data_4KSP
# 
_entry.id   4KSP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4KSP         
RCSB  RCSB079746   
WWPDB D_1000079746 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4DBN 'B-raf inhibitor'                       unspecified 
PDB 3Q96 'B-raf inhibitor'                       unspecified 
PDB 4KSQ 'B-raf bound to a DFG-out Inhibitor 5B' unspecified 
# 
_pdbx_database_status.entry_id                        4KSP 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-05-17 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yano, J.K.'   1 
'Masanori, O.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Discovery of a Selective Kinase Inhibitor (TAK-632) Targeting Pan-RAF Inhibition: Design, Synthesis, and Biological Evaluation of C-7-Substituted 1,3-Benzothiazole Derivatives.
;
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            56 
_citation.page_first                6478 
_citation.page_last                 6494 
_citation.year                      2013 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23906342 
_citation.pdbx_database_id_DOI      10.1021/jm400778d 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Okaniwa, M.'    1  
primary 'Hirose, M.'     2  
primary 'Arita, T.'      3  
primary 'Yabuki, M.'     4  
primary 'Nakamura, A.'   5  
primary 'Takagi, T.'     6  
primary 'Kawamoto, T.'   7  
primary 'Uchiyama, N.'   8  
primary 'Sumita, A.'     9  
primary 'Tsutsumi, S.'   10 
primary 'Tottori, T.'    11 
primary 'Inui, Y.'       12 
primary 'Sang, B.C.'     13 
primary 'Yano, J.'       14 
primary 'Aertgeerts, K.' 15 
primary 'Yoshida, S.'    16 
primary 'Ishikawa, T.'   17 
# 
_cell.length_a           111.495 
_cell.length_b           111.495 
_cell.length_c           145.487 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4KSP 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.entry_id                         4KSP 
_symmetry.Int_Tables_number                92 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine/threonine-protein kinase B-raf' 32322.379 2  2.7.11.1 ? 'UNP residues 445-726' ? 
2 non-polymer syn 
'N-{7-cyano-6-[4-fluoro-3-({[3-(trifluoromethyl)phenyl]acetyl}amino)phenoxy]-1,3-benzothiazol-2-yl}cyclopropanecarboxamide' 
554.515   2  ?        ? ?                      ? 
3 water       nat water 18.015    39 ?        ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Proto-oncogene B-Raf, p94, v-Raf murine sarcoma viral oncogene homolog B1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTK
PQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKS
RWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVR
SNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTK
PQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKS
RWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVR
SNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ASP n 
1 4   SER n 
1 5   SER n 
1 6   ASP n 
1 7   ASP n 
1 8   TRP n 
1 9   GLU n 
1 10  ILE n 
1 11  PRO n 
1 12  ASP n 
1 13  GLY n 
1 14  GLN n 
1 15  ILE n 
1 16  THR n 
1 17  VAL n 
1 18  GLY n 
1 19  GLN n 
1 20  ARG n 
1 21  ILE n 
1 22  GLY n 
1 23  SER n 
1 24  GLY n 
1 25  SER n 
1 26  PHE n 
1 27  GLY n 
1 28  THR n 
1 29  VAL n 
1 30  TYR n 
1 31  LYS n 
1 32  GLY n 
1 33  LYS n 
1 34  TRP n 
1 35  HIS n 
1 36  GLY n 
1 37  ASP n 
1 38  VAL n 
1 39  ALA n 
1 40  VAL n 
1 41  LYS n 
1 42  MET n 
1 43  LEU n 
1 44  ASN n 
1 45  VAL n 
1 46  THR n 
1 47  ALA n 
1 48  PRO n 
1 49  THR n 
1 50  PRO n 
1 51  GLN n 
1 52  GLN n 
1 53  LEU n 
1 54  GLN n 
1 55  ALA n 
1 56  PHE n 
1 57  LYS n 
1 58  ASN n 
1 59  GLU n 
1 60  VAL n 
1 61  GLY n 
1 62  VAL n 
1 63  LEU n 
1 64  ARG n 
1 65  LYS n 
1 66  THR n 
1 67  ARG n 
1 68  HIS n 
1 69  VAL n 
1 70  ASN n 
1 71  ILE n 
1 72  LEU n 
1 73  LEU n 
1 74  PHE n 
1 75  MET n 
1 76  GLY n 
1 77  TYR n 
1 78  SER n 
1 79  THR n 
1 80  LYS n 
1 81  PRO n 
1 82  GLN n 
1 83  LEU n 
1 84  ALA n 
1 85  ILE n 
1 86  VAL n 
1 87  THR n 
1 88  GLN n 
1 89  TRP n 
1 90  CYS n 
1 91  GLU n 
1 92  GLY n 
1 93  SER n 
1 94  SER n 
1 95  LEU n 
1 96  TYR n 
1 97  HIS n 
1 98  HIS n 
1 99  LEU n 
1 100 HIS n 
1 101 ILE n 
1 102 ILE n 
1 103 GLU n 
1 104 THR n 
1 105 LYS n 
1 106 PHE n 
1 107 GLU n 
1 108 MET n 
1 109 ILE n 
1 110 LYS n 
1 111 LEU n 
1 112 ILE n 
1 113 ASP n 
1 114 ILE n 
1 115 ALA n 
1 116 ARG n 
1 117 GLN n 
1 118 THR n 
1 119 ALA n 
1 120 GLN n 
1 121 GLY n 
1 122 MET n 
1 123 ASP n 
1 124 TYR n 
1 125 LEU n 
1 126 HIS n 
1 127 ALA n 
1 128 LYS n 
1 129 SER n 
1 130 ILE n 
1 131 ILE n 
1 132 HIS n 
1 133 ARG n 
1 134 ASP n 
1 135 LEU n 
1 136 LYS n 
1 137 SER n 
1 138 ASN n 
1 139 ASN n 
1 140 ILE n 
1 141 PHE n 
1 142 LEU n 
1 143 HIS n 
1 144 GLU n 
1 145 ASP n 
1 146 LEU n 
1 147 THR n 
1 148 VAL n 
1 149 LYS n 
1 150 ILE n 
1 151 GLY n 
1 152 ASP n 
1 153 PHE n 
1 154 GLY n 
1 155 LEU n 
1 156 ALA n 
1 157 THR n 
1 158 VAL n 
1 159 LYS n 
1 160 SER n 
1 161 ARG n 
1 162 TRP n 
1 163 SER n 
1 164 GLY n 
1 165 SER n 
1 166 HIS n 
1 167 GLN n 
1 168 PHE n 
1 169 GLU n 
1 170 GLN n 
1 171 LEU n 
1 172 SER n 
1 173 GLY n 
1 174 SER n 
1 175 ILE n 
1 176 LEU n 
1 177 TRP n 
1 178 MET n 
1 179 ALA n 
1 180 PRO n 
1 181 GLU n 
1 182 VAL n 
1 183 ILE n 
1 184 ARG n 
1 185 MET n 
1 186 GLN n 
1 187 ASP n 
1 188 LYS n 
1 189 ASN n 
1 190 PRO n 
1 191 TYR n 
1 192 SER n 
1 193 PHE n 
1 194 GLN n 
1 195 SER n 
1 196 ASP n 
1 197 VAL n 
1 198 TYR n 
1 199 ALA n 
1 200 PHE n 
1 201 GLY n 
1 202 ILE n 
1 203 VAL n 
1 204 LEU n 
1 205 TYR n 
1 206 GLU n 
1 207 LEU n 
1 208 MET n 
1 209 THR n 
1 210 GLY n 
1 211 GLN n 
1 212 LEU n 
1 213 PRO n 
1 214 TYR n 
1 215 SER n 
1 216 ASN n 
1 217 ILE n 
1 218 ASN n 
1 219 ASN n 
1 220 ARG n 
1 221 ASP n 
1 222 GLN n 
1 223 ILE n 
1 224 ILE n 
1 225 PHE n 
1 226 MET n 
1 227 VAL n 
1 228 GLY n 
1 229 ARG n 
1 230 GLY n 
1 231 TYR n 
1 232 LEU n 
1 233 SER n 
1 234 PRO n 
1 235 ASP n 
1 236 LEU n 
1 237 SER n 
1 238 LYS n 
1 239 VAL n 
1 240 ARG n 
1 241 SER n 
1 242 ASN n 
1 243 CYS n 
1 244 PRO n 
1 245 LYS n 
1 246 ALA n 
1 247 MET n 
1 248 LYS n 
1 249 ARG n 
1 250 LEU n 
1 251 MET n 
1 252 ALA n 
1 253 GLU n 
1 254 CYS n 
1 255 LEU n 
1 256 LYS n 
1 257 LYS n 
1 258 LYS n 
1 259 ARG n 
1 260 ASP n 
1 261 GLU n 
1 262 ARG n 
1 263 PRO n 
1 264 LEU n 
1 265 PHE n 
1 266 PRO n 
1 267 GLN n 
1 268 ILE n 
1 269 LEU n 
1 270 ALA n 
1 271 SER n 
1 272 ILE n 
1 273 GLU n 
1 274 LEU n 
1 275 LEU n 
1 276 ALA n 
1 277 ARG n 
1 278 SER n 
1 279 LEU n 
1 280 PRO n 
1 281 LYS n 
1 282 ILE n 
1 283 HIS n 
1 284 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'BRAF, BRAF1, P94, RAFB1, V-RAF MURINE SARCOMA VIRAL ONCOGENE HOMOLOG B1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            Sf9 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pFASTBAC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BRAF_HUMAN 
_struct_ref.pdbx_db_accession          P15056 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQ
LAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRW
SGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSN
CPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHR
;
_struct_ref.pdbx_align_begin           445 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4KSP A 3 ? 284 ? P15056 445 ? 726 ? 444 725 
2 1 4KSP B 3 ? 284 ? P15056 445 ? 726 ? 444 725 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4KSP GLY A 1 ? UNP P15056 ? ? 'EXPRESSION TAG' 442 1 
1 4KSP SER A 2 ? UNP P15056 ? ? 'EXPRESSION TAG' 443 2 
2 4KSP GLY B 1 ? UNP P15056 ? ? 'EXPRESSION TAG' 442 3 
2 4KSP SER B 2 ? UNP P15056 ? ? 'EXPRESSION TAG' 443 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1SU non-polymer         . 
'N-{7-cyano-6-[4-fluoro-3-({[3-(trifluoromethyl)phenyl]acetyl}amino)phenoxy]-1,3-benzothiazol-2-yl}cyclopropanecarboxamide' ? 
'C27 H18 F4 N4 O3 S' 554.515 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'         133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'       121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'         75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER ? 'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'      149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'         105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'        117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4KSP 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.50 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   64.83 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'sitting drop, vapor diffusion' 
_exptl_crystal_grow.pH              8.3 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    
'9.6 % PEG 8000, 0.8M LiCl, 100 mM Tris pH 8.3, sitting drop, vapor diffusion, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           92 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2010-06-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Double crystal cryo-cooled Si (111)' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
# 
_reflns.entry_id                     4KSP 
_reflns.d_resolution_high            2.93 
_reflns.d_resolution_low             50.0 
_reflns.number_obs                   20267 
_reflns.pdbx_Rmerge_I_obs            0.157 
_reflns.pdbx_netI_over_sigmaI        5.4 
_reflns.pdbx_chi_squared             1.104 
_reflns.pdbx_redundancy              6.7 
_reflns.percent_possible_obs         99.8 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   20307 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.930 3.000  ? ? ? 0.861 ? ? 0.971 3.900 ? 960  98.500  1  1 
3.000 3.060  ? ? ? 0.829 ? ? 0.777 4.500 ? 998  99.800  2  1 
3.060 3.110  ? ? ? 0.788 ? ? 0.964 5.200 ? 1000 100.000 3  1 
3.110 3.180  ? ? ? 0.765 ? ? 1.224 5.800 ? 990  100.000 4  1 
3.180 3.250  ? ? ? 0.668 ? ? 1.105 6.300 ? 986  100.000 5  1 
3.250 3.320  ? ? ? 0.566 ? ? 0.937 6.700 ? 992  100.000 6  1 
3.320 3.410  ? ? ? 0.476 ? ? 1.012 7.100 ? 1002 100.000 7  1 
3.410 3.500  ? ? ? 0.420 ? ? 1.176 7.300 ? 995  100.000 8  1 
3.500 3.600  ? ? ? 0.374 ? ? 0.987 7.500 ? 1000 100.000 9  1 
3.600 3.720  ? ? ? 0.293 ? ? 1.087 7.500 ? 1004 100.000 10 1 
3.720 3.850  ? ? ? 0.246 ? ? 1.169 7.500 ? 1009 99.900  11 1 
3.850 4.000  ? ? ? 0.203 ? ? 1.167 7.500 ? 995  99.900  12 1 
4.000 4.190  ? ? ? 0.172 ? ? 1.193 7.400 ? 1011 100.000 13 1 
4.190 4.410  ? ? ? 0.148 ? ? 1.240 7.300 ? 1013 99.700  14 1 
4.410 4.680  ? ? ? 0.130 ? ? 1.286 7.200 ? 1014 99.800  15 1 
4.680 5.040  ? ? ? 0.128 ? ? 1.255 7.100 ? 1020 100.000 16 1 
5.040 5.550  ? ? ? 0.119 ? ? 1.150 7.200 ? 1030 99.900  17 1 
5.550 6.350  ? ? ? 0.114 ? ? 1.092 7.300 ? 1040 100.000 18 1 
6.350 8.000  ? ? ? 0.085 ? ? 1.042 7.000 ? 1067 99.900  19 1 
8.000 50.000 ? ? ? 0.058 ? ? 0.972 6.300 ? 1141 99.400  20 1 
# 
_refine.entry_id                                 4KSP 
_refine.ls_d_res_high                            2.93 
_refine.ls_d_res_low                             35.0 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    98.4 
_refine.ls_number_reflns_obs                     20089 
_refine.ls_number_reflns_all                     20307 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : WITH TLS ADDED' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1965 
_refine.ls_R_factor_R_work                       0.1941 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2417 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1031 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               79.5058 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.8900 
_refine.aniso_B[2][2]                            -0.8900 
_refine.aniso_B[3][3]                            1.7700 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9500 
_refine.correlation_coeff_Fo_to_Fc_free          0.9170 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.8070 
_refine.pdbx_overall_ESU_R_Free                  0.3400 
_refine.overall_SU_ML                            0.2610 
_refine.overall_SU_B                             29.0920 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      4DBN 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                166.300 
_refine.B_iso_min                                29.330 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4099 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         78 
_refine_hist.number_atoms_solvent             39 
_refine_hist.number_atoms_total               4216 
_refine_hist.d_res_high                       2.93 
_refine_hist.d_res_low                        35.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       4274 0.007  0.019  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         4139 0.002  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    5780 1.317  1.982  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      9512 0.734  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 509  5.896  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 186  34.825 23.871 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 766  18.170 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 26   18.188 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         625  0.066  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   4838 0.004  0.021  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     1006 0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.930 
_refine_ls_shell.d_res_low                        3.0030 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               87.3100 
_refine_ls_shell.number_reflns_R_work             1218 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3020 
_refine_ls_shell.R_factor_R_free                  0.4790 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             62 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1280 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4KSP 
_struct.title                     'Crystal Structure of Human B-raf bound to a DFG-out Inhibitor TAK-632' 
_struct.pdbx_descriptor           'Serine/threonine-protein kinase B-raf (E.C.2.7.11.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4KSP 
_struct_keywords.text            
'human serine/theronine protein Kinase, kinase drug complex, TRANSFERASE-TRANSFERASE INHIBITOR complex' 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 49  ? ARG A 64  ? THR A 490 ARG A 505 1 ? 16 
HELX_P HELX_P2  2  LEU A 95  ? ILE A 101 ? LEU A 536 ILE A 542 1 ? 7  
HELX_P HELX_P3  3  GLU A 107 ? LYS A 128 ? GLU A 548 LYS A 569 1 ? 22 
HELX_P HELX_P4  4  LYS A 136 ? ASN A 138 ? LYS A 577 ASN A 579 5 ? 3  
HELX_P HELX_P5  5  SER A 174 ? MET A 178 ? SER A 615 MET A 619 5 ? 5  
HELX_P HELX_P6  6  ALA A 179 ? MET A 185 ? ALA A 620 MET A 626 1 ? 7  
HELX_P HELX_P7  7  SER A 192 ? GLY A 210 ? SER A 633 GLY A 651 1 ? 19 
HELX_P HELX_P8  8  ASN A 219 ? ARG A 229 ? ASN A 660 ARG A 670 1 ? 11 
HELX_P HELX_P9  9  ASP A 235 ? VAL A 239 ? ASP A 676 VAL A 680 5 ? 5  
HELX_P HELX_P10 10 PRO A 244 ? LEU A 255 ? PRO A 685 LEU A 696 1 ? 12 
HELX_P HELX_P11 11 LYS A 258 ? ARG A 262 ? LYS A 699 ARG A 703 5 ? 5  
HELX_P HELX_P12 12 LEU A 264 ? SER A 278 ? LEU A 705 SER A 719 1 ? 15 
HELX_P HELX_P13 13 THR B 49  ? ARG B 64  ? THR B 490 ARG B 505 1 ? 16 
HELX_P HELX_P14 14 LEU B 95  ? ILE B 101 ? LEU B 536 ILE B 542 1 ? 7  
HELX_P HELX_P15 15 GLU B 107 ? LYS B 128 ? GLU B 548 LYS B 569 1 ? 22 
HELX_P HELX_P16 16 LYS B 136 ? ASN B 138 ? LYS B 577 ASN B 579 5 ? 3  
HELX_P HELX_P17 17 SER B 174 ? MET B 178 ? SER B 615 MET B 619 5 ? 5  
HELX_P HELX_P18 18 ALA B 179 ? MET B 185 ? ALA B 620 MET B 626 1 ? 7  
HELX_P HELX_P19 19 SER B 192 ? GLY B 210 ? SER B 633 GLY B 651 1 ? 19 
HELX_P HELX_P20 20 ASN B 219 ? ARG B 229 ? ASN B 660 ARG B 670 1 ? 11 
HELX_P HELX_P21 21 ASP B 235 ? VAL B 239 ? ASP B 676 VAL B 680 5 ? 5  
HELX_P HELX_P22 22 PRO B 244 ? LEU B 255 ? PRO B 685 LEU B 696 1 ? 12 
HELX_P HELX_P23 23 LYS B 258 ? ARG B 262 ? LYS B 699 ARG B 703 5 ? 5  
HELX_P HELX_P24 24 LEU B 264 ? SER B 278 ? LEU B 705 SER B 719 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 5 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 16  ? GLY A 24  ? THR A 457 GLY A 465 
A 2 GLY A 27  ? LYS A 33  ? GLY A 468 LYS A 474 
A 3 ASP A 37  ? MET A 42  ? ASP A 478 MET A 483 
A 4 ALA A 84  ? GLN A 88  ? ALA A 525 GLN A 529 
A 5 PHE A 74  ? SER A 78  ? PHE A 515 SER A 519 
B 1 GLY A 92  ? SER A 94  ? GLY A 533 SER A 535 
B 2 ILE A 140 ? HIS A 143 ? ILE A 581 HIS A 584 
B 3 THR A 147 ? ILE A 150 ? THR A 588 ILE A 591 
C 1 THR B 16  ? GLY B 24  ? THR B 457 GLY B 465 
C 2 GLY B 27  ? LYS B 33  ? GLY B 468 LYS B 474 
C 3 ASP B 37  ? MET B 42  ? ASP B 478 MET B 483 
C 4 ALA B 84  ? GLN B 88  ? ALA B 525 GLN B 529 
C 5 PHE B 74  ? SER B 78  ? PHE B 515 SER B 519 
D 1 GLY B 92  ? SER B 94  ? GLY B 533 SER B 535 
D 2 ILE B 140 ? HIS B 143 ? ILE B 581 HIS B 584 
D 3 THR B 147 ? ILE B 150 ? THR B 588 ILE B 591 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 21  ? N ILE A 462 O VAL A 29  ? O VAL A 470 
A 2 3 N GLY A 32  ? N GLY A 473 O VAL A 38  ? O VAL A 479 
A 3 4 N LYS A 41  ? N LYS A 482 O ILE A 85  ? O ILE A 526 
A 4 5 O VAL A 86  ? O VAL A 527 N GLY A 76  ? N GLY A 517 
B 1 2 N SER A 93  ? N SER A 534 O LEU A 142 ? O LEU A 583 
B 2 3 N PHE A 141 ? N PHE A 582 O LYS A 149 ? O LYS A 590 
C 1 2 N ILE B 21  ? N ILE B 462 O VAL B 29  ? O VAL B 470 
C 2 3 N GLY B 32  ? N GLY B 473 O VAL B 38  ? O VAL B 479 
C 3 4 N ALA B 39  ? N ALA B 480 O THR B 87  ? O THR B 528 
C 4 5 O VAL B 86  ? O VAL B 527 N GLY B 76  ? N GLY B 517 
D 1 2 N SER B 93  ? N SER B 534 O LEU B 142 ? O LEU B 583 
D 2 3 N PHE B 141 ? N PHE B 582 O LYS B 149 ? O LYS B 590 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE 1SU A 901' 
AC2 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE 1SU B 901' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 VAL A 29  ? VAL A 470  . ? 1_555 ? 
2  AC1 17 ALA A 39  ? ALA A 480  . ? 1_555 ? 
3  AC1 17 LYS A 41  ? LYS A 482  . ? 1_555 ? 
4  AC1 17 GLU A 59  ? GLU A 500  . ? 1_555 ? 
5  AC1 17 LEU A 63  ? LEU A 504  . ? 1_555 ? 
6  AC1 17 LEU A 72  ? LEU A 513  . ? 1_555 ? 
7  AC1 17 ILE A 85  ? ILE A 526  . ? 1_555 ? 
8  AC1 17 THR A 87  ? THR A 528  . ? 1_555 ? 
9  AC1 17 GLN A 88  ? GLN A 529  . ? 1_555 ? 
10 AC1 17 TRP A 89  ? TRP A 530  . ? 1_555 ? 
11 AC1 17 CYS A 90  ? CYS A 531  . ? 1_555 ? 
12 AC1 17 GLY A 92  ? GLY A 533  . ? 1_555 ? 
13 AC1 17 HIS A 132 ? HIS A 573  . ? 1_555 ? 
14 AC1 17 PHE A 141 ? PHE A 582  . ? 1_555 ? 
15 AC1 17 GLY A 151 ? GLY A 592  . ? 1_555 ? 
16 AC1 17 ASP A 152 ? ASP A 593  . ? 1_555 ? 
17 AC1 17 PHE A 153 ? PHE A 594  . ? 1_555 ? 
18 AC2 18 ILE B 21  ? ILE B 462  . ? 1_555 ? 
19 AC2 18 VAL B 29  ? VAL B 470  . ? 1_555 ? 
20 AC2 18 ALA B 39  ? ALA B 480  . ? 1_555 ? 
21 AC2 18 LYS B 41  ? LYS B 482  . ? 1_555 ? 
22 AC2 18 GLU B 59  ? GLU B 500  . ? 1_555 ? 
23 AC2 18 LEU B 63  ? LEU B 504  . ? 1_555 ? 
24 AC2 18 ILE B 85  ? ILE B 526  . ? 1_555 ? 
25 AC2 18 THR B 87  ? THR B 528  . ? 1_555 ? 
26 AC2 18 GLN B 88  ? GLN B 529  . ? 1_555 ? 
27 AC2 18 TRP B 89  ? TRP B 530  . ? 1_555 ? 
28 AC2 18 CYS B 90  ? CYS B 531  . ? 1_555 ? 
29 AC2 18 LEU B 125 ? LEU B 566  . ? 1_555 ? 
30 AC2 18 HIS B 132 ? HIS B 573  . ? 1_555 ? 
31 AC2 18 PHE B 141 ? PHE B 582  . ? 1_555 ? 
32 AC2 18 GLY B 151 ? GLY B 592  . ? 1_555 ? 
33 AC2 18 ASP B 152 ? ASP B 593  . ? 1_555 ? 
34 AC2 18 PHE B 153 ? PHE B 594  . ? 1_555 ? 
35 AC2 18 HOH F .   ? HOH B 1008 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4KSP 
_atom_sites.fract_transf_matrix[1][1]   0.008969 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008969 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006873 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 6   ? 50.299 -13.702 9.226   1.00 129.26 ? 447  ASP A N   1 
ATOM   2    C CA  . ASP A 1 6   ? 49.538 -14.847 9.830   1.00 122.63 ? 447  ASP A CA  1 
ATOM   3    C C   . ASP A 1 6   ? 50.452 -15.845 10.548  1.00 118.11 ? 447  ASP A C   1 
ATOM   4    O O   . ASP A 1 6   ? 51.659 -15.913 10.291  1.00 122.58 ? 447  ASP A O   1 
ATOM   5    C CB  . ASP A 1 6   ? 48.693 -15.588 8.769   1.00 120.48 ? 447  ASP A CB  1 
ATOM   6    C CG  . ASP A 1 6   ? 47.251 -15.084 8.692   1.00 119.88 ? 447  ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 6   ? 47.009 -13.864 8.865   1.00 121.59 ? 447  ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 6   ? 46.358 -15.924 8.447   1.00 114.65 ? 447  ASP A OD2 1 
ATOM   9    N N   . ASP A 1 7   ? 49.856 -16.611 11.456  1.00 109.02 ? 448  ASP A N   1 
ATOM   10   C CA  . ASP A 1 7   ? 50.570 -17.654 12.176  1.00 103.87 ? 448  ASP A CA  1 
ATOM   11   C C   . ASP A 1 7   ? 49.564 -18.648 12.737  1.00 93.95  ? 448  ASP A C   1 
ATOM   12   O O   . ASP A 1 7   ? 48.594 -18.264 13.389  1.00 90.87  ? 448  ASP A O   1 
ATOM   13   C CB  . ASP A 1 7   ? 51.408 -17.051 13.304  1.00 108.63 ? 448  ASP A CB  1 
ATOM   14   C CG  . ASP A 1 7   ? 52.430 -18.019 13.850  1.00 109.27 ? 448  ASP A CG  1 
ATOM   15   O OD1 . ASP A 1 7   ? 53.114 -17.649 14.823  1.00 112.96 ? 448  ASP A OD1 1 
ATOM   16   O OD2 . ASP A 1 7   ? 52.551 -19.143 13.310  1.00 105.33 ? 448  ASP A OD2 1 
ATOM   17   N N   . TRP A 1 8   ? 49.794 -19.925 12.475  1.00 86.90  ? 449  TRP A N   1 
ATOM   18   C CA  . TRP A 1 8   ? 48.833 -20.942 12.852  1.00 79.33  ? 449  TRP A CA  1 
ATOM   19   C C   . TRP A 1 8   ? 49.329 -21.782 14.011  1.00 77.68  ? 449  TRP A C   1 
ATOM   20   O O   . TRP A 1 8   ? 48.831 -22.882 14.235  1.00 72.97  ? 449  TRP A O   1 
ATOM   21   C CB  . TRP A 1 8   ? 48.530 -21.828 11.652  1.00 77.19  ? 449  TRP A CB  1 
ATOM   22   C CG  . TRP A 1 8   ? 48.030 -21.055 10.494  1.00 76.18  ? 449  TRP A CG  1 
ATOM   23   C CD1 . TRP A 1 8   ? 48.758 -20.597 9.449   1.00 79.61  ? 449  TRP A CD1 1 
ATOM   24   C CD2 . TRP A 1 8   ? 46.688 -20.628 10.272  1.00 73.50  ? 449  TRP A CD2 1 
ATOM   25   N NE1 . TRP A 1 8   ? 47.955 -19.917 8.572   1.00 80.94  ? 449  TRP A NE1 1 
ATOM   26   C CE2 . TRP A 1 8   ? 46.674 -19.922 9.053   1.00 76.85  ? 449  TRP A CE2 1 
ATOM   27   C CE3 . TRP A 1 8   ? 45.492 -20.780 10.980  1.00 69.40  ? 449  TRP A CE3 1 
ATOM   28   C CZ2 . TRP A 1 8   ? 45.510 -19.362 8.524   1.00 75.20  ? 449  TRP A CZ2 1 
ATOM   29   C CZ3 . TRP A 1 8   ? 44.339 -20.223 10.457  1.00 68.69  ? 449  TRP A CZ3 1 
ATOM   30   C CH2 . TRP A 1 8   ? 44.356 -19.522 9.240   1.00 71.44  ? 449  TRP A CH2 1 
ATOM   31   N N   . GLU A 1 9   ? 50.299 -21.269 14.762  1.00 81.47  ? 450  GLU A N   1 
ATOM   32   C CA  . GLU A 1 9   ? 50.720 -21.957 15.966  1.00 82.73  ? 450  GLU A CA  1 
ATOM   33   C C   . GLU A 1 9   ? 49.579 -21.927 16.960  1.00 81.30  ? 450  GLU A C   1 
ATOM   34   O O   . GLU A 1 9   ? 48.905 -20.912 17.106  1.00 84.41  ? 450  GLU A O   1 
ATOM   35   C CB  . GLU A 1 9   ? 51.954 -21.325 16.591  1.00 89.62  ? 450  GLU A CB  1 
ATOM   36   C CG  . GLU A 1 9   ? 52.390 -22.035 17.862  1.00 91.43  ? 450  GLU A CG  1 
ATOM   37   C CD  . GLU A 1 9   ? 53.793 -21.673 18.283  1.00 99.17  ? 450  GLU A CD  1 
ATOM   38   O OE1 . GLU A 1 9   ? 54.651 -22.576 18.270  1.00 102.79 ? 450  GLU A OE1 1 
ATOM   39   O OE2 . GLU A 1 9   ? 54.038 -20.493 18.618  1.00 104.49 ? 450  GLU A OE2 1 
ATOM   40   N N   . ILE A 1 10  ? 49.370 -23.053 17.627  1.00 80.36  ? 451  ILE A N   1 
ATOM   41   C CA  . ILE A 1 10  ? 48.336 -23.208 18.630  1.00 80.37  ? 451  ILE A CA  1 
ATOM   42   C C   . ILE A 1 10  ? 49.045 -23.164 19.990  1.00 84.84  ? 451  ILE A C   1 
ATOM   43   O O   . ILE A 1 10  ? 50.005 -23.908 20.197  1.00 85.55  ? 451  ILE A O   1 
ATOM   44   C CB  . ILE A 1 10  ? 47.603 -24.557 18.429  1.00 77.86  ? 451  ILE A CB  1 
ATOM   45   C CG1 . ILE A 1 10  ? 47.070 -24.663 16.994  1.00 74.50  ? 451  ILE A CG1 1 
ATOM   46   C CG2 . ILE A 1 10  ? 46.460 -24.721 19.424  1.00 80.00  ? 451  ILE A CG2 1 
ATOM   47   C CD1 . ILE A 1 10  ? 46.492 -26.017 16.639  1.00 71.75  ? 451  ILE A CD1 1 
ATOM   48   N N   . PRO A 1 11  ? 48.600 -22.285 20.915  1.00 88.48  ? 452  PRO A N   1 
ATOM   49   C CA  . PRO A 1 11  ? 49.257 -22.297 22.226  1.00 93.48  ? 452  PRO A CA  1 
ATOM   50   C C   . PRO A 1 11  ? 49.086 -23.642 22.918  1.00 94.87  ? 452  PRO A C   1 
ATOM   51   O O   . PRO A 1 11  ? 48.145 -24.391 22.610  1.00 88.78  ? 452  PRO A O   1 
ATOM   52   C CB  . PRO A 1 11  ? 48.556 -21.180 23.015  1.00 96.79  ? 452  PRO A CB  1 
ATOM   53   C CG  . PRO A 1 11  ? 47.357 -20.796 22.217  1.00 93.24  ? 452  PRO A CG  1 
ATOM   54   C CD  . PRO A 1 11  ? 47.607 -21.203 20.798  1.00 88.87  ? 452  PRO A CD  1 
ATOM   55   N N   . ASP A 1 12  ? 50.005 -23.943 23.834  1.00 101.42 ? 453  ASP A N   1 
ATOM   56   C CA  . ASP A 1 12  ? 50.030 -25.248 24.495  1.00 102.70 ? 453  ASP A CA  1 
ATOM   57   C C   . ASP A 1 12  ? 48.842 -25.423 25.442  1.00 103.45 ? 453  ASP A C   1 
ATOM   58   O O   . ASP A 1 12  ? 48.217 -24.442 25.863  1.00 106.00 ? 453  ASP A O   1 
ATOM   59   C CB  . ASP A 1 12  ? 51.372 -25.512 25.216  1.00 108.94 ? 453  ASP A CB  1 
ATOM   60   C CG  . ASP A 1 12  ? 51.789 -24.384 26.158  1.00 115.28 ? 453  ASP A CG  1 
ATOM   61   O OD1 . ASP A 1 12  ? 51.746 -23.207 25.738  1.00 116.12 ? 453  ASP A OD1 1 
ATOM   62   O OD2 . ASP A 1 12  ? 52.189 -24.682 27.307  1.00 118.89 ? 453  ASP A OD2 1 
ATOM   63   N N   . GLY A 1 13  ? 48.515 -26.682 25.728  1.00 100.71 ? 454  GLY A N   1 
ATOM   64   C CA  . GLY A 1 13  ? 47.440 -27.021 26.652  1.00 101.75 ? 454  GLY A CA  1 
ATOM   65   C C   . GLY A 1 13  ? 46.066 -26.569 26.209  1.00 97.47  ? 454  GLY A C   1 
ATOM   66   O O   . GLY A 1 13  ? 45.190 -26.343 27.035  1.00 102.76 ? 454  GLY A O   1 
ATOM   67   N N   . GLN A 1 14  ? 45.888 -26.410 24.907  1.00 91.95  ? 455  GLN A N   1 
ATOM   68   C CA  . GLN A 1 14  ? 44.573 -26.164 24.325  1.00 89.55  ? 455  GLN A CA  1 
ATOM   69   C C   . GLN A 1 14  ? 44.038 -27.434 23.701  1.00 85.31  ? 455  GLN A C   1 
ATOM   70   O O   . GLN A 1 14  ? 42.851 -27.714 23.778  1.00 83.02  ? 455  GLN A O   1 
ATOM   71   C CB  . GLN A 1 14  ? 44.658 -25.083 23.257  1.00 87.66  ? 455  GLN A CB  1 
ATOM   72   C CG  . GLN A 1 14  ? 44.961 -23.709 23.820  1.00 91.91  ? 455  GLN A CG  1 
ATOM   73   C CD  . GLN A 1 14  ? 44.245 -22.626 23.050  1.00 90.75  ? 455  GLN A CD  1 
ATOM   74   O OE1 . GLN A 1 14  ? 44.327 -22.569 21.829  1.00 88.96  ? 455  GLN A OE1 1 
ATOM   75   N NE2 . GLN A 1 14  ? 43.522 -21.774 23.757  1.00 95.99  ? 455  GLN A NE2 1 
ATOM   76   N N   . ILE A 1 15  ? 44.932 -28.196 23.080  1.00 85.48  ? 456  ILE A N   1 
ATOM   77   C CA  . ILE A 1 15  ? 44.580 -29.451 22.447  1.00 84.62  ? 456  ILE A CA  1 
ATOM   78   C C   . ILE A 1 15  ? 44.473 -30.559 23.483  1.00 86.83  ? 456  ILE A C   1 
ATOM   79   O O   . ILE A 1 15  ? 45.421 -30.821 24.209  1.00 88.77  ? 456  ILE A O   1 
ATOM   80   C CB  . ILE A 1 15  ? 45.640 -29.872 21.418  1.00 84.51  ? 456  ILE A CB  1 
ATOM   81   C CG1 . ILE A 1 15  ? 45.809 -28.787 20.347  1.00 83.41  ? 456  ILE A CG1 1 
ATOM   82   C CG2 . ILE A 1 15  ? 45.246 -31.194 20.764  1.00 85.20  ? 456  ILE A CG2 1 
ATOM   83   C CD1 . ILE A 1 15  ? 47.055 -28.957 19.501  1.00 83.21  ? 456  ILE A CD1 1 
ATOM   84   N N   . THR A 1 16  ? 43.310 -31.199 23.537  1.00 88.33  ? 457  THR A N   1 
ATOM   85   C CA  . THR A 1 16  ? 43.113 -32.408 24.328  1.00 91.24  ? 457  THR A CA  1 
ATOM   86   C C   . THR A 1 16  ? 43.206 -33.602 23.393  1.00 88.29  ? 457  THR A C   1 
ATOM   87   O O   . THR A 1 16  ? 42.606 -33.602 22.324  1.00 85.96  ? 457  THR A O   1 
ATOM   88   C CB  . THR A 1 16  ? 41.731 -32.425 24.997  1.00 94.13  ? 457  THR A CB  1 
ATOM   89   O OG1 . THR A 1 16  ? 41.458 -31.134 25.557  1.00 95.10  ? 457  THR A OG1 1 
ATOM   90   C CG2 . THR A 1 16  ? 41.669 -33.494 26.088  1.00 98.16  ? 457  THR A CG2 1 
ATOM   91   N N   . VAL A 1 17  ? 43.958 -34.616 23.799  1.00 90.98  ? 458  VAL A N   1 
ATOM   92   C CA  . VAL A 1 17  ? 44.180 -35.796 22.967  1.00 89.36  ? 458  VAL A CA  1 
ATOM   93   C C   . VAL A 1 17  ? 43.288 -36.952 23.430  1.00 92.70  ? 458  VAL A C   1 
ATOM   94   O O   . VAL A 1 17  ? 43.291 -37.317 24.609  1.00 97.38  ? 458  VAL A O   1 
ATOM   95   C CB  . VAL A 1 17  ? 45.661 -36.216 23.002  1.00 89.63  ? 458  VAL A CB  1 
ATOM   96   C CG1 . VAL A 1 17  ? 45.857 -37.558 22.323  1.00 90.50  ? 458  VAL A CG1 1 
ATOM   97   C CG2 . VAL A 1 17  ? 46.524 -35.155 22.336  1.00 87.09  ? 458  VAL A CG2 1 
ATOM   98   N N   . GLY A 1 18  ? 42.532 -37.520 22.491  1.00 91.43  ? 459  GLY A N   1 
ATOM   99   C CA  . GLY A 1 18  ? 41.613 -38.626 22.770  1.00 94.08  ? 459  GLY A CA  1 
ATOM   100  C C   . GLY A 1 18  ? 42.156 -39.968 22.307  1.00 95.55  ? 459  GLY A C   1 
ATOM   101  O O   . GLY A 1 18  ? 43.338 -40.267 22.480  1.00 95.15  ? 459  GLY A O   1 
ATOM   102  N N   . GLN A 1 19  ? 41.293 -40.780 21.707  1.00 97.91  ? 460  GLN A N   1 
ATOM   103  C CA  . GLN A 1 19  ? 41.662 -42.153 21.368  1.00 102.80 ? 460  GLN A CA  1 
ATOM   104  C C   . GLN A 1 19  ? 42.642 -42.223 20.207  1.00 99.68  ? 460  GLN A C   1 
ATOM   105  O O   . GLN A 1 19  ? 42.530 -41.465 19.244  1.00 96.43  ? 460  GLN A O   1 
ATOM   106  C CB  . GLN A 1 19  ? 40.415 -42.987 21.068  1.00 107.94 ? 460  GLN A CB  1 
ATOM   107  C CG  . GLN A 1 19  ? 39.735 -43.486 22.338  1.00 115.54 ? 460  GLN A CG  1 
ATOM   108  C CD  . GLN A 1 19  ? 38.411 -44.174 22.074  1.00 120.14 ? 460  GLN A CD  1 
ATOM   109  O OE1 . GLN A 1 19  ? 37.773 -43.951 21.038  1.00 120.59 ? 460  GLN A OE1 1 
ATOM   110  N NE2 . GLN A 1 19  ? 37.985 -45.010 23.016  1.00 125.06 ? 460  GLN A NE2 1 
ATOM   111  N N   . ARG A 1 20  ? 43.604 -43.136 20.308  1.00 102.75 ? 461  ARG A N   1 
ATOM   112  C CA  . ARG A 1 20  ? 44.566 -43.362 19.230  1.00 102.23 ? 461  ARG A CA  1 
ATOM   113  C C   . ARG A 1 20  ? 43.827 -43.855 17.983  1.00 103.01 ? 461  ARG A C   1 
ATOM   114  O O   . ARG A 1 20  ? 42.801 -44.523 18.093  1.00 108.12 ? 461  ARG A O   1 
ATOM   115  C CB  . ARG A 1 20  ? 45.639 -44.380 19.648  1.00 106.58 ? 461  ARG A CB  1 
ATOM   116  C CG  . ARG A 1 20  ? 46.958 -44.201 18.909  1.00 106.16 ? 461  ARG A CG  1 
ATOM   117  C CD  . ARG A 1 20  ? 47.858 -45.427 18.950  1.00 112.60 ? 461  ARG A CD  1 
ATOM   118  N NE  . ARG A 1 20  ? 47.340 -46.531 18.136  1.00 116.38 ? 461  ARG A NE  1 
ATOM   119  C CZ  . ARG A 1 20  ? 46.796 -47.656 18.610  1.00 121.96 ? 461  ARG A CZ  1 
ATOM   120  N NH1 . ARG A 1 20  ? 46.683 -47.878 19.919  1.00 123.74 ? 461  ARG A NH1 1 
ATOM   121  N NH2 . ARG A 1 20  ? 46.361 -48.581 17.759  1.00 125.51 ? 461  ARG A NH2 1 
ATOM   122  N N   . ILE A 1 21  ? 44.337 -43.508 16.807  1.00 100.50 ? 462  ILE A N   1 
ATOM   123  C CA  . ILE A 1 21  ? 43.724 -43.925 15.547  1.00 102.96 ? 462  ILE A CA  1 
ATOM   124  C C   . ILE A 1 21  ? 44.683 -44.738 14.671  1.00 107.56 ? 462  ILE A C   1 
ATOM   125  O O   . ILE A 1 21  ? 44.261 -45.702 14.038  1.00 113.33 ? 462  ILE A O   1 
ATOM   126  C CB  . ILE A 1 21  ? 43.154 -42.706 14.776  1.00 99.84  ? 462  ILE A CB  1 
ATOM   127  C CG1 . ILE A 1 21  ? 42.032 -42.042 15.586  1.00 98.40  ? 462  ILE A CG1 1 
ATOM   128  C CG2 . ILE A 1 21  ? 42.632 -43.104 13.401  1.00 101.84 ? 462  ILE A CG2 1 
ATOM   129  C CD1 . ILE A 1 21  ? 40.809 -42.916 15.812  1.00 102.88 ? 462  ILE A CD1 1 
ATOM   130  N N   . GLY A 1 22  ? 45.961 -44.365 14.632  1.00 107.80 ? 463  GLY A N   1 
ATOM   131  C CA  . GLY A 1 22  ? 46.951 -45.095 13.827  1.00 114.67 ? 463  GLY A CA  1 
ATOM   132  C C   . GLY A 1 22  ? 48.374 -44.717 14.188  1.00 116.76 ? 463  GLY A C   1 
ATOM   133  O O   . GLY A 1 22  ? 48.654 -43.565 14.505  1.00 113.50 ? 463  GLY A O   1 
ATOM   134  N N   . SER A 1 23  ? 49.279 -45.683 14.115  1.00 125.33 ? 464  SER A N   1 
ATOM   135  C CA  . SER A 1 23  ? 50.605 -45.521 14.686  1.00 129.08 ? 464  SER A CA  1 
ATOM   136  C C   . SER A 1 23  ? 51.682 -45.949 13.682  1.00 134.94 ? 464  SER A C   1 
ATOM   137  O O   . SER A 1 23  ? 51.519 -46.950 12.990  1.00 140.97 ? 464  SER A O   1 
ATOM   138  C CB  . SER A 1 23  ? 50.680 -46.359 15.973  1.00 134.43 ? 464  SER A CB  1 
ATOM   139  O OG  . SER A 1 23  ? 51.429 -45.704 16.990  1.00 135.50 ? 464  SER A OG  1 
ATOM   140  N N   . GLY A 1 24  ? 52.764 -45.174 13.603  1.00 135.83 ? 465  GLY A N   1 
ATOM   141  C CA  . GLY A 1 24  ? 53.957 -45.523 12.802  1.00 144.65 ? 465  GLY A CA  1 
ATOM   142  C C   . GLY A 1 24  ? 55.005 -44.423 12.929  1.00 145.48 ? 465  GLY A C   1 
ATOM   143  O O   . GLY A 1 24  ? 54.639 -43.250 13.044  1.00 141.37 ? 465  GLY A O   1 
ATOM   144  N N   . SER A 1 25  ? 56.296 -44.770 12.888  1.00 151.31 ? 466  SER A N   1 
ATOM   145  C CA  . SER A 1 25  ? 57.370 -43.811 13.260  1.00 152.36 ? 466  SER A CA  1 
ATOM   146  C C   . SER A 1 25  ? 57.320 -42.394 12.613  1.00 150.38 ? 466  SER A C   1 
ATOM   147  O O   . SER A 1 25  ? 57.934 -41.465 13.148  1.00 151.96 ? 466  SER A O   1 
ATOM   148  C CB  . SER A 1 25  ? 58.761 -44.432 13.068  1.00 161.25 ? 466  SER A CB  1 
ATOM   149  O OG  . SER A 1 25  ? 59.122 -44.497 11.703  1.00 165.66 ? 466  SER A OG  1 
ATOM   150  N N   . PHE A 1 26  ? 56.584 -42.216 11.504  1.00 147.92 ? 467  PHE A N   1 
ATOM   151  C CA  . PHE A 1 26  ? 56.373 -40.872 10.896  1.00 139.13 ? 467  PHE A CA  1 
ATOM   152  C C   . PHE A 1 26  ? 55.366 -40.033 11.708  1.00 127.68 ? 467  PHE A C   1 
ATOM   153  O O   . PHE A 1 26  ? 55.032 -38.907 11.318  1.00 120.57 ? 467  PHE A O   1 
ATOM   154  C CB  . PHE A 1 26  ? 55.906 -40.959 9.417   1.00 139.66 ? 467  PHE A CB  1 
ATOM   155  C CG  . PHE A 1 26  ? 56.604 -42.033 8.594   1.00 149.15 ? 467  PHE A CG  1 
ATOM   156  C CD1 . PHE A 1 26  ? 55.865 -42.942 7.834   1.00 149.61 ? 467  PHE A CD1 1 
ATOM   157  C CD2 . PHE A 1 26  ? 57.996 -42.143 8.585   1.00 155.86 ? 467  PHE A CD2 1 
ATOM   158  C CE1 . PHE A 1 26  ? 56.497 -43.925 7.087   1.00 158.80 ? 467  PHE A CE1 1 
ATOM   159  C CE2 . PHE A 1 26  ? 58.630 -43.129 7.839   1.00 164.59 ? 467  PHE A CE2 1 
ATOM   160  C CZ  . PHE A 1 26  ? 57.880 -44.019 7.090   1.00 166.30 ? 467  PHE A CZ  1 
ATOM   161  N N   . GLY A 1 27  ? 54.887 -40.592 12.826  1.00 124.32 ? 468  GLY A N   1 
ATOM   162  C CA  . GLY A 1 27  ? 53.927 -39.926 13.705  1.00 116.12 ? 468  GLY A CA  1 
ATOM   163  C C   . GLY A 1 27  ? 52.821 -40.835 14.241  1.00 112.96 ? 468  GLY A C   1 
ATOM   164  O O   . GLY A 1 27  ? 52.692 -41.993 13.840  1.00 115.52 ? 468  GLY A O   1 
ATOM   165  N N   . THR A 1 28  ? 52.020 -40.295 15.160  1.00 106.20 ? 469  THR A N   1 
ATOM   166  C CA  . THR A 1 28  ? 50.852 -40.987 15.723  1.00 103.69 ? 469  THR A CA  1 
ATOM   167  C C   . THR A 1 28  ? 49.616 -40.088 15.554  1.00 95.96  ? 469  THR A C   1 
ATOM   168  O O   . THR A 1 28  ? 49.693 -38.871 15.753  1.00 92.11  ? 469  THR A O   1 
ATOM   169  C CB  . THR A 1 28  ? 51.056 -41.313 17.224  1.00 105.77 ? 469  THR A CB  1 
ATOM   170  O OG1 . THR A 1 28  ? 52.362 -41.867 17.427  1.00 113.62 ? 469  THR A OG1 1 
ATOM   171  C CG2 . THR A 1 28  ? 49.999 -42.298 17.735  1.00 105.80 ? 469  THR A CG2 1 
ATOM   172  N N   . VAL A 1 29  ? 48.482 -40.686 15.196  1.00 93.29  ? 470  VAL A N   1 
ATOM   173  C CA  . VAL A 1 29  ? 47.274 -39.922 14.896  1.00 87.42  ? 470  VAL A CA  1 
ATOM   174  C C   . VAL A 1 29  ? 46.194 -40.158 15.944  1.00 84.64  ? 470  VAL A C   1 
ATOM   175  O O   . VAL A 1 29  ? 45.794 -41.290 16.182  1.00 87.19  ? 470  VAL A O   1 
ATOM   176  C CB  . VAL A 1 29  ? 46.717 -40.285 13.511  1.00 88.71  ? 470  VAL A CB  1 
ATOM   177  C CG1 . VAL A 1 29  ? 45.529 -39.401 13.175  1.00 86.10  ? 470  VAL A CG1 1 
ATOM   178  C CG2 . VAL A 1 29  ? 47.798 -40.132 12.454  1.00 90.74  ? 470  VAL A CG2 1 
ATOM   179  N N   . TYR A 1 30  ? 45.724 -39.079 16.561  1.00 80.47  ? 471  TYR A N   1 
ATOM   180  C CA  . TYR A 1 30  ? 44.690 -39.161 17.593  1.00 80.60  ? 471  TYR A CA  1 
ATOM   181  C C   . TYR A 1 30  ? 43.471 -38.348 17.208  1.00 75.29  ? 471  TYR A C   1 
ATOM   182  O O   . TYR A 1 30  ? 43.589 -37.342 16.527  1.00 71.37  ? 471  TYR A O   1 
ATOM   183  C CB  . TYR A 1 30  ? 45.193 -38.593 18.921  1.00 81.40  ? 471  TYR A CB  1 
ATOM   184  C CG  . TYR A 1 30  ? 46.398 -39.266 19.538  1.00 86.00  ? 471  TYR A CG  1 
ATOM   185  C CD1 . TYR A 1 30  ? 47.686 -38.813 19.265  1.00 86.28  ? 471  TYR A CD1 1 
ATOM   186  C CD2 . TYR A 1 30  ? 46.251 -40.317 20.448  1.00 92.17  ? 471  TYR A CD2 1 
ATOM   187  C CE1 . TYR A 1 30  ? 48.795 -39.405 19.852  1.00 91.98  ? 471  TYR A CE1 1 
ATOM   188  C CE2 . TYR A 1 30  ? 47.359 -40.917 21.043  1.00 96.72  ? 471  TYR A CE2 1 
ATOM   189  C CZ  . TYR A 1 30  ? 48.629 -40.457 20.740  1.00 95.96  ? 471  TYR A CZ  1 
ATOM   190  O OH  . TYR A 1 30  ? 49.739 -41.030 21.312  1.00 99.95  ? 471  TYR A OH  1 
ATOM   191  N N   . LYS A 1 31  ? 42.303 -38.780 17.668  1.00 76.94  ? 472  LYS A N   1 
ATOM   192  C CA  . LYS A 1 31  ? 41.124 -37.931 17.650  1.00 75.54  ? 472  LYS A CA  1 
ATOM   193  C C   . LYS A 1 31  ? 41.260 -37.020 18.840  1.00 75.79  ? 472  LYS A C   1 
ATOM   194  O O   . LYS A 1 31  ? 41.540 -37.488 19.934  1.00 80.98  ? 472  LYS A O   1 
ATOM   195  C CB  . LYS A 1 31  ? 39.848 -38.743 17.798  1.00 79.04  ? 472  LYS A CB  1 
ATOM   196  C CG  . LYS A 1 31  ? 38.622 -37.874 18.002  1.00 78.90  ? 472  LYS A CG  1 
ATOM   197  C CD  . LYS A 1 31  ? 37.339 -38.678 17.915  1.00 83.35  ? 472  LYS A CD  1 
ATOM   198  C CE  . LYS A 1 31  ? 36.133 -37.760 17.898  1.00 84.11  ? 472  LYS A CE  1 
ATOM   199  N NZ  . LYS A 1 31  ? 34.985 -38.390 17.205  1.00 88.54  ? 472  LYS A NZ  1 
ATOM   200  N N   . GLY A 1 32  ? 41.060 -35.727 18.641  1.00 73.32  ? 473  GLY A N   1 
ATOM   201  C CA  . GLY A 1 32  ? 41.243 -34.768 19.718  1.00 72.82  ? 473  GLY A CA  1 
ATOM   202  C C   . GLY A 1 32  ? 40.172 -33.708 19.730  1.00 72.99  ? 473  GLY A C   1 
ATOM   203  O O   . GLY A 1 32  ? 39.301 -33.680 18.865  1.00 72.66  ? 473  GLY A O   1 
ATOM   204  N N   . LYS A 1 33  ? 40.246 -32.843 20.734  1.00 76.08  ? 474  LYS A N   1 
ATOM   205  C CA  . LYS A 1 33  ? 39.343 -31.717 20.884  1.00 76.22  ? 474  LYS A CA  1 
ATOM   206  C C   . LYS A 1 33  ? 40.146 -30.416 20.768  1.00 75.02  ? 474  LYS A C   1 
ATOM   207  O O   . LYS A 1 33  ? 41.123 -30.200 21.499  1.00 75.95  ? 474  LYS A O   1 
ATOM   208  C CB  . LYS A 1 33  ? 38.637 -31.795 22.236  1.00 82.16  ? 474  LYS A CB  1 
ATOM   209  C CG  . LYS A 1 33  ? 37.507 -32.814 22.309  1.00 86.55  ? 474  LYS A CG  1 
ATOM   210  C CD  . LYS A 1 33  ? 36.287 -32.343 21.523  1.00 88.29  ? 474  LYS A CD  1 
ATOM   211  C CE  . LYS A 1 33  ? 34.980 -32.836 22.125  1.00 94.94  ? 474  LYS A CE  1 
ATOM   212  N NZ  . LYS A 1 33  ? 33.838 -31.997 21.666  1.00 96.82  ? 474  LYS A NZ  1 
ATOM   213  N N   . TRP A 1 34  ? 39.765 -29.582 19.806  1.00 75.35  ? 475  TRP A N   1 
ATOM   214  C CA  . TRP A 1 34  ? 40.242 -28.199 19.727  1.00 74.93  ? 475  TRP A CA  1 
ATOM   215  C C   . TRP A 1 34  ? 39.256 -27.437 18.881  1.00 72.82  ? 475  TRP A C   1 
ATOM   216  O O   . TRP A 1 34  ? 39.269 -27.550 17.654  1.00 70.50  ? 475  TRP A O   1 
ATOM   217  C CB  . TRP A 1 34  ? 41.637 -28.090 19.122  1.00 73.57  ? 475  TRP A CB  1 
ATOM   218  C CG  . TRP A 1 34  ? 42.191 -26.699 19.159  1.00 71.86  ? 475  TRP A CG  1 
ATOM   219  C CD1 . TRP A 1 34  ? 42.620 -26.014 20.259  1.00 74.38  ? 475  TRP A CD1 1 
ATOM   220  C CD2 . TRP A 1 34  ? 42.391 -25.826 18.043  1.00 70.26  ? 475  TRP A CD2 1 
ATOM   221  N NE1 . TRP A 1 34  ? 43.080 -24.766 19.898  1.00 72.99  ? 475  TRP A NE1 1 
ATOM   222  C CE2 . TRP A 1 34  ? 42.948 -24.626 18.542  1.00 70.88  ? 475  TRP A CE2 1 
ATOM   223  C CE3 . TRP A 1 34  ? 42.156 -25.939 16.665  1.00 66.90  ? 475  TRP A CE3 1 
ATOM   224  C CZ2 . TRP A 1 34  ? 43.269 -23.552 17.711  1.00 69.19  ? 475  TRP A CZ2 1 
ATOM   225  C CZ3 . TRP A 1 34  ? 42.478 -24.865 15.841  1.00 64.75  ? 475  TRP A CZ3 1 
ATOM   226  C CH2 . TRP A 1 34  ? 43.026 -23.693 16.366  1.00 66.28  ? 475  TRP A CH2 1 
ATOM   227  N N   . HIS A 1 35  ? 38.396 -26.681 19.561  1.00 73.99  ? 476  HIS A N   1 
ATOM   228  C CA  . HIS A 1 35  ? 37.264 -26.009 18.949  1.00 72.46  ? 476  HIS A CA  1 
ATOM   229  C C   . HIS A 1 35  ? 36.469 -27.024 18.161  1.00 73.04  ? 476  HIS A C   1 
ATOM   230  O O   . HIS A 1 35  ? 36.267 -26.872 16.953  1.00 71.32  ? 476  HIS A O   1 
ATOM   231  C CB  . HIS A 1 35  ? 37.738 -24.836 18.099  1.00 68.96  ? 476  HIS A CB  1 
ATOM   232  C CG  . HIS A 1 35  ? 38.420 -23.780 18.904  1.00 68.37  ? 476  HIS A CG  1 
ATOM   233  N ND1 . HIS A 1 35  ? 37.794 -23.130 19.944  1.00 70.34  ? 476  HIS A ND1 1 
ATOM   234  C CD2 . HIS A 1 35  ? 39.676 -23.285 18.851  1.00 66.70  ? 476  HIS A CD2 1 
ATOM   235  C CE1 . HIS A 1 35  ? 38.631 -22.267 20.487  1.00 70.60  ? 476  HIS A CE1 1 
ATOM   236  N NE2 . HIS A 1 35  ? 39.780 -22.342 19.844  1.00 69.10  ? 476  HIS A NE2 1 
ATOM   237  N N   . GLY A 1 36  ? 36.045 -28.069 18.875  1.00 74.78  ? 477  GLY A N   1 
ATOM   238  C CA  . GLY A 1 36  ? 35.361 -29.216 18.285  1.00 76.42  ? 477  GLY A CA  1 
ATOM   239  C C   . GLY A 1 36  ? 36.297 -30.383 18.023  1.00 77.16  ? 477  GLY A C   1 
ATOM   240  O O   . GLY A 1 36  ? 37.393 -30.438 18.567  1.00 79.95  ? 477  GLY A O   1 
ATOM   241  N N   . ASP A 1 37  ? 35.857 -31.311 17.178  1.00 77.47  ? 478  ASP A N   1 
ATOM   242  C CA  . ASP A 1 37  ? 36.619 -32.513 16.859  1.00 76.57  ? 478  ASP A CA  1 
ATOM   243  C C   . ASP A 1 37  ? 37.716 -32.227 15.862  1.00 73.45  ? 478  ASP A C   1 
ATOM   244  O O   . ASP A 1 37  ? 37.469 -31.629 14.810  1.00 74.71  ? 478  ASP A O   1 
ATOM   245  C CB  . ASP A 1 37  ? 35.713 -33.582 16.245  1.00 79.78  ? 478  ASP A CB  1 
ATOM   246  C CG  . ASP A 1 37  ? 34.689 -34.127 17.224  1.00 87.38  ? 478  ASP A CG  1 
ATOM   247  O OD1 . ASP A 1 37  ? 34.894 -34.022 18.460  1.00 92.98  ? 478  ASP A OD1 1 
ATOM   248  O OD2 . ASP A 1 37  ? 33.677 -34.682 16.743  1.00 90.85  ? 478  ASP A OD2 1 
ATOM   249  N N   . VAL A 1 38  ? 38.919 -32.698 16.174  1.00 72.39  ? 479  VAL A N   1 
ATOM   250  C CA  . VAL A 1 38  ? 40.051 -32.613 15.258  1.00 68.37  ? 479  VAL A CA  1 
ATOM   251  C C   . VAL A 1 38  ? 40.797 -33.931 15.162  1.00 67.34  ? 479  VAL A C   1 
ATOM   252  O O   . VAL A 1 38  ? 40.653 -34.808 16.015  1.00 69.28  ? 479  VAL A O   1 
ATOM   253  C CB  . VAL A 1 38  ? 41.046 -31.533 15.701  1.00 70.06  ? 479  VAL A CB  1 
ATOM   254  C CG1 . VAL A 1 38  ? 40.389 -30.160 15.623  1.00 71.66  ? 479  VAL A CG1 1 
ATOM   255  C CG2 . VAL A 1 38  ? 41.571 -31.809 17.109  1.00 72.54  ? 479  VAL A CG2 1 
ATOM   256  N N   . ALA A 1 39  ? 41.574 -34.066 14.097  1.00 65.49  ? 480  ALA A N   1 
ATOM   257  C CA  . ALA A 1 39  ? 42.605 -35.081 14.023  1.00 65.14  ? 480  ALA A CA  1 
ATOM   258  C C   . ALA A 1 39  ? 43.922 -34.404 14.386  1.00 65.29  ? 480  ALA A C   1 
ATOM   259  O O   . ALA A 1 39  ? 44.131 -33.236 14.063  1.00 63.54  ? 480  ALA A O   1 
ATOM   260  C CB  . ALA A 1 39  ? 42.660 -35.676 12.630  1.00 63.74  ? 480  ALA A CB  1 
ATOM   261  N N   . VAL A 1 40  ? 44.799 -35.146 15.052  1.00 68.69  ? 481  VAL A N   1 
ATOM   262  C CA  . VAL A 1 40  ? 46.071 -34.633 15.561  1.00 72.32  ? 481  VAL A CA  1 
ATOM   263  C C   . VAL A 1 40  ? 47.202 -35.617 15.241  1.00 75.14  ? 481  VAL A C   1 
ATOM   264  O O   . VAL A 1 40  ? 47.236 -36.716 15.800  1.00 77.21  ? 481  VAL A O   1 
ATOM   265  C CB  . VAL A 1 40  ? 45.993 -34.466 17.093  1.00 76.78  ? 481  VAL A CB  1 
ATOM   266  C CG1 . VAL A 1 40  ? 47.340 -34.084 17.681  1.00 80.50  ? 481  VAL A CG1 1 
ATOM   267  C CG2 . VAL A 1 40  ? 44.944 -33.433 17.468  1.00 77.80  ? 481  VAL A CG2 1 
ATOM   268  N N   . LYS A 1 41  ? 48.117 -35.234 14.348  1.00 75.23  ? 482  LYS A N   1 
ATOM   269  C CA  . LYS A 1 41  ? 49.307 -36.048 14.053  1.00 77.83  ? 482  LYS A CA  1 
ATOM   270  C C   . LYS A 1 41  ? 50.428 -35.579 14.947  1.00 80.36  ? 482  LYS A C   1 
ATOM   271  O O   . LYS A 1 41  ? 50.672 -34.393 15.024  1.00 81.05  ? 482  LYS A O   1 
ATOM   272  C CB  . LYS A 1 41  ? 49.730 -35.904 12.587  1.00 78.91  ? 482  LYS A CB  1 
ATOM   273  C CG  . LYS A 1 41  ? 50.825 -36.872 12.138  1.00 81.66  ? 482  LYS A CG  1 
ATOM   274  C CD  . LYS A 1 41  ? 51.309 -36.612 10.709  1.00 81.16  ? 482  LYS A CD  1 
ATOM   275  C CE  . LYS A 1 41  ? 50.450 -37.313 9.661   1.00 80.61  ? 482  LYS A CE  1 
ATOM   276  N NZ  . LYS A 1 41  ? 50.973 -37.125 8.273   1.00 80.83  ? 482  LYS A NZ  1 
ATOM   277  N N   . MET A 1 42  ? 51.111 -36.503 15.615  1.00 87.02  ? 483  MET A N   1 
ATOM   278  C CA  . MET A 1 42  ? 52.163 -36.158 16.586  1.00 93.74  ? 483  MET A CA  1 
ATOM   279  C C   . MET A 1 42  ? 53.435 -36.982 16.373  1.00 98.55  ? 483  MET A C   1 
ATOM   280  O O   . MET A 1 42  ? 53.362 -38.117 15.921  1.00 98.41  ? 483  MET A O   1 
ATOM   281  C CB  . MET A 1 42  ? 51.656 -36.402 18.016  1.00 95.76  ? 483  MET A CB  1 
ATOM   282  C CG  . MET A 1 42  ? 51.002 -35.204 18.681  1.00 96.92  ? 483  MET A CG  1 
ATOM   283  S SD  . MET A 1 42  ? 50.915 -35.385 20.476  1.00 105.72 ? 483  MET A SD  1 
ATOM   284  C CE  . MET A 1 42  ? 50.789 -33.668 21.006  1.00 107.14 ? 483  MET A CE  1 
ATOM   285  N N   . LEU A 1 43  ? 54.595 -36.416 16.706  1.00 103.35 ? 484  LEU A N   1 
ATOM   286  C CA  . LEU A 1 43  ? 55.820 -37.215 16.813  1.00 108.42 ? 484  LEU A CA  1 
ATOM   287  C C   . LEU A 1 43  ? 55.936 -37.698 18.245  1.00 112.79 ? 484  LEU A C   1 
ATOM   288  O O   . LEU A 1 43  ? 55.967 -36.888 19.173  1.00 115.28 ? 484  LEU A O   1 
ATOM   289  C CB  . LEU A 1 43  ? 57.078 -36.421 16.427  1.00 113.15 ? 484  LEU A CB  1 
ATOM   290  C CG  . LEU A 1 43  ? 57.750 -36.754 15.082  1.00 115.22 ? 484  LEU A CG  1 
ATOM   291  C CD1 . LEU A 1 43  ? 58.043 -38.246 14.941  1.00 116.32 ? 484  LEU A CD1 1 
ATOM   292  C CD2 . LEU A 1 43  ? 56.915 -36.264 13.902  1.00 112.34 ? 484  LEU A CD2 1 
ATOM   293  N N   . ASN A 1 44  ? 56.008 -39.013 18.427  1.00 115.92 ? 485  ASN A N   1 
ATOM   294  C CA  . ASN A 1 44  ? 56.036 -39.593 19.771  1.00 121.51 ? 485  ASN A CA  1 
ATOM   295  C C   . ASN A 1 44  ? 57.456 -39.783 20.303  1.00 126.00 ? 485  ASN A C   1 
ATOM   296  O O   . ASN A 1 44  ? 57.928 -40.908 20.466  1.00 129.04 ? 485  ASN A O   1 
ATOM   297  C CB  . ASN A 1 44  ? 55.239 -40.907 19.815  1.00 122.33 ? 485  ASN A CB  1 
ATOM   298  C CG  . ASN A 1 44  ? 53.838 -40.720 20.374  1.00 122.35 ? 485  ASN A CG  1 
ATOM   299  O OD1 . ASN A 1 44  ? 53.466 -41.364 21.352  1.00 128.26 ? 485  ASN A OD1 1 
ATOM   300  N ND2 . ASN A 1 44  ? 53.060 -39.830 19.766  1.00 118.07 ? 485  ASN A ND2 1 
ATOM   301  N N   . VAL A 1 45  ? 58.126 -38.664 20.573  1.00 126.15 ? 486  VAL A N   1 
ATOM   302  C CA  . VAL A 1 45  ? 59.455 -38.670 21.197  1.00 131.56 ? 486  VAL A CA  1 
ATOM   303  C C   . VAL A 1 45  ? 59.654 -37.417 22.033  1.00 132.60 ? 486  VAL A C   1 
ATOM   304  O O   . VAL A 1 45  ? 58.915 -36.442 21.894  1.00 128.50 ? 486  VAL A O   1 
ATOM   305  C CB  . VAL A 1 45  ? 60.605 -38.741 20.161  1.00 132.73 ? 486  VAL A CB  1 
ATOM   306  C CG1 . VAL A 1 45  ? 60.971 -40.189 19.843  1.00 134.13 ? 486  VAL A CG1 1 
ATOM   307  C CG2 . VAL A 1 45  ? 60.252 -37.956 18.903  1.00 128.24 ? 486  VAL A CG2 1 
ATOM   308  N N   . THR A 1 46  ? 60.659 -37.451 22.902  1.00 138.97 ? 487  THR A N   1 
ATOM   309  C CA  . THR A 1 46  ? 61.019 -36.283 23.702  1.00 142.02 ? 487  THR A CA  1 
ATOM   310  C C   . THR A 1 46  ? 61.699 -35.223 22.810  1.00 141.19 ? 487  THR A C   1 
ATOM   311  O O   . THR A 1 46  ? 61.076 -34.213 22.486  1.00 136.61 ? 487  THR A O   1 
ATOM   312  C CB  . THR A 1 46  ? 61.896 -36.667 24.922  1.00 148.18 ? 487  THR A CB  1 
ATOM   313  O OG1 . THR A 1 46  ? 63.080 -37.345 24.487  1.00 150.29 ? 487  THR A OG1 1 
ATOM   314  C CG2 . THR A 1 46  ? 61.123 -37.581 25.870  1.00 148.54 ? 487  THR A CG2 1 
ATOM   315  N N   . ALA A 1 47  ? 62.947 -35.470 22.394  1.00 145.47 ? 488  ALA A N   1 
ATOM   316  C CA  . ALA A 1 47  ? 63.700 -34.554 21.508  1.00 143.01 ? 488  ALA A CA  1 
ATOM   317  C C   . ALA A 1 47  ? 63.704 -35.042 20.037  1.00 138.99 ? 488  ALA A C   1 
ATOM   318  O O   . ALA A 1 47  ? 64.258 -36.103 19.736  1.00 143.18 ? 488  ALA A O   1 
ATOM   319  C CB  . ALA A 1 47  ? 65.130 -34.400 22.016  1.00 148.87 ? 488  ALA A CB  1 
ATOM   320  N N   . PRO A 1 48  ? 63.090 -34.267 19.114  1.00 130.13 ? 489  PRO A N   1 
ATOM   321  C CA  . PRO A 1 48  ? 63.039 -34.679 17.702  1.00 124.94 ? 489  PRO A CA  1 
ATOM   322  C C   . PRO A 1 48  ? 64.370 -34.493 16.959  1.00 127.27 ? 489  PRO A C   1 
ATOM   323  O O   . PRO A 1 48  ? 65.184 -33.655 17.347  1.00 128.03 ? 489  PRO A O   1 
ATOM   324  C CB  . PRO A 1 48  ? 61.961 -33.762 17.110  1.00 119.01 ? 489  PRO A CB  1 
ATOM   325  C CG  . PRO A 1 48  ? 61.987 -32.541 17.961  1.00 119.92 ? 489  PRO A CG  1 
ATOM   326  C CD  . PRO A 1 48  ? 62.418 -32.971 19.336  1.00 125.80 ? 489  PRO A CD  1 
ATOM   327  N N   . THR A 1 49  ? 64.570 -35.266 15.892  1.00 126.98 ? 490  THR A N   1 
ATOM   328  C CA  . THR A 1 49  ? 65.807 -35.208 15.099  1.00 131.00 ? 490  THR A CA  1 
ATOM   329  C C   . THR A 1 49  ? 65.796 -34.030 14.112  1.00 129.01 ? 490  THR A C   1 
ATOM   330  O O   . THR A 1 49  ? 64.753 -33.410 13.897  1.00 126.61 ? 490  THR A O   1 
ATOM   331  C CB  . THR A 1 49  ? 66.029 -36.514 14.296  1.00 130.84 ? 490  THR A CB  1 
ATOM   332  O OG1 . THR A 1 49  ? 64.951 -36.709 13.369  1.00 124.59 ? 490  THR A OG1 1 
ATOM   333  C CG2 . THR A 1 49  ? 66.136 -37.726 15.227  1.00 133.19 ? 490  THR A CG2 1 
ATOM   334  N N   . PRO A 1 50  ? 66.960 -33.711 13.514  1.00 131.02 ? 491  PRO A N   1 
ATOM   335  C CA  . PRO A 1 50  ? 66.984 -32.744 12.414  1.00 127.99 ? 491  PRO A CA  1 
ATOM   336  C C   . PRO A 1 50  ? 66.158 -33.140 11.173  1.00 123.30 ? 491  PRO A C   1 
ATOM   337  O O   . PRO A 1 50  ? 65.617 -32.255 10.516  1.00 121.65 ? 491  PRO A O   1 
ATOM   338  C CB  . PRO A 1 50  ? 68.468 -32.653 12.066  1.00 133.85 ? 491  PRO A CB  1 
ATOM   339  C CG  . PRO A 1 50  ? 69.167 -32.971 13.341  1.00 139.06 ? 491  PRO A CG  1 
ATOM   340  C CD  . PRO A 1 50  ? 68.317 -34.011 14.007  1.00 136.98 ? 491  PRO A CD  1 
ATOM   341  N N   . GLN A 1 51  ? 66.053 -34.436 10.860  1.00 122.80 ? 492  GLN A N   1 
ATOM   342  C CA  . GLN A 1 51  ? 65.284 -34.900 9.679   1.00 118.28 ? 492  GLN A CA  1 
ATOM   343  C C   . GLN A 1 51  ? 63.773 -34.878 9.893   1.00 113.24 ? 492  GLN A C   1 
ATOM   344  O O   . GLN A 1 51  ? 63.010 -34.672 8.944   1.00 109.84 ? 492  GLN A O   1 
ATOM   345  C CB  . GLN A 1 51  ? 65.680 -36.321 9.255   1.00 119.57 ? 492  GLN A CB  1 
