    1 
ATOM   7522  C  C     . ASN C 2 48  ? -14.943  48.853  -16.223 1.00 119.89 ?  427 ASN C C     1 
ATOM   7523  O  O     . ASN C 2 48  ? -14.380  48.625  -17.292 1.00 126.26 ?  427 ASN C O     1 
ATOM   7524  C  CB    . ASN C 2 48  ? -13.452  50.153  -14.680 1.00 118.99 ?  427 ASN C CB    1 
ATOM   7525  C  CG    . ASN C 2 48  ? -13.265  50.491  -13.211 1.00 116.66 ?  427 ASN C CG    1 
ATOM   7526  O  OD1   . ASN C 2 48  ? -13.306  49.610  -12.351 1.00 117.77 ?  427 ASN C OD1   1 
ATOM   7527  N  ND2   . ASN C 2 48  ? -13.058  51.772  -12.917 1.00 112.71 ?  427 ASN C ND2   1 
ATOM   7528  N  N     . GLU C 2 49  ? -16.235  49.158  -16.138 1.00 113.44 ?  428 GLU C N     1 
ATOM   7529  C  CA    . GLU C 2 49  ? -17.109  49.212  -17.305 1.00 110.32 ?  428 GLU C CA    1 
ATOM   7530  C  C     . GLU C 2 49  ? -17.804  50.573  -17.397 1.00 109.90 ?  428 GLU C C     1 
ATOM   7531  O  O     . GLU C 2 49  ? -18.195  51.152  -16.383 1.00 110.39 ?  428 GLU C O     1 
ATOM   7532  C  CB    . GLU C 2 49  ? -18.155  48.096  -17.233 1.00 110.88 ?  428 GLU C CB    1 
ATOM   7533  C  CG    . GLU C 2 49  ? -17.564  46.699  -17.082 1.00 117.74 ?  428 GLU C CG    1 
ATOM   7534  C  CD    . GLU C 2 49  ? -18.626  45.615  -16.923 1.00 121.59 ?  428 GLU C CD    1 
ATOM   7535  O  OE1   . GLU C 2 49  ? -19.831  45.948  -16.822 1.00 115.48 ?  428 GLU C OE1   1 
ATOM   7536  O  OE2   . GLU C 2 49  ? -18.249  44.422  -16.902 1.00 129.53 ?  428 GLU C OE2   1 
ATOM   7537  N  N     . LEU C 2 50  ? -17.953  51.086  -18.614 1.00 109.76 ?  429 LEU C N     1 
ATOM   7538  C  CA    . LEU C 2 50  ? -18.617  52.370  -18.811 1.00 106.94 ?  429 LEU C CA    1 
ATOM   7539  C  C     . LEU C 2 50  ? -19.976  52.150  -19.466 1.00 104.94 ?  429 LEU C C     1 
ATOM   7540  O  O     . LEU C 2 50  ? -20.072  51.585  -20.552 1.00 109.77 ?  429 LEU C O     1 
ATOM   7541  C  CB    . LEU C 2 50  ? -17.754  53.299  -19.666 1.00 106.21 ?  429 LEU C CB    1 
ATOM   7542  C  CG    . LEU C 2 50  ? -17.873  54.802  -19.405 1.00 102.40 ?  429 LEU C CG    1 
ATOM   7543  C  CD1   . LEU C 2 50  ? -17.303  55.584  -20.577 1.00 100.13 ?  429 LEU C CD1   1 
ATOM   7544  C  CD2   . LEU C 2 50  ? -19.309  55.182  -19.162 1.00 98.40  ?  429 LEU C CD2   1 
ATOM   7545  N  N     . TYR C 2 51  ? -21.030  52.580  -18.788 1.00 98.61  ?  430 TYR C N     1 
ATOM   7546  C  CA    . TYR C 2 51  ? -22.375  52.410  -19.298 1.00 95.79  ?  430 TYR C CA    1 
ATOM   7547  C  C     . TYR C 2 51  ? -22.876  53.721  -19.884 1.00 97.97  ?  430 TYR C C     1 
ATOM   7548  O  O     . TYR C 2 51  ? -22.968  54.734  -19.184 1.00 99.06  ?  430 TYR C O     1 
ATOM   7549  C  CB    . TYR C 2 51  ? -23.313  51.925  -18.190 1.00 99.08  ?  430 TYR C CB    1 
ATOM   7550  C  CG    . TYR C 2 51  ? -23.343  50.420  -18.021 1.00 102.49 ?  430 TYR C CG    1 
ATOM   7551  C  CD1   . TYR C 2 51  ? -24.330  49.653  -18.626 1.00 99.33  ?  430 TYR C CD1   1 
ATOM   7552  C  CD2   . TYR C 2 51  ? -22.388  49.767  -17.256 1.00 106.79 ?  430 TYR C CD2   1 
ATOM   7553  C  CE1   . TYR C 2 51  ? -24.364  48.286  -18.476 1.00 100.84 ?  430 TYR C CE1   1 
ATOM   7554  C  CE2   . TYR C 2 51  ? -22.414  48.395  -17.103 1.00 107.71 ?  430 TYR C CE2   1 
ATOM   7555  C  CZ    . TYR C 2 51  ? -23.404  47.660  -17.716 1.00 106.67 ?  430 TYR C CZ    1 
ATOM   7556  O  OH    . TYR C 2 51  ? -23.430  46.294  -17.565 1.00 111.24 ?  430 TYR C OH    1 
ATOM   7557  N  N     . LEU C 2 52  ? -23.179  53.694  -21.180 1.00 98.53  ?  431 LEU C N     1 
ATOM   7558  C  CA    . LEU C 2 52  ? -23.732  54.845  -21.883 1.00 97.16  ?  431 LEU C CA    1 
ATOM   7559  C  C     . LEU C 2 52  ? -25.232  54.664  -22.026 1.00 100.31 ?  431 LEU C C     1 
ATOM   7560  O  O     . LEU C 2 52  ? -25.703  53.993  -22.949 1.00 103.14 ?  431 LEU C O     1 
ATOM   7561  C  CB    . LEU C 2 52  ? -23.087  54.991  -23.258 1.00 94.99  ?  431 LEU C CB    1 
ATOM   7562  C  CG    . LEU C 2 52  ? -21.565  55.079  -23.201 1.00 97.43  ?  431 LEU C CG    1 
ATOM   7563  C  CD1   . LEU C 2 52  ? -20.959  55.007  -24.597 1.00 96.03  ?  431 LEU C CD1   1 
ATOM   7564  C  CD2   . LEU C 2 52  ? -21.143  56.351  -22.458 1.00 99.37  ?  431 LEU C CD2   1 
ATOM   7565  N  N     . VAL C 2 53  ? -25.978  55.264  -21.104 1.00 98.39  ?  432 VAL C N     1 
ATOM   7566  C  CA    . VAL C 2 53  ? -27.419  55.094  -21.067 1.00 96.80  ?  432 VAL C CA    1 
ATOM   7567  C  C     . VAL C 2 53  ? -28.170  56.181  -21.837 1.00 100.47 ?  432 VAL C C     1 
ATOM   7568  O  O     . VAL C 2 53  ? -27.842  57.362  -21.746 1.00 103.56 ?  432 VAL C O     1 
ATOM   7569  C  CB    . VAL C 2 53  ? -27.926  55.081  -19.627 1.00 92.95  ?  432 VAL C CB    1 
ATOM   7570  C  CG1   . VAL C 2 53  ? -29.413  54.726  -19.607 1.00 96.10  ?  432 VAL C CG1   1 
ATOM   7571  C  CG2   . VAL C 2 53  ? -27.092  54.117  -18.776 1.00 84.20  ?  432 VAL C CG2   1 
ATOM   7572  N  N     . GLU C 2 54  ? -29.174  55.762  -22.600 1.00 101.03 ?  433 GLU C N     1 
ATOM   7573  C  CA    . GLU C 2 54  ? -30.080  56.682  -23.275 1.00 101.78 ?  433 GLU C CA    1 
ATOM   7574  C  C     . GLU C 2 54  ? -31.100  57.203  -22.267 1.00 102.69 ?  433 GLU C C     1 
ATOM   7575  O  O     . GLU C 2 54  ? -32.104  56.545  -22.001 1.00 107.09 ?  433 GLU C O     1 
ATOM   7576  C  CB    . GLU C 2 54  ? -30.806  55.964  -24.425 1.00 101.17 ?  433 GLU C CB    1 
ATOM   7577  C  CG    . GLU C 2 54  ? -31.963  56.753  -25.071 1.00 100.19 ?  433 GLU C CG    1 
ATOM   7578  C  CD    . GLU C 2 54  ? -33.064  55.848  -25.625 1.00 99.36  ?  433 GLU C CD    1 
ATOM   7579  O  OE1   . GLU C 2 54  ? -34.142  56.353  -26.043 1.00 95.30  ?  433 GLU C OE1   1 
ATOM   7580  O  OE2   . GLU C 2 54  ? -32.845  54.619  -25.631 1.00 104.09 ?  433 GLU C OE2   1 
ATOM   7581  N  N     . GLY C 2 55  ? -30.838  58.369  -21.690 1.00 100.33 ?  434 GLY C N     1 
ATOM   7582  C  CA    . GLY C 2 55  ? -31.825  59.017  -20.844 1.00 101.13 ?  434 GLY C CA    1 
ATOM   7583  C  C     . GLY C 2 55  ? -31.389  59.266  -19.419 1.00 107.41 ?  434 GLY C C     1 
ATOM   7584  O  O     . GLY C 2 55  ? -30.738  58.422  -18.803 1.00 109.05 ?  434 GLY C O     1 
ATOM   7585  N  N     . ASP C 2 56  ? -31.751  60.432  -18.893 1.00 113.71 ?  435 ASP C N     1 
ATOM   7586  C  CA    . ASP C 2 56  ? -31.482  60.747  -17.492 1.00 119.30 ?  435 ASP C CA    1 
ATOM   7587  C  C     . ASP C 2 56  ? -32.265  59.799  -16.599 1.00 116.66 ?  435 ASP C C     1 
ATOM   7588  O  O     . ASP C 2 56  ? -31.775  59.372  -15.549 1.00 111.58 ?  435 ASP C O     1 
ATOM   7589  C  CB    . ASP C 2 56  ? -31.859  62.197  -17.172 1.00 127.34 ?  435 ASP C CB    1 
ATOM   7590  C  CG    . ASP C 2 56  ? -30.647  63.067  -16.909 1.00 136.03 ?  435 ASP C CG    1 
ATOM   7591  O  OD1   . ASP C 2 56  ? -29.702  62.582  -16.249 1.00 138.95 ?  435 ASP C OD1   1 
ATOM   7592  O  OD2   . ASP C 2 56  ? -30.634  64.229  -17.372 1.00 139.49 ?  435 ASP C OD2   1 
ATOM   7593  N  N     . SER C 2 57  ? -33.486  59.482  -17.037 1.00 118.27 ?  436 SER C N     1 
ATOM   7594  C  CA    . SER C 2 57  ? -34.390  58.587  -16.316 1.00 113.29 ?  436 SER C CA    1 
ATOM   7595  C  C     . SER C 2 57  ? -33.772  57.209  -16.099 1.00 99.84  ?  436 SER C C     1 
ATOM   7596  O  O     . SER C 2 57  ? -33.628  56.757  -14.962 1.00 96.98  ?  436 SER C O     1 
ATOM   7597  C  CB    . SER C 2 57  ? -35.712  58.443  -17.077 1.00 116.09 ?  436 SER C CB    1 
ATOM   7598  O  OG    . SER C 2 57  ? -35.913  57.103  -17.504 1.00 116.98 ?  436 SER C OG    1 
ATOM   7599  N  N     . ALA C 2 58  ? -33.424  56.549  -17.203 1.00 92.38  ?  437 ALA C N     1 
ATOM   7600  C  CA    . ALA C 2 58  ? -32.712  55.273  -17.176 1.00 84.71  ?  437 ALA C CA    1 
ATOM   7601  C  C     . ALA C 2 58  ? -31.306  55.422  -16.598 1.00 86.52  ?  437 ALA C C     1 
ATOM   7602  O  O     . ALA C 2 58  ? -30.815  54.534  -15.902 1.00 88.18  ?  437 ALA C O     1 
ATOM   7603  C  CB    . ALA C 2 58  ? -32.638  54.692  -18.561 1.00 84.55  ?  437 ALA C CB    1 
ATOM   7604  N  N     . GLY C 2 59  ? -30.651  56.539  -16.898 1.00 88.90  ?  438 GLY C N     1 
ATOM   7605  C  CA    . GLY C 2 59  ? -29.402  56.856  -16.233 1.00 92.84  ?  438 GLY C CA    1 
ATOM   7606  C  C     . GLY C 2 59  ? -29.554  56.717  -14.725 1.00 91.35  ?  438 GLY C C     1 
ATOM   7607  O  O     . GLY C 2 59  ? -28.601  56.367  -14.023 1.00 92.14  ?  438 GLY C O     1 
ATOM   7608  N  N     . GLY C 2 60  ? -30.767  56.984  -14.241 1.00 90.85  ?  439 GLY C N     1 
ATOM   7609  C  CA    . GLY C 2 60  ? -31.098  56.930  -12.828 1.00 93.54  ?  439 GLY C CA    1 
ATOM   7610  C  C     . GLY C 2 60  ? -31.297  55.523  -12.291 1.00 99.21  ?  439 GLY C C     1 
ATOM   7611  O  O     . GLY C 2 60  ? -30.827  55.209  -11.194 1.00 102.07 ?  439 GLY C O     1 
ATOM   7612  N  N     . SER C 2 61  ? -32.001  54.682  -13.050 1.00 100.85 ?  440 SER C N     1 
ATOM   7613  C  CA    . SER C 2 61  ? -32.192  53.279  -12.678 1.00 102.97 ?  440 SER C CA    1 
ATOM   7614  C  C     . SER C 2 61  ? -30.856  52.536  -12.733 1.00 109.04 ?  440 SER C C     1 
ATOM   7615  O  O     . SER C 2 61  ? -30.661  51.533  -12.040 1.00 113.61 ?  440 SER C O     1 
ATOM   7616  C  CB    . SER C 2 61  ? -33.216  52.599  -13.594 1.00 100.13 ?  440 SER C CB    1 
ATOM   7617  O  OG    . SER C 2 61  ? -34.489  53.229  -13.529 1.00 99.21  ?  440 SER C OG    1 
ATOM   7618  N  N     . ALA C 2 62  ? -29.942  53.045  -13.559 1.00 107.77 ?  441 ALA C N     1 
ATOM   7619  C  CA    . ALA C 2 62  ? -28.604  52.475  -13.704 1.00 106.62 ?  441 ALA C CA    1 
ATOM   7620  C  C     . ALA C 2 62  ? -27.737  52.763  -12.487 1.00 108.90 ?  441 ALA C C     1 
ATOM   7621  O  O     . ALA C 2 62  ? -27.110  51.851  -11.949 1.00 115.74 ?  441 ALA C O     1 
ATOM   7622  C  CB    . ALA C 2 62  ? -27.939  52.998  -14.954 1.00 107.49 ?  441 ALA C CB    1 
ATOM   7623  N  N     . LYS C 2 63  ? -27.694  54.027  -12.059 1.00 106.45 ?  442 LYS C N     1 
ATOM   7624  C  CA    . LYS C 2 63  ? -26.994  54.400  -10.821 1.00 108.31 ?  442 LYS C CA    1 
ATOM   7625  C  C     . LYS C 2 63  ? -27.442  53.511  -9.648  1.00 110.32 ?  442 LYS C C     1 
ATOM   7626  O  O     . LYS C 2 63  ? -26.630  53.124  -8.803  1.00 111.30 ?  442 LYS C O     1 
ATOM   7627  C  CB    . LYS C 2 63  ? -27.190  55.900  -10.499 1.00 105.00 ?  442 LYS C CB    1 
ATOM   7628  C  CG    . LYS C 2 63  ? -26.546  56.402  -9.173  1.00 86.65  ?  442 LYS C CG    1 
ATOM   7629  N  N     . GLN C 2 64  ? -28.735  53.180  -9.625  1.00 108.27 ?  443 GLN C N     1 
ATOM   7630  C  CA    . GLN C 2 64  ? -29.345  52.378  -8.562  1.00 107.33 ?  443 GLN C CA    1 
ATOM   7631  C  C     . GLN C 2 64  ? -29.034  50.874  -8.655  1.00 112.79 ?  443 GLN C C     1 
ATOM   7632  O  O     . GLN C 2 64  ? -28.548  50.260  -7.689  1.00 119.32 ?  443 GLN C O     1 
ATOM   7633  C  CB    . GLN C 2 64  ? -30.863  52.617  -8.534  1.00 103.10 ?  443 GLN C CB    1 
ATOM   7634  C  CG    . GLN C 2 64  ? -31.276  53.818  -7.675  1.00 106.03 ?  443 GLN C CG    1 
ATOM   7635  C  CD    . GLN C 2 64  ? -32.502  54.567  -8.197  1.00 104.77 ?  443 GLN C CD    1 
ATOM   7636  O  OE1   . GLN C 2 64  ? -33.575  53.983  -8.396  1.00 102.99 ?  443 GLN C OE1   1 
ATOM   7637  N  NE2   . GLN C 2 64  ? -32.342  55.877  -8.413  1.00 102.40 ?  443 GLN C NE2   1 
ATOM   7638  N  N     . GLY C 2 65  ? -29.308  50.292  -9.820  1.00 109.57 ?  444 GLY C N     1 
ATOM   7639  C  CA    . GLY C 2 65  ? -29.128  48.865  -10.025 1.00 109.23 ?  444 GLY C CA    1 
ATOM   7640  C  C     . GLY C 2 65  ? -27.694  48.384  -10.177 1.00 110.28 ?  444 GLY C C     1 
ATOM   7641  O  O     . GLY C 2 65  ? -27.410  47.213  -9.950  1.00 116.56 ?  444 GLY C O     1 
ATOM   7642  N  N     . ARG C 2 66  ? -26.790  49.283  -10.552 1.00 106.50 ?  445 ARG C N     1 
ATOM   7643  C  CA    . ARG C 2 66  ? -25.399  48.926  -10.845 1.00 104.70 ?  445 ARG C CA    1 
ATOM   7644  C  C     . ARG C 2 66  ? -24.649  48.305  -9.654  1.00 103.58 ?  445 ARG C C     1 
ATOM   7645  O  O     . ARG C 2 66  ? -25.152  48.266  -8.526  1.00 102.43 ?  445 ARG C O     1 
ATOM   7646  C  CB    . ARG C 2 66  ? -24.633  50.165  -11.341 1.00 103.21 ?  445 ARG C CB    1 
ATOM   7647  C  CG    . ARG C 2 66  ? -23.874  50.930  -10.239 1.00 103.06 ?  445 ARG C CG    1 
ATOM   7648  C  CD    . ARG C 2 66  ? -23.987  52.448  -10.384 1.00 101.31 ?  445 ARG C CD    1 
ATOM   7649  N  NE    . ARG C 2 66  ? -22.781  53.148  -9.931  1.00 106.32 ?  445 ARG C NE    1 
ATOM   7650  C  CZ    . ARG C 2 66  ? -22.707  53.899  -8.832  1.00 113.43 ?  445 ARG C CZ    1 
ATOM   7651  N  NH1   . ARG C 2 66  ? -23.774  54.060  -8.054  1.00 117.96 ?  445 ARG C NH1   1 
ATOM   7652  N  NH2   . ARG C 2 66  ? -21.564  54.497  -8.510  1.00 113.53 ?  445 ARG C NH2   1 
ATOM   7653  N  N     . ASP C 2 67  ? -23.445  47.812  -9.931  1.00 104.32 ?  446 ASP C N     1 
ATOM   7654  C  CA    . ASP C 2 67  ? -22.486  47.468  -8.893  1.00 108.53 ?  446 ASP C CA    1 
ATOM   7655  C  C     . ASP C 2 67  ? -21.449  48.584  -8.865  1.00 110.19 ?  446 ASP C C     1 
ATOM   7656  O  O     . ASP C 2 67  ? -20.638  48.708  -9.777  1.00 111.82 ?  446 ASP C O     1 
ATOM   7657  C  CB    . ASP C 2 67  ? -21.819  46.123  -9.193  1.00 111.53 ?  446 ASP C CB    1 
ATOM   7658  C  CG    . ASP C 2 67  ? -20.745  45.760  -8.175  1.00 113.83 ?  446 ASP C CG    1 
ATOM   7659  O  OD1   . ASP C 2 67  ? -20.747  44.612  -7.681  1.00 114.67 ?  446 ASP C OD1   1 
ATOM   7660  O  OD2   . ASP C 2 67  ? -19.894  46.623  -7.874  1.00 113.61 ?  446 ASP C OD2   1 
ATOM   7661  N  N     . ARG C 2 68  ? -21.478  49.395  -7.814  1.00 111.97 ?  447 ARG C N     1 
ATOM   7662  C  CA    . ARG C 2 68  ? -20.678  50.622  -7.766  1.00 113.03 ?  447 ARG C CA    1 
ATOM   7663  C  C     . ARG C 2 68  ? -19.147  50.444  -7.792  1.00 113.23 ?  447 ARG C C     1 
ATOM   7664  O  O     . ARG C 2 68  ? -18.419  51.359  -8.188  1.00 111.02 ?  447 ARG C O     1 
ATOM   7665  C  CB    . ARG C 2 68  ? -21.103  51.484  -6.568  1.00 112.45 ?  447 ARG C CB    1 
ATOM   7666  C  CG    . ARG C 2 68  ? -21.053  50.776  -5.230  1.00 114.71 ?  447 ARG C CG    1 
ATOM   7667  C  CD    . ARG C 2 68  ? -21.999  51.440  -4.264  1.00 118.29 ?  447 ARG C CD    1 
ATOM   7668  N  NE    . ARG C 2 68  ? -21.834  52.889  -4.272  1.00 118.99 ?  447 ARG C NE    1 
ATOM   7669  C  CZ    . ARG C 2 68  ? -22.753  53.749  -3.843  1.00 117.67 ?  447 ARG C CZ    1 
ATOM   7670  N  NH1   . ARG C 2 68  ? -23.915  53.313  -3.372  1.00 117.89 ?  447 ARG C NH1   1 
ATOM   7671  N  NH2   . ARG C 2 68  ? -22.510  55.049  -3.890  1.00 116.44 ?  447 ARG C NH2   1 
ATOM   7672  N  N     . LYS C 2 69  ? -18.654  49.282  -7.378  1.00 115.93 ?  448 LYS C N     1 
ATOM   7673  C  CA    . LYS C 2 69  ? -17.206  49.110  -7.244  1.00 118.72 ?  448 LYS C CA    1 
ATOM   7674  C  C     . LYS C 2 69  ? -16.478  49.186  -8.596  1.00 118.63 ?  448 LYS C C     1 
ATOM   7675  O  O     . LYS C 2 69  ? -15.309  49.566  -8.651  1.00 124.65 ?  448 LYS C O     1 
ATOM   7676  C  CB    . LYS C 2 69  ? -16.852  47.822  -6.472  1.00 115.86 ?  448 LYS C CB    1 
ATOM   7677  N  N     . PHE C 2 70  ? -17.170  48.849  -9.683  1.00 111.39 ?  449 PHE C N     1 
ATOM   7678  C  CA    . PHE C 2 70  ? -16.515  48.796  -10.988 1.00 113.96 ?  449 PHE C CA    1 
ATOM   7679  C  C     . PHE C 2 70  ? -17.375  49.251  -12.178 1.00 113.13 ?  449 PHE C C     1 
ATOM   7680  O  O     . PHE C 2 70  ? -16.928  49.191  -13.322 1.00 115.25 ?  449 PHE C O     1 
ATOM   7681  C  CB    . PHE C 2 70  ? -15.965  47.386  -11.250 1.00 119.39 ?  449 PHE C CB    1 
ATOM   7682  C  CG    . PHE C 2 70  ? -17.023  46.375  -11.592 1.00 121.85 ?  449 PHE C CG    1 
ATOM   7683  C  CD1   . PHE C 2 70  ? -17.729  45.725  -10.592 1.00 125.72 ?  449 PHE C CD1   1 
ATOM   7684  C  CD2   . PHE C 2 70  ? -17.314  46.076  -12.919 1.00 121.75 ?  449 PHE C CD2   1 
ATOM   7685  C  CE1   . PHE C 2 70  ? -18.709  44.795  -10.907 1.00 127.79 ?  449 PHE C CE1   1 
ATOM   7686  C  CE2   . PHE C 2 70  ? -18.294  45.148  -13.245 1.00 122.22 ?  449 PHE C CE2   1 
ATOM   7687  C  CZ    . PHE C 2 70  ? -18.992  44.506  -12.239 1.00 125.63 ?  449 PHE C CZ    1 
ATOM   7688  N  N     . GLN C 2 71  ? -18.599  49.699  -11.914 1.00 109.25 ?  450 GLN C N     1 
ATOM   7689  C  CA    . GLN C 2 71  ? -19.504  50.128  -12.980 1.00 99.09  ?  450 GLN C CA    1 
ATOM   7690  C  C     . GLN C 2 71  ? -19.832  51.610  -12.855 1.00 105.63 ?  450 GLN C C     1 
ATOM   7691  O  O     . GLN C 2 71  ? -20.463  52.029  -11.881 1.00 112.21 ?  450 GLN C O     1 
ATOM   7692  C  CB    . GLN C 2 71  ? -20.805  49.314  -12.961 1.00 87.82  ?  450 GLN C CB    1 
ATOM   7693  C  CG    . GLN C 2 71  ? -20.639  47.832  -13.298 1.00 88.36  ?  450 GLN C CG    1 
ATOM   7694  C  CD    . GLN C 2 71  ? -21.971  47.091  -13.445 1.00 89.87  ?  450 GLN C CD    1 
ATOM   7695  O  OE1   . GLN C 2 71  ? -22.932  47.352  -12.715 1.00 91.61  ?  450 GLN C OE1   1 
ATOM   7696  N  NE2   . GLN C 2 71  ? -22.029  46.165  -14.400 1.00 90.33  ?  450 GLN C NE2   1 
ATOM   7697  N  N     . ALA C 2 72  ? -19.404  52.398  -13.839 1.00 104.13 ?  451 ALA C N     1 
ATOM   7698  C  CA    . ALA C 2 72  ? -19.741  53.820  -13.889 1.00 100.47 ?  451 ALA C CA    1 
ATOM   7699  C  C     . ALA C 2 72  ? -20.925  54.081  -14.826 1.00 97.69  ?  451 ALA C C     1 
ATOM   7700  O  O     . ALA C 2 72  ? -21.238  53.262  -15.690 1.00 100.48 ?  451 ALA C O     1 
ATOM   7701  C  CB    . ALA C 2 72  ? -18.536  54.646  -14.301 1.00 99.92  ?  451 ALA C CB    1 
ATOM   7702  N  N     . ILE C 2 73  ? -21.585  55.220  -14.636 1.00 93.50  ?  452 ILE C N     1 
ATOM   7703  C  CA    . ILE C 2 73  ? -22.772  55.571  -15.406 1.00 91.97  ?  452 ILE C CA    1 
ATOM   7704  C  C     . ILE C 2 73  ? -22.609  56.957  -15.996 1.00 95.55  ?  452 ILE C C     1 
ATOM   7705  O  O     . ILE C 2 73  ? -22.255  57.908  -15.294 1.00 99.48  ?  452 ILE C O     1 
ATOM   7706  C  CB    . ILE C 2 73  ? -24.046  55.603  -14.524 1.00 86.44  ?  452 ILE C CB    1 
ATOM   7707  C  CG1   . ILE C 2 73  ? -24.193  54.309  -13.715 1.00 81.86  ?  452 ILE C CG1   1 
ATOM   7708  C  CG2   . ILE C 2 73  ? -25.291  55.908  -15.366 1.00 82.80  ?  452 ILE C CG2   1 
ATOM   7709  C  CD1   . ILE C 2 73  ? -24.529  53.103  -14.537 1.00 79.88  ?  452 ILE C CD1   1 
ATOM   7710  N  N     . LEU C 2 74  ? -22.867  57.065  -17.293 1.00 95.69  ?  453 LEU C N     1 
ATOM   7711  C  CA    . LEU C 2 74  ? -22.868  58.349  -17.973 1.00 100.44 ?  453 LEU C CA    1 
ATOM   7712  C  C     . LEU C 2 74  ? -24.147  58.385  -18.781 1.00 99.21  ?  453 LEU C C     1 
ATOM   7713  O  O     . LEU C 2 74  ? -24.292  57.643  -19.750 1.00 98.18  ?  453 LEU C O     1 
ATOM   7714  C  CB    . LEU C 2 74  ? -21.652  58.465  -18.898 1.00 106.52 ?  453 LEU C CB    1 
ATOM   7715  C  CG    . LEU C 2 74  ? -21.184  59.823  -19.441 1.00 105.90 ?  453 LEU C CG    1 
ATOM   7716  C  CD1   . LEU C 2 74  ? -20.358  59.625  -20.723 1.00 99.15  ?  453 LEU C CD1   1 
ATOM   7717  C  CD2   . LEU C 2 74  ? -22.348  60.795  -19.666 1.00 108.41 ?  453 LEU C CD2   1 
ATOM   7718  N  N     . PRO C 2 75  ? -25.109  59.212  -18.358 1.00 98.04  ?  454 PRO C N     1 
ATOM   7719  C  CA    . PRO C 2 75  ? -26.330  59.379  -19.148 1.00 95.80  ?  454 PRO C CA    1 
ATOM   7720  C  C     . PRO C 2 75  ? -26.070  60.154  -20.448 1.00 97.05  ?  454 PRO C C     1 
ATOM   7721  O  O     . PRO C 2 75  ? -25.224  61.054  -20.500 1.00 99.15  ?  454 PRO C O     1 
ATOM   7722  C  CB    . PRO C 2 75  ? -27.240  60.195  -18.215 1.00 92.78  ?  454 PRO C CB    1 
ATOM   7723  C  CG    . PRO C 2 75  ? -26.688  60.004  -16.853 1.00 91.03  ?  454 PRO C CG    1 
ATOM   7724  C  CD    . PRO C 2 75  ? -25.211  59.858  -17.039 1.00 95.62  ?  454 PRO C CD    1 
ATOM   7725  N  N     . LEU C 2 76  ? -26.794  59.790  -21.497 1.00 94.61  ?  455 LEU C N     1 
ATOM   7726  C  CA    . LEU C 2 76  ? -26.784  60.554  -22.734 1.00 89.58  ?  455 LEU C CA    1 
ATOM   7727  C  C     . LEU C 2 76  ? -28.105  61.300  -22.842 1.00 87.49  ?  455 LEU C C     1 
ATOM   7728  O  O     . LEU C 2 76  ? -29.103  60.744  -23.304 1.00 91.23  ?  455 LEU C O     1 
ATOM   7729  C  CB    . LEU C 2 76  ? -26.581  59.624  -23.929 1.00 82.88  ?  455 LEU C CB    1 
ATOM   7730  C  CG    . LEU C 2 76  ? -25.173  59.049  -23.919 1.00 83.75  ?  455 LEU C CG    1 
ATOM   7731  C  CD1   . LEU C 2 76  ? -24.966  58.143  -25.104 1.00 87.92  ?  455 LEU C CD1   1 
ATOM   7732  C  CD2   . LEU C 2 76  ? -24.161  60.188  -23.904 1.00 83.49  ?  455 LEU C CD2   1 
ATOM   7733  N  N     . ARG C 2 77  ? -28.115  62.554  -22.401 1.00 85.88  ?  456 ARG C N     1 
ATOM   7734  C  CA    . ARG C 2 77  ? -29.368  63.296  -22.309 1.00 94.55  ?  456 ARG C CA    1 
ATOM   7735  C  C     . ARG C 2 77  ? -29.763  63.936  -23.654 1.00 99.34  ?  456 ARG C C     1 
ATOM   7736  O  O     . ARG C 2 77  ? -29.355  65.056  -23.966 1.00 102.77 ?  456 ARG C O     1 
ATOM   7737  C  CB    . ARG C 2 77  ? -29.313  64.320  -21.155 1.00 95.96  ?  456 ARG C CB    1 
ATOM   7738  N  N     . GLY C 2 78  ? -30.555  63.211  -24.445 1.00 98.02  ?  457 GLY C N     1 
ATOM   7739  C  CA    . GLY C 2 78  ? -30.923  63.646  -25.788 1.00 94.39  ?  457 GLY C CA    1 
ATOM   7740  C  C     . GLY C 2 78  ? -30.163  62.894  -26.871 1.00 92.22  ?  457 GLY C C     1 
ATOM   7741  O  O     . GLY C 2 78  ? -29.293  62.074  -26.573 1.00 92.70  ?  457 GLY C O     1 
ATOM   7742  N  N     . LYS C 2 79  ? -30.482  63.166  -28.134 1.00 92.11  ?  458 LYS C N     1 
ATOM   7743  C  CA    . LYS C 2 79  ? -29.888  62.410  -29.245 1.00 88.64  ?  458 LYS C CA    1 
ATOM   7744  C  C     . LYS C 2 79  ? -28.447  62.824  -29.476 1.00 91.25  ?  458 LYS C C     1 
ATOM   7745  O  O     . LYS C 2 79  ? -28.151  64.006  -29.614 1.00 91.32  ?  458 LYS C O     1 
ATOM   7746  C  CB    . LYS C 2 79  ? -30.703  62.567  -30.539 1.00 84.33  ?  458 LYS C CB    1 
ATOM   7747  C  CG    . LYS C 2 79  ? -31.903  61.611  -30.691 1.00 85.20  ?  458 LYS C CG    1 
ATOM   7748  C  CD    . LYS C 2 79  ? -32.659  61.881  -32.009 1.00 86.53  ?  458 LYS C CD    1 
ATOM   7749  C  CE    . LYS C 2 79  ? -33.917  61.011  -32.199 1.00 85.27  ?  458 LYS C CE    1 
ATOM   7750  N  NZ    . LYS C 2 79  ? -33.631  59.540  -32.230 1.00 82.52  ?  458 LYS C NZ    1 
ATOM   7751  N  N     . VAL C 2 80  ? -27.549  61.846  -29.503 1.00 96.95  ?  459 VAL C N     1 
ATOM   7752  C  CA    . VAL C 2 80  ? -26.136  62.119  -29.747 1.00 101.63 ?  459 VAL C CA    1 
ATOM   7753  C  C     . VAL C 2 80  ? -25.920  62.731  -31.118 1.00 105.18 ?  459 VAL C C     1 
ATOM   7754  O  O     . VAL C 2 80  ? -26.521  62.292  -32.095 1.00 108.24 ?  459 VAL C O     1 
ATOM   7755  C  CB    . VAL C 2 80  ? -25.316  60.835  -29.690 1.00 99.89  ?  459 VAL C CB    1 
ATOM   7756  C  CG1   . VAL C 2 80  ? -23.854  61.109  -30.095 1.00 95.56  ?  459 VAL C CG1   1 
ATOM   7757  C  CG2   . VAL C 2 80  ? -25.431  60.210  -28.304 1.00 100.59 ?  459 VAL C CG2   1 
ATOM   7758  N  N     . ILE C 2 81  ? -25.051  63.733  -31.191 1.00 104.37 ?  460 ILE C N     1 
ATOM   7759  C  CA    . ILE C 2 81  ? -24.728  64.386  -32.462 1.00 102.12 ?  460 ILE C CA    1 
ATOM   7760  C  C     . ILE C 2 81  ? -24.294  63.380  -33.537 1.00 103.30 ?  460 ILE C C     1 
ATOM   7761  O  O     . ILE C 2 81  ? -23.816  62.293  -33.226 1.00 104.23 ?  460 ILE C O     1 
ATOM   7762  C  CB    . ILE C 2 81  ? -23.623  65.460  -32.273 1.00 78.89  ?  460 ILE C CB    1 
ATOM   7763  C  CG1   . ILE C 2 81  ? -23.585  66.419  -33.459 1.00 81.34  ?  460 ILE C CG1   1 
ATOM   7764  C  CG2   . ILE C 2 81  ? -22.253  64.814  -32.031 1.00 73.60  ?  460 ILE C CG2   1 
ATOM   7765  C  CD1   . ILE C 2 81  ? -23.118  67.802  -33.078 1.00 82.71  ?  460 ILE C CD1   1 
ATOM   7766  N  N     . ASN C 2 82  ? -24.480  63.729  -34.803 1.00 105.79 ?  461 ASN C N     1 
ATOM   7767  C  CA    . ASN C 2 82  ? -23.946  62.897  -35.876 1.00 107.47 ?  461 ASN C CA    1 
ATOM   7768  C  C     . ASN C 2 82  ? -22.516  63.327  -36.192 1.00 111.36 ?  461 ASN C C     1 
ATOM   7769  O  O     . ASN C 2 82  ? -22.288  64.461  -36.618 1.00 115.17 ?  461 ASN C O     1 
ATOM   7770  C  CB    . ASN C 2 82  ? -24.826  62.957  -37.131 1.00 103.75 ?  461 ASN C CB    1 
ATOM   7771  C  CG    . ASN C 2 82  ? -24.362  61.991  -38.215 1.00 104.80 ?  461 ASN C CG    1 
ATOM   7772  O  OD1   . ASN C 2 82  ? -23.182  61.665  -38.297 1.00 111.04 ?  461 ASN C OD1   1 
ATOM   7773  N  ND2   . ASN C 2 82  ? -25.289  61.529  -39.048 1.00 100.78 ?  461 ASN C ND2   1 
ATOM   7774  N  N     . THR C 2 83  ? -21.559  62.426  -35.973 1.00 108.36 ?  462 THR C N     1 
ATOM   7775  C  CA    . THR C 2 83  ? -20.147  62.747  -36.173 1.00 109.18 ?  462 THR C CA    1 
ATOM   7776  C  C     . THR C 2 83  ? -19.631  62.473  -37.593 1.00 110.51 ?  462 THR C C     1 
ATOM   7777  O  O     . THR C 2 83  ? -18.425  62.423  -37.830 1.00 117.17 ?  462 THR C O     1 
ATOM   7778  C  CB    . THR C 2 83  ? -19.235  62.061  -35.121 1.00 99.88  ?  462 THR C CB    1 
ATOM   7779  O  OG1   . THR C 2 83  ? -19.633  60.694  -34.937 1.00 100.71 ?  462 THR C OG1   1 
ATOM   7780  C  CG2   . THR C 2 83  ? -19.319  62.794  -33.800 1.00 95.80  ?  462 THR C CG2   1 
ATOM   7781  N  N     . ALA C 2 84  ? -20.546  62.298  -38.534 1.00 106.34 ?  463 ALA C N     1 
ATOM   7782  C  CA    . ALA C 2 84  ? -20.178  62.306  -39.944 1.00 105.58 ?  463 ALA C CA    1 
ATOM   7783  C  C     . ALA C 2 84  ? -20.673  63.601  -40.589 1.00 109.70 ?  463 ALA C C     1 
ATOM   7784  O  O     . ALA C 2 84  ? -19.930  64.277  -41.305 1.00 118.66 ?  463 ALA C O     1 
ATOM   7785  C  CB    . ALA C 2 84  ? -20.741  61.081  -40.670 1.00 96.34  ?  463 ALA C CB    1 
ATOM   7786  N  N     . LYS C 2 85  ? -21.923  63.954  -40.306 1.00 101.90 ?  464 LYS C N     1 
ATOM   7787  C  CA    . LYS C 2 85  ? -22.551  65.111  -40.931 1.00 99.58  ?  464 LYS C CA    1 
ATOM   7788  C  C     . LYS C 2 85  ? -21.993  66.449  -40.437 1.00 104.93 ?  464 LYS C C     1 
ATOM   7789  O  O     . LYS C 2 85  ? -21.866  67.395  -41.211 1.00 107.06 ?  464 LYS C O     1 
ATOM   7790  C  CB    . LYS C 2 85  ? -24.073  65.083  -40.727 1.00 92.64  ?  464 LYS C CB    1 
ATOM   7791  C  CG    . LYS C 2 85  ? -24.779  63.868  -41.298 1.00 88.05  ?  464 LYS C CG    1 
ATOM   7792  C  CD    . LYS C 2 85  ? -26.293  64.059  -41.260 1.00 80.15  ?  464 LYS C CD    1 
ATOM   7793  C  CE    . LYS C 2 85  ? -27.036  62.776  -41.610 1.00 78.91  ?  464 LYS C CE    1 
ATOM   7794  N  NZ    . LYS C 2 85  ? -28.491  62.892  -41.299 1.00 81.81  ?  464 LYS C NZ    1 
ATOM   7795  N  N     . ALA C 2 86  ? -21.675  66.538  -39.152 1.00 110.01 ?  465 ALA C N     1 
ATOM   7796  C  CA    . ALA C 2 86  ? -21.345  67.836  -38.575 1.00 114.23 ?  465 ALA C CA    1 
ATOM   7797  C  C     . ALA C 2 86  ? -19.885  68.201  -38.789 1.00 117.42 ?  465 ALA C C     1 
ATOM   7798  O  O     . ALA C 2 86  ? -19.071  67.356  -39.177 1.00 116.01 ?  465 ALA C O     1 
ATOM   7799  C  CB    . ALA C 2 86  ? -21.721  67.894  -37.085 1.00 114.21 ?  465 ALA C CB    1 
ATOM   7800  N  N     . LYS C 2 87  ? -19.576  69.473  -38.545 1.00 121.99 ?  466 LYS C N     1 
ATOM   7801  C  CA    . LYS C 2 87  ? -18.222  69.995  -38.678 1.00 127.34 ?  466 LYS C CA    1 
ATOM   7802  C  C     . LYS C 2 87  ? -17.387  69.678  -37.430 1.00 131.16 ?  466 LYS C C     1 
ATOM   7803  O  O     . LYS C 2 87  ? -17.875  69.799  -36.299 1.00 129.87 ?  466 LYS C O     1 
ATOM   7804  C  CB    . LYS C 2 87  ? -18.261  71.507  -38.930 1.00 125.25 ?  466 LYS C CB    1 
ATOM   7805  N  N     . MET C 2 88  ? -16.134  69.270  -37.643 1.00 133.48 ?  467 MET C N     1 
ATOM   7806  C  CA    . MET C 2 88  ? -15.237  68.910  -36.543 1.00 133.84 ?  467 MET C CA    1 
ATOM   7807  C  C     . MET C 2 88  ? -15.051  70.067  -35.557 1.00 136.33 ?  467 MET C C     1 
ATOM   7808  O  O     . MET C 2 88  ? -14.462  69.894  -34.486 1.00 133.89 ?  467 MET C O     1 
ATOM   7809  C  CB    . MET C 2 88  ? -13.880  68.424  -37.068 1.00 130.84 ?  467 MET C CB    1 
ATOM   7810  C  CG    . MET C 2 88  ? -12.977  67.848  -35.978 1.00 127.21 ?  467 MET C CG    1 
ATOM   7811  N  N     . ALA C 2 89  ? -15.554  71.242  -35.935 1.00 138.64 ?  468 ALA C N     1 
ATOM   7812  C  CA    . ALA C 2 89  ? -15.582  72.408  -35.056 1.00 138.87 ?  468 ALA C CA    1 
ATOM   7813  C  C     . ALA C 2 89  ? -16.693  72.243  -34.025 1.00 137.92 ?  468 ALA C C     1 
ATOM   7814  O  O     . ALA C 2 89  ? -16.438  72.141  -32.819 1.00 137.33 ?  468 ALA C O     1 
ATOM   7815  C  CB    . ALA C 2 89  ? -15.799  73.685  -35.868 1.00 135.40 ?  468 ALA C CB    1 
ATOM   7816  N  N     . ASP C 2 90  ? -17.929  72.207  -34.512 1.00 134.62 ?  469 ASP C N     1 
ATOM   7817  C  CA    . ASP C 2 90  ? -19.078  72.006  -33.643 1.00 130.25 ?  469 ASP C CA    1 
ATOM   7818  C  C     . ASP C 2 90  ? -19.070  70.621  -32.968 1.00 132.41 ?  469 ASP C C     1 
ATOM   7819  O  O     . ASP C 2 90  ? -19.776  70.417  -31.979 1.00 133.00 ?  469 ASP C O     1 
ATOM   7820  C  CB    . ASP C 2 90  ? -20.386  72.245  -34.410 1.00 120.99 ?  469 ASP C CB    1 
ATOM   7821  C  CG    . ASP C 2 90  ? -20.622  73.715  -34.725 1.00 115.71 ?  469 ASP C CG    1 
ATOM   7822  N  N     . ILE C 2 91  ? -18.275  69.681  -33.492 1.00 131.70 ?  470 ILE C N     1 
ATOM   7823  C  CA    . ILE C 2 91  ? -18.175  68.342  -32.893 1.00 126.17 ?  470 ILE C CA    1 
ATOM   7824  C  C     . ILE C 2 91  ? -17.462  68.366  -31.535 1.00 123.08 ?  470 ILE C C     1 
ATOM   7825  O  O     . ILE C 2 91  ? -17.846  67.646  -30.608 1.00 117.27 ?  470 ILE C O     1 
ATOM   7826  C  CB    . ILE C 2 91  ? -17.488  67.304  -33.830 1.00 82.09  ?  470 ILE C CB    1 
ATOM   7827  N  N     . LEU C 2 92  ? -16.435  69.201  -31.407 1.00 127.78 ?  471 LEU C N     1 
ATOM   7828  C  CA    . LEU C 2 92  ? -15.675  69.252  -30.157 1.00 128.77 ?  471 LEU C CA    1 
ATOM   7829  C  C     . LEU C 2 92  ? -16.359  70.148  -29.116 1.00 125.84 ?  471 LEU C C     1 
ATOM   7830  O  O     . LEU C 2 92  ? -16.176  69.956  -27.913 1.00 127.66 ?  471 LEU C O     1 
ATOM   7831  C  CB    . LEU C 2 92  ? -14.207  69.658  -30.395 1.00 129.10 ?  471 LEU C CB    1 
ATOM   7832  N  N     . LYS C 2 93  ? -17.154  71.110  -29.585 1.00 119.23 ?  472 LYS C N     1 
ATOM   7833  C  CA    . LYS C 2 93  ? -17.938  71.967  -28.693 1.00 115.30 ?  472 LYS C CA    1 
ATOM   7834  C  C     . LYS C 2 93  ? -19.232  71.281  -28.241 1.00 117.45 ?  472 LYS C C     1 
ATOM   7835  O  O     . LYS C 2 93  ? -20.189  71.953  -27.850 1.00 117.82 ?  472 LYS C O     1 
ATOM   7836  C  CB    . LYS C 2 93  ? -18.269  73.312  -29.365 1.00 109.05 ?  472 LYS C CB    1 
ATOM   7837  N  N     . ASN C 2 94  ? -19.261  69.949  -28.301 1.00 118.70 ?  473 ASN C N     1 
ATOM   7838  C  CA    . ASN C 2 94  ? -20.448  69.184  -27.903 1.00 118.54 ?  473 ASN C CA    1 
ATOM   7839  C  C     . ASN C 2 94  ? -20.323  68.550  -26.513 1.00 124.71 ?  473 ASN C C     1 
ATOM   7840  O  O     . ASN C 2 94  ? -19.367  67.825  -26.229 1.00 128.87 ?  473 ASN C O     1 
ATOM   7841  C  CB    . ASN C 2 94  ? -20.788  68.116  -28.948 1.00 111.13 ?  473 ASN C CB    1 
ATOM   7842  C  CG    . ASN C 2 94  ? -22.068  67.364  -28.622 1.00 105.77 ?  473 ASN C CG    1 
ATOM   7843  O  OD1   . ASN C 2 94  ? -22.091  66.133  -28.626 1.00 104.72 ?  473 ASN C OD1   1 
ATOM   7844  N  ND2   . ASN C 2 94  ? -23.139  68.104  -28.326 1.00 102.14 ?  473 ASN C ND2   1 
ATOM   7845  N  N     . GLU C 2 95  ? -21.299  68.826  -25.654 1.00 120.03 ?  474 GLU C N     1 