ATOM   346  C CG  . GLN A 1 51  ? 67.013 -36.415 8.535   1.00 125.36 ? 492  GLN A CG  1 
ATOM   347  C CD  . GLN A 1 51  ? 68.208 -36.293 9.468   1.00 131.52 ? 492  GLN A CD  1 
ATOM   348  O OE1 . GLN A 1 51  ? 68.058 -36.195 10.690  1.00 131.62 ? 492  GLN A OE1 1 
ATOM   349  N NE2 . GLN A 1 51  ? 69.406 -36.299 8.892   1.00 136.56 ? 492  GLN A NE2 1 
ATOM   350  N N   . GLN A 1 52  ? 63.339 -35.129 11.124  1.00 112.67 ? 493  GLN A N   1 
ATOM   351  C CA  . GLN A 1 52  ? 61.914 -35.084 11.457  1.00 107.29 ? 493  GLN A CA  1 
ATOM   352  C C   . GLN A 1 52  ? 61.405 -33.651 11.581  1.00 103.48 ? 493  GLN A C   1 
ATOM   353  O O   . GLN A 1 52  ? 60.257 -33.371 11.249  1.00 97.62  ? 493  GLN A O   1 
ATOM   354  C CB  . GLN A 1 52  ? 61.645 -35.805 12.770  1.00 109.40 ? 493  GLN A CB  1 
ATOM   355  C CG  . GLN A 1 52  ? 61.922 -37.290 12.735  1.00 111.32 ? 493  GLN A CG  1 
ATOM   356  C CD  . GLN A 1 52  ? 62.106 -37.854 14.128  1.00 115.60 ? 493  GLN A CD  1 
ATOM   357  O OE1 . GLN A 1 52  ? 62.981 -37.413 14.877  1.00 118.26 ? 493  GLN A OE1 1 
ATOM   358  N NE2 . GLN A 1 52  ? 61.277 -38.826 14.490  1.00 114.76 ? 493  GLN A NE2 1 
ATOM   359  N N   . LEU A 1 53  ? 62.249 -32.755 12.087  1.00 105.45 ? 494  LEU A N   1 
ATOM   360  C CA  . LEU A 1 53  ? 61.881 -31.345 12.201  1.00 104.43 ? 494  LEU A CA  1 
ATOM   361  C C   . LEU A 1 53  ? 61.746 -30.705 10.825  1.00 101.89 ? 494  LEU A C   1 
ATOM   362  O O   . LEU A 1 53  ? 60.840 -29.912 10.592  1.00 98.06  ? 494  LEU A O   1 
ATOM   363  C CB  . LEU A 1 53  ? 62.919 -30.579 13.026  1.00 109.35 ? 494  LEU A CB  1 
ATOM   364  C CG  . LEU A 1 53  ? 62.603 -29.116 13.369  1.00 109.00 ? 494  LEU A CG  1 
ATOM   365  C CD1 . LEU A 1 53  ? 61.479 -28.998 14.388  1.00 106.52 ? 494  LEU A CD1 1 
ATOM   366  C CD2 . LEU A 1 53  ? 63.851 -28.432 13.899  1.00 114.93 ? 494  LEU A CD2 1 
ATOM   367  N N   . GLN A 1 54  ? 62.654 -31.049 9.918   1.00 104.55 ? 495  GLN A N   1 
ATOM   368  C CA  . GLN A 1 54  ? 62.611 -30.511 8.567   1.00 103.23 ? 495  GLN A CA  1 
ATOM   369  C C   . GLN A 1 54  ? 61.335 -30.922 7.860   1.00 97.97  ? 495  GLN A C   1 
ATOM   370  O O   . GLN A 1 54  ? 60.667 -30.091 7.255   1.00 96.15  ? 495  GLN A O   1 
ATOM   371  C CB  . GLN A 1 54  ? 63.817 -30.982 7.749   1.00 107.59 ? 495  GLN A CB  1 
ATOM   372  C CG  . GLN A 1 54  ? 63.994 -30.233 6.431   1.00 107.99 ? 495  GLN A CG  1 
ATOM   373  C CD  . GLN A 1 54  ? 64.042 -28.720 6.616   1.00 107.89 ? 495  GLN A CD  1 
ATOM   374  O OE1 . GLN A 1 54  ? 64.987 -28.183 7.200   1.00 110.41 ? 495  GLN A OE1 1 
ATOM   375  N NE2 . GLN A 1 54  ? 63.017 -28.028 6.130   1.00 103.63 ? 495  GLN A NE2 1 
ATOM   376  N N   . ALA A 1 55  ? 61.007 -32.208 7.947   1.00 97.92  ? 496  ALA A N   1 
ATOM   377  C CA  . ALA A 1 55  ? 59.844 -32.781 7.258   1.00 94.76  ? 496  ALA A CA  1 
ATOM   378  C C   . ALA A 1 55  ? 58.496 -32.296 7.822   1.00 90.71  ? 496  ALA A C   1 
ATOM   379  O O   . ALA A 1 55  ? 57.470 -32.320 7.127   1.00 86.83  ? 496  ALA A O   1 
ATOM   380  C CB  . ALA A 1 55  ? 59.921 -34.300 7.298   1.00 95.40  ? 496  ALA A CB  1 
ATOM   381  N N   . PHE A 1 56  ? 58.512 -31.880 9.086   1.00 91.20  ? 497  PHE A N   1 
ATOM   382  C CA  . PHE A 1 56  ? 57.354 -31.281 9.750   1.00 86.70  ? 497  PHE A CA  1 
ATOM   383  C C   . PHE A 1 56  ? 57.087 -29.903 9.149   1.00 85.69  ? 497  PHE A C   1 
ATOM   384  O O   . PHE A 1 56  ? 55.972 -29.614 8.722   1.00 82.78  ? 497  PHE A O   1 
ATOM   385  C CB  . PHE A 1 56  ? 57.622 -31.198 11.259  1.00 88.34  ? 497  PHE A CB  1 
ATOM   386  C CG  . PHE A 1 56  ? 56.676 -30.309 12.014  1.00 86.00  ? 497  PHE A CG  1 
ATOM   387  C CD1 . PHE A 1 56  ? 55.435 -30.773 12.411  1.00 82.82  ? 497  PHE A CD1 1 
ATOM   388  C CD2 . PHE A 1 56  ? 57.045 -29.014 12.361  1.00 87.32  ? 497  PHE A CD2 1 
ATOM   389  C CE1 . PHE A 1 56  ? 54.570 -29.959 13.121  1.00 81.04  ? 497  PHE A CE1 1 
ATOM   390  C CE2 . PHE A 1 56  ? 56.185 -28.197 13.071  1.00 84.63  ? 497  PHE A CE2 1 
ATOM   391  C CZ  . PHE A 1 56  ? 54.948 -28.671 13.453  1.00 82.29  ? 497  PHE A CZ  1 
ATOM   392  N N   . LYS A 1 57  ? 58.124 -29.071 9.099   1.00 88.81  ? 498  LYS A N   1 
ATOM   393  C CA  . LYS A 1 57  ? 58.061 -27.768 8.434   1.00 89.61  ? 498  LYS A CA  1 
ATOM   394  C C   . LYS A 1 57  ? 57.697 -27.874 6.951   1.00 88.59  ? 498  LYS A C   1 
ATOM   395  O O   . LYS A 1 57  ? 57.073 -26.970 6.400   1.00 88.79  ? 498  LYS A O   1 
ATOM   396  C CB  . LYS A 1 57  ? 59.392 -27.034 8.580   1.00 94.29  ? 498  LYS A CB  1 
ATOM   397  C CG  . LYS A 1 57  ? 59.679 -26.614 10.011  1.00 98.53  ? 498  LYS A CG  1 
ATOM   398  C CD  . LYS A 1 57  ? 60.987 -25.855 10.143  1.00 104.78 ? 498  LYS A CD  1 
ATOM   399  C CE  . LYS A 1 57  ? 61.074 -25.175 11.501  1.00 107.62 ? 498  LYS A CE  1 
ATOM   400  N NZ  . LYS A 1 57  ? 62.442 -24.653 11.766  1.00 114.56 ? 498  LYS A NZ  1 
ATOM   401  N N   . ASN A 1 58  ? 58.089 -28.971 6.311   1.00 89.25  ? 499  ASN A N   1 
ATOM   402  C CA  . ASN A 1 58  ? 57.743 -29.204 4.916   1.00 88.23  ? 499  ASN A CA  1 
ATOM   403  C C   . ASN A 1 58  ? 56.295 -29.560 4.734   1.00 84.72  ? 499  ASN A C   1 
ATOM   404  O O   . ASN A 1 58  ? 55.680 -29.126 3.767   1.00 86.83  ? 499  ASN A O   1 
ATOM   405  C CB  . ASN A 1 58  ? 58.600 -30.312 4.319   1.00 92.49  ? 499  ASN A CB  1 
ATOM   406  C CG  . ASN A 1 58  ? 59.985 -29.829 3.956   1.00 98.82  ? 499  ASN A CG  1 
ATOM   407  O OD1 . ASN A 1 58  ? 60.140 -28.738 3.405   1.00 100.06 ? 499  ASN A OD1 1 
ATOM   408  N ND2 . ASN A 1 58  ? 61.001 -30.632 4.261   1.00 103.17 ? 499  ASN A ND2 1 
ATOM   409  N N   . GLU A 1 59  ? 55.758 -30.366 5.651   1.00 83.05  ? 500  GLU A N   1 
ATOM   410  C CA  . GLU A 1 59  ? 54.350 -30.760 5.605   1.00 76.82  ? 500  GLU A CA  1 
ATOM   411  C C   . GLU A 1 59  ? 53.471 -29.544 5.855   1.00 75.67  ? 500  GLU A C   1 
ATOM   412  O O   . GLU A 1 59  ? 52.576 -29.249 5.077   1.00 73.82  ? 500  GLU A O   1 
ATOM   413  C CB  . GLU A 1 59  ? 54.058 -31.849 6.638   1.00 76.59  ? 500  GLU A CB  1 
ATOM   414  C CG  . GLU A 1 59  ? 52.707 -32.539 6.452   1.00 74.77  ? 500  GLU A CG  1 
ATOM   415  C CD  . GLU A 1 59  ? 52.518 -33.768 7.343   1.00 77.30  ? 500  GLU A CD  1 
ATOM   416  O OE1 . GLU A 1 59  ? 53.509 -34.232 7.954   1.00 81.32  ? 500  GLU A OE1 1 
ATOM   417  O OE2 . GLU A 1 59  ? 51.373 -34.280 7.436   1.00 75.17  ? 500  GLU A OE2 1 
ATOM   418  N N   . VAL A 1 60  ? 53.756 -28.825 6.935   1.00 78.17  ? 501  VAL A N   1 
ATOM   419  C CA  . VAL A 1 60  ? 53.007 -27.620 7.296   1.00 76.69  ? 501  VAL A CA  1 
ATOM   420  C C   . VAL A 1 60  ? 53.114 -26.554 6.193   1.00 76.46  ? 501  VAL A C   1 
ATOM   421  O O   . VAL A 1 60  ? 52.126 -25.904 5.858   1.00 76.85  ? 501  VAL A O   1 
ATOM   422  C CB  . VAL A 1 60  ? 53.486 -27.062 8.664   1.00 78.74  ? 501  VAL A CB  1 
ATOM   423  C CG1 . VAL A 1 60  ? 52.849 -25.712 8.978   1.00 77.02  ? 501  VAL A CG1 1 
ATOM   424  C CG2 . VAL A 1 60  ? 53.182 -28.063 9.775   1.00 79.08  ? 501  VAL A CG2 1 
ATOM   425  N N   . GLY A 1 61  ? 54.299 -26.396 5.612   1.00 76.30  ? 502  GLY A N   1 
ATOM   426  C CA  . GLY A 1 61  ? 54.494 -25.445 4.523   1.00 77.15  ? 502  GLY A CA  1 
ATOM   427  C C   . GLY A 1 61  ? 53.634 -25.726 3.301   1.00 75.64  ? 502  GLY A C   1 
ATOM   428  O O   . GLY A 1 61  ? 53.282 -24.807 2.564   1.00 76.64  ? 502  GLY A O   1 
ATOM   429  N N   . VAL A 1 62  ? 53.313 -26.996 3.074   1.00 73.53  ? 503  VAL A N   1 
ATOM   430  C CA  . VAL A 1 62  ? 52.455 -27.394 1.961   1.00 71.95  ? 503  VAL A CA  1 
ATOM   431  C C   . VAL A 1 62  ? 51.002 -27.173 2.343   1.00 68.49  ? 503  VAL A C   1 
ATOM   432  O O   . VAL A 1 62  ? 50.235 -26.619 1.577   1.00 68.60  ? 503  VAL A O   1 
ATOM   433  C CB  . VAL A 1 62  ? 52.664 -28.888 1.569   1.00 72.48  ? 503  VAL A CB  1 
ATOM   434  C CG1 . VAL A 1 62  ? 51.534 -29.400 0.678   1.00 70.78  ? 503  VAL A CG1 1 
ATOM   435  C CG2 . VAL A 1 62  ? 54.001 -29.087 0.867   1.00 74.79  ? 503  VAL A CG2 1 
ATOM   436  N N   . LEU A 1 63  ? 50.631 -27.625 3.531   1.00 68.69  ? 504  LEU A N   1 
ATOM   437  C CA  . LEU A 1 63  ? 49.241 -27.602 3.969   1.00 69.01  ? 504  LEU A CA  1 
ATOM   438  C C   . LEU A 1 63  ? 48.655 -26.196 4.063   1.00 67.48  ? 504  LEU A C   1 
ATOM   439  O O   . LEU A 1 63  ? 47.486 -25.977 3.716   1.00 62.58  ? 504  LEU A O   1 
ATOM   440  C CB  . LEU A 1 63  ? 49.111 -28.302 5.326   1.00 72.04  ? 504  LEU A CB  1 
ATOM   441  C CG  . LEU A 1 63  ? 49.057 -29.831 5.273   1.00 74.33  ? 504  LEU A CG  1 
ATOM   442  C CD1 . LEU A 1 63  ? 49.090 -30.399 6.684   1.00 76.76  ? 504  LEU A CD1 1 
ATOM   443  C CD2 . LEU A 1 63  ? 47.805 -30.291 4.530   1.00 76.17  ? 504  LEU A CD2 1 
ATOM   444  N N   . ARG A 1 64  ? 49.469 -25.249 4.525   1.00 69.32  ? 505  ARG A N   1 
ATOM   445  C CA  . ARG A 1 64  ? 49.018 -23.873 4.683   1.00 69.07  ? 505  ARG A CA  1 
ATOM   446  C C   . ARG A 1 64  ? 48.833 -23.183 3.328   1.00 68.49  ? 505  ARG A C   1 
ATOM   447  O O   . ARG A 1 64  ? 48.146 -22.176 3.248   1.00 71.08  ? 505  ARG A O   1 
ATOM   448  C CB  . ARG A 1 64  ? 49.967 -23.092 5.589   1.00 73.38  ? 505  ARG A CB  1 
ATOM   449  C CG  . ARG A 1 64  ? 51.182 -22.516 4.885   1.00 80.82  ? 505  ARG A CG  1 
ATOM   450  C CD  . ARG A 1 64  ? 52.409 -22.461 5.792   1.00 88.34  ? 505  ARG A CD  1 
ATOM   451  N NE  . ARG A 1 64  ? 52.149 -21.860 7.106   1.00 91.25  ? 505  ARG A NE  1 
ATOM   452  C CZ  . ARG A 1 64  ? 52.531 -20.641 7.485   1.00 95.86  ? 505  ARG A CZ  1 
ATOM   453  N NH1 . ARG A 1 64  ? 53.196 -19.840 6.653   1.00 99.03  ? 505  ARG A NH1 1 
ATOM   454  N NH2 . ARG A 1 64  ? 52.240 -20.216 8.713   1.00 98.30  ? 505  ARG A NH2 1 
ATOM   455  N N   . LYS A 1 65  ? 49.420 -23.733 2.266   1.00 68.15  ? 506  LYS A N   1 
ATOM   456  C CA  . LYS A 1 65  ? 49.165 -23.248 0.911   1.00 69.25  ? 506  LYS A CA  1 
ATOM   457  C C   . LYS A 1 65  ? 47.842 -23.753 0.299   1.00 67.13  ? 506  LYS A C   1 
ATOM   458  O O   . LYS A 1 65  ? 47.542 -23.429 -0.847  1.00 67.82  ? 506  LYS A O   1 
ATOM   459  C CB  . LYS A 1 65  ? 50.339 -23.603 -0.014  1.00 74.23  ? 506  LYS A CB  1 
ATOM   460  C CG  . LYS A 1 65  ? 51.585 -22.754 0.212   1.00 81.15  ? 506  LYS A CG  1 
ATOM   461  C CD  . LYS A 1 65  ? 52.641 -22.947 -0.877  1.00 86.46  ? 506  LYS A CD  1 
ATOM   462  C CE  . LYS A 1 65  ? 53.631 -24.054 -0.533  1.00 90.42  ? 506  LYS A CE  1 
ATOM   463  N NZ  . LYS A 1 65  ? 54.725 -24.184 -1.541  1.00 95.68  ? 506  LYS A NZ  1 
ATOM   464  N N   . THR A 1 66  ? 47.046 -24.525 1.045   1.00 64.98  ? 507  THR A N   1 
ATOM   465  C CA  . THR A 1 66  ? 45.799 -25.092 0.504   1.00 62.74  ? 507  THR A CA  1 
ATOM   466  C C   . THR A 1 66  ? 44.526 -24.705 1.234   1.00 59.99  ? 507  THR A C   1 
ATOM   467  O O   . THR A 1 66  ? 44.426 -24.844 2.450   1.00 59.03  ? 507  THR A O   1 
ATOM   468  C CB  . THR A 1 66  ? 45.813 -26.632 0.504   1.00 61.28  ? 507  THR A CB  1 
ATOM   469  O OG1 . THR A 1 66  ? 45.872 -27.122 1.852   1.00 62.42  ? 507  THR A OG1 1 
ATOM   470  C CG2 . THR A 1 66  ? 46.970 -27.145 -0.308  1.00 62.49  ? 507  THR A CG2 1 
ATOM   471  N N   . ARG A 1 67  ? 43.537 -24.291 0.448   1.00 60.03  ? 508  ARG A N   1 
ATOM   472  C CA  . ARG A 1 67  ? 42.198 -23.977 0.936   1.00 60.57  ? 508  ARG A CA  1 
ATOM   473  C C   . ARG A 1 67  ? 41.163 -24.369 -0.116  1.00 59.76  ? 508  ARG A C   1 
ATOM   474  O O   . ARG A 1 67  ? 40.870 -23.577 -1.024  1.00 59.95  ? 508  ARG A O   1 
ATOM   475  C CB  . ARG A 1 67  ? 42.065 -22.478 1.175   1.00 63.35  ? 508  ARG A CB  1 
ATOM   476  C CG  . ARG A 1 67  ? 42.766 -21.943 2.404   1.00 64.15  ? 508  ARG A CG  1 
ATOM   477  C CD  . ARG A 1 67  ? 42.677 -20.417 2.440   1.00 65.55  ? 508  ARG A CD  1 
ATOM   478  N NE  . ARG A 1 67  ? 43.005 -19.879 3.760   1.00 64.09  ? 508  ARG A NE  1 
ATOM   479  C CZ  . ARG A 1 67  ? 42.136 -19.722 4.747   1.00 62.52  ? 508  ARG A CZ  1 
ATOM   480  N NH1 . ARG A 1 67  ? 40.856 -20.041 4.592   1.00 61.33  ? 508  ARG A NH1 1 
ATOM   481  N NH2 . ARG A 1 67  ? 42.556 -19.235 5.899   1.00 65.83  ? 508  ARG A NH2 1 
ATOM   482  N N   . HIS A 1 68  ? 40.599 -25.567 0.013   1.00 56.43  ? 509  HIS A N   1 
ATOM   483  C CA  . HIS A 1 68  ? 39.664 -26.071 -0.983  1.00 56.51  ? 509  HIS A CA  1 
ATOM   484  C C   . HIS A 1 68  ? 38.808 -27.185 -0.387  1.00 54.14  ? 509  HIS A C   1 
ATOM   485  O O   . HIS A 1 68  ? 39.306 -28.004 0.354   1.00 54.13  ? 509  HIS A O   1 
ATOM   486  C CB  . HIS A 1 68  ? 40.449 -26.563 -2.207  1.00 58.12  ? 509  HIS A CB  1 
ATOM   487  C CG  . HIS A 1 68  ? 39.585 -26.938 -3.365  1.00 59.92  ? 509  HIS A CG  1 
ATOM   488  N ND1 . HIS A 1 68  ? 38.858 -28.103 -3.391  1.00 59.87  ? 509  HIS A ND1 1 
ATOM   489  C CD2 . HIS A 1 68  ? 39.314 -26.298 -4.526  1.00 63.69  ? 509  HIS A CD2 1 
ATOM   490  C CE1 . HIS A 1 68  ? 38.178 -28.173 -4.520  1.00 61.99  ? 509  HIS A CE1 1 
ATOM   491  N NE2 . HIS A 1 68  ? 38.439 -27.090 -5.229  1.00 64.64  ? 509  HIS A NE2 1 
ATOM   492  N N   . VAL A 1 69  ? 37.523 -27.209 -0.716  1.00 56.36  ? 510  VAL A N   1 
ATOM   493  C CA  . VAL A 1 69  ? 36.577 -28.158 -0.101  1.00 59.18  ? 510  VAL A CA  1 
ATOM   494  C C   . VAL A 1 69  ? 36.987 -29.621 -0.231  1.00 59.03  ? 510  VAL A C   1 
ATOM   495  O O   . VAL A 1 69  ? 36.655 -30.441 0.623   1.00 59.53  ? 510  VAL A O   1 
ATOM   496  C CB  . VAL A 1 69  ? 35.135 -28.040 -0.676  1.00 61.66  ? 510  VAL A CB  1 
ATOM   497  C CG1 . VAL A 1 69  ? 34.494 -26.742 -0.241  1.00 65.92  ? 510  VAL A CG1 1 
ATOM   498  C CG2 . VAL A 1 69  ? 35.098 -28.163 -2.202  1.00 62.73  ? 510  VAL A CG2 1 
ATOM   499  N N   . ASN A 1 70  ? 37.664 -29.944 -1.323  1.00 58.03  ? 511  ASN A N   1 
ATOM   500  C CA  . ASN A 1 70  ? 38.086 -31.306 -1.599  1.00 58.23  ? 511  ASN A CA  1 
ATOM   501  C C   . ASN A 1 70  ? 39.460 -31.656 -1.047  1.00 57.38  ? 511  ASN A C   1 
ATOM   502  O O   . ASN A 1 70  ? 39.993 -32.718 -1.367  1.00 56.22  ? 511  ASN A O   1 
ATOM   503  C CB  . ASN A 1 70  ? 38.036 -31.576 -3.110  1.00 58.33  ? 511  ASN A CB  1 
ATOM   504  C CG  . ASN A 1 70  ? 36.618 -31.670 -3.642  1.00 59.31  ? 511  ASN A CG  1 
ATOM   505  O OD1 . ASN A 1 70  ? 36.266 -31.035 -4.637  1.00 60.91  ? 511  ASN A OD1 1 
ATOM   506  N ND2 . ASN A 1 70  ? 35.794 -32.474 -2.980  1.00 60.67  ? 511  ASN A ND2 1 
ATOM   507  N N   . ILE A 1 71  ? 40.039 -30.767 -0.239  1.00 58.25  ? 512  ILE A N   1 
ATOM   508  C CA  . ILE A 1 71  ? 41.302 -31.053 0.443   1.00 59.14  ? 512  ILE A CA  1 
ATOM   509  C C   . ILE A 1 71  ? 41.089 -30.965 1.945   1.00 60.05  ? 512  ILE A C   1 
ATOM   510  O O   . ILE A 1 71  ? 40.515 -29.997 2.454   1.00 62.91  ? 512  ILE A O   1 
ATOM   511  C CB  . ILE A 1 71  ? 42.454 -30.112 0.009   1.00 59.77  ? 512  ILE A CB  1 
ATOM   512  C CG1 . ILE A 1 71  ? 43.094 -30.597 -1.287  1.00 61.84  ? 512  ILE A CG1 1 
ATOM   513  C CG2 . ILE A 1 71  ? 43.558 -30.063 1.053   1.00 61.43  ? 512  ILE A CG2 1 
ATOM   514  C CD1 . ILE A 1 71  ? 42.498 -29.974 -2.520  1.00 65.28  ? 512  ILE A CD1 1 
ATOM   515  N N   . LEU A 1 72  ? 41.554 -31.992 2.647   1.00 58.96  ? 513  LEU A N   1 
ATOM   516  C CA  . LEU A 1 72  ? 41.516 -32.023 4.094   1.00 58.96  ? 513  LEU A CA  1 
ATOM   517  C C   . LEU A 1 72  ? 41.971 -30.679 4.643   1.00 58.07  ? 513  LEU A C   1 
ATOM   518  O O   . LEU A 1 72  ? 43.058 -30.208 4.338   1.00 59.96  ? 513  LEU A O   1 
ATOM   519  C CB  . LEU A 1 72  ? 42.433 -33.125 4.596   1.00 63.66  ? 513  LEU A CB  1 
ATOM   520  C CG  . LEU A 1 72  ? 42.444 -33.410 6.097   1.00 68.66  ? 513  LEU A CG  1 
ATOM   521  C CD1 . LEU A 1 72  ? 41.157 -34.109 6.519   1.00 67.33  ? 513  LEU A CD1 1 
ATOM   522  C CD2 . LEU A 1 72  ? 43.680 -34.235 6.452   1.00 70.54  ? 513  LEU A CD2 1 
ATOM   523  N N   . LEU A 1 73  ? 41.119 -30.063 5.450   1.00 58.91  ? 514  LEU A N   1 
ATOM   524  C CA  . LEU A 1 73  ? 41.359 -28.725 5.973   1.00 57.18  ? 514  LEU A CA  1 
ATOM   525  C C   . LEU A 1 73  ? 42.439 -28.680 7.036   1.00 58.73  ? 514  LEU A C   1 
ATOM   526  O O   . LEU A 1 73  ? 42.240 -29.182 8.138   1.00 60.54  ? 514  LEU A O   1 
ATOM   527  C CB  . LEU A 1 73  ? 40.074 -28.183 6.581   1.00 55.71  ? 514  LEU A CB  1 
ATOM   528  C CG  . LEU A 1 73  ? 40.145 -26.752 7.098   1.00 56.45  ? 514  LEU A CG  1 
ATOM   529  C CD1 . LEU A 1 73  ? 40.499 -25.783 5.971   1.00 56.39  ? 514  LEU A CD1 1 
ATOM   530  C CD2 . LEU A 1 73  ? 38.817 -26.397 7.749   1.00 56.06  ? 514  LEU A CD2 1 
ATOM   531  N N   . PHE A 1 74  ? 43.573 -28.063 6.712   1.00 59.82  ? 515  PHE A N   1 
ATOM   532  C CA  . PHE A 1 74  ? 44.593 -27.776 7.709   1.00 61.17  ? 515  PHE A CA  1 
ATOM   533  C C   . PHE A 1 74  ? 44.038 -26.774 8.714   1.00 63.74  ? 515  PHE A C   1 
ATOM   534  O O   . PHE A 1 74  ? 43.414 -25.808 8.301   1.00 67.18  ? 515  PHE A O   1 
ATOM   535  C CB  . PHE A 1 74  ? 45.822 -27.182 7.030   1.00 63.01  ? 515  PHE A CB  1 
ATOM   536  C CG  . PHE A 1 74  ? 46.851 -26.643 7.992   1.00 64.79  ? 515  PHE A CG  1 
ATOM   537  C CD1 . PHE A 1 74  ? 47.547 -27.501 8.835   1.00 65.06  ? 515  PHE A CD1 1 
ATOM   538  C CD2 . PHE A 1 74  ? 47.127 -25.284 8.050   1.00 65.07  ? 515  PHE A CD2 1 
ATOM   539  C CE1 . PHE A 1 74  ? 48.491 -27.016 9.718   1.00 66.73  ? 515  PHE A CE1 1 
ATOM   540  C CE2 . PHE A 1 74  ? 48.073 -24.793 8.931   1.00 67.44  ? 515  PHE A CE2 1 
ATOM   541  C CZ  . PHE A 1 74  ? 48.754 -25.661 9.768   1.00 68.68  ? 515  PHE A CZ  1 
ATOM   542  N N   . MET A 1 75  ? 44.250 -26.995 10.016  1.00 64.68  ? 516  MET A N   1 
ATOM   543  C CA  . MET A 1 75  ? 43.768 -26.056 11.053  1.00 65.01  ? 516  MET A CA  1 
ATOM   544  C C   . MET A 1 75  ? 44.896 -25.387 11.835  1.00 67.13  ? 516  MET A C   1 
ATOM   545  O O   . MET A 1 75  ? 44.798 -24.203 12.174  1.00 69.11  ? 516  MET A O   1 
ATOM   546  C CB  . MET A 1 75  ? 42.796 -26.744 12.018  1.00 64.96  ? 516  MET A CB  1 
ATOM   547  C CG  . MET A 1 75  ? 41.456 -27.096 11.383  1.00 64.25  ? 516  MET A CG  1 
ATOM   548  S SD  . MET A 1 75  ? 40.314 -27.969 12.480  1.00 66.95  ? 516  MET A SD  1 
ATOM   549  C CE  . MET A 1 75  ? 39.883 -26.680 13.639  1.00 69.61  ? 516  MET A CE  1 
ATOM   550  N N   . GLY A 1 76  ? 45.958 -26.133 12.134  1.00 67.77  ? 517  GLY A N   1 
ATOM   551  C CA  . GLY A 1 76  ? 47.129 -25.543 12.793  1.00 68.17  ? 517  GLY A CA  1 
ATOM   552  C C   . GLY A 1 76  ? 48.228 -26.524 13.151  1.00 66.94  ? 517  GLY A C   1 
ATOM   553  O O   . GLY A 1 76  ? 48.164 -27.697 12.794  1.00 63.93  ? 517  GLY A O   1 
ATOM   554  N N   . TYR A 1 77  ? 49.240 -26.024 13.857  1.00 68.97  ? 518  TYR A N   1 
ATOM   555  C CA  . TYR A 1 77  ? 50.317 -26.857 14.392  1.00 70.68  ? 518  TYR A CA  1 
ATOM   556  C C   . TYR A 1 77  ? 50.693 -26.468 15.811  1.00 73.01  ? 518  TYR A C   1 
ATOM   557  O O   . TYR A 1 77  ? 50.363 -25.391 16.278  1.00 73.16  ? 518  TYR A O   1 
ATOM   558  C CB  . TYR A 1 77  ? 51.559 -26.766 13.508  1.00 71.65  ? 518  TYR A CB  1 
ATOM   559  C CG  . TYR A 1 77  ? 52.219 -25.404 13.469  1.00 73.14  ? 518  TYR A CG  1 
ATOM   560  C CD1 . TYR A 1 77  ? 53.106 -25.007 14.464  1.00 76.83  ? 518  TYR A CD1 1 
ATOM   561  C CD2 . TYR A 1 77  ? 51.972 -24.519 12.426  1.00 72.89  ? 518  TYR A CD2 1 
ATOM   562  C CE1 . TYR A 1 77  ? 53.717 -23.760 14.430  1.00 78.78  ? 518  TYR A CE1 1 
ATOM   563  C CE2 . TYR A 1 77  ? 52.583 -23.271 12.380  1.00 75.07  ? 518  TYR A CE2 1 
ATOM   564  C CZ  . TYR A 1 77  ? 53.458 -22.898 13.384  1.00 77.10  ? 518  TYR A CZ  1 
ATOM   565  O OH  . TYR A 1 77  ? 54.064 -21.663 13.350  1.00 78.45  ? 518  TYR A OH  1 
ATOM   566  N N   . SER A 1 78  ? 51.387 -27.365 16.494  1.00 77.40  ? 519  SER A N   1 
ATOM   567  C CA  . SER A 1 78  ? 52.014 -27.042 17.765  1.00 82.67  ? 519  SER A CA  1 
ATOM   568  C C   . SER A 1 78  ? 53.399 -27.651 17.765  1.00 85.89  ? 519  SER A C   1 
ATOM   569  O O   . SER A 1 78  ? 53.623 -28.698 17.152  1.00 82.87  ? 519  SER A O   1 
ATOM   570  C CB  . SER A 1 78  ? 51.202 -27.596 18.938  1.00 84.55  ? 519  SER A CB  1 
ATOM   571  O OG  . SER A 1 78  ? 51.738 -27.172 20.184  1.00 90.07  ? 519  SER A OG  1 
ATOM   572  N N   . THR A 1 79  ? 54.331 -26.970 18.422  1.00 91.82  ? 520  THR A N   1 
ATOM   573  C CA  . THR A 1 79  ? 55.649 -27.531 18.700  1.00 97.90  ? 520  THR A CA  1 
ATOM   574  C C   . THR A 1 79  ? 55.952 -27.504 20.193  1.00 104.51 ? 520  THR A C   1 
ATOM   575  O O   . THR A 1 79  ? 56.961 -28.053 20.620  1.00 111.21 ? 520  THR A O   1 
ATOM   576  C CB  . THR A 1 79  ? 56.754 -26.749 17.960  1.00 99.29  ? 520  THR A CB  1 
ATOM   577  O OG1 . THR A 1 79  ? 56.891 -25.439 18.528  1.00 98.62  ? 520  THR A OG1 1 
ATOM   578  C CG2 . THR A 1 79  ? 56.425 -26.619 16.470  1.00 96.59  ? 520  THR A CG2 1 
ATOM   579  N N   . LYS A 1 80  ? 55.062 -26.897 20.980  1.00 108.51 ? 521  LYS A N   1 
ATOM   580  C CA  . LYS A 1 80  ? 55.389 -26.466 22.347  1.00 114.64 ? 521  LYS A CA  1 
ATOM   581  C C   . LYS A 1 80  ? 55.634 -27.638 23.301  1.00 120.03 ? 521  LYS A C   1 
ATOM   582  O O   . LYS A 1 80  ? 56.735 -27.751 23.848  1.00 129.55 ? 521  LYS A O   1 
ATOM   583  C CB  . LYS A 1 80  ? 54.325 -25.510 22.894  1.00 113.68 ? 521  LYS A CB  1 
ATOM   584  N N   . PRO A 1 81  ? 54.630 -28.515 23.513  1.00 116.25 ? 522  PRO A N   1 
ATOM   585  C CA  . PRO A 1 81  ? 54.988 -29.736 24.246  1.00 117.92 ? 522  PRO A CA  1 
ATOM   586  C C   . PRO A 1 81  ? 55.672 -30.745 23.322  1.00 115.67 ? 522  PRO A C   1 
ATOM   587  O O   . PRO A 1 81  ? 56.732 -31.248 23.650  1.00 119.54 ? 522  PRO A O   1 
ATOM   588  C CB  . PRO A 1 81  ? 53.643 -30.263 24.750  1.00 116.95 ? 522  PRO A CB  1 
ATOM   589  C CG  . PRO A 1 81  ? 52.623 -29.709 23.805  1.00 113.11 ? 522  PRO A CG  1 
ATOM   590  C CD  . PRO A 1 81  ? 53.200 -28.481 23.145  1.00 111.58 ? 522  PRO A CD  1 
ATOM   591  N N   . GLN A 1 82  ? 55.067 -31.015 22.170  1.00 110.33 ? 523  GLN A N   1 
ATOM   592  C CA  . GLN A 1 82  ? 55.648 -31.887 21.157  1.00 108.11 ? 523  GLN A CA  1 
ATOM   593  C C   . GLN A 1 82  ? 55.227 -31.397 19.793  1.00 100.95 ? 523  GLN A C   1 
ATOM   594  O O   . GLN A 1 82  ? 54.421 -30.476 19.690  1.00 100.06 ? 523  GLN A O   1 
ATOM   595  C CB  . GLN A 1 82  ? 55.159 -33.315 21.340  1.00 109.96 ? 523  GLN A CB  1 
ATOM   596  C CG  . GLN A 1 82  ? 55.809 -34.045 22.498  1.00 117.59 ? 523  GLN A CG  1 
ATOM   597  C CD  . GLN A 1 82  ? 55.359 -35.492 22.586  1.00 121.14 ? 523  GLN A CD  1 
ATOM   598  O OE1 . GLN A 1 82  ? 54.393 -35.896 21.933  1.00 119.46 ? 523  GLN A OE1 1 
ATOM   599  N NE2 . GLN A 1 82  ? 56.055 -36.283 23.399  1.00 126.17 ? 523  GLN A NE2 1 
ATOM   600  N N   . LEU A 1 83  ? 55.768 -32.015 18.749  1.00 97.43  ? 524  LEU A N   1 
ATOM   601  C CA  . LEU A 1 83  ? 55.408 -31.657 17.382  1.00 93.65  ? 524  LEU A CA  1 
ATOM   602  C C   . LEU A 1 83  ? 54.059 -32.241 17.047  1.00 90.00  ? 524  LEU A C   1 
ATOM   603  O O   . LEU A 1 83  ? 53.836 -33.435 17.248  1.00 91.34  ? 524  LEU A O   1 
ATOM   604  C CB  . LEU A 1 83  ? 56.426 -32.182 16.369  1.00 94.62  ? 524  LEU A CB  1 
ATOM   605  C CG  . LEU A 1 83  ? 57.774 -31.473 16.275  1.00 98.43  ? 524  LEU A CG  1 
ATOM   606  C CD1 . LEU A 1 83  ? 58.575 -32.066 15.128  1.00 98.41  ? 524  LEU A CD1 1 
ATOM   607  C CD2 . LEU A 1 83  ? 57.602 -29.971 16.085  1.00 99.09  ? 524  LEU A CD2 1 
ATOM   608  N N   . ALA A 1 84  ? 53.178 -31.402 16.507  1.00 85.51  ? 525  ALA A N   1 
ATOM   609  C CA  . ALA A 1 84  ? 51.809 -31.800 16.229  1.00 79.87  ? 525  ALA A CA  1 
ATOM   610  C C   . ALA A 1 84  ? 51.201 -31.015 15.064  1.00 75.30  ? 525  ALA A C   1 
ATOM   611  O O   . ALA A 1 84  ? 51.428 -29.816 14.938  1.00 75.04  ? 525  ALA A O   1 
ATOM   612  C CB  . ALA A 1 84  ? 50.971 -31.617 17.484  1.00 80.61  ? 525  ALA A CB  1 
ATOM   613  N N   . ILE A 1 85  ? 50.431 -31.702 14.223  1.00 73.06  ? 526  ILE A N   1 
ATOM   614  C CA  . ILE A 1 85  ? 49.664 -31.067 13.145  1.00 71.14  ? 526  ILE A CA  1 
ATOM   615  C C   . ILE A 1 85  ? 48.187 -31.390 13.288  1.00 68.46  ? 526  ILE A C   1 
ATOM   616  O O   . ILE A 1 85  ? 47.816 -32.543 13.442  1.00 70.89  ? 526  ILE A O   1 
ATOM   617  C CB  . ILE A 1 85  ? 50.137 -31.532 11.764  1.00 71.94  ? 526  ILE A CB  1 
ATOM   618  C CG1 . ILE A 1 85  ? 51.620 -31.168 11.601  1.00 77.97  ? 526  ILE A CG1 1 
ATOM   619  C CG2 . ILE A 1 85  ? 49.264 -30.922 10.669  1.00 69.14  ? 526  ILE A CG2 1 
ATOM   620  C CD1 . ILE A 1 85  ? 52.158 -31.256 10.187  1.00 79.47  ? 526  ILE A CD1 1 
ATOM   621  N N   . VAL A 1 86  ? 47.351 -30.364 13.218  1.00 66.84  ? 527  VAL A N   1 
ATOM   622  C CA  . VAL A 1 86  ? 45.938 -30.499 13.511  1.00 65.27  ? 527  VAL A CA  1 
ATOM   623  C C   . VAL A 1 86  ? 45.150 -30.264 12.240  1.00 64.78  ? 527  VAL A C   1 
ATOM   624  O O   . VAL A 1 86  ? 45.418 -29.307 11.503  1.00 65.80  ? 527  VAL A O   1 
ATOM   625  C CB  . VAL A 1 86  ? 45.492 -29.473 14.568  1.00 66.61  ? 527  VAL A CB  1 
ATOM   626  C CG1 . VAL A 1 86  ? 44.053 -29.725 14.985  1.00 66.54  ? 527  VAL A CG1 1 
ATOM   627  C CG2 . VAL A 1 86  ? 46.404 -29.520 15.785  1.00 68.71  ? 527  VAL A CG2 1 
ATOM   628  N N   . THR A 1 87  ? 44.188 -31.141 11.975  1.00 62.82  ? 528  THR A N   1 
ATOM   629  C CA  . THR A 1 87  ? 43.314 -30.978 10.822  1.00 61.42  ? 528  THR A CA  1 
ATOM   630  C C   . THR A 1 87  ? 41.891 -31.238 11.267  1.00 62.51  ? 528  THR A C   1 
ATOM   631  O O   . THR A 1 87  ? 41.658 -31.691 12.381  1.00 64.80  ? 528  THR A O   1 
ATOM   632  C CB  . THR A 1 87  ? 43.657 -31.959 9.678   1.00 59.57  ? 528  THR A CB  1 
ATOM   633  O OG1 . THR A 1 87  ? 43.260 -33.288 10.041  1.00 60.92  ? 528  THR A OG1 1 
ATOM   634  C CG2 . THR A 1 87  ? 45.132 -31.943 9.371   1.00 59.58  ? 528  THR A CG2 1 
ATOM   635  N N   . GLN A 1 88  ? 40.943 -30.954 10.384  1.00 61.41  ? 529  GLN A N   1 
ATOM   636  C CA  . GLN A 1 88  ? 39.555 -31.267 10.634  1.00 62.53  ? 529  GLN A CA  1 
ATOM   637  C C   . GLN A 1 88  ? 39.403 -32.759 10.871  1.00 63.02  ? 529  GLN A C   1 
ATOM   638  O O   . GLN A 1 88  ? 40.193 -33.545 10.382  1.00 63.81  ? 529  GLN A O   1 
ATOM   639  C CB  . GLN A 1 88  ? 38.682 -30.835 9.450   1.00 64.63  ? 529  GLN A CB  1 
ATOM   640  C CG  . GLN A 1 88  ? 38.965 -31.546 8.122   1.00 63.11  ? 529  GLN A CG  1 
ATOM   641  C CD  . GLN A 1 88  ? 38.003 -31.139 7.013   1.00 63.32  ? 529  GLN A CD  1 
ATOM   642  O OE1 . GLN A 1 88  ? 38.424 -30.767 5.914   1.00 64.53  ? 529  GLN A OE1 1 
ATOM   643  N NE2 . GLN A 1 88  ? 36.705 -31.197 7.300   1.00 65.02  ? 529  GLN A NE2 1 
ATOM   644  N N   . TRP A 1 89  ? 38.388 -33.135 11.637  1.00 67.44  ? 530  TRP A N   1 
ATOM   645  C CA  . TRP A 1 89  ? 38.083 -34.536 11.894  1.00 67.87  ? 530  TRP A CA  1 
ATOM   646  C C   . TRP A 1 89  ? 37.010 -34.986 10.937  1.00 67.22  ? 530  TRP A C   1 
ATOM   647  O O   . TRP A 1 89  ? 35.864 -34.594 11.072  1.00 65.21  ? 530  TRP A O   1 
ATOM   648  C CB  . TRP A 1 89  ? 37.574 -34.729 13.321  1.00 70.67  ? 530  TRP A CB  1 
ATOM   649  C CG  . TRP A 1 89  ? 37.206 -36.142 13.601  1.00 73.54  ? 530  TRP A CG  1 
ATOM   650  C CD1 . TRP A 1 89  ? 35.950 -36.669 13.670  1.00 76.01  ? 530  TRP A CD1 1 
ATOM   651  C CD2 . TRP A 1 89  ? 38.108 -37.228 13.826  1.00 75.51  ? 530  TRP A CD2 1 
ATOM   652  N NE1 . TRP A 1 89  ? 36.014 -38.015 13.938  1.00 76.16  ? 530  TRP A NE1 1 
ATOM   653  C CE2 . TRP A 1 89  ? 37.329 -38.382 14.038  1.00 75.86  ? 530  TRP A CE2 1 
ATOM   654  C CE3 . TRP A 1 89  ? 39.502 -37.337 13.875  1.00 76.11  ? 530  TRP A CE3 1 
ATOM   655  C CZ2 . TRP A 1 89  ? 37.899 -39.626 14.294  1.00 77.82  ? 530  TRP A CZ2 1 
ATOM   656  C CZ3 . TRP A 1 89  ? 40.067 -38.579 14.132  1.00 76.06  ? 530  TRP A CZ3 1 
ATOM   657  C CH2 . TRP A 1 89  ? 39.266 -39.705 14.337  1.00 76.70  ? 530  TRP A CH2 1 
ATOM   658  N N   . CYS A 1 90  ? 37.367 -35.821 9.973   1.00 71.18  ? 531  CYS A N   1 
ATOM   659  C CA  . CYS A 1 90  ? 36.379 -36.339 9.032   1.00 71.78  ? 531  CYS A CA  1 
ATOM   660  C C   . CYS A 1 90  ? 35.518 -37.386 9.690   1.00 73.63  ? 531  CYS A C   1 
ATOM   661  O O   . CYS A 1 90  ? 36.043 -38.273 10.372  1.00 71.03  ? 531  CYS A O   1 
ATOM   662  C CB  . CYS A 1 90  ? 37.075 -36.965 7.849   1.00 72.28  ? 531  CYS A CB  1 
ATOM   663  S SG  . CYS A 1 90  ? 38.265 -35.851 7.091   1.00 77.69  ? 531  CYS A SG  1 
ATOM   664  N N   . GLU A 1 91  ? 34.201 -37.259 9.513   1.00 76.30  ? 532  GLU A N   1 
ATOM   665  C CA  . GLU A 1 91  ? 33.261 -38.319 9.869   1.00 81.86  ? 532  GLU A CA  1 
ATOM   666  C C   . GLU A 1 91  ? 33.003 -39.210 8.639   1.00 76.68  ? 532  GLU A C   1 
ATOM   667  O O   . GLU A 1 91  ? 32.654 -38.716 7.571   1.00 77.30  ? 532  GLU A O   1 
ATOM   668  C CB  . GLU A 1 91  ? 31.958 -37.720 10.418  1.00 87.77  ? 532  GLU A CB  1 
ATOM   669  C CG  . GLU A 1 91  ? 31.299 -38.552 11.524  1.00 98.02  ? 532  GLU A CG  1 
ATOM   670  C CD  . GLU A 1 91  ? 31.998 -38.431 12.883  1.00 104.51 ? 532  GLU A CD  1 
ATOM   671  O OE1 . GLU A 1 91  ? 32.223 -37.283 13.354  1.00 99.11  ? 532  GLU A OE1 1 
ATOM   672  O OE2 . GLU A 1 91  ? 32.316 -39.494 13.484  1.00 109.92 ? 532  GLU A OE2 1 
ATOM   673  N N   . GLY A 1 92  ? 33.209 -40.516 8.789   1.00 73.76  ? 533  GLY A N   1 
ATOM   674  C CA  . GLY A 1 92  ? 32.995 -41.468 7.696   1.00 72.35  ? 533  GLY A CA  1 
ATOM   675  C C   . GLY A 1 92  ? 34.100 -42.503 7.518   1.00 68.70  ? 533  GLY A C   1 
ATOM   676  O O   . GLY A 1 92  ? 34.523 -43.161 8.481   1.00 65.92  ? 533  GLY A O   1 
ATOM   677  N N   . SER A 1 93  ? 34.558 -42.656 6.277   1.00 62.87  ? 534  SER A N   1 
ATOM   678  C CA  . SER A 1 93  ? 35.548 -43.665 5.962   1.00 60.55  ? 534  SER A CA  1 
ATOM   679  C C   . SER A 1 93  ? 36.405 -43.252 4.798   1.00 58.65  ? 534  SER A C   1 
ATOM   680  O O   . SER A 1 93  ? 35.972 -42.479 3.944   1.00 55.22  ? 534  SER A O   1 
ATOM   681  C CB  . SER A 1 93  ? 34.868 -44.971 5.592   1.00 60.86  ? 534  SER A CB  1 
ATOM   682  O OG  . SER A 1 93  ? 34.431 -45.648 6.738   1.00 62.64  ? 534  SER A OG  1 
ATOM   683  N N   . SER A 1 94  ? 37.618 -43.798 4.757   1.00 57.32  ? 535  SER A N   1 
ATOM   684  C CA  . SER A 1 94  ? 38.424 -43.689 3.567   1.00 56.20  ? 535  SER A CA  1 
ATOM   685  C C   . SER A 1 94  ? 37.711 -44.471 2.477   1.00 56.18  ? 535  SER A C   1 
ATOM   686  O O   . SER A 1 94  ? 36.887 -45.349 2.761   1.00 54.78  ? 535  SER A O   1 
ATOM   687  C CB  . SER A 1 94  ? 39.857 -44.206 3.780   1.00 55.86  ? 535  SER A CB  1 
ATOM   688  O OG  . SER A 1 94  ? 39.934 -45.615 3.813   1.00 55.88  ? 535  SER A OG  1 
ATOM   689  N N   . LEU A 1 95  ? 38.013 -44.108 1.236   1.00 56.54  ? 536  LEU A N   1 
ATOM   690  C CA  . LEU A 1 95  ? 37.553 -44.834 0.070   1.00 56.08  ? 536  LEU A CA  1 
ATOM   691  C C   . LEU A 1 95  ? 37.982 -46.293 0.186   1.00 55.74  ? 536  LEU A C   1 
ATOM   692  O O   . LEU A 1 95  ? 37.152 -47.187 0.062   1.00 59.60  ? 536  LEU A O   1 
ATOM   693  C CB  . LEU A 1 95  ? 38.146 -44.205 -1.187  1.00 58.51  ? 536  LEU A CB  1 
ATOM   694  C CG  . LEU A 1 95  ? 37.321 -44.297 -2.461  1.00 62.14  ? 536  LEU A CG  1 
ATOM   695  C CD1 . LEU A 1 95  ? 36.050 -43.496 -2.288  1.00 64.06  ? 536  LEU A CD1 1 
ATOM   696  C CD2 . LEU A 1 95  ? 38.109 -43.767 -3.646  1.00 62.07  ? 536  LEU A CD2 1 
ATOM   697  N N   . TYR A 1 96  ? 39.269 -46.519 0.456   1.00 53.45  ? 537  TYR A N   1 
ATOM   698  C CA  . TYR A 1 96  ? 39.816 -47.862 0.713   1.00 53.81  ? 537  TYR A CA  1 
ATOM   699  C C   . TYR A 1 96  ? 38.940 -48.669 1.661   1.00 54.36  ? 537  TYR A C   1 
ATOM   700  O O   . TYR A 1 96  ? 38.719 -49.851 1.455   1.00 58.11  ? 537  TYR A O   1 
ATOM   701  C CB  . TYR A 1 96  ? 41.229 -47.762 1.309   1.00 53.55  ? 537  TYR A CB  1 
ATOM   702  C CG  . TYR A 1 96  ? 41.884 -49.080 1.678   1.00 54.78  ? 537  TYR A CG  1 
ATOM   703  C CD1 . TYR A 1 96  ? 42.706 -49.751 0.774   1.00 55.97  ? 537  TYR A CD1 1 
ATOM   704  C CD2 . TYR A 1 96  ? 41.714 -49.641 2.942   1.00 57.13  ? 537  TYR A CD2 1 
ATOM   705  C CE1 . TYR A 1 96  ? 43.319 -50.954 1.104   1.00 57.05  ? 537  TYR A CE1 1 
ATOM   706  C CE2 . TYR A 1 96  ? 42.321 -50.849 3.285   1.00 58.89  ? 537  TYR A CE2 1 
ATOM   707  C CZ  . TYR A 1 96  ? 43.126 -51.503 2.364   1.00 59.12  ? 537  TYR A CZ  1 
ATOM   708  O OH  . TYR A 1 96  ? 43.748 -52.695 2.694   1.00 59.46  ? 537  TYR A OH  1 
ATOM   709  N N   . HIS A 1 97  ? 38.452 -48.040 2.714   1.00 53.65  ? 538  HIS A N   1 
ATOM   710  C CA  . HIS A 1 97  ? 37.683 -48.768 3.698   1.00 55.47  ? 538  HIS A CA  1 
ATOM   711  C C   . HIS A 1 97  ? 36.348 -49.203 3.113   1.00 57.05  ? 538  HIS A C   1 
ATOM   712  O O   . HIS A 1 97  ? 35.943 -50.348 3.281   1.00 59.06  ? 538  HIS A O   1 
ATOM   713  C CB  . HIS A 1 97  ? 37.473 -47.909 4.928   1.00 55.72  ? 538  HIS A CB  1 
ATOM   714  C CG  . HIS A 1 97  ? 36.964 -48.671 6.105   1.00 57.96  ? 538  HIS A CG  1 
ATOM   715  N ND1 . HIS A 1 97  ? 35.665 -48.559 6.556   1.00 59.03  ? 538  HIS A ND1 1 
ATOM   716  C CD2 . HIS A 1 97  ? 37.574 -49.560 6.920   1.00 60.12  ? 538  HIS A CD2 1 
ATOM   717  C CE1 . HIS A 1 97  ? 35.494 -49.351 7.597   1.00 61.51  ? 538  HIS A CE1 1 
ATOM   718  N NE2 . HIS A 1 97  ? 36.637 -49.972 7.836   1.00 64.15  ? 538  HIS A NE2 1 
ATOM   719  N N   . HIS A 1 98  ? 35.680 -48.278 2.426   1.00 57.12  ? 539  HIS A N   1 
ATOM   720  C CA  . HIS A 1 98  ? 34.424 -48.547 1.726   1.00 57.84  ? 539  HIS A CA  1 
ATOM   721  C C   . HIS A 1 98  ? 34.537 -49.673 0.705   1.00 59.92  ? 539  HIS A C   1 
ATOM   722  O O   . HIS A 1 98  ? 33.742 -50.626 0.725   1.00 60.05  ? 539  HIS A O   1 
ATOM   723  C CB  . HIS A 1 98  ? 33.958 -47.295 0.985   1.00 56.70  ? 539  HIS A CB  1 
ATOM   724  C CG  . HIS A 1 98  ? 33.228 -46.325 1.849   1.00 56.21  ? 539  HIS A CG  1 
ATOM   725  N ND1 . HIS A 1 98  ? 32.058 -46.650 2.499   1.00 58.13  ? 539  HIS A ND1 1 
ATOM   726  C CD2 . HIS A 1 98  ? 33.492 -45.040 2.169   1.00 55.19  ? 539  HIS A CD2 1 
ATOM   727  C CE1 . HIS A 1 98  ? 31.640 -45.610 3.193   1.00 57.82  ? 539  HIS A CE1 1 
ATOM   728  N NE2 . HIS A 1 98  ? 32.488 -44.617 3.005   1.00 57.16  ? 539  HIS A NE2 1 
ATOM   729  N N   . LEU A 1 99  ? 35.527 -49.540 -0.179  1.00 56.39  ? 540  LEU A N   1 
ATOM   730  C CA  . LEU A 1 99  ? 35.699 -50.434 -1.328  1.00 56.40  ? 540  LEU A CA  1 
ATOM   731  C C   . LEU A 1 99  ? 36.255 -51.808 -1.013  1.00 56.49  ? 540  LEU A C   1 
ATOM   732  O O   . LEU A 1 99  ? 35.881 -52.771 -1.658  1.00 59.44  ? 540  LEU A O   1 
ATOM   733  C CB  . LEU A 1 99  ? 36.628 -49.794 -2.372  1.00 55.79  ? 540  LEU A CB  1 
ATOM   734  C CG  . LEU A 1 99  ? 36.053 -49.074 -3.595  1.00 55.21  ? 540  LEU A CG  1 
ATOM   735  C CD1 . LEU A 1 99  ? 34.595 -48.690 -3.432  1.00 55.97  ? 540  LEU A CD1 1 
ATOM   736  C CD2 . LEU A 1 99  ? 36.897 -47.848 -3.890  1.00 54.17  ? 540  LEU A CD2 1 
ATOM   737  N N   . HIS A 1 100 ? 37.174 -51.899 -0.063  1.00 56.61  ? 541  HIS A N   1 
ATOM   738  C CA  . HIS A 1 100 ? 37.921 -53.140 0.148   1.00 57.64  ? 541  HIS A CA  1 
ATOM   739  C C   . HIS A 1 100 ? 37.792 -53.763 1.531   1.00 57.87  ? 541  HIS A C   1 
ATOM   740  O O   . HIS A 1 100 ? 38.349 -54.825 1.767   1.00 58.14  ? 541  HIS A O   1 
ATOM   741  C CB  . HIS A 1 100 ? 39.400 -52.912 -0.110  1.00 58.12  ? 541  HIS A CB  1 
ATOM   742  C CG  . HIS A 1 100 ? 39.693 -52.216 -1.396  1.00 57.78  ? 541  HIS A CG  1 
ATOM   743  N ND1 . HIS A 1 100 ? 39.337 -52.732 -2.620  1.00 59.51  ? 541  HIS A ND1 1 
ATOM   744  C CD2 . HIS A 1 100 ? 40.336 -51.052 -1.648  1.00 58.02  ? 541  HIS A CD2 1 
ATOM   745  C CE1 . HIS A 1 100 ? 39.747 -51.912 -3.573  1.00 60.37  ? 541  HIS A CE1 1 
ATOM   746  N NE2 . HIS A 1 100 ? 40.350 -50.882 -3.009  1.00 58.09  ? 541  HIS A NE2 1 
ATOM   747  N N   . ILE A 1 101 ? 37.087 -53.121 2.449   1.00 58.57  ? 542  ILE A N   1 
ATOM   748  C CA  . ILE A 1 101 ? 36.968 -53.671 3.794   1.00 61.33  ? 542  ILE A CA  1 
ATOM   749  C C   . ILE A 1 101 ? 35.511 -53.996 4.053   1.00 61.70  ? 542  ILE A C   1 
ATOM   750  O O   . ILE A 1 101 ? 35.173 -55.158 4.213   1.00 63.83  ? 542  ILE A O   1 
ATOM   751  C CB  . ILE A 1 101 ? 37.525 -52.717 4.889   1.00 61.48  ? 542  ILE A CB  1 
ATOM   752  C CG1 . ILE A 1 101 ? 38.981 -52.322 4.607   1.00 59.28  ? 542  ILE A CG1 1 
ATOM   753  C CG2 . ILE A 1 101 ? 37.427 -53.363 6.263   1.00 64.61  ? 542  ILE A CG2 1 
ATOM   754  C CD1 . ILE A 1 101 ? 39.961 -53.469 4.623   1.00 60.42  ? 542  ILE A CD1 1 
ATOM   755  N N   . ILE A 1 102 ? 34.658 -52.973 4.095   1.00 61.44  ? 543  ILE A N   1 
ATOM   756  C CA  . ILE A 1 102 ? 33.218 -53.183 4.268   1.00 64.00  ? 543  ILE A CA  1 
ATOM   757  C C   . ILE A 1 102 ? 32.482 -53.341 2.941   1.00 65.01  ? 543  ILE A C   1 
ATOM   758  O O   . ILE A 1 102 ? 31.316 -53.674 2.925   1.00 64.72  ? 543  ILE A O   1 
ATOM   759  C CB  . ILE A 1 102 ? 32.549 -52.082 5.122   1.00 64.29  ? 543  ILE A CB  1 
ATOM   760  C CG1 . ILE A 1 102 ? 32.671 -50.702 4.470   1.00 62.08  ? 543  ILE A CG1 1 
ATOM   761  C CG2 . ILE A 1 102 ? 33.139 -52.086 6.528   1.00 65.40  ? 543  ILE A CG2 1 
ATOM   762  C CD1 . ILE A 1 102 ? 31.802 -49.664 5.142   1.00 61.88  ? 543  ILE A CD1 1 
ATOM   763  N N   . GLU A 1 103 ? 33.179 -53.107 1.833   1.00 69.43  ? 544  GLU A N   1 
ATOM   764  C CA  . GLU A 1 103 ? 32.669 -53.399 0.483   1.00 70.67  ? 544  GLU A CA  1 
ATOM   765  C C   . GLU A 1 103 ? 31.347 -52.692 0.170   1.00 72.00  ? 544  GLU A C   1 
ATOM   766  O O   . GLU A 1 103 ? 30.424 -53.309 -0.348  1.00 73.92  ? 544  GLU A O   1 
ATOM   767  C CB  . GLU A 1 103 ? 32.536 -54.913 0.257   1.00 71.48  ? 544  GLU A CB  1 
ATOM   768  C CG  . GLU A 1 103 ? 33.859 -55.625 0.010   1.00 72.20  ? 544  GLU A CG  1 
ATOM   769  C CD  . GLU A 1 103 ? 33.703 -57.115 -0.313  1.00 76.66  ? 544  GLU A CD  1 
ATOM   770  O OE1 . GLU A 1 103 ? 32.565 -57.607 -0.532  1.00 76.37  ? 544  GLU A OE1 1 
ATOM   771  O OE2 . GLU A 1 103 ? 34.741 -57.809 -0.349  1.00 78.68  ? 544  GLU A OE2 1 
ATOM   772  N N   . THR A 1 104 ? 31.265 -51.399 0.479   1.00 70.12  ? 545  THR A N   1 
ATOM   773  C CA  . THR A 1 104 ? 30.109 -50.602 0.097   1.00 69.62  ? 545  THR A CA  1 
ATOM   774  C C   . THR A 1 104 ? 29.917 -50.670 -1.414  1.00 70.21  ? 545  THR A C   1 
ATOM   775  O O   . THR A 1 104 ? 30.883 -50.577 -2.180  1.00 66.88  ? 545  THR A O   1 
ATOM   776  C CB  . THR A 1 104 ? 30.289 -49.135 0.522   1.00 69.39  ? 545  THR A CB  1 
ATOM   777  O OG1 . THR A 1 104 ? 30.360 -49.060 1.952   1.00 71.16  ? 545  THR A OG1 1 
ATOM   778  C CG2 . THR A 1 104 ? 29.133 -48.259 0.015   1.00 69.64  ? 545  THR A CG2 1 
ATOM   779  N N   . LYS A 1 105 ? 28.673 -50.844 -1.849  1.00 74.89  ? 546  LYS A N   1 
ATOM   780  C CA  . LYS A 1 105 ? 28.376 -50.810 -3.275  1.00 77.46  ? 546  LYS A CA  1 
ATOM   781  C C   . LYS A 1 105 ? 27.606 -49.535 -3.606  1.00 77.43  ? 546  LYS A C   1 
ATOM   782  O O   . LYS A 1 105 ? 26.434 -49.406 -3.278  1.00 82.02  ? 546  LYS A O   1 
ATOM   783  C CB  . LYS A 1 105 ? 27.624 -52.062 -3.721  1.00 80.45  ? 546  LYS A CB  1 
ATOM   784  C CG  . LYS A 1 105 ? 27.476 -52.149 -5.237  1.00 83.88  ? 546  LYS A CG  1 
ATOM   785  C CD  . LYS A 1 105 ? 27.656 -53.568 -5.762  1.00 85.51  ? 546  LYS A CD  1 
ATOM   786  C CE  . LYS A 1 105 ? 27.008 -53.751 -7.127  1.00 87.26  ? 546  LYS A CE  1 
ATOM   787  N NZ  . LYS A 1 105 ? 25.520 -53.792 -7.015  1.00 90.35  ? 546  LYS A NZ  1 
ATOM   788  N N   . PHE A 1 106 ? 28.302 -48.592 -4.236  1.00 74.95  ? 547  PHE A N   1 
ATOM   789  C CA  . PHE A 1 106 ? 27.735 -47.307 -4.624  1.00 72.69  ? 547  PHE A CA  1 
ATOM   790  C C   . PHE A 1 106 ? 27.030 -47.410 -5.964  1.00 73.89  ? 547  PHE A C   1 
ATOM   791  O O   . PHE A 1 106 ? 27.350 -48.273 -6.772  1.00 73.90  ? 547  PHE A O   1 
ATOM   792  C CB  . PHE A 1 106 ? 28.843 -46.263 -4.764  1.00 69.45  ? 547  PHE A CB  1 
ATOM   793  C CG  . PHE A 1 106 ? 29.610 -46.008 -3.499  1.00 66.19  ? 547  PHE A CG  1 
ATOM   794  C CD1 . PHE A 1 106 ? 30.889 -46.516 -3.336  1.00 64.49  ? 547  PHE A CD1 1 
ATOM   795  C CD2 . PHE A 1 106 ? 29.057 -45.249 -2.479  1.00 64.34  ? 547  PHE A CD2 1 
ATOM   796  C CE1 . PHE A 1 106 ? 31.600 -46.270 -2.173  1.00 63.10  ? 547  PHE A CE1 1 
ATOM   797  C CE2 . PHE A 1 106 ? 29.757 -45.009 -1.314  1.00 62.99  ? 547  PHE A CE2 1 
ATOM   798  C CZ  . PHE A 1 106 ? 31.036 -45.512 -1.162  1.00 62.10  ? 547  PHE A CZ  1 
ATOM   799  N N   . GLU A 1 107 ? 26.092 -46.506 -6.209  1.00 76.11  ? 548  GLU A N   1 
ATOM   800  C CA  . GLU A 1 107 ? 25.476 -46.405 -7.520  1.00 79.30  ? 548  GLU A CA  1 
ATOM   801  C C   . GLU A 1 107 ? 26.488 -45.768 -8.466  1.00 77.36  ? 548  GLU A C   1 
ATOM   802  O O   . GLU A 1 107 ? 27.266 -44.901 -8.067  1.00 72.93  ? 548  GLU A O   1 
ATOM   803  C CB  . GLU A 1 107 ? 24.185 -45.586 -7.461  1.00 84.42  ? 548  GLU A CB  1 
ATOM   804  C CG  . GLU A 1 107 ? 23.266 -46.011 -6.322  1.00 89.02  ? 548  GLU A CG  1 
ATOM   805  C CD  . GLU A 1 107 ? 21.787 -45.957 -6.676  1.00 95.66  ? 548  GLU A CD  1 
ATOM   806  O OE1 . GLU A 1 107 ? 21.189 -47.036 -6.899  1.00 95.18  ? 548  GLU A OE1 1 
ATOM   807  O OE2 . GLU A 1 107 ? 21.220 -44.840 -6.720  1.00 99.14  ? 548  GLU A OE2 1 
ATOM   808  N N   . MET A 1 108 ? 26.478 -46.212 -9.718  1.00 79.07  ? 549  MET A N   1 
ATOM   809  C CA  . MET A 1 108 ? 27.398 -45.703 -10.738 1.00 77.69  ? 549  MET A CA  1 
ATOM   810  C C   . MET A 1 108 ? 27.442 -44.180 -10.792 1.00 75.84  ? 549  MET A C   1 
ATOM   811  O O   . MET A 1 108 ? 28.492 -43.590 -11.022 1.00 73.39  ? 549  MET A O   1 
ATOM   812  C CB  . MET A 1 108 ? 27.008 -46.238 -12.121 1.00 81.08  ? 549  MET A CB  1 
ATOM   813  C CG  . MET A 1 108 ? 28.009 -45.898 -13.208 1.00 81.59  ? 549  MET A CG  1 
ATOM   814  S SD  . MET A 1 108 ? 29.673 -46.312 -12.666 1.00 81.35  ? 549  MET A SD  1 
ATOM   815  C CE  . MET A 1 108 ? 29.609 -48.113 -12.610 1.00 79.03  ? 549  MET A CE  1 
ATOM   816  N N   . ILE A 1 109 ? 26.288 -43.557 -10.593 1.00 77.66  ? 550  ILE A N   1 
ATOM   817  C CA  . ILE A 1 109 ? 26.182 -42.104 -10.575 1.00 78.72  ? 550  ILE A CA  1 
ATOM   818  C C   . ILE A 1 109 ? 27.066 -41.518 -9.460  1.00 72.59  ? 550  ILE A C   1 
ATOM   819  O O   . ILE A 1 109 ? 27.688 -40.472 -9.625  1.00 67.79  ? 550  ILE A O   1 
ATOM   820  C CB  . ILE A 1 109 ? 24.693 -41.678 -10.431 1.00 83.75  ? 550  ILE A CB  1 
ATOM   821  C CG1 . ILE A 1 109 ? 24.369 -40.503 -11.344 1.00 87.98  ? 550  ILE A CG1 1 
ATOM   822  C CG2 . ILE A 1 109 ? 24.315 -41.359 -8.985  1.00 83.09  ? 550  ILE A CG2 1 
ATOM   823  C CD1 . ILE A 1 109 ? 22.883 -40.360 -11.607 1.00 94.54  ? 550  ILE A CD1 1 
ATOM   824  N N   . LYS A 1 110 ? 27.125 -42.226 -8.339  1.00 71.05  ? 551  LYS A N   1 
ATOM   825  C CA  . LYS A 1 110 ? 27.886 -41.806 -7.171  1.00 69.78  ? 551  LYS A CA  1 
ATOM   826  C C   . LYS A 1 110 ? 29.391 -42.041 -7.359  1.00 67.61  ? 551  LYS A C   1 
ATOM   827  O O   . LYS A 1 110 ? 30.201 -41.181 -7.033  1.00 65.60  ? 551  LYS A O   1 
ATOM   828  C CB  . LYS A 1 110 ? 27.361 -42.556 -5.950  1.00 71.18  ? 551  LYS A CB  1 
ATOM   829  C CG  . LYS A 1 110 ? 28.192 -42.430 -4.691  1.00 72.07  ? 551  LYS A CG  1 
ATOM   830  C CD  . LYS A 1 110 ? 28.109 -41.053 -4.077  1.00 72.83  ? 551  LYS A CD  1 
ATOM   831  C CE  . LYS A 1 110 ? 27.988 -41.154 -2.572  1.00 72.67  ? 551  LYS A CE  1 
ATOM   832  N NZ  . LYS A 1 110 ? 27.732 -39.793 -2.046  1.00 76.67  ? 551  LYS A NZ  1 
ATOM   833  N N   . LEU A 1 111 ? 29.757 -43.209 -7.882  1.00 67.49  ? 552  LEU A N   1 
ATOM   834  C CA  . LEU A 1 111 ? 31.152 -43.513 -8.182  1.00 65.67  ? 552  LEU A CA  1 
ATOM   835  C C   . LEU A 1 111 ? 31.767 -42.456 -9.073  1.00 66.47  ? 552  LEU A C   1 
ATOM   836  O O   . LEU A 1 111 ? 32.906 -42.042 -8.869  1.00 65.91  ? 552  LEU A O   1 
ATOM   837  C CB  . LEU A 1 111 ? 31.272 -44.865 -8.885  1.00 66.95  ? 552  LEU A CB  1 
ATOM   838  C CG  . LEU A 1 111 ? 31.039 -46.104 -8.024  1.00 68.22  ? 552  LEU A CG  1 
ATOM   839  C CD1 . LEU A 1 111 ? 31.177 -47.347 -8.871  1.00 70.38  ? 552  LEU A CD1 1 
ATOM   840  C CD2 . LEU A 1 111 ? 32.010 -46.178 -6.859  1.00 68.32  ? 552  LEU A CD2 1 
ATOM   841  N N   . ILE A 1 112 ? 31.007 -42.030 -10.072 1.00 69.39  ? 553  ILE A N   1 
ATOM   842  C CA  . ILE A 1 112 ? 31.462 -40.995 -10.997 1.00 69.54  ? 553  ILE A CA  1 
ATOM   843  C C   . ILE A 1 112 ? 31.605 -39.653 -10.264 1.00 67.46  ? 553  ILE A C   1 
ATOM   844  O O   . ILE A 1 112 ? 32.519 -38.879 -10.559 1.00 62.19  ? 553  ILE A O   1 
ATOM   845  C CB  . ILE A 1 112 ? 30.514 -40.880 -12.210 1.00 71.95  ? 553  ILE A CB  1 
ATOM   846  C CG1 . ILE A 1 112 ? 30.554 -42.172 -13.022 1.00 77.20  ? 553  ILE A CG1 1 
ATOM   847  C CG2 . ILE A 1 112 ? 30.907 -39.726 -13.111 1.00 71.84  ? 553  ILE A CG2 1 
ATOM   848  C CD1 . ILE A 1 112 ? 29.365 -42.346 -13.946 1.00 83.52  ? 553  ILE A CD1 1 
ATOM   849  N N   . ASP A 1 113 ? 30.715 -39.382 -9.308  1.00 68.44  ? 554  ASP A N   1 
ATOM   850  C CA  . ASP A 1 113 ? 30.815 -38.146 -8.541  1.00 71.05  ? 554  ASP A CA  1 
ATOM   851  C C   . ASP A 1 113 ? 32.068 -38.144 -7.686  1.00 68.91  ? 554  ASP A C   1 
ATOM   852  O O   . ASP A 1 113 ? 32.814 -37.162 -7.670  1.00 70.57  ? 554  ASP A O   1 
ATOM   853  C CB  . ASP A 1 113 ? 29.612 -37.916 -7.636  1.00 73.40  ? 554  ASP A CB  1 
ATOM   854  C CG  . ASP A 1 113 ? 29.570 -36.489 -7.092  1.00 77.59  ? 554  ASP A CG  1 
ATOM   855  O OD1 . ASP A 1 113 ? 29.589 -35.521 -7.898  1.00 81.40  ? 554  ASP A OD1 1 
ATOM   856  O OD2 . ASP A 1 113 ? 29.520 -36.331 -5.859  1.00 79.82  ? 554  ASP A OD2 1 
ATOM   857  N N   . ILE A 1 114 ? 32.291 -39.249 -6.981  1.00 64.10  ? 555  ILE A N   1 
ATOM   858  C CA  . ILE A 1 114 ? 33.480 -39.404 -6.187  1.00 59.02  ? 555  ILE A CA  1 
ATOM   859  C C   . ILE A 1 114 ? 34.704 -39.151 -7.045  1.00 59.61  ? 555  ILE A C   1 
ATOM   860  O O   . ILE A 1 114 ? 35.614 -38.431 -6.636  1.00 60.43  ? 555  ILE A O   1 
ATOM   861  C CB  . ILE A 1 114 ? 33.546 -40.797 -5.571  1.00 58.82  ? 555  ILE A CB  1 
ATOM   862  C CG1 . ILE A 1 114 ? 32.521 -40.890 -4.440  1.00 59.57  ? 555  ILE A CG1 1 
ATOM   863  C CG2 . ILE A 1 114 ? 34.947 -41.073 -5.042  1.00 58.28  ? 555  ILE A CG2 1 
ATOM   864  C CD1 . ILE A 1 114 ? 32.187 -42.296 -4.005  1.00 61.34  ? 555  ILE A CD1 1 
ATOM   865  N N   . ALA A 1 115 ? 34.709 -39.719 -8.244  1.00 61.59  ? 556  ALA A N   1 
ATOM   866  C CA  . ALA A 1 115 ? 35.817 -39.527 -9.181  1.00 62.87  ? 556  ALA A CA  1 
ATOM   867  C C   . ALA A 1 115 ? 36.013 -38.066 -9.552  1.00 63.96  ? 556  ALA A C   1 
ATOM   868  O O   . ALA A 1 115 ? 37.142 -37.589 -9.607  1.00 62.64  ? 556  ALA A O   1 
ATOM   869  C CB  . ALA A 1 115 ? 35.593 -40.347 -10.436 1.00 65.03  ? 556  ALA A CB  1 
ATOM   870  N N   . ARG A 1 116 ? 34.906 -37.372 -9.810  1.00 68.08  ? 557  ARG A N   1 
ATOM   871  C CA  . ARG A 1 116 ? 34.927 -35.956 -10.198 1.00 70.92  ? 557  ARG A CA  1 
ATOM   872  C C   . ARG A 1 116 ? 35.543 -35.100 -9.117  1.00 68.27  ? 557  ARG A C   1 
ATOM   873  O O   . ARG A 1 116 ? 36.291 -34.181 -9.394  1.00 70.49  ? 557  ARG A O   1 
ATOM   874  C CB  . ARG A 1 116 ? 33.507 -35.442 -10.432 1.00 76.78  ? 557  ARG A CB  1 
ATOM   875  C CG  . ARG A 1 116 ? 33.424 -34.161 -11.251 1.00 82.78  ? 557  ARG A CG  1 
ATOM   876  C CD  . ARG A 1 116 ? 32.333 -33.207 -10.770 1.00 86.46  ? 557  ARG A CD  1 
ATOM   877  N NE  . ARG A 1 116 ? 32.911 -32.249 -9.819  1.00 89.89  ? 557  ARG A NE  1 
ATOM   878  C CZ  . ARG A 1 116 ? 32.540 -32.071 -8.551  1.00 87.98  ? 557  ARG A CZ  1 
ATOM   879  N NH1 . ARG A 1 116 ? 31.534 -32.758 -8.021  1.00 89.80  ? 557  ARG A NH1 1 
ATOM   880  N NH2 . ARG A 1 116 ? 33.182 -31.174 -7.807  1.00 87.31  ? 557  ARG A NH2 1 
ATOM   881  N N   . GLN A 1 117 ? 35.199 -35.393 -7.875  1.00 65.55  ? 558  GLN A N   1 
ATOM   882  C CA  . GLN A 1 117 ? 35.667 -34.595 -6.775  1.00 63.62  ? 558  GLN A CA  1 
ATOM   883  C C   . GLN A 1 117 ? 37.145 -34.836 -6.565  1.00 62.28  ? 558  GLN A C   1 
ATOM   884  O O   . GLN A 1 117 ? 37.911 -33.893 -6.450  1.00 63.78  ? 558  GLN A O   1 
ATOM   885  C CB  . GLN A 1 117 ? 34.891 -34.930 -5.512  1.00 64.57  ? 558  GLN A CB  1 
ATOM   886  C CG  . GLN A 1 117 ? 33.436 -34.487 -5.537  1.00 64.65  ? 558  GLN A CG  1 
ATOM   887  C CD  . GLN A 1 117 ? 32.784 -34.681 -4.188  1.00 64.35  ? 558  GLN A CD  1 
ATOM   888  O OE1 . GLN A 1 117 ? 33.312 -34.237 -3.170  1.00 64.19  ? 558  GLN A OE1 1 
ATOM   889  N NE2 . GLN A 1 117 ? 31.649 -35.360 -4.164  1.00 66.59  ? 558  GLN A NE2 1 
ATOM   890  N N   . THR A 1 118 ? 37.551 -36.099 -6.519  1.00 61.38  ? 559  THR A N   1 
ATOM   891  C CA  . THR A 1 118 ? 38.968 -36.430 -6.404  1.00 60.28  ? 559  THR A CA  1 
ATOM   892  C C   . THR A 1 118 ? 39.779 -35.693 -7.460  1.00 63.91  ? 559  THR A C   1 
ATOM   893  O O   . THR A 1 118 ? 40.863 -35.183 -7.179  1.00 66.10  ? 559  THR A O   1 
ATOM   894  C CB  . THR A 1 118 ? 39.218 -37.927 -6.599  1.00 58.83  ? 559  THR A CB  1 
ATOM   895  O OG1 . THR A 1 118 ? 38.374 -38.674 -5.714  1.00 57.95  ? 559  THR A OG1 1 
ATOM   896  C CG2 . THR A 1 118 ? 40.677 -38.258 -6.329  1.00 58.77  ? 559  THR A CG2 1 
ATOM   897  N N   . ALA A 1 119 ? 39.248 -35.646 -8.678  1.00 65.90  ? 560  ALA A N   1 
ATOM   898  C CA  . ALA A 1 119 ? 39.900 -34.941 -9.779  1.00 66.74  ? 560  ALA A CA  1 
ATOM   899  C C   . ALA A 1 119 ? 39.911 -33.433 -9.540  1.00 66.06  ? 560  ALA A C   1 
ATOM   900  O O   . ALA A 1 119 ? 40.884 -32.753 -9.861  1.00 66.64  ? 560  ALA A O   1 
ATOM   901  C CB  . ALA A 1 119 ? 39.201 -35.266 -11.089 1.00 68.33  ? 560  ALA A CB  1 
ATOM   902  N N   . GLN A 1 120 ? 38.818 -32.924 -8.979  1.00 65.60  ? 561  GLN A N   1 
ATOM   903  C CA  . GLN A 1 120 ? 38.685 -31.508 -8.661  1.00 67.59  ? 561  GLN A CA  1 
ATOM   904  C C   . GLN A 1 120 ? 39.798 -31.066 -7.714  1.00 67.68  ? 561  GLN A C   1 
ATOM   905  O O   . GLN A 1 120 ? 40.434 -30.029 -7.932  1.00 71.40  ? 561  GLN A O   1 
ATOM   906  C CB  . GLN A 1 120 ? 37.321 -31.236 -8.014  1.00 68.10  ? 561  GLN A CB  1 
ATOM   907  C CG  . GLN A 1 120 ? 36.944 -29.771 -7.934  1.00 70.16  ? 561  GLN A CG  1 
ATOM   908  C CD  . GLN A 1 120 ? 36.523 -29.220 -9.277  1.00 72.90  ? 561  GLN A CD  1 
ATOM   909  O OE1 . GLN A 1 120 ? 35.395 -29.430 -9.709  1.00 74.47  ? 561  GLN A OE1 1 
ATOM   910  N NE2 . GLN A 1 120 ? 37.430 -28.516 -9.947  1.00 75.08  ? 561  GLN A NE2 1 
ATOM   911  N N   . GLY A 1 121 ? 40.022 -31.863 -6.668  1.00 64.98  ? 562  GLY A N   1 