ATOM   7846  C  CA    . GLU C 2 95  ? -21.239  68.393  -24.264 1.00 113.04 ?  474 GLU C CA    1 
ATOM   7847  C  C     . GLU C 2 95  ? -21.057  66.875  -24.131 1.00 106.90 ?  474 GLU C C     1 
ATOM   7848  O  O     . GLU C 2 95  ? -20.168  66.412  -23.412 1.00 110.66 ?  474 GLU C O     1 
ATOM   7849  C  CB    . GLU C 2 95  ? -22.471  68.883  -23.494 1.00 119.50 ?  474 GLU C CB    1 
ATOM   7850  C  CG    . GLU C 2 95  ? -22.440  68.585  -21.997 1.00 130.40 ?  474 GLU C CG    1 
ATOM   7851  C  CD    . GLU C 2 95  ? -23.641  69.154  -21.252 1.00 137.52 ?  474 GLU C CD    1 
ATOM   7852  O  OE1   . GLU C 2 95  ? -23.965  70.343  -21.467 1.00 142.45 ?  474 GLU C OE1   1 
ATOM   7853  O  OE2   . GLU C 2 95  ? -24.264  68.412  -20.456 1.00 136.26 ?  474 GLU C OE2   1 
ATOM   7854  N  N     . GLU C 2 96  ? -21.878  66.097  -24.828 1.00 103.11 ?  475 GLU C N     1 
ATOM   7855  C  CA    . GLU C 2 96  ? -21.805  64.639  -24.706 1.00 110.35 ?  475 GLU C CA    1 
ATOM   7856  C  C     . GLU C 2 96  ? -20.543  64.077  -25.361 1.00 115.56 ?  475 GLU C C     1 
ATOM   7857  O  O     . GLU C 2 96  ? -20.099  62.975  -25.042 1.00 119.31 ?  475 GLU C O     1 
ATOM   7858  C  CB    . GLU C 2 96  ? -23.057  63.959  -25.275 1.00 115.06 ?  475 GLU C CB    1 
ATOM   7859  C  CG    . GLU C 2 96  ? -24.119  64.925  -25.773 1.00 126.02 ?  475 GLU C CG    1 
ATOM   7860  C  CD    . GLU C 2 96  ? -24.886  65.596  -24.643 1.00 134.23 ?  475 GLU C CD    1 
ATOM   7861  O  OE1   . GLU C 2 96  ? -25.199  64.908  -23.639 1.00 135.79 ?  475 GLU C OE1   1 
ATOM   7862  O  OE2   . GLU C 2 96  ? -25.174  66.811  -24.767 1.00 136.22 ?  475 GLU C OE2   1 
ATOM   7863  N  N     . ILE C 2 97  ? -19.964  64.836  -26.281 1.00 115.15 ?  476 ILE C N     1 
ATOM   7864  C  CA    . ILE C 2 97  ? -18.721  64.420  -26.909 1.00 114.81 ?  476 ILE C CA    1 
ATOM   7865  C  C     . ILE C 2 97  ? -17.526  64.757  -25.997 1.00 115.45 ?  476 ILE C C     1 
ATOM   7866  O  O     . ILE C 2 97  ? -16.618  63.939  -25.832 1.00 112.09 ?  476 ILE C O     1 
ATOM   7867  C  CB    . ILE C 2 97  ? -18.593  65.015  -28.343 1.00 95.58  ?  476 ILE C CB    1 
ATOM   7868  C  CG1   . ILE C 2 97  ? -19.626  64.369  -29.254 1.00 88.60  ?  476 ILE C CG1   1 
ATOM   7869  C  CG2   . ILE C 2 97  ? -17.221  64.753  -28.952 1.00 97.59  ?  476 ILE C CG2   1 
ATOM   7870  C  CD1   . ILE C 2 97  ? -19.295  62.938  -29.553 1.00 86.17  ?  476 ILE C CD1   1 
ATOM   7871  N  N     . ASN C 2 98  ? -17.540  65.942  -25.385 1.00 119.92 ?  477 ASN C N     1 
ATOM   7872  C  CA    . ASN C 2 98  ? -16.502  66.318  -24.414 1.00 125.90 ?  477 ASN C CA    1 
ATOM   7873  C  C     . ASN C 2 98  ? -16.434  65.364  -23.229 1.00 125.45 ?  477 ASN C C     1 
ATOM   7874  O  O     . ASN C 2 98  ? -15.454  64.636  -23.063 1.00 125.98 ?  477 ASN C O     1 
ATOM   7875  C  CB    . ASN C 2 98  ? -16.707  67.743  -23.887 1.00 132.05 ?  477 ASN C CB    1 
ATOM   7876  C  CG    . ASN C 2 98  ? -16.114  68.799  -24.800 1.00 140.29 ?  477 ASN C CG    1 
ATOM   7877  O  OD1   . ASN C 2 98  ? -15.442  68.486  -25.786 1.00 143.74 ?  477 ASN C OD1   1 
ATOM   7878  N  ND2   . ASN C 2 98  ? -16.351  70.065  -24.466 1.00 142.98 ?  477 ASN C ND2   1 
ATOM   7879  N  N     . THR C 2 99  ? -17.483  65.376  -22.408 1.00 123.36 ?  478 THR C N     1 
ATOM   7880  C  CA    . THR C 2 99  ? -17.508  64.571  -21.190 1.00 122.24 ?  478 THR C CA    1 
ATOM   7881  C  C     . THR C 2 99  ? -17.251  63.085  -21.483 1.00 117.98 ?  478 THR C C     1 
ATOM   7882  O  O     . THR C 2 99  ? -16.852  62.328  -20.598 1.00 118.21 ?  478 THR C O     1 
ATOM   7883  C  CB    . THR C 2 99  ? -18.825  64.774  -20.368 1.00 108.28 ?  478 THR C CB    1 
ATOM   7884  O  OG1   . THR C 2 99  ? -19.903  64.047  -20.966 1.00 106.82 ?  478 THR C OG1   1 
ATOM   7885  C  CG2   . THR C 2 99  ? -19.195  66.259  -20.266 1.00 106.77 ?  478 THR C CG2   1 
ATOM   7886  N  N     . MET C 2 100 ? -17.453  62.684  -22.734 1.00 113.61 ?  479 MET C N     1 
ATOM   7887  C  CA    . MET C 2 100 ? -17.248  61.296  -23.147 1.00 110.66 ?  479 MET C CA    1 
ATOM   7888  C  C     . MET C 2 100 ? -15.791  61.012  -23.537 1.00 116.04 ?  479 MET C C     1 
ATOM   7889  O  O     . MET C 2 100 ? -15.263  59.941  -23.231 1.00 114.41 ?  479 MET C O     1 
ATOM   7890  C  CB    . MET C 2 100 ? -18.197  60.943  -24.298 1.00 101.46 ?  479 MET C CB    1 
ATOM   7891  C  CG    . MET C 2 100 ? -18.629  59.482  -24.390 1.00 90.88  ?  479 MET C CG    1 
ATOM   7892  S  SD    . MET C 2 100 ? -19.942  59.310  -25.626 1.00 120.22 ?  479 MET C SD    1 
ATOM   7893  C  CE    . MET C 2 100 ? -20.137  57.532  -25.684 1.00 100.29 ?  479 MET C CE    1 
ATOM   7894  N  N     . ILE C 2 101 ? -15.138  61.957  -24.211 1.00 121.67 ?  480 ILE C N     1 
ATOM   7895  C  CA    . ILE C 2 101 ? -13.714  61.799  -24.502 1.00 126.05 ?  480 ILE C CA    1 
ATOM   7896  C  C     . ILE C 2 101 ? -12.932  61.935  -23.196 1.00 125.15 ?  480 ILE C C     1 
ATOM   7897  O  O     . ILE C 2 101 ? -11.949  61.227  -22.976 1.00 128.02 ?  480 ILE C O     1 
ATOM   7898  C  CB    . ILE C 2 101 ? -13.196  62.812  -25.563 1.00 88.20  ?  480 ILE C CB    1 
ATOM   7899  N  N     . TYR C 2 102 ? -13.409  62.819  -22.320 1.00 120.65 ?  481 TYR C N     1 
ATOM   7900  C  CA    . TYR C 2 102 ? -12.732  63.138  -21.060 1.00 120.13 ?  481 TYR C CA    1 
ATOM   7901  C  C     . TYR C 2 102 ? -12.960  62.113  -19.950 1.00 121.07 ?  481 TYR C C     1 
ATOM   7902  O  O     . TYR C 2 102 ? -12.144  61.999  -19.034 1.00 124.37 ?  481 TYR C O     1 
ATOM   7903  C  CB    . TYR C 2 102 ? -13.145  64.531  -20.563 1.00 116.27 ?  481 TYR C CB    1 
ATOM   7904  N  N     . THR C 2 103 ? -14.075  61.389  -20.021 1.00 121.39 ?  482 THR C N     1 
ATOM   7905  C  CA    . THR C 2 103 ? -14.409  60.390  -19.004 1.00 122.51 ?  482 THR C CA    1 
ATOM   7906  C  C     . THR C 2 103 ? -13.771  59.046  -19.354 1.00 121.18 ?  482 THR C C     1 
ATOM   7907  O  O     . THR C 2 103 ? -13.869  58.078  -18.594 1.00 119.89 ?  482 THR C O     1 
ATOM   7908  C  CB    . THR C 2 103 ? -15.952  60.231  -18.810 1.00 85.09  ?  482 THR C CB    1 
ATOM   7909  N  N     . ILE C 2 104 ? -13.111  59.002  -20.508 1.00 119.86 ?  483 ILE C N     1 
ATOM   7910  C  CA    . ILE C 2 104 ? -12.481  57.780  -20.989 1.00 121.82 ?  483 ILE C CA    1 
ATOM   7911  C  C     . ILE C 2 104 ? -10.979  57.939  -20.940 1.00 129.69 ?  483 ILE C C     1 
ATOM   7912  O  O     . ILE C 2 104 ? -10.242  56.954  -20.911 1.00 133.53 ?  483 ILE C O     1 
ATOM   7913  C  CB    . ILE C 2 104 ? -12.892  57.444  -22.442 1.00 118.57 ?  483 ILE C CB    1 
ATOM   7914  C  CG1   . ILE C 2 104 ? -14.416  57.308  -22.557 1.00 110.68 ?  483 ILE C CG1   1 
ATOM   7915  C  CG2   . ILE C 2 104 ? -12.180  56.182  -22.918 1.00 118.76 ?  483 ILE C CG2   1 
ATOM   7916  C  CD1   . ILE C 2 104 ? -14.869  56.239  -23.525 1.00 104.83 ?  483 ILE C CD1   1 
ATOM   7917  N  N     . GLY C 2 105 ? -10.541  59.195  -20.959 1.00 133.28 ?  484 GLY C N     1 
ATOM   7918  C  CA    . GLY C 2 105 ? -9.146   59.550  -20.752 1.00 138.21 ?  484 GLY C CA    1 
ATOM   7919  C  C     . GLY C 2 105 ? -8.135   58.976  -21.728 1.00 139.03 ?  484 GLY C C     1 
ATOM   7920  O  O     . GLY C 2 105 ? -7.015   58.632  -21.334 1.00 136.07 ?  484 GLY C O     1 
ATOM   7921  N  N     . ALA C 2 106 ? -8.521   58.872  -22.998 1.00 139.29 ?  485 ALA C N     1 
ATOM   7922  C  CA    . ALA C 2 106 ? -7.590   58.452  -24.041 1.00 134.93 ?  485 ALA C CA    1 
ATOM   7923  C  C     . ALA C 2 106 ? -7.511   59.501  -25.145 1.00 131.28 ?  485 ALA C C     1 
ATOM   7924  O  O     . ALA C 2 106 ? -6.669   59.406  -26.038 1.00 133.15 ?  485 ALA C O     1 
ATOM   7925  C  CB    . ALA C 2 106 ? -7.978   57.097  -24.607 1.00 129.12 ?  485 ALA C CB    1 
ATOM   7926  N  N     . GLY C 2 107 ? -8.379   60.508  -25.066 1.00 127.30 ?  486 GLY C N     1 
ATOM   7927  C  CA    . GLY C 2 107 ? -8.396   61.573  -26.054 1.00 130.79 ?  486 GLY C CA    1 
ATOM   7928  C  C     . GLY C 2 107 ? -8.982   61.092  -27.368 1.00 133.93 ?  486 GLY C C     1 
ATOM   7929  O  O     . GLY C 2 107 ? -9.258   59.902  -27.527 1.00 135.77 ?  486 GLY C O     1 
ATOM   7930  N  N     . VAL C 2 108 ? -9.172   62.008  -28.315 1.00 133.54 ?  487 VAL C N     1 
ATOM   7931  C  CA    . VAL C 2 108 ? -9.835   61.665  -29.572 1.00 134.13 ?  487 VAL C CA    1 
ATOM   7932  C  C     . VAL C 2 108 ? -8.871   61.675  -30.762 1.00 137.74 ?  487 VAL C C     1 
ATOM   7933  O  O     . VAL C 2 108 ? -7.683   61.981  -30.616 1.00 140.74 ?  487 VAL C O     1 
ATOM   7934  C  CB    . VAL C 2 108 ? -11.057  62.595  -29.856 1.00 91.97  ?  487 VAL C CB    1 
ATOM   7935  N  N     . GLY C 2 109 ? -9.394   61.318  -31.933 1.00 135.47 ?  488 GLY C N     1 
ATOM   7936  C  CA    . GLY C 2 109 ? -8.635   61.372  -33.170 1.00 137.25 ?  488 GLY C CA    1 
ATOM   7937  C  C     . GLY C 2 109 ? -7.545   60.324  -33.292 1.00 139.47 ?  488 GLY C C     1 
ATOM   7938  O  O     . GLY C 2 109 ? -7.778   59.134  -33.061 1.00 137.42 ?  488 GLY C O     1 
ATOM   7939  N  N     . ALA C 2 110 ? -6.355   60.774  -33.682 1.00 142.13 ?  489 ALA C N     1 
ATOM   7940  C  CA    . ALA C 2 110 ? -5.187   59.908  -33.764 1.00 146.80 ?  489 ALA C CA    1 
ATOM   7941  C  C     . ALA C 2 110 ? -4.218   60.246  -32.631 1.00 158.08 ?  489 ALA C C     1 
ATOM   7942  O  O     . ALA C 2 110 ? -3.163   59.625  -32.495 1.00 163.01 ?  489 ALA C O     1 
ATOM   7943  C  CB    . ALA C 2 110 ? -4.514   60.045  -35.118 1.00 145.63 ?  489 ALA C CB    1 
ATOM   7944  N  N     . ASP C 2 111 ? -4.590   61.243  -31.826 1.00 160.19 ?  490 ASP C N     1 
ATOM   7945  C  CA    . ASP C 2 111 ? -3.913   61.529  -30.562 1.00 159.59 ?  490 ASP C CA    1 
ATOM   7946  C  C     . ASP C 2 111 ? -4.465   60.577  -29.495 1.00 158.37 ?  490 ASP C C     1 
ATOM   7947  O  O     . ASP C 2 111 ? -4.538   60.929  -28.316 1.00 161.06 ?  490 ASP C O     1 
ATOM   7948  C  CB    . ASP C 2 111 ? -4.152   62.987  -30.134 1.00 153.22 ?  490 ASP C CB    1 
ATOM   7949  C  CG    . ASP C 2 111 ? -3.749   63.990  -31.202 1.00 150.16 ?  490 ASP C CG    1 
ATOM   7950  N  N     . PHE C 2 112 ? -4.841   59.370  -29.924 1.00 152.44 ?  491 PHE C N     1 
ATOM   7951  C  CA    . PHE C 2 112 ? -5.623   58.428  -29.110 1.00 144.49 ?  491 PHE C CA    1 
ATOM   7952  C  C     . PHE C 2 112 ? -4.825   57.204  -28.651 1.00 141.26 ?  491 PHE C C     1 
ATOM   7953  O  O     . PHE C 2 112 ? -4.487   56.332  -29.457 1.00 137.12 ?  491 PHE C O     1 
ATOM   7954  C  CB    . PHE C 2 112 ? -6.873   57.981  -29.891 1.00 143.42 ?  491 PHE C CB    1 
ATOM   7955  C  CG    . PHE C 2 112 ? -7.793   57.057  -29.124 1.00 143.42 ?  491 PHE C CG    1 
ATOM   7956  C  CD1   . PHE C 2 112 ? -7.848   55.704  -29.424 1.00 144.54 ?  491 PHE C CD1   1 
ATOM   7957  C  CD2   . PHE C 2 112 ? -8.616   57.545  -28.117 1.00 141.07 ?  491 PHE C CD2   1 
ATOM   7958  C  CE1   . PHE C 2 112 ? -8.698   54.856  -28.723 1.00 142.49 ?  491 PHE C CE1   1 
ATOM   7959  C  CE2   . PHE C 2 112 ? -9.469   56.705  -27.414 1.00 138.33 ?  491 PHE C CE2   1 
ATOM   7960  C  CZ    . PHE C 2 112 ? -9.509   55.359  -27.717 1.00 138.61 ?  491 PHE C CZ    1 
ATOM   7961  N  N     . SER C 2 113 ? -4.544   57.148  -27.347 1.00 143.68 ?  492 SER C N     1 
ATOM   7962  C  CA    . SER C 2 113 ? -3.838   56.024  -26.731 1.00 144.69 ?  492 SER C CA    1 
ATOM   7963  C  C     . SER C 2 113 ? -4.807   55.029  -26.082 1.00 142.74 ?  492 SER C C     1 
ATOM   7964  O  O     . SER C 2 113 ? -5.358   55.299  -25.014 1.00 142.57 ?  492 SER C O     1 
ATOM   7965  C  CB    . SER C 2 113 ? -2.846   56.535  -25.682 1.00 146.35 ?  492 SER C CB    1 
ATOM   7966  N  N     . ILE C 2 114 ? -5.008   53.881  -26.727 1.00 139.31 ?  493 ILE C N     1 
ATOM   7967  C  CA    . ILE C 2 114 ? -5.902   52.846  -26.207 1.00 132.11 ?  493 ILE C CA    1 
ATOM   7968  C  C     . ILE C 2 114 ? -5.312   52.156  -24.981 1.00 133.18 ?  493 ILE C C     1 
ATOM   7969  O  O     . ILE C 2 114 ? -6.029   51.542  -24.193 1.00 128.48 ?  493 ILE C O     1 
ATOM   7970  C  CB    . ILE C 2 114 ? -6.211   51.779  -27.272 1.00 130.10 ?  493 ILE C CB    1 
ATOM   7971  N  N     . GLU C 2 115 ? -3.997   52.255  -24.829 1.00 141.92 ?  494 GLU C N     1 
ATOM   7972  C  CA    . GLU C 2 115 ? -3.321   51.694  -23.666 1.00 147.82 ?  494 GLU C CA    1 
ATOM   7973  C  C     . GLU C 2 115 ? -3.636   52.524  -22.420 1.00 154.14 ?  494 GLU C C     1 
ATOM   7974  O  O     . GLU C 2 115 ? -3.736   51.987  -21.315 1.00 157.93 ?  494 GLU C O     1 
ATOM   7975  C  CB    . GLU C 2 115 ? -1.808   51.628  -23.903 1.00 146.00 ?  494 GLU C CB    1 
ATOM   7976  N  N     . ASP C 2 116 ? -3.801   53.832  -22.609 1.00 152.44 ?  495 ASP C N     1 
ATOM   7977  C  CA    . ASP C 2 116 ? -4.066   54.745  -21.500 1.00 148.23 ?  495 ASP C CA    1 
ATOM   7978  C  C     . ASP C 2 116 ? -5.566   54.989  -21.308 1.00 151.25 ?  495 ASP C C     1 
ATOM   7979  O  O     . ASP C 2 116 ? -5.973   56.069  -20.875 1.00 154.44 ?  495 ASP C O     1 
ATOM   7980  C  CB    . ASP C 2 116 ? -3.325   56.074  -21.706 1.00 142.53 ?  495 ASP C CB    1 
ATOM   7981  N  N     . ALA C 2 117 ? -6.379   53.980  -21.625 1.00 149.48 ?  496 ALA C N     1 
ATOM   7982  C  CA    . ALA C 2 117 ? -7.840   54.078  -21.499 1.00 142.50 ?  496 ALA C CA    1 
ATOM   7983  C  C     . ALA C 2 117 ? -8.293   54.224  -20.045 1.00 144.26 ?  496 ALA C C     1 
ATOM   7984  O  O     . ALA C 2 117 ? -7.523   54.655  -19.184 1.00 149.16 ?  496 ALA C O     1 
ATOM   7985  C  CB    . ALA C 2 117 ? -8.520   52.866  -22.147 1.00 134.54 ?  496 ALA C CB    1 
ATOM   7986  N  N     . ASN C 2 118 ? -9.548   53.867  -19.781 1.00 138.59 ?  497 ASN C N     1 
ATOM   7987  C  CA    . ASN C 2 118 ? -10.079  53.870  -18.416 1.00 134.48 ?  497 ASN C CA    1 
ATOM   7988  C  C     . ASN C 2 118 ? -11.059  52.734  -18.151 1.00 130.82 ?  497 ASN C C     1 
ATOM   7989  O  O     . ASN C 2 118 ? -11.510  52.542  -17.018 1.00 133.30 ?  497 ASN C O     1 
ATOM   7990  C  CB    . ASN C 2 118 ? -10.739  55.211  -18.077 1.00 130.64 ?  497 ASN C CB    1 
ATOM   7991  C  CG    . ASN C 2 118 ? -9.802   56.154  -17.344 1.00 132.67 ?  497 ASN C CG    1 
ATOM   7992  O  OD1   . ASN C 2 118 ? -8.820   55.723  -16.730 1.00 139.09 ?  497 ASN C OD1   1 
ATOM   7993  N  ND2   . ASN C 2 118 ? -10.104  57.448  -17.397 1.00 129.25 ?  497 ASN C ND2   1 
ATOM   7994  N  N     . TYR C 2 119 ? -11.382  51.980  -19.195 1.00 124.99 ?  498 TYR C N     1 
ATOM   7995  C  CA    . TYR C 2 119 ? -12.355  50.907  -19.071 1.00 122.93 ?  498 TYR C CA    1 
ATOM   7996  C  C     . TYR C 2 119 ? -12.016  49.721  -19.976 1.00 125.77 ?  498 TYR C C     1 
ATOM   7997  O  O     . TYR C 2 119 ? -11.645  49.901  -21.137 1.00 121.39 ?  498 TYR C O     1 
ATOM   7998  C  CB    . TYR C 2 119 ? -13.760  51.436  -19.386 1.00 120.25 ?  498 TYR C CB    1 
ATOM   7999  C  CG    . TYR C 2 119 ? -14.175  52.631  -18.548 1.00 122.09 ?  498 TYR C CG    1 
ATOM   8000  C  CD1   . TYR C 2 119 ? -14.876  52.466  -17.355 1.00 122.09 ?  498 TYR C CD1   1 
ATOM   8001  C  CD2   . TYR C 2 119 ? -13.867  53.924  -18.947 1.00 123.57 ?  498 TYR C CD2   1 
ATOM   8002  C  CE1   . TYR C 2 119 ? -15.259  53.561  -16.582 1.00 120.11 ?  498 TYR C CE1   1 
ATOM   8003  C  CE2   . TYR C 2 119 ? -14.246  55.025  -18.182 1.00 123.45 ?  498 TYR C CE2   1 
ATOM   8004  C  CZ    . TYR C 2 119 ? -14.941  54.836  -17.003 1.00 120.52 ?  498 TYR C CZ    1 
ATOM   8005  O  OH    . TYR C 2 119 ? -15.316  55.925  -16.251 1.00 118.34 ?  498 TYR C OH    1 
ATOM   8006  N  N     . ASP C 2 120 ? -12.133  48.511  -19.430 1.00 134.00 ?  499 ASP C N     1 
ATOM   8007  C  CA    . ASP C 2 120 ? -11.984  47.282  -20.211 1.00 141.41 ?  499 ASP C CA    1 
ATOM   8008  C  C     . ASP C 2 120 ? -13.157  47.142  -21.181 1.00 138.85 ?  499 ASP C C     1 
ATOM   8009  O  O     . ASP C 2 120 ? -13.003  46.663  -22.309 1.00 141.34 ?  499 ASP C O     1 
ATOM   8010  C  CB    . ASP C 2 120 ? -11.915  46.059  -19.283 1.00 147.62 ?  499 ASP C CB    1 
ATOM   8011  C  CG    . ASP C 2 120 ? -11.822  44.738  -20.045 1.00 153.21 ?  499 ASP C CG    1 
ATOM   8012  O  OD1   . ASP C 2 120 ? -10.690  44.312  -20.375 1.00 158.21 ?  499 ASP C OD1   1 
ATOM   8013  O  OD2   . ASP C 2 120 ? -12.882  44.119  -20.301 1.00 151.20 ?  499 ASP C OD2   1 
ATOM   8014  N  N     . LYS C 2 121 ? -14.331  47.568  -20.730 1.00 131.61 ?  500 LYS C N     1 
ATOM   8015  C  CA    . LYS C 2 121 ? -15.533  47.488  -21.539 1.00 124.97 ?  500 LYS C CA    1 
ATOM   8016  C  C     . LYS C 2 121 ? -16.203  48.847  -21.583 1.00 125.82 ?  500 LYS C C     1 
ATOM   8017  O  O     . LYS C 2 121 ? -16.024  49.667  -20.683 1.00 132.71 ?  500 LYS C O     1 
ATOM   8018  C  CB    . LYS C 2 121 ? -16.492  46.426  -20.983 1.00 120.08 ?  500 LYS C CB    1 
ATOM   8019  C  CG    . LYS C 2 121 ? -15.971  44.992  -21.145 1.00 120.22 ?  500 LYS C CG    1 
ATOM   8020  C  CD    . LYS C 2 121 ? -16.765  43.954  -20.353 1.00 116.87 ?  500 LYS C CD    1 
ATOM   8021  C  CE    . LYS C 2 121 ? -15.970  42.653  -20.265 1.00 117.86 ?  500 LYS C CE    1 
ATOM   8022  N  NZ    . LYS C 2 121 ? -16.618  41.639  -19.397 1.00 117.75 ?  500 LYS C NZ    1 
ATOM   8023  N  N     . ILE C 2 122 ? -16.946  49.090  -22.656 1.00 118.88 ?  501 ILE C N     1 
ATOM   8024  C  CA    . ILE C 2 122 ? -17.786  50.272  -22.767 1.00 114.18 ?  501 ILE C CA    1 
ATOM   8025  C  C     . ILE C 2 122 ? -19.122  49.773  -23.283 1.00 112.70 ?  501 ILE C C     1 
ATOM   8026  O  O     . ILE C 2 122 ? -19.185  49.069  -24.284 1.00 114.04 ?  501 ILE C O     1 
ATOM   8027  C  CB    . ILE C 2 122 ? -17.151  51.360  -23.679 1.00 91.73  ?  501 ILE C CB    1 
ATOM   8028  C  CG1   . ILE C 2 122 ? -15.921  51.969  -22.982 1.00 93.07  ?  501 ILE C CG1   1 
ATOM   8029  C  CG2   . ILE C 2 122 ? -18.174  52.440  -24.055 1.00 80.63  ?  501 ILE C CG2   1 
ATOM   8030  C  CD1   . ILE C 2 122 ? -15.330  53.185  -23.672 1.00 91.82  ?  501 ILE C CD1   1 
ATOM   8031  N  N     . ILE C 2 123 ? -20.187  50.102  -22.568 1.00 113.05 ?  502 ILE C N     1 
ATOM   8032  C  CA    . ILE C 2 123 ? -21.471  49.463  -22.801 1.00 111.73 ?  502 ILE C CA    1 
ATOM   8033  C  C     . ILE C 2 123 ? -22.544  50.485  -23.158 1.00 109.11 ?  502 ILE C C     1 
ATOM   8034  O  O     . ILE C 2 123 ? -22.833  51.391  -22.379 1.00 110.97 ?  502 ILE C O     1 
ATOM   8035  C  CB    . ILE C 2 123 ? -21.912  48.636  -21.565 1.00 100.67 ?  502 ILE C CB    1 
ATOM   8036  C  CG1   . ILE C 2 123 ? -20.710  47.919  -20.943 1.00 102.48 ?  502 ILE C CG1   1 
ATOM   8037  C  CG2   . ILE C 2 123 ? -22.984  47.630  -21.941 1.00 100.96 ?  502 ILE C CG2   1 
ATOM   8038  C  CD1   . ILE C 2 123 ? -21.085  46.838  -19.949 1.00 102.81 ?  502 ILE C CD1   1 
ATOM   8039  N  N     . ILE C 2 124 ? -23.122  50.337  -24.346 1.00 107.60 ?  503 ILE C N     1 
ATOM   8040  C  CA    . ILE C 2 124 ? -24.184  51.222  -24.800 1.00 101.95 ?  503 ILE C CA    1 
ATOM   8041  C  C     . ILE C 2 124 ? -25.522  50.595  -24.464 1.00 99.42  ?  503 ILE C C     1 
ATOM   8042  O  O     . ILE C 2 124 ? -25.885  49.558  -25.010 1.00 101.27 ?  503 ILE C O     1 
ATOM   8043  C  CB    . ILE C 2 124 ? -24.117  51.454  -26.322 1.00 96.30  ?  503 ILE C CB    1 
ATOM   8044  C  CG1   . ILE C 2 124 ? -22.718  51.905  -26.741 1.00 89.56  ?  503 ILE C CG1   1 
ATOM   8045  C  CG2   . ILE C 2 124 ? -25.142  52.481  -26.739 1.00 94.36  ?  503 ILE C CG2   1 
ATOM   8046  C  CD1   . ILE C 2 124 ? -22.581  52.161  -28.211 1.00 81.41  ?  503 ILE C CD1   1 
ATOM   8047  N  N     . MET C 2 125 ? -26.258  51.227  -23.564 1.00 96.34  ?  504 MET C N     1 
ATOM   8048  C  CA    . MET C 2 125 ? -27.501  50.653  -23.076 1.00 101.00 ?  504 MET C CA    1 
ATOM   8049  C  C     . MET C 2 125 ? -28.674  51.563  -23.423 1.00 102.61 ?  504 MET C C     1 
ATOM   8050  O  O     . MET C 2 125 ? -28.820  52.637  -22.844 1.00 102.43 ?  504 MET C O     1 
ATOM   8051  C  CB    . MET C 2 125 ? -27.407  50.435  -21.558 1.00 104.37 ?  504 MET C CB    1 
ATOM   8052  C  CG    . MET C 2 125 ? -28.547  49.624  -20.949 1.00 106.92 ?  504 MET C CG    1 
ATOM   8053  S  SD    . MET C 2 125 ? -28.294  49.269  -19.196 1.00 90.18  ?  504 MET C SD    1 
ATOM   8054  C  CE    . MET C 2 125 ? -28.048  50.926  -18.569 1.00 101.83 ?  504 MET C CE    1 
ATOM   8055  N  N     . THR C 2 126 ? -29.504  51.143  -24.374 1.00 104.02 ?  505 THR C N     1 
ATOM   8056  C  CA    . THR C 2 126 ? -30.650  51.959  -24.778 1.00 104.46 ?  505 THR C CA    1 
ATOM   8057  C  C     . THR C 2 126 ? -31.972  51.222  -24.663 1.00 105.80 ?  505 THR C C     1 
ATOM   8058  O  O     . THR C 2 126 ? -32.002  49.995  -24.539 1.00 111.42 ?  505 THR C O     1 
ATOM   8059  C  CB    . THR C 2 126 ? -30.540  52.479  -26.238 1.00 94.38  ?  505 THR C CB    1 
ATOM   8060  O  OG1   . THR C 2 126 ? -30.515  51.372  -27.153 1.00 96.86  ?  505 THR C OG1   1 
ATOM   8061  C  CG2   . THR C 2 126 ? -29.299  53.354  -26.424 1.00 93.51  ?  505 THR C CG2   1 
ATOM   8062  N  N     . ASP C 2 127 ? -33.060  51.991  -24.706 1.00 101.95 ?  506 ASP C N     1 
ATOM   8063  C  CA    . ASP C 2 127 ? -34.401  51.438  -24.799 1.00 98.04  ?  506 ASP C CA    1 
ATOM   8064  C  C     . ASP C 2 127 ? -34.371  50.471  -25.966 1.00 95.13  ?  506 ASP C C     1 
ATOM   8065  O  O     . ASP C 2 127 ? -33.632  50.677  -26.940 1.00 92.33  ?  506 ASP C O     1 
ATOM   8066  C  CB    . ASP C 2 127 ? -35.434  52.538  -25.089 1.00 100.75 ?  506 ASP C CB    1 
ATOM   8067  C  CG    . ASP C 2 127 ? -35.741  53.419  -23.881 1.00 111.62 ?  506 ASP C CG    1 
ATOM   8068  O  OD1   . ASP C 2 127 ? -34.920  53.484  -22.935 1.00 116.33 ?  506 ASP C OD1   1 
ATOM   8069  O  OD2   . ASP C 2 127 ? -36.817  54.064  -23.888 1.00 114.77 ?  506 ASP C OD2   1 
ATOM   8070  N  N     . ALA C 2 128 ? -35.165  49.412  -25.873 1.00 94.22  ?  507 ALA C N     1 
ATOM   8071  C  CA    . ALA C 2 128 ? -35.312  48.502  -26.997 1.00 95.26  ?  507 ALA C CA    1 
ATOM   8072  C  C     . ALA C 2 128 ? -36.297  49.079  -28.010 1.00 102.43 ?  507 ALA C C     1 
ATOM   8073  O  O     . ALA C 2 128 ? -37.078  48.344  -28.616 1.00 110.62 ?  507 ALA C O     1 
ATOM   8074  C  CB    . ALA C 2 128 ? -35.772  47.140  -26.519 1.00 94.35  ?  507 ALA C CB    1 
ATOM   8075  N  N     . ASP C 2 129 ? -36.275  50.399  -28.186 1.00 100.52 ?  508 ASP C N     1 
ATOM   8076  C  CA    . ASP C 2 129 ? -37.146  51.023  -29.182 1.00 92.00  ?  508 ASP C CA    1 
ATOM   8077  C  C     . ASP C 2 129 ? -36.414  51.524  -30.438 1.00 87.04  ?  508 ASP C C     1 
ATOM   8078  O  O     . ASP C 2 129 ? -35.207  51.301  -30.621 1.00 79.10  ?  508 ASP C O     1 
ATOM   8079  C  CB    . ASP C 2 129 ? -38.132  52.070  -28.583 1.00 101.64 ?  508 ASP C CB    1 
ATOM   8080  C  CG    . ASP C 2 129 ? -37.452  53.207  -27.790 1.00 110.07 ?  508 ASP C CG    1 
ATOM   8081  O  OD1   . ASP C 2 129 ? -36.258  53.532  -28.023 1.00 109.10 ?  508 ASP C OD1   1 
ATOM   8082  O  OD2   . ASP C 2 129 ? -38.175  53.802  -26.940 1.00 117.25 ?  508 ASP C OD2   1 
ATOM   8083  N  N     . THR C 2 130 ? -37.170  52.156  -31.325 1.00 89.50  ?  509 THR C N     1 
ATOM   8084  C  CA    . THR C 2 130 ? -36.602  52.702  -32.540 1.00 88.58  ?  509 THR C CA    1 
ATOM   8085  C  C     . THR C 2 130 ? -35.511  53.704  -32.214 1.00 87.18  ?  509 THR C C     1 
ATOM   8086  O  O     . THR C 2 130 ? -34.357  53.509  -32.595 1.00 90.95  ?  509 THR C O     1 
ATOM   8087  C  CB    . THR C 2 130 ? -37.673  53.370  -33.381 1.00 93.75  ?  509 THR C CB    1 
ATOM   8088  O  OG1   . THR C 2 130 ? -38.837  53.587  -32.567 1.00 103.24 ?  509 THR C OG1   1 
ATOM   8089  C  CG2   . THR C 2 130 ? -38.027  52.476  -34.560 1.00 90.08  ?  509 THR C CG2   1 
ATOM   8090  N  N     . ASP C 2 131 ? -35.875  54.765  -31.497 1.00 84.16  ?  510 ASP C N     1 
ATOM   8091  C  CA    . ASP C 2 131 ? -34.919  55.809  -31.127 1.00 86.72  ?  510 ASP C CA    1 
ATOM   8092  C  C     . ASP C 2 131 ? -33.743  55.257  -30.335 1.00 91.38  ?  510 ASP C C     1 
ATOM   8093  O  O     . ASP C 2 131 ? -32.626  55.783  -30.419 1.00 93.07  ?  510 ASP C O     1 
ATOM   8094  C  CB    . ASP C 2 131 ? -35.601  56.926  -30.352 1.00 87.19  ?  510 ASP C CB    1 
ATOM   8095  C  CG    . ASP C 2 131 ? -36.818  57.460  -31.070 1.00 89.04  ?  510 ASP C CG    1 
ATOM   8096  O  OD1   . ASP C 2 131 ? -36.682  58.447  -31.829 1.00 89.05  ?  510 ASP C OD1   1 
ATOM   8097  O  OD2   . ASP C 2 131 ? -37.909  56.878  -30.882 1.00 90.48  ?  510 ASP C OD2   1 
ATOM   8098  N  N     . GLY C 2 132 ? -33.993  54.202  -29.566 1.00 91.51  ?  511 GLY C N     1 
ATOM   8099  C  CA    . GLY C 2 132 ? -32.905  53.480  -28.936 1.00 93.02  ?  511 GLY C CA    1 
ATOM   8100  C  C     . GLY C 2 132 ? -31.935  53.036  -30.015 1.00 90.81  ?  511 GLY C C     1 
ATOM   8101  O  O     . GLY C 2 132 ? -30.729  53.275  -29.935 1.00 91.24  ?  511 GLY C O     1 
ATOM   8102  N  N     . ALA C 2 133 ? -32.482  52.394  -31.042 1.00 87.44  ?  512 ALA C N     1 
ATOM   8103  C  CA    . ALA C 2 133 ? -31.697  51.933  -32.175 1.00 87.74  ?  512 ALA C CA    1 
ATOM   8104  C  C     . ALA C 2 133 ? -30.905  53.077  -32.809 1.00 90.21  ?  512 ALA C C     1 
ATOM   8105  O  O     . ALA C 2 133 ? -29.694  52.968  -33.034 1.00 94.42  ?  512 ALA C O     1 
ATOM   8106  C  CB    . ALA C 2 133 ? -32.613  51.293  -33.202 1.00 86.38  ?  512 ALA C CB    1 
ATOM   8107  N  N     . HIS C 2 134 ? -31.603  54.170  -33.105 1.00 87.32  ?  513 HIS C N     1 
ATOM   8108  C  CA    . HIS C 2 134 ? -30.975  55.339  -33.704 1.00 85.00  ?  513 HIS C CA    1 
ATOM   8109  C  C     . HIS C 2 134 ? -29.770  55.795  -32.882 1.00 86.06  ?  513 HIS C C     1 
ATOM   8110  O  O     . HIS C 2 134 ? -28.696  56.038  -33.430 1.00 87.67  ?  513 HIS C O     1 
ATOM   8111  C  CB    . HIS C 2 134 ? -31.995  56.467  -33.857 1.00 84.54  ?  513 HIS C CB    1 
ATOM   8112  C  CG    . HIS C 2 134 ? -31.475  57.663  -34.594 1.00 90.36  ?  513 HIS C CG    1 
ATOM   8113  N  ND1   . HIS C 2 134 ? -31.889  58.948  -34.314 1.00 93.82  ?  513 HIS C ND1   1 
ATOM   8114  C  CD2   . HIS C 2 134 ? -30.579  57.769  -35.603 1.00 94.84  ?  513 HIS C CD2   1 
ATOM   8115  C  CE1   . HIS C 2 134 ? -31.267  59.794  -35.115 1.00 96.34  ?  513 HIS C CE1   1 
ATOM   8116  N  NE2   . HIS C 2 134 ? -30.467  59.104  -35.908 1.00 98.00  ?  513 HIS C NE2   1 
ATOM   8117  N  N     . ILE C 2 135 ? -29.948  55.899  -31.567 1.00 83.47  ?  514 ILE C N     1 
ATOM   8118  C  CA    . ILE C 2 135 ? -28.856  56.319  -30.692 1.00 85.69  ?  514 ILE C CA    1 
ATOM   8119  C  C     . ILE C 2 135 ? -27.649  55.384  -30.802 1.00 88.48  ?  514 ILE C C     1 
ATOM   8120  O  O     . ILE C 2 135 ? -26.515  55.847  -30.898 1.00 91.97  ?  514 ILE C O     1 
ATOM   8121  C  CB    . ILE C 2 135 ? -29.305  56.483  -29.204 1.00 76.88  ?  514 ILE C CB    1 
ATOM   8122  C  CG1   . ILE C 2 135 ? -29.741  57.920  -28.944 1.00 84.69  ?  514 ILE C CG1   1 
ATOM   8123  C  CG2   . ILE C 2 135 ? -28.170  56.134  -28.239 1.00 75.54  ?  514 ILE C CG2   1 
ATOM   8124  C  CD1   . ILE C 2 135 ? -31.214  58.052  -28.583 1.00 93.75  ?  514 ILE C CD1   1 
ATOM   8125  N  N     . GLN C 2 136 ? -27.890  54.076  -30.783 1.00 86.14  ?  515 GLN C N     1 
ATOM   8126  C  CA    . GLN C 2 136 ? -26.805  53.107  -30.897 1.00 90.23  ?  515 GLN C CA    1 
ATOM   8127  C  C     . GLN C 2 136 ? -26.040  53.383  -32.177 1.00 92.48  ?  515 GLN C C     1 
ATOM   8128  O  O     . GLN C 2 136 ? -24.819  53.224  -32.261 1.00 89.99  ?  515 GLN C O     1 
ATOM   8129  C  CB    . GLN C 2 136 ? -27.366  51.689  -30.946 1.00 93.40  ?  515 GLN C CB    1 
ATOM   8130  C  CG    . GLN C 2 136 ? -28.248  51.340  -29.767 1.00 97.49  ?  515 GLN C CG    1 
ATOM   8131  C  CD    . GLN C 2 136 ? -28.606  49.867  -29.733 1.00 100.65 ?  515 GLN C CD    1 
ATOM   8132  O  OE1   . GLN C 2 136 ? -28.046  49.051  -30.483 1.00 97.04  ?  515 GLN C OE1   1 
ATOM   8133  N  NE2   . GLN C 2 136 ? -29.547  49.514  -28.861 1.00 103.24 ?  515 GLN C NE2   1 
ATOM   8134  N  N     . THR C 2 137 ? -26.800  53.824  -33.166 1.00 93.70  ?  516 THR C N     1 
ATOM   8135  C  CA    . THR C 2 137 ? -26.318  54.043  -34.514 1.00 91.56  ?  516 THR C CA    1 
ATOM   8136  C  C     . THR C 2 137 ? -25.379  55.254  -34.596 1.00 89.33  ?  516 THR C C     1 
ATOM   8137  O  O     . THR C 2 137 ? -24.397  55.234  -35.331 1.00 91.34  ?  516 THR C O     1 
ATOM   8138  C  CB    . THR C 2 137 ? -27.534  54.189  -35.465 1.00 86.63  ?  516 THR C CB    1 
ATOM   8139  O  OG1   . THR C 2 137 ? -27.427  53.254  -36.548 1.00 87.60  ?  516 THR C OG1   1 
ATOM   8140  C  CG2   . THR C 2 137 ? -27.663  55.613  -35.980 1.00 87.46  ?  516 THR C CG2   1 
ATOM   8141  N  N     . LEU C 2 138 ? -25.684  56.294  -33.826 1.00 88.30  ?  517 LEU C N     1 
ATOM   8142  C  CA    . LEU C 2 138 ? -24.879  57.515  -33.777 1.00 93.07  ?  517 LEU C CA    1 
ATOM   8143  C  C     . LEU C 2 138 ? -23.638  57.345  -32.898 1.00 101.54 ?  517 LEU C C     1 
ATOM   8144  O  O     . LEU C 2 138 ? -22.561  57.854  -33.215 1.00 106.83 ?  517 LEU C O     1 
ATOM   8145  C  CB    . LEU C 2 138 ? -25.718  58.672  -33.229 1.00 90.63  ?  517 LEU C CB    1 
ATOM   8146  C  CG    . LEU C 2 138 ? -27.033  58.940  -33.954 1.00 88.21  ?  517 LEU C CG    1 
ATOM   8147  C  CD1   . LEU C 2 138 ? -28.150  59.158  -32.955 1.00 85.46  ?  517 LEU C CD1   1 
ATOM   8148  C  CD2   . LEU C 2 138 ? -26.896  60.138  -34.888 1.00 92.61  ?  517 LEU C CD2   1 
ATOM   8149  N  N     . LEU C 2 139 ? -23.801  56.656  -31.775 1.00 99.85  ?  518 LEU C N     1 
ATOM   8150  C  CA    . LEU C 2 139 ? -22.678  56.384  -30.897 1.00 102.52 ?  518 LEU C CA    1 
ATOM   8151  C  C     . LEU C 2 139 ? -21.663  55.533  -31.641 1.00 107.43 ?  518 LEU C C     1 
ATOM   8152  O  O     . LEU C 2 139 ? -20.458  55.799  -31.595 1.00 108.80 ?  518 LEU C O     1 
ATOM   8153  C  CB    . LEU C 2 139 ? -23.140  55.682  -29.622 1.00 102.24 ?  518 LEU C CB    1 
ATOM   8154  C  CG    . LEU C 2 139 ? -23.801  56.590  -28.578 1.00 100.40 ?  518 LEU C CG    1 
ATOM   8155  C  CD1   . LEU C 2 139 ? -24.405  55.773  -27.446 1.00 98.73  ?  518 LEU C CD1   1 
ATOM   8156  C  CD2   . LEU C 2 139 ? -22.821  57.624  -28.023 1.00 99.05  ?  518 LEU C CD2   1 
ATOM   8157  N  N     . LEU C 2 140 ? -22.155  54.522  -32.350 1.00 107.41 ?  519 LEU C N     1 
ATOM   8158  C  CA    . LEU C 2 140 ? -21.270  53.627  -33.091 1.00 105.62 ?  519 LEU C CA    1 
ATOM   8159  C  C     . LEU C 2 140 ? -20.462  54.333  -34.180 1.00 106.80 ?  519 LEU C C     1 
ATOM   8160  O  O     . LEU C 2 140 ? -19.324  53.952  -34.444 1.00 109.00 ?  519 LEU C O     1 
ATOM   8161  C  CB    . LEU C 2 140 ? -22.036  52.431  -33.667 1.00 100.28 ?  519 LEU C CB    1 
ATOM   8162  C  CG    . LEU C 2 140 ? -22.303  51.303  -32.664 1.00 97.09  ?  519 LEU C CG    1 
ATOM   8163  C  CD1   . LEU C 2 140 ? -22.769  50.018  -33.360 1.00 95.65  ?  519 LEU C CD1   1 
ATOM   8164  C  CD2   . LEU C 2 140 ? -21.054  51.049  -31.818 1.00 95.94  ?  519 LEU C CD2   1 
ATOM   8165  N  N     . THR C 2 141 ? -21.032  55.360  -34.809 1.00 103.54 ?  520 THR C N     1 
ATOM   8166  C  CA    . THR C 2 141 ? -20.283  56.086  -35.830 1.00 102.53 ?  520 THR C CA    1 
ATOM   8167  C  C     . THR C 2 141 ? -19.212  56.953  -35.186 1.00 105.65 ?  520 THR C C     1 
ATOM   8168  O  O     . THR C 2 141 ? -18.123  57.100  -35.736 1.00 111.69 ?  520 THR C O     1 
ATOM   8169  C  CB    . THR C 2 141 ? -21.169  56.950  -36.763 1.00 97.68  ?  520 THR C CB    1 
ATOM   8170  O  OG1   . THR C 2 141 ? -21.352  58.252  -36.196 1.00 98.97  ?  520 THR C OG1   1 
ATOM   8171  C  CG2   . THR C 2 141 ? -22.515  56.282  -37.026 1.00 93.46  ?  520 THR C CG2   1 
ATOM   8172  N  N     . PHE C 2 142 ? -19.512  57.511  -34.016 1.00 102.35 ?  521 PHE C N     1 
ATOM   8173  C  CA    . PHE C 2 142 ? -18.524  58.303  -33.279 1.00 107.19 ?  521 PHE C CA    1 
ATOM   8174  C  C     . PHE C 2 142 ? -17.274  57.494  -32.918 1.00 109.69 ?  521 PHE C C     1 
ATOM   8175  O  O     . PHE C 2 142 ? -16.152  58.001  -33.029 1.00 105.09 ?  521 PHE C O     1 
ATOM   8176  C  CB    . PHE C 2 142 ? -19.136  58.913  -32.013 1.00 108.33 ?  521 PHE C CB    1 
ATOM   8177  C  CG    . PHE C 2 142 ? -18.129  59.578  -31.102 1.00 111.95 ?  521 PHE C CG    1 
ATOM   8178  C  CD1   . PHE C 2 142 ? -17.577  58.888  -30.028 1.00 108.90 ?  521 PHE C CD1   1 
ATOM   8179  C  CD2   . PHE C 2 142 ? -17.740  60.897  -31.310 1.00 112.76 ?  521 PHE C CD2   1 
ATOM   8180  C  CE1   . PHE C 2 142 ? -16.650  59.497  -29.184 1.00 106.18 ?  521 PHE C CE1   1 
ATOM   8181  C  CE2   . PHE C 2 142 ? -16.813  61.514  -30.463 1.00 107.00 ?  521 PHE C CE2   1 
ATOM   8182  C  CZ    . PHE C 2 142 ? -16.269  60.809  -29.404 1.00 105.74 ?  521 PHE C CZ    1 
ATOM   8183  N  N     . PHE C 2 143 ? -17.467  56.245  -32.488 1.00 113.52 ?  522 PHE C N     1 
ATOM   8184  C  CA    . PHE C 2 143 ? -16.349  55.404  -32.047 1.00 119.48 ?  522 PHE C CA    1 
ATOM   8185  C  C     . PHE C 2 143 ? -15.569  54.857  -33.227 1.00 125.52 ?  522 PHE C C     1 
ATOM   8186  O  O     . PHE C 2 143 ? -14.347  54.692  -33.155 1.00 130.47 ?  522 PHE C O     1 
ATOM   8187  C  CB    . PHE C 2 143 ? -16.827  54.242  -31.170 1.00 119.43 ?  522 PHE C CB    1 
ATOM   8188  C  CG    . PHE C 2 143 ? -17.365  54.671  -29.841 1.00 119.98 ?  522 PHE C CG    1 
ATOM   8189  C  CD1   . PHE C 2 143 ? -16.709  55.632  -29.090 1.00 121.38 ?  522 PHE C CD1   1 
ATOM   8190  C  CD2   . PHE C 2 143 ? -18.543  54.132  -29.352 1.00 121.56 ?  522 PHE C CD2   1 
ATOM   8191  C  CE1   . PHE C 2 143 ? -17.212  56.043  -27.867 1.00 122.90 ?  522 PHE C CE1   1 
ATOM   8192  C  CE2   . PHE C 2 143 ? -19.055  54.537  -28.137 1.00 124.30 ?  522 PHE C CE2   1 
ATOM   8193  C  CZ    . PHE C 2 143 ? -18.385  55.495  -27.388 1.00 124.53 ?  522 PHE C CZ    1 
ATOM   8194  N  N     . TYR C 2 144 ? -16.284  54.558  -34.306 1.00 123.95 ?  523 TYR C N     1 
ATOM   8195  C  CA    . TYR C 2 144 ? -15.649  54.118  -35.538 1.00 121.77 ?  523 TYR C CA    1 
ATOM   8196  C  C     . TYR C 2 144 ? -14.844  55.275  -36.120 1.00 119.12 ?  523 TYR C C     1 
ATOM   8197  O  O     . TYR C 2 144 ? -13.719  55.091  -36.582 1.00 125.08 ?  523 TYR C O     1 
ATOM   8198  C  CB    . TYR C 2 144 ? -16.694  53.632  -36.543 1.00 120.66 ?  523 TYR C CB    1 
ATOM   8199  C  CG    . TYR C 2 144 ? -16.110  53.304  -37.891 1.00 123.22 ?  523 TYR C CG    1 
ATOM   8200  C  CD1   . TYR C 2 144 ? -15.568  52.055  -38.144 1.00 125.87 ?  523 TYR C CD1   1 
ATOM   8201  C  CD2   . TYR C 2 144 ? -16.088  54.250  -38.908 1.00 126.26 ?  523 TYR C CD2   1 
ATOM   8202  C  CE1   . TYR C 2 144 ? -15.024  51.749  -39.376 1.00 131.49 ?  523 TYR C CE1   1 
ATOM   8203  C  CE2   . TYR C 2 144 ? -15.543  53.958  -40.144 1.00 131.79 ?  523 TYR C CE2   1 
ATOM   8204  C  CZ    . TYR C 2 144 ? -15.013  52.703  -40.374 1.00 135.19 ?  523 TYR C CZ    1 
ATOM   8205  O  OH    . TYR C 2 144 ? -14.470  52.396  -41.603 1.00 139.16 ?  523 TYR C OH    1 
ATOM   8206  N  N     . ARG C 2 145 ? -15.425  56.471  -36.070 1.00 111.31 ?  524 ARG C N     1 
ATOM   8207  C  CA    . ARG C 2 145 ? -14.806  57.660  -36.647 1.00 108.87 ?  524 ARG C CA    1 
ATOM   8208  C  C     . ARG C 2 145 ? -13.652  58.219  -35.820 1.00 110.24 ?  524 ARG C C     1 
ATOM   8209  O  O     . ARG C 2 145 ? -12.637  58.619  -36.380 1.00 109.51 ?  524 ARG C O     1 
ATOM   8210  C  CB    . ARG C 2 145 ? -15.852  58.755  -36.898 1.00 111.17 ?  524 ARG C CB    1 
ATOM   8211  C  CG    . ARG C 2 145 ? -16.750  58.514  -38.121 1.00 115.54 ?  524 ARG C CG    1 
ATOM   8212  C  CD    . ARG C 2 145 ? -15.948  58.538  -39.424 1.00 121.35 ?  524 ARG C CD    1 
ATOM   8213  N  NE    . ARG C 2 145 ? -16.573  59.366  -40.452 1.00 122.13 ?  524 ARG C NE    1 
ATOM   8214  C  CZ    . ARG C 2 145 ? -16.752  60.682  -40.351 1.00 127.11 ?  524 ARG C CZ    1 
ATOM   8215  N  NH1   . ARG C 2 145 ? -16.362  61.335  -39.261 1.00 124.50 ?  524 ARG C NH1   1 
ATOM   8216  N  NH2   . ARG C 2 145 ? -17.332  61.350  -41.341 1.00 132.83 ?  524 ARG C NH2   1 
ATOM   8217  N  N     . TYR C 2 146 ? -13.793  58.243  -34.496 1.00 116.30 ?  525 TYR C N     1 
ATOM   8218  C  CA    . TYR C 2 146 ? -12.835  58.975  -33.661 1.00 121.20 ?  525 TYR C CA    1 
ATOM   8219  C  C     . TYR C 2 146 ? -12.133  58.175  -32.543 1.00 118.02 ?  525 TYR C C     1 
ATOM   8220  O  O     . TYR C 2 146 ? -11.311  58.728  -31.811 1.00 118.01 ?  525 TYR C O     1 
ATOM   8221  C  CB    . TYR C 2 146 ? -13.484  60.256  -33.108 1.00 122.77 ?  525 TYR C CB    1 
ATOM   8222  C  CG    . TYR C 2 146 ? -13.785  61.304  -34.171 1.00 123.30 ?  525 TYR C CG    1 
ATOM   8223  C  CD1   . TYR C 2 146 ? -14.881  61.169  -35.020 1.00 123.86 ?  525 TYR C CD1   1 
ATOM   8224  C  CD2   . TYR C 2 146 ? -12.975  62.430  -34.319 1.00 124.70 ?  525 TYR C CD2   1 
ATOM   8225  C  CE1   . TYR C 2 146 ? -15.159  62.121  -35.994 1.00 126.34 ?  525 TYR C CE1   1 
ATOM   8226  C  CE2   . TYR C 2 146 ? -13.242  63.390  -35.286 1.00 126.83 ?  525 TYR C CE2   1 
ATOM   8227  C  CZ    . TYR C 2 146 ? -14.337  63.232  -36.124 1.00 128.91 ?  525 TYR C CZ    1 
ATOM   8228  O  OH    . TYR C 2 146 ? -14.616  64.180  -37.093 1.00 130.22 ?  525 TYR C OH    1 
ATOM   8229  N  N     . MET C 2 147 ? -12.453  56.888  -32.420 1.00 115.65 ?  526 MET C N     1 
ATOM   8230  C  CA    . MET C 2 147 ? -11.765  55.988  -31.486 1.00 115.53 ?  526 MET C CA    1 
ATOM   8231  C  C     . MET C 2 147 ? -11.693  54.591  -32.098 1.00 114.49 ?  526 MET C C     1 
ATOM   8232  O  O     . MET C 2 147 ? -12.026  53.602  -31.436 1.00 110.69 ?  526 MET C O     1 
ATOM   8233  C  CB    . MET C 2 147 ? -12.500  55.894  -30.139 1.00 117.19 ?  526 MET C CB    1 
ATOM   8234  C  CG    . MET C 2 147 ? -12.607  57.198  -29.331 1.00 122.79 ?  526 MET C CG    1 
ATOM   8235  S  SD    . MET C 2 147 ? -13.646  57.097  -27.828 1.00 110.46 ?  526 MET C SD    1 
ATOM   8236  C  CE    . MET C 2 147 ? -12.785  55.833  -26.893 1.00 160.16 ?  526 MET C CE    1 
ATOM   8237  N  N     . ARG C 2 148 ? -11.265  54.509  -33.357 1.00 115.11 ?  527 ARG C N     1 
ATOM   8238  C  CA    . ARG C 2 148 ? -11.332  53.245  -34.097 1.00 115.01 ?  527 ARG C CA    1 
ATOM   8239  C  C     . ARG C 2 148 ? -10.721  52.062  -33.332 1.00 118.35 ?  527 ARG C C     1 
ATOM   8240  O  O     . ARG C 2 148 ? -11.238  50.942  -33.405 1.00 114.68 ?  527 ARG C O     1 
ATOM   8241  C  CB    . ARG C 2 148 ? -10.729  53.373  -35.513 1.00 115.58 ?  527 ARG C CB    1 
ATOM   8242  N  N     . PRO C 2 149 ? -9.624   52.307  -32.590 1.00 125.12 ?  528 PRO C N     1 
ATOM   8243  C  CA    . PRO C 2 149 ? -8.979   51.211  -31.853 1.00 131.54 ?  528 PRO C CA    1 
ATOM   8244  C  C     . PRO C 2 149 ? -9.958   50.494  -30.920 1.00 134.74 ?  528 PRO C C     1 
ATOM   8245  O  O     . PRO C 2 149 ? -9.959   49.259  -30.860 1.00 136.39 ?  528 PRO C O     1 
ATOM   8246  C  CB    . PRO C 2 149 ? -7.893   51.926  -31.032 1.00 128.58 ?  528 PRO C CB    1 
ATOM   8247  C  CG    . PRO C 2 149 ? -7.618   53.190  -31.773 1.00 124.83 ?  528 PRO C CG    1 
ATOM   8248  C  CD    . PRO C 2 149 ? -8.929   53.593  -32.393 1.00 123.31 ?  528 PRO C CD    1 
ATOM   8249  N  N     . LEU C 2 150 ? -10.783  51.267  -30.212 1.00 131.77 ?  529 LEU C N     1 
ATOM   8250  C  CA    . LEU C 2 150 ? -11.680  50.718  -29.203 1.00 126.82 ?  529 LEU C CA    1 
ATOM   8251  C  C     . LEU C 2 150 ? -12.639  49.667  -29.760 1.00 125.14 ?  529 LEU C C     1 
ATOM   8252  O  O     . LEU C 2 150 ? -12.869  48.634  -29.124 1.00 121.05 ?  529 LEU C O     1 
ATOM   8253  C  CB    . LEU C 2 150 ? -12.450  51.833  -28.487 1.00 121.84 ?  529 LEU C CB    1 
ATOM   8254  C  CG    . LEU C 2 150 ? -11.943  52.154  -27.077 1.00 117.68 ?  529 LEU C CG    1 
ATOM   8255  C  CD1   . LEU C 2 150 ? -12.943  52.998  -26.303 1.00 112.26 ?  529 LEU C CD1   1 
ATOM   8256  C  CD2   . LEU C 2 150 ? -11.622  50.868  -26.323 1.00 116.41 ?  529 LEU C CD2   1 
ATOM   8257  N  N     . VAL C 2 151 ? -13.194  49.924  -30.943 1.00 129.52 ?  530 VAL C N     1 
ATOM   8258  C  CA    . VAL C 2 151 ? -14.130  48.981  -31.548 1.00 133.00 ?  530 VAL C CA    1 
ATOM   8259  C  C     . VAL C 2 151 ? -13.399  47.747  -32.095 1.00 136.37 ?  530 VAL C C     1 
ATOM   8260  O  O     . VAL C 2 151 ? -13.851  46.618  -31.891 1.00 136.60 ?  530 VAL C O     1 
ATOM   8261  C  CB    . VAL C 2 151 ? -15.029  49.649  -32.630 1.00 87.14  ?  530 VAL C CB    1 
ATOM   8262  N  N     . GLU C 2 152 ? -12.261  47.964  -32.760 1.00 137.63 ?  531 GLU C N     1 
ATOM   8263  C  CA    . GLU C 2 152 ? -11.463  46.865  -33.323 1.00 137.49 ?  531 GLU C CA    1 
ATOM   8264  C  C     . GLU C 2 152 ? -10.748  46.053  -32.231 1.00 138.83 ?  531 GLU C C     1 
ATOM   8265  O  O     . GLU C 2 152 ? -10.287  44.929  -32.468 1.00 140.10 ?  531 GLU C O     1 
ATOM   8266  C  CB    . GLU C 2 152 ? -10.459  47.385  -34.368 1.00 135.17 ?  531 GLU C CB    1 
ATOM   8267  N  N     . ALA C 2 153 ? -10.665  46.628  -31.034 1.00 138.30 ?  532 ALA C N     1 
ATOM   8268  C  CA    . ALA C 2 153 ? -10.103  45.928  -29.882 1.00 140.99 ?  532 ALA C CA    1 
ATOM   8269  C  C     . ALA C 2 153 ? -11.198  45.197  -29.095 1.00 143.04 ?  532 ALA C C     1 
ATOM   8270  O  O     . ALA C 2 153 ? -10.925  44.568  -28.067 1.00 141.21 ?  532 ALA C O     1 
ATOM   8271  C  CB    . ALA C 2 153 ? -9.347   46.899  -28.981 1.00 138.26 ?  532 ALA C CB    1 
ATOM   8272  N  N     . GLY C 2 154 ? -12.436  45.296  -29.584 1.00 142.73 ?  533 GLY C N     1 
ATOM   8273  C  CA    . GLY C 2 154 ? -13.568  44.580  -29.014 1.00 139.45 ?  533 GLY C CA    1 
ATOM   8274  C  C     . GLY C 2 154 ? -14.036  45.090  -27.663 1.00 134.39 ?  533 GLY C C     1 
ATOM   8275  O  O     . GLY C 2 154 ? -14.731  44.383  -26.933 1.00 130.50 ?  533 GLY C O     1 
ATOM   8276  N  N     . HIS C 2 155 ? -13.655  46.322  -27.338 1.00 134.09 ?  534 HIS C N     1 
ATOM   8277  C  CA    . HIS C 2 155 ? -13.986  46.930  -26.052 1.00 134.23 ?  534 HIS C CA    1 
ATOM   8278  C  C     . HIS C 2 155 ? -15.369  47.606  -26.054 1.00 130.09 ?  534 HIS C C     1 
ATOM   8279  O  O     . HIS C 2 155 ? -15.859  48.057  -25.018 1.00 132.79 ?  534 HIS C O     1 
ATOM   8280  C  CB    . HIS C 2 155 ? -12.903  47.942  -25.653 1.00 136.61 ?  534 HIS C CB    1 
ATOM   8281  C  CG    . HIS C 2 155 ? -11.693  47.329  -25.012 1.00 140.97 ?  534 HIS C CG    1 
ATOM   8282  N  ND1   . HIS C 2 155 ? -11.406  45.983  -25.089 1.00 146.15 ?  534 HIS C ND1   1 
ATOM   8283  C  CD2   . HIS C 2 155 ? -10.700  47.883  -24.275 1.00 143.42 ?  534 HIS C CD2   1 
ATOM   8284  C  CE1   . HIS C 2 155 ? -10.287  45.735  -24.432 1.00 151.13 ?  534 HIS C CE1   1 
ATOM   8285  N  NE2   . HIS C 2 155 ? -9.839   46.870  -23.925 1.00 148.74 ?  534 HIS C NE2   1 
ATOM   8286  N  N     . VAL C 2 156 ? -16.001  47.676  -27.218 1.00 122.60 ?  535 VAL C N     1 
ATOM   8287  C  CA    . VAL C 2 156 ? -17.284  48.349  -27.323 1.00 113.37 ?  535 VAL C CA    1 
ATOM   8288  C  C     . VAL C 2 156 ? -18.422  47.348  -27.465 1.00 115.68 ?  535 VAL C C     1 
ATOM   8289  O  O     . VAL C 2 156 ? -18.463  46.571  -28.416 1.00 118.28 ?  535 VAL C O     1 
ATOM   8290  C  CB    . VAL C 2 156 ? -17.307  49.321  -28.507 1.00 105.74 ?  535 VAL C CB    1 
ATOM   8291  C  CG1   . VAL C 2 156 ? -18.689  49.880  -28.683 1.00 101.76 ?  535 VAL C CG1   1 
ATOM   8292  C  CG2   . VAL C 2 156 ? -16.311  50.440  -28.285 1.00 106.75 ?  535 VAL C CG2   1 
ATOM   8293  N  N     . TYR C 2 157 ? -19.346  47.375  -26.512 1.00 117.39 ?  536 TYR C N     1 
ATOM   8294  C  CA    . TYR C 2 157 ? -20.462  46.435  -26.493 1.00 116.60 ?  536 TYR C CA    1 
ATOM   8295  C  C     . TYR C 2 157 ? -21.810  47.149  -26.542 1.00 113.88 ?  536 TYR C C     1 
ATOM   8296  O  O     . TYR C 2 157 ? -21.890  48.375  -26.477 1.00 113.75 ?  536 TYR C O     1 
ATOM   8297  C  CB    . TYR C 2 157 ? -20.430  45.585  -25.220 1.00 113.72 ?  536 TYR C CB    1 
ATOM   8298  C  CG    . TYR C 2 157 ? -19.117  44.900  -24.908 1.00 110.90 ?  536 TYR C CG    1 
ATOM   8299  C  CD1   . TYR C 2 157 ? -19.072  43.536  -24.660 1.00 110.86 ?  536 TYR C CD1   1 
ATOM   8300  C  CD2   . TYR C 2 157 ? -17.929  45.619  -24.835 1.00 111.17 ?  536 TYR C CD2   1 
ATOM   8301  C  CE1   . TYR C 2 157 ? -17.878  42.897  -24.350 1.00 115.27 ?  536 TYR C CE1   1 
ATOM   8302  C  CE2   . TYR C 2 157 ? -16.727  44.991  -24.531 1.00 115.89 ?  536 TYR C CE2   1 
ATOM   8303  C  CZ    . TYR C 2 157 ? -16.703  43.625  -24.287 1.00 114.98 ?  536 TYR C CZ    1 
ATOM   8304  O  OH    . TYR C 2 157 ? -15.511  42.986  -23.979 1.00 111.78 ?  536 TYR C OH    1 
ATOM   8305  N  N     . ILE C 2 158 ? -22.873  46.361  -26.630 1.00 111.57 ?  537 ILE C N     1 
ATOM   8306  C  CA    . ILE C 2 158 ? -24.223  46.889  -26.568 1.00 110.69 ?  537 ILE C CA    1 
ATOM   8307  C  C     . ILE C 2 158 ? -25.092  45.964  -25.726 1.00 115.25 ?  537 ILE C C     1 
ATOM   8308  O  O     . ILE C 2 158 ? -25.175  44.763  -25.988 1.00 120.88 ?  537 ILE C O     1 
ATOM   8309  C  CB    . ILE C 2 158 ? -24.825  47.031  -27.967 1.00 108.47 ?  537 ILE C CB    1 
ATOM   8310  C  CG1   . ILE C 2 158 ? -24.012  48.038  -28.781 1.00 106.89 ?  537 ILE C CG1   1 
ATOM   8311  C  CG2   . ILE C 2 158 ? -26.277  47.467  -27.876 1.00 108.28 ?  537 ILE C CG2   1 
ATOM   8312  C  CD1   . ILE C 2 158 ? -24.342  48.046  -30.255 1.00 103.76 ?  537 ILE C CD1   1 
ATOM   8313  N  N     . ALA C 2 159 ? -25.731  46.522  -24.704 1.00 111.69 ?  538 ALA C N     1 
ATOM   8314  C  CA    . ALA C 2 159 ? -26.562  45.726  -23.812 1.00 106.97 ?  538 ALA C CA    1 
ATOM   8315  C  C     . ALA C 2 159 ? -27.912  45.466  -24.447 1.00 102.71 ?  538 ALA C C     1 
ATOM   8316  O  O     . ALA C 2 159 ? -28.555  46.390  -24.934 1.00 105.25 ?  538 ALA C O     1 
ATOM   8317  C  CB    . ALA C 2 159 ? -26.735  46.426  -22.466 1.00 106.11 ?  538 ALA C CB    1 
ATOM   8318  N  N     . LEU C 2 160 ? -28.329  44.205  -24.450 1.00 103.80 ?  539 LEU C N     1 
ATOM   8319  C  CA    . LEU C 2 160 ? -29.665  43.835  -24.901 1.00 108.57 ?  539 LEU C CA    1 
ATOM   8320  C  C     . LEU C 2 160 ? -30.605  43.706  -23.690 1.00 116.42 ?  539 LEU C C     1 
ATOM   8321  O  O     . LEU C 2 160 ? -30.572  42.698  -22.982 1.00 119.68 ?  539 LEU C O     1 
ATOM   8322  C  CB    . LEU C 2 160 ? -29.623  42.513  -25.688 1.00 101.35 ?  539 LEU C CB    1 
ATOM   8323  C  CG    . LEU C 2 160 ? -28.617  42.326  -26.834 1.00 90.65  ?  539 LEU C CG    1 
ATOM   8324  N  N     . PRO C 2 161 ? -31.432  44.736  -23.432 1.00 117.65 ?  540 PRO C N     1 
ATOM   8325  C  CA    . PRO C 2 161 ? -32.419  44.618  -22.354 1.00 117.10 ?  540 PRO C CA    1 
ATOM   8326  C  C     . PRO C 2 161 ? -33.535  43.692  -22.800 1.00 123.40 ?  540 PRO C C     1 
ATOM   8327  O  O     . PRO C 2 161 ? -33.654  43.429  -23.998 1.00 127.54 ?  540 PRO C O     1 
ATOM   8328  C  CB    . PRO C 2 161 ? -32.970  46.042  -22.213 1.00 114.28 ?  540 PRO C CB    1 
ATOM   8329  C  CG    . PRO C 2 161 ? -32.054  46.912  -23.018 1.00 115.79 ?  540 PRO C CG    1 
ATOM   8330  C  CD    . PRO C 2 161 ? -31.495  46.049  -24.089 1.00 117.65 ?  540 PRO C CD    1 
ATOM   8331  N  N     . PRO C 2 162 ? -34.347  43.203  -21.853 1.00 124.34 ?  541 PRO C N     1 
ATOM   8332  C  CA    . PRO C 2 162 ? -35.454  42.298  -22.182 1.00 126.17 ?  541 PRO C CA    1 
ATOM   8333  C  C     . PRO C 2 162 ? -36.611  43.034  -22.856 1.00 127.44 ?  541 PRO C C     1 
ATOM   8334  O  O     . PRO C 2 162 ? -36.818  44.219  -22.591 1.00 126.37 ?  541 PRO C O     1 
ATOM   8335  C  CB    . PRO C 2 162 ? -35.888  41.764  -20.813 1.00 126.18 ?  541 PRO C CB    1 
ATOM   8336  C  CG    . PRO C 2 162 ? -35.506  42.838  -19.853 1.00 124.84 ?  541 PRO C CG    1 
ATOM   8337  C  CD    . PRO C 2 162 ? -34.252  43.471  -20.407 1.00 124.39 ?  541 PRO C CD    1 
ATOM   8338  N  N     . LEU C 2 163 ? -37.344  42.338  -23.722 1.00 129.28 ?  542 LEU C N     1 
ATOM   8339  C  CA    . LEU C 2 163 ? -38.542  42.897  -24.349 1.00 127.21 ?  542 LEU C CA    1 
ATOM   8340  C  C     . LEU C 2 163 ? -39.815  42.546  -23.558 1.00 131.69 ?  542 LEU C C     1 
ATOM   8341  O  O     . LEU C 2 163 ? -40.799  43.289  -23.597 1.00 128.66 ?  542 LEU C O     1 
ATOM   8342  C  CB    . LEU C 2 163 ? -38.671  42.421  -25.807 1.00 123.81 ?  542 LEU C CB    1 
ATOM   8343  C  CG    . LEU C 2 163 ? -37.703  42.939  -26.880 1.00 117.49 ?  542 LEU C CG    1 
ATOM   8344  N  N     . TYR C 2 164 ? -39.783  41.421  -22.838 1.00 138.47 ?  543 TYR C N     1 
ATOM   8345  C  CA    . TYR C 2 164 ? -40.963  40.897  -22.137 1.00 142.31 ?  543 TYR C CA    1 
ATOM   8346  C  C     . TYR C 2 164 ? -40.667  40.391  -20.716 1.00 143.29 ?  543 TYR C C     1 
ATOM   8347  O  O     . TYR C 2 164 ? -39.508  40.222  -20.333 1.00 143.60 ?  543 TYR C O     1 
ATOM   8348  C  CB    . TYR C 2 164 ? -41.588  39.750  -22.939 1.00 147.09 ?  543 TYR C CB    1 
ATOM   8349  C  CG    . TYR C 2 164 ? -41.920  40.069  -24.381 1.00 150.76 ?  543 TYR C CG    1 
ATOM   8350  C  CD1   . TYR C 2 164 ? -43.136  40.650  -24.725 1.00 152.19 ?  543 TYR C CD1   1 
ATOM   8351  C  CD2   . TYR C 2 164 ? -41.028  39.765  -25.401 1.00 154.23 ?  543 TYR C CD2   1 
ATOM   8352  C  CE1   . TYR C 2 164 ? -43.449  40.932  -26.052 1.00 156.09 ?  543 TYR C CE1   1 
ATOM   8353  C  CE2   . TYR C 2 164 ? -41.328  40.042  -26.729 1.00 158.21 ?  543 TYR C CE2   1 
ATOM   8354  C  CZ    . TYR C 2 164 ? -42.540  40.625  -27.053 1.00 159.23 ?  543 TYR C CZ    1 
ATOM   8355  O  OH    . TYR C 2 164 ? -42.837  40.895  -28.379 1.00 161.19 ?  543 TYR C OH    1 
ATOM   8356  N  N     . LYS C 2 165 ? -41.730  40.140  -19.949 1.00 144.47 ?  544 LYS C N     1 
ATOM   8357  C  CA    . LYS C 2 165 ? -41.623  39.533  -18.616 1.00 143.93 ?  544 LYS C CA    1 
ATOM   8358  C  C     . LYS C 2 165 ? -42.811  38.612  -18.295 1.00 147.18 ?  544 LYS C C     1 
ATOM   8359  O  O     . LYS C 2 165 ? -43.943  39.066  -18.092 1.00 146.84 ?  544 LYS C O     1 
ATOM   8360  C  CB    . LYS C 2 165 ? -41.474  40.604  -17.529 1.00 139.28 ?  544 LYS C CB    1 
ATOM   8361  N  N     . ALA C 2 177 ? -40.228  34.963  -15.355 1.00 148.70 ?  556 ALA C N     1 
ATOM   8362  C  CA    . ALA C 2 177 ? -39.198  34.796  -16.382 1.00 148.41 ?  556 ALA C CA    1 
ATOM   8363  C  C     . ALA C 2 177 ? -39.037  36.051  -17.251 1.00 145.01 ?  556 ALA C C     1 
ATOM   8364  O  O     . ALA C 2 177 ? -39.809  37.008  -17.135 1.00 143.67 ?  556 ALA C O     1 
ATOM   8365  C  CB    . ALA C 2 177 ? -39.497  33.566  -17.253 1.00 149.88 ?  556 ALA C CB    1 
ATOM   8366  N  N     . TYR C 2 178 ? -38.027  36.040  -18.116 1.00 140.20 ?  557 TYR C N     1 
ATOM   8367  C  CA    . TYR C 2 178 ? -37.783  37.148  -19.033 1.00 131.79 ?  557 TYR C CA    1 
ATOM   8368  C  C     . TYR C 2 178 ? -37.543  36.625  -20.440 1.00 134.61 ?  557 TYR C C     1 
ATOM   8369  O  O     . TYR C 2 178 ? -36.920  35.578  -20.619 1.00 135.51 ?  557 TYR C O     1 
ATOM   8370  C  CB    . TYR C 2 178 ? -36.577  37.967  -18.579 1.00 123.37 ?  557 TYR C CB    1 
ATOM   8371  C  CG    . TYR C 2 178 ? -36.817  38.750  -17.314 1.00 119.76 ?  557 TYR C CG    1 
ATOM   8372  C  CD1   . TYR C 2 178 ? -36.429  38.248  -16.072 1.00 118.49 ?  557 TYR C CD1   1 
ATOM   8373  C  CD2   . TYR C 2 178 ? -37.438  39.994  -17.359 1.00 120.43 ?  557 TYR C CD2   1 
ATOM   8374  C  CE1   . TYR C 2 178 ? -36.648  38.969  -14.908 1.00 117.32 ?  557 TYR C CE1   1 
ATOM   8375  C  CE2   . TYR C 2 178 ? -37.663  40.721  -16.205 1.00 120.14 ?  557 TYR C CE2   1 
ATOM   8376  C  CZ    . TYR C 2 178 ? -37.264  40.208  -14.982 1.00 121.30 ?  557 TYR C CZ    1 
ATOM   8377  O  OH    . TYR C 2 178 ? -37.488  40.946  -13.838 1.00 123.40 ?  557 TYR C OH    1 
ATOM   8378  N  N     . ALA C 2 179 ? -38.038  37.357  -21.434 1.00 135.45 ?  558 ALA C N     1 
ATOM   8379  C  CA    . ALA C 2 179 ? -37.873  36.969  -22.832 1.00 136.38 ?  558 ALA C CA    1 
ATOM   8380  C  C     . ALA C 2 179 ? -37.339  38.132  -23.666 1.00 136.27 ?  558 ALA C C     1 
ATOM   8381  O  O     . ALA C 2 179 ? -37.719  39.282  -23.447 1.00 132.75 ?  558 ALA C O     1 
ATOM   8382  C  CB    . ALA C 2 179 ? -39.194  36.458  -23.406 1.00 134.73 ?  558 ALA C CB    1 
ATOM   8383  N  N     . TRP C 2 180 ? -36.460  37.825  -24.618 1.00 139.78 ?  559 TRP C N     1 
ATOM   8384  C  CA    . TRP C 2 180 ? -35.882  38.841  -25.500 1.00 139.98 ?  559 TRP C CA    1 
ATOM   8385  C  C     . TRP C 2 180 ? -36.485  38.808  -26.910 1.00 144.56 ?  559 TRP C C     1 
ATOM   8386  O  O     . TRP C 2 180 ? -36.485  39.816  -27.621 1.00 142.45 ?  559 TRP C O     1 
ATOM   8387  C  CB    . TRP C 2 180 ? -34.355  38.701  -25.552 1.00 139.52 ?  559 TRP C CB    1 
ATOM   8388  C  CG    . TRP C 2 180 ? -33.677  39.301  -24.361 1.00 139.13 ?  559 TRP C CG    1 
ATOM   8389  C  CD1   . TRP C 2 180 ? -33.006  40.490  -24.312 1.00 138.94 ?  559 TRP C CD1   1 
ATOM   8390  C  CD2   . TRP C 2 180 ? -33.627  38.757  -23.036 1.00 140.30 ?  559 TRP C CD2   1 
ATOM   8391  N  NE1   . TRP C 2 180 ? -32.532  40.714  -23.042 1.00 139.15 ?  559 TRP C NE1   1 
ATOM   8392  C  CE2   . TRP C 2 180 ? -32.901  39.667  -22.239 1.00 140.24 ?  559 TRP C CE2   1 
ATOM   8393  C  CE3   . TRP C 2 180 ? -34.122  37.589  -22.447 1.00 140.77 ?  559 TRP C CE3   1 
ATOM   8394  C  CZ2   . TRP C 2 180 ? -32.658  39.444  -20.883 1.00 138.62 ?  559 TRP C CZ2   1 
ATOM   8395  C  CZ3   . TRP C 2 180 ? -33.881  37.371  -21.103 1.00 140.52 ?  559 TRP C CZ3   1 
ATOM   8396  C  CH2   . TRP C 2 180 ? -33.155  38.294  -20.335 1.00 139.21 ?  559 TRP C CH2   1 
ATOM   8397  N  N     . THR C 2 181 ? -37.001  37.644  -27.299 1.00 150.63 ?  560 THR C N     1 
ATOM   8398  C  CA    . THR C 2 181 ? -37.646  37.466  -28.598 1.00 153.25 ?  560 THR C CA    1 
ATOM   8399  C  C     . THR C 2 181 ? -39.115  37.075  -28.425 1.00 156.78 ?  560 THR C C     1 
ATOM   8400  O  O     . THR C 2 181 ? -39.484  36.447  -27.433 1.00 159.69 ?  560 THR C O     1 
ATOM   8401  C  CB    . THR C 2 181 ? -36.937  36.377  -29.433 1.00 153.94 ?  560 THR C CB    1 
ATOM   8402  N  N     . ASP C 2 182 ? -39.954  37.448  -29.386 1.00 156.29 ?  561 ASP C N     1 
ATOM   8403  C  CA    . ASP C 2 182 ? -41.345  37.016  -29.363 1.00 155.52 ?  561 ASP C CA    1 
ATOM   8404  C  C     . ASP C 2 182 ? -41.403  35.500  -29.554 1.00 159.46 ?  561 ASP C C     1 
ATOM   8405  O  O     . ASP C 2 182 ? -42.458  34.881  -29.405 1.00 160.53 ?  561 ASP C O     1 
ATOM   8406  C  CB    . ASP C 2 182 ? -42.160  37.739  -30.437 1.00 154.13 ?  561 ASP C CB    1 
ATOM   8407  N  N     . GLY C 2 183 ? -40.251  34.914  -29.877 1.00 161.87 ?  562 GLY C N     1 
ATOM   8408  C  CA    . GLY C 2 183 ? -40.120  33.475  -30.009 1.00 168.92 ?  562 GLY C CA    1 
ATOM   8409  C  C     . GLY C 2 183 ? -39.633  32.842  -28.719 1.00 170.55 ?  562 GLY C C     1 
ATOM   8410  O  O     . GLY C 2 183 ? -39.840  31.648  -28.483 1.00 174.52 ?  562 GLY C O     1 
ATOM   8411  N  N     . GLU C 2 184 ? -38.980  33.648  -27.883 1.00 166.48 ?  563 GLU C N     1 
ATOM   8412  C  CA    . GLU C 2 184 ? -38.530  33.202  -26.566 1.00 165.07 ?  563 GLU C CA    1 
ATOM   8413  C  C     . GLU C 2 184 ? -39.651  33.318  -25.523 1.00 165.66 ?  563 GLU C C     1 
ATOM   8414  O  O     . GLU C 2 184 ? -39.580  32.708  -24.454 1.00 166.42 ?  563 GLU C O     1 
ATOM   8415  C  CB    . GLU C 2 184 ? -37.285  33.983  -26.119 1.00 157.81 ?  563 GLU C CB    1 
ATOM   8416  N  N     . LEU C 2 185 ? -40.685  34.098  -25.845 1.00 164.11 ?  564 LEU C N     1 
ATOM   8417  C  CA    . LEU C 2 185 ? -41.839  34.274  -24.957 1.00 160.09 ?  564 LEU C CA    1 
ATOM   8418  C  C     . LEU C 2 185 ? -42.852  33.137  -25.112 1.00 166.82 ?  564 LEU C C     1 
ATOM   8419  O  O     . LEU C 2 185 ? -43.133  32.417  -24.155 1.00 168.45 ?  564 LEU C O     1 
ATOM   8420  C  CB    . LEU C 2 185 ? -42.520  35.633  -25.190 1.00 151.79 ?  564 LEU C CB    1 
ATOM   8421  N  N     . GLU C 2 186 ? -43.392  32.976  -26.320 1.00 171.05 ?  565 GLU C N     1 
ATOM   8422  C  CA    . GLU C 2 186 ? -44.397  31.947  -26.592 1.00 176.22 ?  565 GLU C CA    1 
ATOM   8423  C  C     . GLU C 2 186 ? -43.957  30.573  -26.084 1.00 181.39 ?  565 GLU C C     1 
ATOM   8424  O  O     . GLU C 2 186 ? -44.789  29.693  -25.845 1.00 184.66 ?  565 GLU C O     1 
ATOM   8425  C  CB    . GLU C 2 186 ? -44.722  31.889  -28.086 1.00 178.23 ?  565 GLU C CB    1 
ATOM   8426  N  N     . GLU C 2 187 ? -42.645  30.406  -25.923 1.00 181.84 ?  566 GLU C N     1 
ATOM   8427  C  CA    . GLU C 2 187 ? -42.071  29.199  -25.332 1.00 184.92 ?  566 GLU C CA    1 
ATOM   8428  C  C     . GLU C 2 187 ? -42.068  29.304  -23.806 1.00 180.38 ?  566 GLU C C     1 
ATOM   8429  O  O     . GLU C 2 187 ? -41.988  28.295  -23.099 1.00 181.01 ?  566 GLU C O     1 
ATOM   8430  C  CB    . GLU C 2 187 ? -40.649  28.969  -25.853 1.00 184.79 ?  566 GLU C CB    1 
ATOM   8431  N  N     . LEU C 2 188 ? -42.157  30.537  -23.311 1.00 175.52 ?  567 LEU C N     1 
ATOM   8432  C  CA    . LEU C 2 188 ? -42.250  30.801  -21.875 1.00 171.05 ?  567 LEU C CA    1 
ATOM   8433  C  C     . LEU C 2 188 ? -43.708  30.815  -21.407 1.00 170.46 ?  567 LEU C C     1 
ATOM   8434  O  O     . LEU C 2 188 ? -43.984  30.857  -20.205 1.00 168.23 ?  567 LEU C O     1 
ATOM   8435  C  CB    . LEU C 2 188 ? -41.566  32.126  -21.517 1.00 162.44 ?  567 LEU C CB    1 
ATOM   8436  N  N     . ARG C 2 189 ? -44.635  30.785  -22.362 1.00 171.67 ?  568 ARG C N     1 
ATOM   8437  C  CA    . ARG C 2 189 ? -46.060  30.695  -22.053 1.00 170.99 ?  568 ARG C CA    1 
ATOM   8438  C  C     . ARG C 2 189 ? -46.389  29.312  -21.480 1.00 176.50 ?  568 ARG C C     1 
ATOM   8439  O  O     . ARG C 2 189 ? -47.466  29.095  -20.914 1.00 177.70 ?  568 ARG C O     1 
ATOM   8440  C  CB    . ARG C 2 189 ? -46.899  30.983  -23.300 1.00 171.09 ?  568 ARG C CB    1 
ATOM   8441  N  N     . LYS C 2 190 ? -45.442  28.386  -21.637 1.00 177.41 ?  569 LYS C N     1 
ATOM   8442  C  CA    . LYS C 2 190 ? -45.537  27.048  -21.058 1.00 174.55 ?  569 LYS C CA    1 
ATOM   8443  C  C     . LYS C 2 190 ? -44.672  26.938  -19.794 1.00 168.41 ?  569 LYS C C     1 
ATOM   8444  O  O     . LYS C 2 190 ? -44.899  27.642  -18.801 1.00 161.29 ?  569 LYS C O     1 
ATOM   8445  C  CB    . LYS C 2 190 ? -45.120  25.989  -22.084 1.00 174.72 ?  569 LYS C CB    1 
ATOM   8446  N  N     . LEU C 2 198 ? -48.400  38.798  -19.097 1.00 127.50 ?  577 LEU C N     1 
ATOM   8447  C  CA    . LEU C 2 198 ? -47.207  39.389  -19.713 1.00 130.20 ?  577 LEU C CA    1 
ATOM   8448  C  C     . LEU C 2 198 ? -47.098  40.904  -19.487 1.00 130.26 ?  577 LEU C C     1 
ATOM   8449  O  O     . LEU C 2 198 ? -48.046  41.648  -19.747 1.00 130.29 ?  577 LEU C O     1 
ATOM   8450  C  CB    . LEU C 2 198 ? -47.163  39.086  -21.220 1.00 98.39  ?  577 LEU C CB    1 
ATOM   8451  N  N     . GLN C 2 199 ? -45.943  41.353  -18.998 1.00 131.79 ?  578 GLN C N     1 
ATOM   8452  C  CA    . GLN C 2 199 ? -45.622  42.783  -18.982 1.00 133.81 ?  578 GLN C CA    1 
ATOM   8453  C  C     . GLN C 2 199 ? -44.667  43.099  -20.142 1.00 139.53 ?  578 GLN C C     1 
ATOM   8454  O  O     . GLN C 2 199 ? -43.605  42.483  -20.264 1.00 143.45 ?  578 GLN C O     1 
ATOM   8455  C  CB    . GLN C 2 199 ? -45.007  43.203  -17.639 1.00 128.47 ?  578 GLN C CB    1 
ATOM   8456  N  N     . ARG C 2 200 ? -45.050  44.045  -20.999 1.00 137.34 ?  579 ARG C N     1 
ATOM   8457  C  CA    . ARG C 2 200 ? -44.265  44.370  -22.195 1.00 133.75 ?  579 ARG C CA    1 
ATOM   8458  C  C     . ARG C 2 200 ? -43.441  45.654  -22.027 1.00 132.79 ?  579 ARG C C     1 
ATOM   8459  O  O     . ARG C 2 200 ? -43.980  46.755  -22.133 1.00 133.87 ?  579 ARG C O     1 
ATOM   8460  C  CB    . ARG C 2 200 ? -45.189  44.489  -23.416 1.00 131.10 ?  579 ARG C CB    1 
ATOM   8461  N  N     . TYR C 2 201 ? -42.140  45.516  -21.776 1.00 130.41 ?  580 TYR C N     1 
ATOM   8462  C  CA    . TYR C 2 201 ? -41.281  46.682  -21.535 1.00 125.80 ?  580 TYR C CA    1 
ATOM   8463  C  C     . TYR C 2 201 ? -41.247  47.638  -22.727 1.00 124.61 ?  580 TYR C C     1 
ATOM   8464  O  O     . TYR C 2 201 ? -40.809  47.273  -23.821 1.00 123.94 ?  580 TYR C O     1 
ATOM   8465  C  CB    . TYR C 2 201 ? -39.857  46.266  -21.136 1.00 125.91 ?  580 TYR C CB    1 
ATOM   8466  C  CG    . TYR C 2 201 ? -39.766  45.546  -19.799 1.00 128.05 ?  580 TYR C CG    1 
ATOM   8467  C  CD1   . TYR C 2 201 ? -39.918  46.237  -18.599 1.00 127.19 ?  580 TYR C CD1   1 
ATOM   8468  C  CD2   . TYR C 2 201 ? -39.517  44.177  -19.737 1.00 130.53 ?  580 TYR C CD2   1 
ATOM   8469  C  CE1   . TYR C 2 201 ? -39.838  45.580  -17.378 1.00 127.50 ?  580 TYR C CE1   1 
ATOM   8470  C  CE2   . TYR C 2 201 ? -39.431  43.515  -18.521 1.00 130.81 ?  580 TYR C CE2   1 
ATOM   8471  C  CZ    . TYR C 2 201 ? -39.593  44.222  -17.347 1.00 129.89 ?  580 TYR C CZ    1 
ATOM   8472  O  OH    . TYR C 2 201 ? -39.511  43.567  -16.139 1.00 132.00 ?  580 TYR C OH    1 
ATOM   8473  N  N     . LYS C 2 202 ? -41.718  48.864  -22.500 1.00 122.42 ?  581 LYS C N     1 
ATOM   8474  C  CA    . LYS C 2 202 ? -41.773  49.897  -23.536 1.00 115.98 ?  581 LYS C CA    1 
ATOM   8475  C  C     . LYS C 2 202 ? -40.504  50.750  -23.521 1.00 111.72 ?  581 LYS C C     1 
ATOM   8476  O  O     . LYS C 2 202 ? -40.311  51.616  -24.384 1.00 106.73 ?  581 LYS C O     1 
ATOM   8477  C  CB    . LYS C 2 202 ? -43.004  50.797  -23.344 1.00 108.32 ?  581 LYS C CB    1 
ATOM   8478  C  CG    . LYS C 2 202 ? -44.357  50.087  -23.446 1.00 103.75 ?  581 LYS C CG    1 
ATOM   8479  C  CD    . LYS C 2 202 ? -45.286  50.448  -22.278 1.00 99.09  ?  581 LYS C CD    1 
ATOM   8480  N  N     . GLY C 2 203 ? -39.648  50.505  -22.531 1.00 109.62 ?  582 GLY C N     1 
ATOM   8481  C  CA    . GLY C 2 203 ? -38.393  51.228  -22.400 1.00 108.60 ?  582 GLY C CA    1 
ATOM   8482  C  C     . GLY C 2 203 ? -37.752  50.953  -21.058 1.00 106.22 ?  582 GLY C C     1 
ATOM   8483  O  O     . GLY C 2 203 ? -38.387  50.343  -20.204 1.00 112.20 ?  582 GLY C O     1 
ATOM   8484  N  N     . LEU C 2 204 ? -36.509  51.395  -20.864 1.00 102.31 ?  583 LEU C N     1 
ATOM   8485  C  CA    . LEU C 2 204 ? -35.799  51.148  -19.606 1.00 106.85 ?  583 LEU C CA    1 
ATOM   8486  C  C     . LEU C 2 204 ? -36.496  51.826  -18.426 1.00 117.87 ?  583 LEU C C     1 
ATOM   8487  O  O     . LEU C 2 204 ? -36.456  51.331  -17.293 1.00 118.74 ?  583 LEU C O     1 
ATOM   8488  C  CB    . LEU C 2 204 ? -34.355  51.640  -19.684 1.00 102.26 ?  583 LEU C CB    1 
ATOM   8489  C  CG    . LEU C 2 204 ? -33.451  51.156  -20.813 1.00 103.05 ?  583 LEU C CG    1 
ATOM   8490  C  CD1   . LEU C 2 204 ? -32.033  51.656  -20.582 1.00 102.45 ?  583 LEU C CD1   1 
ATOM   8491  C  CD2   . LEU C 2 204 ? -33.471  49.639  -20.937 1.00 104.16 ?  583 LEU C CD2   1 
ATOM   8492  N  N     . GLY C 2 205 ? -37.135  52.960  -18.710 1.00 124.03 ?  584 GLY C N     1 
ATOM   8493  C  CA    . GLY C 2 205 ? -37.759  53.789  -17.696 1.00 131.56 ?  584 GLY C CA    1 