ATOM   912  C CA  . GLY A 1 121 ? 41.041 -31.584 -5.662  1.00 63.28  ? 562  GLY A CA  1 
ATOM   913  C C   . GLY A 1 121 ? 42.450 -31.597 -6.220  1.00 64.93  ? 562  GLY A C   1 
ATOM   914  O O   . GLY A 1 121 ? 43.255 -30.728 -5.897  1.00 66.91  ? 562  GLY A O   1 
ATOM   915  N N   . MET A 1 122 ? 42.744 -32.583 -7.060  1.00 64.67  ? 563  MET A N   1 
ATOM   916  C CA  . MET A 1 122 ? 44.050 -32.694 -7.684  1.00 65.07  ? 563  MET A CA  1 
ATOM   917  C C   . MET A 1 122 ? 44.296 -31.531 -8.634  1.00 68.76  ? 563  MET A C   1 
ATOM   918  O O   . MET A 1 122 ? 45.391 -30.963 -8.658  1.00 70.14  ? 563  MET A O   1 
ATOM   919  C CB  . MET A 1 122 ? 44.159 -34.015 -8.434  1.00 65.56  ? 563  MET A CB  1 
ATOM   920  C CG  . MET A 1 122 ? 44.059 -35.225 -7.527  1.00 66.38  ? 563  MET A CG  1 
ATOM   921  S SD  . MET A 1 122 ? 45.280 -35.213 -6.204  1.00 66.91  ? 563  MET A SD  1 
ATOM   922  C CE  . MET A 1 122 ? 46.783 -35.505 -7.134  1.00 70.91  ? 563  MET A CE  1 
ATOM   923  N N   . ASP A 1 123 ? 43.284 -31.170 -9.416  1.00 71.56  ? 564  ASP A N   1 
ATOM   924  C CA  . ASP A 1 123 ? 43.393 -30.004 -10.283 1.00 77.83  ? 564  ASP A CA  1 
ATOM   925  C C   . ASP A 1 123 ? 43.915 -28.817 -9.463  1.00 77.06  ? 564  ASP A C   1 
ATOM   926  O O   . ASP A 1 123 ? 44.851 -28.140 -9.883  1.00 78.22  ? 564  ASP A O   1 
ATOM   927  C CB  . ASP A 1 123 ? 42.039 -29.665 -10.926 1.00 82.87  ? 564  ASP A CB  1 
ATOM   928  C CG  . ASP A 1 123 ? 42.137 -28.546 -11.967 1.00 88.42  ? 564  ASP A CG  1 
ATOM   929  O OD1 . ASP A 1 123 ? 43.059 -28.606 -12.810 1.00 91.36  ? 564  ASP A OD1 1 
ATOM   930  O OD2 . ASP A 1 123 ? 41.288 -27.618 -11.949 1.00 91.00  ? 564  ASP A OD2 1 
ATOM   931  N N   . TYR A 1 124 ? 43.325 -28.607 -8.282  1.00 73.64  ? 565  TYR A N   1 
ATOM   932  C CA  . TYR A 1 124 ? 43.705 -27.517 -7.378  1.00 70.63  ? 565  TYR A CA  1 
ATOM   933  C C   . TYR A 1 124 ? 45.165 -27.599 -6.936  1.00 69.35  ? 565  TYR A C   1 
ATOM   934  O O   . TYR A 1 124 ? 45.873 -26.604 -6.960  1.00 72.86  ? 565  TYR A O   1 
ATOM   935  C CB  . TYR A 1 124 ? 42.798 -27.518 -6.144  1.00 68.13  ? 565  TYR A CB  1 
ATOM   936  C CG  . TYR A 1 124 ? 43.054 -26.386 -5.171  1.00 68.18  ? 565  TYR A CG  1 
ATOM   937  C CD1 . TYR A 1 124 ? 42.531 -25.123 -5.401  1.00 69.05  ? 565  TYR A CD1 1 
ATOM   938  C CD2 . TYR A 1 124 ? 43.806 -26.583 -4.014  1.00 65.64  ? 565  TYR A CD2 1 
ATOM   939  C CE1 . TYR A 1 124 ? 42.750 -24.085 -4.515  1.00 69.43  ? 565  TYR A CE1 1 
ATOM   940  C CE2 . TYR A 1 124 ? 44.034 -25.547 -3.127  1.00 66.23  ? 565  TYR A CE2 1 
ATOM   941  C CZ  . TYR A 1 124 ? 43.502 -24.299 -3.379  1.00 68.65  ? 565  TYR A CZ  1 
ATOM   942  O OH  . TYR A 1 124 ? 43.712 -23.252 -2.501  1.00 70.97  ? 565  TYR A OH  1 
ATOM   943  N N   . LEU A 1 125 ? 45.611 -28.781 -6.534  1.00 67.10  ? 566  LEU A N   1 
ATOM   944  C CA  . LEU A 1 125 ? 46.978 -28.963 -6.061  1.00 67.62  ? 566  LEU A CA  1 
ATOM   945  C C   . LEU A 1 125 ? 48.010 -28.730 -7.165  1.00 71.56  ? 566  LEU A C   1 
ATOM   946  O O   . LEU A 1 125 ? 49.019 -28.053 -6.962  1.00 74.79  ? 566  LEU A O   1 
ATOM   947  C CB  . LEU A 1 125 ? 47.149 -30.369 -5.512  1.00 66.58  ? 566  LEU A CB  1 
ATOM   948  C CG  . LEU A 1 125 ? 46.316 -30.713 -4.283  1.00 66.16  ? 566  LEU A CG  1 
ATOM   949  C CD1 . LEU A 1 125 ? 46.493 -32.190 -3.972  1.00 66.68  ? 566  LEU A CD1 1 
ATOM   950  C CD2 . LEU A 1 125 ? 46.716 -29.853 -3.093  1.00 66.81  ? 566  LEU A CD2 1 
ATOM   951  N N   . HIS A 1 126 ? 47.757 -29.296 -8.335  1.00 70.17  ? 567  HIS A N   1 
ATOM   952  C CA  . HIS A 1 126 ? 48.658 -29.129 -9.453  1.00 72.87  ? 567  HIS A CA  1 
ATOM   953  C C   . HIS A 1 126 ? 48.713 -27.699 -9.924  1.00 76.89  ? 567  HIS A C   1 
ATOM   954  O O   . HIS A 1 126 ? 49.725 -27.266 -10.471 1.00 84.84  ? 567  HIS A O   1 
ATOM   955  C CB  . HIS A 1 126 ? 48.224 -30.020 -10.597 1.00 73.85  ? 567  HIS A CB  1 
ATOM   956  C CG  . HIS A 1 126 ? 48.548 -31.456 -10.374 1.00 71.60  ? 567  HIS A CG  1 
ATOM   957  N ND1 . HIS A 1 126 ? 48.675 -32.358 -11.405 1.00 73.16  ? 567  HIS A ND1 1 
ATOM   958  C CD2 . HIS A 1 126 ? 48.823 -32.136 -9.238  1.00 69.05  ? 567  HIS A CD2 1 
ATOM   959  C CE1 . HIS A 1 126 ? 48.985 -33.541 -10.909 1.00 72.79  ? 567  HIS A CE1 1 
ATOM   960  N NE2 . HIS A 1 126 ? 49.080 -33.434 -9.596  1.00 69.62  ? 567  HIS A NE2 1 
ATOM   961  N N   . ALA A 1 127 ? 47.620 -26.970 -9.731  1.00 76.18  ? 568  ALA A N   1 
ATOM   962  C CA  . ALA A 1 127 ? 47.580 -25.547 -10.053 1.00 77.05  ? 568  ALA A CA  1 
ATOM   963  C C   . ALA A 1 127 ? 48.476 -24.763 -9.083  1.00 77.86  ? 568  ALA A C   1 
ATOM   964  O O   . ALA A 1 127 ? 49.124 -23.792 -9.479  1.00 80.58  ? 568  ALA A O   1 
ATOM   965  C CB  . ALA A 1 127 ? 46.151 -25.039 -9.997  1.00 75.70  ? 568  ALA A CB  1 
ATOM   966  N N   . LYS A 1 128 ? 48.512 -25.206 -7.823  1.00 80.11  ? 569  LYS A N   1 
ATOM   967  C CA  . LYS A 1 128 ? 49.420 -24.670 -6.801  1.00 80.30  ? 569  LYS A CA  1 
ATOM   968  C C   . LYS A 1 128 ? 50.871 -25.188 -6.895  1.00 81.71  ? 569  LYS A C   1 
ATOM   969  O O   . LYS A 1 128 ? 51.712 -24.781 -6.102  1.00 82.96  ? 569  LYS A O   1 
ATOM   970  C CB  . LYS A 1 128 ? 48.879 -25.005 -5.405  1.00 77.14  ? 569  LYS A CB  1 
ATOM   971  C CG  . LYS A 1 128 ? 47.596 -24.283 -5.022  1.00 76.61  ? 569  LYS A CG  1 
ATOM   972  C CD  . LYS A 1 128 ? 47.895 -23.044 -4.204  1.00 79.07  ? 569  LYS A CD  1 
ATOM   973  C CE  . LYS A 1 128 ? 46.632 -22.273 -3.873  1.00 79.17  ? 569  LYS A CE  1 
ATOM   974  N NZ  . LYS A 1 128 ? 46.975 -20.940 -3.310  1.00 83.79  ? 569  LYS A NZ  1 
ATOM   975  N N   . SER A 1 129 ? 51.160 -26.069 -7.852  1.00 82.86  ? 570  SER A N   1 
ATOM   976  C CA  . SER A 1 129 ? 52.472 -26.744 -7.977  1.00 85.52  ? 570  SER A CA  1 
ATOM   977  C C   . SER A 1 129 ? 52.753 -27.711 -6.833  1.00 83.98  ? 570  SER A C   1 
ATOM   978  O O   . SER A 1 129 ? 53.903 -27.884 -6.430  1.00 90.34  ? 570  SER A O   1 
ATOM   979  C CB  . SER A 1 129 ? 53.632 -25.752 -8.088  1.00 89.13  ? 570  SER A CB  1 
ATOM   980  O OG  . SER A 1 129 ? 53.419 -24.865 -9.154  1.00 93.87  ? 570  SER A OG  1 
ATOM   981  N N   . ILE A 1 130 ? 51.707 -28.336 -6.312  1.00 78.33  ? 571  ILE A N   1 
ATOM   982  C CA  . ILE A 1 130 ? 51.870 -29.379 -5.326  1.00 75.54  ? 571  ILE A CA  1 
ATOM   983  C C   . ILE A 1 130 ? 51.688 -30.710 -6.026  1.00 74.17  ? 571  ILE A C   1 
ATOM   984  O O   . ILE A 1 130 ? 50.646 -30.955 -6.639  1.00 72.62  ? 571  ILE A O   1 
ATOM   985  C CB  . ILE A 1 130 ? 50.841 -29.245 -4.199  1.00 73.66  ? 571  ILE A CB  1 
ATOM   986  C CG1 . ILE A 1 130 ? 51.129 -27.977 -3.384  1.00 77.49  ? 571  ILE A CG1 1 
ATOM   987  C CG2 . ILE A 1 130 ? 50.874 -30.472 -3.303  1.00 69.85  ? 571  ILE A CG2 1 
ATOM   988  C CD1 . ILE A 1 130 ? 49.945 -27.464 -2.590  1.00 76.06  ? 571  ILE A CD1 1 
ATOM   989  N N   . ILE A 1 131 ? 52.721 -31.545 -5.955  1.00 74.87  ? 572  ILE A N   1 
ATOM   990  C CA  . ILE A 1 131 ? 52.652 -32.927 -6.415  1.00 72.45  ? 572  ILE A CA  1 
ATOM   991  C C   . ILE A 1 131 ? 52.398 -33.776 -5.178  1.00 69.49  ? 572  ILE A C   1 
ATOM   992  O O   . ILE A 1 131 ? 53.136 -33.676 -4.200  1.00 73.55  ? 572  ILE A O   1 
ATOM   993  C CB  . ILE A 1 131 ? 53.974 -33.361 -7.057  1.00 76.05  ? 572  ILE A CB  1 
ATOM   994  C CG1 . ILE A 1 131 ? 54.264 -32.533 -8.318  1.00 79.64  ? 572  ILE A CG1 1 
ATOM   995  C CG2 . ILE A 1 131 ? 53.932 -34.835 -7.407  1.00 76.00  ? 572  ILE A CG2 1 
ATOM   996  C CD1 . ILE A 1 131 ? 55.738 -32.436 -8.654  1.00 83.16  ? 572  ILE A CD1 1 
ATOM   997  N N   . HIS A 1 132 ? 51.357 -34.598 -5.203  1.00 65.39  ? 573  HIS A N   1 
ATOM   998  C CA  . HIS A 1 132 ? 50.969 -35.345 -4.010  1.00 63.71  ? 573  HIS A CA  1 
ATOM   999  C C   . HIS A 1 132 ? 51.936 -36.483 -3.652  1.00 65.67  ? 573  HIS A C   1 
ATOM   1000 O O   . HIS A 1 132 ? 52.223 -36.693 -2.463  1.00 68.18  ? 573  HIS A O   1 
ATOM   1001 C CB  . HIS A 1 132 ? 49.552 -35.899 -4.152  1.00 61.72  ? 573  HIS A CB  1 
ATOM   1002 C CG  . HIS A 1 132 ? 48.970 -36.370 -2.861  1.00 61.99  ? 573  HIS A CG  1 
ATOM   1003 N ND1 . HIS A 1 132 ? 48.891 -37.701 -2.525  1.00 61.79  ? 573  HIS A ND1 1 
ATOM   1004 C CD2 . HIS A 1 132 ? 48.480 -35.686 -1.801  1.00 65.07  ? 573  HIS A CD2 1 
ATOM   1005 C CE1 . HIS A 1 132 ? 48.358 -37.822 -1.323  1.00 64.03  ? 573  HIS A CE1 1 
ATOM   1006 N NE2 . HIS A 1 132 ? 48.100 -36.612 -0.859  1.00 65.10  ? 573  HIS A NE2 1 
ATOM   1007 N N   . ARG A 1 133 ? 52.392 -37.221 -4.673  1.00 64.89  ? 574  ARG A N   1 
ATOM   1008 C CA  . ARG A 1 133 ? 53.350 -38.338 -4.547  1.00 65.02  ? 574  ARG A CA  1 
ATOM   1009 C C   . ARG A 1 133 ? 52.815 -39.630 -3.915  1.00 63.82  ? 574  ARG A C   1 
ATOM   1010 O O   . ARG A 1 133 ? 53.453 -40.666 -4.062  1.00 67.61  ? 574  ARG A O   1 
ATOM   1011 C CB  . ARG A 1 133 ? 54.626 -37.928 -3.801  1.00 67.69  ? 574  ARG A CB  1 
ATOM   1012 C CG  . ARG A 1 133 ? 55.593 -37.068 -4.582  1.00 71.94  ? 574  ARG A CG  1 
ATOM   1013 C CD  . ARG A 1 133 ? 56.657 -36.512 -3.647  1.00 76.67  ? 574  ARG A CD  1 
ATOM   1014 N NE  . ARG A 1 133 ? 57.825 -36.071 -4.396  1.00 83.30  ? 574  ARG A NE  1 
ATOM   1015 C CZ  . ARG A 1 133 ? 58.041 -34.834 -4.856  1.00 88.40  ? 574  ARG A CZ  1 
ATOM   1016 N NH1 . ARG A 1 133 ? 59.156 -34.584 -5.551  1.00 94.32  ? 574  ARG A NH1 1 
ATOM   1017 N NH2 . ARG A 1 133 ? 57.172 -33.843 -4.641  1.00 86.00  ? 574  ARG A NH2 1 
ATOM   1018 N N   . ASP A 1 134 ? 51.682 -39.593 -3.214  1.00 62.05  ? 575  ASP A N   1 
ATOM   1019 C CA  . ASP A 1 134 ? 51.144 -40.803 -2.573  1.00 62.93  ? 575  ASP A CA  1 
ATOM   1020 C C   . ASP A 1 134 ? 49.604 -40.869 -2.602  1.00 60.97  ? 575  ASP A C   1 
ATOM   1021 O O   . ASP A 1 134 ? 48.957 -41.269 -1.632  1.00 60.38  ? 575  ASP A O   1 
ATOM   1022 C CB  . ASP A 1 134 ? 51.685 -40.926 -1.138  1.00 65.10  ? 575  ASP A CB  1 
ATOM   1023 C CG  . ASP A 1 134 ? 51.558 -42.353 -0.550  1.00 68.56  ? 575  ASP A CG  1 
ATOM   1024 O OD1 . ASP A 1 134 ? 51.512 -43.365 -1.303  1.00 69.06  ? 575  ASP A OD1 1 
ATOM   1025 O OD2 . ASP A 1 134 ? 51.521 -42.455 0.700   1.00 72.99  ? 575  ASP A OD2 1 
ATOM   1026 N N   . LEU A 1 135 ? 49.021 -40.502 -3.735  1.00 58.94  ? 576  LEU A N   1 
ATOM   1027 C CA  . LEU A 1 135 ? 47.583 -40.552 -3.882  1.00 57.38  ? 576  LEU A CA  1 
ATOM   1028 C C   . LEU A 1 135 ? 47.193 -42.007 -3.971  1.00 59.13  ? 576  LEU A C   1 
ATOM   1029 O O   . LEU A 1 135 ? 47.840 -42.772 -4.666  1.00 63.64  ? 576  LEU A O   1 
ATOM   1030 C CB  . LEU A 1 135 ? 47.145 -39.821 -5.150  1.00 57.60  ? 576  LEU A CB  1 
ATOM   1031 C CG  . LEU A 1 135 ? 45.656 -39.852 -5.489  1.00 56.40  ? 576  LEU A CG  1 
ATOM   1032 C CD1 . LEU A 1 135 ? 44.836 -39.186 -4.405  1.00 54.43  ? 576  LEU A CD1 1 
ATOM   1033 C CD2 . LEU A 1 135 ? 45.409 -39.177 -6.825  1.00 59.40  ? 576  LEU A CD2 1 
ATOM   1034 N N   . LYS A 1 136 ? 46.141 -42.387 -3.258  1.00 59.00  ? 577  LYS A N   1 
ATOM   1035 C CA  . LYS A 1 136 ? 45.612 -43.749 -3.297  1.00 57.17  ? 577  LYS A CA  1 
ATOM   1036 C C   . LYS A 1 136 ? 44.350 -43.791 -2.472  1.00 55.94  ? 577  LYS A C   1 
ATOM   1037 O O   . LYS A 1 136 ? 44.098 -42.894 -1.679  1.00 57.06  ? 577  LYS A O   1 
ATOM   1038 C CB  . LYS A 1 136 ? 46.602 -44.744 -2.712  1.00 56.97  ? 577  LYS A CB  1 
ATOM   1039 C CG  . LYS A 1 136 ? 47.249 -44.249 -1.437  1.00 57.21  ? 577  LYS A CG  1 
ATOM   1040 C CD  . LYS A 1 136 ? 47.683 -45.385 -0.541  1.00 58.56  ? 577  LYS A CD  1 
ATOM   1041 C CE  . LYS A 1 136 ? 49.061 -45.101 0.017   1.00 62.69  ? 577  LYS A CE  1 
ATOM   1042 N NZ  . LYS A 1 136 ? 49.440 -46.055 1.093   1.00 68.17  ? 577  LYS A NZ  1 
ATOM   1043 N N   . SER A 1 137 ? 43.583 -44.860 -2.617  1.00 55.21  ? 578  SER A N   1 
ATOM   1044 C CA  . SER A 1 137 ? 42.243 -44.881 -2.066  1.00 54.69  ? 578  SER A CA  1 
ATOM   1045 C C   . SER A 1 137 ? 42.231 -44.709 -0.558  1.00 55.52  ? 578  SER A C   1 
ATOM   1046 O O   . SER A 1 137 ? 41.211 -44.331 0.004   1.00 56.47  ? 578  SER A O   1 
ATOM   1047 C CB  . SER A 1 137 ? 41.493 -46.155 -2.473  1.00 55.41  ? 578  SER A CB  1 
ATOM   1048 O OG  . SER A 1 137 ? 42.029 -47.320 -1.864  1.00 57.42  ? 578  SER A OG  1 
ATOM   1049 N N   . ASN A 1 138 ? 43.353 -44.976 0.100   1.00 57.76  ? 579  ASN A N   1 
ATOM   1050 C CA  . ASN A 1 138 ? 43.400 -44.869 1.550   1.00 60.77  ? 579  ASN A CA  1 
ATOM   1051 C C   . ASN A 1 138 ? 43.650 -43.442 2.023   1.00 59.99  ? 579  ASN A C   1 
ATOM   1052 O O   . ASN A 1 138 ? 43.500 -43.161 3.199   1.00 63.12  ? 579  ASN A O   1 
ATOM   1053 C CB  . ASN A 1 138 ? 44.469 -45.793 2.130   1.00 63.66  ? 579  ASN A CB  1 
ATOM   1054 C CG  . ASN A 1 138 ? 44.152 -46.261 3.546   1.00 70.59  ? 579  ASN A CG  1 
ATOM   1055 O OD1 . ASN A 1 138 ? 44.685 -47.276 3.975   1.00 78.81  ? 579  ASN A OD1 1 
ATOM   1056 N ND2 . ASN A 1 138 ? 43.289 -45.545 4.277   1.00 74.34  ? 579  ASN A ND2 1 
ATOM   1057 N N   . ASN A 1 139 ? 44.045 -42.549 1.125   1.00 58.51  ? 580  ASN A N   1 
ATOM   1058 C CA  . ASN A 1 139 ? 44.266 -41.152 1.485   1.00 59.84  ? 580  ASN A CA  1 
ATOM   1059 C C   . ASN A 1 139 ? 43.181 -40.256 0.892   1.00 59.43  ? 580  ASN A C   1 
ATOM   1060 O O   . ASN A 1 139 ? 43.392 -39.065 0.667   1.00 58.71  ? 580  ASN A O   1 
ATOM   1061 C CB  . ASN A 1 139 ? 45.659 -40.699 1.029   1.00 60.16  ? 580  ASN A CB  1 
ATOM   1062 C CG  . ASN A 1 139 ? 46.782 -41.440 1.738   1.00 60.82  ? 580  ASN A CG  1 
ATOM   1063 O OD1 . ASN A 1 139 ? 46.664 -41.834 2.905   1.00 63.02  ? 580  ASN A OD1 1 
ATOM   1064 N ND2 . ASN A 1 139 ? 47.887 -41.621 1.036   1.00 61.10  ? 580  ASN A ND2 1 
ATOM   1065 N N   . ILE A 1 140 ? 42.019 -40.851 0.641   1.00 59.43  ? 581  ILE A N   1 
ATOM   1066 C CA  . ILE A 1 140 ? 40.852 -40.134 0.175   1.00 56.82  ? 581  ILE A CA  1 
ATOM   1067 C C   . ILE A 1 140 ? 39.723 -40.469 1.121   1.00 57.42  ? 581  ILE A C   1 
ATOM   1068 O O   . ILE A 1 140 ? 39.265 -41.604 1.155   1.00 55.58  ? 581  ILE A O   1 
ATOM   1069 C CB  . ILE A 1 140 ? 40.484 -40.568 -1.239  1.00 57.11  ? 581  ILE A CB  1 
ATOM   1070 C CG1 . ILE A 1 140 ? 41.678 -40.336 -2.156  1.00 57.52  ? 581  ILE A CG1 1 
ATOM   1071 C CG2 . ILE A 1 140 ? 39.261 -39.807 -1.730  1.00 57.86  ? 581  ILE A CG2 1 
ATOM   1072 C CD1 . ILE A 1 140 ? 41.351 -40.426 -3.627  1.00 59.27  ? 581  ILE A CD1 1 
ATOM   1073 N N   . PHE A 1 141 ? 39.299 -39.479 1.901   1.00 60.19  ? 582  PHE A N   1 
ATOM   1074 C CA  . PHE A 1 141 ? 38.237 -39.661 2.882   1.00 62.13  ? 582  PHE A CA  1 
ATOM   1075 C C   . PHE A 1 141 ? 36.891 -39.277 2.255   1.00 61.09  ? 582  PHE A C   1 
ATOM   1076 O O   . PHE A 1 141 ? 36.834 -38.418 1.382   1.00 60.43  ? 582  PHE A O   1 
ATOM   1077 C CB  . PHE A 1 141 ? 38.537 -38.850 4.140   1.00 64.67  ? 582  PHE A CB  1 
ATOM   1078 C CG  . PHE A 1 141 ? 38.187 -39.566 5.419   1.00 73.37  ? 582  PHE A CG  1 
ATOM   1079 C CD1 . PHE A 1 141 ? 39.133 -40.344 6.091   1.00 76.60  ? 582  PHE A CD1 1 
ATOM   1080 C CD2 . PHE A 1 141 ? 36.896 -39.483 5.958   1.00 78.24  ? 582  PHE A CD2 1 
ATOM   1081 C CE1 . PHE A 1 141 ? 38.795 -41.006 7.279   1.00 81.02  ? 582  PHE A CE1 1 
ATOM   1082 C CE2 . PHE A 1 141 ? 36.558 -40.148 7.139   1.00 80.15  ? 582  PHE A CE2 1 
ATOM   1083 C CZ  . PHE A 1 141 ? 37.510 -40.907 7.802   1.00 81.01  ? 582  PHE A CZ  1 
ATOM   1084 N N   . LEU A 1 142 ? 35.824 -39.951 2.679   1.00 62.41  ? 583  LEU A N   1 
ATOM   1085 C CA  . LEU A 1 142 ? 34.483 -39.762 2.129   1.00 62.73  ? 583  LEU A CA  1 
ATOM   1086 C C   . LEU A 1 142 ? 33.657 -39.068 3.194   1.00 65.65  ? 583  LEU A C   1 
ATOM   1087 O O   . LEU A 1 142 ? 32.829 -39.682 3.881   1.00 68.39  ? 583  LEU A O   1 
ATOM   1088 C CB  . LEU A 1 142 ? 33.868 -41.114 1.784   1.00 67.06  ? 583  LEU A CB  1 
ATOM   1089 C CG  . LEU A 1 142 ? 33.059 -41.249 0.493   1.00 70.00  ? 583  LEU A CG  1 
ATOM   1090 C CD1 . LEU A 1 142 ? 32.174 -40.043 0.200   1.00 73.33  ? 583  LEU A CD1 1 
ATOM   1091 C CD2 . LEU A 1 142 ? 34.031 -41.472 -0.644  1.00 68.95  ? 583  LEU A CD2 1 
ATOM   1092 N N   . HIS A 1 143 ? 33.903 -37.773 3.339   1.00 65.60  ? 584  HIS A N   1 
ATOM   1093 C CA  . HIS A 1 143 ? 33.422 -37.040 4.488   1.00 68.12  ? 584  HIS A CA  1 
ATOM   1094 C C   . HIS A 1 143 ? 31.910 -37.000 4.514   1.00 72.18  ? 584  HIS A C   1 
ATOM   1095 O O   . HIS A 1 143 ? 31.275 -36.779 3.496   1.00 71.77  ? 584  HIS A O   1 
ATOM   1096 C CB  . HIS A 1 143 ? 33.976 -35.621 4.503   1.00 66.99  ? 584  HIS A CB  1 
ATOM   1097 C CG  . HIS A 1 143 ? 33.563 -34.840 5.712   1.00 69.92  ? 584  HIS A CG  1 
ATOM   1098 N ND1 . HIS A 1 143 ? 33.057 -33.560 5.646   1.00 68.90  ? 584  HIS A ND1 1 
ATOM   1099 C CD2 . HIS A 1 143 ? 33.535 -35.188 7.017   1.00 72.22  ? 584  HIS A CD2 1 
ATOM   1100 C CE1 . HIS A 1 143 ? 32.755 -33.147 6.862   1.00 73.08  ? 584  HIS A CE1 1 
ATOM   1101 N NE2 . HIS A 1 143 ? 33.032 -34.118 7.712   1.00 74.85  ? 584  HIS A NE2 1 
ATOM   1102 N N   . GLU A 1 144 ? 31.343 -37.234 5.690   1.00 79.13  ? 585  GLU A N   1 
ATOM   1103 C CA  . GLU A 1 144 ? 29.893 -37.288 5.874   1.00 85.76  ? 585  GLU A CA  1 
ATOM   1104 C C   . GLU A 1 144 ? 29.194 -38.014 4.716   1.00 83.62  ? 585  GLU A C   1 
ATOM   1105 O O   . GLU A 1 144 ? 28.100 -37.640 4.293   1.00 81.36  ? 585  GLU A O   1 
ATOM   1106 C CB  . GLU A 1 144 ? 29.345 -35.872 6.066   1.00 90.56  ? 585  GLU A CB  1 
ATOM   1107 C CG  . GLU A 1 144 ? 28.141 -35.805 6.991   1.00 99.24  ? 585  GLU A CG  1 
ATOM   1108 C CD  . GLU A 1 144 ? 28.488 -36.073 8.452   1.00 105.89 ? 585  GLU A CD  1 
ATOM   1109 O OE1 . GLU A 1 144 ? 29.503 -35.520 8.936   1.00 108.44 ? 585  GLU A OE1 1 
ATOM   1110 O OE2 . GLU A 1 144 ? 27.741 -36.827 9.126   1.00 112.17 ? 585  GLU A OE2 1 
ATOM   1111 N N   . ASP A 1 145 ? 29.866 -39.059 4.223   1.00 83.47  ? 586  ASP A N   1 
ATOM   1112 C CA  . ASP A 1 145 ? 29.425 -39.874 3.090   1.00 82.24  ? 586  ASP A CA  1 
ATOM   1113 C C   . ASP A 1 145 ? 29.156 -39.100 1.787   1.00 80.93  ? 586  ASP A C   1 
ATOM   1114 O O   . ASP A 1 145 ? 28.492 -39.622 0.906   1.00 82.31  ? 586  ASP A O   1 
ATOM   1115 C CB  . ASP A 1 145 ? 28.188 -40.700 3.494   1.00 87.26  ? 586  ASP A CB  1 
ATOM   1116 C CG  . ASP A 1 145 ? 28.530 -41.865 4.422   1.00 91.42  ? 586  ASP A CG  1 
ATOM   1117 O OD1 . ASP A 1 145 ? 29.633 -42.440 4.298   1.00 92.65  ? 586  ASP A OD1 1 
ATOM   1118 O OD2 . ASP A 1 145 ? 27.688 -42.224 5.271   1.00 97.25  ? 586  ASP A OD2 1 
ATOM   1119 N N   . LEU A 1 146 ? 29.694 -37.887 1.640   1.00 77.58  ? 587  LEU A N   1 
ATOM   1120 C CA  . LEU A 1 146 ? 29.295 -36.996 0.534   1.00 76.18  ? 587  LEU A CA  1 
ATOM   1121 C C   . LEU A 1 146 ? 30.467 -36.334 -0.171  1.00 72.80  ? 587  LEU A C   1 
ATOM   1122 O O   . LEU A 1 146 ? 30.591 -36.446 -1.391  1.00 76.53  ? 587  LEU A O   1 
ATOM   1123 C CB  . LEU A 1 146 ? 28.329 -35.894 1.017   1.00 78.43  ? 587  LEU A CB  1 
ATOM   1124 C CG  . LEU A 1 146 ? 26.839 -36.205 1.221   1.00 83.01  ? 587  LEU A CG  1 
ATOM   1125 C CD1 . LEU A 1 146 ? 26.082 -34.905 1.414   1.00 87.21  ? 587  LEU A CD1 1 
ATOM   1126 C CD2 . LEU A 1 146 ? 26.223 -36.969 0.061   1.00 84.32  ? 587  LEU A CD2 1 
ATOM   1127 N N   . THR A 1 147 ? 31.300 -35.622 0.585   1.00 68.64  ? 588  THR A N   1 
ATOM   1128 C CA  . THR A 1 147 ? 32.387 -34.845 0.012   1.00 64.56  ? 588  THR A CA  1 
ATOM   1129 C C   . THR A 1 147 ? 33.720 -35.556 0.143   1.00 63.99  ? 588  THR A C   1 
ATOM   1130 O O   . THR A 1 147 ? 34.056 -36.049 1.218   1.00 66.99  ? 588  THR A O   1 
ATOM   1131 C CB  . THR A 1 147 ? 32.537 -33.508 0.726   1.00 65.03  ? 588  THR A CB  1 
ATOM   1132 O OG1 . THR A 1 147 ? 31.252 -32.915 0.883   1.00 68.54  ? 588  THR A OG1 1 
ATOM   1133 C CG2 . THR A 1 147 ? 33.424 -32.577 -0.074  1.00 65.32  ? 588  THR A CG2 1 
ATOM   1134 N N   . VAL A 1 148 ? 34.491 -35.571 -0.941  1.00 62.09  ? 589  VAL A N   1 
ATOM   1135 C CA  . VAL A 1 148 ? 35.834 -36.133 -0.918  1.00 61.94  ? 589  VAL A CA  1 
ATOM   1136 C C   . VAL A 1 148 ? 36.836 -35.195 -0.251  1.00 63.15  ? 589  VAL A C   1 
ATOM   1137 O O   . VAL A 1 148 ? 36.881 -34.005 -0.547  1.00 63.90  ? 589  VAL A O   1 
ATOM   1138 C CB  . VAL A 1 148 ? 36.347 -36.418 -2.338  1.00 61.54  ? 589  VAL A CB  1 
ATOM   1139 C CG1 . VAL A 1 148 ? 37.845 -36.687 -2.327  1.00 60.74  ? 589  VAL A CG1 1 
ATOM   1140 C CG2 . VAL A 1 148 ? 35.602 -37.598 -2.944  1.00 61.96  ? 589  VAL A CG2 1 
ATOM   1141 N N   . LYS A 1 149 ? 37.660 -35.752 0.628   1.00 63.67  ? 590  LYS A N   1 
ATOM   1142 C CA  . LYS A 1 149 ? 38.780 -35.020 1.206   1.00 64.39  ? 590  LYS A CA  1 
ATOM   1143 C C   . LYS A 1 149 ? 40.086 -35.752 0.908   1.00 61.59  ? 590  LYS A C   1 
ATOM   1144 O O   . LYS A 1 149 ? 40.328 -36.846 1.408   1.00 60.88  ? 590  LYS A O   1 
ATOM   1145 C CB  . LYS A 1 149 ? 38.609 -34.883 2.713   1.00 66.85  ? 590  LYS A CB  1 
ATOM   1146 C CG  . LYS A 1 149 ? 37.276 -34.309 3.148   1.00 68.51  ? 590  LYS A CG  1 
ATOM   1147 C CD  . LYS A 1 149 ? 37.168 -32.826 2.859   1.00 70.08  ? 590  LYS A CD  1 
ATOM   1148 C CE  . LYS A 1 149 ? 35.945 -32.227 3.537   1.00 71.54  ? 590  LYS A CE  1 
ATOM   1149 N NZ  . LYS A 1 149 ? 35.696 -30.844 3.065   1.00 72.27  ? 590  LYS A NZ  1 
ATOM   1150 N N   . ILE A 1 150 ? 40.921 -35.141 0.083   1.00 60.81  ? 591  ILE A N   1 
ATOM   1151 C CA  . ILE A 1 150 ? 42.250 -35.657 -0.171  1.00 59.93  ? 591  ILE A CA  1 
ATOM   1152 C C   . ILE A 1 150 ? 43.143 -35.259 0.989   1.00 61.47  ? 591  ILE A C   1 
ATOM   1153 O O   . ILE A 1 150 ? 43.090 -34.135 1.457   1.00 64.36  ? 591  ILE A O   1 
ATOM   1154 C CB  . ILE A 1 150 ? 42.794 -35.130 -1.510  1.00 60.47  ? 591  ILE A CB  1 
ATOM   1155 C CG1 . ILE A 1 150 ? 41.895 -35.637 -2.643  1.00 59.26  ? 591  ILE A CG1 1 
ATOM   1156 C CG2 . ILE A 1 150 ? 44.226 -35.591 -1.735  1.00 60.36  ? 591  ILE A CG2 1 
ATOM   1157 C CD1 . ILE A 1 150 ? 42.366 -35.271 -4.029  1.00 60.56  ? 591  ILE A CD1 1 
ATOM   1158 N N   . GLY A 1 151 ? 43.942 -36.201 1.465   1.00 63.81  ? 592  GLY A N   1 
ATOM   1159 C CA  . GLY A 1 151 ? 44.847 -35.967 2.586   1.00 69.46  ? 592  GLY A CA  1 
ATOM   1160 C C   . GLY A 1 151 ? 46.073 -36.845 2.448   1.00 73.23  ? 592  GLY A C   1 
ATOM   1161 O O   . GLY A 1 151 ? 46.494 -37.145 1.323   1.00 72.14  ? 592  GLY A O   1 
ATOM   1162 N N   . ASP A 1 152 ? 46.651 -37.245 3.582   1.00 79.72  ? 593  ASP A N   1 
ATOM   1163 C CA  . ASP A 1 152 ? 47.742 -38.231 3.606   1.00 87.62  ? 593  ASP A CA  1 
ATOM   1164 C C   . ASP A 1 152 ? 47.798 -38.958 4.957   1.00 94.31  ? 593  ASP A C   1 
ATOM   1165 O O   . ASP A 1 152 ? 48.494 -38.529 5.892   1.00 99.72  ? 593  ASP A O   1 
ATOM   1166 C CB  . ASP A 1 152 ? 49.081 -37.563 3.290   1.00 93.12  ? 593  ASP A CB  1 
ATOM   1167 C CG  . ASP A 1 152 ? 50.249 -38.554 3.245   1.00 100.52 ? 593  ASP A CG  1 
ATOM   1168 O OD1 . ASP A 1 152 ? 51.393 -38.102 3.469   1.00 111.83 ? 593  ASP A OD1 1 
ATOM   1169 O OD2 . ASP A 1 152 ? 50.039 -39.766 2.990   1.00 96.46  ? 593  ASP A OD2 1 
ATOM   1170 N N   . PHE A 1 153 ? 47.069 -40.071 5.040   1.00 97.44  ? 594  PHE A N   1 
ATOM   1171 C CA  . PHE A 1 153 ? 46.857 -40.780 6.309   1.00 103.91 ? 594  PHE A CA  1 
ATOM   1172 C C   . PHE A 1 153 ? 47.884 -41.907 6.587   1.00 109.12 ? 594  PHE A C   1 
ATOM   1173 O O   . PHE A 1 153 ? 47.758 -42.622 7.587   1.00 109.76 ? 594  PHE A O   1 
ATOM   1174 C CB  . PHE A 1 153 ? 45.410 -41.313 6.375   1.00 101.28 ? 594  PHE A CB  1 
ATOM   1175 C CG  . PHE A 1 153 ? 44.353 -40.280 6.009   1.00 98.86  ? 594  PHE A CG  1 
ATOM   1176 C CD1 . PHE A 1 153 ? 43.309 -40.598 5.138   1.00 96.96  ? 594  PHE A CD1 1 
ATOM   1177 C CD2 . PHE A 1 153 ? 44.402 -38.993 6.524   1.00 99.44  ? 594  PHE A CD2 1 
ATOM   1178 C CE1 . PHE A 1 153 ? 42.342 -39.660 4.792   1.00 93.08  ? 594  PHE A CE1 1 
ATOM   1179 C CE2 . PHE A 1 153 ? 43.436 -38.051 6.185   1.00 97.79  ? 594  PHE A CE2 1 
ATOM   1180 C CZ  . PHE A 1 153 ? 42.406 -38.385 5.318   1.00 94.67  ? 594  PHE A CZ  1 
ATOM   1181 N N   . GLY A 1 154 ? 48.901 -42.046 5.727   1.00 110.21 ? 595  GLY A N   1 
ATOM   1182 C CA  . GLY A 1 154 ? 49.991 -43.021 5.932   1.00 113.22 ? 595  GLY A CA  1 
ATOM   1183 C C   . GLY A 1 154 ? 50.594 -43.037 7.336   1.00 117.40 ? 595  GLY A C   1 
ATOM   1184 O O   . GLY A 1 154 ? 51.796 -42.760 7.524   1.00 118.98 ? 595  GLY A O   1 
ATOM   1185 N N   . GLY A 1 173 ? 56.333 -49.046 1.007   1.00 92.08  ? 614  GLY A N   1 
ATOM   1186 C CA  . GLY A 1 173 ? 55.711 -48.197 -0.011  1.00 89.96  ? 614  GLY A CA  1 
ATOM   1187 C C   . GLY A 1 173 ? 54.464 -48.801 -0.664  1.00 90.76  ? 614  GLY A C   1 
ATOM   1188 O O   . GLY A 1 173 ? 54.169 -49.998 -0.485  1.00 91.55  ? 614  GLY A O   1 
ATOM   1189 N N   . SER A 1 174 ? 53.743 -47.972 -1.438  1.00 85.63  ? 615  SER A N   1 
ATOM   1190 C CA  . SER A 1 174 ? 52.429 -48.340 -2.006  1.00 78.60  ? 615  SER A CA  1 
ATOM   1191 C C   . SER A 1 174 ? 52.442 -48.556 -3.504  1.00 70.57  ? 615  SER A C   1 
ATOM   1192 O O   . SER A 1 174 ? 52.130 -47.671 -4.299  1.00 63.23  ? 615  SER A O   1 
ATOM   1193 C CB  . SER A 1 174 ? 51.359 -47.323 -1.627  1.00 80.39  ? 615  SER A CB  1 
ATOM   1194 O OG  . SER A 1 174 ? 50.576 -47.854 -0.571  1.00 88.86  ? 615  SER A OG  1 
ATOM   1195 N N   . ILE A 1 175 ? 52.708 -49.805 -3.845  1.00 69.10  ? 616  ILE A N   1 
ATOM   1196 C CA  . ILE A 1 175 ? 53.193 -50.211 -5.142  1.00 64.67  ? 616  ILE A CA  1 
ATOM   1197 C C   . ILE A 1 175 ? 52.120 -50.182 -6.212  1.00 59.94  ? 616  ILE A C   1 
ATOM   1198 O O   . ILE A 1 175 ? 52.397 -49.846 -7.360  1.00 60.81  ? 616  ILE A O   1 
ATOM   1199 C CB  . ILE A 1 175 ? 53.819 -51.622 -4.991  1.00 68.96  ? 616  ILE A CB  1 
ATOM   1200 C CG1 . ILE A 1 175 ? 55.342 -51.520 -4.909  1.00 74.73  ? 616  ILE A CG1 1 
ATOM   1201 C CG2 . ILE A 1 175 ? 53.455 -52.557 -6.134  1.00 69.20  ? 616  ILE A CG2 1 
ATOM   1202 C CD1 . ILE A 1 175 ? 55.870 -50.437 -3.993  1.00 76.75  ? 616  ILE A CD1 1 
ATOM   1203 N N   . LEU A 1 176 ? 50.897 -50.533 -5.837  1.00 57.46  ? 617  LEU A N   1 
ATOM   1204 C CA  . LEU A 1 176 ? 49.821 -50.726 -6.800  1.00 54.05  ? 617  LEU A CA  1 
ATOM   1205 C C   . LEU A 1 176 ? 49.467 -49.400 -7.483  1.00 54.34  ? 617  LEU A C   1 
ATOM   1206 O O   . LEU A 1 176 ? 49.012 -49.378 -8.628  1.00 55.50  ? 617  LEU A O   1 
ATOM   1207 C CB  . LEU A 1 176 ? 48.588 -51.350 -6.124  1.00 53.21  ? 617  LEU A CB  1 
ATOM   1208 C CG  . LEU A 1 176 ? 48.815 -52.623 -5.287  1.00 55.73  ? 617  LEU A CG  1 
ATOM   1209 C CD1 . LEU A 1 176 ? 47.603 -52.945 -4.437  1.00 55.83  ? 617  LEU A CD1 1 
ATOM   1210 C CD2 . LEU A 1 176 ? 49.157 -53.829 -6.145  1.00 58.14  ? 617  LEU A CD2 1 
ATOM   1211 N N   . TRP A 1 177 ? 49.719 -48.292 -6.800  1.00 56.46  ? 618  TRP A N   1 
ATOM   1212 C CA  . TRP A 1 177 ? 49.401 -46.979 -7.355  1.00 57.13  ? 618  TRP A CA  1 
ATOM   1213 C C   . TRP A 1 177 ? 50.572 -46.309 -8.071  1.00 57.07  ? 618  TRP A C   1 
ATOM   1214 O O   . TRP A 1 177 ? 50.431 -45.192 -8.545  1.00 59.38  ? 618  TRP A O   1 
ATOM   1215 C CB  . TRP A 1 177 ? 48.871 -46.061 -6.251  1.00 56.95  ? 618  TRP A CB  1 
ATOM   1216 C CG  . TRP A 1 177 ? 47.552 -46.507 -5.730  1.00 55.47  ? 618  TRP A CG  1 
ATOM   1217 C CD1 . TRP A 1 177 ? 46.328 -46.084 -6.138  1.00 54.36  ? 618  TRP A CD1 1 
ATOM   1218 C CD2 . TRP A 1 177 ? 47.324 -47.477 -4.710  1.00 55.37  ? 618  TRP A CD2 1 
ATOM   1219 N NE1 . TRP A 1 177 ? 45.350 -46.723 -5.429  1.00 53.11  ? 618  TRP A NE1 1 
ATOM   1220 C CE2 . TRP A 1 177 ? 45.936 -47.583 -4.543  1.00 54.07  ? 618  TRP A CE2 1 
ATOM   1221 C CE3 . TRP A 1 177 ? 48.163 -48.255 -3.907  1.00 56.84  ? 618  TRP A CE3 1 
ATOM   1222 C CZ2 . TRP A 1 177 ? 45.362 -48.443 -3.613  1.00 56.39  ? 618  TRP A CZ2 1 
ATOM   1223 C CZ3 . TRP A 1 177 ? 47.597 -49.108 -2.988  1.00 57.92  ? 618  TRP A CZ3 1 
ATOM   1224 C CH2 . TRP A 1 177 ? 46.205 -49.203 -2.850  1.00 57.85  ? 618  TRP A CH2 1 
ATOM   1225 N N   . MET A 1 178 ? 51.697 -47.002 -8.180  1.00 57.43  ? 619  MET A N   1 
ATOM   1226 C CA  . MET A 1 178 ? 52.943 -46.414 -8.655  1.00 59.21  ? 619  MET A CA  1 
ATOM   1227 C C   . MET A 1 178 ? 53.118 -46.623 -10.160 1.00 59.21  ? 619  MET A C   1 
ATOM   1228 O O   . MET A 1 178 ? 53.039 -47.755 -10.660 1.00 61.81  ? 619  MET A O   1 
ATOM   1229 C CB  . MET A 1 178 ? 54.109 -47.074 -7.914  1.00 63.13  ? 619  MET A CB  1 
ATOM   1230 C CG  . MET A 1 178 ? 55.151 -46.133 -7.351  1.00 66.85  ? 619  MET A CG  1 
ATOM   1231 S SD  . MET A 1 178 ? 55.926 -46.840 -5.875  1.00 71.75  ? 619  MET A SD  1 
ATOM   1232 C CE  . MET A 1 178 ? 57.539 -47.366 -6.464  1.00 76.97  ? 619  MET A CE  1 
ATOM   1233 N N   . ALA A 1 179 ? 53.382 -45.531 -10.870 1.00 59.09  ? 620  ALA A N   1 
ATOM   1234 C CA  . ALA A 1 179 ? 53.641 -45.572 -12.311 1.00 59.39  ? 620  ALA A CA  1 
ATOM   1235 C C   . ALA A 1 179 ? 54.983 -46.206 -12.615 1.00 61.61  ? 620  ALA A C   1 
ATOM   1236 O O   . ALA A 1 179 ? 55.891 -46.155 -11.788 1.00 64.17  ? 620  ALA A O   1 
ATOM   1237 C CB  . ALA A 1 179 ? 53.621 -44.176 -12.895 1.00 60.56  ? 620  ALA A CB  1 
ATOM   1238 N N   . PRO A 1 180 ? 55.124 -46.781 -13.823 1.00 61.56  ? 621  PRO A N   1 
ATOM   1239 C CA  . PRO A 1 180 ? 56.350 -47.458 -14.204 1.00 61.96  ? 621  PRO A CA  1 
ATOM   1240 C C   . PRO A 1 180 ? 57.594 -46.624 -13.962 1.00 65.84  ? 621  PRO A C   1 
ATOM   1241 O O   . PRO A 1 180 ? 58.575 -47.123 -13.402 1.00 68.64  ? 621  PRO A O   1 
ATOM   1242 C CB  . PRO A 1 180 ? 56.158 -47.694 -15.698 1.00 62.41  ? 621  PRO A CB  1 
ATOM   1243 C CG  . PRO A 1 180 ? 54.696 -47.863 -15.853 1.00 60.39  ? 621  PRO A CG  1 
ATOM   1244 C CD  . PRO A 1 180 ? 54.103 -46.880 -14.884 1.00 60.16  ? 621  PRO A CD  1 
ATOM   1245 N N   . GLU A 1 181 ? 57.565 -45.359 -14.366 1.00 66.42  ? 622  GLU A N   1 
ATOM   1246 C CA  . GLU A 1 181 ? 58.774 -44.562 -14.285 1.00 69.41  ? 622  GLU A CA  1 
ATOM   1247 C C   . GLU A 1 181 ? 59.184 -44.346 -12.824 1.00 70.61  ? 622  GLU A C   1 
ATOM   1248 O O   . GLU A 1 181 ? 60.368 -44.156 -12.526 1.00 75.35  ? 622  GLU A O   1 
ATOM   1249 C CB  . GLU A 1 181 ? 58.653 -43.259 -15.085 1.00 70.77  ? 622  GLU A CB  1 
ATOM   1250 C CG  . GLU A 1 181 ? 57.991 -42.086 -14.382 1.00 71.61  ? 622  GLU A CG  1 
ATOM   1251 C CD  . GLU A 1 181 ? 56.492 -41.975 -14.625 1.00 69.27  ? 622  GLU A CD  1 
ATOM   1252 O OE1 . GLU A 1 181 ? 55.873 -42.970 -15.088 1.00 65.67  ? 622  GLU A OE1 1 
ATOM   1253 O OE2 . GLU A 1 181 ? 55.943 -40.871 -14.333 1.00 68.82  ? 622  GLU A OE2 1 
ATOM   1254 N N   . VAL A 1 182 ? 58.218 -44.409 -11.911 1.00 68.09  ? 623  VAL A N   1 
ATOM   1255 C CA  . VAL A 1 182 ? 58.527 -44.312 -10.485 1.00 70.64  ? 623  VAL A CA  1 
ATOM   1256 C C   . VAL A 1 182 ? 59.069 -45.641 -9.970  1.00 71.50  ? 623  VAL A C   1 
ATOM   1257 O O   . VAL A 1 182 ? 60.044 -45.677 -9.223  1.00 75.24  ? 623  VAL A O   1 
ATOM   1258 C CB  . VAL A 1 182 ? 57.298 -43.917 -9.642  1.00 68.85  ? 623  VAL A CB  1 
ATOM   1259 C CG1 . VAL A 1 182 ? 57.675 -43.876 -8.168  1.00 70.71  ? 623  VAL A CG1 1 
ATOM   1260 C CG2 . VAL A 1 182 ? 56.741 -42.569 -10.087 1.00 67.97  ? 623  VAL A CG2 1 
ATOM   1261 N N   . ILE A 1 183 ? 58.414 -46.726 -10.361 1.00 69.90  ? 624  ILE A N   1 
ATOM   1262 C CA  . ILE A 1 183 ? 58.860 -48.060 -10.006 1.00 72.64  ? 624  ILE A CA  1 
ATOM   1263 C C   . ILE A 1 183 ? 60.262 -48.334 -10.522 1.00 76.77  ? 624  ILE A C   1 
ATOM   1264 O O   . ILE A 1 183 ? 61.101 -48.851 -9.794  1.00 80.19  ? 624  ILE A O   1 
ATOM   1265 C CB  . ILE A 1 183 ? 57.898 -49.120 -10.564 1.00 72.62  ? 624  ILE A CB  1 
ATOM   1266 C CG1 . ILE A 1 183 ? 56.702 -49.252 -9.630  1.00 71.09  ? 624  ILE A CG1 1 
ATOM   1267 C CG2 . ILE A 1 183 ? 58.610 -50.458 -10.755 1.00 76.61  ? 624  ILE A CG2 1 
ATOM   1268 C CD1 . ILE A 1 183 ? 55.847 -50.474 -9.869  1.00 72.71  ? 624  ILE A CD1 1 
ATOM   1269 N N   . ARG A 1 184 ? 60.509 -48.004 -11.785 1.00 78.52  ? 625  ARG A N   1 
ATOM   1270 C CA  . ARG A 1 184 ? 61.837 -48.188 -12.369 1.00 83.47  ? 625  ARG A CA  1 
ATOM   1271 C C   . ARG A 1 184 ? 62.873 -47.304 -11.681 1.00 89.08  ? 625  ARG A C   1 
ATOM   1272 O O   . ARG A 1 184 ? 64.061 -47.600 -11.728 1.00 93.51  ? 625  ARG A O   1 
ATOM   1273 C CB  . ARG A 1 184 ? 61.827 -47.891 -13.877 1.00 82.59  ? 625  ARG A CB  1 
ATOM   1274 C CG  . ARG A 1 184 ? 61.444 -49.073 -14.748 1.00 80.22  ? 625  ARG A CG  1 
ATOM   1275 C CD  . ARG A 1 184 ? 61.522 -48.750 -16.236 1.00 80.98  ? 625  ARG A CD  1 
ATOM   1276 N NE  . ARG A 1 184 ? 60.258 -48.219 -16.764 1.00 77.13  ? 625  ARG A NE  1 
ATOM   1277 C CZ  . ARG A 1 184 ? 60.016 -46.944 -17.076 1.00 77.84  ? 625  ARG A CZ  1 
ATOM   1278 N NH1 . ARG A 1 184 ? 60.939 -46.000 -16.927 1.00 83.23  ? 625  ARG A NH1 1 
ATOM   1279 N NH2 . ARG A 1 184 ? 58.826 -46.598 -17.548 1.00 75.51  ? 625  ARG A NH2 1 
ATOM   1280 N N   . MET A 1 185 ? 62.417 -46.227 -11.046 1.00 92.17  ? 626  MET A N   1 
ATOM   1281 C CA  . MET A 1 185 ? 63.299 -45.223 -10.461 1.00 101.71 ? 626  MET A CA  1 
ATOM   1282 C C   . MET A 1 185 ? 64.278 -44.703 -11.515 1.00 106.30 ? 626  MET A C   1 
ATOM   1283 O O   . MET A 1 185 ? 63.901 -43.866 -12.343 1.00 108.52 ? 626  MET A O   1 
ATOM   1284 C CB  . MET A 1 185 ? 64.020 -45.751 -9.205  1.00 107.40 ? 626  MET A CB  1 
ATOM   1285 C CG  . MET A 1 185 ? 63.194 -45.636 -7.930  1.00 109.21 ? 626  MET A CG  1 
ATOM   1286 S SD  . MET A 1 185 ? 63.056 -43.945 -7.279  1.00 114.14 ? 626  MET A SD  1 
ATOM   1287 C CE  . MET A 1 185 ? 61.505 -44.059 -6.372  1.00 108.65 ? 626  MET A CE  1 
ATOM   1288 N N   . GLN A 1 186 ? 65.510 -45.205 -11.504 1.00 109.32 ? 627  GLN A N   1 
ATOM   1289 C CA  . GLN A 1 186 ? 66.550 -44.721 -12.403 1.00 116.83 ? 627  GLN A CA  1 
ATOM   1290 C C   . GLN A 1 186 ? 66.777 -43.215 -12.223 1.00 122.59 ? 627  GLN A C   1 
ATOM   1291 O O   . GLN A 1 186 ? 67.861 -42.787 -11.804 1.00 129.67 ? 627  GLN A O   1 
ATOM   1292 C CB  . GLN A 1 186 ? 66.225 -45.054 -13.874 1.00 115.18 ? 627  GLN A CB  1 
ATOM   1293 C CG  . GLN A 1 186 ? 65.839 -46.509 -14.131 1.00 111.90 ? 627  GLN A CG  1 
ATOM   1294 C CD  . GLN A 1 186 ? 66.098 -46.964 -15.562 1.00 113.27 ? 627  GLN A CD  1 
ATOM   1295 O OE1 . GLN A 1 186 ? 66.673 -46.233 -16.372 1.00 117.04 ? 627  GLN A OE1 1 
ATOM   1296 N NE2 . GLN A 1 186 ? 65.682 -48.187 -15.874 1.00 110.48 ? 627  GLN A NE2 1 
ATOM   1297 N N   . ASP A 1 187 ? 65.753 -42.422 -12.542 1.00 120.73 ? 628  ASP A N   1 
ATOM   1298 C CA  . ASP A 1 187 ? 65.823 -40.965 -12.433 1.00 126.42 ? 628  ASP A CA  1 
ATOM   1299 C C   . ASP A 1 187 ? 65.719 -40.544 -10.955 1.00 124.74 ? 628  ASP A C   1 
ATOM   1300 O O   . ASP A 1 187 ? 64.946 -41.135 -10.201 1.00 121.15 ? 628  ASP A O   1 
ATOM   1301 C CB  . ASP A 1 187 ? 64.696 -40.327 -13.278 1.00 124.17 ? 628  ASP A CB  1 
ATOM   1302 C CG  . ASP A 1 187 ? 65.144 -39.066 -14.028 1.00 129.93 ? 628  ASP A CG  1 
ATOM   1303 O OD1 . ASP A 1 187 ? 66.358 -38.903 -14.309 1.00 133.16 ? 628  ASP A OD1 1 
ATOM   1304 O OD2 . ASP A 1 187 ? 64.262 -38.242 -14.355 1.00 127.88 ? 628  ASP A OD2 1 
ATOM   1305 N N   . LYS A 1 188 ? 66.504 -39.545 -10.544 1.00 127.16 ? 629  LYS A N   1 
ATOM   1306 C CA  . LYS A 1 188 ? 66.453 -39.021 -9.165  1.00 128.30 ? 629  LYS A CA  1 
ATOM   1307 C C   . LYS A 1 188 ? 65.072 -38.475 -8.800  1.00 119.60 ? 629  LYS A C   1 
ATOM   1308 O O   . LYS A 1 188 ? 64.654 -38.586 -7.647  1.00 116.98 ? 629  LYS A O   1 
ATOM   1309 C CB  . LYS A 1 188 ? 67.525 -37.934 -8.938  1.00 138.80 ? 629  LYS A CB  1 
ATOM   1310 C CG  . LYS A 1 188 ? 67.299 -37.015 -7.728  1.00 143.80 ? 629  LYS A CG  1 
ATOM   1311 C CD  . LYS A 1 188 ? 67.387 -37.739 -6.385  1.00 145.73 ? 629  LYS A CD  1 
ATOM   1312 C CE  . LYS A 1 188 ? 66.907 -36.865 -5.229  1.00 146.66 ? 629  LYS A CE  1 
ATOM   1313 N NZ  . LYS A 1 188 ? 67.575 -37.214 -3.939  1.00 151.57 ? 629  LYS A NZ  1 
ATOM   1314 N N   . ASN A 1 189 ? 64.386 -37.869 -9.770  1.00 114.63 ? 630  ASN A N   1 
ATOM   1315 C CA  . ASN A 1 189 ? 63.014 -37.389 -9.575  1.00 107.83 ? 630  ASN A CA  1 
ATOM   1316 C C   . ASN A 1 189 ? 62.103 -37.843 -10.723 1.00 99.75  ? 630  ASN A C   1 
ATOM   1317 O O   . ASN A 1 189 ? 61.987 -37.162 -11.742 1.00 98.77  ? 630  ASN A O   1 
ATOM   1318 C CB  . ASN A 1 189 ? 62.981 -35.860 -9.412  1.00 111.41 ? 630  ASN A CB  1 
ATOM   1319 C CG  . ASN A 1 189 ? 61.732 -35.370 -8.688  1.00 109.19 ? 630  ASN A CG  1 
ATOM   1320 O OD1 . ASN A 1 189 ? 60.767 -36.113 -8.488  1.00 104.01 ? 630  ASN A OD1 1 
ATOM   1321 N ND2 . ASN A 1 189 ? 61.749 -34.107 -8.289  1.00 113.45 ? 630  ASN A ND2 1 
ATOM   1322 N N   . PRO A 1 190 ? 61.467 -39.017 -10.563 1.00 93.17  ? 631  PRO A N   1 
ATOM   1323 C CA  . PRO A 1 190 ? 60.515 -39.567 -11.534 1.00 88.04  ? 631  PRO A CA  1 
ATOM   1324 C C   . PRO A 1 190 ? 59.081 -39.063 -11.343 1.00 83.30  ? 631  PRO A C   1 
ATOM   1325 O O   . PRO A 1 190 ? 58.206 -39.334 -12.189 1.00 81.88  ? 631  PRO A O   1 
ATOM   1326 C CB  . PRO A 1 190 ? 60.571 -41.060 -11.242 1.00 86.37  ? 631  PRO A CB  1 
ATOM   1327 C CG  . PRO A 1 190 ? 60.835 -41.127 -9.776  1.00 87.14  ? 631  PRO A CG  1 
ATOM   1328 C CD  . PRO A 1 190 ? 61.689 -39.943 -9.435  1.00 91.08  ? 631  PRO A CD  1 
ATOM   1329 N N   . TYR A 1 191 ? 58.852 -38.352 -10.236 1.00 81.03  ? 632  TYR A N   1 
ATOM   1330 C CA  . TYR A 1 191 ? 57.539 -37.824 -9.890  1.00 75.41  ? 632  TYR A CA  1 
ATOM   1331 C C   . TYR A 1 191 ? 57.230 -36.608 -10.736 1.00 76.56  ? 632  TYR A C   1 
ATOM   1332 O O   . TYR A 1 191 ? 58.098 -35.788 -11.013 1.00 81.39  ? 632  TYR A O   1 
ATOM   1333 C CB  . TYR A 1 191 ? 57.471 -37.458 -8.408  1.00 75.52  ? 632  TYR A CB  1 
ATOM   1334 C CG  . TYR A 1 191 ? 57.531 -38.661 -7.497  1.00 73.91  ? 632  TYR A CG  1 
ATOM   1335 C CD1 . TYR A 1 191 ? 58.677 -38.949 -6.755  1.00 76.04  ? 632  TYR A CD1 1 
ATOM   1336 C CD2 . TYR A 1 191 ? 56.444 -39.525 -7.388  1.00 70.09  ? 632  TYR A CD2 1 
ATOM   1337 C CE1 . TYR A 1 191 ? 58.733 -40.060 -5.927  1.00 74.60  ? 632  TYR A CE1 1 
ATOM   1338 C CE2 . TYR A 1 191 ? 56.490 -40.636 -6.561  1.00 68.15  ? 632  TYR A CE2 1 
ATOM   1339 C CZ  . TYR A 1 191 ? 57.636 -40.901 -5.836  1.00 71.15  ? 632  TYR A CZ  1 
ATOM   1340 O OH  . TYR A 1 191 ? 57.672 -42.007 -5.018  1.00 70.88  ? 632  TYR A OH  1 
ATOM   1341 N N   . SER A 1 192 ? 55.972 -36.502 -11.127 1.00 73.48  ? 633  SER A N   1 
ATOM   1342 C CA  . SER A 1 192 ? 55.518 -35.511 -12.081 1.00 74.26  ? 633  SER A CA  1 
ATOM   1343 C C   . SER A 1 192 ? 54.016 -35.357 -11.870 1.00 71.82  ? 633  SER A C   1 
ATOM   1344 O O   . SER A 1 192 ? 53.416 -36.125 -11.120 1.00 70.07  ? 633  SER A O   1 
ATOM   1345 C CB  . SER A 1 192 ? 55.836 -35.995 -13.500 1.00 74.81  ? 633  SER A CB  1 
ATOM   1346 O OG  . SER A 1 192 ? 55.892 -37.421 -13.572 1.00 73.36  ? 633  SER A OG  1 
ATOM   1347 N N   . PHE A 1 193 ? 53.389 -34.376 -12.502 1.00 72.20  ? 634  PHE A N   1 
ATOM   1348 C CA  . PHE A 1 193 ? 51.934 -34.339 -12.466 1.00 68.41  ? 634  PHE A CA  1 
ATOM   1349 C C   . PHE A 1 193 ? 51.403 -35.644 -13.051 1.00 66.16  ? 634  PHE A C   1 
ATOM   1350 O O   . PHE A 1 193 ? 50.393 -36.174 -12.587 1.00 64.33  ? 634  PHE A O   1 
ATOM   1351 C CB  . PHE A 1 193 ? 51.375 -33.157 -13.245 1.00 69.78  ? 634  PHE A CB  1 
ATOM   1352 C CG  . PHE A 1 193 ? 51.743 -31.817 -12.675 1.00 72.89  ? 634  PHE A CG  1 
ATOM   1353 C CD1 . PHE A 1 193 ? 52.083 -30.771 -13.515 1.00 75.83  ? 634  PHE A CD1 1 
ATOM   1354 C CD2 . PHE A 1 193 ? 51.744 -31.592 -11.303 1.00 73.16  ? 634  PHE A CD2 1 
ATOM   1355 C CE1 . PHE A 1 193 ? 52.416 -29.534 -13.004 1.00 79.18  ? 634  PHE A CE1 1 
ATOM   1356 C CE2 . PHE A 1 193 ? 52.072 -30.349 -10.788 1.00 75.26  ? 634  PHE A CE2 1 
ATOM   1357 C CZ  . PHE A 1 193 ? 52.411 -29.321 -11.641 1.00 78.36  ? 634  PHE A CZ  1 
ATOM   1358 N N   . GLN A 1 194 ? 52.104 -36.176 -14.047 1.00 65.85  ? 635  GLN A N   1 
ATOM   1359 C CA  . GLN A 1 194 ? 51.669 -37.399 -14.691 1.00 65.05  ? 635  GLN A CA  1 
ATOM   1360 C C   . GLN A 1 194 ? 51.782 -38.649 -13.819 1.00 63.19  ? 635  GLN A C   1 
ATOM   1361 O O   . GLN A 1 194 ? 51.074 -39.626 -14.063 1.00 60.47  ? 635  GLN A O   1 
ATOM   1362 C CB  . GLN A 1 194 ? 52.429 -37.621 -15.989 1.00 68.12  ? 635  GLN A CB  1 
ATOM   1363 C CG  . GLN A 1 194 ? 52.099 -36.604 -17.063 1.00 71.69  ? 635  GLN A CG  1 
ATOM   1364 C CD  . GLN A 1 194 ? 53.135 -35.516 -17.195 1.00 76.24  ? 635  GLN A CD  1 
ATOM   1365 O OE1 . GLN A 1 194 ? 53.950 -35.290 -16.303 1.00 78.90  ? 635  GLN A OE1 1 
ATOM   1366 N NE2 . GLN A 1 194 ? 53.110 -34.834 -18.324 1.00 81.14  ? 635  GLN A NE2 1 
ATOM   1367 N N   . SER A 1 195 ? 52.664 -38.646 -12.822 1.00 63.49  ? 636  SER A N   1 
ATOM   1368 C CA  . SER A 1 195 ? 52.724 -39.788 -11.915 1.00 60.70  ? 636  SER A CA  1 
ATOM   1369 C C   . SER A 1 195 ? 51.455 -39.803 -11.059 1.00 60.43  ? 636  SER A C   1 
ATOM   1370 O O   . SER A 1 195 ? 50.816 -40.850 -10.902 1.00 61.22  ? 636  SER A O   1 
ATOM   1371 C CB  . SER A 1 195 ? 53.997 -39.789 -11.072 1.00 61.41  ? 636  SER A CB  1 
ATOM   1372 O OG  . SER A 1 195 ? 54.027 -38.710 -10.173 1.00 64.65  ? 636  SER A OG  1 
ATOM   1373 N N   . ASP A 1 196 ? 51.072 -38.637 -10.542 1.00 62.29  ? 637  ASP A N   1 
ATOM   1374 C CA  . ASP A 1 196 ? 49.817 -38.489 -9.793  1.00 61.28  ? 637  ASP A CA  1 
ATOM   1375 C C   . ASP A 1 196 ? 48.604 -38.895 -10.637 1.00 61.37  ? 637  ASP A C   1 
ATOM   1376 O O   . ASP A 1 196 ? 47.632 -39.459 -10.118 1.00 59.01  ? 637  ASP A O   1 
ATOM   1377 C CB  . ASP A 1 196 ? 49.629 -37.040 -9.322  1.00 63.09  ? 637  ASP A CB  1 
ATOM   1378 C CG  . ASP A 1 196 ? 50.418 -36.711 -8.060  1.00 64.99  ? 637  ASP A CG  1 
ATOM   1379 O OD1 . ASP A 1 196 ? 51.214 -37.558 -7.578  1.00 67.26  ? 637  ASP A OD1 1 
ATOM   1380 O OD2 . ASP A 1 196 ? 50.230 -35.582 -7.556  1.00 64.06  ? 637  ASP A OD2 1 
ATOM   1381 N N   . VAL A 1 197 ? 48.652 -38.580 -11.932 1.00 63.21  ? 638  VAL A N   1 
ATOM   1382 C CA  . VAL A 1 197 ? 47.595 -38.981 -12.848 1.00 60.51  ? 638  VAL A CA  1 
ATOM   1383 C C   . VAL A 1 197 ? 47.527 -40.499 -12.867 1.00 60.05  ? 638  VAL A C   1 
ATOM   1384 O O   . VAL A 1 197 ? 46.444 -41.066 -12.747 1.00 61.77  ? 638  VAL A O   1 
ATOM   1385 C CB  . VAL A 1 197 ? 47.815 -38.434 -14.266 1.00 61.72  ? 638  VAL A CB  1 
ATOM   1386 C CG1 . VAL A 1 197 ? 46.911 -39.131 -15.267 1.00 62.82  ? 638  VAL A CG1 1 
ATOM   1387 C CG2 . VAL A 1 197 ? 47.552 -36.950 -14.288 1.00 64.54  ? 638  VAL A CG2 1 
ATOM   1388 N N   . TYR A 1 198 ? 48.675 -41.164 -12.992 1.00 59.59  ? 639  TYR A N   1 
ATOM   1389 C CA  . TYR A 1 198 ? 48.669 -42.619 -12.987 1.00 57.54  ? 639  TYR A CA  1 
ATOM   1390 C C   . TYR A 1 198 ? 48.034 -43.126 -11.698 1.00 54.92  ? 639  TYR A C   1 
ATOM   1391 O O   . TYR A 1 198 ? 47.156 -43.982 -11.742 1.00 53.19  ? 639  TYR A O   1 
ATOM   1392 C CB  . TYR A 1 198 ? 50.063 -43.209 -13.162 1.00 58.25  ? 639  TYR A CB  1 
ATOM   1393 C CG  . TYR A 1 198 ? 50.058 -44.725 -13.275 1.00 58.54  ? 639  TYR A CG  1 
ATOM   1394 C CD1 . TYR A 1 198 ? 50.046 -45.353 -14.516 1.00 57.84  ? 639  TYR A CD1 1 
ATOM   1395 C CD2 . TYR A 1 198 ? 50.056 -45.532 -12.135 1.00 58.20  ? 639  TYR A CD2 1 
ATOM   1396 C CE1 . TYR A 1 198 ? 50.045 -46.732 -14.619 1.00 56.58  ? 639  TYR A CE1 1 
ATOM   1397 C CE2 . TYR A 1 198 ? 50.053 -46.911 -12.231 1.00 56.93  ? 639  TYR A CE2 1 
ATOM   1398 C CZ  . TYR A 1 198 ? 50.050 -47.509 -13.474 1.00 56.53  ? 639  TYR A CZ  1 
ATOM   1399 O OH  . TYR A 1 198 ? 50.038 -48.886 -13.566 1.00 57.29  ? 639  TYR A OH  1 
ATOM   1400 N N   . ALA A 1 199 ? 48.457 -42.584 -10.560 1.00 55.10  ? 640  ALA A N   1 
ATOM   1401 C CA  . ALA A 1 199 ? 47.864 -42.968 -9.275  1.00 56.58  ? 640  ALA A CA  1 
ATOM   1402 C C   . ALA A 1 199 ? 46.343 -42.823 -9.331  1.00 57.00  ? 640  ALA A C   1 
ATOM   1403 O O   . ALA A 1 199 ? 45.607 -43.741 -8.943  1.00 54.94  ? 640  ALA A O   1 
ATOM   1404 C CB  . ALA A 1 199 ? 48.425 -42.119 -8.147  1.00 58.10  ? 640  ALA A CB  1 
ATOM   1405 N N   . PHE A 1 200 ? 45.898 -41.665 -9.820  1.00 56.59  ? 641  PHE A N   1 
ATOM   1406 C CA  . PHE A 1 200 ? 44.482 -41.371 -10.000 1.00 55.87  ? 641  PHE A CA  1 
ATOM   1407 C C   . PHE A 1 200 ? 43.825 -42.457 -10.834 1.00 56.49  ? 641  PHE A C   1 
ATOM   1408 O O   . PHE A 1 200 ? 42.730 -42.938 -10.507 1.00 57.84  ? 641  PHE A O   1 
ATOM   1409 C CB  . PHE A 1 200 ? 44.317 -40.006 -10.668 1.00 55.15  ? 641  PHE A CB  1 
ATOM   1410 C CG  . PHE A 1 200 ? 42.911 -39.663 -11.005 1.00 53.07  ? 641  PHE A CG  1 
ATOM   1411 C CD1 . PHE A 1 200 ? 42.053 -39.206 -10.035 1.00 53.54  ? 641  PHE A CD1 1 
ATOM   1412 C CD2 . PHE A 1 200 ? 42.451 -39.784 -12.291 1.00 56.28  ? 641  PHE A CD2 1 
ATOM   1413 C CE1 . PHE A 1 200 ? 40.749 -38.875 -10.333 1.00 55.29  ? 641  PHE A CE1 1 
ATOM   1414 C CE2 . PHE A 1 200 ? 41.140 -39.448 -12.610 1.00 59.48  ? 641  PHE A CE2 1 
ATOM   1415 C CZ  . PHE A 1 200 ? 40.288 -38.990 -11.628 1.00 57.96  ? 641  PHE A CZ  1 
ATOM   1416 N N   . GLY A 1 201 ? 44.513 -42.863 -11.894 1.00 55.84  ? 642  GLY A N   1 
ATOM   1417 C CA  . GLY A 1 201 ? 44.027 -43.932 -12.767 1.00 56.18  ? 642  GLY A CA  1 
ATOM   1418 C C   . GLY A 1 201 ? 43.810 -45.257 -12.065 1.00 54.09  ? 642  GLY A C   1 
ATOM   1419 O O   . GLY A 1 201 ? 42.916 -46.007 -12.420 1.00 56.23  ? 642  GLY A O   1 
ATOM   1420 N N   . ILE A 1 202 ? 44.631 -45.557 -11.068 1.00 53.24  ? 643  ILE A N   1 
ATOM   1421 C CA  . ILE A 1 202 ? 44.436 -46.765 -10.286 1.00 52.91  ? 643  ILE A CA  1 
ATOM   1422 C C   . ILE A 1 202 ? 43.258 -46.582 -9.334  1.00 55.68  ? 643  ILE A C   1 
ATOM   1423 O O   . ILE A 1 202 ? 42.563 -47.540 -9.031  1.00 58.49  ? 643  ILE A O   1 
ATOM   1424 C CB  . ILE A 1 202 ? 45.702 -47.155 -9.497  1.00 53.96  ? 643  ILE A CB  1 
ATOM   1425 C CG1 . ILE A 1 202 ? 46.876 -47.447 -10.449 1.00 52.14  ? 643  ILE A CG1 1 
ATOM   1426 C CG2 . ILE A 1 202 ? 45.432 -48.359 -8.600  1.00 55.51  ? 643  ILE A CG2 1 
ATOM   1427 C CD1 . ILE A 1 202 ? 46.696 -48.671 -11.312 1.00 52.58  ? 643  ILE A CD1 1 
ATOM   1428 N N   . VAL A 1 203 ? 43.014 -45.359 -8.864  1.00 57.80  ? 644  VAL A N   1 
ATOM   1429 C CA  . VAL A 1 203 ? 41.845 -45.118 -8.026  1.00 55.92  ? 644  VAL A CA  1 
ATOM   1430 C C   . VAL A 1 203 ? 40.594 -45.330 -8.856  1.00 56.61  ? 644  VAL A C   1 
ATOM   1431 O O   . VAL A 1 203 ? 39.697 -46.050 -8.422  1.00 60.33  ? 644  VAL A O   1 
ATOM   1432 C CB  . VAL A 1 203 ? 41.829 -43.722 -7.390  1.00 58.01  ? 644  VAL A CB  1 
ATOM   1433 C CG1 . VAL A 1 203 ? 40.519 -43.486 -6.645  1.00 58.96  ? 644  VAL A CG1 1 
ATOM   1434 C CG2 . VAL A 1 203 ? 43.000 -43.577 -6.436  1.00 60.82  ? 644  VAL A CG2 1 
ATOM   1435 N N   . LEU A 1 204 ? 40.530 -44.739 -10.048 1.00 53.45  ? 645  LEU A N   1 
ATOM   1436 C CA  . LEU A 1 204 ? 39.395 -45.001 -10.928 1.00 55.24  ? 645  LEU A CA  1 
ATOM   1437 C C   . LEU A 1 204 ? 39.156 -46.506 -11.066 1.00 55.67  ? 645  LEU A C   1 
ATOM   1438 O O   . LEU A 1 204 ? 38.015 -46.964 -11.077 1.00 58.36  ? 645  LEU A O   1 
ATOM   1439 C CB  . LEU A 1 204 ? 39.604 -44.403 -12.318 1.00 56.86  ? 645  LEU A CB  1 
ATOM   1440 C CG  . LEU A 1 204 ? 39.604 -42.883 -12.478 1.00 58.85  ? 645  LEU A CG  1 
ATOM   1441 C CD1 . LEU A 1 204 ? 39.413 -42.518 -13.937 1.00 61.89  ? 645  LEU A CD1 1 
ATOM   1442 C CD2 . LEU A 1 204 ? 38.527 -42.214 -11.648 1.00 60.85  ? 645  LEU A CD2 1 
ATOM   1443 N N   . TYR A 1 205 ? 40.232 -47.274 -11.173 1.00 54.16  ? 646  TYR A N   1 
ATOM   1444 C CA  . TYR A 1 205 ? 40.113 -48.722 -11.295 1.00 56.22  ? 646  TYR A CA  1 
ATOM   1445 C C   . TYR A 1 205 ? 39.438 -49.303 -10.054 1.00 56.98  ? 646  TYR A C   1 
ATOM   1446 O O   . TYR A 1 205 ? 38.529 -50.122 -10.157 1.00 57.73  ? 646  TYR A O   1 
ATOM   1447 C CB  . TYR A 1 205 ? 41.485 -49.351 -11.518 1.00 55.21  ? 646  TYR A CB  1 
ATOM   1448 C CG  . TYR A 1 205 ? 41.463 -50.842 -11.697 1.00 57.45  ? 646  TYR A CG  1 
ATOM   1449 C CD1 . TYR A 1 205 ? 41.388 -51.414 -12.967 1.00 60.27  ? 646  TYR A CD1 1 
ATOM   1450 C CD2 . TYR A 1 205 ? 41.536 -51.692 -10.599 1.00 60.18  ? 646  TYR A CD2 1 
ATOM   1451 C CE1 . TYR A 1 205 ? 41.377 -52.793 -13.137 1.00 61.26  ? 646  TYR A CE1 1 
ATOM   1452 C CE2 . TYR A 1 205 ? 41.522 -53.075 -10.754 1.00 62.45  ? 646  TYR A CE2 1 
ATOM   1453 C CZ  . TYR A 1 205 ? 41.444 -53.623 -12.024 1.00 62.65  ? 646  TYR A CZ  1 
ATOM   1454 O OH  . TYR A 1 205 ? 41.437 -54.996 -12.164 1.00 64.27  ? 646  TYR A OH  1 
ATOM   1455 N N   . GLU A 1 206 ? 39.870 -48.863 -8.881  1.00 57.34  ? 647  GLU A N   1 
ATOM   1456 C CA  . GLU A 1 206 ? 39.237 -49.305 -7.645  1.00 60.15  ? 647  GLU A CA  1 
ATOM   1457 C C   . GLU A 1 206 ? 37.757 -48.924 -7.612  1.00 59.19  ? 647  GLU A C   1 
ATOM   1458 O O   . GLU A 1 206 ? 36.935 -49.716 -7.187  1.00 61.63  ? 647  GLU A O   1 
ATOM   1459 C CB  . GLU A 1 206 ? 39.928 -48.707 -6.422  1.00 62.10  ? 647  GLU A CB  1 
ATOM   1460 C CG  . GLU A 1 206 ? 41.385 -49.093 -6.232  1.00 63.44  ? 647  GLU A CG  1 
ATOM   1461 C CD  . GLU A 1 206 ? 42.012 -48.371 -5.049  1.00 64.70  ? 647  GLU A CD  1 
ATOM   1462 O OE1 . GLU A 1 206 ? 41.855 -48.865 -3.903  1.00 66.62  ? 647  GLU A OE1 1 
ATOM   1463 O OE2 . GLU A 1 206 ? 42.653 -47.312 -5.261  1.00 62.34  ? 647  GLU A OE2 1 
ATOM   1464 N N   . LEU A 1 207 ? 37.422 -47.712 -8.046  1.00 57.48  ? 648  LEU A N   1 
ATOM   1465 C CA  . LEU A 1 207 ? 36.027 -47.266 -8.058  1.00 56.91  ? 648  LEU A CA  1 
ATOM   1466 C C   . LEU A 1 207 ? 35.169 -48.106 -9.005  1.00 58.45  ? 648  LEU A C   1 
ATOM   1467 O O   . LEU A 1 207 ? 34.121 -48.600 -8.615  1.00 61.52  ? 648  LEU A O   1 
ATOM   1468 C CB  . LEU A 1 207 ? 35.926 -45.796 -8.453  1.00 55.37  ? 648  LEU A CB  1 
ATOM   1469 C CG  . LEU A 1 207 ? 36.390 -44.743 -7.442  1.00 56.40  ? 648  LEU A CG  1 
ATOM   1470 C CD1 . LEU A 1 207 ? 36.255 -43.346 -8.029  1.00 58.58  ? 648  LEU A CD1 1 
ATOM   1471 C CD2 . LEU A 1 207 ? 35.613 -44.814 -6.144  1.00 57.77  ? 648  LEU A CD2 1 
ATOM   1472 N N   . MET A 1 208 ? 35.624 -48.282 -10.239 1.00 59.12  ? 649  MET A N   1 
ATOM   1473 C CA  . MET A 1 208 ? 34.829 -48.972 -11.265 1.00 62.27  ? 649  MET A CA  1 
ATOM   1474 C C   . MET A 1 208 ? 34.783 -50.519 -11.140 1.00 61.50  ? 649  MET A C   1 
ATOM   1475 O O   . MET A 1 208 ? 33.849 -51.133 -11.639 1.00 63.57  ? 649  MET A O   1 
ATOM   1476 C CB  . MET A 1 208 ? 35.329 -48.591 -12.676 1.00 64.23  ? 649  MET A CB  1 
ATOM   1477 C CG  . MET A 1 208 ? 35.417 -47.097 -13.005 1.00 65.33  ? 649  MET A CG  1 