ATOM   8494  C  C     . GLY C 2 205 ? -38.804  53.123  -16.818 1.00 141.16 ?  584 GLY C C     1 
ATOM   8495  O  O     . GLY C 2 205 ? -39.088  53.617  -15.726 1.00 148.49 ?  584 GLY C O     1 
ATOM   8496  N  N     . GLU C 2 206 ? -39.375  52.012  -17.282 1.00 141.02 ?  585 GLU C N     1 
ATOM   8497  C  CA    . GLU C 2 206 ? -40.409  51.304  -16.523 1.00 140.40 ?  585 GLU C CA    1 
ATOM   8498  C  C     . GLU C 2 206 ? -39.861  50.059  -15.833 1.00 139.17 ?  585 GLU C C     1 
ATOM   8499  O  O     . GLU C 2 206 ? -40.618  49.254  -15.286 1.00 141.45 ?  585 GLU C O     1 
ATOM   8500  C  CB    . GLU C 2 206 ? -41.554  50.891  -17.437 1.00 140.26 ?  585 GLU C CB    1 
ATOM   8501  C  CG    . GLU C 2 206 ? -41.822  51.855  -18.562 1.00 141.90 ?  585 GLU C CG    1 
ATOM   8502  C  CD    . GLU C 2 206 ? -42.532  51.184  -19.712 1.00 147.05 ?  585 GLU C CD    1 
ATOM   8503  O  OE1   . GLU C 2 206 ? -42.447  49.940  -19.810 1.00 148.72 ?  585 GLU C OE1   1 
ATOM   8504  O  OE2   . GLU C 2 206 ? -43.177  51.894  -20.511 1.00 149.81 ?  585 GLU C OE2   1 
ATOM   8505  N  N     . MET C 2 207 ? -38.545  49.898  -15.866 1.00 136.13 ?  586 MET C N     1 
ATOM   8506  C  CA    . MET C 2 207 ? -37.917  48.745  -15.249 1.00 138.18 ?  586 MET C CA    1 
ATOM   8507  C  C     . MET C 2 207 ? -37.362  49.145  -13.885 1.00 138.30 ?  586 MET C C     1 
ATOM   8508  O  O     . MET C 2 207 ? -36.839  50.251  -13.718 1.00 139.36 ?  586 MET C O     1 
ATOM   8509  C  CB    . MET C 2 207 ? -36.817  48.212  -16.165 1.00 140.33 ?  586 MET C CB    1 
ATOM   8510  C  CG    . MET C 2 207 ? -36.610  46.706  -16.111 1.00 143.38 ?  586 MET C CG    1 
ATOM   8511  S  SD    . MET C 2 207 ? -35.737  46.130  -17.585 1.00 155.73 ?  586 MET C SD    1 
ATOM   8512  C  CE    . MET C 2 207 ? -34.852  47.625  -18.029 1.00 119.51 ?  586 MET C CE    1 
ATOM   8513  N  N     . ASN C 2 208 ? -37.499  48.256  -12.906 1.00 137.64 ?  587 ASN C N     1 
ATOM   8514  C  CA    . ASN C 2 208 ? -37.019  48.527  -11.554 1.00 138.07 ?  587 ASN C CA    1 
ATOM   8515  C  C     . ASN C 2 208 ? -35.578  48.069  -11.360 1.00 137.98 ?  587 ASN C C     1 
ATOM   8516  O  O     . ASN C 2 208 ? -35.160  47.067  -11.937 1.00 140.85 ?  587 ASN C O     1 
ATOM   8517  C  CB    . ASN C 2 208 ? -37.935  47.879  -10.505 1.00 140.22 ?  587 ASN C CB    1 
ATOM   8518  C  CG    . ASN C 2 208 ? -39.116  48.772  -10.115 1.00 139.49 ?  587 ASN C CG    1 
ATOM   8519  O  OD1   . ASN C 2 208 ? -39.018  50.002  -10.129 1.00 139.20 ?  587 ASN C OD1   1 
ATOM   8520  N  ND2   . ASN C 2 208 ? -40.234  48.150  -9.753  1.00 138.16 ?  587 ASN C ND2   1 
ATOM   8521  N  N     . ALA C 2 209 ? -34.832  48.804  -10.538 1.00 134.25 ?  588 ALA C N     1 
ATOM   8522  C  CA    . ALA C 2 209 ? -33.401  48.563  -10.336 1.00 128.09 ?  588 ALA C CA    1 
ATOM   8523  C  C     . ALA C 2 209 ? -33.007  47.093  -10.144 1.00 127.67 ?  588 ALA C C     1 
ATOM   8524  O  O     . ALA C 2 209 ? -32.095  46.603  -10.810 1.00 126.25 ?  588 ALA C O     1 
ATOM   8525  C  CB    . ALA C 2 209 ? -32.882  49.405  -9.189  1.00 127.87 ?  588 ALA C CB    1 
ATOM   8526  N  N     . ASP C 2 210 ? -33.676  46.387  -9.239  1.00 131.15 ?  589 ASP C N     1 
ATOM   8527  C  CA    . ASP C 2 210 ? -33.345  44.979  -9.012  1.00 134.43 ?  589 ASP C CA    1 
ATOM   8528  C  C     . ASP C 2 210 ? -33.528  44.146  -10.293 1.00 132.90 ?  589 ASP C C     1 
ATOM   8529  O  O     . ASP C 2 210 ? -32.791  43.181  -10.531 1.00 132.24 ?  589 ASP C O     1 
ATOM   8530  C  CB    . ASP C 2 210 ? -34.151  44.397  -7.842  1.00 134.95 ?  589 ASP C CB    1 
ATOM   8531  N  N     . GLN C 2 211 ? -34.500  44.533  -11.119 1.00 129.40 ?  590 GLN C N     1 
ATOM   8532  C  CA    . GLN C 2 211 ? -34.766  43.848  -12.388 1.00 125.52 ?  590 GLN C CA    1 
ATOM   8533  C  C     . GLN C 2 211 ? -33.687  44.142  -13.438 1.00 118.54 ?  590 GLN C C     1 
ATOM   8534  O  O     . GLN C 2 211 ? -33.103  43.225  -14.024 1.00 120.34 ?  590 GLN C O     1 
ATOM   8535  C  CB    . GLN C 2 211 ? -36.156  44.217  -12.923 1.00 127.13 ?  590 GLN C CB    1 
ATOM   8536  C  CG    . GLN C 2 211 ? -37.297  43.869  -11.969 1.00 131.65 ?  590 GLN C CG    1 
ATOM   8537  C  CD    . GLN C 2 211 ? -38.640  44.409  -12.426 1.00 132.68 ?  590 GLN C CD    1 
ATOM   8538  O  OE1   . GLN C 2 211 ? -38.736  45.073  -13.460 1.00 136.47 ?  590 GLN C OE1   1 
ATOM   8539  N  NE2   . GLN C 2 211 ? -39.687  44.131  -11.650 1.00 129.29 ?  590 GLN C NE2   1 
ATOM   8540  N  N     . LEU C 2 212 ? -33.424  45.424  -13.664 1.00 111.66 ?  591 LEU C N     1 
ATOM   8541  C  CA    . LEU C 2 212 ? -32.363  45.851  -14.573 1.00 108.15 ?  591 LEU C CA    1 
ATOM   8542  C  C     . LEU C 2 212 ? -31.043  45.102  -14.320 1.00 110.56 ?  591 LEU C C     1 
ATOM   8543  O  O     . LEU C 2 212 ? -30.390  44.643  -15.256 1.00 108.60 ?  591 LEU C O     1 
ATOM   8544  C  CB    . LEU C 2 212 ? -32.160  47.367  -14.455 1.00 103.82 ?  591 LEU C CB    1 
ATOM   8545  C  CG    . LEU C 2 212 ? -31.641  48.127  -15.677 1.00 98.06  ?  591 LEU C CG    1 
ATOM   8546  C  CD1   . LEU C 2 212 ? -31.510  49.625  -15.388 1.00 96.32  ?  591 LEU C CD1   1 
ATOM   8547  C  CD2   . LEU C 2 212 ? -30.309  47.542  -16.104 1.00 100.01 ?  591 LEU C CD2   1 
ATOM   8548  N  N     . TRP C 2 213 ? -30.657  44.977  -13.052 1.00 114.01 ?  592 TRP C N     1 
ATOM   8549  C  CA    . TRP C 2 213 ? -29.436  44.270  -12.690 1.00 114.96 ?  592 TRP C CA    1 
ATOM   8550  C  C     . TRP C 2 213 ? -29.516  42.817  -13.111 1.00 119.82 ?  592 TRP C C     1 
ATOM   8551  O  O     . TRP C 2 213 ? -28.675  42.336  -13.870 1.00 122.09 ?  592 TRP C O     1 
ATOM   8552  C  CB    . TRP C 2 213 ? -29.208  44.358  -11.187 1.00 113.28 ?  592 TRP C CB    1 
ATOM   8553  C  CG    . TRP C 2 213 ? -28.056  43.529  -10.659 1.00 111.45 ?  592 TRP C CG    1 
ATOM   8554  C  CD1   . TRP C 2 213 ? -28.144  42.434  -9.850  1.00 111.75 ?  592 TRP C CD1   1 
ATOM   8555  C  CD2   . TRP C 2 213 ? -26.650  43.749  -10.882 1.00 108.85 ?  592 TRP C CD2   1 
ATOM   8556  N  NE1   . TRP C 2 213 ? -26.888  41.957  -9.560  1.00 111.41 ?  592 TRP C NE1   1 
ATOM   8557  C  CE2   . TRP C 2 213 ? -25.957  42.743  -10.178 1.00 108.54 ?  592 TRP C CE2   1 
ATOM   8558  C  CE3   . TRP C 2 213 ? -25.918  44.694  -11.607 1.00 108.56 ?  592 TRP C CE3   1 
ATOM   8559  C  CZ2   . TRP C 2 213 ? -24.561  42.656  -10.181 1.00 108.16 ?  592 TRP C CZ2   1 
ATOM   8560  C  CZ3   . TRP C 2 213 ? -24.531  44.605  -11.605 1.00 110.52 ?  592 TRP C CZ3   1 
ATOM   8561  C  CH2   . TRP C 2 213 ? -23.870  43.591  -10.898 1.00 108.71 ?  592 TRP C CH2   1 
ATOM   8562  N  N     . GLU C 2 214 ? -30.538  42.126  -12.616 1.00 122.29 ?  593 GLU C N     1 
ATOM   8563  C  CA    . GLU C 2 214 ? -30.730  40.706  -12.901 1.00 123.64 ?  593 GLU C CA    1 
ATOM   8564  C  C     . GLU C 2 214 ? -30.674  40.388  -14.406 1.00 120.96 ?  593 GLU C C     1 
ATOM   8565  O  O     . GLU C 2 214 ? -30.017  39.422  -14.826 1.00 121.84 ?  593 GLU C O     1 
ATOM   8566  C  CB    . GLU C 2 214 ? -32.052  40.217  -12.290 1.00 122.79 ?  593 GLU C CB    1 
ATOM   8567  N  N     . THR C 2 215 ? -31.338  41.216  -15.212 1.00 114.65 ?  594 THR C N     1 
ATOM   8568  C  CA    . THR C 2 215 ? -31.533  40.909  -16.629 1.00 112.50 ?  594 THR C CA    1 
ATOM   8569  C  C     . THR C 2 215 ? -30.473  41.429  -17.597 1.00 107.04 ?  594 THR C C     1 
ATOM   8570  O  O     . THR C 2 215 ? -30.196  40.774  -18.601 1.00 109.84 ?  594 THR C O     1 
ATOM   8571  C  CB    . THR C 2 215 ? -32.902  41.393  -17.134 1.00 117.26 ?  594 THR C CB    1 
ATOM   8572  O  OG1   . THR C 2 215 ? -32.880  42.815  -17.294 1.00 120.78 ?  594 THR C OG1   1 
ATOM   8573  C  CG2   . THR C 2 215 ? -33.998  41.008  -16.157 1.00 119.76 ?  594 THR C CG2   1 
ATOM   8574  N  N     . THR C 2 216 ? -29.891  42.595  -17.321 1.00 100.76 ?  595 THR C N     1 
ATOM   8575  C  CA    . THR C 2 216 ? -28.975  43.208  -18.290 1.00 98.28  ?  595 THR C CA    1 
ATOM   8576  C  C     . THR C 2 216 ? -27.693  43.876  -17.768 1.00 96.61  ?  595 THR C C     1 
ATOM   8577  O  O     . THR C 2 216 ? -26.856  44.299  -18.571 1.00 97.59  ?  595 THR C O     1 
ATOM   8578  C  CB    . THR C 2 216 ? -29.706  44.206  -19.214 1.00 93.92  ?  595 THR C CB    1 
ATOM   8579  O  OG1   . THR C 2 216 ? -28.972  45.434  -19.268 1.00 94.53  ?  595 THR C OG1   1 
ATOM   8580  C  CG2   . THR C 2 216 ? -31.098  44.482  -18.705 1.00 89.49  ?  595 THR C CG2   1 
ATOM   8581  N  N     . MET C 2 217 ? -27.522  43.971  -16.451 1.00 90.99  ?  596 MET C N     1 
ATOM   8582  C  CA    . MET C 2 217 ? -26.291  44.563  -15.919 1.00 91.92  ?  596 MET C CA    1 
ATOM   8583  C  C     . MET C 2 217 ? -25.374  43.566  -15.198 1.00 103.74 ?  596 MET C C     1 
ATOM   8584  O  O     . MET C 2 217 ? -24.180  43.813  -15.016 1.00 102.50 ?  596 MET C O     1 
ATOM   8585  C  CB    . MET C 2 217 ? -26.598  45.769  -15.028 1.00 88.50  ?  596 MET C CB    1 
ATOM   8586  C  CG    . MET C 2 217 ? -27.127  46.976  -15.791 1.00 86.97  ?  596 MET C CG    1 
ATOM   8587  S  SD    . MET C 2 217 ? -27.364  48.444  -14.757 1.00 108.23 ?  596 MET C SD    1 
ATOM   8588  C  CE    . MET C 2 217 ? -25.667  48.937  -14.451 1.00 78.54  ?  596 MET C CE    1 
ATOM   8589  N  N     . ASN C 2 218 ? -25.935  42.432  -14.800 1.00 113.04 ?  597 ASN C N     1 
ATOM   8590  C  CA    . ASN C 2 218 ? -25.174  41.414  -14.091 1.00 115.81 ?  597 ASN C CA    1 
ATOM   8591  C  C     . ASN C 2 218 ? -24.217  40.660  -15.017 1.00 116.50 ?  597 ASN C C     1 
ATOM   8592  O  O     . ASN C 2 218 ? -24.650  39.886  -15.880 1.00 117.08 ?  597 ASN C O     1 
ATOM   8593  C  CB    . ASN C 2 218 ? -26.132  40.437  -13.412 1.00 119.31 ?  597 ASN C CB    1 
ATOM   8594  C  CG    . ASN C 2 218 ? -25.481  39.676  -12.283 1.00 120.07 ?  597 ASN C CG    1 
ATOM   8595  O  OD1   . ASN C 2 218 ? -24.284  39.368  -12.324 1.00 119.97 ?  597 ASN C OD1   1 
ATOM   8596  N  ND2   . ASN C 2 218 ? -26.268  39.367  -11.257 1.00 121.40 ?  597 ASN C ND2   1 
ATOM   8597  N  N     . PRO C 2 219 ? -22.906  40.882  -14.837 1.00 117.11 ?  598 PRO C N     1 
ATOM   8598  C  CA    . PRO C 2 219 ? -21.859  40.274  -15.672 1.00 118.53 ?  598 PRO C CA    1 
ATOM   8599  C  C     . PRO C 2 219 ? -21.940  38.757  -15.699 1.00 123.11 ?  598 PRO C C     1 
ATOM   8600  O  O     . PRO C 2 219 ? -21.067  38.123  -16.280 1.00 128.03 ?  598 PRO C O     1 
ATOM   8601  C  CB    . PRO C 2 219 ? -20.564  40.699  -14.977 1.00 119.37 ?  598 PRO C CB    1 
ATOM   8602  C  CG    . PRO C 2 219 ? -20.918  41.945  -14.249 1.00 119.50 ?  598 PRO C CG    1 
ATOM   8603  C  CD    . PRO C 2 219 ? -22.349  41.782  -13.815 1.00 117.62 ?  598 PRO C CD    1 
ATOM   8604  N  N     . GLU C 2 220 ? -22.965  38.191  -15.066 1.00 124.23 ?  599 GLU C N     1 
ATOM   8605  C  CA    . GLU C 2 220 ? -23.132  36.741  -14.993 1.00 125.41 ?  599 GLU C CA    1 
ATOM   8606  C  C     . GLU C 2 220 ? -24.556  36.323  -15.390 1.00 127.67 ?  599 GLU C C     1 
ATOM   8607  O  O     . GLU C 2 220 ? -24.891  35.137  -15.402 1.00 133.99 ?  599 GLU C O     1 
ATOM   8608  C  CB    . GLU C 2 220 ? -22.788  36.233  -13.586 1.00 122.70 ?  599 GLU C CB    1 
ATOM   8609  N  N     . THR C 2 221 ? -25.387  37.304  -15.727 1.00 118.90 ?  600 THR C N     1 
ATOM   8610  C  CA    . THR C 2 221 ? -26.775  37.035  -16.068 1.00 111.63 ?  600 THR C CA    1 
ATOM   8611  C  C     . THR C 2 221 ? -27.182  37.822  -17.311 1.00 119.63 ?  600 THR C C     1 
ATOM   8612  O  O     . THR C 2 221 ? -28.308  37.700  -17.791 1.00 124.49 ?  600 THR C O     1 
ATOM   8613  C  CB    . THR C 2 221 ? -27.714  37.387  -14.890 1.00 101.55 ?  600 THR C CB    1 
ATOM   8614  N  N     . ARG C 2 222 ? -26.255  38.618  -17.838 1.00 120.49 ?  601 ARG C N     1 
ATOM   8615  C  CA    . ARG C 2 222 ? -26.567  39.550  -18.924 1.00 114.36 ?  601 ARG C CA    1 
ATOM   8616  C  C     . ARG C 2 222 ? -26.180  39.018  -20.296 1.00 116.88 ?  601 ARG C C     1 
ATOM   8617  O  O     . ARG C 2 222 ? -25.121  38.398  -20.462 1.00 114.93 ?  601 ARG C O     1 
ATOM   8618  C  CB    . ARG C 2 222 ? -25.880  40.906  -18.693 1.00 109.85 ?  601 ARG C CB    1 
ATOM   8619  C  CG    . ARG C 2 222 ? -24.374  40.869  -18.896 1.00 112.22 ?  601 ARG C CG    1 
ATOM   8620  C  CD    . ARG C 2 222 ? -23.674  42.155  -18.462 1.00 113.36 ?  601 ARG C CD    1 
ATOM   8621  N  NE    . ARG C 2 222 ? -22.233  42.061  -18.712 1.00 120.35 ?  601 ARG C NE    1 
ATOM   8622  C  CZ    . ARG C 2 222 ? -21.321  42.926  -18.272 1.00 120.63 ?  601 ARG C CZ    1 
ATOM   8623  N  NH1   . ARG C 2 222 ? -21.686  43.975  -17.544 1.00 116.93 ?  601 ARG C NH1   1 
ATOM   8624  N  NH2   . ARG C 2 222 ? -20.037  42.737  -18.560 1.00 121.59 ?  601 ARG C NH2   1 
ATOM   8625  N  N     . THR C 2 223 ? -27.058  39.260  -21.270 1.00 124.31 ?  602 THR C N     1 
ATOM   8626  C  CA    . THR C 2 223 ? -26.739  39.070  -22.685 1.00 125.78 ?  602 THR C CA    1 
ATOM   8627  C  C     . THR C 2 223 ? -26.039  40.344  -23.148 1.00 123.94 ?  602 THR C C     1 
ATOM   8628  O  O     . THR C 2 223 ? -26.472  41.449  -22.815 1.00 127.34 ?  602 THR C O     1 
ATOM   8629  C  CB    . THR C 2 223 ? -28.009  38.825  -23.536 1.00 120.92 ?  602 THR C CB    1 
ATOM   8630  N  N     . LEU C 2 224 ? -24.955  40.201  -23.901 1.00 118.92 ?  603 LEU C N     1 
ATOM   8631  C  CA    . LEU C 2 224 ? -24.092  41.345  -24.186 1.00 120.13 ?  603 LEU C CA    1 
ATOM   8632  C  C     . LEU C 2 224 ? -23.474  41.256  -25.591 1.00 121.53 ?  603 LEU C C     1 
ATOM   8633  O  O     . LEU C 2 224 ? -22.666  40.370  -25.857 1.00 127.88 ?  603 LEU C O     1 
ATOM   8634  C  CB    . LEU C 2 224 ? -22.990  41.412  -23.117 1.00 123.62 ?  603 LEU C CB    1 
ATOM   8635  C  CG    . LEU C 2 224 ? -22.497  42.746  -22.554 1.00 120.39 ?  603 LEU C CG    1 
ATOM   8636  C  CD1   . LEU C 2 224 ? -21.780  43.550  -23.624 1.00 118.97 ?  603 LEU C CD1   1 
ATOM   8637  C  CD2   . LEU C 2 224 ? -23.660  43.530  -21.976 1.00 119.42 ?  603 LEU C CD2   1 
ATOM   8638  N  N     . ILE C 2 225 ? -23.852  42.169  -26.485 1.00 116.87 ?  604 ILE C N     1 
ATOM   8639  C  CA    . ILE C 2 225 ? -23.343  42.160  -27.864 1.00 119.57 ?  604 ILE C CA    1 
ATOM   8640  C  C     . ILE C 2 225 ? -21.990  42.846  -27.999 1.00 123.38 ?  604 ILE C C     1 
ATOM   8641  O  O     . ILE C 2 225 ? -21.805  43.969  -27.533 1.00 125.41 ?  604 ILE C O     1 
ATOM   8642  C  CB    . ILE C 2 225 ? -24.305  42.871  -28.841 1.00 119.74 ?  604 ILE C CB    1 
ATOM   8643  C  CG1   . ILE C 2 225 ? -25.510  41.985  -29.164 1.00 117.23 ?  604 ILE C CG1   1 
ATOM   8644  C  CG2   . ILE C 2 225 ? -23.571  43.257  -30.123 1.00 120.00 ?  604 ILE C CG2   1 
ATOM   8645  C  CD1   . ILE C 2 225 ? -26.589  42.694  -29.963 1.00 108.75 ?  604 ILE C CD1   1 
ATOM   8646  N  N     . ARG C 2 226 ? -21.051  42.179  -28.658 1.00 124.11 ?  605 ARG C N     1 
ATOM   8647  C  CA    . ARG C 2 226 ? -19.737  42.763  -28.885 1.00 121.59 ?  605 ARG C CA    1 
ATOM   8648  C  C     . ARG C 2 226 ? -19.622  43.288  -30.316 1.00 123.55 ?  605 ARG C C     1 
ATOM   8649  O  O     . ARG C 2 226 ? -19.952  42.588  -31.276 1.00 122.51 ?  605 ARG C O     1 
ATOM   8650  C  CB    . ARG C 2 226 ? -18.631  41.750  -28.595 1.00 118.69 ?  605 ARG C CB    1 
ATOM   8651  C  CG    . ARG C 2 226 ? -17.374  42.388  -28.042 1.00 120.68 ?  605 ARG C CG    1 
ATOM   8652  C  CD    . ARG C 2 226 ? -16.132  41.811  -28.682 1.00 125.77 ?  605 ARG C CD    1 
ATOM   8653  N  NE    . ARG C 2 226 ? -15.120  41.467  -27.688 1.00 130.52 ?  605 ARG C NE    1 
ATOM   8654  C  CZ    . ARG C 2 226 ? -15.063  40.299  -27.052 1.00 133.47 ?  605 ARG C CZ    1 
ATOM   8655  N  NH1   . ARG C 2 226 ? -15.963  39.356  -27.290 1.00 134.22 ?  605 ARG C NH1   1 
ATOM   8656  N  NH2   . ARG C 2 226 ? -14.101  40.072  -26.173 1.00 135.76 ?  605 ARG C NH2   1 
ATOM   8657  N  N     . VAL C 2 227 ? -19.171  44.532  -30.452 1.00 124.70 ?  606 VAL C N     1 
ATOM   8658  C  CA    . VAL C 2 227 ? -19.023  45.140  -31.766 1.00 121.31 ?  606 VAL C CA    1 
ATOM   8659  C  C     . VAL C 2 227 ? -17.652  44.792  -32.295 1.00 122.09 ?  606 VAL C C     1 
ATOM   8660  O  O     . VAL C 2 227 ? -16.653  44.924  -31.582 1.00 119.98 ?  606 VAL C O     1 
ATOM   8661  C  CB    . VAL C 2 227 ? -19.179  46.678  -31.725 1.00 119.27 ?  606 VAL C CB    1 
ATOM   8662  C  CG1   . VAL C 2 227 ? -19.096  47.266  -33.135 1.00 116.87 ?  606 VAL C CG1   1 
ATOM   8663  C  CG2   . VAL C 2 227 ? -20.496  47.071  -31.052 1.00 115.87 ?  606 VAL C CG2   1 
ATOM   8664  N  N     . THR C 2 228 ? -17.622  44.328  -33.542 1.00 125.75 ?  607 THR C N     1 
ATOM   8665  C  CA    . THR C 2 228 ? -16.381  43.967  -34.221 1.00 128.51 ?  607 THR C CA    1 
ATOM   8666  C  C     . THR C 2 228 ? -16.377  44.567  -35.622 1.00 121.65 ?  607 THR C C     1 
ATOM   8667  O  O     . THR C 2 228 ? -17.437  44.782  -36.209 1.00 120.02 ?  607 THR C O     1 
ATOM   8668  C  CB    . THR C 2 228 ? -16.233  42.431  -34.353 1.00 133.46 ?  607 THR C CB    1 
ATOM   8669  O  OG1   . THR C 2 228 ? -17.231  41.921  -35.253 1.00 134.97 ?  607 THR C OG1   1 
ATOM   8670  C  CG2   . THR C 2 228 ? -16.365  41.750  -32.989 1.00 131.75 ?  607 THR C CG2   1 
ATOM   8671  N  N     . ILE C 2 229 ? -15.192  44.850  -36.151 1.00 116.57 ?  608 ILE C N     1 
ATOM   8672  C  CA    . ILE C 2 229 ? -15.068  45.207  -37.559 1.00 115.40 ?  608 ILE C CA    1 
ATOM   8673  C  C     . ILE C 2 229 ? -14.598  43.989  -38.376 1.00 121.84 ?  608 ILE C C     1 
ATOM   8674  O  O     . ILE C 2 229 ? -13.425  43.613  -38.326 1.00 123.11 ?  608 ILE C O     1 
ATOM   8675  C  CB    . ILE C 2 229 ? -14.124  46.417  -37.770 1.00 110.05 ?  608 ILE C CB    1 
ATOM   8676  N  N     . GLU C 2 230 ? -15.524  43.368  -39.110 1.00 126.85 ?  609 GLU C N     1 
ATOM   8677  C  CA    . GLU C 2 230 ? -15.208  42.195  -39.941 1.00 130.21 ?  609 GLU C CA    1 
ATOM   8678  C  C     . GLU C 2 230 ? -14.426  42.559  -41.214 1.00 129.50 ?  609 GLU C C     1 
ATOM   8679  O  O     . GLU C 2 230 ? -13.315  42.060  -41.432 1.00 131.01 ?  609 GLU C O     1 
ATOM   8680  C  CB    . GLU C 2 230 ? -16.479  41.408  -40.299 1.00 127.88 ?  609 GLU C CB    1 
ATOM   8681  N  N     . ASP C 2 231 ? -15.012  43.422  -42.046 1.00 166.27 ?  610 ASP C N     1 
ATOM   8682  C  CA    . ASP C 2 231 ? -14.366  43.908  -43.271 1.00 163.10 ?  610 ASP C CA    1 
ATOM   8683  C  C     . ASP C 2 231 ? -14.213  45.433  -43.252 1.00 152.87 ?  610 ASP C C     1 
ATOM   8684  O  O     . ASP C 2 231 ? -15.079  46.157  -43.745 1.00 145.04 ?  610 ASP C O     1 
ATOM   8685  C  CB    . ASP C 2 231 ? -15.158  43.476  -44.515 1.00 164.30 ?  610 ASP C CB    1 
ATOM   8686  C  CG    . ASP C 2 231 ? -14.392  43.715  -45.814 1.00 171.52 ?  610 ASP C CG    1 
ATOM   8687  O  OD1   . ASP C 2 231 ? -13.698  44.749  -45.929 1.00 173.76 ?  610 ASP C OD1   1 
ATOM   8688  O  OD2   . ASP C 2 231 ? -14.475  42.862  -46.722 1.00 174.88 ?  610 ASP C OD2   1 
ATOM   8689  N  N     . LEU C 2 232 ? -13.100  45.908  -42.697 1.00 153.99 ?  611 LEU C N     1 
ATOM   8690  C  CA    . LEU C 2 232 ? -12.874  47.339  -42.482 1.00 150.34 ?  611 LEU C CA    1 
ATOM   8691  C  C     . LEU C 2 232 ? -13.447  48.250  -43.574 1.00 145.35 ?  611 LEU C C     1 
ATOM   8692  O  O     . LEU C 2 232 ? -14.165  49.206  -43.276 1.00 138.45 ?  611 LEU C O     1 
ATOM   8693  C  CB    . LEU C 2 232 ? -11.379  47.626  -42.278 1.00 154.47 ?  611 LEU C CB    1 
ATOM   8694  C  CG    . LEU C 2 232 ? -11.019  49.061  -41.881 1.00 151.98 ?  611 LEU C CG    1 
ATOM   8695  C  CD1   . LEU C 2 232 ? -11.219  50.033  -43.047 1.00 147.45 ?  611 LEU C CD1   1 
ATOM   8696  C  CD2   . LEU C 2 232 ? -11.854  49.482  -40.683 1.00 148.90 ?  611 LEU C CD2   1 
ATOM   8697  N  N     . ALA C 2 233 ? -13.129  47.955  -44.832 1.00 149.00 ?  612 ALA C N     1 
ATOM   8698  C  CA    . ALA C 2 233 ? -13.555  48.803  -45.948 1.00 144.10 ?  612 ALA C CA    1 
ATOM   8699  C  C     . ALA C 2 233 ? -15.052  48.689  -46.303 1.00 142.29 ?  612 ALA C C     1 
ATOM   8700  O  O     . ALA C 2 233 ? -15.619  49.609  -46.898 1.00 139.13 ?  612 ALA C O     1 
ATOM   8701  C  CB    . ALA C 2 233 ? -12.676  48.559  -47.174 1.00 141.85 ?  612 ALA C CB    1 
ATOM   8702  N  N     . ARG C 2 234 ? -15.687  47.573  -45.944 1.00 144.04 ?  613 ARG C N     1 
ATOM   8703  C  CA    . ARG C 2 234 ? -17.131  47.420  -46.142 1.00 120.70 ?  613 ARG C CA    1 
ATOM   8704  C  C     . ARG C 2 234 ? -17.884  48.133  -45.017 1.00 133.18 ?  613 ARG C C     1 
ATOM   8705  O  O     . ARG C 2 234 ? -19.093  48.381  -45.116 1.00 125.78 ?  613 ARG C O     1 
ATOM   8706  C  CB    . ARG C 2 234 ? -17.538  45.940  -46.227 1.00 122.70 ?  613 ARG C CB    1 
ATOM   8707  N  N     . ALA C 2 235 ? -17.152  48.472  -43.952 1.00 137.93 ?  614 ALA C N     1 
ATOM   8708  C  CA    . ALA C 2 235 ? -17.718  49.186  -42.803 1.00 134.24 ?  614 ALA C CA    1 
ATOM   8709  C  C     . ALA C 2 235 ? -17.588  50.703  -42.948 1.00 133.40 ?  614 ALA C C     1 
ATOM   8710  O  O     . ALA C 2 235 ? -18.309  51.449  -42.293 1.00 130.23 ?  614 ALA C O     1 
ATOM   8711  C  CB    . ALA C 2 235 ? -17.085  48.711  -41.486 1.00 132.83 ?  614 ALA C CB    1 
ATOM   8712  N  N     . GLU C 2 236 ? -16.674  51.160  -43.801 1.00 135.39 ?  615 GLU C N     1 
ATOM   8713  C  CA    . GLU C 2 236 ? -16.570  52.590  -44.107 1.00 133.82 ?  615 GLU C CA    1 
ATOM   8714  C  C     . GLU C 2 236 ? -17.699  53.031  -45.048 1.00 132.45 ?  615 GLU C C     1 
ATOM   8715  O  O     . GLU C 2 236 ? -18.253  54.128  -44.903 1.00 127.68 ?  615 GLU C O     1 
ATOM   8716  C  CB    . GLU C 2 236 ? -15.195  52.922  -44.706 1.00 135.44 ?  615 GLU C CB    1 
ATOM   8717  C  CG    . GLU C 2 236 ? -15.046  54.347  -45.261 1.00 132.43 ?  615 GLU C CG    1 
ATOM   8718  C  CD    . GLU C 2 236 ? -14.913  55.416  -44.183 1.00 131.36 ?  615 GLU C CD    1 
ATOM   8719  O  OE1   . GLU C 2 236 ? -14.482  55.097  -43.054 1.00 135.02 ?  615 GLU C OE1   1 
ATOM   8720  O  OE2   . GLU C 2 236 ? -15.241  56.584  -44.472 1.00 129.36 ?  615 GLU C OE2   1 
ATOM   8721  N  N     . ARG C 2 237 ? -18.035  52.174  -46.012 1.00 134.74 ?  616 ARG C N     1 
ATOM   8722  C  CA    . ARG C 2 237 ? -19.128  52.467  -46.933 1.00 132.52 ?  616 ARG C CA    1 
ATOM   8723  C  C     . ARG C 2 237 ? -20.437  52.423  -46.157 1.00 132.91 ?  616 ARG C C     1 
ATOM   8724  O  O     . ARG C 2 237 ? -21.153  53.425  -46.075 1.00 132.39 ?  616 ARG C O     1 
ATOM   8725  C  CB    . ARG C 2 237 ? -19.150  51.495  -48.125 1.00 130.18 ?  616 ARG C CB    1 
ATOM   8726  N  N     . ARG C 2 238 ? -20.732  51.264  -45.572 1.00 132.75 ?  617 ARG C N     1 
ATOM   8727  C  CA    . ARG C 2 238 ? -21.936  51.090  -44.757 1.00 126.80 ?  617 ARG C CA    1 
ATOM   8728  C  C     . ARG C 2 238 ? -22.207  52.291  -43.837 1.00 118.09 ?  617 ARG C C     1 
ATOM   8729  O  O     . ARG C 2 238 ? -23.317  52.823  -43.825 1.00 114.66 ?  617 ARG C O     1 
ATOM   8730  C  CB    . ARG C 2 238 ? -21.851  49.787  -43.948 1.00 127.35 ?  617 ARG C CB    1 
ATOM   8731  C  CG    . ARG C 2 238 ? -22.906  49.621  -42.852 1.00 121.49 ?  617 ARG C CG    1 
ATOM   8732  C  CD    . ARG C 2 238 ? -24.317  49.644  -43.404 1.00 99.07  ?  617 ARG C CD    1 
ATOM   8733  N  NE    . ARG C 2 238 ? -24.427  48.964  -44.691 1.00 135.97 ?  617 ARG C NE    1 
ATOM   8734  C  CZ    . ARG C 2 238 ? -24.821  47.703  -44.857 1.00 137.90 ?  617 ARG C CZ    1 
ATOM   8735  N  NH1   . ARG C 2 238 ? -25.145  46.952  -43.804 1.00 102.60 ?  617 ARG C NH1   1 
ATOM   8736  N  NH2   . ARG C 2 238 ? -24.889  47.196  -46.088 1.00 103.32 ?  617 ARG C NH2   1 
ATOM   8737  N  N     . VAL C 2 239 ? -21.192  52.718  -43.084 1.00 114.45 ?  618 VAL C N     1 
ATOM   8738  C  CA    . VAL C 2 239 ? -21.317  53.874  -42.195 1.00 111.66 ?  618 VAL C CA    1 
ATOM   8739  C  C     . VAL C 2 239 ? -21.512  55.202  -42.943 1.00 112.88 ?  618 VAL C C     1 
ATOM   8740  O  O     . VAL C 2 239 ? -22.426  55.966  -42.623 1.00 107.42 ?  618 VAL C O     1 
ATOM   8741  C  CB    . VAL C 2 239 ? -20.111  54.008  -41.215 1.00 102.17 ?  618 VAL C CB    1 
ATOM   8742  C  CG1   . VAL C 2 239 ? -20.200  55.312  -40.438 1.00 100.62 ?  618 VAL C CG1   1 
ATOM   8743  C  CG2   . VAL C 2 239 ? -20.052  52.831  -40.241 1.00 104.27 ?  618 VAL C CG2   1 
ATOM   8744  N  N     . ASN C 2 240 ? -20.660  55.482  -43.928 1.00 119.12 ?  619 ASN C N     1 
ATOM   8745  C  CA    . ASN C 2 240 ? -20.728  56.765  -44.631 1.00 114.83 ?  619 ASN C CA    1 
ATOM   8746  C  C     . ASN C 2 240 ? -22.043  56.982  -45.395 1.00 114.79 ?  619 ASN C C     1 
ATOM   8747  O  O     . ASN C 2 240 ? -22.415  58.122  -45.674 1.00 117.29 ?  619 ASN C O     1 
ATOM   8748  C  CB    . ASN C 2 240 ? -19.500  56.987  -45.532 1.00 105.95 ?  619 ASN C CB    1 
ATOM   8749  N  N     . VAL C 2 241 ? -22.758  55.899  -45.710 1.00 110.15 ?  620 VAL C N     1 
ATOM   8750  C  CA    . VAL C 2 241 ? -24.006  56.009  -46.477 1.00 106.14 ?  620 VAL C CA    1 
ATOM   8751  C  C     . VAL C 2 241 ? -25.210  56.275  -45.579 1.00 109.96 ?  620 VAL C C     1 
ATOM   8752  O  O     . VAL C 2 241 ? -26.063  57.110  -45.888 1.00 111.86 ?  620 VAL C O     1 
ATOM   8753  C  CB    . VAL C 2 241 ? -24.286  54.753  -47.334 1.00 103.04 ?  620 VAL C CB    1 
ATOM   8754  C  CG1   . VAL C 2 241 ? -25.464  55.003  -48.284 1.00 93.25  ?  620 VAL C CG1   1 
ATOM   8755  C  CG2   . VAL C 2 241 ? -23.045  54.364  -48.123 1.00 108.50 ?  620 VAL C CG2   1 
ATOM   8756  N  N     . LEU C 2 242 ? -25.275  55.558  -44.465 1.00 111.01 ?  621 LEU C N     1 
ATOM   8757  C  CA    . LEU C 2 242 ? -26.345  55.755  -43.496 1.00 106.25 ?  621 LEU C CA    1 
ATOM   8758  C  C     . LEU C 2 242 ? -26.206  57.085  -42.762 1.00 105.49 ?  621 LEU C C     1 
ATOM   8759  O  O     . LEU C 2 242 ? -27.203  57.745  -42.478 1.00 107.00 ?  621 LEU C O     1 
ATOM   8760  C  CB    . LEU C 2 242 ? -26.358  54.617  -42.475 1.00 107.53 ?  621 LEU C CB    1 
ATOM   8761  C  CG    . LEU C 2 242 ? -26.366  53.182  -43.002 1.00 112.20 ?  621 LEU C CG    1 
ATOM   8762  C  CD1   . LEU C 2 242 ? -26.329  52.201  -41.835 1.00 115.63 ?  621 LEU C CD1   1 
ATOM   8763  C  CD2   . LEU C 2 242 ? -27.569  52.923  -43.895 1.00 112.51 ?  621 LEU C CD2   1 
ATOM   8764  N  N     . MET C 2 243 ? -24.975  57.481  -42.451 1.00 105.68 ?  622 MET C N     1 
ATOM   8765  C  CA    . MET C 2 243 ? -24.760  58.630  -41.569 1.00 106.16 ?  622 MET C CA    1 
ATOM   8766  C  C     . MET C 2 243 ? -24.128  59.863  -42.239 1.00 110.84 ?  622 MET C C     1 
ATOM   8767  O  O     . MET C 2 243 ? -23.979  60.911  -41.596 1.00 111.95 ?  622 MET C O     1 
ATOM   8768  C  CB    . MET C 2 243 ? -23.930  58.213  -40.349 1.00 103.07 ?  622 MET C CB    1 
ATOM   8769  C  CG    . MET C 2 243 ? -24.249  56.818  -39.815 1.00 101.26 ?  622 MET C CG    1 
ATOM   8770  S  SD    . MET C 2 243 ? -25.910  56.592  -39.113 1.00 110.19 ?  622 MET C SD    1 
ATOM   8771  C  CE    . MET C 2 243 ? -25.902  57.763  -37.771 1.00 86.51  ?  622 MET C CE    1 
ATOM   8772  N  N     . GLY C 2 244 ? -23.774  59.738  -43.520 1.00 111.19 ?  623 GLY C N     1 
ATOM   8773  C  CA    . GLY C 2 244 ? -23.090  60.796  -44.250 1.00 113.83 ?  623 GLY C CA    1 
ATOM   8774  C  C     . GLY C 2 244 ? -23.900  62.051  -44.536 1.00 115.52 ?  623 GLY C C     1 
ATOM   8775  O  O     . GLY C 2 244 ? -25.079  62.131  -44.202 1.00 117.52 ?  623 GLY C O     1 
ATOM   8776  N  N     . ASP C 2 245 ? -23.262  63.037  -45.161 1.00 114.80 ?  624 ASP C N     1 
ATOM   8777  C  CA    . ASP C 2 245 ? -23.919  64.304  -45.463 1.00 109.87 ?  624 ASP C CA    1 
ATOM   8778  C  C     . ASP C 2 245 ? -24.796  64.181  -46.705 1.00 103.25 ?  624 ASP C C     1 
ATOM   8779  O  O     . ASP C 2 245 ? -25.737  64.959  -46.880 1.00 91.87  ?  624 ASP C O     1 
ATOM   8780  C  CB    . ASP C 2 245 ? -22.889  65.431  -45.650 1.00 111.90 ?  624 ASP C CB    1 
ATOM   8781  C  CG    . ASP C 2 245 ? -22.111  65.312  -46.961 1.00 110.82 ?  624 ASP C CG    1 
ATOM   8782  N  N     . LYS C 2 246 ? -24.489  63.199  -47.557 1.00 109.63 ?  625 LYS C N     1 
ATOM   8783  C  CA    . LYS C 2 246 ? -25.201  63.022  -48.832 1.00 114.54 ?  625 LYS C CA    1 
ATOM   8784  C  C     . LYS C 2 246 ? -26.505  62.209  -48.709 1.00 112.67 ?  625 LYS C C     1 
ATOM   8785  O  O     . LYS C 2 246 ? -26.480  61.022  -48.366 1.00 112.57 ?  625 LYS C O     1 
ATOM   8786  C  CB    . LYS C 2 246 ? -24.276  62.412  -49.910 1.00 112.69 ?  625 LYS C CB    1 
ATOM   8787  N  N     . VAL C 2 247 ? -27.635  62.852  -49.014 1.00 107.52 ?  626 VAL C N     1 
ATOM   8788  C  CA    . VAL C 2 247 ? -28.950  62.212  -48.891 1.00 102.81 ?  626 VAL C CA    1 
ATOM   8789  C  C     . VAL C 2 247 ? -29.278  61.120  -49.920 1.00 103.62 ?  626 VAL C C     1 
ATOM   8790  O  O     . VAL C 2 247 ? -29.789  60.065  -49.556 1.00 99.33  ?  626 VAL C O     1 
ATOM   8791  C  CB    . VAL C 2 247 ? -30.097  63.233  -48.971 1.00 104.39 ?  626 VAL C CB    1 
ATOM   8792  C  CG1   . VAL C 2 247 ? -31.331  62.678  -48.267 1.00 96.67  ?  626 VAL C CG1   1 
ATOM   8793  C  CG2   . VAL C 2 247 ? -29.674  64.578  -48.389 1.00 110.51 ?  626 VAL C CG2   1 
ATOM   8794  N  N     . GLU C 2 248 ? -29.013  61.377  -51.200 1.00 109.19 ?  627 GLU C N     1 
ATOM   8795  C  CA    . GLU C 2 248 ? -29.526  60.495  -52.256 1.00 106.73 ?  627 GLU C CA    1 
ATOM   8796  C  C     . GLU C 2 248 ? -29.100  59.011  -52.118 1.00 103.74 ?  627 GLU C C     1 
ATOM   8797  O  O     . GLU C 2 248 ? -29.930  58.111  -52.270 1.00 101.97 ?  627 GLU C O     1 
ATOM   8798  C  CB    . GLU C 2 248 ? -29.267  61.077  -53.663 1.00 101.34 ?  627 GLU C CB    1 
ATOM   8799  N  N     . PRO C 2 249 ? -27.821  58.754  -51.794 1.00 102.87 ?  628 PRO C N     1 
ATOM   8800  C  CA    . PRO C 2 249 ? -27.320  57.377  -51.617 1.00 102.28 ?  628 PRO C CA    1 
ATOM   8801  C  C     . PRO C 2 249 ? -28.062  56.625  -50.507 1.00 102.09 ?  628 PRO C C     1 
ATOM   8802  O  O     . PRO C 2 249 ? -28.338  55.429  -50.616 1.00 101.22 ?  628 PRO C O     1 
ATOM   8803  C  CB    . PRO C 2 249 ? -25.861  57.580  -51.192 1.00 100.68 ?  628 PRO C CB    1 
ATOM   8804  C  CG    . PRO C 2 249 ? -25.522  58.983  -51.584 1.00 101.61 ?  628 PRO C CG    1 
ATOM   8805  C  CD    . PRO C 2 249 ? -26.792  59.766  -51.503 1.00 100.04 ?  628 PRO C CD    1 
ATOM   8806  N  N     . ARG C 2 250 ? -28.367  57.347  -49.433 1.00 102.59 ?  629 ARG C N     1 
ATOM   8807  C  CA    . ARG C 2 250 ? -29.127  56.814  -48.313 1.00 98.82  ?  629 ARG C CA    1 
ATOM   8808  C  C     . ARG C 2 250 ? -30.526  56.383  -48.727 1.00 99.25  ?  629 ARG C C     1 
ATOM   8809  O  O     . ARG C 2 250 ? -30.973  55.300  -48.367 1.00 99.84  ?  629 ARG C O     1 
ATOM   8810  C  CB    . ARG C 2 250 ? -29.218  57.864  -47.214 1.00 93.48  ?  629 ARG C CB    1 
ATOM   8811  C  CG    . ARG C 2 250 ? -30.099  57.491  -46.036 1.00 87.88  ?  629 ARG C CG    1 
ATOM   8812  C  CD    . ARG C 2 250 ? -29.961  58.545  -44.965 1.00 86.18  ?  629 ARG C CD    1 
ATOM   8813  N  NE    . ARG C 2 250 ? -28.566  58.968  -44.871 1.00 91.82  ?  629 ARG C NE    1 
ATOM   8814  C  CZ    . ARG C 2 250 ? -28.150  60.235  -44.873 1.00 90.65  ?  629 ARG C CZ    1 
ATOM   8815  N  NH1   . ARG C 2 250 ? -29.020  61.238  -44.958 1.00 90.48  ?  629 ARG C NH1   1 
ATOM   8816  N  NH2   . ARG C 2 250 ? -26.854  60.503  -44.782 1.00 86.92  ?  629 ARG C NH2   1 
ATOM   8817  N  N     . ARG C 2 251 ? -31.218  57.237  -49.479 1.00 100.80 ?  630 ARG C N     1 
ATOM   8818  C  CA    . ARG C 2 251 ? -32.562  56.921  -49.952 1.00 103.68 ?  630 ARG C CA    1 
ATOM   8819  C  C     . ARG C 2 251 ? -32.547  55.590  -50.686 1.00 109.49 ?  630 ARG C C     1 
ATOM   8820  O  O     . ARG C 2 251 ? -33.346  54.700  -50.379 1.00 109.52 ?  630 ARG C O     1 
ATOM   8821  C  CB    . ARG C 2 251 ? -33.089  58.019  -50.870 1.00 89.65  ?  630 ARG C CB    1 
ATOM   8822  C  CG    . ARG C 2 251 ? -34.539  57.822  -51.302 1.00 122.06 ?  630 ARG C CG    1 
ATOM   8823  C  CD    . ARG C 2 251 ? -34.963  58.812  -52.404 1.00 128.28 ?  630 ARG C CD    1 
ATOM   8824  N  NE    . ARG C 2 251 ? -35.041  60.203  -51.943 1.00 130.23 ?  630 ARG C NE    1 
ATOM   8825  C  CZ    . ARG C 2 251 ? -34.322  61.210  -52.443 1.00 132.02 ?  630 ARG C CZ    1 
ATOM   8826  N  NH1   . ARG C 2 251 ? -33.459  60.990  -53.436 1.00 137.72 ?  630 ARG C NH1   1 
ATOM   8827  N  NH2   . ARG C 2 251 ? -34.468  62.439  -51.951 1.00 127.35 ?  630 ARG C NH2   1 
ATOM   8828  N  N     . LYS C 2 252 ? -31.628  55.465  -51.649 1.00 112.91 ?  631 LYS C N     1 
ATOM   8829  C  CA    . LYS C 2 252 ? -31.473  54.239  -52.431 1.00 115.75 ?  631 LYS C CA    1 
ATOM   8830  C  C     . LYS C 2 252 ? -31.215  53.060  -51.504 1.00 115.76 ?  631 LYS C C     1 
ATOM   8831  O  O     . LYS C 2 252 ? -31.831  52.002  -51.659 1.00 121.41 ?  631 LYS C O     1 
ATOM   8832  C  CB    . LYS C 2 252 ? -30.345  54.369  -53.472 1.00 118.69 ?  631 LYS C CB    1 
ATOM   8833  C  CG    . LYS C 2 252 ? -30.043  53.084  -54.285 1.00 114.39 ?  631 LYS C CG    1 
ATOM   8834  C  CD    . LYS C 2 252 ? -30.328  53.227  -55.798 1.00 102.16 ?  631 LYS C CD    1 
ATOM   8835  N  N     . TRP C 2 253 ? -30.314  53.243  -50.536 1.00 107.51 ?  632 TRP C N     1 
ATOM   8836  C  CA    . TRP C 2 253 ? -30.023  52.177  -49.583 1.00 101.94 ?  632 TRP C CA    1 
ATOM   8837  C  C     . TRP C 2 253 ? -31.312  51.723  -48.916 1.00 99.77  ?  632 TRP C C     1 
ATOM   8838  O  O     . TRP C 2 253 ? -31.639  50.532  -48.911 1.00 99.60  ?  632 TRP C O     1 
ATOM   8839  C  CB    . TRP C 2 253 ? -29.036  52.632  -48.512 1.00 91.67  ?  632 TRP C CB    1 
ATOM   8840  C  CG    . TRP C 2 253 ? -28.601  51.497  -47.645 1.00 92.50  ?  632 TRP C CG    1 
ATOM   8841  C  CD1   . TRP C 2 253 ? -27.501  50.724  -47.820 1.00 94.89  ?  632 TRP C CD1   1 
ATOM   8842  C  CD2   . TRP C 2 253 ? -29.272  50.981  -46.486 1.00 100.59 ?  632 TRP C CD2   1 
ATOM   8843  N  NE1   . TRP C 2 253 ? -27.432  49.761  -46.846 1.00 110.96 ?  632 TRP C NE1   1 
ATOM   8844  C  CE2   . TRP C 2 253 ? -28.507  49.898  -46.009 1.00 106.01 ?  632 TRP C CE2   1 
ATOM   8845  C  CE3   . TRP C 2 253 ? -30.437  51.334  -45.797 1.00 95.53  ?  632 TRP C CE3   1 
ATOM   8846  C  CZ2   . TRP C 2 253 ? -28.865  49.163  -44.871 1.00 106.32 ?  632 TRP C CZ2   1 
ATOM   8847  C  CZ3   . TRP C 2 253 ? -30.790  50.601  -44.668 1.00 90.82  ?  632 TRP C CZ3   1 
ATOM   8848  C  CH2   . TRP C 2 253 ? -30.004  49.530  -44.218 1.00 91.22  ?  632 TRP C CH2   1 
ATOM   8849  N  N     . ILE C 2 254 ? -32.036  52.691  -48.359 1.00 97.95  ?  633 ILE C N     1 
ATOM   8850  C  CA    . ILE C 2 254 ? -33.320  52.449  -47.724 1.00 96.47  ?  633 ILE C CA    1 
ATOM   8851  C  C     . ILE C 2 254 ? -34.273  51.744  -48.664 1.00 105.65 ?  633 ILE C C     1 
ATOM   8852  O  O     . ILE C 2 254 ? -34.885  50.751  -48.283 1.00 111.60 ?  633 ILE C O     1 
ATOM   8853  C  CB    . ILE C 2 254 ? -33.971  53.758  -47.270 1.00 92.70  ?  633 ILE C CB    1 
ATOM   8854  C  CG1   . ILE C 2 254 ? -33.055  54.482  -46.286 1.00 84.88  ?  633 ILE C CG1   1 
ATOM   8855  C  CG2   . ILE C 2 254 ? -35.350  53.495  -46.665 1.00 85.70  ?  633 ILE C CG2   1 
ATOM   8856  C  CD1   . ILE C 2 254 ? -33.768  55.505  -45.458 1.00 82.96  ?  633 ILE C CD1   1 
ATOM   8857  N  N     . GLU C 2 255 ? -34.407  52.265  -49.885 1.00 106.84 ?  634 GLU C N     1 
ATOM   8858  C  CA    . GLU C 2 255 ? -35.280  51.658  -50.899 1.00 107.91 ?  634 GLU C CA    1 
ATOM   8859  C  C     . GLU C 2 255 ? -34.933  50.191  -51.160 1.00 113.50 ?  634 GLU C C     1 
ATOM   8860  O  O     . GLU C 2 255 ? -35.819  49.346  -51.264 1.00 113.38 ?  634 GLU C O     1 
ATOM   8861  C  CB    . GLU C 2 255 ? -35.210  52.425  -52.224 1.00 110.76 ?  634 GLU C CB    1 
ATOM   8862  C  CG    . GLU C 2 255 ? -35.753  53.845  -52.187 1.00 113.51 ?  634 GLU C CG    1 
ATOM   8863  C  CD    . GLU C 2 255 ? -35.764  54.491  -53.565 1.00 124.00 ?  634 GLU C CD    1 
ATOM   8864  O  OE1   . GLU C 2 255 ? -36.354  53.887  -54.490 1.00 132.97 ?  634 GLU C OE1   1 
ATOM   8865  O  OE2   . GLU C 2 255 ? -35.178  55.589  -53.729 1.00 124.12 ?  634 GLU C OE2   1 
ATOM   8866  N  N     . ASP C 2 256 ? -33.640  49.896  -51.262 1.00 101.32 ?  635 ASP C N     1 
ATOM   8867  C  CA    . ASP C 2 256 ? -33.186  48.550  -51.595 1.00 113.53 ?  635 ASP C CA    1 
ATOM   8868  C  C     . ASP C 2 256 ? -33.261  47.556  -50.430 1.00 116.81 ?  635 ASP C C     1 
ATOM   8869  O  O     . ASP C 2 256 ? -33.456  46.360  -50.650 1.00 122.54 ?  635 ASP C O     1 
ATOM   8870  C  CB    . ASP C 2 256 ? -31.759  48.580  -52.169 1.00 122.36 ?  635 ASP C CB    1 
ATOM   8871  C  CG    . ASP C 2 256 ? -31.696  49.174  -53.575 1.00 130.25 ?  635 ASP C CG    1 
ATOM   8872  O  OD1   . ASP C 2 256 ? -32.732  49.183  -54.284 1.00 133.15 ?  635 ASP C OD1   1 
ATOM   8873  O  OD2   . ASP C 2 256 ? -30.599  49.626  -53.975 1.00 132.20 ?  635 ASP C OD2   1 
ATOM   8874  N  N     . ASN C 2 257 ? -33.109  48.043  -49.201 1.00 110.63 ?  636 ASN C N     1 
ATOM   8875  C  CA    . ASN C 2 257 ? -32.994  47.151  -48.043 1.00 107.11 ?  636 ASN C CA    1 
ATOM   8876  C  C     . ASN C 2 257 ? -34.176  47.158  -47.079 1.00 104.80 ?  636 ASN C C     1 
ATOM   8877  O  O     . ASN C 2 257 ? -34.383  46.202  -46.341 1.00 109.79 ?  636 ASN C O     1 
ATOM   8878  C  CB    . ASN C 2 257 ? -31.713  47.445  -47.263 1.00 106.48 ?  636 ASN C CB    1 
ATOM   8879  C  CG    . ASN C 2 257 ? -30.489  47.438  -48.139 1.00 103.78 ?  636 ASN C CG    1 
ATOM   8880  O  OD1   . ASN C 2 257 ? -29.751  48.422  -48.203 1.00 101.71 ?  636 ASN C OD1   1 
ATOM   8881  N  ND2   . ASN C 2 257 ? -30.268  46.328  -48.830 1.00 106.20 ?  636 ASN C ND2   1 
ATOM   8882  N  N     . VAL C 2 258 ? -34.938  48.239  -47.069 1.00 100.13 ?  637 VAL C N     1 
ATOM   8883  C  CA    . VAL C 2 258 ? -36.085  48.345  -46.177 1.00 96.61  ?  637 VAL C CA    1 
ATOM   8884  C  C     . VAL C 2 258 ? -37.359  47.805  -46.832 1.00 103.00 ?  637 VAL C C     1 
ATOM   8885  O  O     . VAL C 2 258 ? -37.832  48.342  -47.840 1.00 110.10 ?  637 VAL C O     1 
ATOM   8886  C  CB    . VAL C 2 258 ? -36.295  49.806  -45.722 1.00 89.66  ?  637 VAL C CB    1 
ATOM   8887  C  CG1   . VAL C 2 258 ? -37.775  50.099  -45.489 1.00 90.89  ?  637 VAL C CG1   1 
ATOM   8888  C  CG2   . VAL C 2 258 ? -35.464  50.098  -44.481 1.00 84.74  ?  637 VAL C CG2   1 
ATOM   8889  N  N     . LYS C 2 259 ? -37.910  46.741  -46.253 1.00 101.84 ?  638 LYS C N     1 
ATOM   8890  C  CA    . LYS C 2 259 ? -39.128  46.126  -46.779 1.00 105.35 ?  638 LYS C CA    1 
ATOM   8891  C  C     . LYS C 2 259 ? -40.412  46.696  -46.140 1.00 110.03 ?  638 LYS C C     1 
ATOM   8892  O  O     . LYS C 2 259 ? -40.810  46.306  -45.041 1.00 112.26 ?  638 LYS C O     1 
ATOM   8893  C  CB    . LYS C 2 259 ? -39.057  44.601  -46.626 1.00 102.88 ?  638 LYS C CB    1 
ATOM   8894  N  N     . PHE C 2 260 ? -41.056  47.625  -46.838 1.00 110.88 ?  639 PHE C N     1 
ATOM   8895  C  CA    . PHE C 2 260 ? -42.281  48.251  -46.338 1.00 108.78 ?  639 PHE C CA    1 
ATOM   8896  C  C     . PHE C 2 260 ? -43.475  47.291  -46.369 1.00 113.40 ?  639 PHE C C     1 
ATOM   8897  O  O     . PHE C 2 260 ? -44.438  47.466  -45.620 1.00 107.53 ?  639 PHE C O     1 
ATOM   8898  C  CB    . PHE C 2 260 ? -42.591  49.531  -47.129 1.00 102.76 ?  639 PHE C CB    1 
ATOM   8899  C  CG    . PHE C 2 260 ? -41.518  50.580  -47.020 1.00 97.65  ?  639 PHE C CG    1 
ATOM   8900  C  CD1   . PHE C 2 260 ? -41.606  51.589  -46.087 1.00 100.23 ?  639 PHE C CD1   1 
ATOM   8901  C  CD2   . PHE C 2 260 ? -40.411  50.542  -47.832 1.00 93.24  ?  639 PHE C CD2   1 
ATOM   8902  C  CE1   . PHE C 2 260 ? -40.608  52.546  -45.985 1.00 96.06  ?  639 PHE C CE1   1 
ATOM   8903  C  CE2   . PHE C 2 260 ? -39.420  51.496  -47.727 1.00 88.67  ?  639 PHE C CE2   1 
ATOM   8904  C  CZ    . PHE C 2 260 ? -39.518  52.497  -46.809 1.00 88.02  ?  639 PHE C CZ    1 
ATOM   8905  N  N     . THR C 2 261 ? -43.392  46.280  -47.237 1.00 122.07 ?  640 THR C N     1 
ATOM   8906  C  CA    . THR C 2 261 ? -44.431  45.257  -47.393 1.00 120.86 ?  640 THR C CA    1 
ATOM   8907  C  C     . THR C 2 261 ? -45.769  45.858  -47.806 1.00 121.13 ?  640 THR C C     1 
ATOM   8908  O  O     . THR C 2 261 ? -45.818  46.901  -48.458 1.00 119.68 ?  640 THR C O     1 
ATOM   8909  C  CB    . THR C 2 261 ? -44.614  44.413  -46.108 1.00 118.46 ?  640 THR C CB    1 
ATOM   8910  N  N     . LYS D 2 36  ? -37.446  89.865  -20.247 1.00 115.05 ?  415 LYS D N     1 
ATOM   8911  C  CA    . LYS D 2 36  ? -38.520  89.609  -19.277 1.00 116.35 ?  415 LYS D CA    1 
ATOM   8912  C  C     . LYS D 2 36  ? -39.685  90.574  -19.465 1.00 117.40 ?  415 LYS D C     1 
ATOM   8913  O  O     . LYS D 2 36  ? -40.826  90.157  -19.673 1.00 114.46 ?  415 LYS D O     1 
ATOM   8914  C  CB    . LYS D 2 36  ? -38.007  89.707  -17.829 1.00 112.85 ?  415 LYS D CB    1 
ATOM   8915  N  N     . LEU D 2 37  ? -39.381  91.867  -19.382 1.00 117.47 ?  416 LEU D N     1 
ATOM   8916  C  CA    . LEU D 2 37  ? -40.388  92.918  -19.493 1.00 110.85 ?  416 LEU D CA    1 
ATOM   8917  C  C     . LEU D 2 37  ? -40.780  93.175  -20.943 1.00 107.83 ?  416 LEU D C     1 
ATOM   8918  O  O     . LEU D 2 37  ? -39.936  93.180  -21.830 1.00 101.87 ?  416 LEU D O     1 
ATOM   8919  C  CB    . LEU D 2 37  ? -39.876  94.217  -18.856 1.00 108.19 ?  416 LEU D CB    1 
ATOM   8920  C  CG    . LEU D 2 37  ? -40.709  95.493  -19.034 1.00 106.72 ?  416 LEU D CG    1 
ATOM   8921  C  CD1   . LEU D 2 37  ? -40.570  96.408  -17.833 1.00 110.35 ?  416 LEU D CD1   1 
ATOM   8922  C  CD2   . LEU D 2 37  ? -40.304  96.245  -20.285 1.00 104.91 ?  416 LEU D CD2   1 
ATOM   8923  N  N     . THR D 2 38  ? -42.072  93.375  -21.175 1.00 111.85 ?  417 THR D N     1 
ATOM   8924  C  CA    . THR D 2 38  ? -42.564  93.821  -22.475 1.00 112.16 ?  417 THR D CA    1 
ATOM   8925  C  C     . THR D 2 38  ? -42.932  95.304  -22.369 1.00 115.84 ?  417 THR D C     1 
ATOM   8926  O  O     . THR D 2 38  ? -43.900  95.674  -21.700 1.00 116.25 ?  417 THR D O     1 
ATOM   8927  C  CB    . THR D 2 38  ? -43.782  92.991  -22.950 1.00 106.07 ?  417 THR D CB    1 
ATOM   8928  O  OG1   . THR D 2 38  ? -43.377  91.642  -23.207 1.00 101.21 ?  417 THR D OG1   1 
ATOM   8929  C  CG2   . THR D 2 38  ? -44.378  93.582  -24.218 1.00 106.80 ?  417 THR D CG2   1 
ATOM   8930  N  N     . PRO D 2 39  ? -42.143  96.166  -23.017 1.00 119.26 ?  418 PRO D N     1 
ATOM   8931  C  CA    . PRO D 2 39  ? -42.329  97.606  -22.812 1.00 121.08 ?  418 PRO D CA    1 
ATOM   8932  C  C     . PRO D 2 39  ? -43.497  98.167  -23.620 1.00 118.65 ?  418 PRO D C     1 
ATOM   8933  O  O     . PRO D 2 39  ? -43.919  97.542  -24.593 1.00 118.09 ?  418 PRO D O     1 
ATOM   8934  C  CB    . PRO D 2 39  ? -41.001  98.193  -23.294 1.00 123.84 ?  418 PRO D CB    1 
ATOM   8935  C  CG    . PRO D 2 39  ? -40.512  97.213  -24.317 1.00 122.58 ?  418 PRO D CG    1 
ATOM   8936  C  CD    . PRO D 2 39  ? -41.008  95.860  -23.907 1.00 120.04 ?  418 PRO D CD    1 
ATOM   8937  N  N     . ALA D 2 40  ? -44.023  99.315  -23.202 1.00 116.71 ?  419 ALA D N     1 
ATOM   8938  C  CA    . ALA D 2 40  ? -45.029  100.017 -23.990 1.00 116.26 ?  419 ALA D CA    1 
ATOM   8939  C  C     . ALA D 2 40  ? -44.343  100.795 -25.123 1.00 124.03 ?  419 ALA D C     1 
ATOM   8940  O  O     . ALA D 2 40  ? -43.272  101.379 -24.935 1.00 127.58 ?  419 ALA D O     1 
ATOM   8941  C  CB    . ALA D 2 40  ? -45.860  100.942 -23.107 1.00 110.25 ?  419 ALA D CB    1 
ATOM   8942  N  N     . GLN D 2 41  ? -44.960  100.799 -26.299 1.00 126.61 ?  420 GLN D N     1 
ATOM   8943  C  CA    . GLN D 2 41  ? -44.308  101.305 -27.501 1.00 134.56 ?  420 GLN D CA    1 
ATOM   8944  C  C     . GLN D 2 41  ? -43.967  102.806 -27.465 1.00 144.53 ?  420 GLN D C     1 
ATOM   8945  O  O     . GLN D 2 41  ? -43.210  103.295 -28.309 1.00 148.39 ?  420 GLN D O     1 
ATOM   8946  C  CB    . GLN D 2 41  ? -45.149  100.962 -28.738 1.00 137.42 ?  420 GLN D CB    1 
ATOM   8947  C  CG    . GLN D 2 41  ? -44.471  101.276 -30.067 1.00 147.37 ?  420 GLN D CG    1 
ATOM   8948  C  CD    . GLN D 2 41  ? -44.946  100.374 -31.193 1.00 151.52 ?  420 GLN D CD    1 
ATOM   8949  O  OE1   . GLN D 2 41  ? -46.086  99.901  -31.190 1.00 150.28 ?  420 GLN D OE1   1 
ATOM   8950  N  NE2   . GLN D 2 41  ? -44.064  100.117 -32.158 1.00 153.39 ?  420 GLN D NE2   1 
ATOM   8951  N  N     . SER D 2 42  ? -44.515  103.530 -26.491 1.00 146.79 ?  421 SER D N     1 
ATOM   8952  C  CA    . SER D 2 42  ? -44.280  104.972 -26.393 1.00 148.60 ?  421 SER D CA    1 
ATOM   8953  C  C     . SER D 2 42  ? -44.129  105.438 -24.944 1.00 148.37 ?  421 SER D C     1 
ATOM   8954  O  O     . SER D 2 42  ? -45.088  105.404 -24.174 1.00 146.40 ?  421 SER D O     1 
ATOM   8955  C  CB    . SER D 2 42  ? -45.405  105.751 -27.086 1.00 147.38 ?  421 SER D CB    1 
ATOM   8956  N  N     . LYS D 2 43  ? -42.921  105.873 -24.584 1.00 149.59 ?  422 LYS D N     1 
ATOM   8957  C  CA    . LYS D 2 43  ? -42.644  106.384 -23.240 1.00 145.15 ?  422 LYS D CA    1 
ATOM   8958  C  C     . LYS D 2 43  ? -43.568  107.555 -22.899 1.00 143.45 ?  422 LYS D C     1 
ATOM   8959  O  O     . LYS D 2 43  ? -43.792  108.440 -23.722 1.00 137.87 ?  422 LYS D O     1 
ATOM   8960  C  CB    . LYS D 2 43  ? -41.172  106.798 -23.102 1.00 143.96 ?  422 LYS D CB    1 
ATOM   8961  N  N     . ASN D 2 44  ? -44.104  107.550 -21.683 1.00 147.30 ?  423 ASN D N     1 
ATOM   8962  C  CA    . ASN D 2 44  ? -45.115  108.524 -21.287 1.00 150.98 ?  423 ASN D CA    1 
ATOM   8963  C  C     . ASN D 2 44  ? -45.642  108.247 -19.881 1.00 154.60 ?  423 ASN D C     1 
ATOM   8964  O  O     . ASN D 2 44  ? -46.592  107.480 -19.712 1.00 156.94 ?  423 ASN D O     1 
ATOM   8965  C  CB    . ASN D 2 44  ? -46.278  108.505 -22.284 1.00 147.89 ?  423 ASN D CB    1 
ATOM   8966  C  CG    . ASN D 2 44  ? -47.372  109.500 -21.931 1.00 149.15 ?  423 ASN D CG    1 
ATOM   8967  O  OD1   . ASN D 2 44  ? -47.096  110.601 -21.453 1.00 153.66 ?  423 ASN D OD1   1 
ATOM   8968  N  ND2   . ASN D 2 44  ? -48.625  109.115 -22.165 1.00 145.94 ?  423 ASN D ND2   1 
ATOM   8969  N  N     . PRO D 2 45  ? -45.021  108.867 -18.864 1.00 153.83 ?  424 PRO D N     1 
ATOM   8970  C  CA    . PRO D 2 45  ? -45.446  108.695 -17.468 1.00 150.07 ?  424 PRO D CA    1 
ATOM   8971  C  C     . PRO D 2 45  ? -46.900  109.116 -17.228 1.00 146.16 ?  424 PRO D C     1 
ATOM   8972  O  O     . PRO D 2 45  ? -47.489  108.725 -16.218 1.00 143.63 ?  424 PRO D O     1 
ATOM   8973  C  CB    . PRO D 2 45  ? -44.495  109.618 -16.700 1.00 153.44 ?  424 PRO D CB    1 
ATOM   8974  C  CG    . PRO D 2 45  ? -43.278  109.713 -17.568 1.00 154.69 ?  424 PRO D CG    1 
ATOM   8975  C  CD    . PRO D 2 45  ? -43.798  109.683 -18.977 1.00 155.23 ?  424 PRO D CD    1 
ATOM   8976  N  N     . ALA D 2 46  ? -47.469  109.890 -18.150 1.00 143.77 ?  425 ALA D N     1 
ATOM   8977  C  CA    . ALA D 2 46  ? -48.827  110.416 -17.992 1.00 143.32 ?  425 ALA D CA    1 
ATOM   8978  C  C     . ALA D 2 46  ? -49.942  109.394 -18.242 1.00 142.53 ?  425 ALA D C     1 
ATOM   8979  O  O     . ALA D 2 46  ? -51.021  109.497 -17.654 1.00 141.49 ?  425 ALA D O     1 
ATOM   8980  C  CB    . ALA D 2 46  ? -49.028  111.632 -18.879 1.00 146.62 ?  425 ALA D CB    1 
ATOM   8981  N  N     . LYS D 2 47  ? -49.686  108.421 -19.116 1.00 142.56 ?  426 LYS D N     1 
ATOM   8982  C  CA    . LYS D 2 47  ? -50.700  107.432 -19.490 1.00 137.45 ?  426 LYS D CA    1 
ATOM   8983  C  C     . LYS D 2 47  ? -50.237  106.000 -19.244 1.00 134.40 ?  426 LYS D C     1 
ATOM   8984  O  O     . LYS D 2 47  ? -51.004  105.167 -18.757 1.00 132.96 ?  426 LYS D O     1 
ATOM   8985  C  CB    . LYS D 2 47  ? -51.109  107.595 -20.962 1.00 136.39 ?  426 LYS D CB    1 
ATOM   8986  N  N     . ASN D 2 48  ? -48.983  105.719 -19.587 1.00 136.26 ?  427 ASN D N     1 
ATOM   8987  C  CA    . ASN D 2 48  ? -48.457  104.355 -19.537 1.00 138.37 ?  427 ASN D CA    1 
ATOM   8988  C  C     . ASN D 2 48  ? -48.842  103.567 -18.282 1.00 139.96 ?  427 ASN D C     1 
ATOM   8989  O  O     . ASN D 2 48  ? -48.747  104.066 -17.161 1.00 144.51 ?  427 ASN D O     1 
ATOM   8990  C  CB    . ASN D 2 48  ? -46.935  104.347 -19.730 1.00 138.84 ?  427 ASN D CB    1 
ATOM   8991  C  CG    . ASN D 2 48  ? -46.525  104.605 -21.172 1.00 139.50 ?  427 ASN D CG    1 
ATOM   8992  O  OD1   . ASN D 2 48  ? -47.305  105.137 -21.969 1.00 141.24 ?  427 ASN D OD1   1 
ATOM   8993  N  ND2   . ASN D 2 48  ? -45.293  104.228 -21.513 1.00 136.03 ?  427 ASN D ND2   1 
ATOM   8994  N  N     . GLU D 2 49  ? -49.278  102.329 -18.491 1.00 135.46 ?  428 GLU D N     1 
ATOM   8995  C  CA    . GLU D 2 49  ? -49.628  101.430 -17.400 1.00 129.98 ?  428 GLU D CA    1 
ATOM   8996  C  C     . GLU D 2 49  ? -48.621  100.283 -17.298 1.00 120.86 ?  428 GLU D C     1 
ATOM   8997  O  O     . GLU D 2 49  ? -48.120  99.792  -18.316 1.00 117.11 ?  428 GLU D O     1 
ATOM   8998  C  CB    . GLU D 2 49  ? -51.022  100.841 -17.630 1.00 134.66 ?  428 GLU D CB    1 
ATOM   8999  C  CG    . GLU D 2 49  ? -52.119  101.850 -17.916 1.00 141.79 ?  428 GLU D CG    1 
ATOM   9000  C  CD    . GLU D 2 49  ? -53.487  101.191 -18.012 1.00 146.34 ?  428 GLU D CD    1 
ATOM   9001  O  OE1   . GLU D 2 49  ? -53.544  99.968  -18.269 1.00 145.49 ?  428 GLU D OE1   1 
ATOM   9002  O  OE2   . GLU D 2 49  ? -54.505  101.890 -17.821 1.00 149.90 ?  428 GLU D OE2   1 
ATOM   9003  N  N     . LEU D 2 50  ? -48.327  99.853  -16.074 1.00 117.36 ?  429 LEU D N     1 
ATOM   9004  C  CA    . LEU D 2 50  ? -47.510  98.660  -15.877 1.00 113.69 ?  429 LEU D CA    1 
ATOM   9005  C  C     . LEU D 2 50  ? -48.355  97.531  -15.303 1.00 110.50 ?  429 LEU D C     1 
ATOM   9006  O  O     . LEU D 2 50  ? -48.932  97.653  -14.222 1.00 108.35 ?  429 LEU D O     1 
ATOM   9007  C  CB    . LEU D 2 50  ? -46.316  98.936  -14.964 1.00 115.56 ?  429 LEU D CB    1 
ATOM   9008  C  CG    . LEU D 2 50  ? -45.038  98.150  -15.293 1.00 117.52 ?  429 LEU D CG    1 
ATOM   9009  C  CD1   . LEU D 2 50  ? -44.225  97.857  -14.035 1.00 114.66 ?  429 LEU D CD1   1 
ATOM   9010  C  CD2   . LEU D 2 50  ? -45.340  96.870  -16.058 1.00 118.11 ?  429 LEU D CD2   1 
ATOM   9011  N  N     . TYR D 2 51  ? -48.431  96.433  -16.044 1.00 109.86 ?  430 TYR D N     1 
ATOM   9012  C  CA    . TYR D 2 51  ? -49.175  95.262  -15.611 1.00 103.88 ?  430 TYR D CA    1 
ATOM   9013  C  C     . TYR D 2 51  ? -48.222  94.237  -15.002 1.00 104.30 ?  430 TYR D C     1 
ATOM   9014  O  O     . TYR D 2 51  ? -47.298  93.761  -15.673 1.00 101.77 ?  430 TYR D O     1 
ATOM   9015  C  CB    . TYR D 2 51  ? -49.944  94.652  -16.791 1.00 99.22  ?  430 TYR D CB    1 
ATOM   9016  C  CG    . TYR D 2 51  ? -51.307  95.272  -17.021 1.00 95.70  ?  430 TYR D CG    1 
ATOM   9017  C  CD1   . TYR D 2 51  ? -52.432  94.750  -16.394 1.00 93.57  ?  430 TYR D CD1   1 
ATOM   9018  C  CD2   . TYR D 2 51  ? -51.471  96.376  -17.860 1.00 93.02  ?  430 TYR D CD2   1 
ATOM   9019  C  CE1   . TYR D 2 51  ? -53.681  95.304  -16.585 1.00 95.90  ?  430 TYR D CE1   1 
ATOM   9020  C  CE2   . TYR D 2 51  ? -52.722  96.940  -18.058 1.00 93.55  ?  430 TYR D CE2   1 
ATOM   9021  C  CZ    . TYR D 2 51  ? -53.825  96.396  -17.413 1.00 97.53  ?  430 TYR D CZ    1 
ATOM   9022  O  OH    . TYR D 2 51  ? -55.087  96.926  -17.583 1.00 101.29 ?  430 TYR D OH    1 
ATOM   9023  N  N     . LEU D 2 52  ? -48.436  93.929  -13.723 1.00 105.37 ?  431 LEU D N     1 
ATOM   9024  C  CA    . LEU D 2 52  ? -47.684  92.886  -13.025 1.00 99.82  ?  431 LEU D CA    1 
ATOM   9025  C  C     . LEU D 2 52  ? -48.544  91.628  -12.981 1.00 97.22  ?  431 LEU D C     1 
ATOM   9026  O  O     . LEU D 2 52  ? -49.452  91.504  -12.167 1.00 97.10  ?  431 LEU D O     1 
ATOM   9027  C  CB    . LEU D 2 52  ? -47.308  93.332  -11.605 1.00 93.71  ?  431 LEU D CB    1 
ATOM   9028  C  CG    . LEU D 2 52  ? -46.606  94.685  -11.411 1.00 90.65  ?  431 LEU D CG    1 
ATOM   9029  C  CD1   . LEU D 2 52  ? -46.611  95.056  -9.948  1.00 91.32  ?  431 LEU D CD1   1 
ATOM   9030  C  CD2   . LEU D 2 52  ? -45.180  94.701  -11.952 1.00 88.16  ?  431 LEU D CD2   1 
ATOM   9031  N  N     . VAL D 2 53  ? -48.252  90.698  -13.875 1.00 95.42  ?  432 VAL D N     1 
ATOM   9032  C  CA    . VAL D 2 53  ? -49.113  89.550  -14.091 1.00 97.55  ?  432 VAL D CA    1 
ATOM   9033  C  C     . VAL D 2 53  ? -48.582  88.315  -13.352 1.00 96.56  ?  432 VAL D C     1 
ATOM   9034  O  O     . VAL D 2 53  ? -47.379  88.039  -13.359 1.00 99.23  ?  432 VAL D O     1 
ATOM   9035  C  CB    . VAL D 2 53  ? -49.234  89.263  -15.618 1.00 90.15  ?  432 VAL D CB    1 
ATOM   9036  C  CG1   . VAL D 2 53  ? -50.321  88.241  -15.912 1.00 94.27  ?  432 VAL D CG1   1 
ATOM   9037  C  CG2   . VAL D 2 53  ? -49.519  90.540  -16.363 1.00 86.62  ?  432 VAL D CG2   1 
ATOM   9038  N  N     . GLU D 2 54  ? -49.479  87.580  -12.707 1.00 91.14  ?  433 GLU D N     1 
ATOM   9039  C  CA    . GLU D 2 54  ? -49.121  86.292  -12.127 1.00 94.20  ?  433 GLU D CA    1 
ATOM   9040  C  C     . GLU D 2 54  ? -48.780  85.298  -13.229 1.00 96.27  ?  433 GLU D C     1 
ATOM   9041  O  O     . GLU D 2 54  ? -49.667  84.796  -13.925 1.00 102.26 ?  433 GLU D O     1 
ATOM   9042  C  CB    . GLU D 2 54  ? -50.267  85.746  -11.254 1.00 98.79  ?  433 GLU D CB    1 
ATOM   9043  C  CG    . GLU D 2 54  ? -50.066  84.327  -10.690 1.00 99.17  ?  433 GLU D CG    1 
ATOM   9044  C  CD    . GLU D 2 54  ? -51.278  83.847  -9.891  1.00 101.48 ?  433 GLU D CD    1 
ATOM   9045  O  OE1   . GLU D 2 54  ? -51.341  82.654  -9.499  1.00 101.40 ?  433 GLU D OE1   1 
ATOM   9046  O  OE2   . GLU D 2 54  ? -52.183  84.675  -9.661  1.00 104.66 ?  433 GLU D OE2   1 
ATOM   9047  N  N     . GLY D 2 55  ? -47.489  85.037  -13.402 1.00 93.44  ?  434 GLY D N     1 
ATOM   9048  C  CA    . GLY D 2 55  ? -47.045  83.928  -14.231 1.00 94.43  ?  434 GLY D CA    1 
ATOM   9049  C  C     . GLY D 2 55  ? -46.880  84.170  -15.716 1.00 99.69  ?  434 GLY D C     1 
ATOM   9050  O  O     . GLY D 2 55  ? -47.583  84.983  -16.310 1.00 101.07 ?  434 GLY D O     1 
ATOM   9051  N  N     . ASP D 2 56  ? -45.953  83.424  -16.313 1.00 106.93 ?  435 ASP D N     1 
ATOM   9052  C  CA    . ASP D 2 56  ? -45.586  83.572  -17.723 1.00 110.90 ?  435 ASP D CA    1 
ATOM   9053  C  C     . ASP D 2 56  ? -46.708  83.242  -18.705 1.00 113.31 ?  435 ASP D C     1 
ATOM   9054  O  O     . ASP D 2 56  ? -46.925  83.980  -19.661 1.00 112.83 ?  435 ASP D O     1 
ATOM   9055  C  CB    . ASP D 2 56  ? -44.335  82.748  -18.045 1.00 113.24 ?  435 ASP D CB    1 
ATOM   9056  C  CG    . ASP D 2 56  ? -43.049  83.509  -17.762 1.00 121.48 ?  435 ASP D CG    1 
ATOM   9057  O  OD1   . ASP D 2 56  ? -42.698  84.398  -18.576 1.00 121.31 ?  435 ASP D OD1   1 
ATOM   9058  O  OD2   . ASP D 2 56  ? -42.393  83.222  -16.730 1.00 127.12 ?  435 ASP D OD2   1 
ATOM   9059  N  N     . SER D 2 57  ? -47.412  82.135  -18.481 1.00 116.84 ?  436 SER D N     1 
ATOM   9060  C  CA    . SER D 2 57  ? -48.549  81.788  -19.333 1.00 116.77 ?  436 SER D CA    1 
ATOM   9061  C  C     . SER D 2 57  ? -49.452  83.014  -19.536 1.00 107.46 ?  436 SER D C     1 
ATOM   9062  O  O     . SER D 2 57  ? -49.542  83.545  -20.639 1.00 103.12 ?  436 SER D O     1 
ATOM   9063  C  CB    . SER D 2 57  ? -49.332  80.583  -18.771 1.00 121.14 ?  436 SER D CB    1 
ATOM   9064  O  OG    . SER D 2 57  ? -50.654  80.932  -18.369 1.00 122.11 ?  436 SER D OG    1 
ATOM   9065  N  N     . ALA D 2 58  ? -50.089  83.475  -18.462 1.00 102.27 ?  437 ALA D N     1 
ATOM   9066  C  CA    . ALA D 2 58  ? -50.986  84.628  -18.516 1.00 95.25  ?  437 ALA D CA    1 
ATOM   9067  C  C     . ALA D 2 58  ? -50.272  85.929  -18.891 1.00 95.37  ?  437 ALA D C     1 
ATOM   9068  O  O     . ALA D 2 58  ? -50.859  86.800  -19.534 1.00 98.14  ?  437 ALA D O     1 
ATOM   9069  C  CB    . ALA D 2 58  ? -51.724  84.789  -17.187 1.00 92.18  ?  437 ALA D CB    1 
ATOM   9070  N  N     . GLY D 2 59  ? -49.018  86.075  -18.476 1.00 93.38  ?  438 GLY D N     1 
ATOM   9071  C  CA    . GLY D 2 59  ? -48.230  87.223  -18.892 1.00 95.48  ?  438 GLY D CA    1 
ATOM   9072  C  C     . GLY D 2 59  ? -48.224  87.321  -20.410 1.00 100.70 ?  438 GLY D C     1 
ATOM   9073  O  O     . GLY D 2 59  ? -48.278  88.414  -20.983 1.00 102.16 ?  438 GLY D O     1 
ATOM   9074  N  N     . GLY D 2 60  ? -48.169  86.158  -21.058 1.00 100.92 ?  439 GLY D N     1 
ATOM   9075  C  CA    . GLY D 2 60  ? -48.165  86.057  -22.508 1.00 98.78  ?  439 GLY D CA    1 
ATOM   9076  C  C     . GLY D 2 60  ? -49.516  86.328  -23.149 1.00 95.98  ?  439 GLY D C     1 
ATOM   9077  O  O     . GLY D 2 60  ? -49.570  86.956  -24.207 1.00 103.86 ?  439 GLY D O     1 
ATOM   9078  N  N     . SER D 2 61  ? -50.597  85.846  -22.526 1.00 86.32  ?  440 SER D N     1 
ATOM   9079  C  CA    . SER D 2 61  ? -51.959  86.194  -22.940 1.00 85.01  ?  440 SER D CA    1 
ATOM   9080  C  C     . SER D 2 61  ? -52.137  87.714  -22.886 1.00 90.95  ?  440 SER D C     1 
ATOM   9081  O  O     . SER D 2 61  ? -52.652  88.326  -23.821 1.00 96.85  ?  440 SER D O     1 
ATOM   9082  C  CB    . SER D 2 61  ? -53.008  85.527  -22.045 1.00 87.80  ?  440 SER D CB    1 
ATOM   9083  O  OG    . SER D 2 61  ? -52.989  84.112  -22.127 1.00 91.71  ?  440 SER D OG    1 
ATOM   9084  N  N     . ALA D 2 62  ? -51.699  88.318  -21.787 1.00 92.01  ?  441 ALA D N     1 
ATOM   9085  C  CA    . ALA D 2 62  ? -51.699  89.771  -21.653 1.00 96.07  ?  441 ALA D CA    1 
ATOM   9086  C  C     . ALA D 2 62  ? -50.846  90.457  -22.722 1.00 98.77  ?  441 ALA D C     1 
ATOM   9087  O  O     . ALA D 2 62  ? -51.229  91.507  -23.239 1.00 99.80  ?  441 ALA D O     1 
ATOM   9088  C  CB    . ALA D 2 62  ? -51.230  90.175  -20.260 1.00 97.61  ?  441 ALA D CB    1 
ATOM   9089  N  N     . LYS D 2 63  ? -49.690  89.877  -23.050 1.00 100.28 ?  442 LYS D N     1 
ATOM   9090  C  CA    . LYS D 2 63  ? -48.844  90.432  -24.114 1.00 101.44 ?  442 LYS D CA    1 
ATOM   9091  C  C     . LYS D 2 63  ? -49.636  90.580  -25.416 1.00 97.66  ?  442 LYS D C     1 
ATOM   9092  O  O     . LYS D 2 63  ? -49.394  91.499  -26.199 1.00 94.44  ?  442 LYS D O     1 
ATOM   9093  C  CB    . LYS D 2 63  ? -47.580  89.580  -24.349 1.00 100.28 ?  442 LYS D CB    1 
ATOM   9094  C  CG    . LYS D 2 63  ? -46.653  90.089  -25.488 1.00 77.91  ?  442 LYS D CG    1 
ATOM   9095  N  N     . GLN D 2 64  ? -50.584  89.671  -25.627 1.00 97.83  ?  443 GLN D N     1 
ATOM   9096  C  CA    . GLN D 2 64  ? -51.387  89.641  -26.844 1.00 106.41 ?  443 GLN D CA    1 
ATOM   9097  C  C     . GLN D 2 64  ? -52.612  90.567  -26.759 1.00 109.92 ?  443 GLN D C     1 
ATOM   9098  O  O     . GLN D 2 64  ? -52.905  91.312  -27.707 1.00 117.92 ?  443 GLN D O     1 
ATOM   9099  C  CB    . GLN D 2 64  ? -51.797  88.197  -27.175 1.00 107.92 ?  443 GLN D CB    1 
ATOM   9100  C  CG    . GLN D 2 64  ? -50.633  87.300  -27.614 1.00 108.85 ?  443 GLN D CG    1 
ATOM   9101  C  CD    . GLN D 2 64  ? -50.778  85.845  -27.148 1.00 108.89 ?  443 GLN D CD    1 
ATOM   9102  O  OE1   . GLN D 2 64  ? -51.890  85.317  -27.035 1.00 109.42 ?  443 GLN D OE1   1 
ATOM   9103  N  NE2   . GLN D 2 64  ? -49.644  85.195  -26.871 1.00 105.71 ?  443 GLN D NE2   1 
ATOM   9104  N  N     . GLY D 2 65  ? -53.307  90.526  -25.619 1.00 101.16 ?  444 GLY D N     1 
ATOM   9105  C  CA    . GLY D 2 65  ? -54.508  91.324  -25.395 1.00 98.44  ?  444 GLY D CA    1 
ATOM   9106  C  C     . GLY D 2 65  ? -54.328  92.818  -25.121 1.00 99.81  ?  444 GLY D C     1 
ATOM   9107  O  O     . GLY D 2 65  ? -55.275  93.587  -25.279 1.00 102.18 ?  444 GLY D O     1 
ATOM   9108  N  N     . ARG D 2 66  ? -53.126  93.231  -24.715 1.00 98.85  ?  445 ARG D N     1 
ATOM   9109  C  CA    . ARG D 2 66  ? -52.832  94.628  -24.371 1.00 99.54  ?  445 ARG D CA    1 
ATOM   9110  C  C     . ARG D 2 66  ? -53.059  95.608  -25.535 1.00 105.86 ?  445 ARG D C     1 
ATOM   9111  O  O     . ARG D 2 66  ? -53.392  95.197  -26.653 1.00 108.75 ?  445 ARG D O     1 
ATOM   9112  C  CB    . ARG D 2 66  ? -51.373  94.744  -23.927 1.00 99.72  ?  445 ARG D CB    1 
ATOM   9113  C  CG    . ARG D 2 66  ? -50.383  94.817  -25.105 1.00 104.70 ?  445 ARG D CG    1 
ATOM   9114  C  CD    . ARG D 2 66  ? -49.019  94.251  -24.747 1.00 109.19 ?  445 ARG D CD    1 
ATOM   9115  N  NE    . ARG D 2 66  ? -47.945  95.237  -24.851 1.00 117.05 ?  445 ARG D NE    1 
ATOM   9116  C  CZ    . ARG D 2 66  ? -47.034  95.260  -25.822 1.00 123.61 ?  445 ARG D CZ    1 
ATOM   9117  N  NH1   . ARG D 2 66  ? -47.058  94.349  -26.788 1.00 123.33 ?  445 ARG D NH1   1 
ATOM   9118  N  NH2   . ARG D 2 66  ? -46.090  96.194  -25.823 1.00 128.03 ?  445 ARG D NH2   1 
ATOM   9119  N  N     . ASP D 2 67  ? -52.877  96.902  -25.256 1.00 110.27 ?  446 ASP D N     1 
ATOM   9120  C  CA    . ASP D 2 67  ? -52.778  97.937  -26.291 1.00 117.18 ?  446 ASP D CA    1 
ATOM   9121  C  C     . ASP D 2 67  ? -51.327  98.438  -26.344 1.00 118.29 ?  446 ASP D C     1 
ATOM   9122  O  O     . ASP D 2 67  ? -50.942  99.353  -25.614 1.00 116.55 ?  446 ASP D O     1 
ATOM   9123  C  CB    . ASP D 2 67  ? -53.747  99.102  -26.018 1.00 117.93 ?  446 ASP D CB    1 
ATOM   9124  C  CG    . ASP D 2 67  ? -53.830  100.106 -27.188 1.00 115.91 ?  446 ASP D CG    1 
ATOM   9125  O  OD1   . ASP D 2 67  ? -54.887  100.761 -27.344 1.00 113.74 ?  446 ASP D OD1   1 
ATOM   9126  O  OD2   . ASP D 2 67  ? -52.846  100.246 -27.949 1.00 115.37 ?  446 ASP D OD2   1 
ATOM   9127  N  N     . ARG D 2 68  ? -50.537  97.830  -27.223 1.00 120.49 ?  447 ARG D N     1 
ATOM   9128  C  CA    . ARG D 2 68  ? -49.085  98.013  -27.261 1.00 122.81 ?  447 ARG D CA    1 
ATOM   9129  C  C     . ARG D 2 68  ? -48.591  99.462  -27.225 1.00 130.32 ?  447 ARG D C     1 
ATOM   9130  O  O     . ARG D 2 68  ? -47.386  99.705  -27.109 1.00 133.87 ?  447 ARG D O     1 
ATOM   9131  C  CB    . ARG D 2 68  ? -48.505  97.295  -28.483 1.00 121.31 ?  447 ARG D CB    1 
ATOM   9132  C  CG    . ARG D 2 68  ? -49.182  97.663  -29.793 1.00 120.16 ?  447 ARG D CG    1 
ATOM   9133  C  CD    . ARG D 2 68  ? -48.602  96.876  -30.953 1.00 115.84 ?  447 ARG D CD    1 
ATOM   9134  N  NE    . ARG D 2 68  ? -47.225  96.478  -30.687 1.00 112.49 ?  447 ARG D NE    1 
ATOM   9135  C  CZ    . ARG D 2 68  ? -46.767  95.239  -30.844 1.00 110.72 ?  447 ARG D CZ    1 
ATOM   9136  N  NH1   . ARG D 2 68  ? -47.585  94.283  -31.279 1.00 108.44 ?  447 ARG D NH1   1 
ATOM   9137  N  NH2   . ARG D 2 68  ? -45.493  94.956  -30.572 1.00 109.86 ?  447 ARG D NH2   1 
ATOM   9138  N  N     . LYS D 2 69  ? -49.505  100.423 -27.322 1.00 131.55 ?  448 LYS D N     1 
ATOM   9139  C  CA    . LYS D 2 69  ? -49.102  101.829 -27.356 1.00 130.01 ?  448 LYS D CA    1 
ATOM   9140  C  C     . LYS D 2 69  ? -48.855  102.433 -25.959 1.00 130.11 ?  448 LYS D C     1 
ATOM   9141  O  O     . LYS D 2 69  ? -48.052  103.358 -25.821 1.00 133.90 ?  448 LYS D O     1 