ATOM   1478 S SD  . MET A 1 208 ? 34.184 -45.969 -12.285 1.00 70.19  ? 649  MET A SD  1 
ATOM   1479 C CE  . MET A 1 208 ? 32.691 -46.600 -13.022 1.00 74.34  ? 649  MET A CE  1 
ATOM   1480 N N   . THR A 1 209 ? 35.787 -51.144 -10.514 1.00 56.92  ? 650  THR A N   1 
ATOM   1481 C CA  . THR A 1 209 ? 35.807 -52.600 -10.323 1.00 56.63  ? 650  THR A CA  1 
ATOM   1482 C C   . THR A 1 209 ? 35.480 -53.036 -8.897  1.00 59.46  ? 650  THR A C   1 
ATOM   1483 O O   . THR A 1 209 ? 35.161 -54.202 -8.668  1.00 63.92  ? 650  THR A O   1 
ATOM   1484 C CB  . THR A 1 209 ? 37.180 -53.225 -10.671 1.00 54.23  ? 650  THR A CB  1 
ATOM   1485 O OG1 . THR A 1 209 ? 38.143 -52.903 -9.664  1.00 49.77  ? 650  THR A OG1 1 
ATOM   1486 C CG2 . THR A 1 209 ? 37.675 -52.753 -12.023 1.00 53.88  ? 650  THR A CG2 1 
ATOM   1487 N N   . GLY A 1 210 ? 35.582 -52.116 -7.942  1.00 57.59  ? 651  GLY A N   1 
ATOM   1488 C CA  . GLY A 1 210 ? 35.497 -52.450 -6.520  1.00 58.13  ? 651  GLY A CA  1 
ATOM   1489 C C   . GLY A 1 210 ? 36.623 -53.347 -6.011  1.00 58.84  ? 651  GLY A C   1 
ATOM   1490 O O   . GLY A 1 210 ? 36.432 -54.076 -5.039  1.00 63.23  ? 651  GLY A O   1 
ATOM   1491 N N   . GLN A 1 211 ? 37.790 -53.302 -6.657  1.00 58.28  ? 652  GLN A N   1 
ATOM   1492 C CA  . GLN A 1 211 ? 38.908 -54.197 -6.328  1.00 58.36  ? 652  GLN A CA  1 
ATOM   1493 C C   . GLN A 1 211 ? 40.269 -53.540 -6.521  1.00 58.54  ? 652  GLN A C   1 
ATOM   1494 O O   . GLN A 1 211 ? 40.399 -52.583 -7.286  1.00 61.06  ? 652  GLN A O   1 
ATOM   1495 C CB  . GLN A 1 211 ? 38.886 -55.424 -7.227  1.00 59.50  ? 652  GLN A CB  1 
ATOM   1496 C CG  . GLN A 1 211 ? 37.674 -56.320 -7.077  1.00 63.95  ? 652  GLN A CG  1 
ATOM   1497 C CD  . GLN A 1 211 ? 37.946 -57.715 -7.613  1.00 66.46  ? 652  GLN A CD  1 
ATOM   1498 O OE1 . GLN A 1 211 ? 38.843 -58.415 -7.129  1.00 68.29  ? 652  GLN A OE1 1 
ATOM   1499 N NE2 . GLN A 1 211 ? 37.189 -58.123 -8.622  1.00 67.28  ? 652  GLN A NE2 1 
ATOM   1500 N N   . LEU A 1 212 ? 41.283 -54.073 -5.836  1.00 57.03  ? 653  LEU A N   1 
ATOM   1501 C CA  . LEU A 1 212 ? 42.677 -53.677 -6.073  1.00 55.00  ? 653  LEU A CA  1 
ATOM   1502 C C   . LEU A 1 212 ? 43.190 -54.390 -7.315  1.00 53.50  ? 653  LEU A C   1 
ATOM   1503 O O   . LEU A 1 212 ? 42.795 -55.524 -7.571  1.00 55.86  ? 653  LEU A O   1 
ATOM   1504 C CB  . LEU A 1 212 ? 43.568 -54.080 -4.905  1.00 53.66  ? 653  LEU A CB  1 
ATOM   1505 C CG  . LEU A 1 212 ? 43.213 -53.549 -3.536  1.00 53.99  ? 653  LEU A CG  1 
ATOM   1506 C CD1 . LEU A 1 212 ? 44.005 -54.289 -2.477  1.00 54.57  ? 653  LEU A CD1 1 
ATOM   1507 C CD2 . LEU A 1 212 ? 43.510 -52.064 -3.508  1.00 57.56  ? 653  LEU A CD2 1 
ATOM   1508 N N   . PRO A 1 213 ? 44.099 -53.751 -8.068  1.00 52.27  ? 654  PRO A N   1 
ATOM   1509 C CA  . PRO A 1 213 ? 44.624 -54.406 -9.257  1.00 52.99  ? 654  PRO A CA  1 
ATOM   1510 C C   . PRO A 1 213 ? 45.583 -55.532 -8.889  1.00 54.05  ? 654  PRO A C   1 
ATOM   1511 O O   . PRO A 1 213 ? 46.066 -55.579 -7.749  1.00 53.43  ? 654  PRO A O   1 
ATOM   1512 C CB  . PRO A 1 213 ? 45.375 -53.285 -9.956  1.00 52.94  ? 654  PRO A CB  1 
ATOM   1513 C CG  . PRO A 1 213 ? 45.887 -52.445 -8.825  1.00 52.34  ? 654  PRO A CG  1 
ATOM   1514 C CD  . PRO A 1 213 ? 44.809 -52.490 -7.778  1.00 52.41  ? 654  PRO A CD  1 
ATOM   1515 N N   . TYR A 1 214 ? 45.827 -56.433 -9.844  1.00 54.15  ? 655  TYR A N   1 
ATOM   1516 C CA  . TYR A 1 214 ? 46.812 -57.516 -9.689  1.00 54.24  ? 655  TYR A CA  1 
ATOM   1517 C C   . TYR A 1 214 ? 46.473 -58.429 -8.523  1.00 54.47  ? 655  TYR A C   1 
ATOM   1518 O O   . TYR A 1 214 ? 47.344 -58.854 -7.754  1.00 55.52  ? 655  TYR A O   1 
ATOM   1519 C CB  . TYR A 1 214 ? 48.221 -56.945 -9.521  1.00 54.37  ? 655  TYR A CB  1 
ATOM   1520 C CG  . TYR A 1 214 ? 48.496 -55.748 -10.393 1.00 54.07  ? 655  TYR A CG  1 
ATOM   1521 C CD1 . TYR A 1 214 ? 48.073 -55.716 -11.719 1.00 55.70  ? 655  TYR A CD1 1 
ATOM   1522 C CD2 . TYR A 1 214 ? 49.186 -54.655 -9.897  1.00 52.84  ? 655  TYR A CD2 1 
ATOM   1523 C CE1 . TYR A 1 214 ? 48.315 -54.617 -12.516 1.00 57.98  ? 655  TYR A CE1 1 
ATOM   1524 C CE2 . TYR A 1 214 ? 49.447 -53.561 -10.690 1.00 54.92  ? 655  TYR A CE2 1 
ATOM   1525 C CZ  . TYR A 1 214 ? 49.005 -53.546 -11.993 1.00 58.41  ? 655  TYR A CZ  1 
ATOM   1526 O OH  . TYR A 1 214 ? 49.254 -52.450 -12.773 1.00 65.59  ? 655  TYR A OH  1 
ATOM   1527 N N   . SER A 1 215 ? 45.187 -58.730 -8.412  1.00 57.82  ? 656  SER A N   1 
ATOM   1528 C CA  . SER A 1 215 ? 44.661 -59.544 -7.327  1.00 60.07  ? 656  SER A CA  1 
ATOM   1529 C C   . SER A 1 215 ? 44.999 -61.020 -7.511  1.00 59.65  ? 656  SER A C   1 
ATOM   1530 O O   . SER A 1 215 ? 44.957 -61.773 -6.543  1.00 61.44  ? 656  SER A O   1 
ATOM   1531 C CB  . SER A 1 215 ? 43.143 -59.356 -7.216  1.00 61.91  ? 656  SER A CB  1 
ATOM   1532 O OG  . SER A 1 215 ? 42.501 -59.615 -8.454  1.00 62.05  ? 656  SER A OG  1 
ATOM   1533 N N   . ASN A 1 216 ? 45.344 -61.430 -8.734  1.00 57.76  ? 657  ASN A N   1 
ATOM   1534 C CA  . ASN A 1 216 ? 45.721 -62.828 -8.994  1.00 60.30  ? 657  ASN A CA  1 
ATOM   1535 C C   . ASN A 1 216 ? 47.214 -63.133 -8.774  1.00 60.37  ? 657  ASN A C   1 
ATOM   1536 O O   . ASN A 1 216 ? 47.683 -64.247 -9.063  1.00 60.39  ? 657  ASN A O   1 
ATOM   1537 C CB  . ASN A 1 216 ? 45.286 -63.261 -10.398 1.00 60.84  ? 657  ASN A CB  1 
ATOM   1538 C CG  . ASN A 1 216 ? 45.804 -62.349 -11.489 1.00 63.23  ? 657  ASN A CG  1 
ATOM   1539 O OD1 . ASN A 1 216 ? 46.369 -61.289 -11.217 1.00 64.40  ? 657  ASN A OD1 1 
ATOM   1540 N ND2 . ASN A 1 216 ? 45.608 -62.758 -12.744 1.00 66.84  ? 657  ASN A ND2 1 
ATOM   1541 N N   . ILE A 1 217 ? 47.948 -62.151 -8.250  1.00 57.22  ? 658  ILE A N   1 
ATOM   1542 C CA  . ILE A 1 217 ? 49.378 -62.289 -8.027  1.00 55.75  ? 658  ILE A CA  1 
ATOM   1543 C C   . ILE A 1 217 ? 49.688 -61.981 -6.579  1.00 55.18  ? 658  ILE A C   1 
ATOM   1544 O O   . ILE A 1 217 ? 49.338 -60.908 -6.091  1.00 56.90  ? 658  ILE A O   1 
ATOM   1545 C CB  . ILE A 1 217 ? 50.164 -61.336 -8.928  1.00 53.97  ? 658  ILE A CB  1 
ATOM   1546 C CG1 . ILE A 1 217 ? 49.936 -61.725 -10.388 1.00 54.74  ? 658  ILE A CG1 1 
ATOM   1547 C CG2 . ILE A 1 217 ? 51.642 -61.353 -8.556  1.00 53.53  ? 658  ILE A CG2 1 
ATOM   1548 C CD1 . ILE A 1 217 ? 50.464 -60.715 -11.377 1.00 56.38  ? 658  ILE A CD1 1 
ATOM   1549 N N   . ASN A 1 218 ? 50.354 -62.917 -5.910  1.00 54.69  ? 659  ASN A N   1 
ATOM   1550 C CA  . ASN A 1 218 ? 50.606 -62.817 -4.481  1.00 56.52  ? 659  ASN A CA  1 
ATOM   1551 C C   . ASN A 1 218 ? 52.070 -62.531 -4.164  1.00 59.16  ? 659  ASN A C   1 
ATOM   1552 O O   . ASN A 1 218 ? 52.530 -62.793 -3.061  1.00 64.45  ? 659  ASN A O   1 
ATOM   1553 C CB  . ASN A 1 218 ? 50.178 -64.110 -3.796  1.00 57.41  ? 659  ASN A CB  1 
ATOM   1554 C CG  . ASN A 1 218 ? 50.976 -65.301 -4.270  1.00 59.29  ? 659  ASN A CG  1 
ATOM   1555 O OD1 . ASN A 1 218 ? 52.140 -65.161 -4.657  1.00 60.16  ? 659  ASN A OD1 1 
ATOM   1556 N ND2 . ASN A 1 218 ? 50.352 -66.478 -4.271  1.00 60.38  ? 659  ASN A ND2 1 
ATOM   1557 N N   . ASN A 1 219 ? 52.801 -61.999 -5.131  1.00 59.13  ? 660  ASN A N   1 
ATOM   1558 C CA  . ASN A 1 219 ? 54.221 -61.753 -4.965  1.00 58.46  ? 660  ASN A CA  1 
ATOM   1559 C C   . ASN A 1 219 ? 54.551 -60.323 -5.323  1.00 56.64  ? 660  ASN A C   1 
ATOM   1560 O O   . ASN A 1 219 ? 54.417 -59.920 -6.479  1.00 56.03  ? 660  ASN A O   1 
ATOM   1561 C CB  . ASN A 1 219 ? 55.037 -62.701 -5.842  1.00 59.50  ? 660  ASN A CB  1 
ATOM   1562 C CG  . ASN A 1 219 ? 56.523 -62.631 -5.542  1.00 60.35  ? 660  ASN A CG  1 
ATOM   1563 O OD1 . ASN A 1 219 ? 57.209 -61.688 -5.932  1.00 61.98  ? 660  ASN A OD1 1 
ATOM   1564 N ND2 . ASN A 1 219 ? 57.026 -63.629 -4.843  1.00 62.52  ? 660  ASN A ND2 1 
ATOM   1565 N N   . ARG A 1 220 ? 55.005 -59.575 -4.326  1.00 55.86  ? 661  ARG A N   1 
ATOM   1566 C CA  . ARG A 1 220 ? 55.328 -58.165 -4.485  1.00 55.26  ? 661  ARG A CA  1 
ATOM   1567 C C   . ARG A 1 220 ? 56.486 -57.923 -5.459  1.00 55.25  ? 661  ARG A C   1 
ATOM   1568 O O   . ARG A 1 220 ? 56.460 -56.996 -6.263  1.00 52.95  ? 661  ARG A O   1 
ATOM   1569 C CB  . ARG A 1 220 ? 55.680 -57.606 -3.119  1.00 58.31  ? 661  ARG A CB  1 
ATOM   1570 C CG  . ARG A 1 220 ? 55.868 -56.104 -3.041  1.00 60.84  ? 661  ARG A CG  1 
ATOM   1571 C CD  . ARG A 1 220 ? 56.208 -55.731 -1.607  1.00 65.72  ? 661  ARG A CD  1 
ATOM   1572 N NE  . ARG A 1 220 ? 57.102 -54.579 -1.483  1.00 66.03  ? 661  ARG A NE  1 
ATOM   1573 C CZ  . ARG A 1 220 ? 56.704 -53.312 -1.482  1.00 66.87  ? 661  ARG A CZ  1 
ATOM   1574 N NH1 . ARG A 1 220 ? 55.417 -53.003 -1.619  1.00 70.94  ? 661  ARG A NH1 1 
ATOM   1575 N NH2 . ARG A 1 220 ? 57.598 -52.344 -1.354  1.00 66.49  ? 661  ARG A NH2 1 
ATOM   1576 N N   . ASP A 1 221 ? 57.515 -58.747 -5.386  1.00 58.43  ? 662  ASP A N   1 
ATOM   1577 C CA  . ASP A 1 221 ? 58.667 -58.535 -6.246  1.00 62.00  ? 662  ASP A CA  1 
ATOM   1578 C C   . ASP A 1 221 ? 58.320 -58.655 -7.715  1.00 60.96  ? 662  ASP A C   1 
ATOM   1579 O O   . ASP A 1 221 ? 58.804 -57.880 -8.537  1.00 62.59  ? 662  ASP A O   1 
ATOM   1580 C CB  . ASP A 1 221 ? 59.778 -59.515 -5.910  1.00 66.34  ? 662  ASP A CB  1 
ATOM   1581 C CG  . ASP A 1 221 ? 60.641 -59.033 -4.776  1.00 72.41  ? 662  ASP A CG  1 
ATOM   1582 O OD1 . ASP A 1 221 ? 60.258 -58.041 -4.103  1.00 73.05  ? 662  ASP A OD1 1 
ATOM   1583 O OD2 . ASP A 1 221 ? 61.715 -59.648 -4.569  1.00 78.84  ? 662  ASP A OD2 1 
ATOM   1584 N N   . GLN A 1 222 ? 57.497 -59.638 -8.046  1.00 57.48  ? 663  GLN A N   1 
ATOM   1585 C CA  . GLN A 1 222 ? 57.136 -59.849 -9.416  1.00 57.78  ? 663  GLN A CA  1 
ATOM   1586 C C   . GLN A 1 222 ? 56.306 -58.685 -9.922  1.00 55.91  ? 663  GLN A C   1 
ATOM   1587 O O   . GLN A 1 222 ? 56.501 -58.204 -11.036 1.00 55.81  ? 663  GLN A O   1 
ATOM   1588 C CB  . GLN A 1 222 ? 56.358 -61.143 -9.555  1.00 62.04  ? 663  GLN A CB  1 
ATOM   1589 C CG  . GLN A 1 222 ? 57.227 -62.371 -9.381  1.00 66.81  ? 663  GLN A CG  1 
ATOM   1590 C CD  . GLN A 1 222 ? 58.333 -62.441 -10.411 1.00 69.21  ? 663  GLN A CD  1 
ATOM   1591 O OE1 . GLN A 1 222 ? 58.117 -62.176 -11.596 1.00 66.91  ? 663  GLN A OE1 1 
ATOM   1592 N NE2 . GLN A 1 222 ? 59.532 -62.785 -9.962  1.00 73.74  ? 663  GLN A NE2 1 
ATOM   1593 N N   . ILE A 1 223 ? 55.386 -58.213 -9.099  1.00 52.78  ? 664  ILE A N   1 
ATOM   1594 C CA  . ILE A 1 223 ? 54.535 -57.121 -9.516  1.00 50.86  ? 664  ILE A CA  1 
ATOM   1595 C C   . ILE A 1 223 ? 55.400 -55.913 -9.851  1.00 51.12  ? 664  ILE A C   1 
ATOM   1596 O O   . ILE A 1 223 ? 55.124 -55.194 -10.809 1.00 49.92  ? 664  ILE A O   1 
ATOM   1597 C CB  . ILE A 1 223 ? 53.513 -56.767 -8.430  1.00 50.95  ? 664  ILE A CB  1 
ATOM   1598 C CG1 . ILE A 1 223 ? 52.515 -57.912 -8.270  1.00 51.13  ? 664  ILE A CG1 1 
ATOM   1599 C CG2 . ILE A 1 223 ? 52.781 -55.491 -8.808  1.00 53.07  ? 664  ILE A CG2 1 
ATOM   1600 C CD1 . ILE A 1 223 ? 51.665 -57.836 -7.024  1.00 51.44  ? 664  ILE A CD1 1 
ATOM   1601 N N   . ILE A 1 224 ? 56.450 -55.703 -9.058  1.00 52.38  ? 665  ILE A N   1 
ATOM   1602 C CA  . ILE A 1 224 ? 57.317 -54.547 -9.230  1.00 52.98  ? 665  ILE A CA  1 
ATOM   1603 C C   . ILE A 1 224 ? 58.056 -54.678 -10.536 1.00 54.30  ? 665  ILE A C   1 
ATOM   1604 O O   . ILE A 1 224 ? 58.074 -53.751 -11.342 1.00 54.93  ? 665  ILE A O   1 
ATOM   1605 C CB  . ILE A 1 224 ? 58.328 -54.407 -8.074  1.00 53.82  ? 665  ILE A CB  1 
ATOM   1606 C CG1 . ILE A 1 224 ? 57.613 -53.917 -6.818  1.00 55.54  ? 665  ILE A CG1 1 
ATOM   1607 C CG2 . ILE A 1 224 ? 59.424 -53.418 -8.431  1.00 53.02  ? 665  ILE A CG2 1 
ATOM   1608 C CD1 . ILE A 1 224 ? 58.469 -53.957 -5.570  1.00 57.99  ? 665  ILE A CD1 1 
ATOM   1609 N N   . PHE A 1 225 ? 58.666 -55.846 -10.723 1.00 56.59  ? 666  PHE A N   1 
ATOM   1610 C CA  . PHE A 1 225 ? 59.425 -56.160 -11.923 1.00 57.67  ? 666  PHE A CA  1 
ATOM   1611 C C   . PHE A 1 225 ? 58.574 -56.100 -13.204 1.00 59.27  ? 666  PHE A C   1 
ATOM   1612 O O   . PHE A 1 225 ? 58.994 -55.560 -14.228 1.00 60.54  ? 666  PHE A O   1 
ATOM   1613 C CB  . PHE A 1 225 ? 60.061 -57.540 -11.767 1.00 57.05  ? 666  PHE A CB  1 
ATOM   1614 C CG  . PHE A 1 225 ? 60.697 -58.048 -13.022 1.00 58.01  ? 666  PHE A CG  1 
ATOM   1615 C CD1 . PHE A 1 225 ? 61.845 -57.458 -13.511 1.00 59.34  ? 666  PHE A CD1 1 
ATOM   1616 C CD2 . PHE A 1 225 ? 60.132 -59.092 -13.722 1.00 59.00  ? 666  PHE A CD2 1 
ATOM   1617 C CE1 . PHE A 1 225 ? 62.426 -57.903 -14.672 1.00 62.18  ? 666  PHE A CE1 1 
ATOM   1618 C CE2 . PHE A 1 225 ? 60.712 -59.555 -14.882 1.00 61.20  ? 666  PHE A CE2 1 
ATOM   1619 C CZ  . PHE A 1 225 ? 61.862 -58.958 -15.360 1.00 63.66  ? 666  PHE A CZ  1 
ATOM   1620 N N   . MET A 1 226 ? 57.373 -56.647 -13.127 1.00 60.28  ? 667  MET A N   1 
ATOM   1621 C CA  . MET A 1 226 ? 56.488 -56.696 -14.271 1.00 62.88  ? 667  MET A CA  1 
ATOM   1622 C C   . MET A 1 226 ? 55.890 -55.340 -14.651 1.00 62.93  ? 667  MET A C   1 
ATOM   1623 O O   . MET A 1 226 ? 55.781 -55.024 -15.851 1.00 65.38  ? 667  MET A O   1 
ATOM   1624 C CB  . MET A 1 226 ? 55.379 -57.692 -13.999 1.00 65.04  ? 667  MET A CB  1 
ATOM   1625 C CG  . MET A 1 226 ? 55.900 -59.108 -13.865 1.00 67.75  ? 667  MET A CG  1 
ATOM   1626 S SD  . MET A 1 226 ? 54.571 -60.298 -14.047 1.00 67.23  ? 667  MET A SD  1 
ATOM   1627 C CE  . MET A 1 226 ? 54.689 -60.572 -15.806 1.00 71.39  ? 667  MET A CE  1 
ATOM   1628 N N   . VAL A 1 227 ? 55.488 -54.546 -13.660 1.00 57.87  ? 668  VAL A N   1 
ATOM   1629 C CA  . VAL A 1 227 ? 54.985 -53.200 -13.953 1.00 57.34  ? 668  VAL A CA  1 
ATOM   1630 C C   . VAL A 1 227 ? 56.118 -52.336 -14.507 1.00 57.78  ? 668  VAL A C   1 
ATOM   1631 O O   . VAL A 1 227 ? 55.919 -51.599 -15.470 1.00 60.38  ? 668  VAL A O   1 
ATOM   1632 C CB  . VAL A 1 227 ? 54.328 -52.512 -12.735 1.00 54.49  ? 668  VAL A CB  1 
ATOM   1633 C CG1 . VAL A 1 227 ? 53.905 -51.091 -13.081 1.00 54.45  ? 668  VAL A CG1 1 
ATOM   1634 C CG2 . VAL A 1 227 ? 53.105 -53.290 -12.288 1.00 53.83  ? 668  VAL A CG2 1 
ATOM   1635 N N   . GLY A 1 228 ? 57.302 -52.445 -13.914 1.00 57.78  ? 669  GLY A N   1 
ATOM   1636 C CA  . GLY A 1 228 ? 58.469 -51.693 -14.374 1.00 59.56  ? 669  GLY A CA  1 
ATOM   1637 C C   . GLY A 1 228 ? 58.811 -51.958 -15.831 1.00 61.07  ? 669  GLY A C   1 
ATOM   1638 O O   . GLY A 1 228 ? 59.149 -51.042 -16.564 1.00 60.52  ? 669  GLY A O   1 
ATOM   1639 N N   . ARG A 1 229 ? 58.692 -53.220 -16.238 1.00 63.73  ? 670  ARG A N   1 
ATOM   1640 C CA  . ARG A 1 229 ? 59.041 -53.687 -17.588 1.00 64.90  ? 670  ARG A CA  1 
ATOM   1641 C C   . ARG A 1 229 ? 57.902 -53.573 -18.611 1.00 65.22  ? 670  ARG A C   1 
ATOM   1642 O O   . ARG A 1 229 ? 58.122 -53.754 -19.820 1.00 67.14  ? 670  ARG A O   1 
ATOM   1643 C CB  . ARG A 1 229 ? 59.464 -55.162 -17.515 1.00 65.49  ? 670  ARG A CB  1 
ATOM   1644 C CG  . ARG A 1 229 ? 60.827 -55.400 -16.903 1.00 69.32  ? 670  ARG A CG  1 
ATOM   1645 C CD  . ARG A 1 229 ? 61.919 -54.974 -17.873 1.00 75.47  ? 670  ARG A CD  1 
ATOM   1646 N NE  . ARG A 1 229 ? 63.258 -55.364 -17.430 1.00 79.64  ? 670  ARG A NE  1 
ATOM   1647 C CZ  . ARG A 1 229 ? 63.856 -56.527 -17.700 1.00 82.62  ? 670  ARG A CZ  1 
ATOM   1648 N NH1 . ARG A 1 229 ? 63.251 -57.472 -18.423 1.00 83.35  ? 670  ARG A NH1 1 
ATOM   1649 N NH2 . ARG A 1 229 ? 65.082 -56.749 -17.234 1.00 84.41  ? 670  ARG A NH2 1 
ATOM   1650 N N   . GLY A 1 230 ? 56.684 -53.315 -18.135 1.00 61.48  ? 671  GLY A N   1 
ATOM   1651 C CA  . GLY A 1 230 ? 55.522 -53.221 -19.020 1.00 60.75  ? 671  GLY A CA  1 
ATOM   1652 C C   . GLY A 1 230 ? 54.799 -54.532 -19.294 1.00 59.83  ? 671  GLY A C   1 
ATOM   1653 O O   . GLY A 1 230 ? 53.852 -54.565 -20.079 1.00 59.64  ? 671  GLY A O   1 
ATOM   1654 N N   . TYR A 1 231 ? 55.194 -55.613 -18.629 1.00 59.29  ? 672  TYR A N   1 
ATOM   1655 C CA  . TYR A 1 231 ? 54.532 -56.893 -18.865 1.00 59.92  ? 672  TYR A CA  1 
ATOM   1656 C C   . TYR A 1 231 ? 53.161 -56.998 -18.168 1.00 59.59  ? 672  TYR A C   1 
ATOM   1657 O O   . TYR A 1 231 ? 52.397 -57.895 -18.488 1.00 61.75  ? 672  TYR A O   1 
ATOM   1658 C CB  . TYR A 1 231 ? 55.413 -58.076 -18.440 1.00 59.74  ? 672  TYR A CB  1 
ATOM   1659 C CG  . TYR A 1 231 ? 56.847 -58.117 -18.971 1.00 59.36  ? 672  TYR A CG  1 
ATOM   1660 C CD1 . TYR A 1 231 ? 57.846 -58.760 -18.244 1.00 58.74  ? 672  TYR A CD1 1 
ATOM   1661 C CD2 . TYR A 1 231 ? 57.205 -57.527 -20.184 1.00 60.29  ? 672  TYR A CD2 1 
ATOM   1662 C CE1 . TYR A 1 231 ? 59.151 -58.819 -18.705 1.00 60.70  ? 672  TYR A CE1 1 
ATOM   1663 C CE2 . TYR A 1 231 ? 58.509 -57.580 -20.652 1.00 60.45  ? 672  TYR A CE2 1 
ATOM   1664 C CZ  . TYR A 1 231 ? 59.480 -58.224 -19.910 1.00 62.14  ? 672  TYR A CZ  1 
ATOM   1665 O OH  . TYR A 1 231 ? 60.788 -58.285 -20.356 1.00 64.99  ? 672  TYR A OH  1 
ATOM   1666 N N   . LEU A 1 232 ? 52.853 -56.085 -17.241 1.00 59.67  ? 673  LEU A N   1 
ATOM   1667 C CA  . LEU A 1 232 ? 51.612 -56.111 -16.433 1.00 57.34  ? 673  LEU A CA  1 
ATOM   1668 C C   . LEU A 1 232 ? 50.850 -54.808 -16.581 1.00 58.72  ? 673  LEU A C   1 
ATOM   1669 O O   . LEU A 1 232 ? 51.463 -53.740 -16.553 1.00 60.83  ? 673  LEU A O   1 
ATOM   1670 C CB  . LEU A 1 232 ? 51.959 -56.243 -14.944 1.00 54.40  ? 673  LEU A CB  1 
ATOM   1671 C CG  . LEU A 1 232 ? 51.279 -57.287 -14.054 1.00 54.48  ? 673  LEU A CG  1 
ATOM   1672 C CD1 . LEU A 1 232 ? 51.228 -56.791 -12.615 1.00 54.06  ? 673  LEU A CD1 1 
ATOM   1673 C CD2 . LEU A 1 232 ? 49.889 -57.666 -14.530 1.00 55.79  ? 673  LEU A CD2 1 
ATOM   1674 N N   . SER A 1 233 ? 49.526 -54.893 -16.715 1.00 60.44  ? 674  SER A N   1 
ATOM   1675 C CA  . SER A 1 233 ? 48.634 -53.715 -16.663 1.00 62.25  ? 674  SER A CA  1 
ATOM   1676 C C   . SER A 1 233 ? 47.347 -54.125 -15.967 1.00 63.99  ? 674  SER A C   1 
ATOM   1677 O O   . SER A 1 233 ? 47.002 -55.304 -15.969 1.00 67.61  ? 674  SER A O   1 
ATOM   1678 C CB  . SER A 1 233 ? 48.259 -53.181 -18.061 1.00 64.30  ? 674  SER A CB  1 
ATOM   1679 O OG  . SER A 1 233 ? 49.180 -53.559 -19.077 1.00 68.10  ? 674  SER A OG  1 
ATOM   1680 N N   . PRO A 1 234 ? 46.611 -53.162 -15.388 1.00 63.07  ? 675  PRO A N   1 
ATOM   1681 C CA  . PRO A 1 234 ? 45.328 -53.505 -14.774 1.00 61.12  ? 675  PRO A CA  1 
ATOM   1682 C C   . PRO A 1 234 ? 44.326 -54.066 -15.776 1.00 61.97  ? 675  PRO A C   1 
ATOM   1683 O O   . PRO A 1 234 ? 44.219 -53.574 -16.898 1.00 61.79  ? 675  PRO A O   1 
ATOM   1684 C CB  . PRO A 1 234 ? 44.834 -52.164 -14.223 1.00 61.57  ? 675  PRO A CB  1 
ATOM   1685 C CG  . PRO A 1 234 ? 46.077 -51.371 -14.012 1.00 61.29  ? 675  PRO A CG  1 
ATOM   1686 C CD  . PRO A 1 234 ? 46.962 -51.753 -15.160 1.00 62.62  ? 675  PRO A CD  1 
ATOM   1687 N N   . ASP A 1 235 ? 43.599 -55.091 -15.358 1.00 62.95  ? 676  ASP A N   1 
ATOM   1688 C CA  . ASP A 1 235 ? 42.664 -55.775 -16.237 1.00 67.08  ? 676  ASP A CA  1 
ATOM   1689 C C   . ASP A 1 235 ? 41.341 -54.994 -16.339 1.00 69.43  ? 676  ASP A C   1 
ATOM   1690 O O   . ASP A 1 235 ? 40.494 -55.059 -15.442 1.00 69.00  ? 676  ASP A O   1 
ATOM   1691 C CB  . ASP A 1 235 ? 42.441 -57.199 -15.712 1.00 69.10  ? 676  ASP A CB  1 
ATOM   1692 C CG  . ASP A 1 235 ? 41.465 -57.997 -16.556 1.00 73.29  ? 676  ASP A CG  1 
ATOM   1693 O OD1 . ASP A 1 235 ? 41.134 -57.565 -17.687 1.00 74.55  ? 676  ASP A OD1 1 
ATOM   1694 O OD2 . ASP A 1 235 ? 41.020 -59.059 -16.066 1.00 73.31  ? 676  ASP A OD2 1 
ATOM   1695 N N   . LEU A 1 236 ? 41.157 -54.274 -17.444 1.00 70.86  ? 677  LEU A N   1 
ATOM   1696 C CA  . LEU A 1 236 ? 40.015 -53.362 -17.583 1.00 71.83  ? 677  LEU A CA  1 
ATOM   1697 C C   . LEU A 1 236 ? 38.693 -54.056 -17.910 1.00 73.24  ? 677  LEU A C   1 
ATOM   1698 O O   . LEU A 1 236 ? 37.646 -53.411 -17.941 1.00 74.43  ? 677  LEU A O   1 
ATOM   1699 C CB  . LEU A 1 236 ? 40.313 -52.292 -18.635 1.00 73.78  ? 677  LEU A CB  1 
ATOM   1700 C CG  . LEU A 1 236 ? 41.521 -51.390 -18.360 1.00 72.58  ? 677  LEU A CG  1 
ATOM   1701 C CD1 . LEU A 1 236 ? 41.661 -50.384 -19.487 1.00 75.07  ? 677  LEU A CD1 1 
ATOM   1702 C CD2 . LEU A 1 236 ? 41.406 -50.671 -17.024 1.00 71.31  ? 677  LEU A CD2 1 
ATOM   1703 N N   . SER A 1 237 ? 38.735 -55.362 -18.149 1.00 72.35  ? 678  SER A N   1 
ATOM   1704 C CA  . SER A 1 237 ? 37.511 -56.129 -18.349 1.00 74.07  ? 678  SER A CA  1 
ATOM   1705 C C   . SER A 1 237 ? 36.750 -56.351 -17.037 1.00 70.96  ? 678  SER A C   1 
ATOM   1706 O O   . SER A 1 237 ? 35.586 -56.702 -17.054 1.00 70.66  ? 678  SER A O   1 
ATOM   1707 C CB  . SER A 1 237 ? 37.832 -57.479 -18.988 1.00 76.24  ? 678  SER A CB  1 
ATOM   1708 O OG  . SER A 1 237 ? 38.593 -58.277 -18.104 1.00 73.63  ? 678  SER A OG  1 
ATOM   1709 N N   . LYS A 1 238 ? 37.396 -56.140 -15.899 1.00 68.99  ? 679  LYS A N   1 
ATOM   1710 C CA  . LYS A 1 238 ? 36.728 -56.341 -14.607 1.00 70.15  ? 679  LYS A CA  1 
ATOM   1711 C C   . LYS A 1 238 ? 35.793 -55.188 -14.193 1.00 70.42  ? 679  LYS A C   1 
ATOM   1712 O O   . LYS A 1 238 ? 35.163 -55.261 -13.139 1.00 70.21  ? 679  LYS A O   1 
ATOM   1713 C CB  . LYS A 1 238 ? 37.758 -56.571 -13.495 1.00 67.83  ? 679  LYS A CB  1 
ATOM   1714 C CG  . LYS A 1 238 ? 38.735 -57.704 -13.756 1.00 68.11  ? 679  LYS A CG  1 
ATOM   1715 C CD  . LYS A 1 238 ? 39.764 -57.825 -12.648 1.00 67.51  ? 679  LYS A CD  1 
ATOM   1716 C CE  . LYS A 1 238 ? 39.168 -58.470 -11.406 1.00 70.96  ? 679  LYS A CE  1 
ATOM   1717 N NZ  . LYS A 1 238 ? 40.112 -58.471 -10.250 1.00 71.43  ? 679  LYS A NZ  1 
ATOM   1718 N N   . VAL A 1 239 ? 35.695 -54.134 -15.002 1.00 70.44  ? 680  VAL A N   1 
ATOM   1719 C CA  . VAL A 1 239 ? 34.821 -53.005 -14.665 1.00 72.38  ? 680  VAL A CA  1 
ATOM   1720 C C   . VAL A 1 239 ? 33.339 -53.370 -14.698 1.00 73.07  ? 680  VAL A C   1 
ATOM   1721 O O   . VAL A 1 239 ? 32.903 -54.148 -15.542 1.00 74.45  ? 680  VAL A O   1 
ATOM   1722 C CB  . VAL A 1 239 ? 35.031 -51.796 -15.603 1.00 76.11  ? 680  VAL A CB  1 
ATOM   1723 C CG1 . VAL A 1 239 ? 36.468 -51.291 -15.519 1.00 74.64  ? 680  VAL A CG1 1 
ATOM   1724 C CG2 . VAL A 1 239 ? 34.640 -52.133 -17.037 1.00 79.52  ? 680  VAL A CG2 1 
ATOM   1725 N N   . ARG A 1 240 ? 32.574 -52.783 -13.782 1.00 72.87  ? 681  ARG A N   1 
ATOM   1726 C CA  . ARG A 1 240 ? 31.118 -52.962 -13.733 1.00 76.35  ? 681  ARG A CA  1 
ATOM   1727 C C   . ARG A 1 240 ? 30.514 -52.911 -15.118 1.00 77.49  ? 681  ARG A C   1 
ATOM   1728 O O   . ARG A 1 240 ? 30.946 -52.127 -15.970 1.00 75.05  ? 681  ARG A O   1 
ATOM   1729 C CB  . ARG A 1 240 ? 30.454 -51.855 -12.912 1.00 79.24  ? 681  ARG A CB  1 
ATOM   1730 C CG  . ARG A 1 240 ? 30.861 -51.784 -11.447 1.00 79.52  ? 681  ARG A CG  1 
ATOM   1731 C CD  . ARG A 1 240 ? 29.718 -52.110 -10.504 1.00 82.84  ? 681  ARG A CD  1 
ATOM   1732 N NE  . ARG A 1 240 ? 29.820 -51.354 -9.255  1.00 81.08  ? 681  ARG A NE  1 
ATOM   1733 C CZ  . ARG A 1 240 ? 28.932 -50.464 -8.821  1.00 81.36  ? 681  ARG A CZ  1 
ATOM   1734 N NH1 . ARG A 1 240 ? 27.834 -50.186 -9.519  1.00 85.96  ? 681  ARG A NH1 1 
ATOM   1735 N NH2 . ARG A 1 240 ? 29.139 -49.851 -7.666  1.00 79.88  ? 681  ARG A NH2 1 
ATOM   1736 N N   . SER A 1 241 ? 29.488 -53.726 -15.325 1.00 80.02  ? 682  SER A N   1 
ATOM   1737 C CA  . SER A 1 241 ? 28.793 -53.770 -16.604 1.00 84.13  ? 682  SER A CA  1 
ATOM   1738 C C   . SER A 1 241 ? 28.237 -52.399 -17.036 1.00 84.94  ? 682  SER A C   1 
ATOM   1739 O O   . SER A 1 241 ? 28.263 -52.074 -18.223 1.00 84.84  ? 682  SER A O   1 
ATOM   1740 C CB  . SER A 1 241 ? 27.667 -54.797 -16.540 1.00 88.10  ? 682  SER A CB  1 
ATOM   1741 O OG  . SER A 1 241 ? 26.724 -54.438 -15.542 1.00 91.30  ? 682  SER A OG  1 
ATOM   1742 N N   . ASN A 1 242 ? 27.756 -51.600 -16.077 1.00 84.18  ? 683  ASN A N   1 
ATOM   1743 C CA  . ASN A 1 242 ? 27.153 -50.282 -16.377 1.00 86.87  ? 683  ASN A CA  1 
ATOM   1744 C C   . ASN A 1 242 ? 28.133 -49.098 -16.327 1.00 83.24  ? 683  ASN A C   1 
ATOM   1745 O O   . ASN A 1 242 ? 27.722 -47.940 -16.266 1.00 81.00  ? 683  ASN A O   1 
ATOM   1746 C CB  . ASN A 1 242 ? 25.963 -50.014 -15.450 1.00 90.16  ? 683  ASN A CB  1 
ATOM   1747 C CG  . ASN A 1 242 ? 26.370 -49.903 -13.987 1.00 90.01  ? 683  ASN A CG  1 
ATOM   1748 O OD1 . ASN A 1 242 ? 27.415 -50.415 -13.574 1.00 90.45  ? 683  ASN A OD1 1 
ATOM   1749 N ND2 . ASN A 1 242 ? 25.538 -49.243 -13.191 1.00 91.94  ? 683  ASN A ND2 1 
ATOM   1750 N N   . CYS A 1 243 ? 29.428 -49.393 -16.365 1.00 82.05  ? 684  CYS A N   1 
ATOM   1751 C CA  . CYS A 1 243 ? 30.453 -48.356 -16.428 1.00 82.02  ? 684  CYS A CA  1 
ATOM   1752 C C   . CYS A 1 243 ? 30.587 -47.845 -17.868 1.00 83.86  ? 684  CYS A C   1 
ATOM   1753 O O   . CYS A 1 243 ? 30.919 -48.628 -18.758 1.00 84.33  ? 684  CYS A O   1 
ATOM   1754 C CB  . CYS A 1 243 ? 31.791 -48.910 -15.948 1.00 80.34  ? 684  CYS A CB  1 
ATOM   1755 S SG  . CYS A 1 243 ? 33.157 -47.735 -16.083 1.00 84.40  ? 684  CYS A SG  1 
ATOM   1756 N N   . PRO A 1 244 ? 30.346 -46.534 -18.106 1.00 84.83  ? 685  PRO A N   1 
ATOM   1757 C CA  . PRO A 1 244 ? 30.275 -46.008 -19.482 1.00 86.35  ? 685  PRO A CA  1 
ATOM   1758 C C   . PRO A 1 244 ? 31.582 -46.126 -20.262 1.00 83.16  ? 685  PRO A C   1 
ATOM   1759 O O   . PRO A 1 244 ? 32.655 -46.044 -19.672 1.00 81.26  ? 685  PRO A O   1 
ATOM   1760 C CB  . PRO A 1 244 ? 29.920 -44.527 -19.284 1.00 87.65  ? 685  PRO A CB  1 
ATOM   1761 C CG  . PRO A 1 244 ? 29.478 -44.400 -17.871 1.00 86.38  ? 685  PRO A CG  1 
ATOM   1762 C CD  . PRO A 1 244 ? 30.236 -45.447 -17.119 1.00 83.71  ? 685  PRO A CD  1 
ATOM   1763 N N   . LYS A 1 245 ? 31.482 -46.307 -21.576 1.00 93.15  ? 686  LYS A N   1 
ATOM   1764 C CA  . LYS A 1 245 ? 32.662 -46.428 -22.426 1.00 90.54  ? 686  LYS A CA  1 
ATOM   1765 C C   . LYS A 1 245 ? 33.597 -45.248 -22.205 1.00 87.38  ? 686  LYS A C   1 
ATOM   1766 O O   . LYS A 1 245 ? 34.799 -45.430 -22.068 1.00 84.45  ? 686  LYS A O   1 
ATOM   1767 C CB  . LYS A 1 245 ? 32.267 -46.514 -23.901 1.00 94.29  ? 686  LYS A CB  1 
ATOM   1768 C CG  . LYS A 1 245 ? 31.622 -47.835 -24.300 1.00 97.66  ? 686  LYS A CG  1 
ATOM   1769 C CD  . LYS A 1 245 ? 30.703 -47.672 -25.504 1.00 102.30 ? 686  LYS A CD  1 
ATOM   1770 C CE  . LYS A 1 245 ? 30.301 -49.018 -26.074 1.00 105.31 ? 686  LYS A CE  1 
ATOM   1771 N NZ  . LYS A 1 245 ? 29.186 -48.872 -27.043 1.00 111.38 ? 686  LYS A NZ  1 
ATOM   1772 N N   . ALA A 1 246 ? 33.033 -44.045 -22.147 1.00 89.54  ? 687  ALA A N   1 
ATOM   1773 C CA  . ALA A 1 246 ? 33.815 -42.817 -21.974 1.00 87.53  ? 687  ALA A CA  1 
ATOM   1774 C C   . ALA A 1 246 ? 34.752 -42.910 -20.779 1.00 84.62  ? 687  ALA A C   1 
ATOM   1775 O O   . ALA A 1 246 ? 35.911 -42.499 -20.856 1.00 82.28  ? 687  ALA A O   1 
ATOM   1776 C CB  . ALA A 1 246 ? 32.886 -41.620 -21.821 1.00 89.97  ? 687  ALA A CB  1 
ATOM   1777 N N   . MET A 1 247 ? 34.235 -43.452 -19.678 1.00 86.09  ? 688  MET A N   1 
ATOM   1778 C CA  . MET A 1 247 ? 34.990 -43.606 -18.438 1.00 82.65  ? 688  MET A CA  1 
ATOM   1779 C C   . MET A 1 247 ? 36.086 -44.633 -18.617 1.00 79.07  ? 688  MET A C   1 
ATOM   1780 O O   . MET A 1 247 ? 37.206 -44.454 -18.150 1.00 75.52  ? 688  MET A O   1 
ATOM   1781 C CB  . MET A 1 247 ? 34.061 -44.059 -17.309 1.00 85.42  ? 688  MET A CB  1 
ATOM   1782 C CG  . MET A 1 247 ? 34.752 -44.268 -15.968 1.00 85.84  ? 688  MET A CG  1 
ATOM   1783 S SD  . MET A 1 247 ? 35.501 -42.767 -15.284 1.00 86.97  ? 688  MET A SD  1 
ATOM   1784 C CE  . MET A 1 247 ? 34.062 -41.978 -14.555 1.00 88.87  ? 688  MET A CE  1 
ATOM   1785 N N   . LYS A 1 248 ? 35.745 -45.723 -19.285 1.00 81.11  ? 689  LYS A N   1 
ATOM   1786 C CA  . LYS A 1 248 ? 36.687 -46.802 -19.501 1.00 80.99  ? 689  LYS A CA  1 
ATOM   1787 C C   . LYS A 1 248 ? 37.884 -46.310 -20.326 1.00 79.03  ? 689  LYS A C   1 
ATOM   1788 O O   . LYS A 1 248 ? 39.022 -46.693 -20.041 1.00 76.25  ? 689  LYS A O   1 
ATOM   1789 C CB  . LYS A 1 248 ? 35.986 -47.997 -20.154 1.00 85.73  ? 689  LYS A CB  1 
ATOM   1790 C CG  . LYS A 1 248 ? 36.604 -49.341 -19.807 1.00 86.81  ? 689  LYS A CG  1 
ATOM   1791 C CD  . LYS A 1 248 ? 35.735 -50.493 -20.297 1.00 92.00  ? 689  LYS A CD  1 
ATOM   1792 C CE  . LYS A 1 248 ? 36.564 -51.744 -20.568 1.00 93.03  ? 689  LYS A CE  1 
ATOM   1793 N NZ  . LYS A 1 248 ? 35.751 -52.988 -20.490 1.00 96.84  ? 689  LYS A NZ  1 
ATOM   1794 N N   . ARG A 1 249 ? 37.625 -45.443 -21.311 1.00 79.97  ? 690  ARG A N   1 
ATOM   1795 C CA  . ARG A 1 249 ? 38.690 -44.821 -22.118 1.00 80.16  ? 690  ARG A CA  1 
ATOM   1796 C C   . ARG A 1 249 ? 39.525 -43.830 -21.303 1.00 77.98  ? 690  ARG A C   1 
ATOM   1797 O O   . ARG A 1 249 ? 40.717 -43.680 -21.532 1.00 76.94  ? 690  ARG A O   1 
ATOM   1798 C CB  . ARG A 1 249 ? 38.124 -44.124 -23.365 1.00 84.38  ? 690  ARG A CB  1 
ATOM   1799 C CG  . ARG A 1 249 ? 37.726 -45.088 -24.472 1.00 90.31  ? 690  ARG A CG  1 
ATOM   1800 C CD  . ARG A 1 249 ? 37.365 -44.392 -25.778 1.00 97.07  ? 690  ARG A CD  1 
ATOM   1801 N NE  . ARG A 1 249 ? 35.915 -44.295 -25.992 1.00 103.55 ? 690  ARG A NE  1 
ATOM   1802 C CZ  . ARG A 1 249 ? 35.161 -43.205 -25.791 1.00 107.12 ? 690  ARG A CZ  1 
ATOM   1803 N NH1 . ARG A 1 249 ? 35.689 -42.056 -25.361 1.00 106.29 ? 690  ARG A NH1 1 
ATOM   1804 N NH2 . ARG A 1 249 ? 33.850 -43.261 -26.025 1.00 110.02 ? 690  ARG A NH2 1 
ATOM   1805 N N   . LEU A 1 250 ? 38.907 -43.149 -20.349 1.00 78.33  ? 691  LEU A N   1 
ATOM   1806 C CA  . LEU A 1 250 ? 39.660 -42.260 -19.474 1.00 76.69  ? 691  LEU A CA  1 
ATOM   1807 C C   . LEU A 1 250 ? 40.678 -43.057 -18.661 1.00 75.06  ? 691  LEU A C   1 
ATOM   1808 O O   . LEU A 1 250 ? 41.845 -42.685 -18.588 1.00 74.54  ? 691  LEU A O   1 
ATOM   1809 C CB  . LEU A 1 250 ? 38.718 -41.496 -18.546 1.00 76.88  ? 691  LEU A CB  1 
ATOM   1810 C CG  . LEU A 1 250 ? 39.367 -40.486 -17.611 1.00 75.26  ? 691  LEU A CG  1 
ATOM   1811 C CD1 . LEU A 1 250 ? 40.197 -39.480 -18.396 1.00 75.97  ? 691  LEU A CD1 1 
ATOM   1812 C CD2 . LEU A 1 250 ? 38.288 -39.792 -16.795 1.00 76.75  ? 691  LEU A CD2 1 
ATOM   1813 N N   . MET A 1 251 ? 40.229 -44.146 -18.047 1.00 75.31  ? 692  MET A N   1 
ATOM   1814 C CA  . MET A 1 251 ? 41.136 -45.052 -17.360 1.00 75.10  ? 692  MET A CA  1 
ATOM   1815 C C   . MET A 1 251 ? 42.354 -45.367 -18.236 1.00 75.79  ? 692  MET A C   1 
ATOM   1816 O O   . MET A 1 251 ? 43.493 -45.131 -17.837 1.00 72.63  ? 692  MET A O   1 
ATOM   1817 C CB  . MET A 1 251 ? 40.425 -46.354 -16.992 1.00 78.00  ? 692  MET A CB  1 
ATOM   1818 C CG  . MET A 1 251 ? 40.070 -46.500 -15.524 1.00 78.73  ? 692  MET A CG  1 
ATOM   1819 S SD  . MET A 1 251 ? 38.983 -47.923 -15.260 1.00 84.91  ? 692  MET A SD  1 
ATOM   1820 C CE  . MET A 1 251 ? 37.425 -47.234 -15.818 1.00 87.35  ? 692  MET A CE  1 
ATOM   1821 N N   . ALA A 1 252 ? 42.111 -45.888 -19.436 1.00 77.39  ? 693  ALA A N   1 
ATOM   1822 C CA  . ALA A 1 252 ? 43.206 -46.356 -20.284 1.00 78.08  ? 693  ALA A CA  1 
ATOM   1823 C C   . ALA A 1 252 ? 44.245 -45.267 -20.538 1.00 78.87  ? 693  ALA A C   1 
ATOM   1824 O O   . ALA A 1 252 ? 45.441 -45.557 -20.552 1.00 80.73  ? 693  ALA A O   1 
ATOM   1825 C CB  . ALA A 1 252 ? 42.680 -46.907 -21.599 1.00 80.57  ? 693  ALA A CB  1 
ATOM   1826 N N   . GLU A 1 253 ? 43.791 -44.025 -20.727 1.00 80.14  ? 694  GLU A N   1 
ATOM   1827 C CA  . GLU A 1 253 ? 44.696 -42.897 -20.985 1.00 80.34  ? 694  GLU A CA  1 
ATOM   1828 C C   . GLU A 1 253 ? 45.462 -42.511 -19.712 1.00 75.47  ? 694  GLU A C   1 
ATOM   1829 O O   . GLU A 1 253 ? 46.646 -42.215 -19.760 1.00 75.21  ? 694  GLU A O   1 
ATOM   1830 C CB  . GLU A 1 253 ? 43.950 -41.687 -21.594 1.00 84.10  ? 694  GLU A CB  1 
ATOM   1831 C CG  . GLU A 1 253 ? 43.630 -41.801 -23.092 1.00 90.34  ? 694  GLU A CG  1 
ATOM   1832 C CD  . GLU A 1 253 ? 44.868 -41.801 -24.008 1.00 97.81  ? 694  GLU A CD  1 
ATOM   1833 O OE1 . GLU A 1 253 ? 44.771 -42.273 -25.171 1.00 102.09 ? 694  GLU A OE1 1 
ATOM   1834 O OE2 . GLU A 1 253 ? 45.953 -41.332 -23.585 1.00 101.98 ? 694  GLU A OE2 1 
ATOM   1835 N N   . CYS A 1 254 ? 44.806 -42.546 -18.564 1.00 73.66  ? 695  CYS A N   1 
ATOM   1836 C CA  . CYS A 1 254 ? 45.502 -42.259 -17.319 1.00 71.61  ? 695  CYS A CA  1 
ATOM   1837 C C   . CYS A 1 254 ? 46.531 -43.311 -16.988 1.00 69.95  ? 695  CYS A C   1 
ATOM   1838 O O   . CYS A 1 254 ? 47.491 -43.024 -16.296 1.00 74.27  ? 695  CYS A O   1 
ATOM   1839 C CB  . CYS A 1 254 ? 44.528 -42.176 -16.160 1.00 71.14  ? 695  CYS A CB  1 
ATOM   1840 S SG  . CYS A 1 254 ? 43.381 -40.803 -16.309 1.00 76.51  ? 695  CYS A SG  1 
ATOM   1841 N N   . LEU A 1 255 ? 46.320 -44.534 -17.454 1.00 68.59  ? 696  LEU A N   1 
ATOM   1842 C CA  . LEU A 1 255 ? 47.189 -45.641 -17.090 1.00 66.53  ? 696  LEU A CA  1 
ATOM   1843 C C   . LEU A 1 255 ? 48.237 -45.925 -18.150 1.00 68.36  ? 696  LEU A C   1 
ATOM   1844 O O   . LEU A 1 255 ? 49.005 -46.874 -17.998 1.00 70.28  ? 696  LEU A O   1 
ATOM   1845 C CB  . LEU A 1 255 ? 46.365 -46.904 -16.823 1.00 66.14  ? 696  LEU A CB  1 
ATOM   1846 C CG  . LEU A 1 255 ? 45.489 -46.917 -15.567 1.00 64.58  ? 696  LEU A CG  1 
ATOM   1847 C CD1 . LEU A 1 255 ? 44.538 -48.095 -15.624 1.00 66.54  ? 696  LEU A CD1 1 
ATOM   1848 C CD2 . LEU A 1 255 ? 46.309 -46.990 -14.293 1.00 63.13  ? 696  LEU A CD2 1 
ATOM   1849 N N   . LYS A 1 256 ? 48.278 -45.121 -19.215 1.00 70.13  ? 697  LYS A N   1 
ATOM   1850 C CA  . LYS A 1 256 ? 49.307 -45.268 -20.262 1.00 72.04  ? 697  LYS A CA  1 
ATOM   1851 C C   . LYS A 1 256 ? 50.713 -45.399 -19.639 1.00 71.08  ? 697  LYS A C   1 
ATOM   1852 O O   . LYS A 1 256 ? 51.085 -44.639 -18.762 1.00 69.13  ? 697  LYS A O   1 
ATOM   1853 C CB  . LYS A 1 256 ? 49.275 -44.081 -21.244 1.00 73.20  ? 697  LYS A CB  1 
ATOM   1854 C CG  . LYS A 1 256 ? 48.113 -44.067 -22.231 1.00 74.85  ? 697  LYS A CG  1 
ATOM   1855 C CD  . LYS A 1 256 ? 48.311 -45.067 -23.362 1.00 79.58  ? 697  LYS A CD  1 
ATOM   1856 C CE  . LYS A 1 256 ? 47.379 -44.822 -24.547 1.00 83.15  ? 697  LYS A CE  1 
ATOM   1857 N NZ  . LYS A 1 256 ? 46.054 -45.488 -24.396 1.00 83.64  ? 697  LYS A NZ  1 
ATOM   1858 N N   . LYS A 1 257 ? 51.478 -46.376 -20.103 1.00 75.01  ? 698  LYS A N   1 
ATOM   1859 C CA  . LYS A 1 257 ? 52.804 -46.679 -19.558 1.00 77.20  ? 698  LYS A CA  1 
ATOM   1860 C C   . LYS A 1 257 ? 53.829 -45.561 -19.789 1.00 78.47  ? 698  LYS A C   1 
ATOM   1861 O O   . LYS A 1 257 ? 54.840 -45.486 -19.085 1.00 75.81  ? 698  LYS A O   1 
ATOM   1862 C CB  . LYS A 1 257 ? 53.313 -48.005 -20.158 1.00 81.18  ? 698  LYS A CB  1 
ATOM   1863 C CG  . LYS A 1 257 ? 52.541 -49.211 -19.644 1.00 81.54  ? 698  LYS A CG  1 
ATOM   1864 C CD  . LYS A 1 257 ? 52.435 -50.356 -20.630 1.00 86.66  ? 698  LYS A CD  1 
ATOM   1865 C CE  . LYS A 1 257 ? 51.372 -51.342 -20.155 1.00 87.87  ? 698  LYS A CE  1 
ATOM   1866 N NZ  . LYS A 1 257 ? 51.269 -52.566 -21.001 1.00 93.06  ? 698  LYS A NZ  1 
ATOM   1867 N N   . LYS A 1 258 ? 53.568 -44.713 -20.783 1.00 80.89  ? 699  LYS A N   1 
ATOM   1868 C CA  . LYS A 1 258 ? 54.410 -43.553 -21.086 1.00 83.17  ? 699  LYS A CA  1 
ATOM   1869 C C   . LYS A 1 258 ? 53.874 -42.278 -20.439 1.00 80.86  ? 699  LYS A C   1 
ATOM   1870 O O   . LYS A 1 258 ? 52.715 -41.928 -20.642 1.00 79.57  ? 699  LYS A O   1 
ATOM   1871 C CB  . LYS A 1 258 ? 54.468 -43.346 -22.594 1.00 86.67  ? 699  LYS A CB  1 
ATOM   1872 C CG  . LYS A 1 258 ? 55.328 -44.361 -23.301 1.00 91.82  ? 699  LYS A CG  1 
ATOM   1873 C CD  . LYS A 1 258 ? 55.120 -44.325 -24.812 1.00 99.05  ? 699  LYS A CD  1 
ATOM   1874 C CE  . LYS A 1 258 ? 54.192 -45.432 -25.304 1.00 99.76  ? 699  LYS A CE  1 
ATOM   1875 N NZ  . LYS A 1 258 ? 54.624 -45.953 -26.632 1.00 104.84 ? 699  LYS A NZ  1 
ATOM   1876 N N   . ARG A 1 259 ? 54.715 -41.578 -19.681 1.00 80.42  ? 700  ARG A N   1 
ATOM   1877 C CA  . ARG A 1 259 ? 54.328 -40.292 -19.087 1.00 79.82  ? 700  ARG A CA  1 
ATOM   1878 C C   . ARG A 1 259 ? 53.648 -39.377 -20.085 1.00 82.45  ? 700  ARG A C   1 
ATOM   1879 O O   . ARG A 1 259 ? 52.573 -38.851 -19.836 1.00 81.19  ? 700  ARG A O   1 
ATOM   1880 C CB  . ARG A 1 259 ? 55.549 -39.523 -18.606 1.00 82.64  ? 700  ARG A CB  1 
ATOM   1881 C CG  . ARG A 1 259 ? 56.337 -40.188 -17.514 1.00 83.49  ? 700  ARG A CG  1 
ATOM   1882 C CD  . ARG A 1 259 ? 57.000 -39.148 -16.625 1.00 86.47  ? 700  ARG A CD  1 
ATOM   1883 N NE  . ARG A 1 259 ? 57.974 -38.329 -17.335 1.00 89.14  ? 700  ARG A NE  1 
ATOM   1884 C CZ  . ARG A 1 259 ? 59.030 -37.753 -16.766 1.00 92.17  ? 700  ARG A CZ  1 
ATOM   1885 N NH1 . ARG A 1 259 ? 59.278 -37.898 -15.462 1.00 88.62  ? 700  ARG A NH1 1 
ATOM   1886 N NH2 . ARG A 1 259 ? 59.855 -37.030 -17.520 1.00 98.29  ? 700  ARG A NH2 1 
ATOM   1887 N N   . ASP A 1 260 ? 54.307 -39.179 -21.219 1.00 86.89  ? 701  ASP A N   1 
ATOM   1888 C CA  . ASP A 1 260 ? 53.942 -38.109 -22.128 1.00 90.09  ? 701  ASP A CA  1 
ATOM   1889 C C   . ASP A 1 260 ? 52.517 -38.252 -22.675 1.00 90.05  ? 701  ASP A C   1 
ATOM   1890 O O   . ASP A 1 260 ? 51.856 -37.241 -22.928 1.00 93.34  ? 701  ASP A O   1 
ATOM   1891 C CB  . ASP A 1 260 ? 54.984 -37.994 -23.251 1.00 95.04  ? 701  ASP A CB  1 
ATOM   1892 C CG  . ASP A 1 260 ? 56.360 -37.550 -22.734 1.00 96.48  ? 701  ASP A CG  1 
ATOM   1893 O OD1 . ASP A 1 260 ? 56.491 -37.336 -21.510 1.00 92.44  ? 701  ASP A OD1 1 
ATOM   1894 O OD2 . ASP A 1 260 ? 57.306 -37.412 -23.547 1.00 99.93  ? 701  ASP A OD2 1 
ATOM   1895 N N   . GLU A 1 261 ? 52.036 -39.491 -22.820 1.00 87.07  ? 702  GLU A N   1 
ATOM   1896 C CA  . GLU A 1 261 ? 50.675 -39.746 -23.344 1.00 86.17  ? 702  GLU A CA  1 
ATOM   1897 C C   . GLU A 1 261 ? 49.553 -39.542 -22.310 1.00 80.84  ? 702  GLU A C   1 
ATOM   1898 O O   . GLU A 1 261 ? 48.381 -39.490 -22.678 1.00 82.95  ? 702  GLU A O   1 
ATOM   1899 C CB  . GLU A 1 261 ? 50.571 -41.159 -23.952 1.00 86.76  ? 702  GLU A CB  1 
ATOM   1900 C CG  . GLU A 1 261 ? 50.866 -41.229 -25.448 1.00 91.88  ? 702  GLU A CG  1 
ATOM   1901 C CD  . GLU A 1 261 ? 51.560 -42.521 -25.862 1.00 93.47  ? 702  GLU A CD  1 
ATOM   1902 O OE1 . GLU A 1 261 ? 51.123 -43.617 -25.434 1.00 90.28  ? 702  GLU A OE1 1 
ATOM   1903 O OE2 . GLU A 1 261 ? 52.555 -42.433 -26.618 1.00 96.41  ? 702  GLU A OE2 1 
ATOM   1904 N N   . ARG A 1 262 ? 49.904 -39.426 -21.033 1.00 74.98  ? 703  ARG A N   1 
ATOM   1905 C CA  . ARG A 1 262 ? 48.903 -39.318 -19.980 1.00 71.47  ? 703  ARG A CA  1 
ATOM   1906 C C   . ARG A 1 262 ? 48.345 -37.901 -20.000 1.00 73.12  ? 703  ARG A C   1 
ATOM   1907 O O   . ARG A 1 262 ? 49.105 -36.953 -20.174 1.00 74.85  ? 703  ARG A O   1 
ATOM   1908 C CB  . ARG A 1 262 ? 49.491 -39.659 -18.588 1.00 67.36  ? 703  ARG A CB  1 
ATOM   1909 C CG  . ARG A 1 262 ? 50.237 -40.990 -18.554 1.00 66.73  ? 703  ARG A CG  1 
ATOM   1910 C CD  . ARG A 1 262 ? 50.107 -41.759 -17.248 1.00 64.51  ? 703  ARG A CD  1 
ATOM   1911 N NE  . ARG A 1 262 ? 51.248 -41.576 -16.346 1.00 64.92  ? 703  ARG A NE  1 
ATOM   1912 C CZ  . ARG A 1 262 ? 52.316 -42.375 -16.246 1.00 64.30  ? 703  ARG A CZ  1 
ATOM   1913 N NH1 . ARG A 1 262 ? 52.459 -43.463 -16.998 1.00 63.49  ? 703  ARG A NH1 1 
ATOM   1914 N NH2 . ARG A 1 262 ? 53.270 -42.068 -15.373 1.00 64.89  ? 703  ARG A NH2 1 
ATOM   1915 N N   . PRO A 1 263 ? 47.015 -37.753 -19.834 1.00 73.84  ? 704  PRO A N   1 
ATOM   1916 C CA  . PRO A 1 263 ? 46.402 -36.429 -19.743 1.00 74.52  ? 704  PRO A CA  1 
ATOM   1917 C C   . PRO A 1 263 ? 46.646 -35.752 -18.406 1.00 72.54  ? 704  PRO A C   1 
ATOM   1918 O O   . PRO A 1 263 ? 46.961 -36.416 -17.428 1.00 69.80  ? 704  PRO A O   1 
ATOM   1919 C CB  . PRO A 1 263 ? 44.906 -36.721 -19.902 1.00 75.18  ? 704  PRO A CB  1 
ATOM   1920 C CG  . PRO A 1 263 ? 44.738 -38.114 -19.402 1.00 72.91  ? 704  PRO A CG  1 
ATOM   1921 C CD  . PRO A 1 263 ? 46.005 -38.829 -19.772 1.00 73.54  ? 704  PRO A CD  1 
ATOM   1922 N N   . LEU A 1 264 ? 46.482 -34.435 -18.382 1.00 76.01  ? 705  LEU A N   1 
ATOM   1923 C CA  . LEU A 1 264 ? 46.548 -33.652 -17.149 1.00 76.00  ? 705  LEU A CA  1 
ATOM   1924 C C   . LEU A 1 264 ? 45.138 -33.432 -16.598 1.00 75.02  ? 705  LEU A C   1 
ATOM   1925 O O   . LEU A 1 264 ? 44.142 -33.659 -17.280 1.00 77.58  ? 705  LEU A O   1 
ATOM   1926 C CB  . LEU A 1 264 ? 47.234 -32.316 -17.419 1.00 78.94  ? 705  LEU A CB  1 
ATOM   1927 C CG  . LEU A 1 264 ? 48.682 -32.464 -17.894 1.00 80.95  ? 705  LEU A CG  1 
ATOM   1928 C CD1 . LEU A 1 264 ? 49.122 -31.275 -18.742 1.00 85.95  ? 705  LEU A CD1 1 
ATOM   1929 C CD2 . LEU A 1 264 ? 49.609 -32.678 -16.707 1.00 79.18  ? 705  LEU A CD2 1 
ATOM   1930 N N   . PHE A 1 265 ? 45.051 -32.972 -15.365 1.00 72.85  ? 706  PHE A N   1 
ATOM   1931 C CA  . PHE A 1 265 ? 43.765 -32.927 -14.697 1.00 73.08  ? 706  PHE A CA  1 
ATOM   1932 C C   . PHE A 1 265 ? 42.723 -31.980 -15.287 1.00 74.73  ? 706  PHE A C   1 
ATOM   1933 O O   . PHE A 1 265 ? 41.541 -32.287 -15.215 1.00 76.04  ? 706  PHE A O   1 
ATOM   1934 C CB  . PHE A 1 265 ? 43.947 -32.698 -13.200 1.00 73.04  ? 706  PHE A CB  1 
ATOM   1935 C CG  . PHE A 1 265 ? 44.283 -33.952 -12.459 1.00 71.48  ? 706  PHE A CG  1 
ATOM   1936 C CD1 . PHE A 1 265 ? 43.308 -34.915 -12.237 1.00 72.00  ? 706  PHE A CD1 1 
ATOM   1937 C CD2 . PHE A 1 265 ? 45.571 -34.195 -12.017 1.00 71.14  ? 706  PHE A CD2 1 
ATOM   1938 C CE1 . PHE A 1 265 ? 43.603 -36.088 -11.562 1.00 70.68  ? 706  PHE A CE1 1 
ATOM   1939 C CE2 . PHE A 1 265 ? 45.876 -35.366 -11.345 1.00 69.52  ? 706  PHE A CE2 1 
ATOM   1940 C CZ  . PHE A 1 265 ? 44.889 -36.313 -11.112 1.00 69.76  ? 706  PHE A CZ  1 
ATOM   1941 N N   . PRO A 1 266 ? 43.137 -30.834 -15.858 1.00 76.79  ? 707  PRO A N   1 
ATOM   1942 C CA  . PRO A 1 266 ? 42.130 -30.032 -16.567 1.00 79.06  ? 707  PRO A CA  1 
ATOM   1943 C C   . PRO A 1 266 ? 41.331 -30.819 -17.619 1.00 79.82  ? 707  PRO A C   1 
ATOM   1944 O O   . PRO A 1 266 ? 40.104 -30.718 -17.631 1.00 79.16  ? 707  PRO A O   1 
ATOM   1945 C CB  . PRO A 1 266 ? 42.963 -28.923 -17.207 1.00 80.72  ? 707  PRO A CB  1 
ATOM   1946 C CG  . PRO A 1 266 ? 44.089 -28.718 -16.251 1.00 78.83  ? 707  PRO A CG  1 
ATOM   1947 C CD  . PRO A 1 266 ? 44.368 -30.057 -15.608 1.00 76.40  ? 707  PRO A CD  1 
ATOM   1948 N N   . GLN A 1 267 ? 42.006 -31.613 -18.457 1.00 80.55  ? 708  GLN A N   1 
ATOM   1949 C CA  . GLN A 1 267 ? 41.311 -32.420 -19.481 1.00 83.36  ? 708  GLN A CA  1 
ATOM   1950 C C   . GLN A 1 267 ? 40.498 -33.546 -18.845 1.00 80.34  ? 708  GLN A C   1 
ATOM   1951 O O   . GLN A 1 267 ? 39.373 -33.806 -19.247 1.00 83.06  ? 708  GLN A O   1 
ATOM   1952 C CB  . GLN A 1 267 ? 42.262 -33.082 -20.470 1.00 85.91  ? 708  GLN A CB  1 
ATOM   1953 C CG  . GLN A 1 267 ? 43.442 -32.278 -20.963 1.00 91.33  ? 708  GLN A CG  1 
ATOM   1954 C CD  . GLN A 1 267 ? 44.474 -33.187 -21.629 1.00 96.03  ? 708  GLN A CD  1 
ATOM   1955 O OE1 . GLN A 1 267 ? 45.614 -33.304 -21.157 1.00 97.82  ? 708  GLN A OE1 1 
ATOM   1956 N NE2 . GLN A 1 267 ? 44.069 -33.861 -22.715 1.00 96.92  ? 708  GLN A NE2 1 
ATOM   1957 N N   . ILE A 1 268 ? 41.096 -34.235 -17.879 1.00 76.10  ? 709  ILE A N   1 
ATOM   1958 C CA  . ILE A 1 268 ? 40.411 -35.288 -17.120 1.00 73.48  ? 709  ILE A CA  1 
ATOM   1959 C C   . ILE A 1 268 ? 39.101 -34.781 -16.527 1.00 75.39  ? 709  ILE A C   1 
ATOM   1960 O O   . ILE A 1 268 ? 38.055 -35.421 -16.621 1.00 75.22  ? 709  ILE A O   1 
ATOM   1961 C CB  . ILE A 1 268 ? 41.283 -35.764 -15.954 1.00 69.09  ? 709  ILE A CB  1 
ATOM   1962 C CG1 . ILE A 1 268 ? 42.496 -36.513 -16.498 1.00 68.67  ? 709  ILE A CG1 1 
ATOM   1963 C CG2 . ILE A 1 268 ? 40.484 -36.663 -15.035 1.00 68.16  ? 709  ILE A CG2 1 
ATOM   1964 C CD1 . ILE A 1 268 ? 43.617 -36.713 -15.504 1.00 67.10  ? 709  ILE A CD1 1 
ATOM   1965 N N   . LEU A 1 269 ? 39.190 -33.620 -15.899 1.00 76.28  ? 710  LEU A N   1 
ATOM   1966 C CA  . LEU A 1 269 ? 38.055 -33.007 -15.256 1.00 77.66  ? 710  LEU A CA  1 
ATOM   1967 C C   . LEU A 1 269 ? 36.982 -32.705 -16.290 1.00 81.60  ? 710  LEU A C   1 
ATOM   1968 O O   . LEU A 1 269 ? 35.808 -33.003 -16.089 1.00 83.63  ? 710  LEU A O   1 
ATOM   1969 C CB  . LEU A 1 269 ? 38.500 -31.726 -14.556 1.00 77.44  ? 710  LEU A CB  1 
ATOM   1970 C CG  . LEU A 1 269 ? 37.701 -31.328 -13.334 1.00 79.10  ? 710  LEU A CG  1 
ATOM   1971 C CD1 . LEU A 1 269 ? 37.889 -32.353 -12.236 1.00 77.77  ? 710  LEU A CD1 1 
ATOM   1972 C CD2 . LEU A 1 269 ? 38.150 -29.961 -12.853 1.00 81.10  ? 710  LEU A CD2 1 
ATOM   1973 N N   . ALA A 1 270 ? 37.396 -32.117 -17.405 1.00 83.94  ? 711  ALA A N   1 
ATOM   1974 C CA  . ALA A 1 270 ? 36.470 -31.798 -18.481 1.00 87.89  ? 711  ALA A CA  1 
ATOM   1975 C C   . ALA A 1 270 ? 35.818 -33.081 -18.986 1.00 88.85  ? 711  ALA A C   1 
ATOM   1976 O O   . ALA A 1 270 ? 34.609 -33.131 -19.193 1.00 92.65  ? 711  ALA A O   1 
ATOM   1977 C CB  . ALA A 1 270 ? 37.204 -31.092 -19.608 1.00 88.80  ? 711  ALA A CB  1 
ATOM   1978 N N   . SER A 1 271 ? 36.636 -34.116 -19.167 1.00 86.82  ? 712  SER A N   1 
ATOM   1979 C CA  . SER A 1 271 ? 36.160 -35.420 -19.615 1.00 86.23  ? 712  SER A CA  1 
ATOM   1980 C C   . SER A 1 271 ? 35.059 -35.940 -18.720 1.00 85.39  ? 712  SER A C   1 
ATOM   1981 O O   . SER A 1 271 ? 33.975 -36.258 -19.194 1.00 89.10  ? 712  SER A O   1 
ATOM   1982 C CB  . SER A 1 271 ? 37.299 -36.446 -19.659 1.00 82.90  ? 712  SER A CB  1 
ATOM   1983 O OG  . SER A 1 271 ? 37.838 -36.541 -20.963 1.00 83.90  ? 712  SER A OG  1 
ATOM   1984 N N   . ILE A 1 272 ? 35.337 -36.021 -17.428 1.00 82.07  ? 713  ILE A N   1 
ATOM   1985 C CA  . ILE A 1 272 ? 34.353 -36.530 -16.488 1.00 82.95  ? 713  ILE A CA  1 
ATOM   1986 C C   . ILE A 1 272 ? 33.049 -35.742 -16.624 1.00 89.13  ? 713  ILE A C   1 
ATOM   1987 O O   . ILE A 1 272 ? 31.981 -36.328 -16.790 1.00 90.37  ? 713  ILE A O   1 
ATOM   1988 C CB  . ILE A 1 272 ? 34.865 -36.480 -15.037 1.00 79.03  ? 713  ILE A CB  1 
ATOM   1989 C CG1 . ILE A 1 272 ? 36.072 -37.405 -14.891 1.00 74.62  ? 713  ILE A CG1 1 
ATOM   1990 C CG2 . ILE A 1 272 ? 33.768 -36.901 -14.063 1.00 80.22  ? 713  ILE A CG2 1 
ATOM   1991 C CD1 . ILE A 1 272 ? 36.602 -37.494 -13.482 1.00 73.56  ? 713  ILE A CD1 1 
ATOM   1992 N N   . GLU A 1 273 ? 33.150 -34.416 -16.589 1.00 93.70  ? 714  GLU A N   1 
ATOM   1993 C CA  . GLU A 1 273 ? 31.970 -33.537 -16.614 1.00 99.70  ? 714  GLU A CA  1 
ATOM   1994 C C   . GLU A 1 273 ? 31.101 -33.686 -17.871 1.00 102.78 ? 714  GLU A C   1 
ATOM   1995 O O   . GLU A 1 273 ? 29.893 -33.438 -17.822 1.00 108.75 ? 714  GLU A O   1 
ATOM   1996 C CB  . GLU A 1 273 ? 32.393 -32.072 -16.438 1.00 102.50 ? 714  GLU A CB  1 
ATOM   1997 C CG  . GLU A 1 273 ? 32.939 -31.754 -15.049 1.00 102.55 ? 714  GLU A CG  1 
ATOM   1998 C CD  . GLU A 1 273 ? 33.509 -30.348 -14.932 1.00 105.03 ? 714  GLU A CD  1 
ATOM   1999 O OE1 . GLU A 1 273 ? 33.261 -29.698 -13.892 1.00 107.66 ? 714  GLU A OE1 1 
ATOM   2000 O OE2 . GLU A 1 273 ? 34.205 -29.891 -15.869 1.00 104.96 ? 714  GLU A OE2 1 
ATOM   2001 N N   . LEU A 1 274 ? 31.706 -34.088 -18.987 1.00 100.42 ? 715  LEU A N   1 
ATOM   2002 C CA  . LEU A 1 274 ? 30.961 -34.304 -20.229 1.00 103.43 ? 715  LEU A CA  1 
ATOM   2003 C C   . LEU A 1 274 ? 30.138 -35.590 -20.176 1.00 104.55 ? 715  LEU A C   1 
ATOM   2004 O O   . LEU A 1 274 ? 28.953 -35.577 -20.502 1.00 110.42 ? 715  LEU A O   1 
ATOM   2005 C CB  . LEU A 1 274 ? 31.908 -34.328 -21.431 1.00 101.87 ? 715  LEU A CB  1 
ATOM   2006 C CG  . LEU A 1 274 ? 31.351 -34.785 -22.781 1.00 104.52 ? 715  LEU A CG  1 
ATOM   2007 C CD1 . LEU A 1 274 ? 30.088 -34.039 -23.189 1.00 109.43 ? 715  LEU A CD1 1 
ATOM   2008 C CD2 . LEU A 1 274 ? 32.433 -34.618 -23.832 1.00 103.85 ? 715  LEU A CD2 1 
ATOM   2009 N N   . LEU A 1 275 ? 30.764 -36.694 -19.772 1.00 100.77 ? 716  LEU A N   1 
ATOM   2010 C CA  . LEU A 1 275 ? 30.060 -37.976 -19.660 1.00 102.14 ? 716  LEU A CA  1 
ATOM   2011 C C   . LEU A 1 275 ? 29.188 -38.041 -18.410 1.00 103.86 ? 716  LEU A C   1 
ATOM   2012 O O   . LEU A 1 275 ? 28.290 -38.879 -18.319 1.00 106.36 ? 716  LEU A O   1 
ATOM   2013 C CB  . LEU A 1 275 ? 31.045 -39.148 -19.674 1.00 99.79  ? 716  LEU A CB  1 
ATOM   2014 C CG  . LEU A 1 275 ? 31.836 -39.448 -18.391 1.00 97.86  ? 716  LEU A CG  1 
ATOM   2015 C CD1 . LEU A 1 275 ? 31.052 -40.314 -17.408 1.00 99.07  ? 716  LEU A CD1 1 
ATOM   2016 C CD2 . LEU A 1 275 ? 33.166 -40.123 -18.712 1.00 95.06  ? 716  LEU A CD2 1 
ATOM   2017 N N   . ALA A 1 276 ? 29.471 -37.171 -17.441 1.00 103.70 ? 717  ALA A N   1 
ATOM   2018 C CA  . ALA A 1 276 ? 28.690 -37.094 -16.209 1.00 105.48 ? 717  ALA A CA  1 
ATOM   2019 C C   . ALA A 1 276 ? 27.287 -36.581 -16.480 1.00 113.04 ? 717  ALA A C   1 
ATOM   2020 O O   . ALA A 1 276 ? 26.308 -37.230 -16.113 1.00 116.65 ? 717  ALA A O   1 
ATOM   2021 C CB  . ALA A 1 276 ? 29.381 -36.193 -15.200 1.00 103.31 ? 717  ALA A CB  1 
ATOM   2022 N N   . ARG A 1 277 ? 27.201 -35.412 -17.116 1.00 116.93 ? 718  ARG A N   1 
ATOM   2023 C CA  . ARG A 1 277 ? 25.910 -34.808 -17.468 1.00 124.06 ? 718  ARG A CA  1 
ATOM   2024 C C   . ARG A 1 277 ? 25.169 -35.672 -18.491 1.00 127.75 ? 718  ARG A C   1 
ATOM   2025 O O   . ARG A 1 277 ? 23.942 -35.641 -18.565 1.00 132.75 ? 718  ARG A O   1 
ATOM   2026 C CB  . ARG A 1 277 ? 26.092 -33.372 -17.991 1.00 126.18 ? 718  ARG A CB  1 
ATOM   2027 C CG  . ARG A 1 277 ? 26.810 -33.263 -19.332 1.00 126.43 ? 718  ARG A CG  1 
ATOM   2028 C CD  . ARG A 1 277 ? 27.057 -31.817 -19.744 1.00 129.00 ? 718  ARG A CD  1 
ATOM   2029 N NE  . ARG A 1 277 ? 27.685 -31.725 -21.069 1.00 130.37 ? 718  ARG A NE  1 
ATOM   2030 C CZ  . ARG A 1 277 ? 27.038 -31.687 -22.241 1.00 135.10 ? 718  ARG A CZ  1 
ATOM   2031 N NH1 . ARG A 1 277 ? 25.708 -31.726 -22.298 1.00 140.61 ? 718  ARG A NH1 1 
ATOM   2032 N NH2 . ARG A 1 277 ? 27.730 -31.608 -23.376 1.00 133.83 ? 718  ARG A NH2 1 
ATOM   2033 N N   . SER A 1 278 ? 25.926 -36.451 -19.263 1.00 126.12 ? 719  SER A N   1 
ATOM   2034 C CA  . SER A 1 278 ? 25.371 -37.384 -20.245 1.00 130.17 ? 719  SER A CA  1 
ATOM   2035 C C   . SER A 1 278 ? 24.923 -38.710 -19.593 1.00 131.82 ? 719  SER A C   1 
ATOM   2036 O O   . SER A 1 278 ? 25.443 -39.776 -19.915 1.00 127.57 ? 719  SER A O   1 
ATOM   2037 C CB  . SER A 1 278 ? 26.418 -37.642 -21.334 1.00 126.44 ? 719  SER A CB  1 
ATOM   2038 O OG  . SER A 1 278 ? 25.852 -38.302 -22.447 1.00 130.47 ? 719  SER A OG  1 
ATOM   2039 N N   . LEU A 1 279 ? 23.941 -38.629 -18.692 1.00 138.55 ? 720  LEU A N   1 
ATOM   2040 C CA  . LEU A 1 279 ? 23.509 -39.773 -17.869 1.00 142.04 ? 720  LEU A CA  1 
ATOM   2041 C C   . LEU A 1 279 ? 22.106 -39.472 -17.309 1.00 151.66 ? 720  LEU A C   1 
ATOM   2042 O O   . LEU A 1 279 ? 21.641 -38.335 -17.438 1.00 155.65 ? 720  LEU A O   1 
ATOM   2043 C CB  . LEU A 1 279 ? 24.510 -39.985 -16.721 1.00 136.05 ? 720  LEU A CB  1 
ATOM   2044 C CG  . LEU A 1 279 ? 24.959 -41.396 -16.337 1.00 133.01 ? 720  LEU A CG  1 
ATOM   2045 C CD1 . LEU A 1 279 ? 25.529 -42.146 -17.531 1.00 131.91 ? 720  LEU A CD1 1 
ATOM   2046 C CD2 . LEU A 1 279 ? 25.994 -41.309 -15.228 1.00 127.27 ? 720  LEU A CD2 1 
ATOM   2047 N N   . PRO A 1 280 ? 21.415 -40.482 -16.715 1.00 157.24 ? 721  PRO A N   1 
ATOM   2048 C CA  . PRO A 1 280 ? 20.154 -40.204 -16.001 1.00 163.71 ? 721  PRO A CA  1 
ATOM   2049 C C   . PRO A 1 280 ? 20.302 -40.234 -14.477 1.00 163.24 ? 721  PRO A C   1 
ATOM   2050 O O   . PRO A 1 280 ? 20.589 -39.207 -13.857 1.00 162.75 ? 721  PRO A O   1 
ATOM   2051 C CB  . PRO A 1 280 ? 19.236 -41.345 -16.458 1.00 165.88 ? 721  PRO A CB  1 
ATOM   2052 C CG  . PRO A 1 280 ? 20.156 -42.449 -16.898 1.00 160.60 ? 721  PRO A CG  1 
ATOM   2053 C CD  . PRO A 1 280 ? 21.577 -41.934 -16.919 1.00 154.52 ? 721  PRO A CD  1 
ATOM   2054 N N   . ASP B 1 6   ? 53.434 -17.133 0.805   1.00 122.28 ? 447  ASP B N   1 
ATOM   2055 C CA  . ASP B 1 6   ? 52.408 -16.877 1.868   1.00 122.04 ? 447  ASP B CA  1 
ATOM   2056 C C   . ASP B 1 6   ? 51.183 -16.059 1.383   1.00 115.30 ? 447  ASP B C   1 
ATOM   2057 O O   . ASP B 1 6   ? 50.456 -15.488 2.207   1.00 116.47 ? 447  ASP B O   1 
ATOM   2058 C CB  . ASP B 1 6   ? 53.084 -16.170 3.064   1.00 130.02 ? 447  ASP B CB  1 
ATOM   2059 C CG  . ASP B 1 6   ? 52.171 -16.048 4.278   1.00 131.34 ? 447  ASP B CG  1 
ATOM   2060 O OD1 . ASP B 1 6   ? 51.639 -17.084 4.735   1.00 131.07 ? 447  ASP B OD1 1 
ATOM   2061 O OD2 . ASP B 1 6   ? 51.994 -14.911 4.774   1.00 133.07 ? 447  ASP B OD2 1 
ATOM   2062 N N   . ASP B 1 7   ? 50.927 -16.022 0.071   1.00 107.19 ? 448  ASP B N   1 
ATOM   2063 C CA  . ASP B 1 7   ? 49.950 -15.074 -0.484  1.00 99.79  ? 448  ASP B CA  1 
ATOM   2064 C C   . ASP B 1 7   ? 48.803 -15.742 -1.248  1.00 90.67  ? 448  ASP B C   1 
ATOM   2065 O O   . ASP B 1 7   ? 48.952 -16.824 -1.804  1.00 86.49  ? 448  ASP B O   1 
ATOM   2066 C CB  . ASP B 1 7   ? 50.665 -14.055 -1.369  1.00 103.15 ? 448  ASP B CB  1 
ATOM   2067 C CG  . ASP B 1 7   ? 49.879 -12.763 -1.535  1.00 104.40 ? 448  ASP B CG  1 
ATOM   2068 O OD1 . ASP B 1 7   ? 50.422 -11.840 -2.184  1.00 108.06 ? 448  ASP B OD1 1 
ATOM   2069 O OD2 . ASP B 1 7   ? 48.737 -12.664 -1.013  1.00 98.00  ? 448  ASP B OD2 1 
ATOM   2070 N N   . TRP B 1 8   ? 47.655 -15.068 -1.265  1.00 85.38  ? 449  TRP B N   1 
ATOM   2071 C CA  . TRP B 1 8   ? 46.416 -15.650 -1.770  1.00 78.99  ? 449  TRP B CA  1 
ATOM   2072 C C   . TRP B 1 8   ? 45.834 -14.925 -2.976  1.00 77.79  ? 449  TRP B C   1 
ATOM   2073 O O   . TRP B 1 8   ? 44.652 -15.060 -3.255  1.00 76.34  ? 449  TRP B O   1 
ATOM   2074 C CB  . TRP B 1 8   ? 45.380 -15.694 -0.636  1.00 75.89  ? 449  TRP B CB  1 
ATOM   2075 C CG  . TRP B 1 8   ? 45.711 -16.726 0.392   1.00 75.99  ? 449  TRP B CG  1 
ATOM   2076 C CD1 . TRP B 1 8   ? 46.287 -16.526 1.616   1.00 78.04  ? 449  TRP B CD1 1 
ATOM   2077 C CD2 . TRP B 1 8   ? 45.514 -18.133 0.268   1.00 73.67  ? 449  TRP B CD2 1 
ATOM   2078 N NE1 . TRP B 1 8   ? 46.443 -17.726 2.271   1.00 77.02  ? 449  TRP B NE1 1 
ATOM   2079 C CE2 . TRP B 1 8   ? 45.981 -18.728 1.461   1.00 75.10  ? 449  TRP B CE2 1 
ATOM   2080 C CE3 . TRP B 1 8   ? 44.977 -18.949 -0.734  1.00 70.61  ? 449  TRP B CE3 1 
ATOM   2081 C CZ2 . TRP B 1 8   ? 45.935 -20.097 1.672   1.00 74.22  ? 449  TRP B CZ2 1 
ATOM   2082 C CZ3 . TRP B 1 8   ? 44.925 -20.296 -0.525  1.00 70.06  ? 449  TRP B CZ3 1 
ATOM   2083 C CH2 . TRP B 1 8   ? 45.411 -20.867 0.667   1.00 72.43  ? 449  TRP B CH2 1 
ATOM   2084 N N   . GLU B 1 9   ? 46.637 -14.164 -3.710  1.00 80.92  ? 450  GLU B N   1 
ATOM   2085 C CA  . GLU B 1 9   ? 46.085 -13.468 -4.865  1.00 82.13  ? 450  GLU B CA  1 
ATOM   2086 C C   . GLU B 1 9   ? 45.849 -14.486 -5.967  1.00 80.71  ? 450  GLU B C   1 
ATOM   2087 O O   . GLU B 1 9   ? 46.623 -15.419 -6.115  1.00 82.06  ? 450  GLU B O   1 
ATOM   2088 C CB  . GLU B 1 9   ? 46.995 -12.334 -5.356  1.00 86.18  ? 450  GLU B CB  1 
ATOM   2089 C CG  . GLU B 1 9   ? 46.543 -11.746 -6.691  1.00 86.69  ? 450  GLU B CG  1 
ATOM   2090 C CD  . GLU B 1 9   ? 46.903 -10.288 -6.874  1.00 90.62  ? 450  GLU B CD  1 
ATOM   2091 O OE1 . GLU B 1 9   ? 48.013 -9.889  -6.469  1.00 92.34  ? 450  GLU B OE1 1 
ATOM   2092 O OE2 . GLU B 1 9   ? 46.066 -9.545  -7.439  1.00 92.25  ? 450  GLU B OE2 1 
ATOM   2093 N N   . ILE B 1 10  ? 44.773 -14.300 -6.726  1.00 80.64  ? 451  ILE B N   1 
ATOM   2094 C CA  . ILE B 1 10  ? 44.446 -15.163 -7.858  1.00 81.03  ? 451  ILE B CA  1 
ATOM   2095 C C   . ILE B 1 10  ? 44.702 -14.439 -9.195  1.00 85.57  ? 451  ILE B C   1 
ATOM   2096 O O   . ILE B 1 10  ? 44.085 -13.401 -9.470  1.00 85.34  ? 451  ILE B O   1 
ATOM   2097 C CB  . ILE B 1 10  ? 42.976 -15.582 -7.788  1.00 79.20  ? 451  ILE B CB  1 
ATOM   2098 C CG1 . ILE B 1 10  ? 42.707 -16.286 -6.459  1.00 77.81  ? 451  ILE B CG1 1 
ATOM   2099 C CG2 . ILE B 1 10  ? 42.614 -16.476 -8.968  1.00 79.51  ? 451  ILE B CG2 1 
ATOM   2100 C CD1 . ILE B 1 10  ? 41.235 -16.473 -6.156  1.00 77.33  ? 451  ILE B CD1 1 
ATOM   2101 N N   . PRO B 1 11  ? 45.605 -14.989 -10.038 1.00 88.73  ? 452  PRO B N   1 
ATOM   2102 C CA  . PRO B 1 11  ? 45.904 -14.322 -11.312 1.00 92.76  ? 452  PRO B CA  1 
ATOM   2103 C C   . PRO B 1 11  ? 44.674 -13.978 -12.150 1.00 92.91  ? 452  PRO B C   1 
ATOM   2104 O O   . PRO B 1 11  ? 43.650 -14.661 -12.079 1.00 90.07  ? 452  PRO B O   1 
ATOM   2105 C CB  . PRO B 1 11  ? 46.801 -15.331 -12.033 1.00 94.16  ? 452  PRO B CB  1 
ATOM   2106 C CG  . PRO B 1 11  ? 47.508 -16.038 -10.922 1.00 92.11  ? 452  PRO B CG  1 
ATOM   2107 C CD  . PRO B 1 11  ? 46.504 -16.140 -9.806  1.00 87.53  ? 452  PRO B CD  1 
ATOM   2108 N N   . ASP B 1 12  ? 44.803 -12.909 -12.925 1.00 97.27  ? 453  ASP B N   1 
ATOM   2109 C CA  . ASP B 1 12  ? 43.727 -12.383 -13.753 1.00 99.46  ? 453  ASP B CA  1 
ATOM   2110 C C   . ASP B 1 12  ? 43.163 -13.440 -14.693 1.00 97.15  ? 453  ASP B C   1 
ATOM   2111 O O   . ASP B 1 12  ? 43.916 -14.186 -15.317 1.00 98.38  ? 453  ASP B O   1 
ATOM   2112 C CB  . ASP B 1 12  ? 44.263 -11.194 -14.566 1.00 107.68 ? 453  ASP B CB  1 
ATOM   2113 C CG  . ASP B 1 12  ? 43.306 -10.731 -15.667 1.00 112.67 ? 453  ASP B CG  1 
ATOM   2114 O OD1 . ASP B 1 12  ? 42.122 -10.449 -15.369 1.00 112.91 ? 453  ASP B OD1 1 
ATOM   2115 O OD2 . ASP B 1 12  ? 43.756 -10.632 -16.831 1.00 116.08 ? 453  ASP B OD2 1 
ATOM   2116 N N   . GLY B 1 13  ? 41.837 -13.508 -14.768 1.00 93.65  ? 454  GLY B N   1 
ATOM   2117 C CA  . GLY B 1 13  ? 41.158 -14.250 -15.822 1.00 94.86  ? 454  GLY B CA  1 
ATOM   2118 C C   . GLY B 1 13  ? 40.977 -15.738 -15.608 1.00 92.05  ? 454  GLY B C   1 
ATOM   2119 O O   . GLY B 1 13  ? 40.621 -16.444 -16.542 1.00 93.14  ? 454  GLY B O   1 
ATOM   2120 N N   . GLN B 1 14  ? 41.215 -16.217 -14.389 1.00 89.79  ? 455  GLN B N   1 
ATOM   2121 C CA  . GLN B 1 14  ? 40.942 -17.623 -14.030 1.00 87.79  ? 455  GLN B CA  1 
ATOM   2122 C C   . GLN B 1 14  ? 39.529 -17.833 -13.487 1.00 84.18  ? 455  GLN B C   1 
ATOM   2123 O O   . GLN B 1 14  ? 39.009 -18.949 -13.500 1.00 81.95  ? 455  GLN B O   1 
ATOM   2124 C CB  . GLN B 1 14  ? 41.952 -18.116 -12.991 1.00 85.51  ? 455  GLN B CB  1 
ATOM   2125 C CG  . GLN B 1 14  ? 43.387 -18.088 -13.492 1.00 87.49  ? 455  GLN B CG  1 
ATOM   2126 C CD  . GLN B 1 14  ? 44.376 -18.640 -12.489 1.00 83.54  ? 455  GLN B CD  1 
ATOM   2127 O OE1 . GLN B 1 14  ? 44.057 -18.832 -11.325 1.00 80.50  ? 455  GLN B OE1 1 
ATOM   2128 N NE2 . GLN B 1 14  ? 45.588 -18.893 -12.941 1.00 86.41  ? 455  GLN B NE2 1 
ATOM   2129 N N   . ILE B 1 15  ? 38.919 -16.756 -13.007 1.00 83.78  ? 456  ILE B N   1 
ATOM   2130 C CA  . ILE B 1 15  ? 37.581 -16.813 -12.447 1.00 83.20  ? 456  ILE B CA  1 
ATOM   2131 C C   . ILE B 1 15  ? 36.544 -16.579 -13.542 1.00 86.02  ? 456  ILE B C   1 
ATOM   2132 O O   . ILE B 1 15  ? 36.692 -15.667 -14.361 1.00 88.43  ? 456  ILE B O   1 
ATOM   2133 C CB  . ILE B 1 15  ? 37.406 -15.764 -11.338 1.00 82.91  ? 456  ILE B CB  1 
ATOM   2134 C CG1 . ILE B 1 15  ? 38.489 -15.965 -10.279 1.00 82.22  ? 456  ILE B CG1 1 
ATOM   2135 C CG2 . ILE B 1 15  ? 36.023 -15.878 -10.707 1.00 83.41  ? 456  ILE B CG2 1 
ATOM   2136 C CD1 . ILE B 1 15  ? 38.478 -14.946 -9.164  1.00 82.34  ? 456  ILE B CD1 1 
ATOM   2137 N N   . THR B 1 16  ? 35.516 -17.426 -13.563 1.00 85.77  ? 457  THR B N   1 
ATOM   2138 C CA  . THR B 1 16  ? 34.349 -17.236 -14.421 1.00 89.15  ? 457  THR B CA  1 
ATOM   2139 C C   . THR B 1 16  ? 33.212 -16.778 -13.528 1.00 88.82  ? 457  THR B C   1 
ATOM   2140 O O   . THR B 1 16  ? 32.683 -17.546 -12.734 1.00 88.94  ? 457  THR B O   1 
ATOM   2141 C CB  . THR B 1 16  ? 33.918 -18.530 -15.151 1.00 89.73  ? 457  THR B CB  1 
ATOM   2142 O OG1 . THR B 1 16  ? 35.067 -19.190 -15.686 1.00 90.87  ? 457  THR B OG1 1 
ATOM   2143 C CG2 . THR B 1 16  ? 32.938 -18.223 -16.284 1.00 92.96  ? 457  THR B CG2 1 
ATOM   2144 N N   . VAL B 1 17  ? 32.858 -15.510 -13.647 1.00 91.85  ? 458  VAL B N   1 
ATOM   2145 C CA  . VAL B 1 17  ? 31.712 -14.965 -12.946 1.00 91.74  ? 458  VAL B CA  1 
ATOM   2146 C C   . VAL B 1 17  ? 30.462 -15.406 -13.696 1.00 92.85  ? 458  VAL B C   1 
ATOM   2147 O O   . VAL B 1 17  ? 30.342 -15.179 -14.901 1.00 95.57  ? 458  VAL B O   1 
ATOM   2148 C CB  . VAL B 1 17  ? 31.789 -13.430 -12.887 1.00 94.96  ? 458  VAL B CB  1 
ATOM   2149 C CG1 . VAL B 1 17  ? 30.504 -12.844 -12.318 1.00 96.72  ? 458  VAL B CG1 1 
ATOM   2150 C CG2 . VAL B 1 17  ? 33.006 -13.005 -12.069 1.00 92.82  ? 458  VAL B CG2 1 
ATOM   2151 N N   . GLY B 1 18  ? 29.543 -16.043 -12.977 1.00 90.39  ? 459  GLY B N   1 
ATOM   2152 C CA  . GLY B 1 18  ? 28.340 -16.597 -13.578 1.00 92.85  ? 459  GLY B CA  1 
ATOM   2153 C C   . GLY B 1 18  ? 27.098 -15.786 -13.272 1.00 95.68  ? 459  GLY B C   1 
ATOM   2154 O O   . GLY B 1 18  ? 26.989 -14.624 -13.654 1.00 98.04  ? 459  GLY B O   1 
ATOM   2155 N N   . GLN B 1 19  ? 26.155 -16.416 -12.584 1.00 95.97  ? 460  GLN B N   1 
ATOM   2156 C CA  . GLN B 1 19  ? 24.851 -15.829 -12.333 1.00 100.66 ? 460  GLN B CA  1 
ATOM   2157 C C   . GLN B 1 19  ? 24.935 -14.915 -11.122 1.00 100.09 ? 460  GLN B C   1 
ATOM   2158 O O   . GLN B 1 19  ? 25.708 -15.164 -10.206 1.00 96.57  ? 460  GLN B O   1 
ATOM   2159 C CB  . GLN B 1 19  ? 23.840 -16.944 -12.074 1.00 102.37 ? 460  GLN B CB  1 
ATOM   2160 C CG  . GLN B 1 19  ? 22.386 -16.504 -12.081 1.00 108.58 ? 460  GLN B CG  1 
ATOM   2161 C CD  . GLN B 1 19  ? 21.483 -17.447 -11.302 1.00 110.16 ? 460  GLN B CD  1 
ATOM   2162 O OE1 . GLN B 1 19  ? 21.949 -18.273 -10.514 1.00 107.99 ? 460  GLN B OE1 1 
ATOM   2163 N NE2 . GLN B 1 19  ? 20.180 -17.322 -11.515 1.00 115.68 ? 460  GLN B NE2 1 
ATOM   2164 N N   . ARG B 1 20  ? 24.122 -13.865 -11.123 1.00 105.77 ? 461  ARG B N   1 
ATOM   2165 C CA  . ARG B 1 20  ? 24.065 -12.903 -10.024 1.00 106.18 ? 461  ARG B CA  1 
ATOM   2166 C C   . ARG B 1 20  ? 23.135 -13.425 -8.925  1.00 106.11 ? 461  ARG B C   1 
ATOM   2167 O O   . ARG B 1 20  ? 22.004 -13.806 -9.213  1.00 109.15 ? 461  ARG B O   1 
ATOM   2168 C CB  . ARG B 1 20  ? 23.540 -11.575 -10.571 1.00 111.82 ? 461  ARG B CB  1 
ATOM   2169 C CG  . ARG B 1 20  ? 23.716 -10.372 -9.666  1.00 113.17 ? 461  ARG B CG  1 
ATOM   2170 C CD  . ARG B 1 20  ? 23.194 -9.127  -10.374 1.00 120.17 ? 461  ARG B CD  1 
ATOM   2171 N NE  . ARG B 1 20  ? 22.521 -8.197  -9.472  1.00 124.36 ? 461  ARG B NE  1 
ATOM   2172 C CZ  . ARG B 1 20  ? 21.361 -8.436  -8.860  1.00 128.18 ? 461  ARG B CZ  1 
ATOM   2173 N NH1 . ARG B 1 20  ? 20.720 -9.592  -9.021  1.00 128.47 ? 461  ARG B NH1 1 
ATOM   2174 N NH2 . ARG B 1 20  ? 20.837 -7.515  -8.065  1.00 132.59 ? 461  ARG B NH2 1 
ATOM   2175 N N   . ILE B 1 21  ? 23.604 -13.443 -7.678  1.00 103.04 ? 462  ILE B N   1 
ATOM   2176 C CA  . ILE B 1 21  ? 22.775 -13.910 -6.556  1.00 105.58 ? 462  ILE B CA  1 
ATOM   2177 C C   . ILE B 1 21  ? 22.122 -12.751 -5.809  1.00 109.35 ? 462  ILE B C   1 
ATOM   2178 O O   . ILE B 1 21  ? 20.945 -12.820 -5.476  1.00 111.62 ? 462  ILE B O   1 
ATOM   2179 C CB  . ILE B 1 21  ? 23.572 -14.771 -5.546  1.00 101.62 ? 462  ILE B CB  1 
ATOM   2180 C CG1 . ILE B 1 21  ? 24.273 -15.950 -6.249  1.00 98.95  ? 462  ILE B CG1 1 
ATOM   2181 C CG2 . ILE B 1 21  ? 22.652 -15.285 -4.442  1.00 103.00 ? 462  ILE B CG2 1 
ATOM   2182 C CD1 . ILE B 1 21  ? 23.345 -16.914 -6.975  1.00 101.27 ? 462  ILE B CD1 1 
ATOM   2183 N N   . GLY B 1 22  ? 22.897 -11.704 -5.531  1.00 110.67 ? 463  GLY B N   1 
ATOM   2184 C CA  . GLY B 1 22  ? 22.387 -10.517 -4.840  1.00 116.16 ? 463  GLY B CA  1 
ATOM   2185 C C   . GLY B 1 22  ? 23.365 -9.359  -4.863  1.00 117.29 ? 463  GLY B C   1 
ATOM   2186 O O   . GLY B 1 22  ? 24.563 -9.549  -5.085  1.00 110.84 ? 463  GLY B O   1 
ATOM   2187 N N   . SER B 1 23  ? 22.859 -8.154  -4.615  1.00 125.96 ? 464  SER B N   1 
ATOM   2188 C CA  . SER B 1 23  ? 23.654 -6.951  -4.840  1.00 131.32 ? 464  SER B CA  1 
ATOM   2189 C C   . SER B 1 23  ? 23.230 -5.768  -3.974  1.00 138.72 ? 464  SER B C   1 
ATOM   2190 O O   . SER B 1 23  ? 22.181 -5.163  -4.201  1.00 146.47 ? 464  SER B O   1 
ATOM   2191 C CB  . SER B 1 23  ? 23.566 -6.551  -6.318  1.00 134.82 ? 464  SER B CB  1 
ATOM   2192 O OG  . SER B 1 23  ? 24.472 -5.507  -6.631  1.00 136.56 ? 464  SER B OG  1 
ATOM   2193 N N   . GLY B 1 24  ? 24.055 -5.447  -2.980  1.00 140.02 ? 465  GLY B N   1 
ATOM   2194 C CA  . GLY B 1 24  ? 23.966 -4.167  -2.268  1.00 146.90 ? 465  GLY B CA  1 
ATOM   2195 C C   . GLY B 1 24  ? 25.172 -3.307  -2.619  1.00 147.05 ? 465  GLY B C   1 
ATOM   2196 O O   . GLY B 1 24  ? 26.015 -3.715  -3.428  1.00 145.05 ? 465  GLY B O   1 
ATOM   2197 N N   . SER B 1 25  ? 25.271 -2.125  -2.008  1.00 148.77 ? 466  SER B N   1 
ATOM   2198 C CA  . SER B 1 25  ? 26.422 -1.233  -2.235  1.00 145.93 ? 466  SER B CA  1 
ATOM   2199 C C   . SER B 1 25  ? 27.712 -1.651  -1.486  1.00 138.95 ? 466  SER B C   1 
ATOM   2200 O O   . SER B 1 25  ? 28.731 -0.960  -1.589  1.00 137.41 ? 466  SER B O   1 
ATOM   2201 C CB  . SER B 1 25  ? 26.051 0.217   -1.897  1.00 152.61 ? 466  SER B CB  1 
ATOM   2202 O OG  . SER B 1 25  ? 25.869 0.395   -0.504  1.00 155.09 ? 466  SER B OG  1 
ATOM   2203 N N   . PHE B 1 26  ? 27.667 -2.768  -0.746  1.00 133.40 ? 467  PHE B N   1 
ATOM   2204 C CA  . PHE B 1 26  ? 28.865 -3.364  -0.125  1.00 125.23 ? 467  PHE B CA  1 
ATOM   2205 C C   . PHE B 1 26  ? 29.392 -4.554  -0.947  1.00 117.42 ? 467  PHE B C   1 
ATOM   2206 O O   . PHE B 1 26  ? 29.869 -5.539  -0.373  1.00 113.38 ? 467  PHE B O   1 
ATOM   2207 C CB  . PHE B 1 26  ? 28.571 -3.828  1.316   1.00 124.26 ? 467  PHE B CB  1 
ATOM   2208 C CG  . PHE B 1 26  ? 27.843 -2.812  2.160   1.00 131.07 ? 467  PHE B CG  1 
ATOM   2209 C CD1 . PHE B 1 26  ? 26.860 -3.220  3.054   1.00 133.21 ? 467  PHE B CD1 1 
ATOM   2210 C CD2 . PHE B 1 26  ? 28.132 -1.446  2.065   1.00 135.53 ? 467  PHE B CD2 1 
ATOM   2211 C CE1 . PHE B 1 26  ? 26.181 -2.292  3.837   1.00 140.19 ? 467  PHE B CE1 1 
ATOM   2212 C CE2 . PHE B 1 26  ? 27.450 -0.515  2.842   1.00 141.28 ? 467  PHE B CE2 1 
ATOM   2213 C CZ  . PHE B 1 26  ? 26.474 -0.939  3.730   1.00 143.82 ? 467  PHE B CZ  1 
ATOM   2214 N N   . GLY B 1 27  ? 29.308 -4.457  -2.279  1.00 114.21 ? 468  GLY B N   1 
ATOM   2215 C CA  . GLY B 1 27  ? 29.693 -5.552  -3.186  1.00 107.78 ? 468  GLY B CA  1 
ATOM   2216 C C   . GLY B 1 27  ? 28.510 -6.258  -3.831  1.00 105.75 ? 468  GLY B C   1 
ATOM   2217 O O   . GLY B 1 27  ? 27.363 -6.028  -3.462  1.00 109.23 ? 468  GLY B O   1 
ATOM   2218 N N   . THR B 1 28  ? 28.792 -7.112  -4.809  1.00 100.70 ? 469  THR B N   1 
ATOM   2219 C CA  . THR B 1 28  ? 27.763 -7.912  -5.474  1.00 100.48 ? 469  THR B CA  1 
ATOM   2220 C C   . THR B 1 28  ? 28.206 -9.360  -5.431  1.00 95.05  ? 469  THR B C   1 
ATOM   2221 O O   . THR B 1 28  ? 29.370 -9.655  -5.696  1.00 91.41  ? 469  THR B O   1 
ATOM   2222 C CB  . THR B 1 28  ? 27.573 -7.482  -6.945  1.00 103.13 ? 469  THR B CB  1 
ATOM   2223 O OG1 . THR B 1 28  ? 27.206 -6.100  -7.000  1.00 108.03 ? 469  THR B OG1 1 
ATOM   2224 C CG2 . THR B 1 28  ? 26.496 -8.316  -7.639  1.00 103.87 ? 469  THR B CG2 1 
ATOM   2225 N N   . VAL B 1 29  ? 27.288 -10.263 -5.100  1.00 95.02  ? 470  VAL B N   1 
ATOM   2226 C CA  . VAL B 1 29  ? 27.627 -11.677 -5.014  1.00 92.27  ? 470  VAL B CA  1 
ATOM   2227 C C   . VAL B 1 29  ? 27.140 -12.459 -6.236  1.00 92.74  ? 470  VAL B C   1 
ATOM   2228 O O   . VAL B 1 29  ? 25.945 -12.503 -6.538  1.00 93.53  ? 470  VAL B O   1 
ATOM   2229 C CB  . VAL B 1 29  ? 27.101 -12.325 -3.718  1.00 93.27  ? 470  VAL B CB  1 
ATOM   2230 C CG1 . VAL B 1 29  ? 27.488 -13.800 -3.669  1.00 89.81  ? 470  VAL B CG1 1 
ATOM   2231 C CG2 . VAL B 1 29  ? 27.670 -11.595 -2.510  1.00 93.51  ? 470  VAL B CG2 1 
ATOM   2232 N N   . TYR B 1 30  ? 28.101 -13.077 -6.919  1.00 91.32  ? 471  TYR B N   1 
ATOM   2233 C CA  . TYR B 1 30  ? 27.850 -13.944 -8.063  1.00 91.97  ? 471  TYR B CA  1 
ATOM   2234 C C   . TYR B 1 30  ? 28.216 -15.385 -7.723  1.00 88.13  ? 471  TYR B C   1 
ATOM   2235 O O   . TYR B 1 30  ? 29.136 -15.625 -6.942  1.00 88.04  ? 471  TYR B O   1 
ATOM   2236 C CB  . TYR B 1 30  ? 28.720 -13.509 -9.249  1.00 92.92  ? 471  TYR B CB  1 
ATOM   2237 C CG  . TYR B 1 30  ? 28.496 -12.089 -9.740  1.00 97.41  ? 471  TYR B CG  1 
ATOM   2238 C CD1 . TYR B 1 30  ? 29.275 -11.034 -9.263  1.00 96.96  ? 471  TYR B CD1 1 
ATOM   2239 C CD2 . TYR B 1 30  ? 27.520 -11.809 -10.705 1.00 101.53 ? 471  TYR B CD2 1 
ATOM   2240 C CE1 . TYR B 1 30  ? 29.079 -9.739  -9.718  1.00 102.65 ? 471  TYR B CE1 1 
ATOM   2241 C CE2 . TYR B 1 30  ? 27.317 -10.517 -11.169 1.00 105.55 ? 471  TYR B CE2 1 
ATOM   2242 C CZ  . TYR B 1 30  ? 28.096 -9.484  -10.674 1.00 106.81 ? 471  TYR B CZ  1 
ATOM   2243 O OH  . TYR B 1 30  ? 27.901 -8.198  -11.129 1.00 109.39 ? 471  TYR B OH  1 
ATOM   2244 N N   . LYS B 1 31  ? 27.512 -16.344 -8.317  1.00 88.46  ? 472  LYS B N   1 
ATOM   2245 C CA  . LYS B 1 31  ? 27.983 -17.731 -8.344  1.00 85.37  ? 472  LYS B CA  1 
ATOM   2246 C C   . LYS B 1 31  ? 29.011 -17.871 -9.462  1.00 84.69  ? 472  LYS B C   1 
ATOM   2247 O O   . LYS B 1 31  ? 28.751 -17.471 -10.596 1.00 89.85  ? 472  LYS B O   1 
ATOM   2248 C CB  . LYS B 1 31  ? 26.832 -18.698 -8.591  1.00 87.54  ? 472  LYS B CB  1 
ATOM   2249 C CG  . LYS B 1 31  ? 27.253 -20.155 -8.577  1.00 86.10  ? 472  LYS B CG  1 
ATOM   2250 C CD  . LYS B 1 31  ? 26.063 -21.075 -8.754  1.00 89.94  ? 472  LYS B CD  1 
ATOM   2251 C CE  . LYS B 1 31  ? 26.497 -22.530 -8.821  1.00 89.68  ? 472  LYS B CE  1 
ATOM   2252 N NZ  . LYS B 1 31  ? 25.386 -23.394 -9.309  1.00 94.78  ? 472  LYS B NZ  1 
ATOM   2253 N N   . GLY B 1 32  ? 30.171 -18.440 -9.152  1.00 81.65  ? 473  GLY B N   1 
ATOM   2254 C CA  . GLY B 1 32  ? 31.261 -18.540 -10.124 1.00 79.18  ? 473  GLY B CA  1 
ATOM   2255 C C   . GLY B 1 32  ? 31.935 -19.897 -10.197 1.00 77.16  ? 473  GLY B C   1 
ATOM   2256 O O   . GLY B 1 32  ? 31.507 -20.872 -9.569  1.00 73.74  ? 473  GLY B O   1 
ATOM   2257 N N   . LYS B 1 33  ? 33.001 -19.949 -10.986 1.00 78.09  ? 474  LYS B N   1 
ATOM   2258 C CA  . LYS B 1 33  ? 33.763 -21.172 -11.184 1.00 76.95  ? 474  LYS B CA  1 
ATOM   2259 C C   . LYS B 1 33  ? 35.250 -20.878 -11.103 1.00 74.25  ? 474  LYS B C   1 
ATOM   2260 O O   . LYS B 1 33  ? 35.792 -20.134 -11.911 1.00 75.72  ? 474  LYS B O   1 
ATOM   2261 C CB  . LYS B 1 33  ? 33.411 -21.825 -12.522 1.00 80.94  ? 474  LYS B CB  1 
ATOM   2262 C CG  . LYS B 1 33  ? 32.164 -22.695 -12.465 1.00 83.86  ? 474  LYS B CG  1 
ATOM   2263 C CD  . LYS B 1 33  ? 31.874 -23.306 -13.821 1.00 88.73  ? 474  LYS B CD  1 
ATOM   2264 C CE  . LYS B 1 33  ? 30.634 -24.182 -13.799 1.00 92.11  ? 474  LYS B CE  1 
ATOM   2265 N NZ  . LYS B 1 33  ? 30.167 -24.478 -15.189 1.00 96.69  ? 474  LYS B NZ  1 
ATOM   2266 N N   . TRP B 1 34  ? 35.879 -21.444 -10.082 1.00 72.81  ? 475  TRP B N   1 
ATOM   2267 C CA  . TRP B 1 34  ? 37.323 -21.448 -9.928  1.00 71.73  ? 475  TRP B CA  1 
ATOM   2268 C C   . TRP B 1 34  ? 37.630 -22.728 -9.188  1.00 70.08  ? 475  TRP B C   1 
ATOM   2269 O O   . TRP B 1 34  ? 37.253 -22.866 -8.028  1.00 69.12  ? 475  TRP B O   1 
ATOM   2270 C CB  . TRP B 1 34  ? 37.783 -20.242 -9.113  1.00 70.88  ? 475  TRP B CB  1 
ATOM   2271 C CG  . TRP B 1 34  ? 39.247 -20.074 -9.113  1.00 70.33  ? 475  TRP B CG  1 
ATOM   2272 C CD1 . TRP B 1 34  ? 40.019 -19.671 -10.159 1.00 73.97  ? 475  TRP B CD1 1 
ATOM   2273 C CD2 . TRP B 1 34  ? 40.135 -20.306 -8.021  1.00 68.88  ? 475  TRP B CD2 1 
ATOM   2274 N NE1 . TRP B 1 34  ? 41.340 -19.636 -9.786  1.00 74.14  ? 475  TRP B NE1 1 
ATOM   2275 C CE2 . TRP B 1 34  ? 41.436 -20.019 -8.474  1.00 71.54  ? 475  TRP B CE2 1 
ATOM   2276 C CE3 . TRP B 1 34  ? 39.960 -20.724 -6.701  1.00 68.03  ? 475  TRP B CE3 1 
ATOM   2277 C CZ2 . TRP B 1 34  ? 42.557 -20.140 -7.649  1.00 71.22  ? 475  TRP B CZ2 1 
ATOM   2278 C CZ3 . TRP B 1 34  ? 41.081 -20.842 -5.877  1.00 67.21  ? 475  TRP B CZ3 1 
ATOM   2279 C CH2 . TRP B 1 34  ? 42.357 -20.554 -6.356  1.00 68.28  ? 475  TRP B CH2 1 
ATOM   2280 N N   . HIS B 1 35  ? 38.256 -23.684 -9.866  1.00 71.23  ? 476  HIS B N   1 
ATOM   2281 C CA  . HIS B 1 35  ? 38.481 -25.009 -9.288  1.00 70.98  ? 476  HIS B CA  1 
ATOM   2282 C C   . HIS B 1 35  ? 37.210 -25.543 -8.621  1.00 70.26  ? 476  HIS B C   1 
ATOM   2283 O O   . HIS B 1 35  ? 37.247 -26.084 -7.516  1.00 68.62  ? 476  HIS B O   1 
ATOM   2284 C CB  . HIS B 1 35  ? 39.652 -24.967 -8.303  1.00 70.68  ? 476  HIS B CB  1 
ATOM   2285 C CG  . HIS B 1 35  ? 40.940 -24.547 -8.936  1.00 73.75  ? 476  HIS B CG  1 
ATOM   2286 N ND1 . HIS B 1 35  ? 41.453 -25.171 -10.055 1.00 76.02  ? 476  HIS B ND1 1 
ATOM   2287 C CD2 . HIS B 1 35  ? 41.811 -23.559 -8.624  1.00 73.41  ? 476  HIS B CD2 1 
ATOM   2288 C CE1 . HIS B 1 35  ? 42.585 -24.587 -10.401 1.00 76.90  ? 476  HIS B CE1 1 
ATOM   2289 N NE2 . HIS B 1 35  ? 42.826 -23.606 -9.550  1.00 75.46  ? 476  HIS B NE2 1 
ATOM   2290 N N   . GLY B 1 36  ? 36.086 -25.371 -9.317  1.00 72.75  ? 477  GLY B N   1 
ATOM   2291 C CA  . GLY B 1 36  ? 34.777 -25.833 -8.855  1.00 73.98  ? 477  GLY B CA  1 
ATOM   2292 C C   . GLY B 1 36  ? 33.815 -24.682 -8.653  1.00 74.03  ? 477  GLY B C   1 
ATOM   2293 O O   . GLY B 1 36  ? 34.134 -23.542 -8.963  1.00 74.61  ? 477  GLY B O   1 
ATOM   2294 N N   . ASP B 1 37  ? 32.635 -24.984 -8.122  1.00 75.46  ? 478  ASP B N   1 
ATOM   2295 C CA  . ASP B 1 37  ? 31.677 -23.951 -7.739  1.00 76.53  ? 478  ASP B CA  1 
ATOM   2296 C C   . ASP B 1 37  ? 32.224 -23.107 -6.575  1.00 75.35  ? 478  ASP B C   1 
ATOM   2297 O O   . ASP B 1 37  ? 32.656 -23.641 -5.552  1.00 75.85  ? 478  ASP B O   1 
ATOM   2298 C CB  . ASP B 1 37  ? 30.325 -24.569 -7.357  1.00 78.36  ? 478  ASP B CB  1 
ATOM   2299 C CG  . ASP B 1 37  ? 29.591 -25.179 -8.548  1.00 83.40  ? 478  ASP B CG  1 
ATOM   2300 O OD1 . ASP B 1 37  ? 29.847 -24.776 -9.706  1.00 86.53  ? 478  ASP B OD1 1 
ATOM   2301 O OD2 . ASP B 1 37  ? 28.745 -26.070 -8.321  1.00 87.85  ? 478  ASP B OD2 1 
ATOM   2302 N N   . VAL B 1 38  ? 32.209 -21.788 -6.755  1.00 76.08  ? 479  VAL B N   1 
ATOM   2303 C CA  . VAL B 1 38  ? 32.705 -20.843 -5.763  1.00 75.13  ? 479  VAL B CA  1 
ATOM   2304 C C   . VAL B 1 38  ? 31.772 -19.655 -5.699  1.00 76.39  ? 479  VAL B C   1 
ATOM   2305 O O   . VAL B 1 38  ? 31.122 -19.340 -6.688  1.00 79.60  ? 479  VAL B O   1 
ATOM   2306 C CB  . VAL B 1 38  ? 34.109 -20.318 -6.133  1.00 76.06  ? 479  VAL B CB  1 
ATOM   2307 C CG1 . VAL B 1 38  ? 35.139 -21.435 -6.033  1.00 76.74  ? 479  VAL B CG1 1 
ATOM   2308 C CG2 . VAL B 1 38  ? 34.126 -19.705 -7.530  1.00 76.55  ? 479  VAL B CG2 1 
ATOM   2309 N N   . ALA B 1 39  ? 31.704 -19.001 -4.543  1.00 77.00  ? 480  ALA B N   1 
ATOM   2310 C CA  . ALA B 1 39  ? 30.999 -17.716 -4.424  1.00 79.14  ? 480  ALA B CA  1 
ATOM   2311 C C   . ALA B 1 39  ? 31.976 -16.559 -4.631  1.00 77.79  ? 480  ALA B C   1 
ATOM   2312 O O   . ALA B 1 39  ? 33.111 -16.603 -4.152  1.00 76.78  ? 480  ALA B O   1 
ATOM   2313 C CB  . ALA B 1 39  ? 30.324 -17.595 -3.074  1.00 80.08  ? 480  ALA B CB  1 
ATOM   2314 N N   . VAL B 1 40  ? 31.531 -15.532 -5.344  1.00 78.19  ? 481  VAL B N   1 
ATOM   2315 C CA  . VAL B 1 40  ? 32.380 -14.396 -5.663  1.00 79.66  ? 481  VAL B CA  1 
ATOM   2316 C C   . VAL B 1 40  ? 31.680 -13.104 -5.268  1.00 82.14  ? 481  VAL B C   1 
ATOM   2317 O O   . VAL B 1 40  ? 30.664 -12.741 -5.856  1.00 84.66  ? 481  VAL B O   1 
ATOM   2318 C CB  . VAL B 1 40  ? 32.725 -14.354 -7.171  1.00 83.00  ? 481  VAL B CB  1 
ATOM   2319 C CG1 . VAL B 1 40  ? 33.598 -13.150 -7.494  1.00 84.57  ? 481  VAL B CG1 1 
ATOM   2320 C CG2 . VAL B 1 40  ? 33.437 -15.630 -7.598  1.00 82.41  ? 481  VAL B CG2 1 
ATOM   2321 N N   . LYS B 1 41  ? 32.232 -12.418 -4.271  1.00 82.17  ? 482  LYS B N   1 
ATOM   2322 C CA  . LYS B 1 41  ? 31.745 -11.113 -3.838  1.00 85.53  ? 482  LYS B CA  1 
ATOM   2323 C C   . LYS B 1 41  ? 32.684 -10.080 -4.431  1.00 86.03  ? 482  LYS B C   1 
ATOM   2324 O O   . LYS B 1 41  ? 33.830 -9.988  -4.010  1.00 83.33  ? 482  LYS B O   1 
ATOM   2325 C CB  . LYS B 1 41  ? 31.775 -11.045 -2.310  1.00 86.91  ? 482  LYS B CB  1 
ATOM   2326 C CG  . LYS B 1 41  ? 31.056 -9.869  -1.655  1.00 91.82  ? 482  LYS B CG  1 
ATOM   2327 C CD  . LYS B 1 41  ? 31.651 -9.570  -0.274  1.00 93.88  ? 482  LYS B CD  1 
ATOM   2328 C CE  . LYS B 1 41  ? 30.635 -9.052  0.738   1.00 100.00 ? 482  LYS B CE  1 
ATOM   2329 N NZ  . LYS B 1 41  ? 29.805 -10.138 1.341   1.00 101.89 ? 482  LYS B NZ  1 
ATOM   2330 N N   . MET B 1 42  ? 32.225 -9.319  -5.419  1.00 91.31  ? 483  MET B N   1 
ATOM   2331 C CA  . MET B 1 42  ? 33.098 -8.327  -6.059  1.00 96.41  ? 483  MET B CA  1 
ATOM   2332 C C   . MET B 1 42  ? 32.495 -6.929  -6.112  1.00 98.47  ? 483  MET B C   1 
ATOM   2333 O O   . MET B 1 42  ? 31.289 -6.766  -6.279  1.00 100.40 ? 483  MET B O   1 
ATOM   2334 C CB  . MET B 1 42  ? 33.514 -8.780  -7.469  1.00 101.46 ? 483  MET B CB  1 
ATOM   2335 C CG  . MET B 1 42  ? 32.386 -9.004  -8.474  1.00 107.32 ? 483  MET B CG  1 
ATOM   2336 S SD  . MET B 1 42  ? 32.941 -8.955  -10.203 1.00 114.42 ? 483  MET B SD  1 
ATOM   2337 C CE  . MET B 1 42  ? 34.347 -10.076 -10.204 1.00 106.96 ? 483  MET B CE  1 
ATOM   2338 N N   . LEU B 1 43  ? 33.351 -5.924  -5.957  1.00 99.54  ? 484  LEU B N   1 
ATOM   2339 C CA  . LEU B 1 43  ? 32.928 -4.536  -6.117  1.00 105.21 ? 484  LEU B CA  1 
ATOM   2340 C C   . LEU B 1 43  ? 32.814 -4.217  -7.597  1.00 108.16 ? 484  LEU B C   1 
ATOM   2341 O O   . LEU B 1 43  ? 33.734 -4.485  -8.376  1.00 107.71 ? 484  LEU B O   1 
ATOM   2342 C CB  . LEU B 1 43  ? 33.883 -3.553  -5.428  1.00 106.56 ? 484  LEU B CB  1 
ATOM   2343 C CG  . LEU B 1 43  ? 33.253 -2.804  -4.254  1.00 109.37 ? 484  LEU B CG  1 
ATOM   2344 C CD1 . LEU B 1 43  ? 34.327 -2.127  -3.423  1.00 111.20 ? 484  LEU B CD1 1 
ATOM   2345 C CD2 . LEU B 1 43  ? 32.229 -1.786  -4.740  1.00 114.48 ? 484  LEU B CD2 1 
ATOM   2346 N N   . ASN B 1 44  ? 31.679 -3.632  -7.963  1.00 111.57 ? 485  ASN B N   1 
ATOM   2347 C CA  . ASN B 1 44  ? 31.306 -3.437  -9.351  1.00 114.25 ? 485  ASN B CA  1 
ATOM   2348 C C   . ASN B 1 44  ? 31.525 -1.976  -9.762  1.00 119.96 ? 485  ASN B C   1 
ATOM   2349 O O   . ASN B 1 44  ? 30.582 -1.272  -10.151 1.00 122.30 ? 485  ASN B O   1 
ATOM   2350 C CB  . ASN B 1 44  ? 29.840 -3.848  -9.522  1.00 116.48 ? 485  ASN B CB  1 
ATOM   2351 C CG  . ASN B 1 44  ? 29.632 -4.801  -10.676 1.00 115.91 ? 485  ASN B CG  1 
ATOM   2352 O OD1 . ASN B 1 44  ? 29.162 -4.406  -11.743 1.00 118.87 ? 485  ASN B OD1 1 
ATOM   2353 N ND2 . ASN B 1 44  ? 29.982 -6.072  -10.466 1.00 111.41 ? 485  ASN B ND2 1 
ATOM   2354 N N   . VAL B 1 45  ? 32.776 -1.524  -9.671  1.00 120.07 ? 486  VAL B N   1 
ATOM   2355 C CA  . VAL B 1 45  ? 33.109 -0.117  -9.919  1.00 126.19 ? 486  VAL B CA  1 
ATOM   2356 C C   . VAL B 1 45  ? 34.308 0.067   -10.845 1.00 126.68 ? 486  VAL B C   1 
ATOM   2357 O O   . VAL B 1 45  ? 35.151 -0.818  -10.977 1.00 121.65 ? 486  VAL B O   1 
ATOM   2358 C CB  . VAL B 1 45  ? 33.390 0.653   -8.604  1.00 128.30 ? 486  VAL B CB  1 
ATOM   2359 C CG1 . VAL B 1 45  ? 32.149 0.680   -7.721  1.00 129.47 ? 486  VAL B CG1 1 
ATOM   2360 C CG2 . VAL B 1 45  ? 34.582 0.067   -7.854  1.00 124.31 ? 486  VAL B CG2 1 
ATOM   2361 N N   . THR B 1 46  ? 34.361 1.239   -11.474 1.00 132.92 ? 487  THR B N   1 
ATOM   2362 C CA  . THR B 1 46  ? 35.491 1.664   -12.300 1.00 135.16 ? 487  THR B CA  1 
ATOM   2363 C C   . THR B 1 46  ? 36.772 1.797   -11.469 1.00 132.90 ? 487  THR B C   1 
ATOM   2364 O O   . THR B 1 46  ? 37.823 1.284   -11.853 1.00 130.22 ? 487  THR B O   1 
ATOM   2365 C CB  . THR B 1 46  ? 35.189 3.032   -12.963 1.00 142.60 ? 487  THR B CB  1 
ATOM   2366 O OG1 . THR B 1 46  ? 33.949 2.956   -13.674 1.00 145.00 ? 487  THR B OG1 1 
ATOM   2367 C CG2 . THR B 1 46  ? 36.297 3.455   -13.928 1.00 145.94 ? 487  THR B CG2 1 
ATOM   2368 N N   . ALA B 1 47  ? 36.664 2.481   -10.329 1.00 133.76 ? 488  ALA B N   1 
ATOM   2369 C CA  . ALA B 1 47  ? 37.822 2.870   -9.522  1.00 132.56 ? 488  ALA B CA  1 
ATOM   2370 C C   . ALA B 1 47  ? 37.455 2.930   -8.032  1.00 129.32 ? 488  ALA B C   1 
ATOM   2371 O O   . ALA B 1 47  ? 36.715 3.821   -7.615  1.00 133.36 ? 488  ALA B O   1 
ATOM   2372 C CB  . ALA B 1 47  ? 38.335 4.225   -9.988  1.00 139.80 ? 488  ALA B CB  1 
ATOM   2373 N N   . PRO B 1 48  ? 37.972 1.988   -7.224  1.00 122.02 ? 489  PRO B N   1 
ATOM   2374 C CA  . PRO B 1 48  ? 37.637 1.959   -5.788  1.00 119.95 ? 489  PRO B CA  1 
ATOM   2375 C C   . PRO B 1 48  ? 38.145 3.175   -5.010  1.00 123.73 ? 489  PRO B C   1 
ATOM   2376 O O   . PRO B 1 48  ? 39.255 3.628   -5.260  1.00 125.73 ? 489  PRO B O   1 
ATOM   2377 C CB  . PRO B 1 48  ? 38.340 0.689   -5.284  1.00 114.38 ? 489  PRO B CB  1 
ATOM   2378 C CG  . PRO B 1 48  ? 38.691 -0.101  -6.501  1.00 111.51 ? 489  PRO B CG  1 
ATOM   2379 C CD  . PRO B 1 48  ? 38.860 0.877   -7.614  1.00 116.43 ? 489  PRO B CD  1 
ATOM   2380 N N   . THR B 1 49  ? 37.345 3.692   -4.076  1.00 126.34 ? 490  THR B N   1 
ATOM   2381 C CA  . THR B 1 49  ? 37.772 4.825   -3.238  1.00 132.37 ? 490  THR B CA  1 
ATOM   2382 C C   . THR B 1 49  ? 38.498 4.305   -2.000  1.00 133.05 ? 490  THR B C   1 
ATOM   2383 O O   . THR B 1 49  ? 38.173 3.226   -1.512  1.00 128.85 ? 490  THR B O   1 
ATOM   2384 C CB  . THR B 1 49  ? 36.595 5.702   -2.772  1.00 135.43 ? 490  THR B CB  1 
ATOM   2385 O OG1 . THR B 1 49  ? 35.766 4.967   -1.862  1.00 131.07 ? 490  THR B OG1 1 
ATOM   2386 C CG2 . THR B 1 49  ? 35.774 6.177   -3.955  1.00 137.85 ? 490  THR B CG2 1 
ATOM   2387 N N   . PRO B 1 50  ? 39.475 5.078   -1.481  1.00 122.07 ? 491  PRO B N   1 
ATOM   2388 C CA  . PRO B 1 50  ? 40.334 4.694   -0.352  1.00 120.56 ? 491  PRO B CA  1 
ATOM   2389 C C   . PRO B 1 50  ? 39.693 3.875   0.777   1.00 117.54 ? 491  PRO B C   1 
ATOM   2390 O O   . PRO B 1 50  ? 40.352 2.973   1.297   1.00 116.00 ? 491  PRO B O   1 
ATOM   2391 C CB  . PRO B 1 50  ? 40.804 6.046   0.177   1.00 125.40 ? 491  PRO B CB  1 
ATOM   2392 C CG  . PRO B 1 50  ? 40.915 6.888   -1.051  1.00 129.29 ? 491  PRO B CG  1 
ATOM   2393 C CD  . PRO B 1 50  ? 39.883 6.387   -2.030  1.00 127.38 ? 491  PRO B CD  1 
ATOM   2394 N N   . GLN B 1 51  ? 38.447 4.180   1.156   1.00 118.32 ? 492  GLN B N   1 
ATOM   2395 C CA  . GLN B 1 51  ? 37.757 3.441   2.241   1.00 115.47 ? 492  GLN B CA  1 
ATOM   2396 C C   . GLN B 1 51  ? 37.018 2.169   1.780   1.00 112.05 ? 492  GLN B C   1 
ATOM   2397 O O   . GLN B 1 51  ? 36.737 1.275   2.592   1.00 108.28 ? 492  GLN B O   1 
ATOM   2398 C CB  . GLN B 1 51  ? 36.797 4.350   3.003   1.00 117.16 ? 492  GLN B CB  1 
ATOM   2399 C CG  . GLN B 1 51  ? 35.571 4.776   2.216   1.00 119.89 ? 492  GLN B CG  1 
ATOM   2400 C CD  . GLN B 1 51  ? 35.026 6.101   2.711   1.00 124.78 ? 492  GLN B CD  1 
ATOM   2401 O OE1 . GLN B 1 51  ? 35.227 7.147   2.084   1.00 126.92 ? 492  GLN B OE1 1 
ATOM   2402 N NE2 . GLN B 1 51  ? 34.361 6.067   3.864   1.00 124.04 ? 492  GLN B NE2 1 
ATOM   2403 N N   . GLN B 1 52  ? 36.688 2.097   0.491   1.00 112.25 ? 493  GLN B N   1 
ATOM   2404 C CA  . GLN B 1 52  ? 36.272 0.829   -0.122  1.00 107.21 ? 493  GLN B CA  1 
ATOM   2405 C C   . GLN B 1 52  ? 37.455 -0.149  -0.138  1.00 104.88 ? 493  GLN B C   1 
ATOM   2406 O O   . GLN B 1 52  ? 37.316 -1.323  0.233   1.00 100.29 ? 493  GLN B O   1 
ATOM   2407 C CB  . GLN B 1 52  ? 35.765 1.047   -1.550  1.00 107.28 ? 493  GLN B CB  1 
ATOM   2408 C CG  . GLN B 1 52  ? 34.312 1.458   -1.625  1.00 106.81 ? 493  GLN B CG  1 
ATOM   2409 C CD  . GLN B 1 52  ? 33.904 1.871   -3.021  1.00 108.70 ? 493  GLN B CD  1 
ATOM   2410 O OE1 . GLN B 1 52  ? 34.623 2.606   -3.699  1.00 111.44 ? 493  GLN B OE1 1 
ATOM   2411 N NE2 . GLN B 1 52  ? 32.742 1.406   -3.458  1.00 107.48 ? 493  GLN B NE2 1 
ATOM   2412 N N   . LEU B 1 53  ? 38.608 0.360   -0.574  1.00 105.91 ? 494  LEU B N   1 
ATOM   2413 C CA  . LEU B 1 53  ? 39.858 -0.391  -0.588  1.00 103.23 ? 494  LEU B CA  1 
ATOM   2414 C C   . LEU B 1 53  ? 40.254 -0.864  0.802   1.00 101.64 ? 494  LEU B C   1 
ATOM   2415 O O   . LEU B 1 53  ? 40.854 -1.926  0.945   1.00 100.65 ? 494  LEU B O   1 
ATOM   2416 C CB  . LEU B 1 53  ? 40.979 0.475   -1.158  1.00 107.32 ? 494  LEU B CB  1 
ATOM   2417 C CG  . LEU B 1 53  ? 42.343 -0.196  -1.313  1.00 106.19 ? 494  LEU B CG  1 
ATOM   2418 C CD1 . LEU B 1 53  ? 42.264 -1.299  -2.360  1.00 103.44 ? 494  LEU B CD1 1 
ATOM   2419 C CD2 . LEU B 1 53  ? 43.417 0.827   -1.669  1.00 110.63 ? 494  LEU B CD2 1 
ATOM   2420 N N   . GLN B 1 54  ? 39.930 -0.075  1.822   1.00 103.19 ? 495  GLN B N   1 
ATOM   2421 C CA  . GLN B 1 54  ? 40.194 -0.481  3.199   1.00 101.73 ? 495  GLN B CA  1 
ATOM   2422 C C   . GLN B 1 54  ? 39.224 -1.545  3.697   1.00 98.62  ? 495  GLN B C   1 
ATOM   2423 O O   . GLN B 1 54  ? 39.648 -2.477  4.379   1.00 98.40  ? 495  GLN B O   1 
ATOM   2424 C CB  . GLN B 1 54  ? 40.192 0.721   4.145   1.00 105.35 ? 495  GLN B CB  1 
ATOM   2425 C CG  . GLN B 1 54  ? 41.593 1.206   4.502   1.00 108.92 ? 495  GLN B CG  1 
ATOM   2426 C CD  . GLN B 1 54  ? 42.423 0.156   5.226   1.00 104.52 ? 495  GLN B CD  1 
ATOM   2427 O OE1 . GLN B 1 54  ? 43.615 -0.001  4.958   1.00 104.32 ? 495  GLN B OE1 1 
ATOM   2428 N NE2 . GLN B 1 54  ? 41.794 -0.569  6.143   1.00 100.55 ? 495  GLN B NE2 1 
ATOM   2429 N N   . ALA B 1 55  ? 37.937 -1.420  3.368   1.00 97.69  ? 496  ALA B N   1 
ATOM   2430 C CA  . ALA B 1 55  ? 36.942 -2.432  3.777   1.00 93.34  ? 496  ALA B CA  1 
ATOM   2431 C C   . ALA B 1 55  ? 37.310 -3.822  3.249   1.00 90.18  ? 496  ALA B C   1 
ATOM   2432 O O   . ALA B 1 55  ? 37.247 -4.818  3.977   1.00 84.83  ? 496  ALA B O   1 
ATOM   2433 C CB  . ALA B 1 55  ? 35.553 -2.043  3.299   1.00 93.23  ? 496  ALA B CB  1 
ATOM   2434 N N   . PHE B 1 56  ? 37.685 -3.853  1.971   1.00 91.25  ? 497  PHE B N   1 
ATOM   2435 C CA  . PHE B 1 56  ? 38.184 -5.039  1.284   1.00 87.96  ? 497  PHE B CA  1 
ATOM   2436 C C   . PHE B 1 56  ? 39.339 -5.673  2.052   1.00 86.49  ? 497  PHE B C   1 
ATOM   2437 O O   . PHE B 1 56  ? 39.294 -6.857  2.388   1.00 83.72  ? 497  PHE B O   1 
ATOM   2438 C CB  . PHE B 1 56  ? 38.629 -4.632  -0.128  1.00 91.13  ? 497  PHE B CB  1 
ATOM   2439 C CG  . PHE B 1 56  ? 39.232 -5.747  -0.945  1.00 90.74  ? 497  PHE B CG  1 
ATOM   2440 C CD1 . PHE B 1 56  ? 38.423 -6.698  -1.563  1.00 89.72  ? 497  PHE B CD1 1 
ATOM   2441 C CD2 . PHE B 1 56  ? 40.610 -5.824  -1.132  1.00 90.56  ? 497  PHE B CD2 1 
ATOM   2442 C CE1 . PHE B 1 56  ? 38.981 -7.714  -2.330  1.00 88.19  ? 497  PHE B CE1 1 
ATOM   2443 C CE2 . PHE B 1 56  ? 41.169 -6.831  -1.899  1.00 89.25  ? 497  PHE B CE2 1 
ATOM   2444 C CZ  . PHE B 1 56  ? 40.354 -7.778  -2.498  1.00 88.33  ? 497  PHE B CZ  1 
ATOM   2445 N N   . LYS B 1 57  ? 40.363 -4.879  2.345   1.00 89.82  ? 498  LYS B N   1 
ATOM   2446 C CA  . LYS B 1 57  ? 41.542 -5.377  3.068   1.00 89.62  ? 498  LYS B CA  1 
ATOM   2447 C C   . LYS B 1 57  ? 41.203 -5.901  4.474   1.00 86.60  ? 498  LYS B C   1 
ATOM   2448 O O   . LYS B 1 57  ? 41.731 -6.933  4.886   1.00 86.61  ? 498  LYS B O   1 
ATOM   2449 C CB  . LYS B 1 57  ? 42.634 -4.305  3.146   1.00 93.09  ? 498  LYS B CB  1 
ATOM   2450 C CG  . LYS B 1 57  ? 43.372 -4.078  1.840   1.00 96.02  ? 498  LYS B CG  1 
ATOM   2451 C CD  . LYS B 1 57  ? 44.412 -2.981  2.004   1.00 103.87 ? 498  LYS B CD  1 
ATOM   2452 C CE  . LYS B 1 57  ? 45.427 -2.954  0.867   1.00 108.41 ? 498  LYS B CE  1 
ATOM   2453 N NZ  . LYS B 1 57  ? 44.824 -2.554  -0.435  1.00 110.87 ? 498  LYS B NZ  1 
ATOM   2454 N N   . ASN B 1 58  ? 40.332 -5.201  5.201   1.00 85.48  ? 499  ASN B N   1 
ATOM   2455 C CA  . ASN B 1 58  ? 39.856 -5.681  6.503   1.00 83.46  ? 499  ASN B CA  1 
ATOM   2456 C C   . ASN B 1 58  ? 39.118 -7.005  6.411   1.00 81.94  ? 499  ASN B C   1 
ATOM   2457 O O   . ASN B 1 58  ? 39.340 -7.886  7.232   1.00 81.88  ? 499  ASN B O   1 
ATOM   2458 C CB  . ASN B 1 58  ? 38.920 -4.668  7.160   1.00 84.35  ? 499  ASN B CB  1 
ATOM   2459 C CG  . ASN B 1 58  ? 39.653 -3.485  7.735   1.00 85.64  ? 499  ASN B CG  1 
ATOM   2460 O OD1 . ASN B 1 58  ? 40.878 -3.481  7.837   1.00 85.10  ? 499  ASN B OD1 1 
ATOM   2461 N ND2 . ASN B 1 58  ? 38.902 -2.471  8.117   1.00 86.40  ? 499  ASN B ND2 1 
ATOM   2462 N N   . GLU B 1 59  ? 38.227 -7.133  5.428   1.00 82.75  ? 500  GLU B N   1 
ATOM   2463 C CA  . GLU B 1 59  ? 37.457 -8.363  5.239   1.00 80.28  ? 500  GLU B CA  1 
ATOM   2464 C C   . GLU B 1 59  ? 38.381 -9.510  4.874   1.00 77.97  ? 500  GLU B C   1 
ATOM   2465 O O   . GLU B 1 59  ? 38.262 -10.599 5.428   1.00 77.74  ? 500  GLU B O   1 
ATOM   2466 C CB  . GLU B 1 59  ? 36.391 -8.186  4.151   1.00 84.19  ? 500  GLU B CB  1 
ATOM   2467 C CG  . GLU B 1 59  ? 35.379 -9.330  4.055   1.00 85.67  ? 500  GLU B CG  1 
ATOM   2468 C CD  . GLU B 1 59  ? 34.064 -8.943  3.357   1.00 92.76  ? 500  GLU B CD  1 
ATOM   2469 O OE1 . GLU B 1 59  ? 33.693 -7.744  3.336   1.00 102.98 ? 500  GLU B OE1 1 
ATOM   2470 O OE2 . GLU B 1 59  ? 33.374 -9.843  2.834   1.00 93.00  ? 500  GLU B OE2 1 
ATOM   2471 N N   . VAL B 1 60  ? 39.300 -9.266  3.943   1.00 77.24  ? 501  VAL B N   1 
ATOM   2472 C CA  . VAL B 1 60  ? 40.264 -10.290 3.543   1.00 74.74  ? 501  VAL B CA  1 
ATOM   2473 C C   . VAL B 1 60  ? 41.192 -10.600 4.705   1.00 73.70  ? 501  VAL B C   1 
ATOM   2474 O O   . VAL B 1 60  ? 41.472 -11.759 4.980   1.00 74.16  ? 501  VAL B O   1 
ATOM   2475 C CB  . VAL B 1 60  ? 41.078 -9.869  2.300   1.00 75.84  ? 501  VAL B CB  1 
ATOM   2476 C CG1 . VAL B 1 60  ? 42.359 -10.689 2.160   1.00 73.94  ? 501  VAL B CG1 1 
ATOM   2477 C CG2 . VAL B 1 60  ? 40.213 -9.989  1.053   1.00 75.41  ? 501  VAL B CG2 1 
ATOM   2478 N N   . GLY B 1 61  ? 41.657 -9.566  5.390   1.00 75.14  ? 502  GLY B N   1 
ATOM   2479 C CA  . GLY B 1 61  ? 42.481 -9.752  6.575   1.00 75.75  ? 502  GLY B CA  1 
ATOM   2480 C C   . GLY B 1 61  ? 41.854 -10.698 7.589   1.00 73.67  ? 502  GLY B C   1 
ATOM   2481 O O   . GLY B 1 61  ? 42.566 -11.437 8.261   1.00 76.10  ? 502  GLY B O   1 
ATOM   2482 N N   . VAL B 1 62  ? 40.526 -10.683 7.693   1.00 70.39  ? 503  VAL B N   1 
ATOM   2483 C CA  . VAL B 1 62  ? 39.817 -11.442 8.723   1.00 68.96  ? 503  VAL B CA  1 
ATOM   2484 C C   . VAL B 1 62  ? 39.539 -12.868 8.279   1.00 67.89  ? 503  VAL B C   1 
ATOM   2485 O O   . VAL B 1 62  ? 39.782 -13.819 9.022   1.00 67.82  ? 503  VAL B O   1 
ATOM   2486 C CB  . VAL B 1 62  ? 38.493 -10.750 9.104   1.00 69.36  ? 503  VAL B CB  1 
ATOM   2487 C CG1 . VAL B 1 62  ? 37.530 -11.708 9.795   1.00 67.81  ? 503  VAL B CG1 1 
ATOM   2488 C CG2 . VAL B 1 62  ? 38.778 -9.561  10.003  1.00 72.42  ? 503  VAL B CG2 1 
ATOM   2489 N N   . LEU B 1 63  ? 38.994 -13.002 7.080   1.00 67.54  ? 504  LEU B N   1 
ATOM   2490 C CA  . LEU B 1 63  ? 38.777 -14.301 6.477   1.00 66.44  ? 504  LEU B CA  1 
ATOM   2491 C C   . LEU B 1 63  ? 40.053 -15.153 6.448   1.00 67.28  ? 504  LEU B C   1 
ATOM   2492 O O   . LEU B 1 63  ? 40.024 -16.333 6.801   1.00 66.37  ? 504  LEU B O   1 
ATOM   2493 C CB  . LEU B 1 63  ? 38.230 -14.130 5.061   1.00 66.64  ? 504  LEU B CB  1 
ATOM   2494 C CG  . LEU B 1 63  ? 36.767 -13.730 4.947   1.00 66.61  ? 504  LEU B CG  1 
ATOM   2495 C CD1 . LEU B 1 63  ? 36.406 -13.674 3.477   1.00 68.44  ? 504  LEU B CD1 1 
ATOM   2496 C CD2 . LEU B 1 63  ? 35.864 -14.717 5.671   1.00 66.44  ? 504  LEU B CD2 1 
ATOM   2497 N N   . ARG B 1 64  ? 41.175 -14.566 6.051   1.00 70.85  ? 505  ARG B N   1 
ATOM   2498 C CA  . ARG B 1 64  ? 42.428 -15.326 6.022   1.00 74.49  ? 505  ARG B CA  1 
ATOM   2499 C C   . ARG B 1 64  ? 42.945 -15.777 7.412   1.00 73.28  ? 505  ARG B C   1 
ATOM   2500 O O   . ARG B 1 64  ? 43.808 -16.653 7.484   1.00 70.27  ? 505  ARG B O   1 
ATOM   2501 C CB  . ARG B 1 64  ? 43.512 -14.571 5.253   1.00 79.35  ? 505  ARG B CB  1 
ATOM   2502 C CG  . ARG B 1 64  ? 44.085 -13.364 5.962   1.00 85.19  ? 505  ARG B CG  1 
ATOM   2503 C CD  . ARG B 1 64  ? 45.043 -12.635 5.040   1.00 92.34  ? 505  ARG B CD  1 
ATOM   2504 N NE  . ARG B 1 64  ? 46.247 -13.430 4.801   1.00 96.33  ? 505  ARG B NE  1 
ATOM   2505 C CZ  . ARG B 1 64  ? 47.020 -13.340 3.719   1.00 100.05 ? 505  ARG B CZ  1 
ATOM   2506 N NH1 . ARG B 1 64  ? 46.722 -12.494 2.733   1.00 101.30 ? 505  ARG B NH1 1 
ATOM   2507 N NH2 . ARG B 1 64  ? 48.101 -14.114 3.616   1.00 100.46 ? 505  ARG B NH2 1 
ATOM   2508 N N   . LYS B 1 65  ? 42.417 -15.200 8.500   1.00 73.25  ? 506  LYS B N   1 
ATOM   2509 C CA  . LYS B 1 65  ? 42.695 -15.706 9.857   1.00 72.73  ? 506  LYS B CA  1 
ATOM   2510 C C   . LYS B 1 65  ? 41.871 -16.954 10.238  1.00 67.99  ? 506  LYS B C   1 
ATOM   2511 O O   . LYS B 1 65  ? 42.076 -17.491 11.325  1.00 65.95  ? 506  LYS B O   1 
ATOM   2512 C CB  . LYS B 1 65  ? 42.455 -14.627 10.934  1.00 76.90  ? 506  LYS B CB  1 
ATOM   2513 C CG  . LYS B 1 65  ? 43.272 -13.350 10.793  1.00 83.49  ? 506  LYS B CG  1 
ATOM   2514 C CD  . LYS B 1 65  ? 44.112 -13.017 12.037  1.00 88.88  ? 506  LYS B CD  1 
ATOM   2515 C CE  . LYS B 1 65  ? 43.285 -12.660 13.274  1.00 91.72  ? 506  LYS B CE  1 
ATOM   2516 N NZ  . LYS B 1 65  ? 42.567 -11.350 13.197  1.00 92.66  ? 506  LYS B NZ  1 
ATOM   2517 N N   . THR B 1 66  ? 40.947 -17.407 9.378   1.00 64.49  ? 507  THR B N   1 
ATOM   2518 C CA  . THR B 1 66  ? 40.062 -18.543 9.717   1.00 62.66  ? 507  THR B CA  1 
ATOM   2519 C C   . THR B 1 66  ? 40.348 -19.864 8.975   1.00 62.05  ? 507  THR B C   1 
ATOM   2520 O O   . THR B 1 66  ? 40.557 -19.891 7.756   1.00 59.94  ? 507  THR B O   1 
ATOM   2521 C CB  . THR B 1 66  ? 38.566 -18.204 9.517   1.00 61.55  ? 507  THR B CB  1 
ATOM   2522 O OG1 . THR B 1 66  ? 38.275 -17.983 8.129   1.00 59.63  ? 507  THR B OG1 1 
ATOM   2523 C CG2 . THR B 1 66  ? 38.189 -16.991 10.319  1.00 63.98  ? 507  THR B CG2 1 
ATOM   2524 N N   . ARG B 1 67  ? 40.346 -20.951 9.747   1.00 61.30  ? 508  ARG B N   1 
ATOM   2525 C CA  . ARG B 1 67  ? 40.397 -22.320 9.224   1.00 61.87  ? 508  ARG B CA  1 
ATOM   2526 C C   . ARG B 1 67  ? 39.652 -23.225 10.195  1.00 61.66  ? 508  ARG B C   1 
ATOM   2527 O O   . ARG B 1 67  ? 40.249 -23.790 11.127  1.00 60.91  ? 508  ARG B O   1 
ATOM   2528 C CB  . ARG B 1 67  ? 41.833 -22.822 9.071   1.00 62.09  ? 508  ARG B CB  1 
ATOM   2529 C CG  . ARG B 1 67  ? 42.573 -22.294 7.859   1.00 61.57  ? 508  ARG B CG  1 
ATOM   2530 C CD  . ARG B 1 67  ? 44.025 -22.730 7.924   1.00 62.02  ? 508  ARG B CD  1 
ATOM   2531 N NE  . ARG B 1 67  ? 44.725 -22.467 6.677   1.00 61.94  ? 508  ARG B NE  1 
ATOM   2532 C CZ  . ARG B 1 67  ? 44.684 -23.249 5.605   1.00 60.88  ? 508  ARG B CZ  1 
ATOM   2533 N NH1 . ARG B 1 67  ? 43.977 -24.377 5.603   1.00 59.49  ? 508  ARG B NH1 1 
ATOM   2534 N NH2 . ARG B 1 67  ? 45.366 -22.896 4.522   1.00 62.67  ? 508  ARG B NH2 1 
ATOM   2535 N N   . HIS B 1 68  ? 38.345 -23.334 9.973   1.00 61.41  ? 509  HIS B N   1 
ATOM   2536 C CA  . HIS B 1 68  ? 37.460 -24.079 10.853  1.00 62.54  ? 509  HIS B CA  1 
ATOM   2537 C C   . HIS B 1 68  ? 36.218 -24.513 10.084  1.00 62.03  ? 509  HIS B C   1 
ATOM   2538 O O   . HIS B 1 68  ? 35.663 -23.750 9.304   1.00 63.19  ? 509  HIS B O   1 
ATOM   2539 C CB  . HIS B 1 68  ? 37.056 -23.212 12.050  1.00 64.39  ? 509  HIS B CB  1 
ATOM   2540 C CG  . HIS B 1 68  ? 36.391 -23.977 13.148  1.00 65.42  ? 509  HIS B CG  1 
ATOM   2541 N ND1 . HIS B 1 68  ? 35.063 -24.329 13.104  1.00 64.34  ? 509  HIS B ND1 1 
ATOM   2542 C CD2 . HIS B 1 68  ? 36.872 -24.471 14.312  1.00 68.04  ? 509  HIS B CD2 1 
ATOM   2543 C CE1 . HIS B 1 68  ? 34.750 -25.006 14.192  1.00 64.73  ? 509  HIS B CE1 1 
ATOM   2544 N NE2 . HIS B 1 68  ? 35.831 -25.105 14.944  1.00 66.03  ? 509  HIS B NE2 1 
ATOM   2545 N N   . VAL B 1 69  ? 35.777 -25.733 10.350  1.00 65.04  ? 510  VAL B N   1 
ATOM   2546 C CA  . VAL B 1 69  ? 34.712 -26.403 9.580   1.00 66.36  ? 510  VAL B CA  1 
ATOM   2547 C C   . VAL B 1 69  ? 33.404 -25.619 9.504   1.00 67.38  ? 510  VAL B C   1 
ATOM   2548 O O   . VAL B 1 69  ? 32.660 -25.738 8.524   1.00 69.40  ? 510  VAL B O   1 
ATOM   2549 C CB  . VAL B 1 69  ? 34.309 -27.765 10.195  1.00 68.06  ? 510  VAL B CB  1 
ATOM   2550 C CG1 . VAL B 1 69  ? 33.990 -28.745 9.080   1.00 69.50  ? 510  VAL B CG1 1 
ATOM   2551 C CG2 . VAL B 1 69  ? 35.382 -28.329 11.132  1.00 70.67  ? 510  VAL B CG2 1 
ATOM   2552 N N   . ASN B 1 70  ? 33.118 -24.880 10.576  1.00 64.40  ? 511  ASN B N   1 
ATOM   2553 C CA  . ASN B 1 70  ? 31.892 -24.100 10.745  1.00 62.24  ? 511  ASN B CA  1 
ATOM   2554 C C   . ASN B 1 70  ? 32.024 -22.625 10.342  1.00 62.64  ? 511  ASN B C   1 
ATOM   2555 O O   . ASN B 1 70  ? 31.097 -21.834 10.563  1.00 61.31  ? 511  ASN B O   1 
ATOM   2556 C CB  . ASN B 1 70  ? 31.419 -24.165 12.215  1.00 60.51  ? 511  ASN B CB  1 
ATOM   2557 C CG  . ASN B 1 70  ? 30.976 -25.551 12.640  1.00 59.66  ? 511  ASN B CG  1 
ATOM   2558 O OD1 . ASN B 1 70  ? 31.232 -25.983 13.765  1.00 59.22  ? 511  ASN B OD1 1 
ATOM   2559 N ND2 . ASN B 1 70  ? 30.303 -26.254 11.746  1.00 60.02  ? 511  ASN B ND2 1 
ATOM   2560 N N   . ILE B 1 71  ? 33.175 -22.242 9.787   1.00 62.49  ? 512  ILE B N   1 
ATOM   2561 C CA  . ILE B 1 71  ? 33.330 -20.915 9.189   1.00 62.43  ? 512  ILE B CA  1 
ATOM   2562 C C   . ILE B 1 71  ? 33.393 -21.089 7.676   1.00 61.27  ? 512  ILE B C   1 
ATOM   2563 O O   . ILE B 1 71  ? 34.032 -22.005 7.183   1.00 62.90  ? 512  ILE B O   1 
ATOM   2564 C CB  . ILE B 1 71  ? 34.593 -20.193 9.701   1.00 62.35  ? 512  ILE B CB  1 
ATOM   2565 C CG1 . ILE B 1 71  ? 34.331 -19.457 11.009  1.00 63.38  ? 512  ILE B CG1 1 
ATOM   2566 C CG2 . ILE B 1 71  ? 35.042 -19.115 8.729   1.00 64.15  ? 512  ILE B CG2 1 
ATOM   2567 C CD1 . ILE B 1 71  ? 33.612 -20.252 12.066  1.00 64.65  ? 512  ILE B CD1 1 
ATOM   2568 N N   . LEU B 1 72  ? 32.718 -20.212 6.949   1.00 61.69  ? 513  LEU B N   1 
ATOM   2569 C CA  . LEU B 1 72  ? 32.783 -20.197 5.491   1.00 63.79  ? 513  LEU B CA  1 
ATOM   2570 C C   . LEU B 1 72  ? 34.229 -20.269 4.997   1.00 63.16  ? 513  LEU B C   1 
ATOM   2571 O O   . LEU B 1 72  ? 35.079 -19.491 5.428   1.00 64.04  ? 513  LEU B O   1 
ATOM   2572 C CB  . LEU B 1 72  ? 32.151 -18.910 4.962   1.00 66.05  ? 513  LEU B CB  1 
ATOM   2573 C CG  . LEU B 1 72  ? 31.914 -18.855 3.454   1.00 69.24  ? 513  LEU B CG  1 
ATOM   2574 C CD1 . LEU B 1 72  ? 30.616 -19.566 3.106   1.00 69.96  ? 513  LEU B CD1 1 
ATOM   2575 C CD2 . LEU B 1 72  ? 31.878 -17.408 2.983   1.00 73.51  ? 513  LEU B CD2 1 
ATOM   2576 N N   . LEU B 1 73  ? 34.513 -21.197 4.089   1.00 60.61  ? 514  LEU B N   1 
ATOM   2577 C CA  . LEU B 1 73  ? 35.871 -21.348 3.610   1.00 58.63  ? 514  LEU B CA  1 
ATOM   2578 C C   . LEU B 1 73  ? 36.237 -20.259 2.600   1.00 59.36  ? 514  LEU B C   1 
ATOM   2579 O O   . LEU B 1 73  ? 35.739 -20.219 1.467   1.00 61.66  ? 514  LEU B O   1 
ATOM   2580 C CB  . LEU B 1 73  ? 36.089 -22.737 3.018   1.00 59.74  ? 514  LEU B CB  1 
ATOM   2581 C CG  . LEU B 1 73  ? 37.530 -23.026 2.579   1.00 60.77  ? 514  LEU B CG  1 
ATOM   2582 C CD1 . LEU B 1 73  ? 38.489 -22.941 3.759   1.00 60.70  ? 514  LEU B CD1 1 
ATOM   2583 C CD2 . LEU B 1 73  ? 37.616 -24.384 1.901   1.00 61.76  ? 514  LEU B CD2 1 
ATOM   2584 N N   . PHE B 1 74  ? 37.113 -19.371 3.038   1.00 58.51  ? 515  PHE B N   1 
ATOM   2585 C CA  . PHE B 1 74  ? 37.748 -18.396 2.163   1.00 59.68  ? 515  PHE B CA  1 
ATOM   2586 C C   . PHE B 1 74  ? 38.761 -19.121 1.278   1.00 61.35  ? 515  PHE B C   1 
ATOM   2587 O O   . PHE B 1 74  ? 39.456 -20.011 1.752   1.00 61.94  ? 515  PHE B O   1 
ATOM   2588 C CB  . PHE B 1 74  ? 38.421 -17.339 3.039   1.00 59.36  ? 515  PHE B CB  1 
ATOM   2589 C CG  . PHE B 1 74  ? 39.479 -16.547 2.350   1.00 62.37  ? 515  PHE B CG  1 
ATOM   2590 C CD1 . PHE B 1 74  ? 39.146 -15.590 1.409   1.00 65.21  ? 515  PHE B CD1 1 
ATOM   2591 C CD2 . PHE B 1 74  ? 40.815 -16.728 2.669   1.00 64.60  ? 515  PHE B CD2 1 
ATOM   2592 C CE1 . PHE B 1 74  ? 40.131 -14.841 0.776   1.00 67.57  ? 515  PHE B CE1 1 
ATOM   2593 C CE2 . PHE B 1 74  ? 41.805 -15.982 2.043   1.00 66.22  ? 515  PHE B CE2 1 
ATOM   2594 C CZ  . PHE B 1 74  ? 41.462 -15.039 1.094   1.00 67.37  ? 515  PHE B CZ  1 
ATOM   2595 N N   . MET B 1 75  ? 38.838 -18.761 -0.000  1.00 63.02  ? 516  MET B N   1 
ATOM   2596 C CA  . MET B 1 75  ? 39.764 -19.423 -0.933  1.00 64.82  ? 516  MET B CA  1 
ATOM   2597 C C   . MET B 1 75  ? 40.796 -18.509 -1.589  1.00 66.50  ? 516  MET B C   1 
ATOM   2598 O O   . MET B 1 75  ? 41.865 -18.964 -2.006  1.00 69.49  ? 516  MET B O   1 
ATOM   2599 C CB  . MET B 1 75  ? 38.974 -20.137 -2.023  1.00 65.82  ? 516  MET B CB  1 
ATOM   2600 C CG  . MET B 1 75  ? 38.199 -21.331 -1.506  1.00 64.98  ? 516  MET B CG  1 
ATOM   2601 S SD  . MET B 1 75  ? 36.927 -21.844 -2.659  1.00 66.60  ? 516  MET B SD  1 
ATOM   2602 C CE  . MET B 1 75  ? 37.934 -22.431 -4.020  1.00 68.71  ? 516  MET B CE  1 
ATOM   2603 N N   . GLY B 1 76  ? 40.478 -17.230 -1.705  1.00 67.87  ? 517  GLY B N   1 
ATOM   2604 C CA  . GLY B 1 76  ? 41.390 -16.292 -2.339  1.00 70.84  ? 517  GLY B CA  1 
ATOM   2605 C C   . GLY B 1 76  ? 40.710 -15.017 -2.778  1.00 71.94  ? 517  GLY B C   1 
ATOM   2606 O O   . GLY B 1 76  ? 39.493 -14.872 -2.649  1.00 69.58  ? 517  GLY B O   1 
ATOM   2607 N N   . TYR B 1 77  ? 41.515 -14.097 -3.299  1.00 75.76  ? 518  TYR B N   1 
ATOM   2608 C CA  . TYR B 1 77  ? 41.032 -12.796 -3.742  1.00 79.39  ? 518  TYR B CA  1 
ATOM   2609 C C   . TYR B 1 77  ? 41.724 -12.363 -5.026  1.00 82.28  ? 518  TYR B C   1 