ATOM   9142  C  CB    . LYS D 2 69  ? -50.092  102.675 -28.180 1.00 126.31 ?  448 LYS D CB    1 
ATOM   9143  N  N     . PHE D 2 70  ? -49.519  101.907 -24.928 1.00 125.57 ?  449 PHE D N     1 
ATOM   9144  C  CA    . PHE D 2 70  ? -49.399  102.486 -23.583 1.00 122.30 ?  449 PHE D CA    1 
ATOM   9145  C  C     . PHE D 2 70  ? -49.441  101.480 -22.425 1.00 117.44 ?  449 PHE D C     1 
ATOM   9146  O  O     . PHE D 2 70  ? -49.368  101.872 -21.263 1.00 116.66 ?  449 PHE D O     1 
ATOM   9147  C  CB    . PHE D 2 70  ? -50.465  103.570 -23.365 1.00 121.85 ?  449 PHE D CB    1 
ATOM   9148  C  CG    . PHE D 2 70  ? -51.867  103.032 -23.240 1.00 118.04 ?  449 PHE D CG    1 
ATOM   9149  C  CD1   . PHE D 2 70  ? -52.609  102.717 -24.369 1.00 119.40 ?  449 PHE D CD1   1 
ATOM   9150  C  CD2   . PHE D 2 70  ? -52.444  102.848 -21.993 1.00 114.91 ?  449 PHE D CD2   1 
ATOM   9151  C  CE1   . PHE D 2 70  ? -53.901  102.221 -24.258 1.00 118.83 ?  449 PHE D CE1   1 
ATOM   9152  C  CE2   . PHE D 2 70  ? -53.735  102.349 -21.874 1.00 112.91 ?  449 PHE D CE2   1 
ATOM   9153  C  CZ    . PHE D 2 70  ? -54.464  102.036 -23.008 1.00 114.29 ?  449 PHE D CZ    1 
ATOM   9154  N  N     . GLN D 2 71  ? -49.562  100.195 -22.743 1.00 113.56 ?  450 GLN D N     1 
ATOM   9155  C  CA    . GLN D 2 71  ? -49.610  99.145  -21.726 1.00 107.94 ?  450 GLN D CA    1 
ATOM   9156  C  C     . GLN D 2 71  ? -48.364  98.254  -21.758 1.00 110.32 ?  450 GLN D C     1 
ATOM   9157  O  O     . GLN D 2 71  ? -48.069  97.615  -22.774 1.00 113.39 ?  450 GLN D O     1 
ATOM   9158  C  CB    . GLN D 2 71  ? -50.846  98.269  -21.925 1.00 104.96 ?  450 GLN D CB    1 
ATOM   9159  C  CG    . GLN D 2 71  ? -52.170  98.979  -21.749 1.00 109.56 ?  450 GLN D CG    1 
ATOM   9160  C  CD    . GLN D 2 71  ? -53.354  98.031  -21.895 1.00 115.20 ?  450 GLN D CD    1 
ATOM   9161  O  OE1   . GLN D 2 71  ? -53.284  97.032  -22.621 1.00 118.74 ?  450 GLN D OE1   1 
ATOM   9162  N  NE2   . GLN D 2 71  ? -54.445  98.334  -21.195 1.00 115.91 ?  450 GLN D NE2   1 
ATOM   9163  N  N     . ALA D 2 72  ? -47.639  98.203  -20.645 1.00 109.56 ?  451 ALA D N     1 
ATOM   9164  C  CA    . ALA D 2 72  ? -46.485  97.315  -20.538 1.00 109.24 ?  451 ALA D CA    1 
ATOM   9165  C  C     . ALA D 2 72  ? -46.783  96.079  -19.665 1.00 104.41 ?  451 ALA D C     1 
ATOM   9166  O  O     . ALA D 2 72  ? -47.539  96.147  -18.695 1.00 104.85 ?  451 ALA D O     1 
ATOM   9167  C  CB    . ALA D 2 72  ? -45.276  98.079  -20.013 1.00 112.46 ?  451 ALA D CB    1 
ATOM   9168  N  N     . ILE D 2 73  ? -46.194  94.943  -20.013 1.00 99.22  ?  452 ILE D N     1 
ATOM   9169  C  CA    . ILE D 2 73  ? -46.406  93.735  -19.234 1.00 99.89  ?  452 ILE D CA    1 
ATOM   9170  C  C     . ILE D 2 73  ? -45.108  93.272  -18.567 1.00 106.74 ?  452 ILE D C     1 
ATOM   9171  O  O     . ILE D 2 73  ? -44.049  93.210  -19.206 1.00 107.95 ?  452 ILE D O     1 
ATOM   9172  C  CB    . ILE D 2 73  ? -46.987  92.595  -20.106 1.00 96.35  ?  452 ILE D CB    1 
ATOM   9173  C  CG1   . ILE D 2 73  ? -48.114  93.119  -21.004 1.00 94.88  ?  452 ILE D CG1   1 
ATOM   9174  C  CG2   . ILE D 2 73  ? -47.474  91.428  -19.229 1.00 93.25  ?  452 ILE D CG2   1 
ATOM   9175  C  CD1   . ILE D 2 73  ? -49.440  93.312  -20.279 1.00 91.49  ?  452 ILE D CD1   1 
ATOM   9176  N  N     . LEU D 2 74  ? -45.189  92.963  -17.276 1.00 107.26 ?  453 LEU D N     1 
ATOM   9177  C  CA    . LEU D 2 74  ? -44.057  92.378  -16.569 1.00 109.08 ?  453 LEU D CA    1 
ATOM   9178  C  C     . LEU D 2 74  ? -44.523  91.153  -15.811 1.00 111.54 ?  453 LEU D C     1 
ATOM   9179  O  O     . LEU D 2 74  ? -45.181  91.273  -14.780 1.00 114.73 ?  453 LEU D O     1 
ATOM   9180  C  CB    . LEU D 2 74  ? -43.416  93.379  -15.599 1.00 110.19 ?  453 LEU D CB    1 
ATOM   9181  C  CG    . LEU D 2 74  ? -41.980  93.073  -15.136 1.00 107.86 ?  453 LEU D CG    1 
ATOM   9182  C  CD1   . LEU D 2 74  ? -41.822  93.303  -13.644 1.00 98.89  ?  453 LEU D CD1   1 
ATOM   9183  C  CD2   . LEU D 2 74  ? -41.525  91.659  -15.522 1.00 110.20 ?  453 LEU D CD2   1 
ATOM   9184  N  N     . PRO D 2 75  ? -44.192  89.964  -16.325 1.00 109.38 ?  454 PRO D N     1 
ATOM   9185  C  CA    . PRO D 2 75  ? -44.539  88.705  -15.657 1.00 106.98 ?  454 PRO D CA    1 
ATOM   9186  C  C     . PRO D 2 75  ? -43.901  88.574  -14.270 1.00 105.60 ?  454 PRO D C     1 
ATOM   9187  O  O     . PRO D 2 75  ? -42.708  88.851  -14.098 1.00 109.28 ?  454 PRO D O     1 
ATOM   9188  C  CB    . PRO D 2 75  ? -43.966  87.638  -16.602 1.00 104.63 ?  454 PRO D CB    1 
ATOM   9189  C  CG    . PRO D 2 75  ? -43.886  88.302  -17.911 1.00 108.37 ?  454 PRO D CG    1 
ATOM   9190  C  CD    . PRO D 2 75  ? -43.546  89.735  -17.625 1.00 110.17 ?  454 PRO D CD    1 
ATOM   9191  N  N     . LEU D 2 76  ? -44.699  88.165  -13.288 1.00 97.96  ?  455 LEU D N     1 
ATOM   9192  C  CA    . LEU D 2 76  ? -44.173  87.799  -11.978 1.00 92.86  ?  455 LEU D CA    1 
ATOM   9193  C  C     . LEU D 2 76  ? -44.099  86.290  -11.899 1.00 93.24  ?  455 LEU D C     1 
ATOM   9194  O  O     . LEU D 2 76  ? -45.040  85.630  -11.448 1.00 98.02  ?  455 LEU D O     1 
ATOM   9195  C  CB    . LEU D 2 76  ? -45.055  88.342  -10.862 1.00 89.92  ?  455 LEU D CB    1 
ATOM   9196  C  CG    . LEU D 2 76  ? -44.969  89.858  -10.691 1.00 92.43  ?  455 LEU D CG    1 
ATOM   9197  C  CD1   . LEU D 2 76  ? -45.727  90.284  -9.442  1.00 97.84  ?  455 LEU D CD1   1 
ATOM   9198  C  CD2   . LEU D 2 76  ? -43.510  90.318  -10.639 1.00 88.33  ?  455 LEU D CD2   1 
ATOM   9199  N  N     . ARG D 2 77  ? -42.975  85.752  -12.360 1.00 91.19  ?  456 ARG D N     1 
ATOM   9200  C  CA    . ARG D 2 77  ? -42.801  84.314  -12.497 1.00 91.70  ?  456 ARG D CA    1 
ATOM   9201  C  C     . ARG D 2 77  ? -42.545  83.684  -11.121 1.00 94.89  ?  456 ARG D C     1 
ATOM   9202  O  O     . ARG D 2 77  ? -41.439  83.747  -10.589 1.00 95.17  ?  456 ARG D O     1 
ATOM   9203  C  CB    . ARG D 2 77  ? -41.673  84.013  -13.509 1.00 87.98  ?  456 ARG D CB    1 
ATOM   9204  N  N     . GLY D 2 78  ? -43.590  83.114  -10.531 1.00 95.96  ?  457 GLY D N     1 
ATOM   9205  C  CA    . GLY D 2 78  ? -43.471  82.477  -9.228  1.00 96.02  ?  457 GLY D CA    1 
ATOM   9206  C  C     . GLY D 2 78  ? -44.014  83.305  -8.077  1.00 96.89  ?  457 GLY D C     1 
ATOM   9207  O  O     . GLY D 2 78  ? -44.513  84.409  -8.288  1.00 98.93  ?  457 GLY D O     1 
ATOM   9208  N  N     . LYS D 2 79  ? -43.930  82.765  -6.860  1.00 94.59  ?  458 LYS D N     1 
ATOM   9209  C  CA    . LYS D 2 79  ? -44.348  83.494  -5.657  1.00 88.91  ?  458 LYS D CA    1 
ATOM   9210  C  C     . LYS D 2 79  ? -43.315  84.559  -5.304  1.00 92.49  ?  458 LYS D C     1 
ATOM   9211  O  O     . LYS D 2 79  ? -42.109  84.330  -5.421  1.00 96.96  ?  458 LYS D O     1 
ATOM   9212  C  CB    . LYS D 2 79  ? -44.562  82.549  -4.468  1.00 81.44  ?  458 LYS D CB    1 
ATOM   9213  C  CG    . LYS D 2 79  ? -45.991  82.025  -4.296  1.00 82.79  ?  458 LYS D CG    1 
ATOM   9214  C  CD    . LYS D 2 79  ? -46.066  81.123  -3.062  1.00 92.36  ?  458 LYS D CD    1 
ATOM   9215  C  CE    . LYS D 2 79  ? -47.377  80.340  -2.962  1.00 96.39  ?  458 LYS D CE    1 
ATOM   9216  N  NZ    . LYS D 2 79  ? -48.565  81.213  -2.714  1.00 99.00  ?  458 LYS D NZ    1 
ATOM   9217  N  N     . VAL D 2 80  ? -43.792  85.720  -4.864  1.00 94.55  ?  459 VAL D N     1 
ATOM   9218  C  CA    . VAL D 2 80  ? -42.924  86.883  -4.679  1.00 96.79  ?  459 VAL D CA    1 
ATOM   9219  C  C     . VAL D 2 80  ? -42.410  87.037  -3.256  1.00 91.68  ?  459 VAL D C     1 
ATOM   9220  O  O     . VAL D 2 80  ? -43.141  86.820  -2.292  1.00 87.02  ?  459 VAL D O     1 
ATOM   9221  C  CB    . VAL D 2 80  ? -43.623  88.183  -5.108  1.00 93.79  ?  459 VAL D CB    1 
ATOM   9222  C  CG1   . VAL D 2 80  ? -42.726  89.373  -4.848  1.00 85.39  ?  459 VAL D CG1   1 
ATOM   9223  C  CG2   . VAL D 2 80  ? -44.013  88.104  -6.580  1.00 95.77  ?  459 VAL D CG2   1 
ATOM   9224  N  N     . ILE D 2 81  ? -41.147  87.445  -3.160  1.00 91.70  ?  460 ILE D N     1 
ATOM   9225  C  CA    . ILE D 2 81  ? -40.386  87.479  -1.912  1.00 89.60  ?  460 ILE D CA    1 
ATOM   9226  C  C     . ILE D 2 81  ? -41.012  88.344  -0.826  1.00 94.63  ?  460 ILE D C     1 
ATOM   9227  O  O     . ILE D 2 81  ? -41.362  89.497  -1.060  1.00 99.07  ?  460 ILE D O     1 
ATOM   9228  C  CB    . ILE D 2 81  ? -38.935  87.952  -2.178  1.00 90.77  ?  460 ILE D CB    1 
ATOM   9229  C  CG1   . ILE D 2 81  ? -38.039  87.692  -0.964  1.00 93.73  ?  460 ILE D CG1   1 
ATOM   9230  C  CG2   . ILE D 2 81  ? -38.905  89.417  -2.613  1.00 87.42  ?  460 ILE D CG2   1 
ATOM   9231  C  CD1   . ILE D 2 81  ? -36.558  87.838  -1.275  1.00 94.74  ?  460 ILE D CD1   1 
ATOM   9232  N  N     . ASN D 2 82  ? -41.146  87.785  0.371   1.00 96.63  ?  461 ASN D N     1 
ATOM   9233  C  CA    . ASN D 2 82  ? -41.728  88.534  1.478   1.00 95.26  ?  461 ASN D CA    1 
ATOM   9234  C  C     . ASN D 2 82  ? -40.763  89.565  2.041   1.00 98.43  ?  461 ASN D C     1 
ATOM   9235  O  O     . ASN D 2 82  ? -39.849  89.218  2.784   1.00 100.04 ?  461 ASN D O     1 
ATOM   9236  C  CB    . ASN D 2 82  ? -42.177  87.602  2.593   1.00 90.06  ?  461 ASN D CB    1 
ATOM   9237  C  CG    . ASN D 2 82  ? -43.038  88.308  3.603   1.00 94.16  ?  461 ASN D CG    1 
ATOM   9238  O  OD1   . ASN D 2 82  ? -42.795  89.471  3.922   1.00 98.35  ?  461 ASN D OD1   1 
ATOM   9239  N  ND2   . ASN D 2 82  ? -44.069  87.628  4.093   1.00 95.37  ?  461 ASN D ND2   1 
ATOM   9240  N  N     . THR D 2 83  ? -40.969  90.831  1.694   1.00 101.29 ?  462 THR D N     1 
ATOM   9241  C  CA    . THR D 2 83  ? -40.014  91.871  2.066   1.00 107.63 ?  462 THR D CA    1 
ATOM   9242  C  C     . THR D 2 83  ? -40.199  92.391  3.505   1.00 112.97 ?  462 THR D C     1 
ATOM   9243  O  O     . THR D 2 83  ? -39.581  93.379  3.918   1.00 115.92 ?  462 THR D O     1 
ATOM   9244  C  CB    . THR D 2 83  ? -39.977  93.015  1.022   1.00 107.17 ?  462 THR D CB    1 
ATOM   9245  O  OG1   . THR D 2 83  ? -41.306  93.477  0.756   1.00 106.83 ?  462 THR D OG1   1 
ATOM   9246  C  CG2   . THR D 2 83  ? -39.371  92.511  -0.272  1.00 104.31 ?  462 THR D CG2   1 
ATOM   9247  N  N     . ALA D 2 84  ? -41.038  91.700  4.267   1.00 110.23 ?  463 ALA D N     1 
ATOM   9248  C  CA    . ALA D 2 84  ? -41.158  91.947  5.701   1.00 107.96 ?  463 ALA D CA    1 
ATOM   9249  C  C     . ALA D 2 84  ? -40.289  90.972  6.504   1.00 109.59 ?  463 ALA D C     1 
ATOM   9250  O  O     . ALA D 2 84  ? -39.861  91.278  7.618   1.00 117.96 ?  463 ALA D O     1 
ATOM   9251  C  CB    . ALA D 2 84  ? -42.608  91.831  6.134   1.00 105.47 ?  463 ALA D CB    1 
ATOM   9252  N  N     . LYS D 2 85  ? -40.036  89.798  5.929   1.00 102.24 ?  464 LYS D N     1 
ATOM   9253  C  CA    . LYS D 2 85  ? -39.309  88.738  6.618   1.00 99.70  ?  464 LYS D CA    1 
ATOM   9254  C  C     . LYS D 2 85  ? -37.835  88.672  6.216   1.00 103.42 ?  464 LYS D C     1 
ATOM   9255  O  O     . LYS D 2 85  ? -36.959  88.514  7.059   1.00 106.19 ?  464 LYS D O     1 
ATOM   9256  C  CB    . LYS D 2 85  ? -39.982  87.374  6.375   1.00 95.46  ?  464 LYS D CB    1 
ATOM   9257  C  CG    . LYS D 2 85  ? -41.399  87.237  6.959   1.00 91.84  ?  464 LYS D CG    1 
ATOM   9258  C  CD    . LYS D 2 85  ? -42.007  85.841  6.728   1.00 85.25  ?  464 LYS D CD    1 
ATOM   9259  C  CE    . LYS D 2 85  ? -43.508  85.857  7.016   1.00 82.44  ?  464 LYS D CE    1 
ATOM   9260  N  NZ    . LYS D 2 85  ? -44.234  84.647  6.536   1.00 81.63  ?  464 LYS D NZ    1 
ATOM   9261  N  N     . ALA D 2 86  ? -37.562  88.795  4.926   1.00 105.69 ?  465 ALA D N     1 
ATOM   9262  C  CA    . ALA D 2 86  ? -36.214  88.562  4.422   1.00 107.14 ?  465 ALA D CA    1 
ATOM   9263  C  C     . ALA D 2 86  ? -35.267  89.738  4.661   1.00 108.73 ?  465 ALA D C     1 
ATOM   9264  O  O     . ALA D 2 86  ? -35.704  90.876  4.840   1.00 108.77 ?  465 ALA D O     1 
ATOM   9265  C  CB    . ALA D 2 86  ? -36.260  88.192  2.951   1.00 109.82 ?  465 ALA D CB    1 
ATOM   9266  N  N     . LYS D 2 87  ? -33.966  89.442  4.653   1.00 113.64 ?  466 LYS D N     1 
ATOM   9267  C  CA    . LYS D 2 87  ? -32.923  90.422  4.963   1.00 123.04 ?  466 LYS D CA    1 
ATOM   9268  C  C     . LYS D 2 87  ? -32.595  91.306  3.759   1.00 126.24 ?  466 LYS D C     1 
ATOM   9269  O  O     . LYS D 2 87  ? -32.245  90.789  2.699   1.00 129.03 ?  466 LYS D O     1 
ATOM   9270  C  CB    . LYS D 2 87  ? -31.661  89.698  5.443   1.00 123.67 ?  466 LYS D CB    1 
ATOM   9271  N  N     . MET D 2 88  ? -32.687  92.628  3.929   1.00 124.74 ?  467 MET D N     1 
ATOM   9272  C  CA    . MET D 2 88  ? -32.549  93.583  2.814   1.00 123.12 ?  467 MET D CA    1 
ATOM   9273  C  C     . MET D 2 88  ? -31.434  93.228  1.822   1.00 126.47 ?  467 MET D C     1 
ATOM   9274  O  O     . MET D 2 88  ? -31.427  93.707  0.685   1.00 123.09 ?  467 MET D O     1 
ATOM   9275  C  CB    . MET D 2 88  ? -32.367  95.018  3.331   1.00 117.03 ?  467 MET D CB    1 
ATOM   9276  C  CG    . MET D 2 88  ? -32.347  96.092  2.240   1.00 108.82 ?  467 MET D CG    1 
ATOM   9277  N  N     . ALA D 2 89  ? -30.497  92.391  2.268   1.00 131.18 ?  468 ALA D N     1 
ATOM   9278  C  CA    . ALA D 2 89  ? -29.431  91.869  1.413   1.00 134.20 ?  468 ALA D CA    1 
ATOM   9279  C  C     . ALA D 2 89  ? -29.996  90.885  0.393   1.00 134.39 ?  468 ALA D C     1 
ATOM   9280  O  O     . ALA D 2 89  ? -29.959  91.140  -0.812  1.00 137.96 ?  468 ALA D O     1 
ATOM   9281  C  CB    . ALA D 2 89  ? -28.358  91.195  2.258   1.00 133.62 ?  468 ALA D CB    1 
ATOM   9282  N  N     . ASP D 2 90  ? -30.517  89.763  0.886   1.00 128.93 ?  469 ASP D N     1 
ATOM   9283  C  CA    . ASP D 2 90  ? -31.224  88.794  0.049   1.00 123.24 ?  469 ASP D CA    1 
ATOM   9284  C  C     . ASP D 2 90  ? -32.336  89.442  -0.801  1.00 122.32 ?  469 ASP D C     1 
ATOM   9285  O  O     . ASP D 2 90  ? -32.732  88.895  -1.838  1.00 124.53 ?  469 ASP D O     1 
ATOM   9286  C  CB    . ASP D 2 90  ? -31.795  87.653  0.908   1.00 115.46 ?  469 ASP D CB    1 
ATOM   9287  C  CG    . ASP D 2 90  ? -30.722  86.696  1.402   1.00 112.45 ?  469 ASP D CG    1 
ATOM   9288  N  N     . ILE D 2 91  ? -32.830  90.602  -0.361  1.00 114.63 ?  470 ILE D N     1 
ATOM   9289  C  CA    . ILE D 2 91  ? -33.862  91.343  -1.096  1.00 107.57 ?  470 ILE D CA    1 
ATOM   9290  C  C     . ILE D 2 91  ? -33.346  92.039  -2.363  1.00 109.25 ?  470 ILE D C     1 
ATOM   9291  O  O     . ILE D 2 91  ? -33.939  91.893  -3.431  1.00 104.50 ?  470 ILE D O     1 
ATOM   9292  C  CB    . ILE D 2 91  ? -34.578  92.397  -0.217  1.00 103.09 ?  470 ILE D CB    1 
ATOM   9293  C  CG1   . ILE D 2 91  ? -35.469  91.718  0.828   1.00 104.72 ?  470 ILE D CG1   1 
ATOM   9294  C  CG2   . ILE D 2 91  ? -35.413  93.329  -1.091  1.00 99.72  ?  470 ILE D CG2   1 
ATOM   9295  C  CD1   . ILE D 2 91  ? -36.235  92.689  1.739   1.00 108.48 ?  470 ILE D CD1   1 
ATOM   9296  N  N     . LEU D 2 92  ? -32.261  92.805  -2.245  1.00 116.96 ?  471 LEU D N     1 
ATOM   9297  C  CA    . LEU D 2 92  ? -31.693  93.506  -3.404  1.00 120.03 ?  471 LEU D CA    1 
ATOM   9298  C  C     . LEU D 2 92  ? -31.142  92.515  -4.445  1.00 120.60 ?  471 LEU D C     1 
ATOM   9299  O  O     . LEU D 2 92  ? -30.892  92.882  -5.601  1.00 116.66 ?  471 LEU D O     1 
ATOM   9300  C  CB    . LEU D 2 92  ? -30.619  94.519  -2.975  1.00 117.02 ?  471 LEU D CB    1 
ATOM   9301  N  N     . LYS D 2 93  ? -30.986  91.257  -4.023  1.00 119.79 ?  472 LYS D N     1 
ATOM   9302  C  CA    . LYS D 2 93  ? -30.422  90.196  -4.858  1.00 116.14 ?  472 LYS D CA    1 
ATOM   9303  C  C     . LYS D 2 93  ? -31.495  89.285  -5.481  1.00 118.10 ?  472 LYS D C     1 
ATOM   9304  O  O     . LYS D 2 93  ? -31.173  88.247  -6.064  1.00 119.89 ?  472 LYS D O     1 
ATOM   9305  C  CB    . LYS D 2 93  ? -29.424  89.361  -4.042  1.00 111.33 ?  472 LYS D CB    1 
ATOM   9306  N  N     . ASN D 2 94  ? -32.762  89.683  -5.350  1.00 117.54 ?  473 ASN D N     1 
ATOM   9307  C  CA    . ASN D 2 94  ? -33.900  88.957  -5.928  1.00 113.64 ?  473 ASN D CA    1 
ATOM   9308  C  C     . ASN D 2 94  ? -34.372  89.583  -7.249  1.00 108.35 ?  473 ASN D C     1 
ATOM   9309  O  O     . ASN D 2 94  ? -34.715  90.772  -7.299  1.00 104.61 ?  473 ASN D O     1 
ATOM   9310  C  CB    . ASN D 2 94  ? -35.041  88.891  -4.908  1.00 115.96 ?  473 ASN D CB    1 
ATOM   9311  C  CG    . ASN D 2 94  ? -36.378  88.542  -5.534  1.00 115.28 ?  473 ASN D CG    1 
ATOM   9312  O  OD1   . ASN D 2 94  ? -37.238  89.406  -5.701  1.00 116.62 ?  473 ASN D OD1   1 
ATOM   9313  N  ND2   . ASN D 2 94  ? -36.568  87.271  -5.863  1.00 111.46 ?  473 ASN D ND2   1 
ATOM   9314  N  N     . GLU D 2 95  ? -34.389  88.775  -8.312  1.00 108.34 ?  474 GLU D N     1 
ATOM   9315  C  CA    . GLU D 2 95  ? -34.535  89.281  -9.687  1.00 107.33 ?  474 GLU D CA    1 
ATOM   9316  C  C     . GLU D 2 95  ? -35.849  90.022  -9.965  1.00 108.63 ?  474 GLU D C     1 
ATOM   9317  O  O     . GLU D 2 95  ? -35.870  90.983  -10.741 1.00 108.12 ?  474 GLU D O     1 
ATOM   9318  C  CB    . GLU D 2 95  ? -34.310  88.167  -10.723 1.00 99.70  ?  474 GLU D CB    1 
ATOM   9319  N  N     . GLU D 2 96  ? -36.937  89.587  -9.336  1.00 109.02 ?  475 GLU D N     1 
ATOM   9320  C  CA    . GLU D 2 96  ? -38.225  90.257  -9.526  1.00 113.94 ?  475 GLU D CA    1 
ATOM   9321  C  C     . GLU D 2 96  ? -38.222  91.682  -8.952  1.00 117.80 ?  475 GLU D C     1 
ATOM   9322  O  O     . GLU D 2 96  ? -38.563  92.644  -9.647  1.00 120.94 ?  475 GLU D O     1 
ATOM   9323  C  CB    . GLU D 2 96  ? -39.357  89.436  -8.914  1.00 117.07 ?  475 GLU D CB    1 
ATOM   9324  C  CG    . GLU D 2 96  ? -39.039  87.955  -8.780  1.00 124.56 ?  475 GLU D CG    1 
ATOM   9325  C  CD    . GLU D 2 96  ? -39.066  87.210  -10.105 1.00 128.10 ?  475 GLU D CD    1 
ATOM   9326  O  OE1   . GLU D 2 96  ? -39.788  87.651  -11.032 1.00 129.37 ?  475 GLU D OE1   1 
ATOM   9327  O  OE2   . GLU D 2 96  ? -38.367  86.176  -10.207 1.00 127.42 ?  475 GLU D OE2   1 
ATOM   9328  N  N     . ILE D 2 97  ? -37.831  91.810  -7.686  1.00 114.09 ?  476 ILE D N     1 
ATOM   9329  C  CA    . ILE D 2 97  ? -37.723  93.113  -7.034  1.00 106.42 ?  476 ILE D CA    1 
ATOM   9330  C  C     . ILE D 2 97  ? -36.757  94.044  -7.772  1.00 108.27 ?  476 ILE D C     1 
ATOM   9331  O  O     . ILE D 2 97  ? -37.074  95.212  -8.009  1.00 109.35 ?  476 ILE D O     1 
ATOM   9332  C  CB    . ILE D 2 97  ? -37.274  92.967  -5.569  1.00 99.03  ?  476 ILE D CB    1 
ATOM   9333  C  CG1   . ILE D 2 97  ? -38.255  92.081  -4.808  1.00 95.57  ?  476 ILE D CG1   1 
ATOM   9334  C  CG2   . ILE D 2 97  ? -37.190  94.333  -4.893  1.00 99.01  ?  476 ILE D CG2   1 
ATOM   9335  C  CD1   . ILE D 2 97  ? -39.529  92.809  -4.393  1.00 93.51  ?  476 ILE D CD1   1 
ATOM   9336  N  N     . ASN D 2 98  ? -35.580  93.533  -8.131  1.00 108.14 ?  477 ASN D N     1 
ATOM   9337  C  CA    . ASN D 2 98  ? -34.638  94.339  -8.902  1.00 113.61 ?  477 ASN D CA    1 
ATOM   9338  C  C     . ASN D 2 98  ? -35.216  94.795  -10.239 1.00 121.31 ?  477 ASN D C     1 
ATOM   9339  O  O     . ASN D 2 98  ? -35.107  95.970  -10.577 1.00 126.50 ?  477 ASN D O     1 
ATOM   9340  C  CB    . ASN D 2 98  ? -33.287  93.636  -9.094  1.00 109.26 ?  477 ASN D CB    1 
ATOM   9341  C  CG    . ASN D 2 98  ? -32.286  93.991  -8.010  1.00 106.11 ?  477 ASN D CG    1 
ATOM   9342  N  N     . THR D 2 99  ? -35.843  93.888  -10.991 1.00 120.55 ?  478 THR D N     1 
ATOM   9343  C  CA    . THR D 2 99  ? -36.369  94.267  -12.314 1.00 120.24 ?  478 THR D CA    1 
ATOM   9344  C  C     . THR D 2 99  ? -37.744  94.960  -12.277 1.00 113.68 ?  478 THR D C     1 
ATOM   9345  O  O     . THR D 2 99  ? -38.254  95.389  -13.313 1.00 108.64 ?  478 THR D O     1 
ATOM   9346  C  CB    . THR D 2 99  ? -36.337  93.108  -13.379 1.00 101.04 ?  478 THR D CB    1 
ATOM   9347  O  OG1   . THR D 2 99  ? -37.494  92.276  -13.249 1.00 98.65  ?  478 THR D OG1   1 
ATOM   9348  C  CG2   . THR D 2 99  ? -35.057  92.268  -13.259 1.00 100.82 ?  478 THR D CG2   1 
ATOM   9349  N  N     . MET D 2 100 ? -38.335  95.071  -11.090 1.00 111.12 ?  479 MET D N     1 
ATOM   9350  C  CA    . MET D 2 100 ? -39.461  95.982  -10.893 1.00 110.29 ?  479 MET D CA    1 
ATOM   9351  C  C     . MET D 2 100 ? -38.939  97.389  -10.598 1.00 117.27 ?  479 MET D C     1 
ATOM   9352  O  O     . MET D 2 100 ? -39.358  98.363  -11.228 1.00 121.92 ?  479 MET D O     1 
ATOM   9353  C  CB    . MET D 2 100 ? -40.351  95.532  -9.739  1.00 107.92 ?  479 MET D CB    1 
ATOM   9354  C  CG    . MET D 2 100 ? -41.322  94.418  -10.059 1.00 107.17 ?  479 MET D CG    1 
ATOM   9355  S  SD    . MET D 2 100 ? -42.282  93.882  -8.615  1.00 123.19 ?  479 MET D SD    1 
ATOM   9356  C  CE    . MET D 2 100 ? -43.190  95.381  -8.239  1.00 112.64 ?  479 MET D CE    1 
ATOM   9357  N  N     . ILE D 2 101 ? -38.026  97.490  -9.632  1.00 119.23 ?  480 ILE D N     1 
ATOM   9358  C  CA    . ILE D 2 101 ? -37.473  98.779  -9.239  1.00 120.99 ?  480 ILE D CA    1 
ATOM   9359  C  C     . ILE D 2 101 ? -36.779  99.473  -10.428 1.00 122.85 ?  480 ILE D C     1 
ATOM   9360  O  O     . ILE D 2 101 ? -36.888  100.695 -10.588 1.00 126.10 ?  480 ILE D O     1 
ATOM   9361  C  CB    . ILE D 2 101 ? -36.525  98.652  -8.014  1.00 80.47  ?  480 ILE D CB    1 
ATOM   9362  N  N     . TYR D 2 102 ? -36.108  98.687  -11.275 1.00 121.31 ?  481 TYR D N     1 
ATOM   9363  C  CA    . TYR D 2 102 ? -35.307  99.227  -12.388 1.00 123.24 ?  481 TYR D CA    1 
ATOM   9364  C  C     . TYR D 2 102 ? -36.048  99.344  -13.725 1.00 123.82 ?  481 TYR D C     1 
ATOM   9365  O  O     . TYR D 2 102 ? -35.428  99.630  -14.759 1.00 121.58 ?  481 TYR D O     1 
ATOM   9366  C  CB    . TYR D 2 102 ? -34.018  98.417  -12.585 1.00 120.14 ?  481 TYR D CB    1 
ATOM   9367  N  N     . THR D 2 103 ? -37.361  99.103  -13.707 1.00 124.89 ?  482 THR D N     1 
ATOM   9368  C  CA    . THR D 2 103 ? -38.203  99.333  -14.884 1.00 124.96 ?  482 THR D CA    1 
ATOM   9369  C  C     . THR D 2 103 ? -39.224  100.413 -14.577 1.00 124.58 ?  482 THR D C     1 
ATOM   9370  O  O     . THR D 2 103 ? -39.818  100.993 -15.493 1.00 127.95 ?  482 THR D O     1 
ATOM   9371  C  CB    . THR D 2 103 ? -38.956  98.061  -15.379 1.00 109.28 ?  482 THR D CB    1 
ATOM   9372  O  OG1   . THR D 2 103 ? -40.026  97.736  -14.480 1.00 107.04 ?  482 THR D OG1   1 
ATOM   9373  C  CG2   . THR D 2 103 ? -38.009  96.871  -15.533 1.00 107.36 ?  482 THR D CG2   1 
ATOM   9374  N  N     . ILE D 2 104 ? -39.429  100.671 -13.286 1.00 120.74 ?  483 ILE D N     1 
ATOM   9375  C  CA    . ILE D 2 104 ? -40.253  101.793 -12.852 1.00 124.63 ?  483 ILE D CA    1 
ATOM   9376  C  C     . ILE D 2 104 ? -39.404  103.056 -12.751 1.00 138.79 ?  483 ILE D C     1 
ATOM   9377  O  O     . ILE D 2 104 ? -39.928  104.158 -12.579 1.00 144.01 ?  483 ILE D O     1 
ATOM   9378  C  CB    . ILE D 2 104 ? -40.946  101.509 -11.520 1.00 116.06 ?  483 ILE D CB    1 
ATOM   9379  C  CG1   . ILE D 2 104 ? -41.862  100.296 -11.669 1.00 111.40 ?  483 ILE D CG1   1 
ATOM   9380  C  CG2   . ILE D 2 104 ? -41.747  102.712 -11.067 1.00 115.25 ?  483 ILE D CG2   1 
ATOM   9381  C  CD1   . ILE D 2 104 ? -42.736  100.054 -10.475 1.00 109.28 ?  483 ILE D CD1   1 
ATOM   9382  N  N     . GLY D 2 105 ? -38.089  102.877 -12.863 1.00 145.10 ?  484 GLY D N     1 
ATOM   9383  C  CA    . GLY D 2 105 ? -37.150  103.975 -13.034 1.00 152.35 ?  484 GLY D CA    1 
ATOM   9384  C  C     . GLY D 2 105 ? -37.127  105.023 -11.936 1.00 154.58 ?  484 GLY D C     1 
ATOM   9385  O  O     . GLY D 2 105 ? -36.799  106.188 -12.194 1.00 153.72 ?  484 GLY D O     1 
ATOM   9386  N  N     . ALA D 2 106 ? -37.458  104.612 -10.713 1.00 152.63 ?  485 ALA D N     1 
ATOM   9387  C  CA    . ALA D 2 106 ? -37.498  105.539 -9.587  1.00 151.01 ?  485 ALA D CA    1 
ATOM   9388  C  C     . ALA D 2 106 ? -36.725  105.040 -8.368  1.00 149.94 ?  485 ALA D C     1 
ATOM   9389  O  O     . ALA D 2 106 ? -36.936  105.528 -7.262  1.00 153.41 ?  485 ALA D O     1 
ATOM   9390  C  CB    . ALA D 2 106 ? -38.941  105.859 -9.212  1.00 146.52 ?  485 ALA D CB    1 
ATOM   9391  N  N     . GLY D 2 107 ? -35.822  104.085 -8.568  1.00 146.00 ?  486 GLY D N     1 
ATOM   9392  C  CA    . GLY D 2 107 ? -35.077  103.522 -7.454  1.00 148.25 ?  486 GLY D CA    1 
ATOM   9393  C  C     . GLY D 2 107 ? -36.000  102.955 -6.383  1.00 150.95 ?  486 GLY D C     1 
ATOM   9394  O  O     . GLY D 2 107 ? -37.196  102.762 -6.625  1.00 152.57 ?  486 GLY D O     1 
ATOM   9395  N  N     . VAL D 2 108 ? -35.450  102.687 -5.198  1.00 149.89 ?  487 VAL D N     1 
ATOM   9396  C  CA    . VAL D 2 108 ? -36.224  102.125 -4.088  1.00 145.15 ?  487 VAL D CA    1 
ATOM   9397  C  C     . VAL D 2 108 ? -35.889  102.791 -2.756  1.00 143.69 ?  487 VAL D C     1 
ATOM   9398  O  O     . VAL D 2 108 ? -34.841  103.421 -2.608  1.00 142.84 ?  487 VAL D O     1 
ATOM   9399  C  CB    . VAL D 2 108 ? -36.001  100.592 -3.937  1.00 84.69  ?  487 VAL D CB    1 
ATOM   9400  N  N     . GLY D 2 109 ? -36.795  102.646 -1.792  1.00 142.80 ?  488 GLY D N     1 
ATOM   9401  C  CA    . GLY D 2 109 ? -36.551  103.088 -0.430  1.00 143.66 ?  488 GLY D CA    1 
ATOM   9402  C  C     . GLY D 2 109 ? -36.703  104.579 -0.220  1.00 147.23 ?  488 GLY D C     1 
ATOM   9403  O  O     . GLY D 2 109 ? -37.627  105.203 -0.740  1.00 147.23 ?  488 GLY D O     1 
ATOM   9404  N  N     . ALA D 2 110 ? -35.785  105.150 0.552   1.00 152.35 ?  489 ALA D N     1 
ATOM   9405  C  CA    . ALA D 2 110 ? -35.833  106.570 0.878   1.00 159.72 ?  489 ALA D CA    1 
ATOM   9406  C  C     . ALA D 2 110 ? -35.169  107.424 -0.197  1.00 165.85 ?  489 ALA D C     1 
ATOM   9407  O  O     . ALA D 2 110 ? -35.288  108.652 -0.178  1.00 167.59 ?  489 ALA D O     1 
ATOM   9408  C  CB    . ALA D 2 110 ? -35.192  106.822 2.231   1.00 161.28 ?  489 ALA D CB    1 
ATOM   9409  N  N     . ASP D 2 111 ? -34.461  106.772 -1.122  1.00 169.07 ?  490 ASP D N     1 
ATOM   9410  C  CA    . ASP D 2 111 ? -33.871  107.454 -2.280  1.00 175.07 ?  490 ASP D CA    1 
ATOM   9411  C  C     . ASP D 2 111 ? -34.803  107.342 -3.491  1.00 173.05 ?  490 ASP D C     1 
ATOM   9412  O  O     . ASP D 2 111 ? -34.351  107.246 -4.637  1.00 172.96 ?  490 ASP D O     1 
ATOM   9413  C  CB    . ASP D 2 111 ? -32.488  106.881 -2.614  1.00 175.46 ?  490 ASP D CB    1 
ATOM   9414  N  N     . PHE D 2 112 ? -36.106  107.381 -3.211  1.00 168.39 ?  491 PHE D N     1 
ATOM   9415  C  CA    . PHE D 2 112 ? -37.159  107.105 -4.188  1.00 160.85 ?  491 PHE D CA    1 
ATOM   9416  C  C     . PHE D 2 112 ? -37.926  108.357 -4.640  1.00 159.93 ?  491 PHE D C     1 
ATOM   9417  O  O     . PHE D 2 112 ? -38.881  108.783 -3.986  1.00 160.24 ?  491 PHE D O     1 
ATOM   9418  C  CB    . PHE D 2 112 ? -38.127  106.074 -3.594  1.00 155.72 ?  491 PHE D CB    1 
ATOM   9419  C  CG    . PHE D 2 112 ? -39.382  105.867 -4.399  1.00 152.38 ?  491 PHE D CG    1 
ATOM   9420  C  CD1   . PHE D 2 112 ? -40.536  106.582 -4.105  1.00 151.74 ?  491 PHE D CD1   1 
ATOM   9421  C  CD2   . PHE D 2 112 ? -39.417  104.942 -5.435  1.00 146.43 ?  491 PHE D CD2   1 
ATOM   9422  C  CE1   . PHE D 2 112 ? -41.697  106.390 -4.838  1.00 147.05 ?  491 PHE D CE1   1 
ATOM   9423  C  CE2   . PHE D 2 112 ? -40.575  104.746 -6.171  1.00 141.34 ?  491 PHE D CE2   1 
ATOM   9424  C  CZ    . PHE D 2 112 ? -41.717  105.472 -5.870  1.00 141.41 ?  491 PHE D CZ    1 
ATOM   9425  N  N     . SER D 2 113 ? -37.510  108.939 -5.762  1.00 157.89 ?  492 SER D N     1 
ATOM   9426  C  CA    . SER D 2 113 ? -38.203  110.095 -6.323  1.00 157.38 ?  492 SER D CA    1 
ATOM   9427  C  C     . SER D 2 113 ? -39.489  109.660 -7.034  1.00 154.89 ?  492 SER D C     1 
ATOM   9428  O  O     . SER D 2 113 ? -39.435  108.943 -8.038  1.00 155.11 ?  492 SER D O     1 
ATOM   9429  C  CB    . SER D 2 113 ? -37.284  110.846 -7.292  1.00 157.61 ?  492 SER D CB    1 
ATOM   9430  N  N     . ILE D 2 114 ? -40.640  110.085 -6.511  1.00 149.70 ?  493 ILE D N     1 
ATOM   9431  C  CA    . ILE D 2 114 ? -41.933  109.759 -7.126  1.00 139.98 ?  493 ILE D CA    1 
ATOM   9432  C  C     . ILE D 2 114 ? -42.082  110.417 -8.497  1.00 141.55 ?  493 ILE D C     1 
ATOM   9433  O  O     . ILE D 2 114 ? -42.696  109.858 -9.411  1.00 134.60 ?  493 ILE D O     1 
ATOM   9434  C  CB    . ILE D 2 114 ? -43.120  110.194 -6.240  1.00 133.92 ?  493 ILE D CB    1 
ATOM   9435  N  N     . GLU D 2 115 ? -41.508  111.611 -8.627  1.00 148.92 ?  494 GLU D N     1 
ATOM   9436  C  CA    . GLU D 2 115 ? -41.607  112.402 -9.850  1.00 148.05 ?  494 GLU D CA    1 
ATOM   9437  C  C     . GLU D 2 115 ? -40.886  111.739 -11.024 1.00 149.13 ?  494 GLU D C     1 
ATOM   9438  O  O     . GLU D 2 115 ? -41.180  112.025 -12.185 1.00 150.85 ?  494 GLU D O     1 
ATOM   9439  C  CB    . GLU D 2 115 ? -41.059  113.817 -9.617  1.00 144.99 ?  494 GLU D CB    1 
ATOM   9440  N  N     . ASP D 2 116 ? -39.948  110.848 -10.719 1.00 147.91 ?  495 ASP D N     1 
ATOM   9441  C  CA    . ASP D 2 116 ? -39.158  110.201 -11.760 1.00 148.62 ?  495 ASP D CA    1 
ATOM   9442  C  C     . ASP D 2 116 ? -39.679  108.794 -12.128 1.00 150.35 ?  495 ASP D C     1 
ATOM   9443  O  O     . ASP D 2 116 ? -38.956  107.995 -12.730 1.00 152.28 ?  495 ASP D O     1 
ATOM   9444  C  CB    . ASP D 2 116 ? -37.670  110.175 -11.366 1.00 145.60 ?  495 ASP D CB    1 
ATOM   9445  N  N     . ALA D 2 117 ? -40.932  108.498 -11.778 1.00 146.70 ?  496 ALA D N     1 
ATOM   9446  C  CA    . ALA D 2 117 ? -41.552  107.222 -12.159 1.00 138.78 ?  496 ALA D CA    1 
ATOM   9447  C  C     . ALA D 2 117 ? -41.782  107.143 -13.670 1.00 141.00 ?  496 ALA D C     1 
ATOM   9448  O  O     . ALA D 2 117 ? -41.547  108.114 -14.398 1.00 145.13 ?  496 ALA D O     1 
ATOM   9449  C  CB    . ALA D 2 117 ? -42.865  106.998 -11.404 1.00 130.62 ?  496 ALA D CB    1 
ATOM   9450  N  N     . ASN D 2 118 ? -42.241  105.983 -14.136 1.00 137.16 ?  497 ASN D N     1 
ATOM   9451  C  CA    . ASN D 2 118 ? -42.467  105.763 -15.566 1.00 133.73 ?  497 ASN D CA    1 
ATOM   9452  C  C     . ASN D 2 118 ? -43.935  105.553 -15.912 1.00 131.27 ?  497 ASN D C     1 
ATOM   9453  O  O     . ASN D 2 118 ? -44.349  105.734 -17.058 1.00 128.29 ?  497 ASN D O     1 
ATOM   9454  C  CB    . ASN D 2 118 ? -41.656  104.564 -16.067 1.00 125.83 ?  497 ASN D CB    1 
ATOM   9455  C  CG    . ASN D 2 118 ? -40.197  104.897 -16.291 1.00 124.95 ?  497 ASN D CG    1 
ATOM   9456  O  OD1   . ASN D 2 118 ? -39.851  106.034 -16.621 1.00 134.63 ?  497 ASN D OD1   1 
ATOM   9457  N  ND2   . ASN D 2 118 ? -39.331  103.904 -16.121 1.00 117.16 ?  497 ASN D ND2   1 
ATOM   9458  N  N     . TYR D 2 119 ? -44.715  105.165 -14.910 1.00 130.07 ?  498 TYR D N     1 
ATOM   9459  C  CA    . TYR D 2 119 ? -46.105  104.803 -15.130 1.00 128.29 ?  498 TYR D CA    1 
ATOM   9460  C  C     . TYR D 2 119 ? -47.039  105.604 -14.229 1.00 126.05 ?  498 TYR D C     1 
ATOM   9461  O  O     . TYR D 2 119 ? -46.692  105.954 -13.102 1.00 121.38 ?  498 TYR D O     1 
ATOM   9462  C  CB    . TYR D 2 119 ? -46.295  103.292 -14.933 1.00 124.73 ?  498 TYR D CB    1 
ATOM   9463  C  CG    . TYR D 2 119 ? -45.337  102.458 -15.769 1.00 124.11 ?  498 TYR D CG    1 
ATOM   9464  C  CD1   . TYR D 2 119 ? -45.714  101.955 -17.011 1.00 125.05 ?  498 TYR D CD1   1 
ATOM   9465  C  CD2   . TYR D 2 119 ? -44.048  102.192 -15.324 1.00 122.73 ?  498 TYR D CD2   1 
ATOM   9466  C  CE1   . TYR D 2 119 ? -44.839  101.202 -17.775 1.00 124.44 ?  498 TYR D CE1   1 
ATOM   9467  C  CE2   . TYR D 2 119 ? -43.169  101.445 -16.081 1.00 122.91 ?  498 TYR D CE2   1 
ATOM   9468  C  CZ    . TYR D 2 119 ? -43.569  100.953 -17.302 1.00 124.73 ?  498 TYR D CZ    1 
ATOM   9469  O  OH    . TYR D 2 119 ? -42.684  100.212 -18.046 1.00 126.64 ?  498 TYR D OH    1 
ATOM   9470  N  N     . ASP D 2 120 ? -48.219  105.913 -14.747 1.00 129.10 ?  499 ASP D N     1 
ATOM   9471  C  CA    . ASP D 2 120 ? -49.218  106.646 -13.988 1.00 132.13 ?  499 ASP D CA    1 
ATOM   9472  C  C     . ASP D 2 120 ? -50.189  105.671 -13.322 1.00 129.70 ?  499 ASP D C     1 
ATOM   9473  O  O     . ASP D 2 120 ? -50.980  106.051 -12.458 1.00 134.52 ?  499 ASP D O     1 
ATOM   9474  C  CB    . ASP D 2 120 ? -49.959  107.624 -14.902 1.00 138.45 ?  499 ASP D CB    1 
ATOM   9475  C  CG    . ASP D 2 120 ? -51.130  108.295 -14.214 1.00 144.10 ?  499 ASP D CG    1 
ATOM   9476  O  OD1   . ASP D 2 120 ? -50.972  109.446 -13.743 1.00 147.08 ?  499 ASP D OD1   1 
ATOM   9477  O  OD2   . ASP D 2 120 ? -52.209  107.664 -14.149 1.00 144.66 ?  499 ASP D OD2   1 
ATOM   9478  N  N     . LYS D 2 121 ? -50.120  104.407 -13.725 1.00 122.32 ?  500 LYS D N     1 
ATOM   9479  C  CA    . LYS D 2 121 ? -50.938  103.367 -13.108 1.00 116.04 ?  500 LYS D CA    1 
ATOM   9480  C  C     . LYS D 2 121 ? -50.196  102.023 -13.108 1.00 120.27 ?  500 LYS D C     1 
ATOM   9481  O  O     . LYS D 2 121 ? -49.864  101.492 -14.169 1.00 125.82 ?  500 LYS D O     1 
ATOM   9482  C  CB    . LYS D 2 121 ? -52.312  103.257 -13.799 1.00 106.56 ?  500 LYS D CB    1 
ATOM   9483  N  N     . ILE D 2 122 ? -49.913  101.496 -11.915 1.00 116.65 ?  501 ILE D N     1 
ATOM   9484  C  CA    . ILE D 2 122 ? -49.336  100.155 -11.781 1.00 109.45 ?  501 ILE D CA    1 
ATOM   9485  C  C     . ILE D 2 122 ? -50.412  99.143  -11.391 1.00 107.53 ?  501 ILE D C     1 
ATOM   9486  O  O     . ILE D 2 122 ? -51.045  99.256  -10.343 1.00 105.19 ?  501 ILE D O     1 
ATOM   9487  C  CB    . ILE D 2 122 ? -48.179  100.105 -10.767 1.00 105.50 ?  501 ILE D CB    1 
ATOM   9488  C  CG1   . ILE D 2 122 ? -47.075  101.069 -11.190 1.00 110.19 ?  501 ILE D CG1   1 
ATOM   9489  C  CG2   . ILE D 2 122 ? -47.633  98.682  -10.645 1.00 96.12  ?  501 ILE D CG2   1 
ATOM   9490  C  CD1   . ILE D 2 122 ? -45.757  100.806 -10.516 1.00 111.82 ?  501 ILE D CD1   1 
ATOM   9491  N  N     . ILE D 2 123 ? -50.614  98.152  -12.248 1.00 111.31 ?  502 ILE D N     1 
ATOM   9492  C  CA    . ILE D 2 123 ? -51.762  97.268  -12.127 1.00 113.68 ?  502 ILE D CA    1 
ATOM   9493  C  C     . ILE D 2 123 ? -51.350  95.848  -11.735 1.00 111.51 ?  502 ILE D C     1 
ATOM   9494  O  O     . ILE D 2 123 ? -50.646  95.175  -12.486 1.00 114.95 ?  502 ILE D O     1 
ATOM   9495  C  CB    . ILE D 2 123 ? -52.555  97.237  -13.461 1.00 96.38  ?  502 ILE D CB    1 
ATOM   9496  C  CG1   . ILE D 2 123 ? -52.959  98.656  -13.888 1.00 96.04  ?  502 ILE D CG1   1 
ATOM   9497  C  CG2   . ILE D 2 123 ? -53.781  96.365  -13.339 1.00 95.87  ?  502 ILE D CG2   1 
ATOM   9498  C  CD1   . ILE D 2 123 ? -53.577  98.746  -15.285 1.00 92.49  ?  502 ILE D CD1   1 
ATOM   9499  N  N     . ILE D 2 124 ? -51.773  95.398  -10.556 1.00 104.84 ?  503 ILE D N     1 
ATOM   9500  C  CA    . ILE D 2 124 ? -51.551  94.011  -10.165 1.00 99.18  ?  503 ILE D CA    1 
ATOM   9501  C  C     . ILE D 2 124 ? -52.702  93.168  -10.685 1.00 100.73 ?  503 ILE D C     1 
ATOM   9502  O  O     . ILE D 2 124 ? -53.867  93.447  -10.401 1.00 102.54 ?  503 ILE D O     1 
ATOM   9503  C  CB    . ILE D 2 124 ? -51.477  93.834  -8.645  1.00 98.72  ?  503 ILE D CB    1 
ATOM   9504  C  CG1   . ILE D 2 124 ? -50.548  94.878  -8.024  1.00 98.83  ?  503 ILE D CG1   1 
ATOM   9505  C  CG2   . ILE D 2 124 ? -51.034  92.413  -8.308  1.00 94.84  ?  503 ILE D CG2   1 
ATOM   9506  C  CD1   . ILE D 2 124 ? -50.827  95.142  -6.557  1.00 93.79  ?  503 ILE D CD1   1 
ATOM   9507  N  N     . MET D 2 125 ? -52.363  92.135  -11.446 1.00 102.85 ?  504 MET D N     1 
ATOM   9508  C  CA    . MET D 2 125 ? -53.345  91.319  -12.142 1.00 104.69 ?  504 MET D CA    1 
ATOM   9509  C  C     . MET D 2 125 ? -52.992  89.869  -11.894 1.00 104.46 ?  504 MET D C     1 
ATOM   9510  O  O     . MET D 2 125 ? -52.048  89.339  -12.482 1.00 104.72 ?  504 MET D O     1 
ATOM   9511  C  CB    . MET D 2 125 ? -53.292  91.611  -13.644 1.00 106.41 ?  504 MET D CB    1 
ATOM   9512  C  CG    . MET D 2 125 ? -54.631  91.533  -14.361 1.00 106.64 ?  504 MET D CG    1 
ATOM   9513  S  SD    . MET D 2 125 ? -54.471  91.844  -16.138 1.00 111.00 ?  504 MET D SD    1 
ATOM   9514  C  CE    . MET D 2 125 ? -53.940  90.239  -16.720 1.00 69.42  ?  504 MET D CE    1 
ATOM   9515  N  N     . THR D 2 126 ? -53.747  89.232  -11.011 1.00 101.51 ?  505 THR D N     1 
ATOM   9516  C  CA    . THR D 2 126 ? -53.462  87.864  -10.610 1.00 93.11  ?  505 THR D CA    1 
ATOM   9517  C  C     . THR D 2 126 ? -54.688  87.004  -10.820 1.00 91.93  ?  505 THR D C     1 
ATOM   9518  O  O     . THR D 2 126 ? -55.805  87.510  -10.821 1.00 88.73  ?  505 THR D O     1 
ATOM   9519  C  CB    . THR D 2 126 ? -53.126  87.801  -9.122  1.00 86.88  ?  505 THR D CB    1 
ATOM   9520  O  OG1   . THR D 2 126 ? -54.284  88.191  -8.361  1.00 89.17  ?  505 THR D OG1   1 
ATOM   9521  C  CG2   . THR D 2 126 ? -51.950  88.722  -8.802  1.00 81.67  ?  505 THR D CG2   1 
ATOM   9522  N  N     . ASP D 2 127 ? -54.484  85.700  -10.982 1.00 98.15  ?  506 ASP D N     1 
ATOM   9523  C  CA    . ASP D 2 127 ? -55.613  84.780  -11.046 1.00 102.69 ?  506 ASP D CA    1 
ATOM   9524  C  C     . ASP D 2 127 ? -56.554  85.152  -9.901  1.00 95.17  ?  506 ASP D C     1 
ATOM   9525  O  O     . ASP D 2 127 ? -56.136  85.766  -8.916  1.00 90.79  ?  506 ASP D O     1 
ATOM   9526  C  CB    . ASP D 2 127 ? -55.163  83.309  -10.928 1.00 111.56 ?  506 ASP D CB    1 
ATOM   9527  C  CG    . ASP D 2 127 ? -54.380  82.811  -12.158 1.00 120.97 ?  506 ASP D CG    1 
ATOM   9528  O  OD1   . ASP D 2 127 ? -54.238  83.569  -13.149 1.00 124.60 ?  506 ASP D OD1   1 
ATOM   9529  O  OD2   . ASP D 2 127 ? -53.914  81.645  -12.134 1.00 121.79 ?  506 ASP D OD2   1 
ATOM   9530  N  N     . ALA D 2 128 ? -57.829  84.810  -10.035 1.00 94.22  ?  507 ALA D N     1 
ATOM   9531  C  CA    . ALA D 2 128 ? -58.764  85.011  -8.936  1.00 94.84  ?  507 ALA D CA    1 
ATOM   9532  C  C     . ALA D 2 128 ? -58.832  83.737  -8.088  1.00 100.90 ?  507 ALA D C     1 
ATOM   9533  O  O     . ALA D 2 128 ? -59.904  83.186  -7.840  1.00 98.56  ?  507 ALA D O     1 
ATOM   9534  C  CB    . ALA D 2 128 ? -60.132  85.393  -9.464  1.00 92.80  ?  507 ALA D CB    1 
ATOM   9535  N  N     . ASP D 2 129 ? -57.666  83.248  -7.678  1.00 104.75 ?  508 ASP D N     1 
ATOM   9536  C  CA    . ASP D 2 129 ? -57.610  82.127  -6.754  1.00 101.49 ?  508 ASP D CA    1 
ATOM   9537  C  C     . ASP D 2 129 ? -56.894  82.555  -5.476  1.00 99.76  ?  508 ASP D C     1 
ATOM   9538  O  O     . ASP D 2 129 ? -56.462  83.704  -5.358  1.00 97.63  ?  508 ASP D O     1 
ATOM   9539  C  CB    . ASP D 2 129 ? -57.032  80.836  -7.396  1.00 115.89 ?  508 ASP D CB    1 
ATOM   9540  C  CG    . ASP D 2 129 ? -55.670  81.034  -8.080  1.00 119.95 ?  508 ASP D CG    1 
ATOM   9541  O  OD1   . ASP D 2 129 ? -54.927  81.968  -7.703  1.00 119.07 ?  508 ASP D OD1   1 
ATOM   9542  O  OD2   . ASP D 2 129 ? -55.337  80.211  -8.980  1.00 124.46 ?  508 ASP D OD2   1 
ATOM   9543  N  N     . THR D 2 130 ? -56.804  81.646  -4.512  1.00 98.12  ?  509 THR D N     1 
ATOM   9544  C  CA    . THR D 2 130 ? -56.173  81.952  -3.232  1.00 89.65  ?  509 THR D CA    1 
ATOM   9545  C  C     . THR D 2 130 ? -54.736  82.411  -3.401  1.00 82.87  ?  509 THR D C     1 
ATOM   9546  O  O     . THR D 2 130 ? -54.345  83.438  -2.844  1.00 82.87  ?  509 THR D O     1 
ATOM   9547  C  CB    . THR D 2 130 ? -56.182  80.743  -2.296  1.00 89.36  ?  509 THR D CB    1 
ATOM   9548  O  OG1   . THR D 2 130 ? -56.010  79.553  -3.074  1.00 94.63  ?  509 THR D OG1   1 
ATOM   9549  C  CG2   . THR D 2 130 ? -57.496  80.677  -1.542  1.00 86.02  ?  509 THR D CG2   1 
ATOM   9550  N  N     . ASP D 2 131 ? -53.950  81.651  -4.161  1.00 79.36  ?  510 ASP D N     1 
ATOM   9551  C  CA    . ASP D 2 131 ? -52.556  82.016  -4.382  1.00 79.55  ?  510 ASP D CA    1 
ATOM   9552  C  C     . ASP D 2 131 ? -52.439  83.314  -5.168  1.00 84.94  ?  510 ASP D C     1 
ATOM   9553  O  O     . ASP D 2 131 ? -51.415  83.994  -5.109  1.00 90.47  ?  510 ASP D O     1 
ATOM   9554  C  CB    . ASP D 2 131 ? -51.806  80.908  -5.089  1.00 78.87  ?  510 ASP D CB    1 
ATOM   9555  C  CG    . ASP D 2 131 ? -52.026  79.566  -4.447  1.00 81.92  ?  510 ASP D CG    1 
ATOM   9556  O  OD1   . ASP D 2 131 ? -51.172  79.185  -3.621  1.00 83.23  ?  510 ASP D OD1   1 
ATOM   9557  O  OD2   . ASP D 2 131 ? -53.047  78.900  -4.771  1.00 80.43  ?  510 ASP D OD2   1 
ATOM   9558  N  N     . GLY D 2 132 ? -53.485  83.660  -5.908  1.00 86.07  ?  511 GLY D N     1 
ATOM   9559  C  CA    . GLY D 2 132 ? -53.535  84.967  -6.528  1.00 88.76  ?  511 GLY D CA    1 
ATOM   9560  C  C     . GLY D 2 132 ? -53.603  85.981  -5.409  1.00 94.02  ?  511 GLY D C     1 
ATOM   9561  O  O     . GLY D 2 132 ? -52.815  86.928  -5.335  1.00 96.98  ?  511 GLY D O     1 
ATOM   9562  N  N     . ALA D 2 133 ? -54.559  85.757  -4.516  1.00 92.05  ?  512 ALA D N     1 
ATOM   9563  C  CA    . ALA D 2 133 ? -54.722  86.594  -3.345  1.00 86.33  ?  512 ALA D CA    1 
ATOM   9564  C  C     . ALA D 2 133 ? -53.419  86.665  -2.550  1.00 89.17  ?  512 ALA D C     1 
ATOM   9565  O  O     . ALA D 2 133 ? -53.066  87.721  -2.033  1.00 93.71  ?  512 ALA D O     1 
ATOM   9566  C  CB    . ALA D 2 133 ? -55.847  86.067  -2.494  1.00 80.92  ?  512 ALA D CB    1 
ATOM   9567  N  N     . HIS D 2 134 ? -52.689  85.553  -2.462  1.00 87.25  ?  513 HIS D N     1 
ATOM   9568  C  CA    . HIS D 2 134 ? -51.428  85.574  -1.725  1.00 86.59  ?  513 HIS D CA    1 
ATOM   9569  C  C     . HIS D 2 134 ? -50.418  86.525  -2.365  1.00 85.69  ?  513 HIS D C     1 
ATOM   9570  O  O     . HIS D 2 134 ? -49.809  87.334  -1.663  1.00 89.70  ?  513 HIS D O     1 
ATOM   9571  C  CB    . HIS D 2 134 ? -50.824  84.180  -1.553  1.00 84.66  ?  513 HIS D CB    1 
ATOM   9572  C  CG    . HIS D 2 134 ? -49.651  84.143  -0.616  1.00 85.94  ?  513 HIS D CG    1 
ATOM   9573  N  ND1   . HIS D 2 134 ? -48.569  83.305  -0.802  1.00 86.21  ?  513 HIS D ND1   1 
ATOM   9574  C  CD2   . HIS D 2 134 ? -49.389  84.848  0.512   1.00 86.38  ?  513 HIS D CD2   1 
ATOM   9575  C  CE1   . HIS D 2 134 ? -47.694  83.497  0.168   1.00 84.99  ?  513 HIS D CE1   1 
ATOM   9576  N  NE2   . HIS D 2 134 ? -48.169  84.425  0.982   1.00 86.22  ?  513 HIS D NE2   1 
ATOM   9577  N  N     . ILE D 2 135 ? -50.243  86.433  -3.685  1.00 77.07  ?  514 ILE D N     1 
ATOM   9578  C  CA    . ILE D 2 135 ? -49.332  87.340  -4.384  1.00 79.60  ?  514 ILE D CA    1 
ATOM   9579  C  C     . ILE D 2 135 ? -49.699  88.808  -4.150  1.00 81.69  ?  514 ILE D C     1 
ATOM   9580  O  O     . ILE D 2 135 ? -48.820  89.658  -3.956  1.00 81.47  ?  514 ILE D O     1 
ATOM   9581  C  CB    . ILE D 2 135 ? -49.250  87.083  -5.917  1.00 76.21  ?  514 ILE D CB    1 
ATOM   9582  C  CG1   . ILE D 2 135 ? -48.147  86.086  -6.252  1.00 78.30  ?  514 ILE D CG1   1 
ATOM   9583  C  CG2   . ILE D 2 135 ? -48.903  88.367  -6.644  1.00 73.75  ?  514 ILE D CG2   1 
ATOM   9584  C  CD1   . ILE D 2 135 ? -48.653  84.705  -6.594  1.00 81.31  ?  514 ILE D CD1   1 
ATOM   9585  N  N     . GLN D 2 136 ? -50.990  89.120  -4.179  1.00 82.86  ?  515 GLN D N     1 
ATOM   9586  C  CA    . GLN D 2 136 ? -51.395  90.509  -4.012  1.00 94.41  ?  515 GLN D CA    1 
ATOM   9587  C  C     . GLN D 2 136 ? -50.901  90.983  -2.661  1.00 100.03 ?  515 GLN D C     1 
ATOM   9588  O  O     . GLN D 2 136 ? -50.449  92.114  -2.493  1.00 100.56 ?  515 GLN D O     1 
ATOM   9589  C  CB    . GLN D 2 136 ? -52.910  90.654  -4.104  1.00 99.64  ?  515 GLN D CB    1 
ATOM   9590  C  CG    . GLN D 2 136 ? -53.488  90.205  -5.426  1.00 100.89 ?  515 GLN D CG    1 
ATOM   9591  C  CD    . GLN D 2 136 ? -54.971  90.444  -5.497  1.00 104.07 ?  515 GLN D CD    1 
ATOM   9592  O  OE1   . GLN D 2 136 ? -55.560  91.045  -4.595  1.00 103.24 ?  515 GLN D OE1   1 
ATOM   9593  N  NE2   . GLN D 2 136 ? -55.591  89.972  -6.567  1.00 107.58 ?  515 GLN D NE2   1 
ATOM   9594  N  N     . THR D 2 137 ? -50.983  90.076  -1.700  1.00 101.88 ?  516 THR D N     1 
ATOM   9595  C  CA    . THR D 2 137 ? -50.524  90.319  -0.350  1.00 102.27 ?  516 THR D CA    1 
ATOM   9596  C  C     . THR D 2 137 ? -49.032  90.676  -0.302  1.00 99.39  ?  516 THR D C     1 
ATOM   9597  O  O     . THR D 2 137 ? -48.625  91.592  0.404   1.00 103.07 ?  516 THR D O     1 
ATOM   9598  C  CB    . THR D 2 137 ? -50.803  89.078  0.502   1.00 104.04 ?  516 THR D CB    1 
ATOM   9599  O  OG1   . THR D 2 137 ? -51.636  89.439  1.609   1.00 108.76 ?  516 THR D OG1   1 
ATOM   9600  C  CG2   . THR D 2 137 ? -49.506  88.451  0.991   1.00 103.83 ?  516 THR D CG2   1 
ATOM   9601  N  N     . LEU D 2 138 ? -48.225  89.960  -1.071  1.00 92.93  ?  517 LEU D N     1 
ATOM   9602  C  CA    . LEU D 2 138 ? -46.781  90.124  -1.036  1.00 93.80  ?  517 LEU D CA    1 
ATOM   9603  C  C     . LEU D 2 138 ? -46.325  91.355  -1.814  1.00 101.07 ?  517 LEU D C     1 
ATOM   9604  O  O     . LEU D 2 138 ? -45.428  92.082  -1.370  1.00 104.70 ?  517 LEU D O     1 
ATOM   9605  C  CB    . LEU D 2 138 ? -46.099  88.865  -1.580  1.00 94.32  ?  517 LEU D CB    1 
ATOM   9606  C  CG    . LEU D 2 138 ? -46.378  87.587  -0.782  1.00 91.21  ?  517 LEU D CG    1 
ATOM   9607  C  CD1   . LEU D 2 138 ? -46.489  86.388  -1.687  1.00 84.62  ?  517 LEU D CD1   1 
ATOM   9608  C  CD2   . LEU D 2 138 ? -45.288  87.355  0.245   1.00 94.80  ?  517 LEU D CD2   1 
ATOM   9609  N  N     . LEU D 2 139 ? -46.934  91.585  -2.975  1.00 101.05 ?  518 LEU D N     1 
ATOM   9610  C  CA    . LEU D 2 139 ? -46.574  92.737  -3.799  1.00 100.93 ?  518 LEU D CA    1 
ATOM   9611  C  C     . LEU D 2 139 ? -46.904  94.025  -3.070  1.00 108.05 ?  518 LEU D C     1 
ATOM   9612  O  O     . LEU D 2 139 ? -46.091  94.946  -3.021  1.00 111.82 ?  518 LEU D O     1 
ATOM   9613  C  CB    . LEU D 2 139 ? -47.291  92.695  -5.145  1.00 97.96  ?  518 LEU D CB    1 
ATOM   9614  C  CG    . LEU D 2 139 ? -46.714  91.664  -6.118  1.00 95.06  ?  518 LEU D CG    1 
ATOM   9615  C  CD1   . LEU D 2 139 ? -47.666  91.401  -7.269  1.00 97.67  ?  518 LEU D CD1   1 
ATOM   9616  C  CD2   . LEU D 2 139 ? -45.356  92.107  -6.632  1.00 87.11  ?  518 LEU D CD2   1 
ATOM   9617  N  N     . LEU D 2 140 ? -48.100  94.079  -2.495  1.00 108.81 ?  519 LEU D N     1 
ATOM   9618  C  CA    . LEU D 2 140 ? -48.515  95.226  -1.694  1.00 105.72 ?  519 LEU D CA    1 
ATOM   9619  C  C     . LEU D 2 140 ? -47.557  95.517  -0.524  1.00 106.38 ?  519 LEU D C     1 
ATOM   9620  O  O     . LEU D 2 140 ? -47.113  96.657  -0.364  1.00 107.03 ?  519 LEU D O     1 
ATOM   9621  C  CB    . LEU D 2 140 ? -49.972  95.071  -1.222  1.00 98.26  ?  519 LEU D CB    1 
ATOM   9622  C  CG    . LEU D 2 140 ? -51.049  95.454  -2.257  1.00 88.18  ?  519 LEU D CG    1 
ATOM   9623  C  CD1   . LEU D 2 140 ? -52.470  95.042  -1.824  1.00 76.71  ?  519 LEU D CD1   1 
ATOM   9624  C  CD2   . LEU D 2 140 ? -50.988  96.960  -2.583  1.00 89.27  ?  519 LEU D CD2   1 
ATOM   9625  N  N     . THR D 2 141 ? -47.218  94.506  0.278   1.00 102.35 ?  520 THR D N     1 
ATOM   9626  C  CA    . THR D 2 141 ? -46.291  94.739  1.388   1.00 103.75 ?  520 THR D CA    1 
ATOM   9627  C  C     . THR D 2 141 ? -44.977  95.350  0.899   1.00 110.97 ?  520 THR D C     1 
ATOM   9628  O  O     . THR D 2 141 ? -44.346  96.128  1.618   1.00 115.50 ?  520 THR D O     1 
ATOM   9629  C  CB    . THR D 2 141 ? -45.980  93.469  2.215   1.00 96.60  ?  520 THR D CB    1 
ATOM   9630  O  OG1   . THR D 2 141 ? -45.041  92.651  1.512   1.00 101.71 ?  520 THR D OG1   1 
ATOM   9631  C  CG2   . THR D 2 141 ? -47.238  92.680  2.513   1.00 90.87  ?  520 THR D CG2   1 
ATOM   9632  N  N     . PHE D 2 142 ? -44.569  95.003  -0.319  1.00 111.35 ?  521 PHE D N     1 
ATOM   9633  C  CA    . PHE D 2 142 ? -43.334  95.546  -0.889  1.00 115.47 ?  521 PHE D CA    1 
ATOM   9634  C  C     . PHE D 2 142 ? -43.412  97.044  -1.193  1.00 116.72 ?  521 PHE D C     1 
ATOM   9635  O  O     . PHE D 2 142 ? -42.530  97.815  -0.796  1.00 119.25 ?  521 PHE D O     1 
ATOM   9636  C  CB    . PHE D 2 142 ? -42.923  94.789  -2.156  1.00 114.15 ?  521 PHE D CB    1 
ATOM   9637  C  CG    . PHE D 2 142 ? -41.844  95.482  -2.948  1.00 112.42 ?  521 PHE D CG    1 
ATOM   9638  C  CD1   . PHE D 2 142 ? -42.122  96.043  -4.185  1.00 111.75 ?  521 PHE D CD1   1 
ATOM   9639  C  CD2   . PHE D 2 142 ? -40.557  95.592  -2.446  1.00 109.83 ?  521 PHE D CD2   1 
ATOM   9640  C  CE1   . PHE D 2 142 ? -41.140  96.684  -4.906  1.00 110.45 ?  521 PHE D CE1   1 
ATOM   9641  C  CE2   . PHE D 2 142 ? -39.572  96.234  -3.162  1.00 108.60 ?  521 PHE D CE2   1 
ATOM   9642  C  CZ    . PHE D 2 142 ? -39.862  96.782  -4.391  1.00 111.02 ?  521 PHE D CZ    1 
ATOM   9643  N  N     . PHE D 2 143 ? -44.454  97.448  -1.913  1.00 113.66 ?  522 PHE D N     1 
ATOM   9644  C  CA    . PHE D 2 143 ? -44.635  98.856  -2.252  1.00 115.98 ?  522 PHE D CA    1 
ATOM   9645  C  C     . PHE D 2 143 ? -44.753  99.695  -0.988  1.00 117.29 ?  522 PHE D C     1 
ATOM   9646  O  O     . PHE D 2 143 ? -44.064  100.702 -0.833  1.00 118.58 ?  522 PHE D O     1 
ATOM   9647  C  CB    . PHE D 2 143 ? -45.856  99.045  -3.153  1.00 116.10 ?  522 PHE D CB    1 
ATOM   9648  C  CG    . PHE D 2 143 ? -45.680  98.474  -4.529  1.00 117.50 ?  522 PHE D CG    1 
ATOM   9649  C  CD1   . PHE D 2 143 ? -44.504  98.682  -5.233  1.00 120.80 ?  522 PHE D CD1   1 
ATOM   9650  C  CD2   . PHE D 2 143 ? -46.677  97.716  -5.112  1.00 116.14 ?  522 PHE D CD2   1 
ATOM   9651  C  CE1   . PHE D 2 143 ? -44.330  98.150  -6.502  1.00 118.25 ?  522 PHE D CE1   1 
ATOM   9652  C  CE2   . PHE D 2 143 ? -46.508  97.180  -6.377  1.00 116.56 ?  522 PHE D CE2   1 
ATOM   9653  C  CZ    . PHE D 2 143 ? -45.334  97.398  -7.074  1.00 116.43 ?  522 PHE D CZ    1 
ATOM   9654  N  N     . TYR D 2 144 ? -45.626  99.266  -0.084  1.00 116.40 ?  523 TYR D N     1 
ATOM   9655  C  CA    . TYR D 2 144 ? -45.737  99.876  1.230   1.00 117.69 ?  523 TYR D CA    1 
ATOM   9656  C  C     . TYR D 2 144 ? -44.343  100.060 1.813   1.00 119.52 ?  523 TYR D C     1 
ATOM   9657  O  O     . TYR D 2 144 ? -43.918  101.179 2.101   1.00 125.28 ?  523 TYR D O     1 
ATOM   9658  C  CB    . TYR D 2 144 ? -46.578  98.982  2.143   1.00 117.12 ?  523 TYR D CB    1 
ATOM   9659  C  CG    . TYR D 2 144 ? -46.797  99.531  3.529   1.00 122.77 ?  523 TYR D CG    1 
ATOM   9660  C  CD1   . TYR D 2 144 ? -47.926  100.280 3.828   1.00 126.87 ?  523 TYR D CD1   1 
ATOM   9661  C  CD2   . TYR D 2 144 ? -45.877  99.297  4.542   1.00 127.32 ?  523 TYR D CD2   1 
ATOM   9662  C  CE1   . TYR D 2 144 ? -48.135  100.786 5.102   1.00 133.67 ?  523 TYR D CE1   1 
ATOM   9663  C  CE2   . TYR D 2 144 ? -46.073  99.799  5.818   1.00 132.93 ?  523 TYR D CE2   1 
ATOM   9664  C  CZ    . TYR D 2 144 ? -47.206  100.542 6.095   1.00 136.92 ?  523 TYR D CZ    1 
ATOM   9665  O  OH    . TYR D 2 144 ? -47.411  101.043 7.365   1.00 141.84 ?  523 TYR D OH    1 
ATOM   9666  N  N     . ARG D 2 145 ? -43.622  98.953  1.954   1.00 117.52 ?  524 ARG D N     1 
ATOM   9667  C  CA    . ARG D 2 145 ? -42.323  98.961  2.616   1.00 120.16 ?  524 ARG D CA    1 
ATOM   9668  C  C     . ARG D 2 145 ? -41.239  99.770  1.893   1.00 121.02 ?  524 ARG D C     1 
ATOM   9669  O  O     . ARG D 2 145 ? -40.538  100.560 2.525   1.00 119.87 ?  524 ARG D O     1 
ATOM   9670  C  CB    . ARG D 2 145 ? -41.849  97.526  2.888   1.00 123.17 ?  524 ARG D CB    1 
ATOM   9671  C  CG    . ARG D 2 145 ? -42.645  96.786  3.979   1.00 126.52 ?  524 ARG D CG    1 
ATOM   9672  C  CD    . ARG D 2 145 ? -42.424  97.411  5.359   1.00 131.58 ?  524 ARG D CD    1 
ATOM   9673  N  NE    . ARG D 2 145 ? -41.913  96.458  6.346   1.00 130.34 ?  524 ARG D NE    1 
ATOM   9674  C  CZ    . ARG D 2 145 ? -40.719  95.871  6.281   1.00 132.10 ?  524 ARG D CZ    1 
ATOM   9675  N  NH1   . ARG D 2 145 ? -39.899  96.113  5.266   1.00 132.85 ?  524 ARG D NH1   1 
ATOM   9676  N  NH2   . ARG D 2 145 ? -40.346  95.028  7.232   1.00 132.67 ?  524 ARG D NH2   1 
ATOM   9677  N  N     . TYR D 2 146 ? -41.107  99.595  0.578   1.00 125.28 ?  525 TYR D N     1 
ATOM   9678  C  CA    . TYR D 2 146 ? -39.977  100.195 -0.154  1.00 129.58 ?  525 TYR D CA    1 
ATOM   9679  C  C     . TYR D 2 146 ? -40.336  101.217 -1.256  1.00 125.15 ?  525 TYR D C     1 
ATOM   9680  O  O     . TYR D 2 146 ? -39.466  101.685 -2.004  1.00 121.08 ?  525 TYR D O     1 
ATOM   9681  C  CB    . TYR D 2 146 ? -39.057  99.093  -0.693  1.00 131.23 ?  525 TYR D CB    1 
ATOM   9682  C  CG    . TYR D 2 146 ? -38.448  98.249  0.406   1.00 132.99 ?  525 TYR D CG    1 
ATOM   9683  C  CD1   . TYR D 2 146 ? -39.215  97.319  1.096   1.00 134.32 ?  525 TYR D CD1   1 
ATOM   9684  C  CD2   . TYR D 2 146 ? -37.112  98.394  0.764   1.00 135.16 ?  525 TYR D CD2   1 
ATOM   9685  C  CE1   . TYR D 2 146 ? -38.672  96.553  2.104   1.00 136.99 ?  525 TYR D CE1   1 
ATOM   9686  C  CE2   . TYR D 2 146 ? -36.556  97.629  1.770   1.00 138.02 ?  525 TYR D CE2   1 
ATOM   9687  C  CZ    . TYR D 2 146 ? -37.342  96.709  2.437   1.00 141.26 ?  525 TYR D CZ    1 
ATOM   9688  O  OH    . TYR D 2 146 ? -36.804  95.939  3.443   1.00 147.19 ?  525 TYR D OH    1 
ATOM   9689  N  N     . MET D 2 147 ? -41.617  101.562 -1.333  1.00 122.43 ?  526 MET D N     1 
ATOM   9690  C  CA    . MET D 2 147 ? -42.099  102.570 -2.267  1.00 122.55 ?  526 MET D CA    1 
ATOM   9691  C  C     . MET D 2 147 ? -43.393  103.193 -1.730  1.00 124.63 ?  526 MET D C     1 
ATOM   9692  O  O     . MET D 2 147 ? -44.394  103.291 -2.451  1.00 121.77 ?  526 MET D O     1 
ATOM   9693  C  CB    . MET D 2 147 ? -42.325  101.959 -3.655  1.00 119.58 ?  526 MET D CB    1 
ATOM   9694  C  CG    . MET D 2 147 ? -41.042  101.603 -4.407  1.00 121.26 ?  526 MET D CG    1 
ATOM   9695  S  SD    . MET D 2 147 ? -41.311  100.751 -5.990  1.00 107.16 ?  526 MET D SD    1 
ATOM   9696  C  CE    . MET D 2 147 ? -42.376  101.920 -6.833  1.00 228.56 ?  526 MET D CE    1 
ATOM   9697  N  N     . ARG D 2 148 ? -43.361  103.608 -0.460  1.00 126.78 ?  527 ARG D N     1 
ATOM   9698  C  CA    . ARG D 2 148 ? -44.548  104.147 0.220   1.00 125.33 ?  527 ARG D CA    1 
ATOM   9699  C  C     . ARG D 2 148 ? -45.219  105.299 -0.558  1.00 131.35 ?  527 ARG D C     1 
ATOM   9700  O  O     . ARG D 2 148 ? -46.452  105.370 -0.622  1.00 129.91 ?  527 ARG D O     1 
ATOM   9701  C  CB    . ARG D 2 148 ? -44.239  104.530 1.685   1.00 119.45 ?  527 ARG D CB    1 
ATOM   9702  N  N     . PRO D 2 149 ? -44.407  106.192 -1.162  1.00 136.70 ?  528 PRO D N     1 
ATOM   9703  C  CA    . PRO D 2 149 ? -44.916  107.290 -2.000  1.00 139.57 ?  528 PRO D CA    1 
ATOM   9704  C  C     . PRO D 2 149 ? -45.769  106.841 -3.200  1.00 140.04 ?  528 PRO D C     1 
ATOM   9705  O  O     . PRO D 2 149 ? -46.642  107.601 -3.625  1.00 138.88 ?  528 PRO D O     1 
ATOM   9706  C  CB    . PRO D 2 149 ? -43.636  107.974 -2.497  1.00 138.35 ?  528 PRO D CB    1 
ATOM   9707  C  CG    . PRO D 2 149 ? -42.622  107.670 -1.457  1.00 138.26 ?  528 PRO D CG    1 
ATOM   9708  C  CD    . PRO D 2 149 ? -42.950  106.294 -0.953  1.00 136.26 ?  528 PRO D CD    1 
ATOM   9709  N  N     . LEU D 2 150 ? -45.524  105.641 -3.731  1.00 139.89 ?  529 LEU D N     1 
ATOM   9710  C  CA    . LEU D 2 150 ? -46.231  105.168 -4.926  1.00 138.05 ?  529 LEU D CA    1 
ATOM   9711  C  C     . LEU D 2 150 ? -47.689  104.773 -4.653  1.00 141.04 ?  529 LEU D C     1 
ATOM   9712  O  O     . LEU D 2 150 ? -48.569  105.044 -5.473  1.00 141.35 ?  529 LEU D O     1 
ATOM   9713  C  CB    . LEU D 2 150 ? -45.471  104.021 -5.604  1.00 130.79 ?  529 LEU D CB    1 
ATOM   9714  N  N     . VAL D 2 151 ? -47.945  104.134 -3.512  1.00 142.26 ?  530 VAL D N     1 
ATOM   9715  C  CA    . VAL D 2 151 ? -49.322  103.812 -3.134  1.00 140.47 ?  530 VAL D CA    1 
ATOM   9716  C  C     . VAL D 2 151 ? -49.996  105.029 -2.495  1.00 140.40 ?  530 VAL D C     1 
ATOM   9717  O  O     . VAL D 2 151 ? -51.131  105.355 -2.837  1.00 141.25 ?  530 VAL D O     1 
ATOM   9718  C  CB    . VAL D 2 151 ? -49.434  102.554 -2.213  1.00 83.25  ?  530 VAL D CB    1 
ATOM   9719  N  N     . GLU D 2 152 ? -49.289  105.716 -1.596  1.00 140.09 ?  531 GLU D N     1 
ATOM   9720  C  CA    . GLU D 2 152 ? -49.852  106.890 -0.914  1.00 141.82 ?  531 GLU D CA    1 
ATOM   9721  C  C     . GLU D 2 152 ? -50.432  107.905 -1.897  1.00 144.86 ?  531 GLU D C     1 
ATOM   9722  O  O     . GLU D 2 152 ? -51.226  108.761 -1.511  1.00 146.60 ?  531 GLU D O     1 
ATOM   9723  C  CB    . GLU D 2 152 ? -48.818  107.565 -0.000  1.00 140.33 ?  531 GLU D CB    1 
ATOM   9724  N  N     . ALA D 2 153 ? -50.034  107.796 -3.164  1.00 146.01 ?  532 ALA D N     1 
ATOM   9725  C  CA    . ALA D 2 153 ? -50.484  108.719 -4.212  1.00 146.26 ?  532 ALA D CA    1 
ATOM   9726  C  C     . ALA D 2 153 ? -51.535  108.093 -5.131  1.00 147.02 ?  532 ALA D C     1 
ATOM   9727  O  O     . ALA D 2 153 ? -51.886  108.664 -6.166  1.00 145.69 ?  532 ALA D O     1 
ATOM   9728  C  CB    . ALA D 2 153 ? -49.295  109.228 -5.031  1.00 142.56 ?  532 ALA D CB    1 
ATOM   9729  N  N     . GLY D 2 154 ? -52.024  106.915 -4.750  1.00 147.52 ?  533 GLY D N     1 
ATOM   9730  C  CA    . GLY D 2 154 ? -53.089  106.245 -5.479  1.00 145.06 ?  533 GLY D CA    1 
ATOM   9731  C  C     . GLY D 2 154 ? -52.707  105.693 -6.842  1.00 140.20 ?  533 GLY D C     1 
ATOM   9732  O  O     . GLY D 2 154 ? -53.579  105.510 -7.697  1.00 138.99 ?  533 GLY D O     1 
ATOM   9733  N  N     . HIS D 2 155 ? -51.414  105.424 -7.038  1.00 135.87 ?  534 HIS D N     1 
ATOM   9734  C  CA    . HIS D 2 155 ? -50.901  104.927 -8.319  1.00 130.74 ?  534 HIS D CA    1 
ATOM   9735  C  C     . HIS D 2 155 ? -50.831  103.403 -8.370  1.00 127.25 ?  534 HIS D C     1 
ATOM   9736  O  O     . HIS D 2 155 ? -50.385  102.834 -9.372  1.00 126.32 ?  534 HIS D O     1 
ATOM   9737  C  CB    . HIS D 2 155 ? -49.505  105.493 -8.626  1.00 129.62 ?  534 HIS D CB    1 
ATOM   9738  C  CG    . HIS D 2 155 ? -49.513  106.871 -9.210  1.00 135.35 ?  534 HIS D CG    1 
ATOM   9739  N  ND1   . HIS D 2 155 ? -50.675  107.526 -9.575  1.00 139.77 ?  534 HIS D ND1   1 
ATOM   9740  C  CD2   . HIS D 2 155 ? -48.499  107.723 -9.491  1.00 138.72 ?  534 HIS D CD2   1 
ATOM   9741  C  CE1   . HIS D 2 155 ? -50.371  108.716 -10.050 1.00 145.47 ?  534 HIS D CE1   1 
ATOM   9742  N  NE2   . HIS D 2 155 ? -49.062  108.869 -10.015 1.00 145.02 ?  534 HIS D NE2   1 
ATOM   9743  N  N     . VAL D 2 156 ? -51.253  102.738 -7.297  1.00 121.92 ?  535 VAL D N     1 
ATOM   9744  C  CA    . VAL D 2 156 ? -51.216  101.277 -7.277  1.00 113.56 ?  535 VAL D CA    1 
ATOM   9745  C  C     . VAL D 2 156 ? -52.610  100.661 -7.275  1.00 113.05 ?  535 VAL D C     1 
ATOM   9746  O  O     . VAL D 2 156 ? -53.331  100.730 -6.279  1.00 111.09 ?  535 VAL D O     1 
ATOM   9747  C  CB    . VAL D 2 156 ? -50.402  100.727 -6.094  1.00 112.04 ?  535 VAL D CB    1 
ATOM   9748  C  CG1   . VAL D 2 156 ? -50.542  99.225  -6.026  1.00 110.01 ?  535 VAL D CG1   1 
ATOM   9749  C  CG2   . VAL D 2 156 ? -48.941  101.103 -6.238  1.00 113.46 ?  535 VAL D CG2   1 
ATOM   9750  N  N     . TYR D 2 157 ? -52.971  100.049 -8.402  1.00 117.66 ?  536 TYR D N     1 
ATOM   9751  C  CA    . TYR D 2 157 ? -54.304  99.485  -8.605  1.00 119.90 ?  536 TYR D CA    1 
ATOM   9752  C  C     . TYR D 2 157 ? -54.303  97.950  -8.570  1.00 121.40 ?  536 TYR D C     1 
ATOM   9753  O  O     . TYR D 2 157 ? -53.247  97.314  -8.560  1.00 123.73 ?  536 TYR D O     1 
ATOM   9754  C  CB    . TYR D 2 157 ? -54.875  99.963  -9.946  1.00 118.24 ?  536 TYR D CB    1 
ATOM   9755  C  CG    . TYR D 2 157 ? -54.780  101.462 -10.198 1.00 117.12 ?  536 TYR D CG    1 
ATOM   9756  C  CD1   . TYR D 2 157 ? -55.893  102.290 -10.052 1.00 118.06 ?  536 TYR D CD1   1 
ATOM   9757  C  CD2   . TYR D 2 157 ? -53.586  102.042 -10.601 1.00 118.97 ?  536 TYR D CD2   1 
ATOM   9758  C  CE1   . TYR D 2 157 ? -55.811  103.660 -10.290 1.00 123.47 ?  536 TYR D CE1   1 
ATOM   9759  C  CE2   . TYR D 2 157 ? -53.496  103.406 -10.844 1.00 125.54 ?  536 TYR D CE2   1 
ATOM   9760  C  CZ    . TYR D 2 157 ? -54.609  104.213 -10.687 1.00 126.98 ?  536 TYR D CZ    1 
ATOM   9761  O  OH    . TYR D 2 157 ? -54.504  105.571 -10.929 1.00 129.66 ?  536 TYR D OH    1 
ATOM   9762  N  N     . ILE D 2 158 ? -55.495  97.360  -8.556  1.00 118.69 ?  537 ILE D N     1 
ATOM   9763  C  CA    . ILE D 2 158 ? -55.638  95.909  -8.603  1.00 113.14 ?  537 ILE D CA    1 
ATOM   9764  C  C     . ILE D 2 158 ? -56.753  95.506  -9.552  1.00 112.11 ?  537 ILE D C     1 
ATOM   9765  O  O     . ILE D 2 158 ? -57.909  95.874  -9.349  1.00 116.31 ?  537 ILE D O     1 
ATOM   9766  C  CB    . ILE D 2 158 ? -55.980  95.323  -7.226  1.00 112.25 ?  537 ILE D CB    1 
ATOM   9767  C  CG1   . ILE D 2 158 ? -54.829  95.539  -6.244  1.00 108.83 ?  537 ILE D CG1   1 
ATOM   9768  C  CG2   . ILE D 2 158 ? -56.317  93.835  -7.356  1.00 113.13 ?  537 ILE D CG2   1 
ATOM   9769  C  CD1   . ILE D 2 158 ? -55.027  94.824  -4.924  1.00 106.70 ?  537 ILE D CD1   1 
ATOM   9770  N  N     . ALA D 2 159 ? -56.413  94.734  -10.577 1.00 110.69 ?  538 ALA D N     1 
ATOM   9771  C  CA    . ALA D 2 159 ? -57.412  94.311  -11.554 1.00 112.09 ?  538 ALA D CA    1 
ATOM   9772  C  C     . ALA D 2 159 ? -58.317  93.217  -11.004 1.00 110.21 ?  538 ALA D C     1 
ATOM   9773  O  O     . ALA D 2 159 ? -57.844  92.244  -10.426 1.00 110.17 ?  538 ALA D O     1 
ATOM   9774  C  CB    . ALA D 2 159 ? -56.749  93.855  -12.838 1.00 111.15 ?  538 ALA D CB    1 
ATOM   9775  N  N     . LEU D 2 160 ? -59.622  93.402  -11.177 1.00 115.26 ?  539 LEU D N     1 
ATOM   9776  C  CA    . LEU D 2 160 ? -60.604  92.388  -10.824 1.00 111.96 ?  539 LEU D CA    1 
ATOM   9777  C  C     . LEU D 2 160 ? -61.001  91.638  -12.100 1.00 115.13 ?  539 LEU D C     1 
ATOM   9778  O  O     . LEU D 2 160 ? -61.861  92.098  -12.855 1.00 118.59 ?  539 LEU D O     1 
ATOM   9779  C  CB    . LEU D 2 160 ? -61.838  93.030  -10.158 1.00 103.13 ?  539 LEU D CB    1 
ATOM   9780  C  CG    . LEU D 2 160 ? -61.624  93.959  -8.952  1.00 93.03  ?  539 LEU D CG    1 
ATOM   9781  N  N     . PRO D 2 161 ? -60.352  90.491  -12.362 1.00 113.08 ?  540 PRO D N     1 
ATOM   9782  C  CA    . PRO D 2 161 ? -60.732  89.677  -13.521 1.00 112.64 ?  540 PRO D CA    1 
ATOM   9783  C  C     . PRO D 2 161 ? -62.125  89.117  -13.304 1.00 119.30 ?  540 PRO D C     1 
ATOM   9784  O  O     . PRO D 2 161 ? -62.614  89.122  -12.174 1.00 122.36 ?  540 PRO D O     1 
ATOM   9785  C  CB    . PRO D 2 161 ? -59.717  88.527  -13.505 1.00 109.68 ?  540 PRO D CB    1 
ATOM   9786  C  CG    . PRO D 2 161 ? -58.636  88.955  -12.580 1.00 112.82 ?  540 PRO D CG    1 
ATOM   9787  C  CD    . PRO D 2 161 ? -59.279  89.861  -11.579 1.00 114.18 ?  540 PRO D CD    1 
ATOM   9788  N  N     . PRO D 2 162 ? -62.763  88.635  -14.374 1.00 123.41 ?  541 PRO D N     1 
ATOM   9789  C  CA    . PRO D 2 162 ? -64.102  88.053  -14.256 1.00 123.43 ?  541 PRO D CA    1 