ATOM   2610 O O   . TYR B 1 77  ? 42.828 -12.813 -5.339  1.00 83.83  ? 518  TYR B O   1 
ATOM   2611 C CB  . TYR B 1 77  ? 41.275 -11.750 -2.651  1.00 79.59  ? 518  TYR B CB  1 
ATOM   2612 C CG  . TYR B 1 77  ? 42.738 -11.406 -2.405  1.00 80.87  ? 518  TYR B CG  1 
ATOM   2613 C CD1 . TYR B 1 77  ? 43.368 -10.398 -3.130  1.00 84.75  ? 518  TYR B CD1 1 
ATOM   2614 C CD2 . TYR B 1 77  ? 43.482 -12.072 -1.432  1.00 78.42  ? 518  TYR B CD2 1 
ATOM   2615 C CE1 . TYR B 1 77  ? 44.693 -10.072 -2.905  1.00 85.91  ? 518  TYR B CE1 1 
ATOM   2616 C CE2 . TYR B 1 77  ? 44.805 -11.748 -1.197  1.00 79.40  ? 518  TYR B CE2 1 
ATOM   2617 C CZ  . TYR B 1 77  ? 45.400 -10.748 -1.939  1.00 83.99  ? 518  TYR B CZ  1 
ATOM   2618 O OH  . TYR B 1 77  ? 46.709 -10.419 -1.723  1.00 87.10  ? 518  TYR B OH  1 
ATOM   2619 N N   . SER B 1 78  ? 41.061 -11.489 -5.767  1.00 85.22  ? 519  SER B N   1 
ATOM   2620 C CA  . SER B 1 78  ? 41.692 -10.811 -6.889  1.00 91.23  ? 519  SER B CA  1 
ATOM   2621 C C   . SER B 1 78  ? 41.372 -9.333  -6.795  1.00 92.70  ? 519  SER B C   1 
ATOM   2622 O O   . SER B 1 78  ? 40.270 -8.956  -6.392  1.00 90.36  ? 519  SER B O   1 
ATOM   2623 C CB  . SER B 1 78  ? 41.204 -11.369 -8.233  1.00 93.41  ? 519  SER B CB  1 
ATOM   2624 O OG  . SER B 1 78  ? 42.033 -10.928 -9.302  1.00 96.85  ? 519  SER B OG  1 
ATOM   2625 N N   . THR B 1 79  ? 42.357 -8.509  -7.135  1.00 96.30  ? 520  THR B N   1 
ATOM   2626 C CA  . THR B 1 79  ? 42.136 -7.090  -7.379  1.00 100.40 ? 520  THR B CA  1 
ATOM   2627 C C   . THR B 1 79  ? 42.301 -6.797  -8.860  1.00 102.90 ? 520  THR B C   1 
ATOM   2628 O O   . THR B 1 79  ? 42.120 -5.668  -9.282  1.00 104.15 ? 520  THR B O   1 
ATOM   2629 C CB  . THR B 1 79  ? 43.154 -6.248  -6.608  1.00 103.00 ? 520  THR B CB  1 
ATOM   2630 O OG1 . THR B 1 79  ? 44.472 -6.607  -7.037  1.00 104.98 ? 520  THR B OG1 1 
ATOM   2631 C CG2 . THR B 1 79  ? 43.027 -6.500  -5.106  1.00 101.17 ? 520  THR B CG2 1 
ATOM   2632 N N   . LYS B 1 80  ? 42.612 -7.833  -9.639  1.00 105.72 ? 521  LYS B N   1 
ATOM   2633 C CA  . LYS B 1 80  ? 43.142 -7.675  -10.996 1.00 109.98 ? 521  LYS B CA  1 
ATOM   2634 C C   . LYS B 1 80  ? 42.191 -6.918  -11.931 1.00 112.82 ? 521  LYS B C   1 
ATOM   2635 O O   . LYS B 1 80  ? 42.468 -5.765  -12.242 1.00 120.40 ? 521  LYS B O   1 
ATOM   2636 C CB  . LYS B 1 80  ? 43.577 -9.022  -11.583 1.00 109.44 ? 521  LYS B CB  1 
ATOM   2637 N N   . PRO B 1 81  ? 41.077 -7.541  -12.381 1.00 111.53 ? 522  PRO B N   1 
ATOM   2638 C CA  . PRO B 1 81  ? 40.138 -6.721  -13.172 1.00 113.87 ? 522  PRO B CA  1 
ATOM   2639 C C   . PRO B 1 81  ? 39.289 -5.829  -12.267 1.00 113.30 ? 522  PRO B C   1 
ATOM   2640 O O   . PRO B 1 81  ? 39.054 -4.669  -12.594 1.00 115.42 ? 522  PRO B O   1 
ATOM   2641 C CB  . PRO B 1 81  ? 39.275 -7.757  -13.887 1.00 113.21 ? 522  PRO B CB  1 
ATOM   2642 C CG  . PRO B 1 81  ? 39.293 -8.952  -12.984 1.00 110.55 ? 522  PRO B CG  1 
ATOM   2643 C CD  . PRO B 1 81  ? 40.589 -8.925  -12.213 1.00 108.59 ? 522  PRO B CD  1 
ATOM   2644 N N   . GLN B 1 82  ? 38.847 -6.387  -11.139 1.00 108.97 ? 523  GLN B N   1 
ATOM   2645 C CA  . GLN B 1 82  ? 38.153 -5.658  -10.084 1.00 106.58 ? 523  GLN B CA  1 
ATOM   2646 C C   . GLN B 1 82  ? 38.499 -6.278  -8.732  1.00 101.54 ? 523  GLN B C   1 
ATOM   2647 O O   . GLN B 1 82  ? 39.083 -7.359  -8.673  1.00 102.37 ? 523  GLN B O   1 
ATOM   2648 C CB  . GLN B 1 82  ? 36.650 -5.756  -10.281 1.00 106.46 ? 523  GLN B CB  1 
ATOM   2649 C CG  . GLN B 1 82  ? 36.120 -5.070  -11.521 1.00 111.13 ? 523  GLN B CG  1 
ATOM   2650 C CD  . GLN B 1 82  ? 34.605 -5.132  -11.578 1.00 113.46 ? 523  GLN B CD  1 
ATOM   2651 O OE1 . GLN B 1 82  ? 33.990 -6.071  -11.052 1.00 109.69 ? 523  GLN B OE1 1 
ATOM   2652 N NE2 . GLN B 1 82  ? 33.987 -4.126  -12.201 1.00 117.02 ? 523  GLN B NE2 1 
ATOM   2653 N N   . LEU B 1 83  ? 38.119 -5.600  -7.654  1.00 98.92  ? 524  LEU B N   1 
ATOM   2654 C CA  . LEU B 1 83  ? 38.291 -6.125  -6.303  1.00 94.09  ? 524  LEU B CA  1 
ATOM   2655 C C   . LEU B 1 83  ? 37.283 -7.234  -6.080  1.00 91.41  ? 524  LEU B C   1 
ATOM   2656 O O   . LEU B 1 83  ? 36.088 -7.032  -6.319  1.00 94.18  ? 524  LEU B O   1 
ATOM   2657 C CB  . LEU B 1 83  ? 38.072 -5.031  -5.253  1.00 95.14  ? 524  LEU B CB  1 
ATOM   2658 C CG  . LEU B 1 83  ? 38.928 -3.760  -5.345  1.00 99.76  ? 524  LEU B CG  1 
ATOM   2659 C CD1 . LEU B 1 83  ? 38.677 -2.883  -4.130  1.00 99.90  ? 524  LEU B CD1 1 
ATOM   2660 C CD2 . LEU B 1 83  ? 40.417 -4.069  -5.476  1.00 100.25 ? 524  LEU B CD2 1 
ATOM   2661 N N   . ALA B 1 84  ? 37.753 -8.396  -5.620  1.00 86.98  ? 525  ALA B N   1 
ATOM   2662 C CA  . ALA B 1 84  ? 36.872 -9.546  -5.415  1.00 81.00  ? 525  ALA B CA  1 
ATOM   2663 C C   . ALA B 1 84  ? 37.399 -10.547 -4.394  1.00 76.98  ? 525  ALA B C   1 
ATOM   2664 O O   . ALA B 1 84  ? 38.603 -10.736 -4.250  1.00 77.59  ? 525  ALA B O   1 
ATOM   2665 C CB  . ALA B 1 84  ? 36.629 -10.245 -6.735  1.00 81.66  ? 525  ALA B CB  1 
ATOM   2666 N N   . ILE B 1 85  ? 36.469 -11.195 -3.704  1.00 73.85  ? 526  ILE B N   1 
ATOM   2667 C CA  . ILE B 1 85  ? 36.777 -12.233 -2.733  1.00 70.75  ? 526  ILE B CA  1 
ATOM   2668 C C   . ILE B 1 85  ? 36.071 -13.534 -3.128  1.00 68.45  ? 526  ILE B C   1 
ATOM   2669 O O   . ILE B 1 85  ? 34.884 -13.538 -3.419  1.00 69.10  ? 526  ILE B O   1 
ATOM   2670 C CB  . ILE B 1 85  ? 36.319 -11.815 -1.325  1.00 70.72  ? 526  ILE B CB  1 
ATOM   2671 C CG1 . ILE B 1 85  ? 36.776 -10.383 -1.031  1.00 74.39  ? 526  ILE B CG1 1 
ATOM   2672 C CG2 . ILE B 1 85  ? 36.855 -12.776 -0.270  1.00 68.21  ? 526  ILE B CG2 1 
ATOM   2673 C CD1 . ILE B 1 85  ? 36.505 -9.929  0.389   1.00 75.17  ? 526  ILE B CD1 1 
ATOM   2674 N N   . VAL B 1 86  ? 36.810 -14.635 -3.121  1.00 67.49  ? 527  VAL B N   1 
ATOM   2675 C CA  . VAL B 1 86  ? 36.288 -15.927 -3.525  1.00 67.09  ? 527  VAL B CA  1 
ATOM   2676 C C   . VAL B 1 86  ? 36.177 -16.832 -2.320  1.00 65.14  ? 527  VAL B C   1 
ATOM   2677 O O   . VAL B 1 86  ? 37.155 -17.017 -1.605  1.00 64.59  ? 527  VAL B O   1 
ATOM   2678 C CB  . VAL B 1 86  ? 37.238 -16.608 -4.524  1.00 69.33  ? 527  VAL B CB  1 
ATOM   2679 C CG1 . VAL B 1 86  ? 36.745 -18.004 -4.866  1.00 69.00  ? 527  VAL B CG1 1 
ATOM   2680 C CG2 . VAL B 1 86  ? 37.374 -15.768 -5.787  1.00 73.32  ? 527  VAL B CG2 1 
ATOM   2681 N N   . THR B 1 87  ? 34.999 -17.406 -2.101  1.00 64.90  ? 528  THR B N   1 
ATOM   2682 C CA  . THR B 1 87  ? 34.832 -18.406 -1.054  1.00 65.56  ? 528  THR B CA  1 
ATOM   2683 C C   . THR B 1 87  ? 34.196 -19.642 -1.631  1.00 66.80  ? 528  THR B C   1 
ATOM   2684 O O   . THR B 1 87  ? 33.772 -19.648 -2.786  1.00 68.37  ? 528  THR B O   1 
ATOM   2685 C CB  . THR B 1 87  ? 33.898 -17.920 0.041   1.00 65.25  ? 528  THR B CB  1 
ATOM   2686 O OG1 . THR B 1 87  ? 32.608 -17.703 -0.529  1.00 68.66  ? 528  THR B OG1 1 
ATOM   2687 C CG2 . THR B 1 87  ? 34.406 -16.636 0.633   1.00 67.15  ? 528  THR B CG2 1 
ATOM   2688 N N   . GLN B 1 88  ? 34.110 -20.687 -0.819  1.00 66.37  ? 529  GLN B N   1 
ATOM   2689 C CA  . GLN B 1 88  ? 33.368 -21.870 -1.219  1.00 68.04  ? 529  GLN B CA  1 
ATOM   2690 C C   . GLN B 1 88  ? 31.929 -21.484 -1.516  1.00 67.62  ? 529  GLN B C   1 
ATOM   2691 O O   . GLN B 1 88  ? 31.421 -20.506 -0.974  1.00 64.53  ? 529  GLN B O   1 
ATOM   2692 C CB  . GLN B 1 88  ? 33.400 -22.951 -0.132  1.00 68.18  ? 529  GLN B CB  1 
ATOM   2693 C CG  . GLN B 1 88  ? 32.650 -22.588 1.148   1.00 68.03  ? 529  GLN B CG  1 
ATOM   2694 C CD  . GLN B 1 88  ? 32.605 -23.724 2.151   1.00 67.54  ? 529  GLN B CD  1 
ATOM   2695 O OE1 . GLN B 1 88  ? 32.867 -23.531 3.345   1.00 63.88  ? 529  GLN B OE1 1 
ATOM   2696 N NE2 . GLN B 1 88  ? 32.271 -24.924 1.669   1.00 69.17  ? 529  GLN B NE2 1 
ATOM   2697 N N   . TRP B 1 89  ? 31.301 -22.252 -2.400  1.00 71.50  ? 530  TRP B N   1 
ATOM   2698 C CA  . TRP B 1 89  ? 29.875 -22.140 -2.683  1.00 73.03  ? 530  TRP B CA  1 
ATOM   2699 C C   . TRP B 1 89  ? 29.158 -23.049 -1.710  1.00 73.92  ? 530  TRP B C   1 
ATOM   2700 O O   . TRP B 1 89  ? 29.592 -24.176 -1.506  1.00 78.05  ? 530  TRP B O   1 
ATOM   2701 C CB  . TRP B 1 89  ? 29.576 -22.596 -4.116  1.00 73.99  ? 530  TRP B CB  1 
ATOM   2702 C CG  . TRP B 1 89  ? 28.127 -22.510 -4.458  1.00 76.08  ? 530  TRP B CG  1 
ATOM   2703 C CD1 . TRP B 1 89  ? 27.246 -23.543 -4.573  1.00 78.07  ? 530  TRP B CD1 1 
ATOM   2704 C CD2 . TRP B 1 89  ? 27.380 -21.315 -4.704  1.00 77.49  ? 530  TRP B CD2 1 
ATOM   2705 N NE1 . TRP B 1 89  ? 25.994 -23.068 -4.885  1.00 79.26  ? 530  TRP B NE1 1 
ATOM   2706 C CE2 . TRP B 1 89  ? 26.048 -21.703 -4.969  1.00 78.70  ? 530  TRP B CE2 1 
ATOM   2707 C CE3 . TRP B 1 89  ? 27.708 -19.954 -4.727  1.00 77.13  ? 530  TRP B CE3 1 
ATOM   2708 C CZ2 . TRP B 1 89  ? 25.045 -20.782 -5.253  1.00 80.71  ? 530  TRP B CZ2 1 
ATOM   2709 C CZ3 . TRP B 1 89  ? 26.714 -19.039 -5.013  1.00 79.69  ? 530  TRP B CZ3 1 
ATOM   2710 C CH2 . TRP B 1 89  ? 25.394 -19.458 -5.273  1.00 82.17  ? 530  TRP B CH2 1 
ATOM   2711 N N   . CYS B 1 90  ? 28.069 -22.587 -1.105  1.00 75.81  ? 531  CYS B N   1 
ATOM   2712 C CA  . CYS B 1 90  ? 27.311 -23.452 -0.191  1.00 77.93  ? 531  CYS B CA  1 
ATOM   2713 C C   . CYS B 1 90  ? 26.005 -23.972 -0.820  1.00 78.19  ? 531  CYS B C   1 
ATOM   2714 O O   . CYS B 1 90  ? 25.332 -23.265 -1.579  1.00 77.72  ? 531  CYS B O   1 
ATOM   2715 C CB  . CYS B 1 90  ? 27.047 -22.729 1.131   1.00 79.20  ? 531  CYS B CB  1 
ATOM   2716 S SG  . CYS B 1 90  ? 28.542 -22.121 1.963   1.00 78.28  ? 531  CYS B SG  1 
ATOM   2717 N N   . GLU B 1 91  ? 25.664 -25.216 -0.499  1.00 78.01  ? 532  GLU B N   1 
ATOM   2718 C CA  . GLU B 1 91  ? 24.542 -25.915 -1.109  1.00 81.63  ? 532  GLU B CA  1 
ATOM   2719 C C   . GLU B 1 91  ? 23.424 -26.010 -0.093  1.00 78.75  ? 532  GLU B C   1 
ATOM   2720 O O   . GLU B 1 91  ? 23.637 -26.506 1.008   1.00 77.93  ? 532  GLU B O   1 
ATOM   2721 C CB  . GLU B 1 91  ? 24.971 -27.326 -1.521  1.00 84.88  ? 532  GLU B CB  1 
ATOM   2722 C CG  . GLU B 1 91  ? 24.388 -27.799 -2.844  1.00 90.12  ? 532  GLU B CG  1 
ATOM   2723 C CD  . GLU B 1 91  ? 25.221 -27.377 -4.045  1.00 91.77  ? 532  GLU B CD  1 
ATOM   2724 O OE1 . GLU B 1 91  ? 26.310 -26.790 -3.841  1.00 86.94  ? 532  GLU B OE1 1 
ATOM   2725 O OE2 . GLU B 1 91  ? 24.783 -27.642 -5.193  1.00 93.67  ? 532  GLU B OE2 1 
ATOM   2726 N N   . GLY B 1 92  ? 22.243 -25.528 -0.459  1.00 79.63  ? 533  GLY B N   1 
ATOM   2727 C CA  . GLY B 1 92  ? 21.095 -25.513 0.446   1.00 78.05  ? 533  GLY B CA  1 
ATOM   2728 C C   . GLY B 1 92  ? 20.553 -24.111 0.641   1.00 76.82  ? 533  GLY B C   1 
ATOM   2729 O O   . GLY B 1 92  ? 20.187 -23.438 -0.330  1.00 78.75  ? 533  GLY B O   1 
ATOM   2730 N N   . SER B 1 93  ? 20.503 -23.667 1.895   1.00 73.84  ? 534  SER B N   1 
ATOM   2731 C CA  . SER B 1 93  ? 19.897 -22.377 2.237   1.00 71.62  ? 534  SER B CA  1 
ATOM   2732 C C   . SER B 1 93  ? 20.148 -21.999 3.686   1.00 67.10  ? 534  SER B C   1 
ATOM   2733 O O   . SER B 1 93  ? 20.624 -22.802 4.482   1.00 62.81  ? 534  SER B O   1 
ATOM   2734 C CB  . SER B 1 93  ? 18.390 -22.398 1.967   1.00 73.97  ? 534  SER B CB  1 
ATOM   2735 O OG  . SER B 1 93  ? 17.786 -23.510 2.591   1.00 75.41  ? 534  SER B OG  1 
ATOM   2736 N N   . SER B 1 94  ? 19.819 -20.757 4.021   1.00 66.79  ? 535  SER B N   1 
ATOM   2737 C CA  . SER B 1 94  ? 20.136 -20.227 5.340   1.00 63.08  ? 535  SER B CA  1 
ATOM   2738 C C   . SER B 1 94  ? 19.209 -20.778 6.409   1.00 62.91  ? 535  SER B C   1 
ATOM   2739 O O   . SER B 1 94  ? 18.123 -21.288 6.132   1.00 63.26  ? 535  SER B O   1 
ATOM   2740 C CB  . SER B 1 94  ? 20.105 -18.691 5.346   1.00 61.41  ? 535  SER B CB  1 
ATOM   2741 O OG  . SER B 1 94  ? 18.786 -18.181 5.337   1.00 61.40  ? 535  SER B OG  1 
ATOM   2742 N N   . LEU B 1 95  ? 19.669 -20.672 7.643   1.00 62.17  ? 536  LEU B N   1 
ATOM   2743 C CA  . LEU B 1 95  ? 18.872 -21.035 8.786   1.00 62.78  ? 536  LEU B CA  1 
ATOM   2744 C C   . LEU B 1 95  ? 17.616 -20.172 8.858   1.00 64.98  ? 536  LEU B C   1 
ATOM   2745 O O   . LEU B 1 95  ? 16.534 -20.677 9.162   1.00 67.02  ? 536  LEU B O   1 
ATOM   2746 C CB  . LEU B 1 95  ? 19.711 -20.880 10.038  1.00 61.94  ? 536  LEU B CB  1 
ATOM   2747 C CG  . LEU B 1 95  ? 19.096 -21.269 11.365  1.00 63.56  ? 536  LEU B CG  1 
ATOM   2748 C CD1 . LEU B 1 95  ? 18.424 -22.637 11.298  1.00 65.35  ? 536  LEU B CD1 1 
ATOM   2749 C CD2 . LEU B 1 95  ? 20.202 -21.240 12.406  1.00 62.86  ? 536  LEU B CD2 1 
ATOM   2750 N N   . TYR B 1 96  ? 17.757 -18.882 8.554   1.00 65.98  ? 537  TYR B N   1 
ATOM   2751 C CA  . TYR B 1 96  ? 16.604 -17.976 8.466   1.00 68.48  ? 537  TYR B CA  1 
ATOM   2752 C C   . TYR B 1 96  ? 15.551 -18.561 7.528   1.00 72.17  ? 537  TYR B C   1 
ATOM   2753 O O   . TYR B 1 96  ? 14.393 -18.727 7.907   1.00 78.54  ? 537  TYR B O   1 
ATOM   2754 C CB  . TYR B 1 96  ? 17.033 -16.591 7.973   1.00 67.01  ? 537  TYR B CB  1 
ATOM   2755 C CG  . TYR B 1 96  ? 15.917 -15.574 7.858   1.00 67.59  ? 537  TYR B CG  1 
ATOM   2756 C CD1 . TYR B 1 96  ? 15.675 -14.657 8.878   1.00 69.26  ? 537  TYR B CD1 1 
ATOM   2757 C CD2 . TYR B 1 96  ? 15.122 -15.505 6.720   1.00 70.07  ? 537  TYR B CD2 1 
ATOM   2758 C CE1 . TYR B 1 96  ? 14.658 -13.711 8.780   1.00 70.10  ? 537  TYR B CE1 1 
ATOM   2759 C CE2 . TYR B 1 96  ? 14.102 -14.569 6.609   1.00 72.56  ? 537  TYR B CE2 1 
ATOM   2760 C CZ  . TYR B 1 96  ? 13.874 -13.674 7.643   1.00 72.34  ? 537  TYR B CZ  1 
ATOM   2761 O OH  . TYR B 1 96  ? 12.866 -12.744 7.538   1.00 73.47  ? 537  TYR B OH  1 
ATOM   2762 N N   . HIS B 1 97  ? 15.975 -18.881 6.311   1.00 71.11  ? 538  HIS B N   1 
ATOM   2763 C CA  . HIS B 1 97  ? 15.096 -19.424 5.267   1.00 71.03  ? 538  HIS B CA  1 
ATOM   2764 C C   . HIS B 1 97  ? 14.374 -20.720 5.691   1.00 69.98  ? 538  HIS B C   1 
ATOM   2765 O O   . HIS B 1 97  ? 13.182 -20.897 5.417   1.00 69.58  ? 538  HIS B O   1 
ATOM   2766 C CB  . HIS B 1 97  ? 15.944 -19.678 4.021   1.00 71.04  ? 538  HIS B CB  1 
ATOM   2767 C CG  . HIS B 1 97  ? 15.157 -20.005 2.800   1.00 74.08  ? 538  HIS B CG  1 
ATOM   2768 N ND1 . HIS B 1 97  ? 14.885 -21.302 2.420   1.00 75.20  ? 538  HIS B ND1 1 
ATOM   2769 C CD2 . HIS B 1 97  ? 14.598 -19.208 1.858   1.00 75.92  ? 538  HIS B CD2 1 
ATOM   2770 C CE1 . HIS B 1 97  ? 14.185 -21.290 1.300   1.00 77.45  ? 538  HIS B CE1 1 
ATOM   2771 N NE2 . HIS B 1 97  ? 13.995 -20.032 0.941   1.00 78.36  ? 538  HIS B NE2 1 
ATOM   2772 N N   . HIS B 1 98  ? 15.102 -21.616 6.357   1.00 65.85  ? 539  HIS B N   1 
ATOM   2773 C CA  . HIS B 1 98  ? 14.525 -22.853 6.875   1.00 65.11  ? 539  HIS B CA  1 
ATOM   2774 C C   . HIS B 1 98  ? 13.481 -22.565 7.934   1.00 65.53  ? 539  HIS B C   1 
ATOM   2775 O O   . HIS B 1 98  ? 12.394 -23.124 7.922   1.00 68.40  ? 539  HIS B O   1 
ATOM   2776 C CB  . HIS B 1 98  ? 15.601 -23.742 7.505   1.00 63.91  ? 539  HIS B CB  1 
ATOM   2777 C CG  . HIS B 1 98  ? 16.350 -24.589 6.522   1.00 63.66  ? 539  HIS B CG  1 
ATOM   2778 N ND1 . HIS B 1 98  ? 15.769 -25.645 5.855   1.00 64.09  ? 539  HIS B ND1 1 
ATOM   2779 C CD2 . HIS B 1 98  ? 17.641 -24.554 6.120   1.00 61.89  ? 539  HIS B CD2 1 
ATOM   2780 C CE1 . HIS B 1 98  ? 16.665 -26.215 5.072   1.00 64.14  ? 539  HIS B CE1 1 
ATOM   2781 N NE2 . HIS B 1 98  ? 17.808 -25.571 5.214   1.00 63.83  ? 539  HIS B NE2 1 
ATOM   2782 N N   . LEU B 1 99  ? 13.830 -21.694 8.865   1.00 64.75  ? 540  LEU B N   1 
ATOM   2783 C CA  . LEU B 1 99  ? 13.006 -21.477 10.041  1.00 64.69  ? 540  LEU B CA  1 
ATOM   2784 C C   . LEU B 1 99  ? 11.757 -20.664 9.756   1.00 67.85  ? 540  LEU B C   1 
ATOM   2785 O O   . LEU B 1 99  ? 10.708 -20.930 10.335  1.00 72.46  ? 540  LEU B O   1 
ATOM   2786 C CB  . LEU B 1 99  ? 13.829 -20.789 11.126  1.00 62.46  ? 540  LEU B CB  1 
ATOM   2787 C CG  . LEU B 1 99  ? 14.383 -21.655 12.259  1.00 62.24  ? 540  LEU B CG  1 
ATOM   2788 C CD1 . LEU B 1 99  ? 14.567 -23.116 11.905  1.00 62.24  ? 540  LEU B CD1 1 
ATOM   2789 C CD2 . LEU B 1 99  ? 15.689 -21.062 12.747  1.00 62.31  ? 540  LEU B CD2 1 
ATOM   2790 N N   . HIS B 1 100 ? 11.866 -19.682 8.864   1.00 68.14  ? 541  HIS B N   1 
ATOM   2791 C CA  . HIS B 1 100 ? 10.832 -18.657 8.717   1.00 67.57  ? 541  HIS B CA  1 
ATOM   2792 C C   . HIS B 1 100 ? 10.209 -18.569 7.340   1.00 70.05  ? 541  HIS B C   1 
ATOM   2793 O O   . HIS B 1 100 ? 9.204  -17.899 7.188   1.00 72.14  ? 541  HIS B O   1 
ATOM   2794 C CB  . HIS B 1 100 ? 11.416 -17.299 9.084   1.00 65.18  ? 541  HIS B CB  1 
ATOM   2795 C CG  . HIS B 1 100 ? 12.179 -17.314 10.366  1.00 63.17  ? 541  HIS B CG  1 
ATOM   2796 N ND1 . HIS B 1 100 ? 11.578 -17.537 11.584  1.00 64.25  ? 541  HIS B ND1 1 
ATOM   2797 C CD2 . HIS B 1 100 ? 13.498 -17.163 10.621  1.00 61.71  ? 541  HIS B CD2 1 
ATOM   2798 C CE1 . HIS B 1 100 ? 12.491 -17.511 12.537  1.00 62.56  ? 541  HIS B CE1 1 
ATOM   2799 N NE2 . HIS B 1 100 ? 13.665 -17.284 11.980  1.00 61.42  ? 541  HIS B NE2 1 
ATOM   2800 N N   . ILE B 1 101 ? 10.790 -19.229 6.342   1.00 71.55  ? 542  ILE B N   1 
ATOM   2801 C CA  . ILE B 1 101 ? 10.280 -19.131 4.976   1.00 74.96  ? 542  ILE B CA  1 
ATOM   2802 C C   . ILE B 1 101 ? 9.631  -20.459 4.588   1.00 78.39  ? 542  ILE B C   1 
ATOM   2803 O O   . ILE B 1 101 ? 8.408  -20.561 4.583   1.00 81.33  ? 542  ILE B O   1 
ATOM   2804 C CB  . ILE B 1 101 ? 11.383 -18.681 3.980   1.00 74.62  ? 542  ILE B CB  1 
ATOM   2805 C CG1 . ILE B 1 101 ? 11.953 -17.308 4.382   1.00 73.92  ? 542  ILE B CG1 1 
ATOM   2806 C CG2 . ILE B 1 101 ? 10.856 -18.616 2.560   1.00 77.17  ? 542  ILE B CG2 1 
ATOM   2807 C CD1 . ILE B 1 101 ? 10.920 -16.218 4.599   1.00 74.84  ? 542  ILE B CD1 1 
ATOM   2808 N N   . ILE B 1 102 ? 10.425 -21.486 4.298   1.00 79.03  ? 543  ILE B N   1 
ATOM   2809 C CA  . ILE B 1 102 ? 9.853  -22.807 3.990   1.00 81.08  ? 543  ILE B CA  1 
ATOM   2810 C C   . ILE B 1 102 ? 9.409  -23.560 5.255   1.00 82.44  ? 543  ILE B C   1 
ATOM   2811 O O   . ILE B 1 102 ? 8.854  -24.656 5.167   1.00 83.90  ? 543  ILE B O   1 
ATOM   2812 C CB  . ILE B 1 102 ? 10.813 -23.678 3.154   1.00 80.19  ? 543  ILE B CB  1 
ATOM   2813 C CG1 . ILE B 1 102 ? 12.072 -24.046 3.952   1.00 76.46  ? 543  ILE B CG1 1 
ATOM   2814 C CG2 . ILE B 1 102 ? 11.155 -22.960 1.852   1.00 80.94  ? 543  ILE B CG2 1 
ATOM   2815 C CD1 . ILE B 1 102 ? 13.059 -24.883 3.172   1.00 76.14  ? 543  ILE B CD1 1 
ATOM   2816 N N   . GLU B 1 103 ? 9.666  -22.967 6.422   1.00 82.83  ? 544  GLU B N   1 
ATOM   2817 C CA  . GLU B 1 103 ? 9.209  -23.489 7.711   1.00 84.00  ? 544  GLU B CA  1 
ATOM   2818 C C   . GLU B 1 103 ? 9.499  -24.987 7.865   1.00 82.93  ? 544  GLU B C   1 
ATOM   2819 O O   . GLU B 1 103 ? 8.607  -25.798 8.091   1.00 86.08  ? 544  GLU B O   1 
ATOM   2820 C CB  . GLU B 1 103 ? 7.725  -23.145 7.933   1.00 88.13  ? 544  GLU B CB  1 
ATOM   2821 C CG  . GLU B 1 103 ? 7.490  -21.688 8.335   1.00 88.85  ? 544  GLU B CG  1 
ATOM   2822 C CD  . GLU B 1 103 ? 6.043  -21.388 8.721   1.00 92.50  ? 544  GLU B CD  1 
ATOM   2823 O OE1 . GLU B 1 103 ? 5.756  -21.282 9.936   1.00 92.23  ? 544  GLU B OE1 1 
ATOM   2824 O OE2 . GLU B 1 103 ? 5.186  -21.256 7.818   1.00 94.23  ? 544  GLU B OE2 1 
ATOM   2825 N N   . THR B 1 104 ? 10.770 -25.334 7.726   1.00 80.72  ? 545  THR B N   1 
ATOM   2826 C CA  . THR B 1 104 ? 11.239 -26.699 7.925   1.00 81.44  ? 545  THR B CA  1 
ATOM   2827 C C   . THR B 1 104 ? 11.054 -27.108 9.384   1.00 83.37  ? 545  THR B C   1 
ATOM   2828 O O   . THR B 1 104 ? 11.422 -26.361 10.303  1.00 82.95  ? 545  THR B O   1 
ATOM   2829 C CB  . THR B 1 104 ? 12.733 -26.830 7.535   1.00 78.89  ? 545  THR B CB  1 
ATOM   2830 O OG1 . THR B 1 104 ? 12.880 -26.675 6.116   1.00 76.63  ? 545  THR B OG1 1 
ATOM   2831 C CG2 . THR B 1 104 ? 13.315 -28.181 7.957   1.00 78.73  ? 545  THR B CG2 1 
ATOM   2832 N N   . LYS B 1 105 ? 10.494 -28.300 9.584   1.00 87.91  ? 546  LYS B N   1 
ATOM   2833 C CA  . LYS B 1 105 ? 10.280 -28.861 10.924  1.00 90.63  ? 546  LYS B CA  1 
ATOM   2834 C C   . LYS B 1 105 ? 11.397 -29.844 11.298  1.00 88.14  ? 546  LYS B C   1 
ATOM   2835 O O   . LYS B 1 105 ? 11.324 -31.033 10.974  1.00 88.41  ? 546  LYS B O   1 
ATOM   2836 C CB  . LYS B 1 105 ? 8.920  -29.569 10.989  1.00 97.64  ? 546  LYS B CB  1 
ATOM   2837 C CG  . LYS B 1 105 ? 7.723  -28.695 10.617  1.00 102.07 ? 546  LYS B CG  1 
ATOM   2838 C CD  . LYS B 1 105 ? 7.602  -27.455 11.504  1.00 100.51 ? 546  LYS B CD  1 
ATOM   2839 C CE  . LYS B 1 105 ? 6.353  -26.648 11.172  1.00 101.09 ? 546  LYS B CE  1 
ATOM   2840 N NZ  . LYS B 1 105 ? 6.200  -25.483 12.085  1.00 99.83  ? 546  LYS B NZ  1 
ATOM   2841 N N   . PHE B 1 106 ? 12.430 -29.328 11.968  1.00 82.54  ? 547  PHE B N   1 
ATOM   2842 C CA  . PHE B 1 106 ? 13.562 -30.134 12.430  1.00 79.96  ? 547  PHE B CA  1 
ATOM   2843 C C   . PHE B 1 106 ? 13.224 -30.844 13.732  1.00 79.73  ? 547  PHE B C   1 
ATOM   2844 O O   . PHE B 1 106 ? 12.561 -30.267 14.581  1.00 79.40  ? 547  PHE B O   1 
ATOM   2845 C CB  . PHE B 1 106 ? 14.763 -29.241 12.745  1.00 78.85  ? 547  PHE B CB  1 
ATOM   2846 C CG  . PHE B 1 106 ? 15.376 -28.566 11.554  1.00 77.86  ? 547  PHE B CG  1 
ATOM   2847 C CD1 . PHE B 1 106 ? 15.368 -27.176 11.446  1.00 75.92  ? 547  PHE B CD1 1 
ATOM   2848 C CD2 . PHE B 1 106 ? 16.008 -29.309 10.566  1.00 79.39  ? 547  PHE B CD2 1 
ATOM   2849 C CE1 . PHE B 1 106 ? 15.950 -26.544 10.361  1.00 75.18  ? 547  PHE B CE1 1 
ATOM   2850 C CE2 . PHE B 1 106 ? 16.591 -28.681 9.474   1.00 79.21  ? 547  PHE B CE2 1 
ATOM   2851 C CZ  . PHE B 1 106 ? 16.564 -27.297 9.373   1.00 76.64  ? 547  PHE B CZ  1 
ATOM   2852 N N   . GLU B 1 107 ? 13.716 -32.066 13.918  1.00 80.68  ? 548  GLU B N   1 
ATOM   2853 C CA  . GLU B 1 107 ? 13.645 -32.714 15.233  1.00 83.32  ? 548  GLU B CA  1 
ATOM   2854 C C   . GLU B 1 107 ? 14.535 -31.951 16.222  1.00 80.25  ? 548  GLU B C   1 
ATOM   2855 O O   . GLU B 1 107 ? 15.454 -31.253 15.809  1.00 78.70  ? 548  GLU B O   1 
ATOM   2856 C CB  . GLU B 1 107 ? 14.102 -34.168 15.150  1.00 88.25  ? 548  GLU B CB  1 
ATOM   2857 C CG  . GLU B 1 107 ? 13.102 -35.114 14.503  1.00 94.79  ? 548  GLU B CG  1 
ATOM   2858 C CD  . GLU B 1 107 ? 13.481 -36.583 14.680  1.00 101.81 ? 548  GLU B CD  1 
ATOM   2859 O OE1 . GLU B 1 107 ? 14.696 -36.901 14.724  1.00 101.74 ? 548  GLU B OE1 1 
ATOM   2860 O OE2 . GLU B 1 107 ? 12.561 -37.427 14.779  1.00 108.23 ? 548  GLU B OE2 1 
ATOM   2861 N N   . MET B 1 108 ? 14.278 -32.096 17.520  1.00 80.50  ? 549  MET B N   1 
ATOM   2862 C CA  . MET B 1 108 ? 15.060 -31.385 18.532  1.00 78.65  ? 549  MET B CA  1 
ATOM   2863 C C   . MET B 1 108 ? 16.530 -31.827 18.529  1.00 78.11  ? 549  MET B C   1 
ATOM   2864 O O   . MET B 1 108 ? 17.429 -31.017 18.772  1.00 75.28  ? 549  MET B O   1 
ATOM   2865 C CB  . MET B 1 108 ? 14.443 -31.571 19.919  1.00 83.13  ? 549  MET B CB  1 
ATOM   2866 C CG  . MET B 1 108 ? 15.055 -30.713 21.031  1.00 84.01  ? 549  MET B CG  1 
ATOM   2867 S SD  . MET B 1 108 ? 14.693 -28.931 21.011  1.00 86.68  ? 549  MET B SD  1 
ATOM   2868 C CE  . MET B 1 108 ? 12.898 -28.931 21.102  1.00 89.94  ? 549  MET B CE  1 
ATOM   2869 N N   . ILE B 1 109 ? 16.772 -33.101 18.230  1.00 80.22  ? 550  ILE B N   1 
ATOM   2870 C CA  . ILE B 1 109 ? 18.137 -33.622 18.096  1.00 78.71  ? 550  ILE B CA  1 
ATOM   2871 C C   . ILE B 1 109 ? 18.976 -32.707 17.189  1.00 74.80  ? 550  ILE B C   1 
ATOM   2872 O O   . ILE B 1 109 ? 20.143 -32.433 17.476  1.00 70.76  ? 550  ILE B O   1 
ATOM   2873 C CB  . ILE B 1 109 ? 18.178 -35.064 17.514  1.00 82.35  ? 550  ILE B CB  1 
ATOM   2874 C CG1 . ILE B 1 109 ? 17.111 -35.969 18.153  1.00 90.57  ? 550  ILE B CG1 1 
ATOM   2875 C CG2 . ILE B 1 109 ? 19.553 -35.684 17.728  1.00 81.45  ? 550  ILE B CG2 1 
ATOM   2876 C CD1 . ILE B 1 109 ? 16.972 -37.349 17.524  1.00 95.22  ? 550  ILE B CD1 1 
ATOM   2877 N N   . LYS B 1 110 ? 18.377 -32.231 16.099  1.00 75.36  ? 551  LYS B N   1 
ATOM   2878 C CA  . LYS B 1 110 ? 19.107 -31.425 15.112  1.00 74.28  ? 551  LYS B CA  1 
ATOM   2879 C C   . LYS B 1 110 ? 19.196 -29.950 15.491  1.00 69.96  ? 551  LYS B C   1 
ATOM   2880 O O   . LYS B 1 110 ? 20.234 -29.319 15.281  1.00 66.91  ? 551  LYS B O   1 
ATOM   2881 C CB  . LYS B 1 110 ? 18.469 -31.557 13.728  1.00 77.26  ? 551  LYS B CB  1 
ATOM   2882 C CG  . LYS B 1 110 ? 19.402 -31.170 12.591  1.00 78.37  ? 551  LYS B CG  1 
ATOM   2883 C CD  . LYS B 1 110 ? 18.889 -31.703 11.258  1.00 83.94  ? 551  LYS B CD  1 
ATOM   2884 C CE  . LYS B 1 110 ? 19.975 -31.754 10.186  1.00 84.63  ? 551  LYS B CE  1 
ATOM   2885 N NZ  . LYS B 1 110 ? 19.753 -32.891 9.238   1.00 88.67  ? 551  LYS B NZ  1 
ATOM   2886 N N   . LEU B 1 111 ? 18.110 -29.399 16.032  1.00 67.43  ? 552  LEU B N   1 
ATOM   2887 C CA  . LEU B 1 111 ? 18.115 -28.016 16.492  1.00 63.89  ? 552  LEU B CA  1 
ATOM   2888 C C   . LEU B 1 111 ? 19.236 -27.811 17.503  1.00 62.79  ? 552  LEU B C   1 
ATOM   2889 O O   . LEU B 1 111 ? 19.919 -26.794 17.500  1.00 59.36  ? 552  LEU B O   1 
ATOM   2890 C CB  . LEU B 1 111 ? 16.776 -27.642 17.125  1.00 65.35  ? 552  LEU B CB  1 
ATOM   2891 C CG  . LEU B 1 111 ? 15.534 -27.581 16.218  1.00 65.96  ? 552  LEU B CG  1 
ATOM   2892 C CD1 . LEU B 1 111 ? 14.297 -27.377 17.077  1.00 67.21  ? 552  LEU B CD1 1 
ATOM   2893 C CD2 . LEU B 1 111 ? 15.621 -26.493 15.156  1.00 62.51  ? 552  LEU B CD2 1 
ATOM   2894 N N   . ILE B 1 112 ? 19.434 -28.793 18.367  1.00 65.44  ? 553  ILE B N   1 
ATOM   2895 C CA  . ILE B 1 112 ? 20.505 -28.720 19.346  1.00 65.66  ? 553  ILE B CA  1 
ATOM   2896 C C   . ILE B 1 112 ? 21.841 -28.876 18.639  1.00 66.21  ? 553  ILE B C   1 
ATOM   2897 O O   . ILE B 1 112 ? 22.804 -28.169 18.935  1.00 67.80  ? 553  ILE B O   1 
ATOM   2898 C CB  . ILE B 1 112 ? 20.338 -29.798 20.425  1.00 68.69  ? 553  ILE B CB  1 
ATOM   2899 C CG1 . ILE B 1 112 ? 19.077 -29.504 21.242  1.00 70.62  ? 553  ILE B CG1 1 
ATOM   2900 C CG2 . ILE B 1 112 ? 21.563 -29.850 21.328  1.00 69.20  ? 553  ILE B CG2 1 
ATOM   2901 C CD1 . ILE B 1 112 ? 18.629 -30.645 22.124  1.00 75.23  ? 553  ILE B CD1 1 
ATOM   2902 N N   . ASP B 1 113 ? 21.904 -29.795 17.693  1.00 67.26  ? 554  ASP B N   1 
ATOM   2903 C CA  . ASP B 1 113 ? 23.113 -29.941 16.916  1.00 68.63  ? 554  ASP B CA  1 
ATOM   2904 C C   . ASP B 1 113 ? 23.451 -28.657 16.148  1.00 65.45  ? 554  ASP B C   1 
ATOM   2905 O O   . ASP B 1 113 ? 24.612 -28.270 16.081  1.00 66.64  ? 554  ASP B O   1 
ATOM   2906 C CB  . ASP B 1 113 ? 22.991 -31.114 15.954  1.00 72.73  ? 554  ASP B CB  1 
ATOM   2907 C CG  . ASP B 1 113 ? 24.290 -31.419 15.249  1.00 73.91  ? 554  ASP B CG  1 
ATOM   2908 O OD1 . ASP B 1 113 ? 25.322 -31.569 15.937  1.00 76.03  ? 554  ASP B OD1 1 
ATOM   2909 O OD2 . ASP B 1 113 ? 24.277 -31.506 14.006  1.00 77.43  ? 554  ASP B OD2 1 
ATOM   2910 N N   . ILE B 1 114 ? 22.451 -27.991 15.578  1.00 62.34  ? 555  ILE B N   1 
ATOM   2911 C CA  . ILE B 1 114 ? 22.707 -26.737 14.876  1.00 59.24  ? 555  ILE B CA  1 
ATOM   2912 C C   . ILE B 1 114 ? 23.215 -25.687 15.874  1.00 58.38  ? 555  ILE B C   1 
ATOM   2913 O O   . ILE B 1 114 ? 24.162 -24.947 15.592  1.00 54.93  ? 555  ILE B O   1 
ATOM   2914 C CB  . ILE B 1 114 ? 21.458 -26.244 14.129  1.00 59.18  ? 555  ILE B CB  1 
ATOM   2915 C CG1 . ILE B 1 114 ? 21.165 -27.165 12.946  1.00 61.08  ? 555  ILE B CG1 1 
ATOM   2916 C CG2 . ILE B 1 114 ? 21.667 -24.835 13.610  1.00 57.85  ? 555  ILE B CG2 1 
ATOM   2917 C CD1 . ILE B 1 114 ? 19.810 -26.944 12.320  1.00 62.20  ? 555  ILE B CD1 1 
ATOM   2918 N N   . ALA B 1 115 ? 22.591 -25.647 17.048  1.00 60.56  ? 556  ALA B N   1 
ATOM   2919 C CA  . ALA B 1 115 ? 23.028 -24.775 18.132  1.00 59.19  ? 556  ALA B CA  1 
ATOM   2920 C C   . ALA B 1 115 ? 24.475 -25.047 18.476  1.00 59.35  ? 556  ALA B C   1 
ATOM   2921 O O   . ALA B 1 115 ? 25.250 -24.115 18.641  1.00 59.77  ? 556  ALA B O   1 
ATOM   2922 C CB  . ALA B 1 115 ? 22.161 -24.977 19.359  1.00 61.45  ? 556  ALA B CB  1 
ATOM   2923 N N   . ARG B 1 116 ? 24.844 -26.322 18.563  1.00 62.03  ? 557  ARG B N   1 
ATOM   2924 C CA  . ARG B 1 116 ? 26.214 -26.685 18.938  1.00 64.72  ? 557  ARG B CA  1 
ATOM   2925 C C   . ARG B 1 116 ? 27.241 -26.194 17.931  1.00 62.06  ? 557  ARG B C   1 
ATOM   2926 O O   . ARG B 1 116 ? 28.255 -25.611 18.303  1.00 64.54  ? 557  ARG B O   1 
ATOM   2927 C CB  . ARG B 1 116 ? 26.379 -28.198 19.111  1.00 69.16  ? 557  ARG B CB  1 
ATOM   2928 C CG  . ARG B 1 116 ? 27.694 -28.551 19.790  1.00 72.78  ? 557  ARG B CG  1 
ATOM   2929 C CD  . ARG B 1 116 ? 27.876 -30.035 20.070  1.00 79.07  ? 557  ARG B CD  1 
ATOM   2930 N NE  . ARG B 1 116 ? 27.563 -30.881 18.918  1.00 86.49  ? 557  ARG B NE  1 
ATOM   2931 C CZ  . ARG B 1 116 ? 28.246 -30.917 17.767  1.00 87.84  ? 557  ARG B CZ  1 
ATOM   2932 N NH1 . ARG B 1 116 ? 29.309 -30.141 17.555  1.00 85.56  ? 557  ARG B NH1 1 
ATOM   2933 N NH2 . ARG B 1 116 ? 27.853 -31.740 16.800  1.00 89.71  ? 557  ARG B NH2 1 
ATOM   2934 N N   . GLN B 1 117 ? 26.980 -26.437 16.657  1.00 58.87  ? 558  GLN B N   1 
ATOM   2935 C CA  . GLN B 1 117 ? 27.924 -26.072 15.626  1.00 57.26  ? 558  GLN B CA  1 
ATOM   2936 C C   . GLN B 1 117 ? 28.101 -24.577 15.530  1.00 57.15  ? 558  GLN B C   1 
ATOM   2937 O O   . GLN B 1 117 ? 29.224 -24.100 15.383  1.00 58.10  ? 558  GLN B O   1 
ATOM   2938 C CB  . GLN B 1 117 ? 27.460 -26.596 14.297  1.00 59.11  ? 558  GLN B CB  1 
ATOM   2939 C CG  . GLN B 1 117 ? 27.504 -28.100 14.205  1.00 61.18  ? 558  GLN B CG  1 
ATOM   2940 C CD  . GLN B 1 117 ? 27.269 -28.557 12.796  1.00 62.11  ? 558  GLN B CD  1 
ATOM   2941 O OE1 . GLN B 1 117 ? 27.972 -28.145 11.884  1.00 62.04  ? 558  GLN B OE1 1 
ATOM   2942 N NE2 . GLN B 1 117 ? 26.277 -29.402 12.604  1.00 66.40  ? 558  GLN B NE2 1 
ATOM   2943 N N   . THR B 1 118 ? 26.995 -23.840 15.613  1.00 58.17  ? 559  THR B N   1 
ATOM   2944 C CA  . THR B 1 118 ? 27.042 -22.380 15.615  1.00 55.86  ? 559  THR B CA  1 
ATOM   2945 C C   . THR B 1 118 ? 27.896 -21.911 16.774  1.00 55.54  ? 559  THR B C   1 
ATOM   2946 O O   . THR B 1 118 ? 28.743 -21.041 16.609  1.00 55.43  ? 559  THR B O   1 
ATOM   2947 C CB  . THR B 1 118 ? 25.645 -21.755 15.740  1.00 55.58  ? 559  THR B CB  1 
ATOM   2948 O OG1 . THR B 1 118 ? 24.779 -22.321 14.751  1.00 56.94  ? 559  THR B OG1 1 
ATOM   2949 C CG2 . THR B 1 118 ? 25.703 -20.244 15.544  1.00 53.48  ? 559  THR B CG2 1 
ATOM   2950 N N   . ALA B 1 119 ? 27.692 -22.495 17.945  1.00 56.56  ? 560  ALA B N   1 
ATOM   2951 C CA  . ALA B 1 119 ? 28.532 -22.141 19.094  1.00 60.97  ? 560  ALA B CA  1 
ATOM   2952 C C   . ALA B 1 119 ? 29.989 -22.526 18.859  1.00 61.03  ? 560  ALA B C   1 
ATOM   2953 O O   . ALA B 1 119 ? 30.902 -21.866 19.346  1.00 60.79  ? 560  ALA B O   1 
ATOM   2954 C CB  . ALA B 1 119 ? 28.019 -22.796 20.366  1.00 62.76  ? 560  ALA B CB  1 
ATOM   2955 N N   . GLN B 1 120 ? 30.202 -23.598 18.109  1.00 62.63  ? 561  GLN B N   1 
ATOM   2956 C CA  . GLN B 1 120 ? 31.548 -24.112 17.919  1.00 65.72  ? 561  GLN B CA  1 
ATOM   2957 C C   . GLN B 1 120 ? 32.343 -23.101 17.122  1.00 61.79  ? 561  GLN B C   1 
ATOM   2958 O O   . GLN B 1 120 ? 33.443 -22.715 17.516  1.00 63.04  ? 561  GLN B O   1 
ATOM   2959 C CB  . GLN B 1 120 ? 31.524 -25.481 17.229  1.00 68.17  ? 561  GLN B CB  1 
ATOM   2960 C CG  . GLN B 1 120 ? 32.493 -26.488 17.830  1.00 74.56  ? 561  GLN B CG  1 
ATOM   2961 C CD  . GLN B 1 120 ? 31.888 -27.891 17.954  1.00 83.93  ? 561  GLN B CD  1 
ATOM   2962 O OE1 . GLN B 1 120 ? 31.209 -28.396 17.031  1.00 83.30  ? 561  GLN B OE1 1 
ATOM   2963 N NE2 . GLN B 1 120 ? 32.142 -28.538 19.097  1.00 87.35  ? 561  GLN B NE2 1 
ATOM   2964 N N   . GLY B 1 121 ? 31.753 -22.649 16.023  1.00 58.33  ? 562  GLY B N   1 
ATOM   2965 C CA  . GLY B 1 121 ? 32.363 -21.635 15.180  1.00 58.14  ? 562  GLY B CA  1 
ATOM   2966 C C   . GLY B 1 121 ? 32.546 -20.294 15.867  1.00 58.07  ? 562  GLY B C   1 
ATOM   2967 O O   . GLY B 1 121 ? 33.529 -19.610 15.642  1.00 59.81  ? 562  GLY B O   1 
ATOM   2968 N N   . MET B 1 122 ? 31.601 -19.913 16.712  1.00 60.06  ? 563  MET B N   1 
ATOM   2969 C CA  . MET B 1 122 ? 31.661 -18.620 17.388  1.00 61.00  ? 563  MET B CA  1 
ATOM   2970 C C   . MET B 1 122 ? 32.751 -18.588 18.449  1.00 63.41  ? 563  MET B C   1 
ATOM   2971 O O   . MET B 1 122 ? 33.334 -17.536 18.741  1.00 64.59  ? 563  MET B O   1 
ATOM   2972 C CB  . MET B 1 122 ? 30.308 -18.314 18.019  1.00 63.37  ? 563  MET B CB  1 
ATOM   2973 C CG  . MET B 1 122 ? 29.246 -17.896 17.008  1.00 64.74  ? 563  MET B CG  1 
ATOM   2974 S SD  . MET B 1 122 ? 29.658 -16.387 16.110  1.00 65.99  ? 563  MET B SD  1 
ATOM   2975 C CE  . MET B 1 122 ? 30.174 -15.308 17.445  1.00 66.58  ? 563  MET B CE  1 
ATOM   2976 N N   . ASP B 1 123 ? 33.016 -19.745 19.037  1.00 64.24  ? 564  ASP B N   1 
ATOM   2977 C CA  . ASP B 1 123 ? 34.097 -19.867 19.985  1.00 66.62  ? 564  ASP B CA  1 
ATOM   2978 C C   . ASP B 1 123 ? 35.424 -19.746 19.249  1.00 65.96  ? 564  ASP B C   1 
ATOM   2979 O O   . ASP B 1 123 ? 36.371 -19.150 19.754  1.00 67.55  ? 564  ASP B O   1 
ATOM   2980 C CB  . ASP B 1 123 ? 34.015 -21.206 20.703  1.00 69.96  ? 564  ASP B CB  1 
ATOM   2981 C CG  . ASP B 1 123 ? 35.026 -21.326 21.818  1.00 75.53  ? 564  ASP B CG  1 
ATOM   2982 O OD1 . ASP B 1 123 ? 35.275 -20.305 22.508  1.00 79.65  ? 564  ASP B OD1 1 
ATOM   2983 O OD2 . ASP B 1 123 ? 35.572 -22.441 21.997  1.00 79.02  ? 564  ASP B OD2 1 
ATOM   2984 N N   . TYR B 1 124 ? 35.485 -20.310 18.048  1.00 62.82  ? 565  TYR B N   1 
ATOM   2985 C CA  . TYR B 1 124 ? 36.679 -20.199 17.223  1.00 62.37  ? 565  TYR B CA  1 
ATOM   2986 C C   . TYR B 1 124 ? 37.006 -18.744 16.913  1.00 61.46  ? 565  TYR B C   1 
ATOM   2987 O O   . TYR B 1 124 ? 38.142 -18.305 17.071  1.00 64.02  ? 565  TYR B O   1 
ATOM   2988 C CB  . TYR B 1 124 ? 36.499 -20.966 15.925  1.00 59.18  ? 565  TYR B CB  1 
ATOM   2989 C CG  . TYR B 1 124 ? 37.690 -20.902 15.025  1.00 60.22  ? 565  TYR B CG  1 
ATOM   2990 C CD1 . TYR B 1 124 ? 38.801 -21.666 15.286  1.00 62.99  ? 565  TYR B CD1 1 
ATOM   2991 C CD2 . TYR B 1 124 ? 37.706 -20.082 13.908  1.00 59.98  ? 565  TYR B CD2 1 
ATOM   2992 C CE1 . TYR B 1 124 ? 39.906 -21.628 14.460  1.00 66.09  ? 565  TYR B CE1 1 
ATOM   2993 C CE2 . TYR B 1 124 ? 38.806 -20.037 13.069  1.00 62.19  ? 565  TYR B CE2 1 
ATOM   2994 C CZ  . TYR B 1 124 ? 39.909 -20.815 13.355  1.00 65.16  ? 565  TYR B CZ  1 
ATOM   2995 O OH  . TYR B 1 124 ? 41.026 -20.808 12.547  1.00 67.94  ? 565  TYR B OH  1 
ATOM   2996 N N   . LEU B 1 125 ? 36.004 -18.001 16.471  1.00 59.18  ? 566  LEU B N   1 
ATOM   2997 C CA  . LEU B 1 125 ? 36.205 -16.608 16.127  1.00 60.66  ? 566  LEU B CA  1 
ATOM   2998 C C   . LEU B 1 125 ? 36.761 -15.823 17.317  1.00 63.60  ? 566  LEU B C   1 
ATOM   2999 O O   . LEU B 1 125 ? 37.818 -15.205 17.226  1.00 67.53  ? 566  LEU B O   1 
ATOM   3000 C CB  . LEU B 1 125 ? 34.897 -16.000 15.642  1.00 58.36  ? 566  LEU B CB  1 
ATOM   3001 C CG  . LEU B 1 125 ? 34.339 -16.581 14.332  1.00 59.14  ? 566  LEU B CG  1 
ATOM   3002 C CD1 . LEU B 1 125 ? 33.022 -15.891 14.009  1.00 61.03  ? 566  LEU B CD1 1 
ATOM   3003 C CD2 . LEU B 1 125 ? 35.284 -16.448 13.142  1.00 59.91  ? 566  LEU B CD2 1 
ATOM   3004 N N   . HIS B 1 126 ? 36.061 -15.892 18.438  1.00 63.43  ? 567  HIS B N   1 
ATOM   3005 C CA  . HIS B 1 126 ? 36.448 -15.186 19.658  1.00 65.53  ? 567  HIS B CA  1 
ATOM   3006 C C   . HIS B 1 126 ? 37.832 -15.558 20.216  1.00 68.95  ? 567  HIS B C   1 
ATOM   3007 O O   . HIS B 1 126 ? 38.502 -14.728 20.848  1.00 72.99  ? 567  HIS B O   1 
ATOM   3008 C CB  . HIS B 1 126 ? 35.385 -15.430 20.721  1.00 65.49  ? 567  HIS B CB  1 
ATOM   3009 C CG  . HIS B 1 126 ? 34.100 -14.720 20.447  1.00 63.49  ? 567  HIS B CG  1 
ATOM   3010 N ND1 . HIS B 1 126 ? 33.136 -14.529 21.413  1.00 65.15  ? 567  HIS B ND1 1 
ATOM   3011 C CD2 . HIS B 1 126 ? 33.635 -14.122 19.326  1.00 61.29  ? 567  HIS B CD2 1 
ATOM   3012 C CE1 . HIS B 1 126 ? 32.123 -13.860 20.892  1.00 61.99  ? 567  HIS B CE1 1 
ATOM   3013 N NE2 . HIS B 1 126 ? 32.402 -13.600 19.628  1.00 60.36  ? 567  HIS B NE2 1 
ATOM   3014 N N   . ALA B 1 127 ? 38.251 -16.800 19.993  1.00 69.31  ? 568  ALA B N   1 
ATOM   3015 C CA  . ALA B 1 127 ? 39.604 -17.236 20.348  1.00 71.40  ? 568  ALA B CA  1 
ATOM   3016 C C   . ALA B 1 127 ? 40.635 -16.571 19.443  1.00 72.78  ? 568  ALA B C   1 
ATOM   3017 O O   . ALA B 1 127 ? 41.738 -16.265 19.887  1.00 74.80  ? 568  ALA B O   1 
ATOM   3018 C CB  . ALA B 1 127 ? 39.725 -18.749 20.250  1.00 72.49  ? 568  ALA B CB  1 
ATOM   3019 N N   . LYS B 1 128 ? 40.267 -16.353 18.178  1.00 72.64  ? 569  LYS B N   1 
ATOM   3020 C CA  . LYS B 1 128 ? 41.090 -15.583 17.233  1.00 75.00  ? 569  LYS B CA  1 
ATOM   3021 C C   . LYS B 1 128 ? 40.871 -14.059 17.338  1.00 76.02  ? 569  LYS B C   1 
ATOM   3022 O O   . LYS B 1 128 ? 41.416 -13.305 16.525  1.00 81.37  ? 569  LYS B O   1 
ATOM   3023 C CB  . LYS B 1 128 ? 40.812 -16.022 15.791  1.00 73.14  ? 569  LYS B CB  1 
ATOM   3024 C CG  . LYS B 1 128 ? 41.128 -17.474 15.484  1.00 73.13  ? 569  LYS B CG  1 
ATOM   3025 C CD  . LYS B 1 128 ? 42.618 -17.709 15.382  1.00 76.30  ? 569  LYS B CD  1 
ATOM   3026 C CE  . LYS B 1 128 ? 42.904 -18.996 14.635  1.00 77.11  ? 569  LYS B CE  1 
ATOM   3027 N NZ  . LYS B 1 128 ? 44.345 -19.353 14.726  1.00 82.23  ? 569  LYS B NZ  1 
ATOM   3028 N N   . SER B 1 129 ? 40.082 -13.611 18.320  1.00 72.29  ? 570  SER B N   1 
ATOM   3029 C CA  . SER B 1 129 ? 39.833 -12.185 18.556  1.00 72.50  ? 570  SER B CA  1 
ATOM   3030 C C   . SER B 1 129 ? 38.987 -11.502 17.466  1.00 71.32  ? 570  SER B C   1 
ATOM   3031 O O   . SER B 1 129 ? 39.077 -10.289 17.257  1.00 72.28  ? 570  SER B O   1 
ATOM   3032 C CB  . SER B 1 129 ? 41.154 -11.426 18.781  1.00 76.10  ? 570  SER B CB  1 
ATOM   3033 O OG  . SER B 1 129 ? 41.413 -11.287 20.165  1.00 78.62  ? 570  SER B OG  1 
ATOM   3034 N N   . ILE B 1 130 ? 38.145 -12.276 16.794  1.00 68.57  ? 571  ILE B N   1 
ATOM   3035 C CA  . ILE B 1 130 ? 37.251 -11.728 15.792  1.00 67.70  ? 571  ILE B CA  1 
ATOM   3036 C C   . ILE B 1 130 ? 35.853 -11.594 16.369  1.00 65.06  ? 571  ILE B C   1 
ATOM   3037 O O   . ILE B 1 130 ? 35.227 -12.598 16.706  1.00 63.65  ? 571  ILE B O   1 
ATOM   3038 C CB  . ILE B 1 130 ? 37.182 -12.639 14.555  1.00 68.65  ? 571  ILE B CB  1 
ATOM   3039 C CG1 . ILE B 1 130 ? 38.520 -12.617 13.810  1.00 73.24  ? 571  ILE B CG1 1 
ATOM   3040 C CG2 . ILE B 1 130 ? 36.052 -12.198 13.634  1.00 68.42  ? 571  ILE B CG2 1 
ATOM   3041 C CD1 . ILE B 1 130 ? 38.670 -13.698 12.751  1.00 75.17  ? 571  ILE B CD1 1 
ATOM   3042 N N   . ILE B 1 131 ? 35.367 -10.359 16.468  1.00 64.39  ? 572  ILE B N   1 
ATOM   3043 C CA  . ILE B 1 131 ? 33.968 -10.109 16.806  1.00 62.53  ? 572  ILE B CA  1 
ATOM   3044 C C   . ILE B 1 131 ? 33.141 -10.020 15.523  1.00 60.98  ? 572  ILE B C   1 
ATOM   3045 O O   . ILE B 1 131 ? 33.407 -9.181  14.669  1.00 62.67  ? 572  ILE B O   1 
ATOM   3046 C CB  . ILE B 1 131 ? 33.796 -8.813  17.620  1.00 64.71  ? 572  ILE B CB  1 
ATOM   3047 C CG1 . ILE B 1 131 ? 34.639 -8.871  18.905  1.00 65.83  ? 572  ILE B CG1 1 
ATOM   3048 C CG2 . ILE B 1 131 ? 32.328 -8.602  17.968  1.00 64.61  ? 572  ILE B CG2 1 
ATOM   3049 C CD1 . ILE B 1 131 ? 34.581 -7.627  19.766  1.00 66.29  ? 572  ILE B CD1 1 
ATOM   3050 N N   . HIS B 1 132 ? 32.123 -10.873 15.414  1.00 60.36  ? 573  HIS B N   1 
ATOM   3051 C CA  . HIS B 1 132 ? 31.313 -10.990 14.200  1.00 58.82  ? 573  HIS B CA  1 
ATOM   3052 C C   . HIS B 1 132 ? 30.522 -9.720  13.900  1.00 59.74  ? 573  HIS B C   1 
ATOM   3053 O O   . HIS B 1 132 ? 30.537 -9.236  12.765  1.00 57.07  ? 573  HIS B O   1 
ATOM   3054 C CB  . HIS B 1 132 ? 30.349 -12.181 14.309  1.00 57.94  ? 573  HIS B CB  1 
ATOM   3055 C CG  . HIS B 1 132 ? 29.757 -12.592 12.995  1.00 60.14  ? 573  HIS B CG  1 
ATOM   3056 N ND1 . HIS B 1 132 ? 28.744 -11.889 12.382  1.00 63.29  ? 573  HIS B ND1 1 
ATOM   3057 C CD2 . HIS B 1 132 ? 30.052 -13.618 12.164  1.00 61.11  ? 573  HIS B CD2 1 
ATOM   3058 C CE1 . HIS B 1 132 ? 28.440 -12.461 11.231  1.00 63.60  ? 573  HIS B CE1 1 
ATOM   3059 N NE2 . HIS B 1 132 ? 29.216 -13.517 11.077  1.00 61.27  ? 573  HIS B NE2 1 
ATOM   3060 N N   . ARG B 1 133 ? 29.806 -9.228  14.917  1.00 61.35  ? 574  ARG B N   1 
ATOM   3061 C CA  . ARG B 1 133 ? 29.042 -7.963  14.882  1.00 63.14  ? 574  ARG B CA  1 
ATOM   3062 C C   . ARG B 1 133 ? 27.658 -8.019  14.239  1.00 63.31  ? 574  ARG B C   1 
ATOM   3063 O O   . ARG B 1 133 ? 26.850 -7.118  14.462  1.00 66.76  ? 574  ARG B O   1 
ATOM   3064 C CB  . ARG B 1 133 ? 29.831 -6.828  14.228  1.00 66.68  ? 574  ARG B CB  1 
ATOM   3065 C CG  . ARG B 1 133 ? 31.057 -6.392  14.998  1.00 70.79  ? 574  ARG B CG  1 
ATOM   3066 C CD  . ARG B 1 133 ? 31.740 -5.229  14.302  1.00 75.99  ? 574  ARG B CD  1 
ATOM   3067 N NE  . ARG B 1 133 ? 32.466 -4.399  15.261  1.00 80.95  ? 574  ARG B NE  1 
ATOM   3068 C CZ  . ARG B 1 133 ? 33.716 -4.615  15.678  1.00 84.55  ? 574  ARG B CZ  1 
ATOM   3069 N NH1 . ARG B 1 133 ? 34.260 -3.778  16.568  1.00 87.84  ? 574  ARG B NH1 1 
ATOM   3070 N NH2 . ARG B 1 133 ? 34.429 -5.654  15.220  1.00 82.05  ? 574  ARG B NH2 1 
ATOM   3071 N N   . ASP B 1 134 ? 27.381 -9.050  13.449  1.00 61.93  ? 575  ASP B N   1 
ATOM   3072 C CA  . ASP B 1 134 ? 26.104 -9.168  12.751  1.00 63.80  ? 575  ASP B CA  1 
ATOM   3073 C C   . ASP B 1 134 ? 25.713 -10.641 12.640  1.00 63.03  ? 575  ASP B C   1 
ATOM   3074 O O   . ASP B 1 134 ? 25.387 -11.138 11.573  1.00 63.34  ? 575  ASP B O   1 
ATOM   3075 C CB  . ASP B 1 134 ? 26.207 -8.488  11.380  1.00 68.50  ? 575  ASP B CB  1 
ATOM   3076 C CG  . ASP B 1 134 ? 24.849 -8.264  10.700  1.00 73.70  ? 575  ASP B CG  1 
ATOM   3077 O OD1 . ASP B 1 134 ? 23.818 -8.074  11.392  1.00 77.20  ? 575  ASP B OD1 1 
ATOM   3078 O OD2 . ASP B 1 134 ? 24.827 -8.270  9.443   1.00 77.18  ? 575  ASP B OD2 1 
ATOM   3079 N N   . LEU B 1 135 ? 25.760 -11.341 13.768  1.00 63.70  ? 576  LEU B N   1 
ATOM   3080 C CA  . LEU B 1 135 ? 25.317 -12.721 13.821  1.00 59.18  ? 576  LEU B CA  1 
ATOM   3081 C C   . LEU B 1 135 ? 23.802 -12.740 13.795  1.00 58.56  ? 576  LEU B C   1 
ATOM   3082 O O   . LEU B 1 135 ? 23.157 -12.022 14.549  1.00 60.60  ? 576  LEU B O   1 
ATOM   3083 C CB  . LEU B 1 135 ? 25.823 -13.388 15.093  1.00 60.65  ? 576  LEU B CB  1 
ATOM   3084 C CG  . LEU B 1 135 ? 25.519 -14.872 15.308  1.00 59.75  ? 576  LEU B CG  1 
ATOM   3085 C CD1 . LEU B 1 135 ? 26.108 -15.725 14.204  1.00 61.32  ? 576  LEU B CD1 1 
ATOM   3086 C CD2 . LEU B 1 135 ? 26.066 -15.316 16.648  1.00 60.41  ? 576  LEU B CD2 1 
ATOM   3087 N N   . LYS B 1 136 ? 23.249 -13.549 12.900  1.00 57.75  ? 577  LYS B N   1 
ATOM   3088 C CA  . LYS B 1 136 ? 21.812 -13.758 12.787  1.00 56.76  ? 577  LYS B CA  1 
ATOM   3089 C C   . LYS B 1 136 ? 21.540 -14.946 11.855  1.00 58.40  ? 577  LYS B C   1 
ATOM   3090 O O   . LYS B 1 136 ? 22.387 -15.327 11.038  1.00 59.61  ? 577  LYS B O   1 
ATOM   3091 C CB  . LYS B 1 136 ? 21.109 -12.502 12.266  1.00 57.36  ? 577  LYS B CB  1 
ATOM   3092 C CG  . LYS B 1 136 ? 21.680 -11.954 10.974  1.00 58.85  ? 577  LYS B CG  1 
ATOM   3093 C CD  . LYS B 1 136 ? 20.881 -10.763 10.473  1.00 62.14  ? 577  LYS B CD  1 
ATOM   3094 C CE  . LYS B 1 136 ? 21.756 -9.837  9.645   1.00 65.04  ? 577  LYS B CE  1 
ATOM   3095 N NZ  . LYS B 1 136 ? 21.017 -9.116  8.570   1.00 70.51  ? 577  LYS B NZ  1 
ATOM   3096 N N   . SER B 1 137 ? 20.349 -15.517 11.961  1.00 58.08  ? 578  SER B N   1 
ATOM   3097 C CA  . SER B 1 137 ? 20.030 -16.733 11.236  1.00 58.19  ? 578  SER B CA  1 
ATOM   3098 C C   . SER B 1 137 ? 20.193 -16.671 9.708   1.00 58.68  ? 578  SER B C   1 
ATOM   3099 O O   . SER B 1 137 ? 20.345 -17.709 9.087   1.00 59.29  ? 578  SER B O   1 
ATOM   3100 C CB  . SER B 1 137 ? 18.613 -17.177 11.586  1.00 61.13  ? 578  SER B CB  1 
ATOM   3101 O OG  . SER B 1 137 ? 17.714 -16.096 11.446  1.00 64.48  ? 578  SER B OG  1 
ATOM   3102 N N   . ASN B 1 138 ? 20.150 -15.499 9.079   1.00 60.30  ? 579  ASN B N   1 
ATOM   3103 C CA  . ASN B 1 138 ? 20.429 -15.459 7.626   1.00 65.15  ? 579  ASN B CA  1 
ATOM   3104 C C   . ASN B 1 138 ? 21.907 -15.347 7.318   1.00 62.39  ? 579  ASN B C   1 
ATOM   3105 O O   . ASN B 1 138 ? 22.289 -15.363 6.161   1.00 63.54  ? 579  ASN B O   1 
ATOM   3106 C CB  . ASN B 1 138 ? 19.626 -14.405 6.849   1.00 71.99  ? 579  ASN B CB  1 
ATOM   3107 C CG  . ASN B 1 138 ? 19.350 -13.161 7.654   1.00 80.78  ? 579  ASN B CG  1 
ATOM   3108 O OD1 . ASN B 1 138 ? 19.117 -13.219 8.871   1.00 86.36  ? 579  ASN B OD1 1 
ATOM   3109 N ND2 . ASN B 1 138 ? 19.338 -12.021 6.976   1.00 88.23  ? 579  ASN B ND2 1 
ATOM   3110 N N   . ASN B 1 139 ? 22.730 -15.239 8.354   1.00 60.55  ? 580  ASN B N   1 
ATOM   3111 C CA  . ASN B 1 139 ? 24.176 -15.340 8.207   1.00 60.54  ? 580  ASN B CA  1 
ATOM   3112 C C   . ASN B 1 139 ? 24.687 -16.707 8.668   1.00 59.47  ? 580  ASN B C   1 
ATOM   3113 O O   . ASN B 1 139 ? 25.858 -16.865 8.988   1.00 58.80  ? 580  ASN B O   1 
ATOM   3114 C CB  . ASN B 1 139 ? 24.869 -14.200 8.963   1.00 60.97  ? 580  ASN B CB  1 
ATOM   3115 C CG  . ASN B 1 139 ? 24.783 -12.872 8.221   1.00 65.89  ? 580  ASN B CG  1 
ATOM   3116 O OD1 . ASN B 1 139 ? 24.593 -12.840 7.000   1.00 70.22  ? 580  ASN B OD1 1 
ATOM   3117 N ND2 . ASN B 1 139 ? 24.917 -11.766 8.952   1.00 66.23  ? 580  ASN B ND2 1 
ATOM   3118 N N   . ILE B 1 140 ? 23.804 -17.701 8.679   1.00 60.60  ? 581  ILE B N   1 
ATOM   3119 C CA  . ILE B 1 140 ? 24.153 -19.059 9.090   1.00 60.53  ? 581  ILE B CA  1 
ATOM   3120 C C   . ILE B 1 140 ? 23.614 -20.012 8.035   1.00 61.10  ? 581  ILE B C   1 
ATOM   3121 O O   . ILE B 1 140 ? 22.415 -20.263 7.960   1.00 62.21  ? 581  ILE B O   1 
ATOM   3122 C CB  . ILE B 1 140 ? 23.552 -19.405 10.471  1.00 61.16  ? 581  ILE B CB  1 
ATOM   3123 C CG1 . ILE B 1 140 ? 24.205 -18.574 11.561  1.00 61.64  ? 581  ILE B CG1 1 
ATOM   3124 C CG2 . ILE B 1 140 ? 23.770 -20.867 10.816  1.00 63.68  ? 581  ILE B CG2 1 
ATOM   3125 C CD1 . ILE B 1 140 ? 23.458 -18.610 12.874  1.00 64.52  ? 581  ILE B CD1 1 
ATOM   3126 N N   . PHE B 1 141 ? 24.508 -20.533 7.212   1.00 63.26  ? 582  PHE B N   1 
ATOM   3127 C CA  . PHE B 1 141 ? 24.118 -21.341 6.075   1.00 66.84  ? 582  PHE B CA  1 
ATOM   3128 C C   . PHE B 1 141 ? 24.109 -22.788 6.532   1.00 66.40  ? 582  PHE B C   1 
ATOM   3129 O O   . PHE B 1 141 ? 25.020 -23.208 7.230   1.00 68.04  ? 582  PHE B O   1 
ATOM   3130 C CB  . PHE B 1 141 ? 25.107 -21.131 4.924   1.00 68.42  ? 582  PHE B CB  1 
ATOM   3131 C CG  . PHE B 1 141 ? 24.488 -21.258 3.559   1.00 74.39  ? 582  PHE B CG  1 
ATOM   3132 C CD1 . PHE B 1 141 ? 24.068 -20.128 2.862   1.00 75.56  ? 582  PHE B CD1 1 
ATOM   3133 C CD2 . PHE B 1 141 ? 24.322 -22.510 2.968   1.00 76.73  ? 582  PHE B CD2 1 
ATOM   3134 C CE1 . PHE B 1 141 ? 23.502 -20.247 1.604   1.00 78.69  ? 582  PHE B CE1 1 
ATOM   3135 C CE2 . PHE B 1 141 ? 23.747 -22.634 1.713   1.00 78.96  ? 582  PHE B CE2 1 
ATOM   3136 C CZ  . PHE B 1 141 ? 23.339 -21.500 1.031   1.00 80.50  ? 582  PHE B CZ  1 
ATOM   3137 N N   . LEU B 1 142 ? 23.077 -23.539 6.164   1.00 67.48  ? 583  LEU B N   1 
ATOM   3138 C CA  . LEU B 1 142 ? 23.012 -24.951 6.511   1.00 69.40  ? 583  LEU B CA  1 
ATOM   3139 C C   . LEU B 1 142 ? 23.473 -25.761 5.292   1.00 70.47  ? 583  LEU B C   1 
ATOM   3140 O O   . LEU B 1 142 ? 22.672 -26.144 4.428   1.00 69.34  ? 583  LEU B O   1 
ATOM   3141 C CB  . LEU B 1 142 ? 21.600 -25.331 6.957   1.00 74.58  ? 583  LEU B CB  1 
ATOM   3142 C CG  . LEU B 1 142 ? 21.462 -26.018 8.318   1.00 78.79  ? 583  LEU B CG  1 
ATOM   3143 C CD1 . LEU B 1 142 ? 20.055 -26.591 8.442   1.00 83.47  ? 583  LEU B CD1 1 
ATOM   3144 C CD2 . LEU B 1 142 ? 22.497 -27.115 8.534   1.00 79.85  ? 583  LEU B CD2 1 
ATOM   3145 N N   . HIS B 1 143 ? 24.786 -25.996 5.241   1.00 70.70  ? 584  HIS B N   1 
ATOM   3146 C CA  . HIS B 1 143 ? 25.471 -26.545 4.068   1.00 71.45  ? 584  HIS B CA  1 
ATOM   3147 C C   . HIS B 1 143 ? 25.229 -28.030 3.907   1.00 74.49  ? 584  HIS B C   1 
ATOM   3148 O O   . HIS B 1 143 ? 25.427 -28.803 4.846   1.00 73.87  ? 584  HIS B O   1 
ATOM   3149 C CB  . HIS B 1 143 ? 26.971 -26.305 4.171   1.00 69.44  ? 584  HIS B CB  1 
ATOM   3150 C CG  . HIS B 1 143 ? 27.737 -26.826 3.000   1.00 73.67  ? 584  HIS B CG  1 
ATOM   3151 N ND1 . HIS B 1 143 ? 28.695 -27.812 3.105   1.00 73.62  ? 584  HIS B ND1 1 
ATOM   3152 C CD2 . HIS B 1 143 ? 27.664 -26.514 1.688   1.00 75.79  ? 584  HIS B CD2 1 
ATOM   3153 C CE1 . HIS B 1 143 ? 29.186 -28.074 1.910   1.00 76.11  ? 584  HIS B CE1 1 
ATOM   3154 N NE2 . HIS B 1 143 ? 28.575 -27.301 1.031   1.00 77.83  ? 584  HIS B NE2 1 
ATOM   3155 N N   . GLU B 1 144 ? 24.818 -28.420 2.704   1.00 79.70  ? 585  GLU B N   1 
ATOM   3156 C CA  . GLU B 1 144 ? 24.365 -29.789 2.429   1.00 86.32  ? 585  GLU B CA  1 
ATOM   3157 C C   . GLU B 1 144 ? 23.371 -30.291 3.497   1.00 82.83  ? 585  GLU B C   1 
ATOM   3158 O O   . GLU B 1 144 ? 23.281 -31.479 3.783   1.00 83.62  ? 585  GLU B O   1 
ATOM   3159 C CB  . GLU B 1 144 ? 25.571 -30.736 2.274   1.00 91.60  ? 585  GLU B CB  1 
ATOM   3160 C CG  . GLU B 1 144 ? 26.467 -30.421 1.071   1.00 96.65  ? 585  GLU B CG  1 
ATOM   3161 C CD  . GLU B 1 144 ? 25.930 -30.948 -0.265  1.00 104.84 ? 585  GLU B CD  1 
ATOM   3162 O OE1 . GLU B 1 144 ? 26.742 -31.079 -1.206  1.00 111.19 ? 585  GLU B OE1 1 
ATOM   3163 O OE2 . GLU B 1 144 ? 24.715 -31.237 -0.397  1.00 107.65 ? 585  GLU B OE2 1 
ATOM   3164 N N   . ASP B 1 145 ? 22.616 -29.358 4.065   1.00 80.40  ? 586  ASP B N   1 
ATOM   3165 C CA  . ASP B 1 145 ? 21.639 -29.628 5.119   1.00 80.24  ? 586  ASP B CA  1 
ATOM   3166 C C   . ASP B 1 145 ? 22.176 -30.275 6.397   1.00 77.70  ? 586  ASP B C   1 
ATOM   3167 O O   . ASP B 1 145 ? 21.396 -30.774 7.199   1.00 77.53  ? 586  ASP B O   1 
ATOM   3168 C CB  . ASP B 1 145 ? 20.444 -30.419 4.561   1.00 82.95  ? 586  ASP B CB  1 
ATOM   3169 C CG  . ASP B 1 145 ? 19.523 -29.556 3.713   1.00 85.85  ? 586  ASP B CG  1 
ATOM   3170 O OD1 . ASP B 1 145 ? 19.229 -28.398 4.117   1.00 83.03  ? 586  ASP B OD1 1 
ATOM   3171 O OD2 . ASP B 1 145 ? 19.089 -30.043 2.643   1.00 90.14  ? 586  ASP B OD2 1 
ATOM   3172 N N   . LEU B 1 146 ? 23.483 -30.239 6.631   1.00 77.61  ? 587  LEU B N   1 
ATOM   3173 C CA  . LEU B 1 146 ? 23.975 -30.760 7.902   1.00 76.90  ? 587  LEU B CA  1 
ATOM   3174 C C   . LEU B 1 146 ? 25.222 -30.116 8.503   1.00 72.55  ? 587  LEU B C   1 