ATOM   9790  C  C     . PRO D 2 162 ? -64.058  86.651  -13.668 1.00 118.30 ?  541 PRO D C     1 
ATOM   9791  O  O     . PRO D 2 162 ? -63.141  85.874  -13.958 1.00 115.19 ?  541 PRO D O     1 
ATOM   9792  C  CB    . PRO D 2 162 ? -64.585  88.001  -15.707 1.00 128.37 ?  541 PRO D CB    1 
ATOM   9793  C  CG    . PRO D 2 162 ? -63.336  87.876  -16.504 1.00 130.60 ?  541 PRO D CG    1 
ATOM   9794  C  CD    . PRO D 2 162 ? -62.288  88.670  -15.767 1.00 127.78 ?  541 PRO D CD    1 
ATOM   9795  N  N     . LEU D 2 163 ? -65.045  86.332  -12.842 1.00 118.94 ?  542 LEU D N     1 
ATOM   9796  C  CA    . LEU D 2 163 ? -65.143  84.990  -12.293 1.00 117.09 ?  542 LEU D CA    1 
ATOM   9797  C  C     . LEU D 2 163 ? -65.975  84.097  -13.214 1.00 120.73 ?  542 LEU D C     1 
ATOM   9798  O  O     . LEU D 2 163 ? -65.816  82.879  -13.193 1.00 118.77 ?  542 LEU D O     1 
ATOM   9799  C  CB    . LEU D 2 163 ? -65.723  85.000  -10.860 1.00 110.04 ?  542 LEU D CB    1 
ATOM   9800  C  CG    . LEU D 2 163 ? -64.871  85.525  -9.686  1.00 98.65  ?  542 LEU D CG    1 
ATOM   9801  N  N     . TYR D 2 164 ? -66.836  84.695  -14.039 1.00 126.35 ?  543 TYR D N     1 
ATOM   9802  C  CA    . TYR D 2 164 ? -67.818  83.905  -14.794 1.00 132.07 ?  543 TYR D CA    1 
ATOM   9803  C  C     . TYR D 2 164 ? -68.077  84.337  -16.247 1.00 136.26 ?  543 TYR D C     1 
ATOM   9804  O  O     . TYR D 2 164 ? -67.804  85.477  -16.621 1.00 141.70 ?  543 TYR D O     1 
ATOM   9805  C  CB    . TYR D 2 164 ? -69.137  83.863  -14.017 1.00 135.63 ?  543 TYR D CB    1 
ATOM   9806  C  CG    . TYR D 2 164 ? -68.962  83.406  -12.588 1.00 141.40 ?  543 TYR D CG    1 
ATOM   9807  C  CD1   . TYR D 2 164 ? -68.869  82.056  -12.276 1.00 143.02 ?  543 TYR D CD1   1 
ATOM   9808  C  CD2   . TYR D 2 164 ? -68.869  84.322  -11.552 1.00 145.12 ?  543 TYR D CD2   1 
ATOM   9809  C  CE1   . TYR D 2 164 ? -68.701  81.630  -10.972 1.00 143.67 ?  543 TYR D CE1   1 
ATOM   9810  C  CE2   . TYR D 2 164 ? -68.701  83.905  -10.242 1.00 146.61 ?  543 TYR D CE2   1 
ATOM   9811  C  CZ    . TYR D 2 164 ? -68.619  82.558  -9.957  1.00 145.93 ?  543 TYR D CZ    1 
ATOM   9812  O  OH    . TYR D 2 164 ? -68.453  82.134  -8.655  1.00 147.95 ?  543 TYR D OH    1 
ATOM   9813  N  N     . LYS D 2 165 ? -68.600  83.406  -17.052 1.00 134.62 ?  544 LYS D N     1 
ATOM   9814  C  CA    . LYS D 2 165 ? -69.073  83.680  -18.422 1.00 133.13 ?  544 LYS D CA    1 
ATOM   9815  C  C     . LYS D 2 165 ? -70.154  82.669  -18.840 1.00 132.95 ?  544 LYS D C     1 
ATOM   9816  O  O     . LYS D 2 165 ? -69.915  81.460  -18.801 1.00 135.57 ?  544 LYS D O     1 
ATOM   9817  C  CB    . LYS D 2 165 ? -67.915  83.651  -19.428 1.00 130.24 ?  544 LYS D CB    1 
ATOM   9818  N  N     . MET D 2 166 ? -71.330  83.156  -19.245 1.00 128.66 ?  545 MET D N     1 
ATOM   9819  C  CA    . MET D 2 166 ? -72.456  82.267  -19.570 1.00 126.26 ?  545 MET D CA    1 
ATOM   9820  C  C     . MET D 2 166 ? -72.816  82.220  -21.069 1.00 126.89 ?  545 MET D C     1 
ATOM   9821  O  O     . MET D 2 166 ? -72.326  83.011  -21.880 1.00 122.72 ?  545 MET D O     1 
ATOM   9822  C  CB    . MET D 2 166 ? -73.695  82.620  -18.725 1.00 120.43 ?  545 MET D CB    1 
ATOM   9823  C  CG    . MET D 2 166 ? -74.671  81.459  -18.494 1.00 115.24 ?  545 MET D CG    1 
ATOM   9824  N  N     . ALA D 2 177 ? -72.065  86.798  -21.807 1.00 137.79 ?  556 ALA D N     1 
ATOM   9825  C  CA    . ALA D 2 177 ? -71.632  87.952  -21.019 1.00 138.76 ?  556 ALA D CA    1 
ATOM   9826  C  C     . ALA D 2 177 ? -70.767  87.551  -19.815 1.00 138.61 ?  556 ALA D C     1 
ATOM   9827  O  O     . ALA D 2 177 ? -70.276  86.420  -19.740 1.00 134.81 ?  556 ALA D O     1 
ATOM   9828  C  CB    . ALA D 2 177 ? -72.835  88.784  -20.572 1.00 139.46 ?  556 ALA D CB    1 
ATOM   9829  N  N     . TYR D 2 178 ? -70.592  88.481  -18.876 1.00 140.46 ?  557 TYR D N     1 
ATOM   9830  C  CA    . TYR D 2 178 ? -69.674  88.284  -17.755 1.00 138.51 ?  557 TYR D CA    1 
ATOM   9831  C  C     . TYR D 2 178 ? -70.251  88.719  -16.401 1.00 140.44 ?  557 TYR D C     1 
ATOM   9832  O  O     . TYR D 2 178 ? -71.057  89.647  -16.329 1.00 144.07 ?  557 TYR D O     1 
ATOM   9833  C  CB    . TYR D 2 178 ? -68.361  89.029  -18.021 1.00 136.42 ?  557 TYR D CB    1 
ATOM   9834  C  CG    . TYR D 2 178 ? -67.544  88.480  -19.178 1.00 134.44 ?  557 TYR D CG    1 
ATOM   9835  C  CD1   . TYR D 2 178 ? -67.770  88.908  -20.483 1.00 133.85 ?  557 TYR D CD1   1 
ATOM   9836  C  CD2   . TYR D 2 178 ? -66.538  87.545  -18.959 1.00 134.80 ?  557 TYR D CD2   1 
ATOM   9837  C  CE1   . TYR D 2 178 ? -67.019  88.411  -21.541 1.00 135.94 ?  557 TYR D CE1   1 
ATOM   9838  C  CE2   . TYR D 2 178 ? -65.784  87.041  -20.005 1.00 136.68 ?  557 TYR D CE2   1 
ATOM   9839  C  CZ    . TYR D 2 178 ? -66.024  87.476  -21.297 1.00 137.37 ?  557 TYR D CZ    1 
ATOM   9840  O  OH    . TYR D 2 178 ? -65.266  86.971  -22.338 1.00 136.73 ?  557 TYR D OH    1 
ATOM   9841  N  N     . ALA D 2 179 ? -69.821  88.043  -15.335 1.00 138.64 ?  558 ALA D N     1 
ATOM   9842  C  CA    . ALA D 2 179 ? -70.242  88.362  -13.968 1.00 140.28 ?  558 ALA D CA    1 
ATOM   9843  C  C     . ALA D 2 179 ? -69.088  88.208  -12.972 1.00 139.37 ?  558 ALA D C     1 
ATOM   9844  O  O     . ALA D 2 179 ? -68.298  87.259  -13.063 1.00 135.90 ?  558 ALA D O     1 
ATOM   9845  C  CB    . ALA D 2 179 ? -71.412  87.491  -13.554 1.00 141.28 ?  558 ALA D CB    1 
ATOM   9846  N  N     . TRP D 2 180 ? -69.005  89.141  -12.022 1.00 140.68 ?  559 TRP D N     1 
ATOM   9847  C  CA    . TRP D 2 180 ? -67.921  89.170  -11.033 1.00 137.27 ?  559 TRP D CA    1 
ATOM   9848  C  C     . TRP D 2 180 ? -68.321  88.567  -9.683  1.00 142.24 ?  559 TRP D C     1 
ATOM   9849  O  O     . TRP D 2 180 ? -67.552  87.819  -9.080  1.00 142.92 ?  559 TRP D O     1 
ATOM   9850  C  CB    . TRP D 2 180 ? -67.412  90.602  -10.831 1.00 135.18 ?  559 TRP D CB    1 
ATOM   9851  C  CG    . TRP D 2 180 ? -66.416  91.051  -11.854 1.00 134.83 ?  559 TRP D CG    1 
ATOM   9852  C  CD1   . TRP D 2 180 ? -65.110  91.388  -11.633 1.00 134.31 ?  559 TRP D CD1   1 
ATOM   9853  C  CD2   . TRP D 2 180 ? -66.638  91.207  -13.262 1.00 135.15 ?  559 TRP D CD2   1 
ATOM   9854  N  NE1   . TRP D 2 180 ? -64.508  91.747  -12.815 1.00 132.97 ?  559 TRP D NE1   1 
ATOM   9855  C  CE2   . TRP D 2 180 ? -65.423  91.643  -13.830 1.00 133.93 ?  559 TRP D CE2   1 
ATOM   9856  C  CE3   . TRP D 2 180 ? -67.745  91.021  -14.098 1.00 133.88 ?  559 TRP D CE3   1 
ATOM   9857  C  CZ2   . TRP D 2 180 ? -65.286  91.895  -15.200 1.00 132.60 ?  559 TRP D CZ2   1 
ATOM   9858  C  CZ3   . TRP D 2 180 ? -67.605  91.272  -15.458 1.00 129.84 ?  559 TRP D CZ3   1 
ATOM   9859  C  CH2   . TRP D 2 180 ? -66.386  91.703  -15.993 1.00 130.37 ?  559 TRP D CH2   1 
ATOM   9860  N  N     . THR D 2 181 ? -69.516  88.906  -9.206  1.00 145.56 ?  560 THR D N     1 
ATOM   9861  C  CA    . THR D 2 181 ? -70.001  88.400  -7.927  1.00 147.57 ?  560 THR D CA    1 
ATOM   9862  C  C     . THR D 2 181 ? -71.028  87.293  -8.154  1.00 150.23 ?  560 THR D C     1 
ATOM   9863  O  O     . THR D 2 181 ? -71.848  87.384  -9.066  1.00 151.40 ?  560 THR D O     1 
ATOM   9864  C  CB    . THR D 2 181 ? -70.637  89.527  -7.082  1.00 151.71 ?  560 THR D CB    1 
ATOM   9865  N  N     . ASP D 2 182 ? -70.979  86.247  -7.331  1.00 151.06 ?  561 ASP D N     1 
ATOM   9866  C  CA    . ASP D 2 182 ? -71.958  85.166  -7.420  1.00 151.89 ?  561 ASP D CA    1 
ATOM   9867  C  C     . ASP D 2 182 ? -73.374  85.739  -7.514  1.00 154.87 ?  561 ASP D C     1 
ATOM   9868  O  O     . ASP D 2 182 ? -74.304  85.066  -7.970  1.00 155.81 ?  561 ASP D O     1 
ATOM   9869  C  CB    . ASP D 2 182 ? -71.835  84.218  -6.223  1.00 152.14 ?  561 ASP D CB    1 
ATOM   9870  N  N     . GLY D 2 183 ? -73.523  86.991  -7.083  1.00 154.60 ?  562 GLY D N     1 
ATOM   9871  C  CA    . GLY D 2 183 ? -74.783  87.705  -7.198  1.00 156.39 ?  562 GLY D CA    1 
ATOM   9872  C  C     . GLY D 2 183 ? -74.961  88.324  -8.573  1.00 153.01 ?  562 GLY D C     1 
ATOM   9873  O  O     . GLY D 2 183 ? -76.047  88.266  -9.161  1.00 149.42 ?  562 GLY D O     1 
ATOM   9874  N  N     . GLU D 2 184 ? -73.889  88.923  -9.084  1.00 154.95 ?  563 GLU D N     1 
ATOM   9875  C  CA    . GLU D 2 184 ? -73.882  89.451  -10.444 1.00 158.20 ?  563 GLU D CA    1 
ATOM   9876  C  C     . GLU D 2 184 ? -74.068  88.309  -11.449 1.00 162.18 ?  563 GLU D C     1 
ATOM   9877  O  O     . GLU D 2 184 ? -74.464  88.537  -12.594 1.00 164.77 ?  563 GLU D O     1 
ATOM   9878  C  CB    . GLU D 2 184 ? -72.587  90.227  -10.727 1.00 152.00 ?  563 GLU D CB    1 
ATOM   9879  N  N     . LEU D 2 185 ? -73.789  87.080  -11.010 1.00 161.61 ?  564 LEU D N     1 
ATOM   9880  C  CA    . LEU D 2 185 ? -73.986  85.892  -11.844 1.00 157.74 ?  564 LEU D CA    1 
ATOM   9881  C  C     . LEU D 2 185 ? -75.463  85.537  -11.954 1.00 165.33 ?  564 LEU D C     1 
ATOM   9882  O  O     . LEU D 2 185 ? -76.047  85.638  -13.033 1.00 167.94 ?  564 LEU D O     1 
ATOM   9883  C  CB    . LEU D 2 185 ? -73.207  84.692  -11.296 1.00 150.51 ?  564 LEU D CB    1 
ATOM   9884  N  N     . GLU D 2 186 ? -76.060  85.139  -10.830 1.00 169.45 ?  565 GLU D N     1 
ATOM   9885  C  CA    . GLU D 2 186 ? -77.453  84.673  -10.791 1.00 172.91 ?  565 GLU D CA    1 
ATOM   9886  C  C     . GLU D 2 186 ? -78.454  85.594  -11.500 1.00 176.08 ?  565 GLU D C     1 
ATOM   9887  O  O     . GLU D 2 186 ? -79.586  85.193  -11.771 1.00 179.88 ?  565 GLU D O     1 
ATOM   9888  C  CB    . GLU D 2 186 ? -77.903  84.424  -9.346  1.00 174.11 ?  565 GLU D CB    1 
ATOM   9889  N  N     . GLU D 2 187 ? -78.036  86.823  -11.796 1.00 174.79 ?  566 GLU D N     1 
ATOM   9890  C  CA    . GLU D 2 187 ? -78.883  87.763  -12.526 1.00 176.59 ?  566 GLU D CA    1 
ATOM   9891  C  C     . GLU D 2 187 ? -78.759  87.581  -14.042 1.00 175.70 ?  566 GLU D C     1 
ATOM   9892  O  O     . GLU D 2 187 ? -79.673  87.941  -14.791 1.00 178.08 ?  566 GLU D O     1 
ATOM   9893  C  CB    . GLU D 2 187 ? -78.553  89.207  -12.136 1.00 175.53 ?  566 GLU D CB    1 
ATOM   9894  N  N     . LEU D 2 188 ? -77.628  87.021  -14.482 1.00 171.74 ?  567 LEU D N     1 
ATOM   9895  C  CA    . LEU D 2 188 ? -77.366  86.778  -15.908 1.00 166.49 ?  567 LEU D CA    1 
ATOM   9896  C  C     . LEU D 2 188 ? -78.175  85.590  -16.466 1.00 170.99 ?  567 LEU D C     1 
ATOM   9897  O  O     . LEU D 2 188 ? -78.647  85.635  -17.607 1.00 173.28 ?  567 LEU D O     1 
ATOM   9898  C  CB    . LEU D 2 188 ? -75.858  86.596  -16.170 1.00 151.87 ?  567 LEU D CB    1 
ATOM   9899  N  N     . ARG D 2 189 ? -78.342  84.547  -15.647 1.00 168.76 ?  568 ARG D N     1 
ATOM   9900  C  CA    . ARG D 2 189 ? -79.104  83.347  -16.020 1.00 164.88 ?  568 ARG D CA    1 
ATOM   9901  C  C     . ARG D 2 189 ? -80.568  83.652  -16.383 1.00 168.02 ?  568 ARG D C     1 
ATOM   9902  O  O     . ARG D 2 189 ? -81.278  82.805  -16.934 1.00 168.22 ?  568 ARG D O     1 
ATOM   9903  C  CB    . ARG D 2 189 ? -79.033  82.297  -14.904 1.00 159.82 ?  568 ARG D CB    1 
ATOM   9904  N  N     . LYS D 2 190 ? -81.010  84.865  -16.065 1.00 169.12 ?  569 LYS D N     1 
ATOM   9905  C  CA    . LYS D 2 190 ? -82.324  85.338  -16.473 1.00 174.22 ?  569 LYS D CA    1 
ATOM   9906  C  C     . LYS D 2 190 ? -82.219  86.031  -17.828 1.00 177.55 ?  569 LYS D C     1 
ATOM   9907  O  O     . LYS D 2 190 ? -83.018  85.773  -18.730 1.00 180.51 ?  569 LYS D O     1 
ATOM   9908  C  CB    . LYS D 2 190 ? -82.889  86.304  -15.431 1.00 175.35 ?  569 LYS D CB    1 
ATOM   9909  N  N     . GLN D 2 191 ? -81.216  86.901  -17.963 1.00 176.22 ?  570 GLN D N     1 
ATOM   9910  C  CA    . GLN D 2 191 ? -81.012  87.700  -19.176 1.00 175.18 ?  570 GLN D CA    1 
ATOM   9911  C  C     . GLN D 2 191 ? -80.847  86.841  -20.431 1.00 174.45 ?  570 GLN D C     1 
ATOM   9912  O  O     . GLN D 2 191 ? -80.788  87.360  -21.549 1.00 174.04 ?  570 GLN D O     1 
ATOM   9913  C  CB    . GLN D 2 191 ? -79.803  88.633  -19.013 1.00 167.94 ?  570 GLN D CB    1 
ATOM   9914  N  N     . LEU D 2 198 ? -72.468  78.464  -18.074 1.00 132.76 ?  577 LEU D N     1 
ATOM   9915  C  CA    . LEU D 2 198 ? -71.494  79.075  -17.161 1.00 129.14 ?  577 LEU D CA    1 
ATOM   9916  C  C     . LEU D 2 198 ? -70.075  78.510  -17.305 1.00 134.89 ?  577 LEU D C     1 
ATOM   9917  O  O     . LEU D 2 198 ? -69.808  77.374  -16.909 1.00 139.00 ?  577 LEU D O     1 
ATOM   9918  C  CB    . LEU D 2 198 ? -71.948  78.950  -15.698 1.00 119.67 ?  577 LEU D CB    1 
ATOM   9919  N  N     . GLN D 2 199 ? -69.173  79.305  -17.876 1.00 134.21 ?  578 GLN D N     1 
ATOM   9920  C  CA    . GLN D 2 199 ? -67.748  78.996  -17.833 1.00 132.39 ?  578 GLN D CA    1 
ATOM   9921  C  C     . GLN D 2 199 ? -67.170  79.631  -16.568 1.00 129.75 ?  578 GLN D C     1 
ATOM   9922  O  O     . GLN D 2 199 ? -67.133  80.856  -16.445 1.00 132.40 ?  578 GLN D O     1 
ATOM   9923  C  CB    . GLN D 2 199 ? -67.027  79.521  -19.079 1.00 131.80 ?  578 GLN D CB    1 
ATOM   9924  N  N     . ARG D 2 200 ? -66.744  78.795  -15.623 1.00 124.53 ?  579 ARG D N     1 
ATOM   9925  C  CA    . ARG D 2 200 ? -66.236  79.267  -14.332 1.00 118.93 ?  579 ARG D CA    1 
ATOM   9926  C  C     . ARG D 2 200 ? -64.712  79.474  -14.345 1.00 118.10 ?  579 ARG D C     1 
ATOM   9927  O  O     . ARG D 2 200 ? -63.953  78.571  -13.986 1.00 122.97 ?  579 ARG D O     1 
ATOM   9928  C  CB    . ARG D 2 200 ? -66.646  78.295  -13.208 1.00 116.16 ?  579 ARG D CB    1 
ATOM   9929  N  N     . TYR D 2 201 ? -64.270  80.666  -14.746 1.00 113.70 ?  580 TYR D N     1 
ATOM   9930  C  CA    . TYR D 2 201 ? -62.841  80.946  -14.893 1.00 117.85 ?  580 TYR D CA    1 
ATOM   9931  C  C     . TYR D 2 201 ? -62.015  80.525  -13.678 1.00 117.67 ?  580 TYR D C     1 
ATOM   9932  O  O     . TYR D 2 201 ? -62.128  81.112  -12.598 1.00 113.33 ?  580 TYR D O     1 
ATOM   9933  C  CB    . TYR D 2 201 ? -62.596  82.415  -15.260 1.00 125.35 ?  580 TYR D CB    1 
ATOM   9934  C  CG    . TYR D 2 201 ? -63.101  82.752  -16.647 1.00 137.36 ?  580 TYR D CG    1 
ATOM   9935  C  CD1   . TYR D 2 201 ? -62.487  82.227  -17.780 1.00 139.81 ?  580 TYR D CD1   1 
ATOM   9936  C  CD2   . TYR D 2 201 ? -64.206  83.578  -16.825 1.00 143.17 ?  580 TYR D CD2   1 
ATOM   9937  C  CE1   . TYR D 2 201 ? -62.957  82.522  -19.053 1.00 143.43 ?  580 TYR D CE1   1 
ATOM   9938  C  CE2   . TYR D 2 201 ? -64.680  83.880  -18.094 1.00 145.62 ?  580 TYR D CE2   1 
ATOM   9939  C  CZ    . TYR D 2 201 ? -64.053  83.351  -19.202 1.00 147.99 ?  580 TYR D CZ    1 
ATOM   9940  O  OH    . TYR D 2 201 ? -64.530  83.653  -20.458 1.00 155.02 ?  580 TYR D OH    1 
ATOM   9941  N  N     . LYS D 2 202 ? -61.187  79.497  -13.876 1.00 119.85 ?  581 LYS D N     1 
ATOM   9942  C  CA    . LYS D 2 202 ? -60.343  78.938  -12.816 1.00 115.67 ?  581 LYS D CA    1 
ATOM   9943  C  C     . LYS D 2 202 ? -58.977  79.654  -12.720 1.00 116.13 ?  581 LYS D C     1 
ATOM   9944  O  O     . LYS D 2 202 ? -58.186  79.411  -11.792 1.00 111.57 ?  581 LYS D O     1 
ATOM   9945  C  CB    . LYS D 2 202 ? -60.170  77.426  -13.023 1.00 112.68 ?  581 LYS D CB    1 
ATOM   9946  N  N     . GLY D 2 203 ? -58.716  80.540  -13.682 1.00 109.99 ?  582 GLY D N     1 
ATOM   9947  C  CA    . GLY D 2 203 ? -57.502  81.337  -13.699 1.00 112.07 ?  582 GLY D CA    1 
ATOM   9948  C  C     . GLY D 2 203 ? -57.408  82.197  -14.944 1.00 117.09 ?  582 GLY D C     1 
ATOM   9949  O  O     . GLY D 2 203 ? -58.277  82.129  -15.813 1.00 123.51 ?  582 GLY D O     1 
ATOM   9950  N  N     . LEU D 2 204 ? -56.355  83.005  -15.036 1.00 115.85 ?  583 LEU D N     1 
ATOM   9951  C  CA    . LEU D 2 204 ? -56.139  83.854  -16.208 1.00 116.65 ?  583 LEU D CA    1 
ATOM   9952  C  C     . LEU D 2 204 ? -55.699  83.058  -17.444 1.00 125.74 ?  583 LEU D C     1 
ATOM   9953  O  O     . LEU D 2 204 ? -56.015  83.433  -18.575 1.00 124.07 ?  583 LEU D O     1 
ATOM   9954  C  CB    . LEU D 2 204 ? -55.109  84.946  -15.901 1.00 106.41 ?  583 LEU D CB    1 
ATOM   9955  C  CG    . LEU D 2 204 ? -55.509  86.032  -14.905 1.00 101.96 ?  583 LEU D CG    1 
ATOM   9956  C  CD1   . LEU D 2 204 ? -54.386  87.042  -14.738 1.00 102.40 ?  583 LEU D CD1   1 
ATOM   9957  C  CD2   . LEU D 2 204 ? -56.776  86.722  -15.358 1.00 101.11 ?  583 LEU D CD2   1 
ATOM   9958  N  N     . GLY D 2 205 ? -54.973  81.963  -17.217 1.00 133.80 ?  584 GLY D N     1 
ATOM   9959  C  CA    . GLY D 2 205 ? -54.379  81.185  -18.292 1.00 141.59 ?  584 GLY D CA    1 
ATOM   9960  C  C     . GLY D 2 205 ? -55.387  80.426  -19.134 1.00 147.99 ?  584 GLY D C     1 
ATOM   9961  O  O     . GLY D 2 205 ? -55.029  79.818  -20.152 1.00 151.13 ?  584 GLY D O     1 
ATOM   9962  N  N     . GLU D 2 206 ? -56.647  80.471  -18.706 1.00 147.45 ?  585 GLU D N     1 
ATOM   9963  C  CA    . GLU D 2 206 ? -57.739  79.778  -19.389 1.00 146.36 ?  585 GLU D CA    1 
ATOM   9964  C  C     . GLU D 2 206 ? -58.539  80.700  -20.330 1.00 142.46 ?  585 GLU D C     1 
ATOM   9965  O  O     . GLU D 2 206 ? -59.510  80.266  -20.960 1.00 138.56 ?  585 GLU D O     1 
ATOM   9966  C  CB    . GLU D 2 206 ? -58.669  79.112  -18.362 1.00 146.39 ?  585 GLU D CB    1 
ATOM   9967  N  N     . MET D 2 207 ? -58.125  81.966  -20.422 1.00 141.56 ?  586 MET D N     1 
ATOM   9968  C  CA    . MET D 2 207 ? -58.777  82.947  -21.295 1.00 140.88 ?  586 MET D CA    1 
ATOM   9969  C  C     . MET D 2 207 ? -57.945  83.268  -22.535 1.00 140.14 ?  586 MET D C     1 
ATOM   9970  O  O     . MET D 2 207 ? -56.718  83.380  -22.458 1.00 140.47 ?  586 MET D O     1 
ATOM   9971  C  CB    . MET D 2 207 ? -59.041  84.255  -20.546 1.00 141.36 ?  586 MET D CB    1 
ATOM   9972  C  CG    . MET D 2 207 ? -60.009  84.154  -19.385 1.00 143.10 ?  586 MET D CG    1 
ATOM   9973  S  SD    . MET D 2 207 ? -60.359  85.778  -18.674 1.00 174.45 ?  586 MET D SD    1 
ATOM   9974  C  CE    . MET D 2 207 ? -58.717  86.273  -18.149 1.00 94.81  ?  586 MET D CE    1 
ATOM   9975  N  N     . ASN D 2 208 ? -58.622  83.423  -23.673 1.00 138.61 ?  587 ASN D N     1 
ATOM   9976  C  CA    . ASN D 2 208 ? -57.979  83.906  -24.890 1.00 136.02 ?  587 ASN D CA    1 
ATOM   9977  C  C     . ASN D 2 208 ? -57.875  85.433  -24.830 1.00 130.06 ?  587 ASN D C     1 
ATOM   9978  O  O     . ASN D 2 208 ? -58.647  86.087  -24.129 1.00 130.32 ?  587 ASN D O     1 
ATOM   9979  C  CB    . ASN D 2 208 ? -58.736  83.443  -26.151 1.00 140.81 ?  587 ASN D CB    1 
ATOM   9980  C  CG    . ASN D 2 208 ? -58.227  82.092  -26.705 1.00 140.64 ?  587 ASN D CG    1 
ATOM   9981  O  OD1   . ASN D 2 208 ? -58.929  81.075  -26.627 1.00 139.75 ?  587 ASN D OD1   1 
ATOM   9982  N  ND2   . ASN D 2 208 ? -57.019  82.094  -27.294 1.00 138.32 ?  587 ASN D ND2   1 
ATOM   9983  N  N     . ALA D 2 209 ? -56.917  85.990  -25.566 1.00 125.59 ?  588 ALA D N     1 
ATOM   9984  C  CA    . ALA D 2 209 ? -56.571  87.411  -25.474 1.00 122.55 ?  588 ALA D CA    1 
ATOM   9985  C  C     . ALA D 2 209 ? -57.705  88.424  -25.721 1.00 122.58 ?  588 ALA D C     1 
ATOM   9986  O  O     . ALA D 2 209 ? -57.804  89.420  -25.002 1.00 119.40 ?  588 ALA D O     1 
ATOM   9987  C  CB    . ALA D 2 209 ? -55.365  87.724  -26.368 1.00 121.96 ?  588 ALA D CB    1 
ATOM   9988  N  N     . ASP D 2 210 ? -58.540  88.196  -26.736 1.00 123.44 ?  589 ASP D N     1 
ATOM   9989  C  CA    . ASP D 2 210 ? -59.642  89.124  -27.011 1.00 120.58 ?  589 ASP D CA    1 
ATOM   9990  C  C     . ASP D 2 210 ? -60.613  89.145  -25.815 1.00 126.63 ?  589 ASP D C     1 
ATOM   9991  O  O     . ASP D 2 210 ? -61.288  90.151  -25.566 1.00 127.56 ?  589 ASP D O     1 
ATOM   9992  C  CB    . ASP D 2 210 ? -60.353  88.803  -28.339 1.00 111.98 ?  589 ASP D CB    1 
ATOM   9993  N  N     . GLN D 2 211 ? -60.654  88.038  -25.067 1.00 127.77 ?  590 GLN D N     1 
ATOM   9994  C  CA    . GLN D 2 211 ? -61.462  87.950  -23.843 1.00 122.86 ?  590 GLN D CA    1 
ATOM   9995  C  C     . GLN D 2 211 ? -60.871  88.831  -22.734 1.00 122.69 ?  590 GLN D C     1 
ATOM   9996  O  O     . GLN D 2 211 ? -61.539  89.742  -22.240 1.00 125.96 ?  590 GLN D O     1 
ATOM   9997  C  CB    . GLN D 2 211 ? -61.629  86.491  -23.375 1.00 114.12 ?  590 GLN D CB    1 
ATOM   9998  N  N     . LEU D 2 212 ? -59.617  88.577  -22.363 1.00 118.21 ?  591 LEU D N     1 
ATOM   9999  C  CA    . LEU D 2 212 ? -58.944  89.394  -21.347 1.00 115.20 ?  591 LEU D CA    1 
ATOM   10000 C  C     . LEU D 2 212 ? -59.131  90.893  -21.608 1.00 120.50 ?  591 LEU D C     1 
ATOM   10001 O  O     . LEU D 2 212 ? -59.684  91.608  -20.774 1.00 125.70 ?  591 LEU D O     1 
ATOM   10002 C  CB    . LEU D 2 212 ? -57.448  89.045  -21.232 1.00 107.39 ?  591 LEU D CB    1 
ATOM   10003 N  N     . TRP D 2 213 ? -58.685  91.360  -22.771 1.00 116.06 ?  592 TRP D N     1 
ATOM   10004 C  CA    . TRP D 2 213 ? -58.717  92.788  -23.075 1.00 113.90 ?  592 TRP D CA    1 
ATOM   10005 C  C     . TRP D 2 213 ? -60.066  93.427  -22.762 1.00 117.36 ?  592 TRP D C     1 
ATOM   10006 O  O     . TRP D 2 213 ? -60.124  94.512  -22.176 1.00 116.08 ?  592 TRP D O     1 
ATOM   10007 C  CB    . TRP D 2 213 ? -58.334  93.043  -24.537 1.00 113.77 ?  592 TRP D CB    1 
ATOM   10008 C  CG    . TRP D 2 213 ? -58.726  94.414  -25.056 1.00 111.87 ?  592 TRP D CG    1 
ATOM   10009 C  CD1   . TRP D 2 213 ? -59.788  94.711  -25.863 1.00 111.48 ?  592 TRP D CD1   1 
ATOM   10010 C  CD2   . TRP D 2 213 ? -58.059  95.658  -24.802 1.00 111.98 ?  592 TRP D CD2   1 
ATOM   10011 N  NE1   . TRP D 2 213 ? -59.824  96.057  -26.124 1.00 113.18 ?  592 TRP D NE1   1 
ATOM   10012 C  CE2   . TRP D 2 213 ? -58.775  96.663  -25.484 1.00 112.22 ?  592 TRP D CE2   1 
ATOM   10013 C  CE3   . TRP D 2 213 ? -56.928  96.021  -24.059 1.00 112.57 ?  592 TRP D CE3   1 
ATOM   10014 C  CZ2   . TRP D 2 213 ? -58.398  98.007  -25.449 1.00 113.55 ?  592 TRP D CZ2   1 
ATOM   10015 C  CZ3   . TRP D 2 213 ? -56.554  97.359  -24.027 1.00 114.09 ?  592 TRP D CZ3   1 
ATOM   10016 C  CH2   . TRP D 2 213 ? -57.288  98.333  -24.716 1.00 114.77 ?  592 TRP D CH2   1 
ATOM   10017 N  N     . GLU D 2 214 ? -61.144  92.746  -23.147 1.00 122.00 ?  593 GLU D N     1 
ATOM   10018 C  CA    . GLU D 2 214 ? -62.491  93.314  -23.052 1.00 122.96 ?  593 GLU D CA    1 
ATOM   10019 C  C     . GLU D 2 214 ? -62.993  93.446  -21.604 1.00 112.82 ?  593 GLU D C     1 
ATOM   10020 O  O     . GLU D 2 214 ? -63.701  94.411  -21.271 1.00 106.69 ?  593 GLU D O     1 
ATOM   10021 C  CB    . GLU D 2 214 ? -63.480  92.509  -23.912 1.00 124.85 ?  593 GLU D CB    1 
ATOM   10022 N  N     . THR D 2 215 ? -62.596  92.493  -20.753 1.00 108.48 ?  594 THR D N     1 
ATOM   10023 C  CA    . THR D 2 215 ? -63.099  92.398  -19.377 1.00 109.27 ?  594 THR D CA    1 
ATOM   10024 C  C     . THR D 2 215 ? -62.207  93.022  -18.299 1.00 115.14 ?  594 THR D C     1 
ATOM   10025 O  O     . THR D 2 215 ? -62.710  93.489  -17.269 1.00 120.20 ?  594 THR D O     1 
ATOM   10026 C  CB    . THR D 2 215 ? -63.340  90.939  -18.966 1.00 104.90 ?  594 THR D CB    1 
ATOM   10027 O  OG1   . THR D 2 215 ? -62.084  90.251  -18.904 1.00 107.29 ?  594 THR D OG1   1 
ATOM   10028 C  CG2   . THR D 2 215 ? -64.256  90.240  -19.960 1.00 101.61 ?  594 THR D CG2   1 
ATOM   10029 N  N     . THR D 2 216 ? -60.894  93.023  -18.516 1.00 114.01 ?  595 THR D N     1 
ATOM   10030 C  CA    . THR D 2 216 ? -59.976  93.490  -17.475 1.00 115.70 ?  595 THR D CA    1 
ATOM   10031 C  C     . THR D 2 216 ? -58.928  94.524  -17.919 1.00 115.17 ?  595 THR D C     1 
ATOM   10032 O  O     . THR D 2 216 ? -58.528  95.380  -17.129 1.00 117.43 ?  595 THR D O     1 
ATOM   10033 C  CB    . THR D 2 216 ? -59.244  92.313  -16.803 1.00 114.60 ?  595 THR D CB    1 
ATOM   10034 O  OG1   . THR D 2 216 ? -57.884  92.294  -17.247 1.00 119.94 ?  595 THR D OG1   1 
ATOM   10035 C  CG2   . THR D 2 216 ? -59.924  90.967  -17.132 1.00 108.63 ?  595 THR D CG2   1 
ATOM   10036 N  N     . MET D 2 217 ? -58.481  94.449  -19.169 1.00 111.75 ?  596 MET D N     1 
ATOM   10037 C  CA    . MET D 2 217 ? -57.424  95.343  -19.652 1.00 112.42 ?  596 MET D CA    1 
ATOM   10038 C  C     . MET D 2 217 ? -57.927  96.635  -20.328 1.00 113.42 ?  596 MET D C     1 
ATOM   10039 O  O     . MET D 2 217 ? -57.321  97.700  -20.185 1.00 111.89 ?  596 MET D O     1 
ATOM   10040 C  CB    . MET D 2 217 ? -56.479  94.585  -20.589 1.00 114.88 ?  596 MET D CB    1 
ATOM   10041 C  CG    . MET D 2 217 ? -55.985  93.259  -20.025 1.00 113.29 ?  596 MET D CG    1 
ATOM   10042 S  SD    . MET D 2 217 ? -54.433  92.718  -20.774 1.00 118.59 ?  596 MET D SD    1 
ATOM   10043 C  CE    . MET D 2 217 ? -53.333  94.055  -20.306 1.00 82.08  ?  596 MET D CE    1 
ATOM   10044 N  N     . ASN D 2 218 ? -59.024  96.540  -21.070 1.00 113.85 ?  597 ASN D N     1 
ATOM   10045 C  CA    . ASN D 2 218 ? -59.617  97.715  -21.705 1.00 117.66 ?  597 ASN D CA    1 
ATOM   10046 C  C     . ASN D 2 218 ? -60.036  98.754  -20.662 1.00 114.92 ?  597 ASN D C     1 
ATOM   10047 O  O     . ASN D 2 218 ? -60.918  98.497  -19.839 1.00 117.39 ?  597 ASN D O     1 
ATOM   10048 C  CB    . ASN D 2 218 ? -60.815  97.291  -22.570 1.00 124.92 ?  597 ASN D CB    1 
ATOM   10049 C  CG    . ASN D 2 218 ? -61.479  98.462  -23.290 1.00 129.77 ?  597 ASN D CG    1 
ATOM   10050 O  OD1   . ASN D 2 218 ? -60.844  99.478  -23.588 1.00 126.92 ?  597 ASN D OD1   1 
ATOM   10051 N  ND2   . ASN D 2 218 ? -62.770  98.314  -23.574 1.00 133.52 ?  597 ASN D ND2   1 
ATOM   10052 N  N     . PRO D 2 219 ? -59.401  99.934  -20.695 1.00 110.28 ?  598 PRO D N     1 
ATOM   10053 C  CA    . PRO D 2 219 ? -59.624  101.010 -19.717 1.00 111.90 ?  598 PRO D CA    1 
ATOM   10054 C  C     . PRO D 2 219 ? -61.083  101.448 -19.619 1.00 120.53 ?  598 PRO D C     1 
ATOM   10055 O  O     . PRO D 2 219 ? -61.502  101.930 -18.562 1.00 124.33 ?  598 PRO D O     1 
ATOM   10056 C  CB    . PRO D 2 219 ? -58.775  102.162 -20.261 1.00 108.69 ?  598 PRO D CB    1 
ATOM   10057 C  CG    . PRO D 2 219 ? -57.724  101.499 -21.087 1.00 108.88 ?  598 PRO D CG    1 
ATOM   10058 C  CD    . PRO D 2 219 ? -58.393  100.303 -21.702 1.00 108.09 ?  598 PRO D CD    1 
ATOM   10059 N  N     . GLU D 2 220 ? -61.833  101.288 -20.708 1.00 123.84 ?  599 GLU D N     1 
ATOM   10060 C  CA    . GLU D 2 220 ? -63.238  101.691 -20.757 1.00 126.59 ?  599 GLU D CA    1 
ATOM   10061 C  C     . GLU D 2 220 ? -64.180  100.480 -20.704 1.00 128.05 ?  599 GLU D C     1 
ATOM   10062 O  O     . GLU D 2 220 ? -65.151  100.398 -21.454 1.00 133.82 ?  599 GLU D O     1 
ATOM   10063 C  CB    . GLU D 2 220 ? -63.511  102.543 -22.009 1.00 125.95 ?  599 GLU D CB    1 
ATOM   10064 N  N     . THR D 2 221 ? -63.894  99.542  -19.809 1.00 122.66 ?  600 THR D N     1 
ATOM   10065 C  CA    . THR D 2 221 ? -64.703  98.334  -19.707 1.00 122.68 ?  600 THR D CA    1 
ATOM   10066 C  C     . THR D 2 221 ? -64.255  97.490  -18.511 1.00 120.82 ?  600 THR D C     1 
ATOM   10067 O  O     . THR D 2 221 ? -64.908  96.515  -18.130 1.00 116.49 ?  600 THR D O     1 
ATOM   10068 C  CB    . THR D 2 221 ? -64.634  97.503  -21.017 1.00 92.69  ?  600 THR D CB    1 
ATOM   10069 N  N     . ARG D 2 222 ? -63.139  97.887  -17.913 1.00 123.33 ?  601 ARG D N     1 
ATOM   10070 C  CA    . ARG D 2 222 ? -62.558  97.140  -16.807 1.00 123.27 ?  601 ARG D CA    1 
ATOM   10071 C  C     . ARG D 2 222 ? -63.030  97.694  -15.473 1.00 127.18 ?  601 ARG D C     1 
ATOM   10072 O  O     . ARG D 2 222 ? -63.123  98.915  -15.296 1.00 124.56 ?  601 ARG D O     1 
ATOM   10073 C  CB    . ARG D 2 222 ? -61.029  97.219  -16.862 1.00 118.44 ?  601 ARG D CB    1 
ATOM   10074 C  CG    . ARG D 2 222 ? -60.500  98.635  -16.663 1.00 116.50 ?  601 ARG D CG    1 
ATOM   10075 C  CD    . ARG D 2 222 ? -58.981  98.711  -16.681 1.00 111.83 ?  601 ARG D CD    1 
ATOM   10076 N  NE    . ARG D 2 222 ? -58.536  100.102 -16.653 1.00 115.70 ?  601 ARG D NE    1 
ATOM   10077 C  CZ    . ARG D 2 222 ? -57.287  100.502 -16.867 1.00 114.41 ?  601 ARG D CZ    1 
ATOM   10078 N  NH1   . ARG D 2 222 ? -56.335  99.614  -17.124 1.00 110.06 ?  601 ARG D NH1   1 
ATOM   10079 N  NH2   . ARG D 2 222 ? -56.993  101.796 -16.825 1.00 116.06 ?  601 ARG D NH2   1 
ATOM   10080 N  N     . THR D 2 223 ? -63.333  96.790  -14.543 1.00 132.76 ?  602 THR D N     1 
ATOM   10081 C  CA    . THR D 2 223 ? -63.495  97.158  -13.142 1.00 134.81 ?  602 THR D CA    1 
ATOM   10082 C  C     . THR D 2 223 ? -62.090  97.190  -12.539 1.00 137.31 ?  602 THR D C     1 
ATOM   10083 O  O     . THR D 2 223 ? -61.227  96.389  -12.913 1.00 133.94 ?  602 THR D O     1 
ATOM   10084 C  CB    . THR D 2 223 ? -64.399  96.167  -12.379 1.00 129.30 ?  602 THR D CB    1 
ATOM   10085 N  N     . LEU D 2 224 ? -61.858  98.124  -11.621 1.00 140.79 ?  603 LEU D N     1 
ATOM   10086 C  CA    . LEU D 2 224 ? -60.503  98.419  -11.163 1.00 138.60 ?  603 LEU D CA    1 
ATOM   10087 C  C     . LEU D 2 224 ? -60.497  98.896  -9.708  1.00 138.02 ?  603 LEU D C     1 
ATOM   10088 O  O     . LEU D 2 224 ? -61.247  99.800  -9.348  1.00 144.04 ?  603 LEU D O     1 
ATOM   10089 C  CB    . LEU D 2 224 ? -59.894  99.493  -12.072 1.00 137.20 ?  603 LEU D CB    1 
ATOM   10090 C  CG    . LEU D 2 224 ? -58.445  99.324  -12.508 1.00 131.59 ?  603 LEU D CG    1 
ATOM   10091 C  CD1   . LEU D 2 224 ? -57.528  99.806  -11.415 1.00 132.13 ?  603 LEU D CD1   1 
ATOM   10092 C  CD2   . LEU D 2 224 ? -58.186  97.863  -12.821 1.00 126.94 ?  603 LEU D CD2   1 
ATOM   10093 N  N     . ILE D 2 225 ? -59.658  98.288  -8.873  1.00 131.29 ?  604 ILE D N     1 
ATOM   10094 C  CA    . ILE D 2 225 ? -59.544  98.693  -7.467  1.00 129.51 ?  604 ILE D CA    1 
ATOM   10095 C  C     . ILE D 2 225 ? -58.421  99.704  -7.288  1.00 131.59 ?  604 ILE D C     1 
ATOM   10096 O  O     . ILE D 2 225 ? -57.391  99.613  -7.954  1.00 134.67 ?  604 ILE D O     1 
ATOM   10097 C  CB    . ILE D 2 225 ? -59.242  97.493  -6.540  1.00 122.55 ?  604 ILE D CB    1 
ATOM   10098 C  CG1   . ILE D 2 225 ? -60.510  96.681  -6.255  1.00 118.19 ?  604 ILE D CG1   1 
ATOM   10099 C  CG2   . ILE D 2 225 ? -58.599  97.968  -5.240  1.00 118.33 ?  604 ILE D CG2   1 
ATOM   10100 C  CD1   . ILE D 2 225 ? -60.237  95.344  -5.590  1.00 110.33 ?  604 ILE D CD1   1 
ATOM   10101 N  N     . ARG D 2 226 ? -58.614  100.666 -6.392  1.00 128.58 ?  605 ARG D N     1 
ATOM   10102 C  CA    . ARG D 2 226 ? -57.551  101.612 -6.077  1.00 125.08 ?  605 ARG D CA    1 
ATOM   10103 C  C     . ARG D 2 226 ? -57.136  101.439 -4.621  1.00 122.58 ?  605 ARG D C     1 
ATOM   10104 O  O     . ARG D 2 226 ? -57.963  101.580 -3.718  1.00 126.41 ?  605 ARG D O     1 
ATOM   10105 C  CB    . ARG D 2 226 ? -57.987  103.056 -6.364  1.00 125.00 ?  605 ARG D CB    1 
ATOM   10106 N  N     . VAL D 2 227 ? -55.865  101.106 -4.396  1.00 115.28 ?  606 VAL D N     1 
ATOM   10107 C  CA    . VAL D 2 227 ? -55.357  100.928 -3.037  1.00 109.08 ?  606 VAL D CA    1 
ATOM   10108 C  C     . VAL D 2 227 ? -54.980  102.270 -2.446  1.00 116.06 ?  606 VAL D C     1 
ATOM   10109 O  O     . VAL D 2 227 ? -53.941  102.832 -2.793  1.00 118.36 ?  606 VAL D O     1 
ATOM   10110 C  CB    . VAL D 2 227 ? -54.129  99.989  -2.964  1.00 98.45  ?  606 VAL D CB    1 
ATOM   10111 N  N     . THR D 2 228 ? -55.845  102.775 -1.566  1.00 118.49 ?  607 THR D N     1 
ATOM   10112 C  CA    . THR D 2 228 ? -55.588  103.991 -0.797  1.00 117.64 ?  607 THR D CA    1 
ATOM   10113 C  C     . THR D 2 228 ? -55.324  103.657 0.681