ATOM   3175 O O   . LEU B 1 146 ? 25.611 -30.491 9.602   1.00 73.70  ? 587  LEU B O   1 
ATOM   3176 C CB  . LEU B 1 146 ? 24.107 -32.296 7.832   1.00 82.02  ? 587  LEU B CB  1 
ATOM   3177 C CG  . LEU B 1 146 ? 25.270 -33.028 7.157   1.00 84.76  ? 587  LEU B CG  1 
ATOM   3178 C CD1 . LEU B 1 146 ? 24.865 -34.479 6.933   1.00 88.24  ? 587  LEU B CD1 1 
ATOM   3179 C CD2 . LEU B 1 146 ? 25.703 -32.405 5.840   1.00 87.88  ? 587  LEU B CD2 1 
ATOM   3180 N N   . THR B 1 147 ? 25.823 -29.127 7.846   1.00 70.81  ? 588  THR B N   1 
ATOM   3181 C CA  . THR B 1 147 ? 26.941 -28.387 8.474   1.00 69.14  ? 588  THR B CA  1 
ATOM   3182 C C   . THR B 1 147 ? 26.717 -26.871 8.538   1.00 65.31  ? 588  THR B C   1 
ATOM   3183 O O   . THR B 1 147 ? 26.456 -26.238 7.520   1.00 65.24  ? 588  THR B O   1 
ATOM   3184 C CB  . THR B 1 147 ? 28.279 -28.633 7.751   1.00 69.14  ? 588  THR B CB  1 
ATOM   3185 O OG1 . THR B 1 147 ? 28.321 -29.972 7.236   1.00 74.77  ? 588  THR B OG1 1 
ATOM   3186 C CG2 . THR B 1 147 ? 29.434 -28.412 8.707   1.00 67.16  ? 588  THR B CG2 1 
ATOM   3187 N N   . VAL B 1 148 ? 26.841 -26.295 9.731   1.00 61.75  ? 589  VAL B N   1 
ATOM   3188 C CA  . VAL B 1 148 ? 26.710 -24.852 9.901   1.00 60.67  ? 589  VAL B CA  1 
ATOM   3189 C C   . VAL B 1 148 ? 27.908 -24.119 9.337   1.00 60.33  ? 589  VAL B C   1 
ATOM   3190 O O   . VAL B 1 148 ? 29.026 -24.360 9.765   1.00 60.22  ? 589  VAL B O   1 
ATOM   3191 C CB  . VAL B 1 148 ? 26.608 -24.458 11.381  1.00 60.57  ? 589  VAL B CB  1 
ATOM   3192 C CG1 . VAL B 1 148 ? 26.757 -22.953 11.544  1.00 60.24  ? 589  VAL B CG1 1 
ATOM   3193 C CG2 . VAL B 1 148 ? 25.286 -24.927 11.969  1.00 62.34  ? 589  VAL B CG2 1 
ATOM   3194 N N   . LYS B 1 149 ? 27.667 -23.203 8.401   1.00 61.42  ? 590  LYS B N   1 
ATOM   3195 C CA  . LYS B 1 149 ? 28.715 -22.316 7.898   1.00 61.70  ? 590  LYS B CA  1 
ATOM   3196 C C   . LYS B 1 149 ? 28.376 -20.865 8.230   1.00 59.56  ? 590  LYS B C   1 
ATOM   3197 O O   . LYS B 1 149 ? 27.499 -20.286 7.614   1.00 60.25  ? 590  LYS B O   1 
ATOM   3198 C CB  . LYS B 1 149 ? 28.894 -22.485 6.389   1.00 63.77  ? 590  LYS B CB  1 
ATOM   3199 C CG  . LYS B 1 149 ? 29.289 -23.887 5.940   1.00 65.97  ? 590  LYS B CG  1 
ATOM   3200 C CD  . LYS B 1 149 ? 30.704 -24.234 6.360   1.00 68.05  ? 590  LYS B CD  1 
ATOM   3201 C CE  . LYS B 1 149 ? 31.182 -25.539 5.743   1.00 70.73  ? 590  LYS B CE  1 
ATOM   3202 N NZ  . LYS B 1 149 ? 32.662 -25.660 5.854   1.00 72.86  ? 590  LYS B NZ  1 
ATOM   3203 N N   . ILE B 1 150 ? 29.077 -20.298 9.212   1.00 58.81  ? 591  ILE B N   1 
ATOM   3204 C CA  . ILE B 1 150 ? 28.937 -18.891 9.596   1.00 57.06  ? 591  ILE B CA  1 
ATOM   3205 C C   . ILE B 1 150 ? 29.651 -17.959 8.617   1.00 58.94  ? 591  ILE B C   1 
ATOM   3206 O O   . ILE B 1 150 ? 30.764 -18.261 8.175   1.00 63.23  ? 591  ILE B O   1 
ATOM   3207 C CB  . ILE B 1 150 ? 29.549 -18.654 10.982  1.00 56.31  ? 591  ILE B CB  1 
ATOM   3208 C CG1 . ILE B 1 150 ? 28.769 -19.421 12.038  1.00 56.66  ? 591  ILE B CG1 1 
ATOM   3209 C CG2 . ILE B 1 150 ? 29.520 -17.179 11.336  1.00 57.67  ? 591  ILE B CG2 1 
ATOM   3210 C CD1 . ILE B 1 150 ? 29.543 -19.626 13.320  1.00 58.41  ? 591  ILE B CD1 1 
ATOM   3211 N N   . GLY B 1 151 ? 29.028 -16.820 8.303   1.00 81.63  ? 592  GLY B N   1 
ATOM   3212 C CA  . GLY B 1 151 ? 29.635 -15.818 7.414   1.00 86.16  ? 592  GLY B CA  1 
ATOM   3213 C C   . GLY B 1 151 ? 28.822 -14.540 7.303   1.00 86.05  ? 592  GLY B C   1 
ATOM   3214 O O   . GLY B 1 151 ? 28.072 -14.199 8.211   1.00 82.22  ? 592  GLY B O   1 
ATOM   3215 N N   . ASP B 1 152 ? 28.991 -13.811 6.204   1.00 93.51  ? 593  ASP B N   1 
ATOM   3216 C CA  . ASP B 1 152 ? 28.064 -12.730 5.861   1.00 97.20  ? 593  ASP B CA  1 
ATOM   3217 C C   . ASP B 1 152 ? 27.381 -13.022 4.516   1.00 102.74 ? 593  ASP B C   1 
ATOM   3218 O O   . ASP B 1 152 ? 28.021 -12.971 3.462   1.00 106.19 ? 593  ASP B O   1 
ATOM   3219 C CB  . ASP B 1 152 ? 28.745 -11.358 5.845   1.00 101.14 ? 593  ASP B CB  1 
ATOM   3220 C CG  . ASP B 1 152 ? 27.741 -10.224 6.007   1.00 102.93 ? 593  ASP B CG  1 
ATOM   3221 O OD1 . ASP B 1 152 ? 27.593 -9.713  7.144   1.00 105.35 ? 593  ASP B OD1 1 
ATOM   3222 O OD2 . ASP B 1 152 ? 27.057 -9.878  5.022   1.00 103.73 ? 593  ASP B OD2 1 
ATOM   3223 N N   . PHE B 1 153 ? 26.084 -13.348 4.584   1.00 101.71 ? 594  PHE B N   1 
ATOM   3224 C CA  . PHE B 1 153 ? 25.258 -13.662 3.412   1.00 106.12 ? 594  PHE B CA  1 
ATOM   3225 C C   . PHE B 1 153 ? 24.195 -12.573 3.267   1.00 110.93 ? 594  PHE B C   1 
ATOM   3226 O O   . PHE B 1 153 ? 22.996 -12.827 3.434   1.00 110.87 ? 594  PHE B O   1 
ATOM   3227 C CB  . PHE B 1 153 ? 24.590 -15.047 3.546   1.00 102.03 ? 594  PHE B CB  1 
ATOM   3228 C CG  . PHE B 1 153 ? 25.547 -16.163 3.895   1.00 99.86  ? 594  PHE B CG  1 
ATOM   3229 C CD1 . PHE B 1 153 ? 25.445 -16.833 5.110   1.00 93.04  ? 594  PHE B CD1 1 
ATOM   3230 C CD2 . PHE B 1 153 ? 26.553 -16.543 3.009   1.00 104.08 ? 594  PHE B CD2 1 
ATOM   3231 C CE1 . PHE B 1 153 ? 26.326 -17.848 5.437   1.00 91.98  ? 594  PHE B CE1 1 
ATOM   3232 C CE2 . PHE B 1 153 ? 27.436 -17.561 3.331   1.00 102.88 ? 594  PHE B CE2 1 
ATOM   3233 C CZ  . PHE B 1 153 ? 27.322 -18.213 4.550   1.00 97.29  ? 594  PHE B CZ  1 
ATOM   3234 N N   . GLY B 1 154 ? 24.658 -11.360 2.960   1.00 116.84 ? 595  GLY B N   1 
ATOM   3235 C CA  . GLY B 1 154 ? 23.807 -10.176 2.846   1.00 117.10 ? 595  GLY B CA  1 
ATOM   3236 C C   . GLY B 1 154 ? 22.610 -10.360 1.932   1.00 119.15 ? 595  GLY B C   1 
ATOM   3237 O O   . GLY B 1 154 ? 21.487 -10.538 2.407   1.00 122.13 ? 595  GLY B O   1 
ATOM   3238 N N   . LEU B 1 155 ? 22.842 -10.315 0.624   1.00 121.03 ? 596  LEU B N   1 
ATOM   3239 C CA  . LEU B 1 155 ? 21.763 -10.456 -0.359  1.00 123.19 ? 596  LEU B CA  1 
ATOM   3240 C C   . LEU B 1 155 ? 22.108 -11.542 -1.383  1.00 123.87 ? 596  LEU B C   1 
ATOM   3241 O O   . LEU B 1 155 ? 23.258 -11.687 -1.797  1.00 122.25 ? 596  LEU B O   1 
ATOM   3242 C CB  . LEU B 1 155 ? 21.485 -9.107  -1.058  1.00 129.04 ? 596  LEU B CB  1 
ATOM   3243 C CG  . LEU B 1 155 ? 20.519 -8.039  -0.487  1.00 126.01 ? 596  LEU B CG  1 
ATOM   3244 C CD1 . LEU B 1 155 ? 19.344 -7.802  -1.436  1.00 129.85 ? 596  LEU B CD1 1 
ATOM   3245 C CD2 . LEU B 1 155 ? 20.032 -8.309  0.941   1.00 116.95 ? 596  LEU B CD2 1 
ATOM   3246 N N   . GLY B 1 173 ? 19.501 -2.079  8.879   1.00 102.59 ? 614  GLY B N   1 
ATOM   3247 C CA  . GLY B 1 173 ? 20.198 -3.127  9.614   1.00 96.38  ? 614  GLY B CA  1 
ATOM   3248 C C   . GLY B 1 173 ? 19.242 -4.087  10.300  1.00 91.23  ? 614  GLY B C   1 
ATOM   3249 O O   . GLY B 1 173 ? 18.028 -4.037  10.080  1.00 93.79  ? 614  GLY B O   1 
ATOM   3250 N N   . SER B 1 174 ? 19.791 -4.948  11.155  1.00 84.28  ? 615  SER B N   1 
ATOM   3251 C CA  . SER B 1 174 ? 19.041 -6.067  11.693  1.00 78.66  ? 615  SER B CA  1 
ATOM   3252 C C   . SER B 1 174 ? 18.937 -6.061  13.218  1.00 74.65  ? 615  SER B C   1 
ATOM   3253 O O   . SER B 1 174 ? 19.830 -6.484  13.949  1.00 70.37  ? 615  SER B O   1 
ATOM   3254 C CB  . SER B 1 174 ? 19.610 -7.367  11.153  1.00 78.43  ? 615  SER B CB  1 
ATOM   3255 O OG  . SER B 1 174 ? 19.107 -7.560  9.838   1.00 80.79  ? 615  SER B OG  1 
ATOM   3256 N N   . ILE B 1 175 ? 17.753 -5.657  13.648  1.00 74.33  ? 616  ILE B N   1 
ATOM   3257 C CA  . ILE B 1 175 ? 17.487 -5.094  14.954  1.00 69.76  ? 616  ILE B CA  1 
ATOM   3258 C C   . ILE B 1 175 ? 17.168 -6.170  15.979  1.00 64.43  ? 616  ILE B C   1 
ATOM   3259 O O   . ILE B 1 175 ? 17.436 -6.009  17.179  1.00 64.46  ? 616  ILE B O   1 
ATOM   3260 C CB  . ILE B 1 175 ? 16.302 -4.107  14.778  1.00 74.82  ? 616  ILE B CB  1 
ATOM   3261 C CG1 . ILE B 1 175 ? 16.840 -2.721  14.452  1.00 80.68  ? 616  ILE B CG1 1 
ATOM   3262 C CG2 . ILE B 1 175 ? 15.372 -4.046  15.976  1.00 74.53  ? 616  ILE B CG2 1 
ATOM   3263 C CD1 . ILE B 1 175 ? 17.593 -2.666  13.139  1.00 86.25  ? 616  ILE B CD1 1 
ATOM   3264 N N   . LEU B 1 176 ? 16.584 -7.269  15.517  1.00 60.25  ? 617  LEU B N   1 
ATOM   3265 C CA  . LEU B 1 176 ? 16.084 -8.279  16.435  1.00 56.08  ? 617  LEU B CA  1 
ATOM   3266 C C   . LEU B 1 176 ? 17.206 -9.012  17.155  1.00 55.08  ? 617  LEU B C   1 
ATOM   3267 O O   . LEU B 1 176 ? 16.977 -9.575  18.219  1.00 56.18  ? 617  LEU B O   1 
ATOM   3268 C CB  . LEU B 1 176 ? 15.179 -9.276  15.720  1.00 54.86  ? 617  LEU B CB  1 
ATOM   3269 C CG  . LEU B 1 176 ? 13.948 -8.703  15.021  1.00 57.79  ? 617  LEU B CG  1 
ATOM   3270 C CD1 . LEU B 1 176 ? 13.190 -9.813  14.326  1.00 60.04  ? 617  LEU B CD1 1 
ATOM   3271 C CD2 . LEU B 1 176 ? 13.019 -7.964  15.958  1.00 57.51  ? 617  LEU B CD2 1 
ATOM   3272 N N   . TRP B 1 177 ? 18.413 -8.985  16.593  1.00 56.16  ? 618  TRP B N   1 
ATOM   3273 C CA  . TRP B 1 177 ? 19.567 -9.672  17.187  1.00 54.90  ? 618  TRP B CA  1 
ATOM   3274 C C   . TRP B 1 177 ? 20.462 -8.729  17.990  1.00 56.26  ? 618  TRP B C   1 
ATOM   3275 O O   . TRP B 1 177 ? 21.453 -9.172  18.582  1.00 56.26  ? 618  TRP B O   1 
ATOM   3276 C CB  . TRP B 1 177 ? 20.392 -10.384 16.091  1.00 56.27  ? 618  TRP B CB  1 
ATOM   3277 C CG  . TRP B 1 177 ? 19.614 -11.481 15.442  1.00 54.22  ? 618  TRP B CG  1 
ATOM   3278 C CD1 . TRP B 1 177 ? 19.591 -12.785 15.808  1.00 53.20  ? 618  TRP B CD1 1 
ATOM   3279 C CD2 . TRP B 1 177 ? 18.697 -11.350 14.354  1.00 55.83  ? 618  TRP B CD2 1 
ATOM   3280 N NE1 . TRP B 1 177 ? 18.720 -13.482 15.017  1.00 55.29  ? 618  TRP B NE1 1 
ATOM   3281 C CE2 . TRP B 1 177 ? 18.157 -12.623 14.114  1.00 56.40  ? 618  TRP B CE2 1 
ATOM   3282 C CE3 . TRP B 1 177 ? 18.283 -10.276 13.552  1.00 58.57  ? 618  TRP B CE3 1 
ATOM   3283 C CZ2 . TRP B 1 177 ? 17.228 -12.861 13.100  1.00 60.03  ? 618  TRP B CZ2 1 
ATOM   3284 C CZ3 . TRP B 1 177 ? 17.353 -10.509 12.550  1.00 60.32  ? 618  TRP B CZ3 1 
ATOM   3285 C CH2 . TRP B 1 177 ? 16.835 -11.791 12.332  1.00 61.02  ? 618  TRP B CH2 1 
ATOM   3286 N N   . MET B 1 178 ? 20.121 -7.441  18.027  1.00 57.03  ? 619  MET B N   1 
ATOM   3287 C CA  . MET B 1 178 ? 20.961 -6.471  18.722  1.00 57.53  ? 619  MET B CA  1 
ATOM   3288 C C   . MET B 1 178 ? 20.706 -6.430  20.226  1.00 55.76  ? 619  MET B C   1 
ATOM   3289 O O   . MET B 1 178 ? 19.558 -6.309  20.680  1.00 55.05  ? 619  MET B O   1 
ATOM   3290 C CB  . MET B 1 178 ? 20.784 -5.079  18.138  1.00 59.37  ? 619  MET B CB  1 
ATOM   3291 C CG  . MET B 1 178 ? 21.175 -5.006  16.686  1.00 63.43  ? 619  MET B CG  1 
ATOM   3292 S SD  . MET B 1 178 ? 21.435 -3.346  16.018  1.00 70.25  ? 619  MET B SD  1 
ATOM   3293 C CE  . MET B 1 178 ? 20.555 -2.336  17.194  1.00 72.84  ? 619  MET B CE  1 
ATOM   3294 N N   . ALA B 1 179 ? 21.801 -6.521  20.981  1.00 55.43  ? 620  ALA B N   1 
ATOM   3295 C CA  . ALA B 1 179 ? 21.777 -6.363  22.427  1.00 54.78  ? 620  ALA B CA  1 
ATOM   3296 C C   . ALA B 1 179 ? 21.289 -4.977  22.784  1.00 57.12  ? 620  ALA B C   1 
ATOM   3297 O O   . ALA B 1 179 ? 21.343 -4.067  21.957  1.00 58.18  ? 620  ALA B O   1 
ATOM   3298 C CB  . ALA B 1 179 ? 23.161 -6.569  23.007  1.00 57.13  ? 620  ALA B CB  1 
ATOM   3299 N N   . PRO B 1 180 ? 20.784 -4.813  24.017  1.00 57.80  ? 621  PRO B N   1 
ATOM   3300 C CA  . PRO B 1 180 ? 20.320 -3.515  24.465  1.00 58.12  ? 621  PRO B CA  1 
ATOM   3301 C C   . PRO B 1 180 ? 21.384 -2.436  24.419  1.00 61.02  ? 621  PRO B C   1 
ATOM   3302 O O   . PRO B 1 180 ? 21.078 -1.320  24.019  1.00 64.30  ? 621  PRO B O   1 
ATOM   3303 C CB  . PRO B 1 180 ? 19.884 -3.785  25.895  1.00 58.79  ? 621  PRO B CB  1 
ATOM   3304 C CG  . PRO B 1 180 ? 19.401 -5.179  25.849  1.00 56.00  ? 621  PRO B CG  1 
ATOM   3305 C CD  . PRO B 1 180 ? 20.325 -5.887  24.913  1.00 55.71  ? 621  PRO B CD  1 
ATOM   3306 N N   . GLU B 1 181 ? 22.616 -2.746  24.816  1.00 62.42  ? 622  GLU B N   1 
ATOM   3307 C CA  . GLU B 1 181 ? 23.667 -1.722  24.803  1.00 65.66  ? 622  GLU B CA  1 
ATOM   3308 C C   . GLU B 1 181 ? 24.016 -1.293  23.377  1.00 65.85  ? 622  GLU B C   1 
ATOM   3309 O O   . GLU B 1 181 ? 24.405 -0.152  23.150  1.00 69.77  ? 622  GLU B O   1 
ATOM   3310 C CB  . GLU B 1 181 ? 24.909 -2.150  25.588  1.00 67.66  ? 622  GLU B CB  1 
ATOM   3311 C CG  . GLU B 1 181 ? 25.760 -3.238  24.953  1.00 69.13  ? 622  GLU B CG  1 
ATOM   3312 C CD  . GLU B 1 181 ? 25.280 -4.650  25.245  1.00 66.92  ? 622  GLU B CD  1 
ATOM   3313 O OE1 . GLU B 1 181 ? 24.157 -4.821  25.779  1.00 66.17  ? 622  GLU B OE1 1 
ATOM   3314 O OE2 . GLU B 1 181 ? 26.042 -5.599  24.933  1.00 67.55  ? 622  GLU B OE2 1 
ATOM   3315 N N   . VAL B 1 182 ? 23.845 -2.199  22.419  1.00 63.16  ? 623  VAL B N   1 
ATOM   3316 C CA  . VAL B 1 182 ? 24.076 -1.894  21.003  1.00 64.50  ? 623  VAL B CA  1 
ATOM   3317 C C   . VAL B 1 182 ? 22.997 -0.946  20.486  1.00 65.14  ? 623  VAL B C   1 
ATOM   3318 O O   . VAL B 1 182 ? 23.304 0.054   19.846  1.00 68.43  ? 623  VAL B O   1 
ATOM   3319 C CB  . VAL B 1 182 ? 24.108 -3.179  20.145  1.00 61.60  ? 623  VAL B CB  1 
ATOM   3320 C CG1 . VAL B 1 182 ? 24.240 -2.859  18.670  1.00 64.27  ? 623  VAL B CG1 1 
ATOM   3321 C CG2 . VAL B 1 182 ? 25.254 -4.074  20.576  1.00 61.93  ? 623  VAL B CG2 1 
ATOM   3322 N N   . ILE B 1 183 ? 21.739 -1.260  20.778  1.00 63.03  ? 624  ILE B N   1 
ATOM   3323 C CA  . ILE B 1 183 ? 20.620 -0.435  20.341  1.00 66.11  ? 624  ILE B CA  1 
ATOM   3324 C C   . ILE B 1 183 ? 20.734 0.984   20.850  1.00 71.19  ? 624  ILE B C   1 
ATOM   3325 O O   . ILE B 1 183 ? 20.615 1.931   20.087  1.00 77.38  ? 624  ILE B O   1 
ATOM   3326 C CB  . ILE B 1 183 ? 19.272 -0.945  20.851  1.00 63.78  ? 624  ILE B CB  1 
ATOM   3327 C CG1 . ILE B 1 183 ? 18.991 -2.349  20.321  1.00 60.57  ? 624  ILE B CG1 1 
ATOM   3328 C CG2 . ILE B 1 183 ? 18.199 0.058   20.467  1.00 67.90  ? 624  ILE B CG2 1 
ATOM   3329 C CD1 . ILE B 1 183 ? 17.558 -2.592  19.902  1.00 61.57  ? 624  ILE B CD1 1 
ATOM   3330 N N   . ARG B 1 184 ? 20.921 1.125   22.152  1.00 72.38  ? 625  ARG B N   1 
ATOM   3331 C CA  . ARG B 1 184 ? 21.127 2.433   22.762  1.00 78.47  ? 625  ARG B CA  1 
ATOM   3332 C C   . ARG B 1 184 ? 22.173 3.267   22.004  1.00 87.56  ? 625  ARG B C   1 
ATOM   3333 O O   . ARG B 1 184 ? 21.953 4.443   21.717  1.00 91.70  ? 625  ARG B O   1 
ATOM   3334 C CB  . ARG B 1 184 ? 21.561 2.264   24.216  1.00 76.44  ? 625  ARG B CB  1 
ATOM   3335 C CG  . ARG B 1 184 ? 20.424 2.144   25.205  1.00 72.20  ? 625  ARG B CG  1 
ATOM   3336 C CD  . ARG B 1 184 ? 20.985 1.829   26.577  1.00 71.96  ? 625  ARG B CD  1 
ATOM   3337 N NE  . ARG B 1 184 ? 20.514 0.536   27.050  1.00 68.60  ? 625  ARG B NE  1 
ATOM   3338 C CZ  . ARG B 1 184 ? 21.242 -0.359  27.709  1.00 69.00  ? 625  ARG B CZ  1 
ATOM   3339 N NH1 . ARG B 1 184 ? 22.525 -0.144  27.974  1.00 71.97  ? 625  ARG B NH1 1 
ATOM   3340 N NH2 . ARG B 1 184 ? 20.679 -1.504  28.087  1.00 67.58  ? 625  ARG B NH2 1 
ATOM   3341 N N   . MET B 1 185 ? 23.305 2.643   21.686  1.00 93.30  ? 626  MET B N   1 
ATOM   3342 C CA  . MET B 1 185 ? 24.359 3.290   20.919  1.00 102.01 ? 626  MET B CA  1 
ATOM   3343 C C   . MET B 1 185 ? 24.807 4.555   21.652  1.00 109.34 ? 626  MET B C   1 
ATOM   3344 O O   . MET B 1 185 ? 24.673 5.670   21.149  1.00 115.63 ? 626  MET B O   1 
ATOM   3345 C CB  . MET B 1 185 ? 23.872 3.591   19.495  1.00 106.17 ? 626  MET B CB  1 
ATOM   3346 C CG  . MET B 1 185 ? 24.992 3.729   18.479  1.00 115.69 ? 626  MET B CG  1 
ATOM   3347 S SD  . MET B 1 185 ? 25.874 2.184   18.142  1.00 117.60 ? 626  MET B SD  1 
ATOM   3348 C CE  . MET B 1 185 ? 27.031 2.742   16.883  1.00 124.23 ? 626  MET B CE  1 
ATOM   3349 N N   . GLN B 1 186 ? 25.308 4.353   22.866  1.00 111.00 ? 627  GLN B N   1 
ATOM   3350 C CA  . GLN B 1 186 ? 25.865 5.425   23.700  1.00 119.56 ? 627  GLN B CA  1 
ATOM   3351 C C   . GLN B 1 186 ? 27.337 5.635   23.395  1.00 124.39 ? 627  GLN B C   1 
ATOM   3352 O O   . GLN B 1 186 ? 27.871 6.734   23.568  1.00 129.75 ? 627  GLN B O   1 
ATOM   3353 C CB  . GLN B 1 186 ? 25.711 5.095   25.194  1.00 120.40 ? 627  GLN B CB  1 
ATOM   3354 C CG  . GLN B 1 186 ? 26.624 3.982   25.721  1.00 120.81 ? 627  GLN B CG  1 
ATOM   3355 C CD  . GLN B 1 186 ? 26.317 2.610   25.121  1.00 115.28 ? 627  GLN B CD  1 
ATOM   3356 O OE1 . GLN B 1 186 ? 27.154 2.018   24.427  1.00 113.71 ? 627  GLN B OE1 1 
ATOM   3357 N NE2 . GLN B 1 186 ? 25.103 2.107   25.375  1.00 107.26 ? 627  GLN B NE2 1 
ATOM   3358 N N   . ASP B 1 187 ? 27.988 4.563   22.952  1.00 122.67 ? 628  ASP B N   1 
ATOM   3359 C CA  . ASP B 1 187 ? 29.427 4.556   22.777  1.00 128.74 ? 628  ASP B CA  1 
ATOM   3360 C C   . ASP B 1 187 ? 29.808 4.552   21.295  1.00 129.43 ? 628  ASP B C   1 
ATOM   3361 O O   . ASP B 1 187 ? 29.044 4.077   20.443  1.00 123.13 ? 628  ASP B O   1 
ATOM   3362 C CB  . ASP B 1 187 ? 30.010 3.323   23.485  1.00 125.11 ? 628  ASP B CB  1 
ATOM   3363 C CG  . ASP B 1 187 ? 31.453 3.514   23.906  1.00 132.11 ? 628  ASP B CG  1 
ATOM   3364 O OD1 . ASP B 1 187 ? 31.807 4.629   24.350  1.00 138.07 ? 628  ASP B OD1 1 
ATOM   3365 O OD2 . ASP B 1 187 ? 32.231 2.541   23.805  1.00 130.68 ? 628  ASP B OD2 1 
ATOM   3366 N N   . LYS B 1 188 ? 30.986 5.103   21.000  1.00 134.94 ? 629  LYS B N   1 
ATOM   3367 C CA  . LYS B 1 188 ? 31.630 4.932   19.695  1.00 138.79 ? 629  LYS B CA  1 
ATOM   3368 C C   . LYS B 1 188 ? 31.605 3.440   19.310  1.00 129.91 ? 629  LYS B C   1 
ATOM   3369 O O   . LYS B 1 188 ? 31.263 3.098   18.177  1.00 132.23 ? 629  LYS B O   1 
ATOM   3370 C CB  . LYS B 1 188 ? 33.066 5.511   19.735  1.00 149.26 ? 629  LYS B CB  1 
ATOM   3371 C CG  . LYS B 1 188 ? 33.998 5.222   18.551  1.00 154.56 ? 629  LYS B CG  1 
ATOM   3372 C CD  . LYS B 1 188 ? 33.594 5.907   17.248  1.00 159.63 ? 629  LYS B CD  1 
ATOM   3373 C CE  . LYS B 1 188 ? 32.669 5.034   16.408  1.00 153.51 ? 629  LYS B CE  1 
ATOM   3374 N NZ  . LYS B 1 188 ? 32.643 5.437   14.977  1.00 160.31 ? 629  LYS B NZ  1 
ATOM   3375 N N   . ASN B 1 189 ? 31.914 2.560   20.268  1.00 121.11 ? 630  ASN B N   1 
ATOM   3376 C CA  . ASN B 1 189 ? 31.910 1.107   20.036  1.00 111.15 ? 630  ASN B CA  1 
ATOM   3377 C C   . ASN B 1 189 ? 31.268 0.313   21.192  1.00 102.08 ? 630  ASN B C   1 
ATOM   3378 O O   . ASN B 1 189 ? 31.892 0.108   22.231  1.00 101.41 ? 630  ASN B O   1 
ATOM   3379 C CB  . ASN B 1 189 ? 33.341 0.628   19.768  1.00 114.74 ? 630  ASN B CB  1 
ATOM   3380 C CG  . ASN B 1 189 ? 33.503 -0.875  19.929  1.00 109.00 ? 630  ASN B CG  1 
ATOM   3381 O OD1 . ASN B 1 189 ? 32.794 -1.669  19.299  1.00 101.91 ? 630  ASN B OD1 1 
ATOM   3382 N ND2 . ASN B 1 189 ? 34.448 -1.274  20.778  1.00 110.47 ? 630  ASN B ND2 1 
ATOM   3383 N N   . PRO B 1 190 ? 30.013 -0.135  21.007  1.00 94.63  ? 631  PRO B N   1 
ATOM   3384 C CA  . PRO B 1 190 ? 29.281 -0.932  21.992  1.00 87.37  ? 631  PRO B CA  1 
ATOM   3385 C C   . PRO B 1 190 ? 29.359 -2.443  21.756  1.00 81.90  ? 631  PRO B C   1 
ATOM   3386 O O   . PRO B 1 190 ? 28.677 -3.223  22.454  1.00 77.25  ? 631  PRO B O   1 
ATOM   3387 C CB  . PRO B 1 190 ? 27.848 -0.471  21.772  1.00 85.56  ? 631  PRO B CB  1 
ATOM   3388 C CG  . PRO B 1 190 ? 27.777 -0.240  20.299  1.00 87.09  ? 631  PRO B CG  1 
ATOM   3389 C CD  . PRO B 1 190 ? 29.141 0.235   19.873  1.00 93.87  ? 631  PRO B CD  1 
ATOM   3390 N N   . TYR B 1 191 ? 30.170 -2.846  20.780  1.00 81.37  ? 632  TYR B N   1 
ATOM   3391 C CA  . TYR B 1 191 ? 30.257 -4.240  20.380  1.00 76.34  ? 632  TYR B CA  1 
ATOM   3392 C C   . TYR B 1 191 ? 31.289 -4.951  21.228  1.00 77.64  ? 632  TYR B C   1 
ATOM   3393 O O   . TYR B 1 191 ? 32.312 -4.375  21.586  1.00 81.84  ? 632  TYR B O   1 
ATOM   3394 C CB  . TYR B 1 191 ? 30.619 -4.350  18.901  1.00 77.71  ? 632  TYR B CB  1 
ATOM   3395 C CG  . TYR B 1 191 ? 29.500 -3.933  17.973  1.00 75.13  ? 632  TYR B CG  1 
ATOM   3396 C CD1 . TYR B 1 191 ? 29.539 -2.714  17.295  1.00 79.16  ? 632  TYR B CD1 1 
ATOM   3397 C CD2 . TYR B 1 191 ? 28.401 -4.755  17.780  1.00 69.26  ? 632  TYR B CD2 1 
ATOM   3398 C CE1 . TYR B 1 191 ? 28.516 -2.334  16.447  1.00 78.07  ? 632  TYR B CE1 1 
ATOM   3399 C CE2 . TYR B 1 191 ? 27.375 -4.385  16.938  1.00 68.54  ? 632  TYR B CE2 1 
ATOM   3400 C CZ  . TYR B 1 191 ? 27.439 -3.178  16.275  1.00 73.83  ? 632  TYR B CZ  1 
ATOM   3401 O OH  . TYR B 1 191 ? 26.413 -2.823  15.441  1.00 76.09  ? 632  TYR B OH  1 
ATOM   3402 N N   . SER B 1 192 ? 31.009 -6.207  21.547  1.00 75.44  ? 633  SER B N   1 
ATOM   3403 C CA  . SER B 1 192 ? 31.867 -6.995  22.420  1.00 79.10  ? 633  SER B CA  1 
ATOM   3404 C C   . SER B 1 192 ? 31.666 -8.462  22.107  1.00 77.94  ? 633  SER B C   1 
ATOM   3405 O O   . SER B 1 192 ? 30.791 -8.805  21.311  1.00 75.38  ? 633  SER B O   1 
ATOM   3406 C CB  . SER B 1 192 ? 31.489 -6.736  23.872  1.00 79.79  ? 633  SER B CB  1 
ATOM   3407 O OG  . SER B 1 192 ? 30.092 -6.917  24.062  1.00 77.83  ? 633  SER B OG  1 
ATOM   3408 N N   . PHE B 1 193 ? 32.464 -9.330  22.730  1.00 67.83  ? 634  PHE B N   1 
ATOM   3409 C CA  . PHE B 1 193 ? 32.183 -10.775 22.683  1.00 66.32  ? 634  PHE B CA  1 
ATOM   3410 C C   . PHE B 1 193 ? 30.775 -11.028 23.202  1.00 63.93  ? 634  PHE B C   1 
ATOM   3411 O O   . PHE B 1 193 ? 30.097 -11.932 22.745  1.00 65.76  ? 634  PHE B O   1 
ATOM   3412 C CB  . PHE B 1 193 ? 33.139 -11.591 23.555  1.00 68.12  ? 634  PHE B CB  1 
ATOM   3413 C CG  . PHE B 1 193 ? 34.575 -11.569 23.112  1.00 71.16  ? 634  PHE B CG  1 
ATOM   3414 C CD1 . PHE B 1 193 ? 35.589 -11.399 24.046  1.00 74.22  ? 634  PHE B CD1 1 
ATOM   3415 C CD2 . PHE B 1 193 ? 34.923 -11.752 21.784  1.00 71.60  ? 634  PHE B CD2 1 
ATOM   3416 C CE1 . PHE B 1 193 ? 36.914 -11.399 23.665  1.00 75.53  ? 634  PHE B CE1 1 
ATOM   3417 C CE2 . PHE B 1 193 ? 36.250 -11.753 21.397  1.00 73.35  ? 634  PHE B CE2 1 
ATOM   3418 C CZ  . PHE B 1 193 ? 37.244 -11.577 22.339  1.00 75.75  ? 634  PHE B CZ  1 
ATOM   3419 N N   . GLN B 1 194 ? 30.346 -10.229 24.171  1.00 63.86  ? 635  GLN B N   1 
ATOM   3420 C CA  . GLN B 1 194 ? 29.042 -10.417 24.785  1.00 64.42  ? 635  GLN B CA  1 
ATOM   3421 C C   . GLN B 1 194 ? 27.858 -9.912  23.953  1.00 62.17  ? 635  GLN B C   1 
ATOM   3422 O O   . GLN B 1 194 ? 26.729 -10.318 24.206  1.00 61.16  ? 635  GLN B O   1 
ATOM   3423 C CB  . GLN B 1 194 ? 29.008 -9.777  26.177  1.00 67.28  ? 635  GLN B CB  1 
ATOM   3424 C CG  . GLN B 1 194 ? 29.771 -10.566 27.233  1.00 70.42  ? 635  GLN B CG  1 
ATOM   3425 C CD  . GLN B 1 194 ? 31.112 -9.961  27.595  1.00 73.27  ? 635  GLN B CD  1 
ATOM   3426 O OE1 . GLN B 1 194 ? 31.786 -9.351  26.766  1.00 73.75  ? 635  GLN B OE1 1 
ATOM   3427 N NE2 . GLN B 1 194 ? 31.511 -10.139 28.845  1.00 77.77  ? 635  GLN B NE2 1 
ATOM   3428 N N   . SER B 1 195 ? 28.079 -9.030  22.984  1.00 60.84  ? 636  SER B N   1 
ATOM   3429 C CA  . SER B 1 195 ? 26.976 -8.661  22.099  1.00 59.76  ? 636  SER B CA  1 
ATOM   3430 C C   . SER B 1 195 ? 26.778 -9.802  21.096  1.00 58.90  ? 636  SER B C   1 
ATOM   3431 O O   . SER B 1 195 ? 25.647 -10.144 20.747  1.00 56.69  ? 636  SER B O   1 
ATOM   3432 C CB  . SER B 1 195 ? 27.206 -7.303  21.418  1.00 60.90  ? 636  SER B CB  1 
ATOM   3433 O OG  . SER B 1 195 ? 28.410 -7.274  20.679  1.00 64.34  ? 636  SER B OG  1 
ATOM   3434 N N   . ASP B 1 196 ? 27.877 -10.417 20.660  1.00 58.72  ? 637  ASP B N   1 
ATOM   3435 C CA  . ASP B 1 196 ? 27.793 -11.632 19.849  1.00 57.42  ? 637  ASP B CA  1 
ATOM   3436 C C   . ASP B 1 196 ? 27.051 -12.753 20.614  1.00 55.98  ? 637  ASP B C   1 
ATOM   3437 O O   . ASP B 1 196 ? 26.225 -13.465 20.051  1.00 56.91  ? 637  ASP B O   1 
ATOM   3438 C CB  . ASP B 1 196 ? 29.190 -12.094 19.405  1.00 58.63  ? 637  ASP B CB  1 
ATOM   3439 C CG  . ASP B 1 196 ? 29.704 -11.361 18.157  1.00 60.37  ? 637  ASP B CG  1 
ATOM   3440 O OD1 . ASP B 1 196 ? 29.003 -10.469 17.637  1.00 64.72  ? 637  ASP B OD1 1 
ATOM   3441 O OD2 . ASP B 1 196 ? 30.822 -11.680 17.685  1.00 59.21  ? 637  ASP B OD2 1 
ATOM   3442 N N   . VAL B 1 197 ? 27.315 -12.899 21.900  1.00 55.11  ? 638  VAL B N   1 
ATOM   3443 C CA  . VAL B 1 197 ? 26.568 -13.877 22.697  1.00 57.30  ? 638  VAL B CA  1 
ATOM   3444 C C   . VAL B 1 197 ? 25.034 -13.638 22.674  1.00 57.75  ? 638  VAL B C   1 
ATOM   3445 O O   . VAL B 1 197 ? 24.265 -14.568 22.426  1.00 58.79  ? 638  VAL B O   1 
ATOM   3446 C CB  . VAL B 1 197 ? 27.073 -13.911 24.149  1.00 56.79  ? 638  VAL B CB  1 
ATOM   3447 C CG1 . VAL B 1 197 ? 26.149 -14.750 25.005  1.00 56.10  ? 638  VAL B CG1 1 
ATOM   3448 C CG2 . VAL B 1 197 ? 28.491 -14.460 24.196  1.00 58.09  ? 638  VAL B CG2 1 
ATOM   3449 N N   . TYR B 1 198 ? 24.599 -12.405 22.935  1.00 55.60  ? 639  TYR B N   1 
ATOM   3450 C CA  . TYR B 1 198 ? 23.186 -12.038 22.838  1.00 52.36  ? 639  TYR B CA  1 
ATOM   3451 C C   . TYR B 1 198 ? 22.576 -12.394 21.487  1.00 52.09  ? 639  TYR B C   1 
ATOM   3452 O O   . TYR B 1 198 ? 21.512 -13.019 21.434  1.00 52.27  ? 639  TYR B O   1 
ATOM   3453 C CB  . TYR B 1 198 ? 23.009 -10.550 23.070  1.00 51.11  ? 639  TYR B CB  1 
ATOM   3454 C CG  . TYR B 1 198 ? 21.577 -10.113 23.130  1.00 49.91  ? 639  TYR B CG  1 
ATOM   3455 C CD1 . TYR B 1 198 ? 20.909 -10.036 24.338  1.00 49.95  ? 639  TYR B CD1 1 
ATOM   3456 C CD2 . TYR B 1 198 ? 20.889 -9.769  21.980  1.00 51.75  ? 639  TYR B CD2 1 
ATOM   3457 C CE1 . TYR B 1 198 ? 19.585 -9.634  24.402  1.00 50.89  ? 639  TYR B CE1 1 
ATOM   3458 C CE2 . TYR B 1 198 ? 19.559 -9.353  22.028  1.00 52.36  ? 639  TYR B CE2 1 
ATOM   3459 C CZ  . TYR B 1 198 ? 18.908 -9.284  23.241  1.00 51.70  ? 639  TYR B CZ  1 
ATOM   3460 O OH  . TYR B 1 198 ? 17.591 -8.863  23.285  1.00 50.82  ? 639  TYR B OH  1 
ATOM   3461 N N   . ALA B 1 199 ? 23.234 -12.007 20.398  1.00 51.76  ? 640  ALA B N   1 
ATOM   3462 C CA  . ALA B 1 199 ? 22.754 -12.400 19.066  1.00 53.42  ? 640  ALA B CA  1 
ATOM   3463 C C   . ALA B 1 199 ? 22.602 -13.917 18.991  1.00 55.85  ? 640  ALA B C   1 
ATOM   3464 O O   . ALA B 1 199 ? 21.557 -14.416 18.562  1.00 57.62  ? 640  ALA B O   1 
ATOM   3465 C CB  . ALA B 1 199 ? 23.683 -11.918 17.972  1.00 54.59  ? 640  ALA B CB  1 
ATOM   3466 N N   . PHE B 1 200 ? 23.626 -14.649 19.429  1.00 55.13  ? 641  PHE B N   1 
ATOM   3467 C CA  . PHE B 1 200 ? 23.507 -16.097 19.547  1.00 56.78  ? 641  PHE B CA  1 
ATOM   3468 C C   . PHE B 1 200 ? 22.262 -16.511 20.336  1.00 57.62  ? 641  PHE B C   1 
ATOM   3469 O O   . PHE B 1 200 ? 21.587 -17.487 19.992  1.00 56.75  ? 641  PHE B O   1 
ATOM   3470 C CB  . PHE B 1 200 ? 24.730 -16.694 20.225  1.00 58.67  ? 641  PHE B CB  1 
ATOM   3471 C CG  . PHE B 1 200 ? 24.646 -18.177 20.388  1.00 58.90  ? 641  PHE B CG  1 
ATOM   3472 C CD1 . PHE B 1 200 ? 24.841 -19.009 19.297  1.00 59.99  ? 641  PHE B CD1 1 
ATOM   3473 C CD2 . PHE B 1 200 ? 24.345 -18.735 21.611  1.00 58.48  ? 641  PHE B CD2 1 
ATOM   3474 C CE1 . PHE B 1 200 ? 24.763 -20.376 19.430  1.00 61.94  ? 641  PHE B CE1 1 
ATOM   3475 C CE2 . PHE B 1 200 ? 24.258 -20.100 21.755  1.00 61.94  ? 641  PHE B CE2 1 
ATOM   3476 C CZ  . PHE B 1 200 ? 24.468 -20.925 20.664  1.00 63.99  ? 641  PHE B CZ  1 
ATOM   3477 N N   . GLY B 1 201 ? 21.985 -15.768 21.406  1.00 57.12  ? 642  GLY B N   1 
ATOM   3478 C CA  . GLY B 1 201 ? 20.829 -16.012 22.246  1.00 55.93  ? 642  GLY B CA  1 
ATOM   3479 C C   . GLY B 1 201 ? 19.531 -15.848 21.492  1.00 53.92  ? 642  GLY B C   1 
ATOM   3480 O O   . GLY B 1 201 ? 18.607 -16.627 21.690  1.00 55.74  ? 642  GLY B O   1 
ATOM   3481 N N   . ILE B 1 202 ? 19.446 -14.837 20.635  1.00 50.88  ? 643  ILE B N   1 
ATOM   3482 C CA  . ILE B 1 202 ? 18.248 -14.669 19.816  1.00 52.05  ? 643  ILE B CA  1 
ATOM   3483 C C   . ILE B 1 202 ? 18.122 -15.793 18.808  1.00 53.58  ? 643  ILE B C   1 
ATOM   3484 O O   . ILE B 1 202 ? 17.021 -16.211 18.493  1.00 54.75  ? 643  ILE B O   1 
ATOM   3485 C CB  . ILE B 1 202 ? 18.233 -13.334 19.055  1.00 52.24  ? 643  ILE B CB  1 
ATOM   3486 C CG1 . ILE B 1 202 ? 18.153 -12.166 20.042  1.00 53.80  ? 643  ILE B CG1 1 
ATOM   3487 C CG2 . ILE B 1 202 ? 17.076 -13.282 18.057  1.00 50.94  ? 643  ILE B CG2 1 
ATOM   3488 C CD1 . ILE B 1 202 ? 16.906 -12.153 20.907  1.00 55.50  ? 643  ILE B CD1 1 
ATOM   3489 N N   . VAL B 1 203 ? 19.248 -16.280 18.303  1.00 55.98  ? 644  VAL B N   1 
ATOM   3490 C CA  . VAL B 1 203 ? 19.235 -17.383 17.346  1.00 56.72  ? 644  VAL B CA  1 
ATOM   3491 C C   . VAL B 1 203 ? 18.752 -18.654 18.038  1.00 58.53  ? 644  VAL B C   1 
ATOM   3492 O O   . VAL B 1 203 ? 18.000 -19.428 17.463  1.00 60.35  ? 644  VAL B O   1 
ATOM   3493 C CB  . VAL B 1 203 ? 20.622 -17.581 16.708  1.00 56.63  ? 644  VAL B CB  1 
ATOM   3494 C CG1 . VAL B 1 203 ? 20.655 -18.820 15.821  1.00 57.66  ? 644  VAL B CG1 1 
ATOM   3495 C CG2 . VAL B 1 203 ? 20.985 -16.350 15.899  1.00 56.07  ? 644  VAL B CG2 1 
ATOM   3496 N N   . LEU B 1 204 ? 19.172 -18.858 19.280  1.00 60.72  ? 645  LEU B N   1 
ATOM   3497 C CA  . LEU B 1 204 ? 18.629 -19.948 20.090  1.00 61.92  ? 645  LEU B CA  1 
ATOM   3498 C C   . LEU B 1 204 ? 17.122 -19.836 20.238  1.00 60.85  ? 645  LEU B C   1 
ATOM   3499 O O   . LEU B 1 204 ? 16.433 -20.846 20.322  1.00 63.32  ? 645  LEU B O   1 
ATOM   3500 C CB  . LEU B 1 204 ? 19.249 -19.966 21.487  1.00 62.73  ? 645  LEU B CB  1 
ATOM   3501 C CG  . LEU B 1 204 ? 20.588 -20.673 21.640  1.00 66.24  ? 645  LEU B CG  1 
ATOM   3502 C CD1 . LEU B 1 204 ? 21.073 -20.497 23.065  1.00 68.71  ? 645  LEU B CD1 1 
ATOM   3503 C CD2 . LEU B 1 204 ? 20.484 -22.151 21.283  1.00 69.45  ? 645  LEU B CD2 1 
ATOM   3504 N N   . TYR B 1 205 ? 16.615 -18.613 20.301  1.00 57.34  ? 646  TYR B N   1 
ATOM   3505 C CA  . TYR B 1 205 ? 15.186 -18.407 20.364  1.00 58.75  ? 646  TYR B CA  1 
ATOM   3506 C C   . TYR B 1 205 ? 14.524 -18.859 19.073  1.00 59.00  ? 646  TYR B C   1 
ATOM   3507 O O   . TYR B 1 205 ? 13.511 -19.536 19.104  1.00 63.00  ? 646  TYR B O   1 
ATOM   3508 C CB  . TYR B 1 205 ? 14.876 -16.946 20.620  1.00 58.90  ? 646  TYR B CB  1 
ATOM   3509 C CG  . TYR B 1 205 ? 13.415 -16.649 20.786  1.00 61.30  ? 646  TYR B CG  1 
ATOM   3510 C CD1 . TYR B 1 205 ? 12.816 -16.697 22.034  1.00 62.90  ? 646  TYR B CD1 1 
ATOM   3511 C CD2 . TYR B 1 205 ? 12.633 -16.303 19.695  1.00 63.12  ? 646  TYR B CD2 1 
ATOM   3512 C CE1 . TYR B 1 205 ? 11.474 -16.412 22.190  1.00 64.36  ? 646  TYR B CE1 1 
ATOM   3513 C CE2 . TYR B 1 205 ? 11.291 -16.012 19.842  1.00 64.96  ? 646  TYR B CE2 1 
ATOM   3514 C CZ  . TYR B 1 205 ? 10.717 -16.070 21.092  1.00 65.27  ? 646  TYR B CZ  1 
ATOM   3515 O OH  . TYR B 1 205 ? 9.382  -15.780 21.237  1.00 67.96  ? 646  TYR B OH  1 
ATOM   3516 N N   . GLU B 1 206 ? 15.103 -18.502 17.937  1.00 58.67  ? 647  GLU B N   1 
ATOM   3517 C CA  . GLU B 1 206 ? 14.531 -18.903 16.656  1.00 58.96  ? 647  GLU B CA  1 
ATOM   3518 C C   . GLU B 1 206 ? 14.486 -20.423 16.547  1.00 58.67  ? 647  GLU B C   1 
ATOM   3519 O O   . GLU B 1 206 ? 13.485 -20.981 16.137  1.00 60.12  ? 647  GLU B O   1 
ATOM   3520 C CB  . GLU B 1 206 ? 15.326 -18.342 15.473  1.00 59.82  ? 647  GLU B CB  1 
ATOM   3521 C CG  . GLU B 1 206 ? 15.574 -16.839 15.501  1.00 60.24  ? 647  GLU B CG  1 
ATOM   3522 C CD  . GLU B 1 206 ? 16.312 -16.353 14.257  1.00 63.05  ? 647  GLU B CD  1 
ATOM   3523 O OE1 . GLU B 1 206 ? 15.759 -16.527 13.136  1.00 64.42  ? 647  GLU B OE1 1 
ATOM   3524 O OE2 . GLU B 1 206 ? 17.440 -15.809 14.395  1.00 58.67  ? 647  GLU B OE2 1 
ATOM   3525 N N   . LEU B 1 207 ? 15.573 -21.089 16.916  1.00 57.89  ? 648  LEU B N   1 
ATOM   3526 C CA  . LEU B 1 207 ? 15.662 -22.537 16.762  1.00 59.35  ? 648  LEU B CA  1 
ATOM   3527 C C   . LEU B 1 207 ? 14.591 -23.221 17.574  1.00 60.54  ? 648  LEU B C   1 
ATOM   3528 O O   . LEU B 1 207 ? 13.934 -24.145 17.119  1.00 60.63  ? 648  LEU B O   1 
ATOM   3529 C CB  . LEU B 1 207 ? 17.030 -23.047 17.215  1.00 59.37  ? 648  LEU B CB  1 
ATOM   3530 C CG  . LEU B 1 207 ? 18.207 -22.710 16.300  1.00 59.22  ? 648  LEU B CG  1 
ATOM   3531 C CD1 . LEU B 1 207 ? 19.521 -23.005 17.001  1.00 60.79  ? 648  LEU B CD1 1 
ATOM   3532 C CD2 . LEU B 1 207 ? 18.127 -23.485 14.995  1.00 60.76  ? 648  LEU B CD2 1 
ATOM   3533 N N   . MET B 1 208 ? 14.404 -22.711 18.776  1.00 62.26  ? 649  MET B N   1 
ATOM   3534 C CA  . MET B 1 208 ? 13.641 -23.383 19.799  1.00 65.86  ? 649  MET B CA  1 
ATOM   3535 C C   . MET B 1 208 ? 12.160 -23.016 19.714  1.00 64.77  ? 649  MET B C   1 
ATOM   3536 O O   . MET B 1 208 ? 11.333 -23.650 20.355  1.00 67.71  ? 649  MET B O   1 
ATOM   3537 C CB  . MET B 1 208 ? 14.233 -22.985 21.156  1.00 70.27  ? 649  MET B CB  1 
ATOM   3538 C CG  . MET B 1 208 ? 14.685 -24.121 22.060  1.00 76.90  ? 649  MET B CG  1 
ATOM   3539 S SD  . MET B 1 208 ? 15.642 -25.498 21.358  1.00 88.37  ? 649  MET B SD  1 
ATOM   3540 C CE  . MET B 1 208 ? 16.812 -24.692 20.268  1.00 86.06  ? 649  MET B CE  1 
ATOM   3541 N N   . THR B 1 209 ? 11.820 -21.999 18.924  1.00 62.08  ? 650  THR B N   1 
ATOM   3542 C CA  . THR B 1 209 ? 10.421 -21.589 18.738  1.00 62.57  ? 650  THR B CA  1 
ATOM   3543 C C   . THR B 1 209 ? 9.942  -21.626 17.285  1.00 63.29  ? 650  THR B C   1 
ATOM   3544 O O   . THR B 1 209 ? 8.742  -21.650 17.012  1.00 64.09  ? 650  THR B O   1 
ATOM   3545 C CB  . THR B 1 209 ? 10.206 -20.153 19.225  1.00 61.25  ? 650  THR B CB  1 
ATOM   3546 O OG1 . THR B 1 209 ? 10.921 -19.250 18.370  1.00 62.57  ? 650  THR B OG1 1 
ATOM   3547 C CG2 . THR B 1 209 ? 10.681 -19.983 20.662  1.00 61.30  ? 650  THR B CG2 1 
ATOM   3548 N N   . GLY B 1 210 ? 10.880 -21.600 16.351  1.00 64.93  ? 651  GLY B N   1 
ATOM   3549 C CA  . GLY B 1 210 ? 10.552 -21.498 14.937  1.00 66.58  ? 651  GLY B CA  1 
ATOM   3550 C C   . GLY B 1 210 ? 10.115 -20.099 14.554  1.00 66.64  ? 651  GLY B C   1 
ATOM   3551 O O   . GLY B 1 210 ? 9.691  -19.876 13.420  1.00 71.57  ? 651  GLY B O   1 
ATOM   3552 N N   . GLN B 1 211 ? 10.243 -19.146 15.476  1.00 63.58  ? 652  GLN B N   1 
ATOM   3553 C CA  . GLN B 1 211 ? 9.663  -17.830 15.286  1.00 62.85  ? 652  GLN B CA  1 
ATOM   3554 C C   . GLN B 1 211 ? 10.674 -16.729 15.507  1.00 59.98  ? 652  GLN B C   1 
ATOM   3555 O O   . GLN B 1 211 ? 11.673 -16.921 16.191  1.00 57.69  ? 652  GLN B O   1 
ATOM   3556 C CB  . GLN B 1 211 ? 8.492  -17.649 16.240  1.00 64.74  ? 652  GLN B CB  1 
ATOM   3557 C CG  . GLN B 1 211 ? 7.323  -18.557 15.920  1.00 68.33  ? 652  GLN B CG  1 
ATOM   3558 C CD  . GLN B 1 211 ? 6.134  -18.306 16.816  1.00 69.49  ? 652  GLN B CD  1 
ATOM   3559 O OE1 . GLN B 1 211 ? 5.650  -17.185 16.922  1.00 68.94  ? 652  GLN B OE1 1 
ATOM   3560 N NE2 . GLN B 1 211 ? 5.649  -19.350 17.456  1.00 74.73  ? 652  GLN B NE2 1 
ATOM   3561 N N   . LEU B 1 212 ? 10.412 -15.584 14.890  1.00 60.33  ? 653  LEU B N   1 
ATOM   3562 C CA  . LEU B 1 212 ? 11.151 -14.371 15.178  1.00 61.43  ? 653  LEU B CA  1 
ATOM   3563 C C   . LEU B 1 212 ? 10.572 -13.784 16.449  1.00 61.38  ? 653  LEU B C   1 
ATOM   3564 O O   . LEU B 1 212 ? 9.366  -13.863 16.662  1.00 62.64  ? 653  LEU B O   1 
ATOM   3565 C CB  . LEU B 1 212 ? 10.999 -13.343 14.054  1.00 63.45  ? 653  LEU B CB  1 
ATOM   3566 C CG  . LEU B 1 212 ? 11.564 -13.688 12.674  1.00 66.88  ? 653  LEU B CG  1 
ATOM   3567 C CD1 . LEU B 1 212 ? 11.057 -12.741 11.598  1.00 68.02  ? 653  LEU B CD1 1 
ATOM   3568 C CD2 . LEU B 1 212 ? 13.082 -13.661 12.727  1.00 69.33  ? 653  LEU B CD2 1 
ATOM   3569 N N   . PRO B 1 213 ? 11.418 -13.163 17.286  1.00 61.03  ? 654  PRO B N   1 
ATOM   3570 C CA  . PRO B 1 213 ? 10.918 -12.503 18.489  1.00 61.52  ? 654  PRO B CA  1 
ATOM   3571 C C   . PRO B 1 213 ? 10.038 -11.275 18.193  1.00 60.71  ? 654  PRO B C   1 
ATOM   3572 O O   . PRO B 1 213 ? 10.079 -10.721 17.082  1.00 59.47  ? 654  PRO B O   1 
ATOM   3573 C CB  . PRO B 1 213 ? 12.197 -12.081 19.206  1.00 60.36  ? 654  PRO B CB  1 
ATOM   3574 C CG  . PRO B 1 213 ? 13.183 -11.885 18.117  1.00 59.89  ? 654  PRO B CG  1 
ATOM   3575 C CD  . PRO B 1 213 ? 12.854 -12.911 17.077  1.00 60.50  ? 654  PRO B CD  1 
ATOM   3576 N N   . TYR B 1 214 ? 9.231  -10.896 19.185  1.00 57.64  ? 655  TYR B N   1 
ATOM   3577 C CA  . TYR B 1 214 ? 8.392  -9.697  19.130  1.00 56.87  ? 655  TYR B CA  1 
ATOM   3578 C C   . TYR B 1 214 ? 7.341  -9.676  18.004  1.00 58.16  ? 655  TYR B C   1 
ATOM   3579 O O   . TYR B 1 214 ? 6.943  -8.610  17.545  1.00 60.18  ? 655  TYR B O   1 
ATOM   3580 C CB  . TYR B 1 214 ? 9.270  -8.443  19.038  1.00 54.56  ? 655  TYR B CB  1 
ATOM   3581 C CG  . TYR B 1 214 ? 10.522 -8.509  19.870  1.00 54.02  ? 655  TYR B CG  1 
ATOM   3582 C CD1 . TYR B 1 214 ? 10.496 -8.992  21.174  1.00 55.29  ? 655  TYR B CD1 1 
ATOM   3583 C CD2 . TYR B 1 214 ? 11.738 -8.077  19.361  1.00 54.17  ? 655  TYR B CD2 1 
ATOM   3584 C CE1 . TYR B 1 214 ? 11.653 -9.062  21.940  1.00 54.58  ? 655  TYR B CE1 1 
ATOM   3585 C CE2 . TYR B 1 214 ? 12.900 -8.134  20.116  1.00 54.38  ? 655  TYR B CE2 1 
ATOM   3586 C CZ  . TYR B 1 214 ? 12.854 -8.626  21.408  1.00 55.28  ? 655  TYR B CZ  1 
ATOM   3587 O OH  . TYR B 1 214 ? 14.013 -8.693  22.156  1.00 56.41  ? 655  TYR B OH  1 
ATOM   3588 N N   . SER B 1 215 ? 6.860  -10.834 17.578  1.00 59.12  ? 656  SER B N   1 
ATOM   3589 C CA  . SER B 1 215 ? 5.920  -10.861 16.457  1.00 63.38  ? 656  SER B CA  1 
ATOM   3590 C C   . SER B 1 215 ? 4.579  -10.139 16.740  1.00 62.10  ? 656  SER B C   1 
ATOM   3591 O O   . SER B 1 215 ? 3.866  -9.805  15.803  1.00 61.43  ? 656  SER B O   1 
ATOM   3592 C CB  . SER B 1 215 ? 5.682  -12.303 15.985  1.00 67.38  ? 656  SER B CB  1 
ATOM   3593 O OG  . SER B 1 215 ? 5.072  -13.090 17.003  1.00 71.28  ? 656  SER B OG  1 
ATOM   3594 N N   . ASN B 1 216 ? 4.249  -9.892  18.011  1.00 62.18  ? 657  ASN B N   1 
ATOM   3595 C CA  . ASN B 1 216 ? 3.011  -9.145  18.388  1.00 63.97  ? 657  ASN B CA  1 
ATOM   3596 C C   . ASN B 1 216 ? 3.075  -7.601  18.269  1.00 63.97  ? 657  ASN B C   1 
ATOM   3597 O O   . ASN B 1 216 ? 2.115  -6.909  18.618  1.00 62.91  ? 657  ASN B O   1 
ATOM   3598 C CB  . ASN B 1 216 ? 2.525  -9.537  19.804  1.00 63.38  ? 657  ASN B CB  1 
ATOM   3599 C CG  . ASN B 1 216 ? 3.583  -9.349  20.891  1.00 63.88  ? 657  ASN B CG  1 
ATOM   3600 O OD1 . ASN B 1 216 ? 4.779  -9.257  20.619  1.00 65.84  ? 657  ASN B OD1 1 
ATOM   3601 N ND2 . ASN B 1 216 ? 3.139  -9.313  22.140  1.00 66.01  ? 657  ASN B ND2 1 
ATOM   3602 N N   . ILE B 1 217 ? 4.193  -7.075  17.764  1.00 63.31  ? 658  ILE B N   1 
ATOM   3603 C CA  . ILE B 1 217 ? 4.433  -5.640  17.705  1.00 64.10  ? 658  ILE B CA  1 
ATOM   3604 C C   . ILE B 1 217 ? 4.769  -5.229  16.276  1.00 64.32  ? 658  ILE B C   1 
ATOM   3605 O O   . ILE B 1 217 ? 5.768  -5.667  15.739  1.00 65.47  ? 658  ILE B O   1 
ATOM   3606 C CB  . ILE B 1 217 ? 5.591  -5.242  18.653  1.00 63.76  ? 658  ILE B CB  1 
ATOM   3607 C CG1 . ILE B 1 217 ? 5.231  -5.624  20.096  1.00 64.05  ? 658  ILE B CG1 1 
ATOM   3608 C CG2 . ILE B 1 217 ? 5.892  -3.742  18.560  1.00 62.85  ? 658  ILE B CG2 1 
ATOM   3609 C CD1 . ILE B 1 217 ? 6.342  -5.410  21.103  1.00 63.25  ? 658  ILE B CD1 1 
ATOM   3610 N N   . ASN B 1 218 ? 3.949  -4.370  15.675  1.00 66.53  ? 659  ASN B N   1 
ATOM   3611 C CA  . ASN B 1 218 ? 4.127  -3.980  14.274  1.00 67.44  ? 659  ASN B CA  1 
ATOM   3612 C C   . ASN B 1 218 ? 4.943  -2.696  14.041  1.00 68.21  ? 659  ASN B C   1 
ATOM   3613 O O   . ASN B 1 218 ? 4.980  -2.203  12.922  1.00 73.75  ? 659  ASN B O   1 
ATOM   3614 C CB  . ASN B 1 218 ? 2.753  -3.837  13.608  1.00 70.18  ? 659  ASN B CB  1 
ATOM   3615 C CG  . ASN B 1 218 ? 1.990  -2.635  14.109  1.00 72.94  ? 659  ASN B CG  1 
ATOM   3616 O OD1 . ASN B 1 218 ? 2.585  -1.632  14.491  1.00 75.71  ? 659  ASN B OD1 1 
ATOM   3617 N ND2 . ASN B 1 218 ? 0.671  -2.727  14.118  1.00 75.79  ? 659  ASN B ND2 1 
ATOM   3618 N N   . ASN B 1 219 ? 5.590  -2.157  15.074  1.00 65.28  ? 660  ASN B N   1 
ATOM   3619 C CA  . ASN B 1 219 ? 6.275  -0.870  14.975  1.00 63.98  ? 660  ASN B CA  1 
ATOM   3620 C C   . ASN B 1 219 ? 7.755  -0.966  15.282  1.00 61.61  ? 660  ASN B C   1 
ATOM   3621 O O   . ASN B 1 219 ? 8.144  -1.214  16.401  1.00 60.86  ? 660  ASN B O   1 
ATOM   3622 C CB  . ASN B 1 219 ? 5.638  0.127   15.933  1.00 65.82  ? 660  ASN B CB  1 
ATOM   3623 C CG  . ASN B 1 219 ? 6.172  1.540   15.746  1.00 68.60  ? 660  ASN B CG  1 
ATOM   3624 O OD1 . ASN B 1 219 ? 7.307  1.848   16.109  1.00 70.20  ? 660  ASN B OD1 1 
ATOM   3625 N ND2 . ASN B 1 219 ? 5.350  2.407   15.180  1.00 71.89  ? 660  ASN B ND2 1 
ATOM   3626 N N   . ARG B 1 220 ? 8.589  -0.704  14.294  1.00 66.56  ? 661  ARG B N   1 
ATOM   3627 C CA  . ARG B 1 220 ? 10.038 -0.899  14.438  1.00 67.01  ? 661  ARG B CA  1 
ATOM   3628 C C   . ARG B 1 220 ? 10.699 0.023   15.489  1.00 67.11  ? 661  ARG B C   1 
ATOM   3629 O O   . ARG B 1 220 ? 11.605 -0.396  16.213  1.00 66.03  ? 661  ARG B O   1 
ATOM   3630 C CB  . ARG B 1 220 ? 10.707 -0.701  13.072  1.00 68.99  ? 661  ARG B CB  1 
ATOM   3631 C CG  . ARG B 1 220 ? 11.932 -1.558  12.837  1.00 69.07  ? 661  ARG B CG  1 
ATOM   3632 C CD  . ARG B 1 220 ? 12.583 -1.210  11.512  1.00 73.05  ? 661  ARG B CD  1 
ATOM   3633 N NE  . ARG B 1 220 ? 13.590 -0.161  11.687  1.00 75.64  ? 661  ARG B NE  1 
ATOM   3634 C CZ  . ARG B 1 220 ? 14.907 -0.334  11.582  1.00 74.42  ? 661  ARG B CZ  1 
ATOM   3635 N NH1 . ARG B 1 220 ? 15.427 -1.520  11.265  1.00 73.30  ? 661  ARG B NH1 1 
ATOM   3636 N NH2 . ARG B 1 220 ? 15.717 0.698   11.781  1.00 74.37  ? 661  ARG B NH2 1 
ATOM   3637 N N   . ASP B 1 221 ? 10.250 1.274   15.563  1.00 69.04  ? 662  ASP B N   1 
ATOM   3638 C CA  . ASP B 1 221 ? 10.849 2.251   16.477  1.00 69.28  ? 662  ASP B CA  1 
ATOM   3639 C C   . ASP B 1 221 ? 10.531 1.928   17.924  1.00 66.72  ? 662  ASP B C   1 
ATOM   3640 O O   . ASP B 1 221 ? 11.306 2.249   18.820  1.00 64.96  ? 662  ASP B O   1 
ATOM   3641 C CB  . ASP B 1 221 ? 10.367 3.670   16.162  1.00 73.54  ? 662  ASP B CB  1 
ATOM   3642 C CG  . ASP B 1 221 ? 10.973 4.228   14.878  1.00 77.96  ? 662  ASP B CG  1 
ATOM   3643 O OD1 . ASP B 1 221 ? 12.032 3.722   14.420  1.00 77.14  ? 662  ASP B OD1 1 
ATOM   3644 O OD2 . ASP B 1 221 ? 10.384 5.191   14.334  1.00 80.27  ? 662  ASP B OD2 1 
ATOM   3645 N N   . GLN B 1 222 ? 9.388  1.294   18.145  1.00 65.31  ? 663  GLN B N   1 
ATOM   3646 C CA  . GLN B 1 222 ? 8.991  0.896   19.481  1.00 64.41  ? 663  GLN B CA  1 
ATOM   3647 C C   . GLN B 1 222 ? 9.777  -0.313  19.968  1.00 61.56  ? 663  GLN B C   1 
ATOM   3648 O O   . GLN B 1 222 ? 10.148 -0.390  21.141  1.00 61.28  ? 663  GLN B O   1 
ATOM   3649 C CB  . GLN B 1 222 ? 7.502  0.608   19.514  1.00 66.44  ? 663  GLN B CB  1 
ATOM   3650 C CG  . GLN B 1 222 ? 6.658  1.872   19.564  1.00 70.65  ? 663  GLN B CG  1 
ATOM   3651 C CD  . GLN B 1 222 ? 6.593  2.523   20.946  1.00 72.22  ? 663  GLN B CD  1 
ATOM   3652 O OE1 . GLN B 1 222 ? 6.797  3.729   21.072  1.00 72.10  ? 663  GLN B OE1 1 
ATOM   3653 N NE2 . GLN B 1 222 ? 6.282  1.737   21.982  1.00 73.33  ? 663  GLN B NE2 1 
ATOM   3654 N N   . ILE B 1 223 ? 10.044 -1.256  19.078  1.00 59.11  ? 664  ILE B N   1 
ATOM   3655 C CA  . ILE B 1 223 ? 10.887 -2.371  19.455  1.00 58.37  ? 664  ILE B CA  1 
ATOM   3656 C C   . ILE B 1 223 ? 12.260 -1.828  19.804  1.00 56.73  ? 664  ILE B C   1 
ATOM   3657 O O   . ILE B 1 223 ? 12.859 -2.203  20.826  1.00 53.11  ? 664  ILE B O   1 
ATOM   3658 C CB  . ILE B 1 223 ? 11.021 -3.403  18.335  1.00 59.41  ? 664  ILE B CB  1 
ATOM   3659 C CG1 . ILE B 1 223 ? 9.666  -4.058  18.084  1.00 60.61  ? 664  ILE B CG1 1 
ATOM   3660 C CG2 . ILE B 1 223 ? 12.062 -4.464  18.713  1.00 58.23  ? 664  ILE B CG2 1 
ATOM   3661 C CD1 . ILE B 1 223 ? 9.598  -4.806  16.773  1.00 62.74  ? 664  ILE B CD1 1 
ATOM   3662 N N   . ILE B 1 224 ? 12.757 -0.943  18.949  1.00 55.61  ? 665  ILE B N   1 
ATOM   3663 C CA  . ILE B 1 224 ? 14.046 -0.327  19.211  1.00 56.57  ? 665  ILE B CA  1 
ATOM   3664 C C   . ILE B 1 224 ? 14.051 0.279   20.619  1.00 56.83  ? 665  ILE B C   1 
ATOM   3665 O O   . ILE B 1 224 ? 14.916 -0.035  21.438  1.00 55.22  ? 665  ILE B O   1 
ATOM   3666 C CB  . ILE B 1 224 ? 14.399 0.718   18.139  1.00 56.45  ? 665  ILE B CB  1 
ATOM   3667 C CG1 . ILE B 1 224 ? 14.741 -0.006  16.831  1.00 56.93  ? 665  ILE B CG1 1 
ATOM   3668 C CG2 . ILE B 1 224 ? 15.572 1.570   18.590  1.00 55.83  ? 665  ILE B CG2 1 
ATOM   3669 C CD1 . ILE B 1 224 ? 14.995 0.886   15.637  1.00 58.12  ? 665  ILE B CD1 1 
ATOM   3670 N N   . PHE B 1 225 ? 13.052 1.104   20.911  1.00 58.47  ? 666  PHE B N   1 
ATOM   3671 C CA  . PHE B 1 225 ? 13.023 1.846   22.170  1.00 58.62  ? 666  PHE B CA  1 
ATOM   3672 C C   . PHE B 1 225 ? 13.004 0.923   23.371  1.00 58.27  ? 666  PHE B C   1 
ATOM   3673 O O   . PHE B 1 225 ? 13.831 1.042   24.268  1.00 60.11  ? 666  PHE B O   1 
ATOM   3674 C CB  . PHE B 1 225 ? 11.816 2.772   22.221  1.00 57.37  ? 666  PHE B CB  1 
ATOM   3675 C CG  . PHE B 1 225 ? 11.717 3.558   23.485  1.00 57.64  ? 666  PHE B CG  1 
ATOM   3676 C CD1 . PHE B 1 225 ? 12.672 4.504   23.796  1.00 60.98  ? 666  PHE B CD1 1 
ATOM   3677 C CD2 . PHE B 1 225 ? 10.659 3.363   24.361  1.00 58.49  ? 666  PHE B CD2 1 
ATOM   3678 C CE1 . PHE B 1 225 ? 12.582 5.245   24.963  1.00 62.73  ? 666  PHE B CE1 1 
ATOM   3679 C CE2 . PHE B 1 225 ? 10.556 4.095   25.528  1.00 58.75  ? 666  PHE B CE2 1 
ATOM   3680 C CZ  . PHE B 1 225 ? 11.518 5.039   25.830  1.00 62.16  ? 666  PHE B CZ  1 
ATOM   3681 N N   . MET B 1 226 ? 12.074 -0.018  23.359  1.00 59.25  ? 667  MET B N   1 
ATOM   3682 C CA  . MET B 1 226 ? 11.807 -0.842  24.529  1.00 60.55  ? 667  MET B CA  1 
ATOM   3683 C C   . MET B 1 226 ? 12.871 -1.908  24.808  1.00 57.00  ? 667  MET B C   1 
ATOM   3684 O O   . MET B 1 226 ? 13.153 -2.213  25.956  1.00 58.01  ? 667  MET B O   1 
ATOM   3685 C CB  . MET B 1 226 ? 10.460 -1.518  24.372  1.00 63.20  ? 667  MET B CB  1 
ATOM   3686 C CG  . MET B 1 226 ? 9.303  -0.565  24.174  1.00 66.44  ? 667  MET B CG  1 
ATOM   3687 S SD  . MET B 1 226 ? 7.864  -1.571  23.809  1.00 71.75  ? 667  MET B SD  1 
ATOM   3688 C CE  . MET B 1 226 ? 7.342  -1.886  25.490  1.00 72.32  ? 667  MET B CE  1 
ATOM   3689 N N   . VAL B 1 227 ? 13.448 -2.494  23.775  1.00 55.84  ? 668  VAL B N   1 
ATOM   3690 C CA  . VAL B 1 227 ? 14.548 -3.412  23.996  1.00 54.97  ? 668  VAL B CA  1 
ATOM   3691 C C   . VAL B 1 227 ? 15.713 -2.620  24.586  1.00 55.62  ? 668  VAL B C   1 
ATOM   3692 O O   . VAL B 1 227 ? 16.358 -3.071  25.528  1.00 56.50  ? 668  VAL B O   1 
ATOM   3693 C CB  . VAL B 1 227 ? 14.980 -4.129  22.705  1.00 54.43  ? 668  VAL B CB  1 
ATOM   3694 C CG1 . VAL B 1 227 ? 16.204 -4.992  22.964  1.00 55.40  ? 668  VAL B CG1 1 
ATOM   3695 C CG2 . VAL B 1 227 ? 13.860 -5.002  22.173  1.00 53.18  ? 668  VAL B CG2 1 
ATOM   3696 N N   . GLY B 1 228 ? 15.968 -1.434  24.040  1.00 57.01  ? 669  GLY B N   1 
ATOM   3697 C CA  . GLY B 1 228 ? 17.019 -0.555  24.560  1.00 58.50  ? 669  GLY B CA  1 
ATOM   3698 C C   . GLY B 1 228 ? 16.845 -0.244  26.039  1.00 57.53  ? 669  GLY B C   1 
ATOM   3699 O O   . GLY B 1 228 ? 17.806 -0.205  26.801  1.00 57.37  ? 669  GLY B O   1 
ATOM   3700 N N   . ARG B 1 229 ? 15.597 -0.053  26.435  1.00 57.47  ? 670  ARG B N   1 
ATOM   3701 C CA  . ARG B 1 229 ? 15.243 0.345   27.786  1.00 58.79  ? 670  ARG B CA  1 
ATOM   3702 C C   . ARG B 1 229 ? 15.064 -0.843  28.738  1.00 55.93  ? 670  ARG B C   1 
ATOM   3703 O O   . ARG B 1 229 ? 14.928 -0.656  29.934  1.00 58.29  ? 670  ARG B O   1 
ATOM   3704 C CB  . ARG B 1 229 ? 13.947 1.176   27.735  1.00 62.90  ? 670  ARG B CB  1 
ATOM   3705 C CG  . ARG B 1 229 ? 14.139 2.624   27.281  1.00 67.12  ? 670  ARG B CG  1 
ATOM   3706 C CD  . ARG B 1 229 ? 14.654 3.466   28.439  1.00 73.16  ? 670  ARG B CD  1 
ATOM   3707 N NE  . ARG B 1 229 ? 14.658 4.914   28.200  1.00 80.79  ? 670  ARG B NE  1 
ATOM   3708 C CZ  . ARG B 1 229 ? 13.685 5.762   28.547  1.00 82.59  ? 670  ARG B CZ  1 
ATOM   3709 N NH1 . ARG B 1 229 ? 12.561 5.343   29.139  1.00 81.73  ? 670  ARG B NH1 1 
ATOM   3710 N NH2 . ARG B 1 229 ? 13.834 7.052   28.279  1.00 86.06  ? 670  ARG B NH2 1 
ATOM   3711 N N   . GLY B 1 230 ? 15.060 -2.060  28.219  1.00 54.04  ? 671  GLY B N   1 
ATOM   3712 C CA  . GLY B 1 230 ? 14.766 -3.227  29.035  1.00 54.32  ? 671  GLY B CA  1 
ATOM   3713 C C   . GLY B 1 230 ? 13.275 -3.496  29.218  1.00 55.98  ? 671  GLY B C   1 
ATOM   3714 O O   . GLY B 1 230 ? 12.897 -4.410  29.944  1.00 61.87  ? 671  GLY B O   1 
ATOM   3715 N N   . TYR B 1 231 ? 12.406 -2.736  28.564  1.00 53.78  ? 672  TYR B N   1 
ATOM   3716 C CA  . TYR B 1 231 ? 10.979 -2.966  28.734  1.00 55.29  ? 672  TYR B CA  1 
ATOM   3717 C C   . TYR B 1 231 ? 10.471 -4.169  27.942  1.00 54.09  ? 672  TYR B C   1 
ATOM   3718 O O   . TYR B 1 231 ? 9.400  -4.680  28.236  1.00 55.29  ? 672  TYR B O   1 
ATOM   3719 C CB  . TYR B 1 231 ? 10.172 -1.719  28.364  1.00 57.20  ? 672  TYR B CB  1 
ATOM   3720 C CG  . TYR B 1 231 ? 10.561 -0.461  29.114  1.00 58.82  ? 672  TYR B CG  1 
ATOM   3721 C CD1 . TYR B 1 231 ? 10.354 0.794   28.552  1.00 58.68  ? 672  TYR B CD1 1 
ATOM   3722 C CD2 . TYR B 1 231 ? 11.132 -0.524  30.390  1.00 60.80  ? 672  TYR B CD2 1 
ATOM   3723 C CE1 . TYR B 1 231 ? 10.699 1.951   29.236  1.00 60.37  ? 672  TYR B CE1 1 
ATOM   3724 C CE2 . TYR B 1 231 ? 11.488 0.625   31.077  1.00 61.61  ? 672  TYR B CE2 1 
ATOM   3725 C CZ  . TYR B 1 231 ? 11.271 1.859   30.496  1.00 62.54  ? 672  TYR B CZ  1 
ATOM   3726 O OH  . TYR B 1 231 ? 11.627 2.996   31.187  1.00 66.03  ? 672  TYR B OH  1 
ATOM   3727 N N   . LEU B 1 232 ? 11.239 -4.614  26.952  1.00 53.18  ? 673  LEU B N   1 
ATOM   3728 C CA  . LEU B 1 232 ? 10.836 -5.686  26.034  1.00 54.13  ? 673  LEU B CA  1 
ATOM   3729 C C   . LEU B 1 232 ? 11.915 -6.743  26.004  1.00 55.45  ? 673  LEU B C   1 
ATOM   3730 O O   . LEU B 1 232 ? 13.100 -6.417  25.939  1.00 59.40  ? 673  LEU B O   1 
ATOM   3731 C CB  . LEU B 1 232 ? 10.681 -5.137  24.606  1.00 52.81  ? 673  LEU B CB  1 
ATOM   3732 C CG  . LEU B 1 232 ? 9.647  -5.715  23.620  1.00 54.12  ? 673  LEU B CG  1 
ATOM   3733 C CD1 . LEU B 1 232 ? 10.106 -5.595  22.170  1.00 52.85  ? 673  LEU B CD1 1 
ATOM   3734 C CD2 . LEU B 1 232 ? 9.276  -7.152  23.918  1.00 55.40  ? 673  LEU B CD2 1 
ATOM   3735 N N   . SER B 1 233 ? 11.526 -8.008  26.039  1.00 57.85  ? 674  SER B N   1 
ATOM   3736 C CA  . SER B 1 233 ? 12.483 -9.090  25.830  1.00 60.49  ? 674  SER B CA  1 
ATOM   3737 C C   . SER B 1 233 ? 11.747 -10.341 25.358  1.00 63.24  ? 674  SER B C   1 
ATOM   3738 O O   . SER B 1 233 ? 10.532 -10.428 25.516  1.00 66.99  ? 674  SER B O   1 
ATOM   3739 C CB  . SER B 1 233 ? 13.241 -9.383  27.117  1.00 63.63  ? 674  SER B CB  1 
ATOM   3740 O OG  . SER B 1 233 ? 12.382 -10.014 28.040  1.00 67.99  ? 674  SER B OG  1 
ATOM   3741 N N   . PRO B 1 234 ? 12.474 -11.307 24.771  1.00 61.51  ? 675  PRO B N   1 
ATOM   3742 C CA  . PRO B 1 234 ? 11.827 -12.444 24.120  1.00 60.88  ? 675  PRO B CA  1 
ATOM   3743 C C   . PRO B 1 234 ? 10.991 -13.260 25.070  1.00 62.86  ? 675  PRO B C   1 
ATOM   3744 O O   . PRO B 1 234 ? 11.375 -13.443 26.222  1.00 64.83  ? 675  PRO B O   1 
ATOM   3745 C CB  . PRO B 1 234 ? 12.999 -13.277 23.622  1.00 61.80  ? 675  PRO B CB  1 
ATOM   3746 C CG  . PRO B 1 234 ? 14.104 -12.292 23.454  1.00 62.41  ? 675  PRO B CG  1 
ATOM   3747 C CD  . PRO B 1 234 ? 13.932 -11.329 24.578  1.00 62.41  ? 675  PRO B CD  1 
ATOM   3748 N N   . ASP B 1 235 ? 9.851  -13.737 24.584  1.00 63.16  ? 676  ASP B N   1 
ATOM   3749 C CA  . ASP B 1 235 ? 8.951  -14.517 25.405  1.00 64.91  ? 676  ASP B CA  1 
ATOM   3750 C C   . ASP B 1 235 ? 9.381  -15.976 25.381  1.00 67.45  ? 676  ASP B C   1 
ATOM   3751 O O   . ASP B 1 235 ? 9.180  -16.673 24.385  1.00 68.38  ? 676  ASP B O   1 
ATOM   3752 C CB  . ASP B 1 235 ? 7.524  -14.390 24.892  1.00 65.43  ? 676  ASP B CB  1 
ATOM   3753 C CG  . ASP B 1 235 ? 6.525  -15.137 25.756  1.00 68.72  ? 676  ASP B CG  1 
ATOM   3754 O OD1 . ASP B 1 235 ? 6.928  -15.800 26.741  1.00 70.92  ? 676  ASP B OD1 1 
ATOM   3755 O OD2 . ASP B 1 235 ? 5.325  -15.059 25.441  1.00 70.29  ? 676  ASP B OD2 1 
ATOM   3756 N N   . LEU B 1 236 ? 9.938  -16.454 26.488  1.00 68.24  ? 677  LEU B N   1 
ATOM   3757 C CA  . LEU B 1 236 ? 10.485 -17.810 26.512  1.00 67.26  ? 677  LEU B CA  1 
ATOM   3758 C C   . LEU B 1 236 ? 9.440  -18.896 26.639  1.00 66.25  ? 677  LEU B C   1 
ATOM   3759 O O   . LEU B 1 236 ? 9.777  -20.060 26.505  1.00 68.25  ? 677  LEU B O   1 
ATOM   3760 C CB  . LEU B 1 236 ? 11.531 -17.963 27.615  1.00 67.80  ? 677  LEU B CB  1 
ATOM   3761 C CG  . LEU B 1 236 ? 12.668 -16.942 27.522  1.00 66.63  ? 677  LEU B CG  1 
ATOM   3762 C CD1 . LEU B 1 236 ? 13.682 -17.210 28.620  1.00 68.48  ? 677  LEU B CD1 1 
ATOM   3763 C CD2 . LEU B 1 236 ? 13.332 -16.939 26.151  1.00 64.10  ? 677  LEU B CD2 1 
ATOM   3764 N N   . SER B 1 237 ? 8.178  -18.540 26.868  1.00 65.48  ? 678  SER B N   1 
ATOM   3765 C CA  . SER B 1 237 ? 7.127  -19.563 26.980  1.00 67.05  ? 678  SER B CA  1 
ATOM   3766 C C   . SER B 1 237 ? 6.754  -20.171 25.633  1.00 67.24  ? 678  SER B C   1 
ATOM   3767 O O   . SER B 1 237 ? 6.075  -21.180 25.579  1.00 71.27  ? 678  SER B O   1 
ATOM   3768 C CB  . SER B 1 237 ? 5.883  -18.996 27.654  1.00 67.59  ? 678  SER B CB  1 
ATOM   3769 O OG  . SER B 1 237 ? 5.382  -17.897 26.930  1.00 66.48  ? 678  SER B OG  1 
ATOM   3770 N N   . LYS B 1 238 ? 7.219  -19.572 24.546  1.00 66.56  ? 679  LYS B N   1 
ATOM   3771 C CA  . LYS B 1 238 ? 6.918  -20.065 23.211  1.00 67.48  ? 679  LYS B CA  1 
ATOM   3772 C C   . LYS B 1 238 ? 7.861  -21.172 22.755  1.00 68.57  ? 679  LYS B C   1 
ATOM   3773 O O   . LYS B 1 238 ? 7.756  -21.644 21.624  1.00 70.80  ? 679  LYS B O   1 
ATOM   3774 C CB  . LYS B 1 238 ? 6.986  -18.913 22.212  1.00 65.79  ? 679  LYS B CB  1 
ATOM   3775 C CG  . LYS B 1 238 ? 6.020  -17.791 22.526  1.00 66.91  ? 679  LYS B CG  1 
ATOM   3776 C CD  . LYS B 1 238 ? 6.162  -16.647 21.553  1.00 65.90  ? 679  LYS B CD  1 
ATOM   3777 C CE  . LYS B 1 238 ? 5.546  -16.986 20.215  1.00 70.11  ? 679  LYS B CE  1 
ATOM   3778 N NZ  . LYS B 1 238 ? 5.879  -15.928 19.222  1.00 72.35  ? 679  LYS B NZ  1 
ATOM   3779 N N   . VAL B 1 239 ? 8.796  -21.579 23.604  1.00 68.56  ? 680  VAL B N   1 
ATOM   3780 C CA  . VAL B 1 239 ? 9.693  -22.661 23.228  1.00 69.86  ? 680  VAL B CA  1 
ATOM   3781 C C   . VAL B 1 239 ? 8.896  -23.954 23.177  1.00 75.05  ? 680  VAL B C   1 
ATOM   3782 O O   . VAL B 1 239 ? 7.914  -24.124 23.910  1.00 76.88  ? 680  VAL B O   1 
ATOM   3783 C CB  . VAL B 1 239 ? 10.886 -22.805 24.186  1.00 69.71  ? 680  VAL B CB  1 
ATOM   3784 C CG1 . VAL B 1 239 ? 11.665 -21.495 24.268  1.00 66.77  ? 680  VAL B CG1 1 
ATOM   3785 C CG2 . VAL B 1 239 ? 10.429 -23.262 25.561  1.00 72.52  ? 680  VAL B CG2 1 
ATOM   3786 N N   . ARG B 1 240 ? 9.326  -24.861 22.308  1.00 77.81  ? 681  ARG B N   1 
ATOM   3787 C CA  . ARG B 1 240 ? 8.593  -26.101 22.073  1.00 82.76  ? 681  ARG B CA  1 
ATOM   3788 C C   . ARG B 1 240 ? 8.660  -26.960 23.331  1.00 85.22  ? 681  ARG B C   1 
ATOM   3789 O O   . ARG B 1 240 ? 9.607  -26.861 24.116  1.00 84.78  ? 681  ARG B O   1 
ATOM   3790 C CB  . ARG B 1 240 ? 9.135  -26.848 20.839  1.00 85.61  ? 681  ARG B CB  1 
ATOM   3791 C CG  . ARG B 1 240 ? 9.345  -25.945 19.612  1.00 84.40  ? 681  ARG B CG  1 
ATOM   3792 C CD  . ARG B 1 240 ? 8.703  -26.470 18.332  1.00 87.71  ? 681  ARG B CD  1 
ATOM   3793 N NE  . ARG B 1 240 ? 9.684  -26.948 17.356  1.00 88.30  ? 681  ARG B NE  1 
ATOM   3794 C CZ  . ARG B 1 240 ? 10.206 -28.174 17.325  1.00 89.40  ? 681  ARG B CZ  1 
ATOM   3795 N NH1 . ARG B 1 240 ? 9.869  -29.090 18.230  1.00 94.16  ? 681  ARG B NH1 1 
ATOM   3796 N NH2 . ARG B 1 240 ? 11.081 -28.486 16.378  1.00 86.32  ? 681  ARG B NH2 1 
ATOM   3797 N N   . SER B 1 241 ? 7.642  -27.791 23.522  1.00 88.01  ? 682  SER B N   1 
ATOM   3798 C CA  . SER B 1 241 ? 7.455  -28.517 24.782  1.00 91.27  ? 682  SER B CA  1 
ATOM   3799 C C   . SER B 1 241 ? 8.588  -29.500 25.128  1.00 92.90  ? 682  SER B C   1 
ATOM   3800 O O   . SER B 1 241 ? 8.793  -29.843 26.296  1.00 94.90  ? 682  SER B O   1 
ATOM   3801 C CB  . SER B 1 241 ? 6.107  -29.248 24.769  1.00 94.69  ? 682  SER B CB  1 
ATOM   3802 O OG  . SER B 1 241 ? 6.041  -30.194 23.718  1.00 95.89  ? 682  SER B OG  1 
ATOM   3803 N N   . ASN B 1 242 ? 9.323  -29.945 24.120  1.00 91.95  ? 683  ASN B N   1 
ATOM   3804 C CA  . ASN B 1 242 ? 10.408 -30.890 24.336  1.00 94.43  ? 683  ASN B CA  1 
ATOM   3805 C C   . ASN B 1 242 ? 11.791 -30.229 24.322  1.00 90.01  ? 683  ASN B C   1 
ATOM   3806 O O   . ASN B 1 242 ? 12.809 -30.921 24.242  1.00 88.18  ? 683  ASN B O   1 
ATOM   3807 C CB  . ASN B 1 242 ? 10.326 -32.026 23.312  1.00 97.02  ? 683  ASN B CB  1 
ATOM   3808 C CG  . ASN B 1 242 ? 10.393 -31.532 21.879  1.00 96.09  ? 683  ASN B CG  1 
ATOM   3809 O OD1 . ASN B 1 242 ? 9.859  -30.466 21.541  1.00 92.96  ? 683  ASN B OD1 1 
ATOM   3810 N ND2 . ASN B 1 242 ? 11.047 -32.309 21.020  1.00 98.40  ? 683  ASN B ND2 1 
ATOM   3811 N N   . CYS B 1 243 ? 11.825 -28.899 24.405  1.00 86.88  ? 684  CYS B N   1 
ATOM   3812 C CA  . CYS B 1 243 ? 13.090 -28.181 24.549  1.00 86.37  ? 684  CYS B CA  1 
ATOM   3813 C C   . CYS B 1 243 ? 13.558 -28.317 25.981  1.00 87.97  ? 684  CYS B C   1 
ATOM   3814 O O   . CYS B 1 243 ? 12.954 -27.724 26.876  1.00 89.96  ? 684  CYS B O   1 
ATOM   3815 C CB  . CYS B 1 243 ? 12.953 -26.699 24.228  1.00 84.87  ? 684  CYS B CB  1 
ATOM   3816 S SG  . CYS B 1 243 ? 14.420 -25.742 24.714  1.00 87.88  ? 684  CYS B SG  1 
ATOM   3817 N N   . PRO B 1 244 ? 14.648 -29.072 26.206  1.00 88.79  ? 685  PRO B N   1 
ATOM   3818 C CA  . PRO B 1 244 ? 15.047 -29.396 27.575  1.00 91.78  ? 685  PRO B CA  1 
ATOM   3819 C C   . PRO B 1 244 ? 15.308 -28.164 28.438  1.00 88.60  ? 685  PRO B C   1 
ATOM   3820 O O   . PRO B 1 244 ? 15.783 -27.145 27.940  1.00 82.40  ? 685  PRO B O   1 
ATOM   3821 C CB  . PRO B 1 244 ? 16.344 -30.195 27.392  1.00 93.55  ? 685  PRO B CB  1 
ATOM   3822 C CG  . PRO B 1 244 ? 16.367 -30.602 25.963  1.00 92.00  ? 685  PRO B CG  1 
ATOM   3823 C CD  . PRO B 1 244 ? 15.659 -29.511 25.233  1.00 87.96  ? 685  PRO B CD  1 
ATOM   3824 N N   . LYS B 1 245 ? 15.020 -28.286 29.730  1.00 107.64 ? 686  LYS B N   1 
ATOM   3825 C CA  . LYS B 1 245 ? 15.113 -27.165 30.663  1.00 104.01 ? 686  LYS B CA  1 
ATOM   3826 C C   . LYS B 1 245 ? 16.497 -26.520 30.675  1.00 96.72  ? 686  LYS B C   1 
ATOM   3827 O O   . LYS B 1 245 ? 16.611 -25.301 30.761  1.00 92.78  ? 686  LYS B O   1 
ATOM   3828 C CB  . LYS B 1 245 ? 14.701 -27.615 32.069  1.00 112.45 ? 686  LYS B CB  1 
ATOM   3829 C CG  . LYS B 1 245 ? 13.211 -27.448 32.391  1.00 117.57 ? 686  LYS B CG  1 
ATOM   3830 C CD  . LYS B 1 245 ? 12.261 -27.806 31.247  1.00 118.87 ? 686  LYS B CD  1 
ATOM   3831 C CE  . LYS B 1 245 ? 12.194 -29.303 30.982  1.00 124.24 ? 686  LYS B CE  1 
ATOM   3832 N NZ  . LYS B 1 245 ? 11.320 -29.988 31.966  1.00 131.79 ? 686  LYS B NZ  1 
ATOM   3833 N N   . ALA B 1 246 ? 17.544 -27.326 30.555  1.00 95.85  ? 687  ALA B N   1 
ATOM   3834 C CA  . ALA B 1 246 ? 18.900 -26.796 30.430  1.00 91.07  ? 687  ALA B CA  1 
ATOM   3835 C C   . ALA B 1 246 ? 19.022 -25.730 29.331  1.00 85.89  ? 687  ALA B C   1 
ATOM   3836 O O   . ALA B 1 246 ? 19.695 -24.727 29.522  1.00 83.23  ? 687  ALA B O   1 
ATOM   3837 C CB  . ALA B 1 246 ? 19.877 -27.925 30.169  1.00 92.95  ? 687  ALA B CB  1 
ATOM   3838 N N   . MET B 1 247 ? 18.355 -25.952 28.199  1.00 86.62  ? 688  MET B N   1 
ATOM   3839 C CA  . MET B 1 247 ? 18.458 -25.084 27.015  1.00 82.39  ? 688  MET B CA  1 
ATOM   3840 C C   . MET B 1 247 ? 17.733 -23.756 27.206  1.00 79.27  ? 688  MET B C   1 
ATOM   3841 O O   . MET B 1 247 ? 18.255 -22.711 26.821  1.00 72.85  ? 688  MET B O   1 
ATOM   3842 C CB  . MET B 1 247 ? 17.883 -25.808 25.792  1.00 85.69  ? 688  MET B CB  1 
ATOM   3843 C CG  . MET B 1 247 ? 18.011 -25.078 24.465  1.00 84.66  ? 688  MET B CG  1 
ATOM   3844 S SD  . MET B 1 247 ? 19.704 -24.795 23.886  1.00 87.59  ? 688  MET B SD  1 
ATOM   3845 C CE  . MET B 1 247 ? 20.368 -26.457 23.893  1.00 91.47  ? 688  MET B CE  1 
ATOM   3846 N N   . LYS B 1 248 ? 16.525 -23.807 27.772  1.00 82.22  ? 689  LYS B N   1 
ATOM   3847 C CA  . LYS B 1 248 ? 15.791 -22.596 28.161  1.00 81.12  ? 689  LYS B CA  1 
ATOM   3848 C C   . LYS B 1 248 ? 16.608 -21.741 29.097  1.00 80.37  ? 689  LYS B C   1 
ATOM   3849 O O   . LYS B 1 248 ? 16.695 -20.532 28.926  1.00 75.99  ? 689  LYS B O   1 
ATOM   3850 C CB  . LYS B 1 248 ? 14.501 -22.941 28.884  1.00 86.52  ? 689  LYS B CB  1 
ATOM   3851 C CG  . LYS B 1 248 ? 13.337 -23.228 27.971  1.00 90.30  ? 689  LYS B CG  1 
ATOM   3852 C CD  . LYS B 1 248 ? 12.034 -23.270 28.756  1.00 97.33  ? 689  LYS B CD  1 
ATOM   3853 C CE  . LYS B 1 248 ? 11.462 -21.879 29.013  1.00 95.43  ? 689  LYS B CE  1 
ATOM   3854 N NZ  . LYS B 1 248 ? 10.026 -21.965 29.415  1.00 100.77 ? 689  LYS B NZ  1 
ATOM   3855 N N   . ARG B 1 249 ? 17.173 -22.389 30.110  1.00 84.94  ? 690  ARG B N   1 
ATOM   3856 C CA  . ARG B 1 249 ? 18.054 -21.745 31.073  1.00 84.96  ? 690  ARG B CA  1 
ATOM   3857 C C   . ARG B 1 249 ? 19.253 -21.133 30.361  1.00 77.84  ? 690  ARG B C   1 
ATOM   3858 O O   . ARG B 1 249 ? 19.644 -20.028 30.667  1.00 76.74  ? 690  ARG B O   1 
ATOM   3859 C CB  . ARG B 1 249 ? 18.515 -22.778 32.094  1.00 93.38  ? 690  ARG B CB  1 
ATOM   3860 C CG  . ARG B 1 249 ? 19.239 -22.243 33.313  1.00 99.89  ? 690  ARG B CG  1 
ATOM   3861 C CD  . ARG B 1 249 ? 19.614 -23.427 34.200  1.00 109.48 ? 690  ARG B CD  1 
ATOM   3862 N NE  . ARG B 1 249 ? 20.268 -23.024 35.450  1.00 118.31 ? 690  ARG B NE  1 
ATOM   3863 C CZ  . ARG B 1 249 ? 19.878 -23.377 36.683  1.00 128.40 ? 690  ARG B CZ  1 
ATOM   3864 N NH1 . ARG B 1 249 ? 18.830 -24.177 36.885  1.00 132.73 ? 690  ARG B NH1 1 
ATOM   3865 N NH2 . ARG B 1 249 ? 20.562 -22.939 37.740  1.00 132.20 ? 690  ARG B NH2 1 
ATOM   3866 N N   . LEU B 1 250 ? 19.828 -21.848 29.403  1.00 75.33  ? 691  LEU B N   1 
ATOM   3867 C CA  . LEU B 1 250 ? 20.987 -21.341 28.674  1.00 73.13  ? 691  LEU B CA  1 
ATOM   3868 C C   . LEU B 1 250 ? 20.620 -20.102 27.854  1.00 70.86  ? 691  LEU B C   1 
ATOM   3869 O O   . LEU B 1 250 ? 21.336 -19.105 27.857  1.00 70.33  ? 691  LEU B O   1 
ATOM   3870 C CB  . LEU B 1 250 ? 21.567 -22.415 27.749  1.00 72.33  ? 691  LEU B CB  1 
ATOM   3871 C CG  . LEU B 1 250 ? 22.668 -21.898 26.820  1.00 70.27  ? 691  LEU B CG  1 
ATOM   3872 C CD1 . LEU B 1 250 ? 23.878 -21.458 27.632  1.00 71.74  ? 691  LEU B CD1 1 
ATOM   3873 C CD2 . LEU B 1 250 ? 23.060 -22.935 25.786  1.00 70.55  ? 691  LEU B CD2 1 
ATOM   3874 N N   . MET B 1 251 ? 19.516 -20.201 27.127  1.00 70.69  ? 692  MET B N   1 
ATOM   3875 C CA  . MET B 1 251 ? 18.940 -19.085 26.388  1.00 67.25  ? 692  MET B CA  1 
ATOM   3876 C C   . MET B 1 251 ? 18.798 -17.846 27.276  1.00 66.65  ? 692  MET B C   1 
ATOM   3877 O O   . MET B 1 251 ? 19.142 -16.732 26.881  1.00 63.73  ? 692  MET B O   1 
ATOM   3878 C CB  . MET B 1 251 ? 17.544 -19.480 25.907  1.00 70.47  ? 692  MET B CB  1 
ATOM   3879 C CG  . MET B 1 251 ? 17.337 -19.391 24.421  1.00 71.15  ? 692  MET B CG  1 
ATOM   3880 S SD  . MET B 1 251 ? 15.612 -19.660 23.985  1.00 77.96  ? 692  MET B SD  1 
ATOM   3881 C CE  . MET B 1 251 ? 15.391 -21.381 24.437  1.00 81.66  ? 692  MET B CE  1 
ATOM   3882 N N   . ALA B 1 252 ? 18.270 -18.056 28.478  1.00 68.58  ? 693  ALA B N   1 
ATOM   3883 C CA  . ALA B 1 252 ? 17.989 -16.964 29.390  1.00 69.33  ? 693  ALA B CA  1 
ATOM   3884 C C   . ALA B 1 252 ? 19.256 -16.185 29.744  1.00 69.24  ? 693  ALA B C   1 
ATOM   3885 O O   . ALA B 1 252 ? 19.227 -14.957 29.795  1.00 67.43  ? 693  ALA B O   1 
ATOM   3886 C CB  . ALA B 1 252 ? 17.308 -17.486 30.642  1.00 72.04  ? 693  ALA B CB  1 
ATOM   3887 N N   . GLU B 1 253 ? 20.359 -16.902 29.954  1.00 72.30  ? 694  GLU B N   1 
ATOM   3888 C CA  . GLU B 1 253 ? 21.652 -16.290 30.300  1.00 74.91  ? 694  GLU B CA  1 
ATOM   3889 C C   . GLU B 1 253 ? 22.247 -15.505 29.135  1.00 70.02  ? 694  GLU B C   1 
ATOM   3890 O O   . GLU B 1 253 ? 22.786 -14.416 29.317  1.00 68.46  ? 694  GLU B O   1 
ATOM   3891 C CB  . GLU B 1 253 ? 22.665 -17.351 30.746  1.00 79.69  ? 694  GLU B CB  1 
ATOM   3892 C CG  . GLU B 1 253 ? 22.230 -18.226 31.919  1.00 87.32  ? 694  GLU B CG  1 
ATOM   3893 C CD  . GLU B 1 253 ? 21.903 -17.453 33.194  1.00 93.67  ? 694  GLU B CD  1 
ATOM   3894 O OE1 . GLU B 1 253 ? 21.112 -17.977 34.016  1.00 100.92 ? 694  GLU B OE1 1 
ATOM   3895 O OE2 . GLU B 1 253 ? 22.435 -16.335 33.389  1.00 94.96  ? 694  GLU B OE2 1 
ATOM   3896 N N   . CYS B 1 254 ? 22.157 -16.069 27.939  1.00 67.53  ? 695  CYS B N   1 
ATOM   3897 C CA  . CYS B 1 254 ? 22.598 -15.374 26.739  1.00 66.24  ? 695  CYS B CA  1 
ATOM   3898 C C   . CYS B 1 254 ? 21.811 -14.081 26.495  1.00 65.94  ? 695  CYS B C   1 
ATOM   3899 O O   . CYS B 1 254 ? 22.329 -13.153 25.885  1.00 65.79  ? 695  CYS B O   1 
ATOM   3900 C CB  . CYS B 1 254 ? 22.464 -16.287 25.512  1.00 66.48  ? 695  CYS B CB  1 
ATOM   3901 S SG  . CYS B 1 254 ? 23.518 -17.760 25.557  1.00 72.90  ? 695  CYS B SG  1 
ATOM   3902 N N   . LEU B 1 255 ? 20.561 -14.027 26.954  1.00 66.09  ? 696  LEU B N   1 
ATOM   3903 C CA  . LEU B 1 255 ? 19.695 -12.892 26.667  1.00 63.57  ? 696  LEU B CA  1 
ATOM   3904 C C   . LEU B 1 255 ? 19.671 -11.838 27.774  1.00 66.50  ? 696  LEU B C   1 
ATOM   3905 O O   . LEU B 1 255 ? 18.982 -10.819 27.635  1.00 68.62  ? 696  LEU B O   1 
ATOM   3906 C CB  . LEU B 1 255 ? 18.275 -13.381 26.368  1.00 63.95  ? 696  LEU B CB  1 
ATOM   3907 C CG  . LEU B 1 255 ? 18.073 -14.192 25.082  1.00 63.36  ? 696  LEU B CG  1 
ATOM   3908 C CD1 . LEU B 1 255 ? 16.646 -14.705 25.015  1.00 64.39  ? 696  LEU B CD1 1 
ATOM   3909 C CD2 . LEU B 1 255 ? 18.393 -13.357 23.850  1.00 63.39  ? 696  LEU B CD2 1 
ATOM   3910 N N   . LYS B 1 256 ? 20.424 -12.048 28.856  1.00 67.28  ? 697  LYS B N   1 
ATOM   3911 C CA  . LYS B 1 256 ? 20.440 -11.075 29.954  1.00 69.44  ? 697  LYS B CA  1 
ATOM   3912 C C   . LYS B 1 256 ? 20.781 -9.707  29.416  1.00 67.39  ? 697  LYS B C   1 
ATOM   3913 O O   . LYS B 1 256 ? 21.501 -9.596  28.446  1.00 68.84  ? 697  LYS B O   1 
ATOM   3914 C CB  . LYS B 1 256 ? 21.453 -11.437 31.037  1.00 73.19  ? 697  LYS B CB  1 
ATOM   3915 C CG  . LYS B 1 256 ? 21.139 -12.725 31.775  1.00 75.97  ? 697  LYS B CG  1 
ATOM   3916 C CD  . LYS B 1 256 ? 21.304 -12.598 33.279  1.00 81.35  ? 697  LYS B CD  1 
ATOM   3917 C CE  . LYS B 1 256 ? 19.969 -12.623 34.005  1.00 84.90  ? 697  LYS B CE  1 
ATOM   3918 N NZ  . LYS B 1 256 ? 19.460 -14.019 34.085  1.00 87.16  ? 697  LYS B NZ  1 
ATOM   3919 N N   . LYS B 1 257 ? 20.273 -8.671  30.063  1.00 70.14  ? 698  LYS B N   1 
ATOM   3920 C CA  . LYS B 1 257 ? 20.348 -7.312  29.537  1.00 70.14  ? 698  LYS B CA  1 
ATOM   3921 C C   . LYS B 1 257 ? 21.657 -6.617  29.916  1.00 72.38  ? 698  LYS B C   1 
ATOM   3922 O O   . LYS B 1 257 ? 22.086 -5.692  29.239  1.00 73.40  ? 698  LYS B O   1 
ATOM   3923 C CB  . LYS B 1 257 ? 19.133 -6.507  30.014  1.00 71.68  ? 698  LYS B CB  1 
ATOM   3924 C CG  . LYS B 1 257 ? 17.805 -7.047  29.497  1.00 69.48  ? 698  LYS B CG  1 
ATOM   3925 C CD  . LYS B 1 257 ? 16.649 -6.592  30.361  1.00 73.17  ? 698  LYS B CD  1 
ATOM   3926 C CE  . LYS B 1 257 ? 15.347 -7.254  29.950  1.00 73.19  ? 698  LYS B CE  1 
ATOM   3927 N NZ  . LYS B 1 257 ? 14.234 -6.858  30.860  1.00 77.27  ? 698  LYS B NZ  1 
ATOM   3928 N N   . LYS B 1 258 ? 22.287 -7.074  30.991  1.00 76.71  ? 699  LYS B N   1 
ATOM   3929 C CA  . LYS B 1 258 ? 23.606 -6.595  31.387  1.00 79.50  ? 699  LYS B CA  1 
ATOM   3930 C C   . LYS B 1 258 ? 24.680 -7.479  30.716  1.00 76.68  ? 699  LYS B C   1 
ATOM   3931 O O   . LYS B 1 258 ? 24.705 -8.693  30.922  1.00 74.31  ? 699  LYS B O   1 
ATOM   3932 C CB  . LYS B 1 258 ? 23.726 -6.625  32.920  1.00 85.65  ? 699  LYS B CB  1 
ATOM   3933 C CG  . LYS B 1 258 ? 24.386 -5.397  33.548  1.00 94.75  ? 699  LYS B CG  1 
ATOM   3934 C CD  . LYS B 1 258 ? 25.784 -5.682  34.103  1.00 99.71  ? 699  LYS B CD  1 
ATOM   3935 C CE  . LYS B 1 258 ? 26.524 -4.411  34.515  1.00 105.33 ? 699  LYS B CE  1 
ATOM   3936 N NZ  . LYS B 1 258 ? 25.752 -3.530  35.441  1.00 110.02 ? 699  LYS B NZ  1 
ATOM   3937 N N   . ARG B 1 259 ? 25.528 -6.860  29.888  1.00 76.36  ? 700  ARG B N   1 
ATOM   3938 C CA  . ARG B 1 259 ? 26.689 -7.505  29.242  1.00 74.40  ? 700  ARG B CA  1 
ATOM   3939 C C   . ARG B 1 259 ? 27.453 -8.470  30.117  1.00 77.58  ? 700  ARG B C   1 
ATOM   3940 O O   . ARG B 1 259 ? 27.755 -9.594  29.720  1.00 75.88  ? 700  ARG B O   1 
ATOM   3941 C CB  . ARG B 1 259 ? 27.727 -6.449  28.879  1.00 77.15  ? 700  ARG B CB  1 
ATOM   3942 C CG  . ARG B 1 259 ? 27.601 -5.832  27.506  1.00 77.34  ? 700  ARG B CG  1 
ATOM   3943 C CD  . ARG B 1 259 ? 28.903 -5.158  27.108  1.00 80.21  ? 700  ARG B CD  1 
ATOM   3944 N NE  . ARG B 1 259 ? 29.477 -4.431  28.233  1.00 86.37  ? 700  ARG B NE  1 
ATOM   3945 C CZ  . ARG B 1 259 ? 30.616 -3.750  28.183  1.00 93.64  ? 700  ARG B CZ  1 
ATOM   3946 N NH1 . ARG B 1 259 ? 31.311 -3.678  27.051  1.00 94.20  ? 700  ARG B NH1 1 
ATOM   3947 N NH2 . ARG B 1 259 ? 31.055 -3.125  29.275  1.00 99.76  ? 700  ARG B NH2 1 
ATOM   3948 N N   . ASP B 1 260 ? 27.812 -7.985  31.300  1.00 83.74  ? 701  ASP B N   1 
ATOM   3949 C CA  . ASP B 1 260 ? 28.791 -8.644  32.155  1.00 87.92  ? 701  ASP B CA  1 
ATOM   3950 C C   . ASP B 1 260 ? 28.214 -9.919  32.751  1.00 86.39  ? 701  ASP B C   1 
ATOM   3951 O O   . ASP B 1 260 ? 28.960 -10.814 33.159  1.00 88.35  ? 701  ASP B O   1 
ATOM   3952 C CB  . ASP B 1 260 ? 29.248 -7.693  33.259  1.00 95.59  ? 701  ASP B CB  1 
ATOM   3953 C CG  . ASP B 1 260 ? 29.464 -6.271  32.750  1.00 101.02 ? 701  ASP B CG  1 
ATOM   3954 O OD1 . ASP B 1 260 ? 28.533 -5.708  32.118  1.00 99.49  ? 701  ASP B OD1 1 
ATOM   3955 O OD2 . ASP B 1 260 ? 30.558 -5.712  32.987  1.00 107.59 ? 701  ASP B OD2 1 
ATOM   3956 N N   . GLU B 1 261 ? 26.885 -9.994  32.784  1.00 82.78  ? 702  GLU B N   1 
ATOM   3957 C CA  . GLU B 1 261 ? 26.183 -11.175 33.267  1.00 82.20  ? 702  GLU B CA  1 
ATOM   3958 C C   . GLU B 1 261 ? 26.003 -12.255 32.207  1.00 74.63  ? 702  GLU B C   1 
ATOM   3959 O O   . GLU B 1 261 ? 25.633 -13.371 32.539  1.00 73.47  ? 702  GLU B O   1 
ATOM   3960 C CB  . GLU B 1 261 ? 24.828 -10.783 33.868  1.00 85.19  ? 702  GLU B CB  1 
ATOM   3961 C CG  . GLU B 1 261 ? 24.962 -10.186 35.263  1.00 92.23  ? 702  GLU B CG  1 
ATOM   3962 C CD  . GLU B 1 261 ? 23.643 -9.706  35.841  1.00 95.48  ? 702  GLU B CD  1 
ATOM   3963 O OE1 . GLU B 1 261 ? 22.572 -10.168 35.376  1.00 90.64  ? 702  GLU B OE1 1 
ATOM   3964 O OE2 . GLU B 1 261 ? 23.690 -8.862  36.770  1.00 99.89  ? 702  GLU B OE2 1 
ATOM   3965 N N   . ARG B 1 262 ? 26.271 -11.943 30.942  1.00 70.67  ? 703  ARG B N   1 
ATOM   3966 C CA  . ARG B 1 262 ? 26.165 -12.951 29.887  1.00 66.22  ? 703  ARG B CA  1 
ATOM   3967 C C   . ARG B 1 262 ? 27.412 -13.797 29.940  1.00 68.94  ? 703  ARG B C   1 
ATOM   3968 O O   . ARG B 1 262 ? 28.502 -13.282 30.195  1.00 72.81  ? 703  ARG B O   1 
ATOM   3969 C CB  . ARG B 1 262 ? 26.001 -12.337 28.498  1.00 61.27  ? 703  ARG B CB  1 
ATOM   3970 C CG  . ARG B 1 262 ? 24.943 -11.249 28.456  1.00 62.48  ? 703  ARG B CG  1 
ATOM   3971 C CD  . ARG B 1 262 ? 24.256 -11.092 27.108  1.00 61.11  ? 703  ARG B CD  1 
ATOM   3972 N NE  . ARG B 1 262 ? 24.741 -9.956  26.325  1.00 61.90  ? 703  ARG B NE  1 
ATOM   3973 C CZ  . ARG B 1 262 ? 24.319 -8.697  26.439  1.00 63.97  ? 703  ARG B CZ  1 
ATOM   3974 N NH1 . ARG B 1 262 ? 23.398 -8.356  27.325  1.00 65.39  ? 703  ARG B NH1 1 
ATOM   3975 N NH2 . ARG B 1 262 ? 24.846 -7.756  25.664  1.00 65.08  ? 703  ARG B NH2 1 
ATOM   3976 N N   . PRO B 1 263 ? 27.257 -15.105 29.724  1.00 69.06  ? 704  PRO B N   1 
ATOM   3977 C CA  . PRO B 1 263 ? 28.400 -15.993 29.687  1.00 70.88  ? 704  PRO B CA  1 
ATOM   3978 C C   . PRO B 1 263 ? 29.175 -15.851 28.385  1.00 69.37  ? 704  PRO B C   1 
ATOM   3979 O O   . PRO B 1 263 ? 28.650 -15.334 27.405  1.00 65.78  ? 704  PRO B O   1 
ATOM   3980 C CB  . PRO B 1 263 ? 27.755 -17.372 29.758  1.00 71.73  ? 704  PRO B CB  1 
ATOM   3981 C CG  . PRO B 1 263 ? 26.440 -17.189 29.084  1.00 68.29  ? 704  PRO B CG  1 
ATOM   3982 C CD  . PRO B 1 263 ? 25.992 -15.828 29.506  1.00 67.93  ? 704  PRO B CD  1 
ATOM   3983 N N   . LEU B 1 264 ? 30.415 -16.322 28.385  1.00 72.49  ? 705  LEU B N   1 
ATOM   3984 C CA  . LEU B 1 264 ? 31.230 -16.354 27.173  1.00 69.31  ? 705  LEU B CA  1 
ATOM   3985 C C   . LEU B 1 264 ? 31.012 -17.691 26.482  1.00 67.36  ? 705  LEU B C   1 
ATOM   3986 O O   . LEU B 1 264 ? 30.228 -18.514 26.952  1.00 67.11  ? 705  LEU B O   1 
ATOM   3987 C CB  . LEU B 1 264 ? 32.703 -16.127 27.524  1.00 71.83  ? 705  LEU B CB  1 
ATOM   3988 C CG  . LEU B 1 264 ? 32.989 -14.735 28.100  1.00 72.31  ? 705  LEU B CG  1 
ATOM   3989 C CD1 . LEU B 1 264 ? 34.404 -14.645 28.648  1.00 76.19  ? 705  LEU B CD1 1 
ATOM   3990 C CD2 . LEU B 1 264 ? 32.740 -13.659 27.048  1.00 69.91  ? 705  LEU B CD2 1 
ATOM   3991 N N   . PHE B 1 265 ? 31.692 -17.912 25.365  1.00 66.38  ? 706  PHE B N   1 
ATOM   3992 C CA  . PHE B 1 265 ? 31.366 -19.061 24.530  1.00 65.26  ? 706  PHE B CA  1 
ATOM   3993 C C   . PHE B 1 265 ? 31.869 -20.416 25.008  1.00 67.04  ? 706  PHE B C   1 
ATOM   3994 O O   . PHE B 1 265 ? 31.155 -21.397 24.881  1.00 66.63  ? 706  PHE B O   1 
ATOM   3995 C CB  . PHE B 1 265 ? 31.741 -18.801 23.078  1.00 64.47  ? 706  PHE B CB  1 
ATOM   3996 C CG  . PHE B 1 265 ? 30.612 -18.246 22.287  1.00 62.12  ? 706  PHE B CG  1 
ATOM   3997 C CD1 . PHE B 1 265 ? 29.647 -19.087 21.772  1.00 63.19  ? 706  PHE B CD1 1 
ATOM   3998 C CD2 . PHE B 1 265 ? 30.481 -16.889 22.104  1.00 61.89  ? 706  PHE B CD2 1 
ATOM   3999 C CE1 . PHE B 1 265 ? 28.576 -18.584 21.059  1.00 63.29  ? 706  PHE B CE1 1 
ATOM   4000 C CE2 . PHE B 1 265 ? 29.420 -16.374 21.392  1.00 61.56  ? 706  PHE B CE2 1 
ATOM   4001 C CZ  . PHE B 1 265 ? 28.460 -17.223 20.866  1.00 61.88  ? 706  PHE B CZ  1 
ATOM   4002 N N   . PRO B 1 266 ? 33.082 -20.487 25.557  1.00 71.04  ? 707  PRO B N   1 
ATOM   4003 C CA  . PRO B 1 266 ? 33.466 -21.784 26.118  1.00 76.20  ? 707  PRO B CA  1 
ATOM   4004 C C   . PRO B 1 266 ? 32.415 -22.354 27.097  1.00 79.49  ? 707  PRO B C   1 
ATOM   4005 O O   . PRO B 1 266 ? 32.139 -23.561 27.075  1.00 81.02  ? 707  PRO B O   1 
ATOM   4006 C CB  . PRO B 1 266 ? 34.783 -21.478 26.831  1.00 78.86  ? 707  PRO B CB  1 
ATOM   4007 C CG  . PRO B 1 266 ? 35.348 -20.303 26.099  1.00 76.87  ? 707  PRO B CG  1 
ATOM   4008 C CD  . PRO B 1 266 ? 34.178 -19.503 25.608  1.00 72.65  ? 707  PRO B CD  1 
ATOM   4009 N N   . GLN B 1 267 ? 31.822 -21.485 27.918  1.00 80.83  ? 708  GLN B N   1 
ATOM   4010 C CA  . GLN B 1 267 ? 30.767 -21.881 28.862  1.00 83.92  ? 708  GLN B CA  1 
ATOM   4011 C C   . GLN B 1 267 ? 29.520 -22.368 28.115  1.00 81.04  ? 708  GLN B C   1 
ATOM   4012 O O   . GLN B 1 267 ? 28.882 -23.343 28.508  1.00 83.14  ? 708  GLN B O   1 
ATOM   4013 C CB  . GLN B 1 267 ? 30.382 -20.713 29.780  1.00 86.55  ? 708  GLN B CB  1 
ATOM   4014 C CG  . GLN B 1 267 ? 31.320 -20.474 30.953  1.00 95.33  ? 708  GLN B CG  1 
ATOM   4015 C CD  . GLN B 1 267 ? 32.757 -20.150 30.542  1.00 99.76  ? 708  GLN B CD  1 
ATOM   4016 O OE1 . GLN B 1 267 ? 33.699 -20.846 30.951  1.00 105.16 ? 708  GLN B OE1 1 
ATOM   4017 N NE2 . GLN B 1 267 ? 32.936 -19.089 29.739  1.00 95.04  ? 708  GLN B NE2 1 
ATOM   4018 N N   . ILE B 1 268 ? 29.171 -21.675 27.038  1.00 75.77  ? 709  ILE B N   1 
ATOM   4019 C CA  . ILE B 1 268 ? 28.012 -22.048 26.235  1.00 72.86  ? 709  ILE B CA  1 
ATOM   4020 C C   . ILE B 1 268 ? 28.257 -23.403 25.574  1.00 74.42  ? 709  ILE B C   1 
ATOM   4021 O O   . ILE B 1 268 ? 27.410 -24.293 25.625  1.00 76.10  ? 709  ILE B O   1 
ATOM   4022 C CB  . ILE B 1 268 ? 27.705 -20.967 25.174  1.00 68.48  ? 709  ILE B CB  1 
ATOM   4023 C CG1 . ILE B 1 268 ? 27.196 -19.703 25.866  1.00 67.57  ? 709  ILE B CG1 1 
ATOM   4024 C CG2 . ILE B 1 268 ? 26.676 -21.457 24.165  1.00 67.19  ? 709  ILE B CG2 1 
ATOM   4025 C CD1 . ILE B 1 268 ? 27.253 -18.469 25.001  1.00 66.27  ? 709  ILE B CD1 1 
ATOM   4026 N N   . LEU B 1 269 ? 29.429 -23.553 24.966  1.00 74.42  ? 710  LEU B N   1 
ATOM   4027 C CA  . LEU B 1 269 ? 29.799 -24.801 24.307  1.00 75.83  ? 710  LEU B CA  1 
ATOM   4028 C C   . LEU B 1 269 ? 29.745 -25.939 25.330  1.00 80.15  ? 710  LEU B C   1 
ATOM   4029 O O   . LEU B 1 269 ? 29.162 -26.992 25.072  1.00 81.01  ? 710  LEU B O   1 
ATOM   4030 C CB  . LEU B 1 269 ? 31.191 -24.678 23.676  1.00 75.27  ? 710  LEU B CB  1 
ATOM   4031 C CG  . LEU B 1 269 ? 31.512 -25.541 22.456  1.00 78.06  ? 710  LEU B CG  1 
ATOM   4032 C CD1 . LEU B 1 269 ? 30.442 -25.412 21.383  1.00 76.40  ? 710  LEU B CD1 1 
ATOM   4033 C CD2 . LEU B 1 269 ? 32.881 -25.178 21.887  1.00 79.89  ? 710  LEU B CD2 1 
ATOM   4034 N N   . ALA B 1 270 ? 30.317 -25.691 26.505  1.00 81.34  ? 711  ALA B N   1 
ATOM   4035 C CA  . ALA B 1 270 ? 30.311 -26.658 27.591  1.00 85.77  ? 711  ALA B CA  1 
ATOM   4036 C C   . ALA B 1 270 ? 28.896 -27.022 28.043  1.00 87.17  ? 711  ALA B C   1 
ATOM   4037 O O   . ALA B 1 270 ? 28.612 -28.184 28.293  1.00 92.36  ? 711  ALA B O   1 
ATOM   4038 C CB  . ALA B 1 270 ? 31.115 -26.127 28.763  1.00 87.38  ? 711  ALA B CB  1 
ATOM   4039 N N   . SER B 1 271 ? 28.011 -26.037 28.148  1.00 85.40  ? 712  SER B N   1 
ATOM   4040 C CA  . SER B 1 271 ? 26.634 -26.301 28.593  1.00 86.51  ? 712  SER B CA  1 
ATOM   4041 C C   . SER B 1 271 ? 25.857 -27.125 27.581  1.00 86.36  ? 712  SER B C   1 
ATOM   4042 O O   . SER B 1 271 ? 25.109 -28.025 27.955  1.00 89.61  ? 712  SER B O   1 
ATOM   4043 C CB  . SER B 1 271 ? 25.883 -25.001 28.876  1.00 82.99  ? 712  SER B CB  1 
ATOM   4044 O OG  . SER B 1 271 ? 26.216 -24.515 30.161  1.00 86.28  ? 712  SER B OG  1 
ATOM   4045 N N   . ILE B 1 272 ? 26.043 -26.812 26.305  1.00 83.57  ? 713  ILE B N   1 
ATOM   4046 C CA  . ILE B 1 272 ? 25.375 -27.532 25.229  1.00 85.26  ? 713  ILE B CA  1 
ATOM   4047 C C   . ILE B 1 272 ? 25.910 -28.961 25.102  1.00 90.90  ? 713  ILE B C   1 
ATOM   4048 O O   . ILE B 1 272 ? 25.131 -29.907 24.989  1.00 95.03  ? 713  ILE B O   1 
ATOM   4049 C CB  . ILE B 1 272 ? 25.531 -26.794 23.889  1.00 82.40  ? 713  ILE B CB  1 
ATOM   4050 C CG1 . ILE B 1 272 ? 24.799 -25.449 23.958  1.00 79.53  ? 713  ILE B CG1 1 
ATOM   4051 C CG2 . ILE B 1 272 ? 24.993 -27.647 22.742  1.00 84.10  ? 713  ILE B CG2 1 
ATOM   4052 C CD1 . ILE B 1 272 ? 25.196 -24.452 22.888  1.00 76.69  ? 713  ILE B CD1 1 
ATOM   4053 N N   . GLU B 1 273 ? 27.232 -29.117 25.125  1.00 91.56  ? 714  GLU B N   1 
ATOM   4054 C CA  . GLU B 1 273 ? 27.852 -30.448 25.085  1.00 96.38  ? 714  GLU B CA  1 
ATOM   4055 C C   . GLU B 1 273 ? 27.383 -31.348 26.237  1.00 99.61  ? 714  GLU B C   1 
ATOM   4056 O O   . GLU B 1 273 ? 27.301 -32.559 26.075  1.00 104.75 ? 714  GLU B O   1 
ATOM   4057 C CB  . GLU B 1 273 ? 29.384 -30.336 25.094  1.00 98.93  ? 714  GLU B CB  1 
ATOM   4058 C CG  . GLU B 1 273 ? 29.986 -29.816 23.784  1.00 97.79  ? 714  GLU B CG  1 
ATOM   4059 C CD  . GLU B 1 273 ? 31.471 -29.435 23.882  1.00 99.34  ? 714  GLU B CD  1 
ATOM   4060 O OE1 . GLU B 1 273 ? 32.069 -29.084 22.838  1.00 96.81  ? 714  GLU B OE1 1 
ATOM   4061 O OE2 . GLU B 1 273 ? 32.053 -29.477 24.992  1.00 102.51 ? 714  GLU B OE2 1 
ATOM   4062 N N   . LEU B 1 274 ? 27.069 -30.753 27.385  1.00 97.64  ? 715  LEU B N   1 
ATOM   4063 C CA  . LEU B 1 274 ? 26.577 -31.493 28.553  1.00 102.29 ? 715  LEU B CA  1 
ATOM   4064 C C   . LEU B 1 274 ? 25.202 -32.123 28.313  1.00 104.90 ? 715  LEU B C   1 
ATOM   4065 O O   . LEU B 1 274 ? 25.028 -33.331 28.499  1.00 110.40 ? 715  LEU B O   1 
ATOM   4066 C CB  . LEU B 1 274 ? 26.495 -30.557 29.764  1.00 100.59 ? 715  LEU B CB  1 
ATOM   4067 C CG  . LEU B 1 274 ? 26.121 -31.155 31.120  1.00 105.77 ? 715  LEU B CG  1 
ATOM   4068 C CD1 . LEU B 1 274 ? 27.350 -31.756 31.787  1.00 111.35 ? 715  LEU B CD1 1 
ATOM   4069 C CD2 . LEU B 1 274 ? 25.498 -30.092 32.011  1.00 103.19 ? 715  LEU B CD2 1 
ATOM   4070 N N   . LEU B 1 275 ? 24.228 -31.302 27.915  1.00 101.22 ? 716  LEU B N   1 
ATOM   4071 C CA  . LEU B 1 275 ? 22.861 -31.788 27.697  1.00 103.90 ? 716  LEU B CA  1 
ATOM   4072 C C   . LEU B 1 275 ? 22.739 -32.565 26.389  1.00 106.60 ? 716  LEU B C   1 
ATOM   4073 O O   . LEU B 1 275 ? 21.870 -33.430 26.257  1.00 111.65 ? 716  LEU B O   1 
ATOM   4074 C CB  . LEU B 1 275 ? 21.850 -30.643 27.737  1.00 99.03  ? 716  LEU B CB  1 
ATOM   4075 C CG  . LEU B 1 275 ? 21.769 -29.722 26.518  1.00 93.86  ? 716  LEU B CG  1 
ATOM   4076 C CD1 . LEU B 1 275 ? 20.892 -30.300 25.417  1.00 95.81  ? 716  LEU B CD1 1 
ATOM   4077 C CD2 . LEU B 1 275 ? 21.239 -28.355 26.916  1.00 89.64  ? 716  LEU B CD2 1 
ATOM   4078 N N   . ALA B 1 276 ? 23.601 -32.252 25.423  1.00 103.85 ? 717  ALA B N   1 
ATOM   4079 C CA  . ALA B 1 276 ? 23.666 -33.017 24.183  1.00 106.53 ? 717  ALA B CA  1 
ATOM   4080 C C   . ALA B 1 276 ? 23.803 -34.507 24.490  1.00 115.61 ? 717  ALA B C   1 
ATOM   4081 O O   . ALA B 1 276 ? 22.936 -35.301 24.123  1.00 119.85 ? 717  ALA B O   1 
ATOM   4082 C CB  . ALA B 1 276 ? 24.827 -32.547 23.319  1.00 102.69 ? 717  ALA B CB  1 
ATOM   4083 N N   . ARG B 1 277 ? 24.872 -34.874 25.194  1.00 119.56 ? 718  ARG B N   1 
ATOM   4084 C CA  . ARG B 1 277 ? 25.191 -36.287 25.418  1.00 128.46 ? 718  ARG B CA  1 
ATOM   4085 C C   . ARG B 1 277 ? 24.104 -37.023 26.206  1.00 134.20 ? 718  ARG B C   1 
ATOM   4086 O O   . ARG B 1 277 ? 23.891 -38.215 25.988  1.00 139.39 ? 718  ARG B O   1 
ATOM   4087 C CB  . ARG B 1 277 ? 26.560 -36.449 26.100  1.00 131.36 ? 718  ARG B CB  1 
ATOM   4088 C CG  . ARG B 1 277 ? 26.543 -36.497 27.625  1.00 135.65 ? 718  ARG B CG  1 
ATOM   4089 C CD  . ARG B 1 277 ? 27.950 -36.540 28.207  1.00 138.52 ? 718  ARG B CD  1 
ATOM   4090 N NE  . ARG B 1 277 ? 28.611 -35.235 28.112  1.00 133.88 ? 718  ARG B NE  1 
ATOM   4091 C CZ  . ARG B 1 277 ? 29.412 -34.837 27.120  1.00 130.97 ? 718  ARG B CZ  1 
ATOM   4092 N NH1 . ARG B 1 277 ? 29.696 -35.639 26.093  1.00 133.71 ? 718  ARG B NH1 1 
ATOM   4093 N NH2 . ARG B 1 277 ? 29.940 -33.614 27.156  1.00 124.97 ? 718  ARG B NH2 1 
ATOM   4094 N N   . SER B 1 278 ? 23.420 -36.314 27.105  1.00 132.68 ? 719  SER B N   1 
ATOM   4095 C CA  . SER B 1 278 ? 22.375 -36.920 27.942  1.00 138.10 ? 719  SER B CA  1 
ATOM   4096 C C   . SER B 1 278 ? 21.039 -37.013 27.209  1.00 138.45 ? 719  SER B C   1 
ATOM   4097 O O   . SER B 1 278 ? 20.718 -36.181 26.359  1.00 132.01 ? 719  SER B O   1 
ATOM   4098 C CB  . SER B 1 278 ? 22.200 -36.126 29.237  1.00 135.83 ? 719  SER B CB  1 
ATOM   4099 O OG  . SER B 1 278 ? 21.921 -34.768 28.960  1.00 127.16 ? 719  SER B OG  1 
HETATM 4100 C C4  . 1SU C 2 .   ? 49.976 -34.265 1.451   1.00 101.36 ? 901  1SU A C4  1 
HETATM 4101 C C5  . 1SU C 2 .   ? 41.390 -36.903 9.794   1.00 90.13  ? 901  1SU A C5  1 
HETATM 4102 C C6  . 1SU C 2 .   ? 42.748 -36.799 9.557   1.00 92.71  ? 901  1SU A C6  1 
HETATM 4103 C C7  . 1SU C 2 .   ? 45.802 -35.975 10.658  1.00 85.96  ? 901  1SU A C7  1 
HETATM 4104 C C8  . 1SU C 2 .   ? 46.663 -34.901 10.710  1.00 84.56  ? 901  1SU A C8  1 
HETATM 4105 C C10 . 1SU C 2 .   ? 46.617 -36.496 8.458   1.00 88.63  ? 901  1SU A C10 1 
HETATM 4106 C C13 . 1SU C 2 .   ? 48.830 -33.563 1.786   1.00 94.47  ? 901  1SU A C13 1 
HETATM 4107 C C15 . 1SU C 2 .   ? 47.473 -35.416 8.509   1.00 86.40  ? 901  1SU A C15 1 
HETATM 4108 C C17 . 1SU C 2 .   ? 43.582 -37.885 9.706   1.00 94.66  ? 901  1SU A C17 1 
HETATM 4109 C C20 . 1SU C 2 .   ? 39.386 -39.652 10.817  1.00 94.72  ? 901  1SU A C20 1 
HETATM 4110 C C21 . 1SU C 2 .   ? 38.012 -41.611 11.468  1.00 99.94  ? 901  1SU A C21 1 
HETATM 4111 C C22 . 1SU C 2 .   ? 47.962 -34.861 6.171   1.00 81.98  ? 901  1SU A C22 1 
HETATM 4112 C C24 . 1SU C 2 .   ? 35.446 -41.457 11.505  1.00 96.29  ? 901  1SU A C24 1 
HETATM 4113 C C26 . 1SU C 2 .   ? 48.813 -33.829 5.522   1.00 87.33  ? 901  1SU A C26 1 
HETATM 4114 C C1  . 1SU C 2 .   ? 43.939 -40.269 10.242  1.00 96.79  ? 901  1SU A C1  1 
HETATM 4115 C C2  . 1SU C 2 .   ? 50.763 -34.843 2.430   1.00 96.31  ? 901  1SU A C2  1 
HETATM 4116 C C3  . 1SU C 2 .   ? 50.392 -34.706 3.751   1.00 101.99 ? 901  1SU A C3  1 
HETATM 4117 C C9  . 1SU C 2 .   ? 48.466 -33.439 3.107   1.00 94.21  ? 901  1SU A C9  1 
HETATM 4118 C C11 . 1SU C 2 .   ? 43.094 -39.116 10.087  1.00 95.30  ? 901  1SU A C11 1 
HETATM 4119 C C12 . 1SU C 2 .   ? 49.237 -34.016 4.094   1.00 99.02  ? 901  1SU A C12 1 
HETATM 4120 C C14 . 1SU C 2 .   ? 40.873 -38.125 10.190  1.00 91.29  ? 901  1SU A C14 1 
HETATM 4121 C C16 . 1SU C 2 .   ? 45.780 -36.759 9.530   1.00 86.85  ? 901  1SU A C16 1 
HETATM 4122 C C18 . 1SU C 2 .   ? 47.492 -34.633 9.638   1.00 86.08  ? 901  1SU A C18 1 
HETATM 4123 C C19 . 1SU C 2 .   ? 41.741 -39.200 10.328  1.00 93.82  ? 901  1SU A C19 1 
HETATM 4124 C C23 . 1SU C 2 .   ? 35.809 -42.912 11.481  1.00 97.45  ? 901  1SU A C23 1 
HETATM 4125 C C25 . 1SU C 2 .   ? 36.729 -41.920 12.132  1.00 97.08  ? 901  1SU A C25 1 
HETATM 4126 C C27 . 1SU C 2 .   ? 47.960 -32.914 0.763   1.00 92.36  ? 901  1SU A C27 1 
HETATM 4127 N N28 . 1SU C 2 .   ? 44.588 -41.234 10.322  1.00 96.42  ? 901  1SU A N28 1 
HETATM 4128 N N29 . 1SU C 2 .   ? 39.549 -38.390 10.469  1.00 89.43  ? 901  1SU A N29 1 
HETATM 4129 N N30 . 1SU C 2 .   ? 48.362 -35.073 7.469   1.00 82.25  ? 901  1SU A N30 1 
HETATM 4130 N N31 . 1SU C 2 .   ? 38.176 -40.253 11.164  1.00 95.17  ? 901  1SU A N31 1 
HETATM 4131 O O32 . 1SU C 2 .   ? 38.771 -42.551 11.257  1.00 99.67  ? 901  1SU A O32 1 
HETATM 4132 O O33 . 1SU C 2 .   ? 47.026 -35.396 5.599   1.00 88.30  ? 901  1SU A O33 1 
HETATM 4133 O O34 . 1SU C 2 .   ? 44.950 -37.865 9.461   1.00 91.10  ? 901  1SU A O34 1 
HETATM 4134 F F35 . 1SU C 2 .   ? 48.344 -33.592 9.655   1.00 87.63  ? 901  1SU A F35 1 
HETATM 4135 F F36 . 1SU C 2 .   ? 48.677 -32.432 -0.293  1.00 90.28  ? 901  1SU A F36 1 
HETATM 4136 F F37 . 1SU C 2 .   ? 46.980 -33.692 0.242   1.00 89.10  ? 901  1SU A F37 1 
HETATM 4137 F F38 . 1SU C 2 .   ? 47.254 -31.887 1.306   1.00 89.55  ? 901  1SU A F38 1 
HETATM 4138 S S39 . 1SU C 2 .   ? 40.840 -40.572 10.825  1.00 102.13 ? 901  1SU A S39 1 
HETATM 4139 C C4  . 1SU D 2 .   ? 32.314 -12.356 9.533   1.00 91.85  ? 901  1SU B C4  1 
HETATM 4140 C C5  . 1SU D 2 .   ? 28.834 -18.584 -0.340  1.00 75.65  ? 901  1SU B C5  1 
HETATM 4141 C C6  . 1SU D 2 .   ? 29.399 -17.386 0.075   1.00 72.96  ? 901  1SU B C6  1 
HETATM 4142 C C7  . 1SU D 2 .   ? 31.186 -14.437 -0.542  1.00 68.55  ? 901  1SU B C7  1 
HETATM 4143 C C8  . 1SU D 2 .   ? 32.425 -13.856 -0.399  1.00 71.05  ? 901  1SU B C8  1 
HETATM 4144 C C10 . 1SU D 2 .   ? 30.668 -13.788 1.712   1.00 75.72  ? 901  1SU B C10 1 
HETATM 4145 C C13 . 1SU D 2 .   ? 32.940 -13.319 8.770   1.00 89.72  ? 901  1SU B C13 1 
HETATM 4146 C C15 . 1SU D 2 .   ? 31.908 -13.211 1.869   1.00 75.71  ? 901  1SU B C15 1 
HETATM 4147 C C17 . 1SU D 2 .   ? 28.667 -16.218 0.046   1.00 73.78  ? 901  1SU B C17 1 
HETATM 4148 C C20 . 1SU D 2 .   ? 25.580 -19.394 -1.607  1.00 77.79  ? 901  1SU B C20 1 
HETATM 4149 C C21 . 1SU D 2 .   ? 23.369 -19.762 -2.548  1.00 89.24  ? 901  1SU B C21 1 
HETATM 4150 C C22 . 1SU D 2 .   ? 32.041 -12.921 4.366   1.00 77.65  ? 901  1SU B C22 1 
HETATM 4151 C C24 . 1SU D 2 .   ? 21.622 -21.097 -3.850  1.00 90.24  ? 901  1SU B C24 1 
HETATM 4152 C C26 . 1SU D 2 .   ? 32.663 -11.895 5.292   1.00 81.13  ? 901  1SU B C26 1 
HETATM 4153 C C1  . 1SU D 2 .   ? 26.580 -15.050 -0.416  1.00 78.72  ? 901  1SU B C1  1 
HETATM 4154 C C2  . 1SU D 2 .   ? 31.791 -11.236 8.917   1.00 94.56  ? 901  1SU B C2  1 
HETATM 4155 C C3  . 1SU D 2 .   ? 31.898 -11.078 7.549   1.00 88.30  ? 901  1SU B C3  1 
HETATM 4156 C C9  . 1SU D 2 .   ? 33.041 -13.160 7.405   1.00 87.84  ? 901  1SU B C9  1 
HETATM 4157 C C11 . 1SU D 2 .   ? 27.368 -16.239 -0.394  1.00 76.49  ? 901  1SU B C11 1 
HETATM 4158 C C12 . 1SU D 2 .   ? 32.520 -12.047 6.783   1.00 87.58  ? 901  1SU B C12 1 
HETATM 4159 C C14 . 1SU D 2 .   ? 27.517 -18.621 -0.796  1.00 77.78  ? 901  1SU B C14 1 
HETATM 4160 C C16 . 1SU D 2 .   ? 30.323 -14.404 0.523   1.00 68.85  ? 901  1SU B C16 1 
HETATM 4161 C C18 . 1SU D 2 .   ? 32.773 -13.250 0.791   1.00 75.85  ? 901  1SU B C18 1 
HETATM 4162 C C19 . 1SU D 2 .   ? 26.813 -17.430 -0.811  1.00 77.34  ? 901  1SU B C19 1 
HETATM 4163 C C23 . 1SU D 2 .   ? 22.449 -22.103 -3.110  1.00 90.26  ? 901  1SU B C23 1 
HETATM 4164 C C25 . 1SU D 2 .   ? 22.263 -20.735 -2.536  1.00 91.71  ? 901  1SU B C25 1 
HETATM 4165 C C27 . 1SU D 2 .   ? 33.515 -14.538 9.396   1.00 93.20  ? 901  1SU B C27 1 
HETATM 4166 N N28 . 1SU D 2 .   ? 25.974 -14.057 -0.458  1.00 78.17  ? 901  1SU B N28 1 
HETATM 4167 N N29 . 1SU D 2 .   ? 26.807 -19.722 -1.246  1.00 75.81  ? 901  1SU B N29 1 
HETATM 4168 N N30 . 1SU D 2 .   ? 32.332 -12.562 3.059   1.00 76.78  ? 901  1SU B N30 1 
HETATM 4169 N N31 . 1SU D 2 .   ? 24.594 -20.242 -2.104  1.00 78.77  ? 901  1SU B N31 1 
HETATM 4170 O O32 . 1SU D 2 .   ? 23.112 -18.633 -2.946  1.00 98.91  ? 901  1SU B O32 1 
HETATM 4171 O O33 . 1SU D 2 .   ? 31.390 -13.894 4.721   1.00 73.77  ? 901  1SU B O33 1 
HETATM 4172 O O34 . 1SU D 2 .   ? 29.052 -14.936 0.439   1.00 66.99  ? 901  1SU B O34 1 
HETATM 4173 F F35 . 1SU D 2 .   ? 34.000 -12.695 0.886   1.00 76.41  ? 901  1SU B F35 1 
HETATM 4174 F F36 . 1SU D 2 .   ? 32.581 -15.308 10.017  1.00 88.58  ? 901  1SU B F36 1 
HETATM 4175 F F37 . 1SU D 2 .   ? 34.102 -15.357 8.479   1.00 92.29  ? 901  1SU B F37 1 
HETATM 4176 F F38 . 1SU D 2 .   ? 34.472 -14.244 10.322  1.00 95.74  ? 901  1SU B F38 1 
HETATM 4177 S S39 . 1SU D 2 .   ? 25.230 -17.724 -1.414  1.00 77.78  ? 901  1SU B S39 1 
HETATM 4178 O O   . HOH E 3 .   ? 44.473 -56.550 -12.841 1.00 29.33  ? 1001 HOH A O   1 
HETATM 4179 O O   . HOH E 3 .   ? 50.408 -39.899 -6.023  1.00 54.89  ? 1002 HOH A O   1 
HETATM 4180 O O   . HOH E 3 .   ? 41.558 -27.020 2.195   1.00 60.07  ? 1003 HOH A O   1 
HETATM 4181 O O   . HOH E 3 .   ? 50.269 -48.209 -22.268 1.00 53.41  ? 1004 HOH A O   1 
HETATM 4182 O O   . HOH E 3 .   ? 47.302 -57.211 -5.157  1.00 52.39  ? 1005 HOH A O   1 
HETATM 4183 O O   . HOH E 3 .   ? 45.587 -51.585 -18.415 1.00 74.45  ? 1006 HOH A O   1 
HETATM 4184 O O   . HOH E 3 .   ? 58.352 -37.275 -19.853 1.00 73.24  ? 1007 HOH A O   1 
HETATM 4185 O O   . HOH E 3 .   ? 38.335 -55.461 -2.415  1.00 56.08  ? 1008 HOH A O   1 
HETATM 4186 O O   . HOH E 3 .   ? 42.889 -54.077 -20.115 1.00 59.44  ? 1009 HOH A O   1 
HETATM 4187 O O   . HOH E 3 .   ? 51.971 -45.950 -23.189 1.00 53.31  ? 1010 HOH A O   1 
HETATM 4188 O O   . HOH E 3 .   ? 50.036 -55.617 -20.425 1.00 61.00  ? 1011 HOH A O   1 
HETATM 4189 O O   . HOH E 3 .   ? 45.770 -19.580 5.264   1.00 49.38  ? 1012 HOH A O   1 
HETATM 4190 O O   . HOH E 3 .   ? 54.422 -65.448 -3.138  1.00 60.27  ? 1013 HOH A O   1 
HETATM 4191 O O   . HOH E 3 .   ? 24.814 -48.459 -10.176 1.00 61.19  ? 1014 HOH A O   1 
HETATM 4192 O O   . HOH E 3 .   ? 25.422 -45.000 -3.842  1.00 42.89  ? 1015 HOH A O   1 
HETATM 4193 O O   . HOH F 3 .   ? 8.833  -12.480 21.752  1.00 38.36  ? 1001 HOH B O   1 
HETATM 4194 O O   . HOH F 3 .   ? 15.984 5.182   25.852  1.00 56.07  ? 1002 HOH B O   1 
HETATM 4195 O O   . HOH F 3 .   ? 40.903 -14.440 -12.317 1.00 83.34  ? 1003 HOH B O   1 
HETATM 4196 O O   . HOH F 3 .   ? 18.190 -10.041 32.338  1.00 43.70  ? 1004 HOH B O   1 
HETATM 4197 O O   . HOH F 3 .   ? 16.329 -8.316  20.773  1.00 54.86  ? 1005 HOH B O   1 
HETATM 4198 O O   . HOH F 3 .   ? 18.433 -2.205  30.211  1.00 52.87  ? 1006 HOH B O   1 
HETATM 4199 O O   . HOH F 3 .   ? 18.882 -38.533 26.403  1.00 82.10  ? 1007 HOH B O   1 
HETATM 4200 O O   . HOH F 3 .   ? 21.688 -24.992 -3.315  1.00 58.16  ? 1008 HOH B O   1 
HETATM 4201 O O   . HOH F 3 .   ? 36.766 -8.148  14.618  1.00 49.10  ? 1009 HOH B O   1 
HETATM 4202 O O   . HOH F 3 .   ? 35.525 -17.631 28.952  1.00 59.77  ? 1010 HOH B O   1 
HETATM 4203 O O   . HOH F 3 .   ? 50.397 -14.828 -4.303  1.00 82.89  ? 1011 HOH B O   1 
HETATM 4204 O O   . HOH F 3 .   ? 37.536 6.499   0.185   1.00 83.96  ? 1012 HOH B O   1 
HETATM 4205 O O   . HOH F 3 .   ? 24.235 -8.130  19.637  1.00 56.20  ? 1013 HOH B O   1 
HETATM 4206 O O   . HOH F 3 .   ? 36.343 -24.156 23.875  1.00 69.10  ? 1014 HOH B O   1 
HETATM 4207 O O   . HOH F 3 .   ? 24.452 -7.460  -1.236  1.00 62.53  ? 1015 HOH B O   1 
HETATM 4208 O O   . HOH F 3 .   ? 8.289  -14.802 13.117  1.00 64.98  ? 1016 HOH B O   1 
HETATM 4209 O O   . HOH F 3 .   ? 33.720 -5.710  27.322  1.00 66.59  ? 1017 HOH B O   1 
HETATM 4210 O O   . HOH F 3 .   ? 10.270 -30.356 7.064   1.00 60.26  ? 1018 HOH B O   1 
HETATM 4211 O O   . HOH F 3 .   ? 11.101 -7.750  30.088  1.00 73.23  ? 1019 HOH B O   1 
HETATM 4212 O O   . HOH F 3 .   ? 11.927 -33.730 18.013  1.00 59.73  ? 1020 HOH B O   1 
HETATM 4213 O O   . HOH F 3 .   ? 40.888 -9.582  15.339  1.00 72.97  ? 1021 HOH B O   1 
HETATM 4214 O O   . HOH F 3 .   ? 17.147 -31.518 7.952   1.00 77.83  ? 1022 HOH B O   1 
HETATM 4215 O O   . HOH F 3 .   ? 15.419 -33.101 11.132  1.00 65.82  ? 1023 HOH B O   1 
HETATM 4216 O O   . HOH F 3 .   ? 40.362 -22.490 -12.961 1.00 48.74  ? 1024 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASP A 6   ? 1.6226 1.1799 2.1088 -0.2125 -0.1180 0.1818  447 ASP A N   
2    C CA  . ASP A 6   ? 1.5464 1.1465 1.9662 -0.1601 -0.0979 0.1230  447 ASP A CA  
3    C C   . ASP A 6   ? 1.4394 1.1338 1.9144 -0.1631 -0.0798 0.1175  447 ASP A C   
4    O O   . ASP A 6   ? 1.4465 1.1989 2.0119 -0.1978 -0.0609 0.1663  447 ASP A O   
5    C CB  . ASP A 6   ? 1.5440 1.1562 1.8772 -0.1305 -0.0429 0.1336  447 ASP A CB  
6    C CG  . ASP A 6   ? 1.5850 1.1243 1.8453 -0.0975 -0.0745 0.1010  447 ASP A CG  
7    O OD1 . ASP A 6   ? 1.6289 1.0871 1.9040 -0.1035 -0.1268 0.0961  447 ASP A OD1 
8    O OD2 . ASP A 6   ? 1.5328 1.0959 1.7276 -0.0649 -0.0495 0.0820  447 ASP A OD2 
9    N N   . ASP A 7   ? 1.3340 1.0479 1.7602 -0.1260 -0.0863 0.0629  448 ASP A N   
10   C CA  . ASP A 7   ? 1.2293 1.0237 1.6934 -0.1220 -0.0744 0.0573  448 ASP A CA  
11   C C   . ASP A 7   ? 1.1275 0.9355 1.5066 -0.0780 -0.0618 0.0109  448 ASP A C   
12   O O   . ASP A 7   ? 1.1229 0.8867 1.4430 -0.0564 -0.0930 -0.0350 448 ASP A O   
13   C CB  . ASP A 7   ? 1.2679 1.0580 1.8014 -0.1512 -0.1408 0.0458  448 ASP A CB  
14   C CG  . ASP A 7   ? 1.2221 1.1044 1.8252 -0.1564 -0.1332 0.0616  448 ASP A CG  
15   O OD1 . ASP A 7   ? 1.2508 1.1349 1.9063 -0.1809 -0.1951 0.0526  448 ASP A OD1 
16   O OD2 . ASP A 7   ? 1.1511 1.0966 1.7544 -0.1346 -0.0711 0.0822  448 ASP A OD2 
17   N N   . TRP A 8   ? 1.0189 0.8877 1.3950 -0.0635 -0.0141 0.0250  449 TRP A N   
18   C CA  . TRP A 8   ? 0.9450 0.8240 1.2451 -0.0300 -0.0001 -0.0069 449 TRP A CA  
19   C C   . TRP A 8   ? 0.9014 0.8283 1.2217 -0.0240 -0.0155 -0.0191 449 TRP A C   
20   O O   . TRP A 8   ? 0.8503 0.7970 1.1248 -0.0027 0.0039  -0.0289 449 TRP A O   
21   C CB  . TRP A 8   ? 0.9295 0.8155 1.1876 -0.0166 0.0568  0.0140  449 TRP A CB  
22   C CG  . TRP A 8   ? 0.9445 0.7815 1.1682 -0.0235 0.0672  0.0309  449 TRP A CG  
23   C CD1 . TRP A 8   ? 0.9805 0.8127 1.2315 -0.0439 0.0946  0.0749  449 TRP A CD1 
24   C CD2 . TRP A 8   ? 0.9479 0.7381 1.1065 -0.0098 0.0487  0.0101  449 TRP A CD2 
25   N NE1 . TRP A 8   ? 1.0358 0.8102 1.2291 -0.0458 0.0904  0.0840  449 TRP A NE1 
26   C CE2 . TRP A 8   ? 1.0097 0.7582 1.1520 -0.0233 0.0592  0.0439  449 TRP A CE2 
27   C CE3 . TRP A 8   ? 0.9102 0.6980 1.0287 0.0135  0.0263  -0.0287 449 TRP A CE3 
28   C CZ2 . TRP A 8   ? 1.0232 0.7215 1.1125 -0.0130 0.0389  0.0391  449 TRP A CZ2 
29   C CZ3 . TRP A 8   ? 0.9263 0.6769 1.0064 0.0258  0.0124  -0.0344 449 TRP A CZ3 
30   C CH2 . TRP A 8   ? 0.9814 0.6846 1.0483 0.0132  0.0143  -0.0011 449 TRP A CH2 
31   N N   . GLU A 9   ? 0.9224 0.8629 1.3100 -0.0462 -0.0577 -0.0151 450 GLU A N   
32   C CA  . GLU A 9   ? 0.9232 0.9011 1.3188 -0.0417 -0.0864 -0.0263 450 GLU A CA  
33   C C   . GLU A 9   ? 0.9492 0.8957 1.2440 -0.0209 -0.1107 -0.0756 450 GLU A C   
34   O O   . GLU A 9   ? 1.0199 0.9132 1.2739 -0.0177 -0.1328 -0.1072 450 GLU A O   
35   C CB  . GLU A 9   ? 0.9746 0.9695 1.4608 -0.0745 -0.1406 -0.0124 450 GLU A CB  
36   C CG  . GLU A 9   ? 0.9862 1.0161 1.4713 -0.0702 -0.1806 -0.0210 450 GLU A CG  
37   C CD  . GLU A 9   ? 1.0326 1.1007 1.6346 -0.1050 -0.2327 0.0078  450 GLU A CD  
38   O OE1 . GLU A 9   ? 1.0267 1.1683 1.7102 -0.1003 -0.2199 0.0452  450 GLU A OE1 
39   O OE2 . GLU A 9   ? 1.1094 1.1324 1.7281 -0.1367 -0.2903 -0.0059 450 GLU A OE2 
40   N N   . ILE A 10  ? 0.9386 0.9190 1.1957 -0.0047 -0.1032 -0.0787 451 ILE A N   
41   C CA  . ILE A 10  ? 0.9734 0.9442 1.1361 0.0142  -0.1151 -0.1154 451 ILE A CA  
42   C C   . ILE A 10  ? 1.0304 1.0089 1.1840 0.0046  -0.1706 -0.1265 451 ILE A C   
43   O O   . ILE A 10  ? 1.0086 1.0260 1.2159 -0.0052 -0.1819 -0.0945 451 ILE A O   
44   C CB  . ILE A 10  ? 0.9449 0.9452 1.0680 0.0308  -0.0718 -0.1011 451 ILE A CB  
45   C CG1 . ILE A 10  ? 0.9048 0.8907 1.0351 0.0351  -0.0274 -0.0876 451 ILE A CG1 
46   C CG2 . ILE A 10  ? 0.9991 1.0063 1.0340 0.0469  -0.0743 -0.1290 451 ILE A CG2 
47   C CD1 . ILE A 10  ? 0.8760 0.8754 0.9746 0.0439  0.0060  -0.0717 451 ILE A CD1 
48   N N   . PRO A 11  ? 1.1139 1.0513 1.1966 0.0105  -0.2085 -0.1728 452 PRO A N   
49   C CA  . PRO A 11  ? 1.1887 1.1245 1.2386 0.0002  -0.2673 -0.1853 452 PRO A CA  
50   C C   . PRO A 11  ? 1.2061 1.1908 1.2077 0.0108  -0.2533 -0.1648 452 PRO A C   
51   O O   . PRO A 11  ? 1.1325 1.1405 1.0999 0.0288  -0.2002 -0.1561 452 PRO A O   
52   C CB  . PRO A 11  ? 1.2856 1.1559 1.2361 0.0162  -0.2972 -0.2486 452 PRO A CB  
53   C CG  . PRO A 11  ? 1.2508 1.1061 1.1856 0.0430  -0.2455 -0.2653 452 PRO A CG  
54   C CD  . PRO A 11  ? 1.1538 1.0375 1.1853 0.0290  -0.2056 -0.2162 452 PRO A CD  
55   N N   . ASP A 12  ? 1.2841 1.2814 1.2878 -0.0043 -0.3073 -0.1520 453 ASP A N   
56   C CA  . ASP A 12  ? 1.2990 1.3365 1.2665 0.0015  -0.3044 -0.1209 453 ASP A CA  
57   C C   . ASP A 12  ? 1.3596 1.3901 1.1808 0.0209  -0.2880 -0.1489 453 ASP A C   
58   O O   . ASP A 12  ? 1.4308 1.4241 1.1725 0.0334  -0.2936 -0.2008 453 ASP A O   
59   C CB  . ASP A 12  ? 1.3557 1.4114 1.3719 -0.0192 -0.3751 -0.0929 453 ASP A CB  
60   C CG  . ASP A 12  ? 1.4690 1.4778 1.4331 -0.0373 -0.4539 -0.1333 453 ASP A CG  
61   O OD1 . ASP A 12  ? 1.4876 1.4522 1.4720 -0.0456 -0.4631 -0.1670 453 ASP A OD1 
62   O OD2 . ASP A 12  ? 1.5368 1.5441 1.4363 -0.0449 -0.5127 -0.1298 453 ASP A OD2 
63   N N   . GLY A 13  ? 1.3231 1.3893 1.1138 0.0252  -0.2634 -0.1120 454 GLY A N   
64   C CA  . GLY A 13  ? 1.3754 1.4536 1.0369 0.0380  -0.2411 -0.1218 454 GLY A CA  
65   C C   . GLY A 13  ? 1.3294 1.4145 0.9593 0.0590  -0.1806 -0.1526 454 GLY A C   
66   O O   . GLY A 13  ? 1.4278 1.5238 0.9528 0.0761  -0.1625 -0.1782 454 GLY A O   
67   N N   . GLN A 14  ? 1.2303 1.3125 0.9506 0.0600  -0.1495 -0.1489 455 GLN A N   
68   C CA  . GLN A 14  ? 1.1973 1.2947 0.9101 0.0778  -0.0964 -0.1650 455 GLN A CA  
69   C C   . GLN A 14  ? 1.1211 1.2535 0.8665 0.0676  -0.0571 -0.1178 455 GLN A C   
70   O O   . GLN A 14  ? 1.0896 1.2593 0.8054 0.0742  -0.0196 -0.1137 455 GLN A O   
71   C CB  . GLN A 14  ? 1.1642 1.2235 0.9428 0.0831  -0.0968 -0.1905 455 GLN A CB  
72   C CG  . GLN A 14  ? 1.2471 1.2548 0.9902 0.0934  -0.1375 -0.2427 455 GLN A CG  
73   C CD  . GLN A 14  ? 1.2355 1.2110 1.0014 0.1138  -0.1209 -0.2747 455 GLN A CD  
74   O OE1 . GLN A 14  ? 1.1895 1.1578 1.0328 0.1037  -0.1067 -0.2522 455 GLN A OE1 
75   N NE2 . GLN A 14  ? 1.3340 1.2870 1.0263 0.1466  -0.1216 -0.3269 455 GLN A NE2 
76   N N   . ILE A 15  ? 1.1056 1.2250 0.9170 0.0521  -0.0675 -0.0824 456 ILE A N   
77   C CA  . ILE A 15  ? 1.0838 1.2109 0.9203 0.0425  -0.0404 -0.0422 456 ILE A CA  
78   C C   . ILE A 15  ? 1.1226 1.2699 0.9063 0.0315  -0.0488 -0.0053 456 ILE A C   
79   O O   . ILE A 15  ? 1.1524 1.2929 0.9275 0.0282  -0.0862 0.0096  456 ILE A O   
80   C CB  . ILE A 15  ? 1.0651 1.1626 0.9831 0.0398  -0.0443 -0.0227 456 ILE A CB  
81   C CG1 . ILE A 15  ? 1.0418 1.1196 1.0077 0.0453  -0.0337 -0.0487 456 ILE A CG1 
82   C CG2 . ILE A 15  ? 1.0761 1.1590 1.0019 0.0338  -0.0207 0.0098  456 ILE A CG2 
83   C CD1 . ILE A 15  ? 1.0174 1.0807 1.0633 0.0453  -0.0336 -0.0305 456 ILE A CD1 
84   N N   . THR A 16  ? 1.1425 1.3169 0.8965 0.0227  -0.0178 0.0148  457 THR A N   
85   C CA  . THR A 16  ? 1.1888 1.3768 0.9010 0.0041  -0.0217 0.0639  457 THR A CA  
86   C C   . THR A 16  ? 1.1469 1.2947 0.9129 -0.0101 -0.0193 0.1000  457 THR A C   
87   O O   . THR A 16  ? 1.1094 1.2458 0.9108 -0.0129 0.0028  0.0907  457 THR A O   
88   C CB  . THR A 16  ? 1.2243 1.4742 0.8779 -0.0025 0.0135  0.0726  457 THR A CB  
89   O OG1 . THR A 16  ? 1.2430 1.5206 0.8496 0.0234  0.0231  0.0218  457 THR A OG1 
90   C CG2 . THR A 16  ? 1.2904 1.5569 0.8820 -0.0249 0.0053  0.1281  457 THR A CG2 
91   N N   . VAL A 17  ? 1.1910 1.3088 0.9570 -0.0170 -0.0472 0.1398  458 VAL A N   
92   C CA  . VAL A 17  ? 1.1754 1.2347 0.9851 -0.0226 -0.0501 0.1685  458 VAL A CA  
93   C C   . VAL A 17  ? 1.2319 1.2867 1.0034 -0.0546 -0.0493 0.2200  458 VAL A C   
94   O O   . VAL A 17  ? 1.3009 1.3780 1.0211 -0.0674 -0.0653 0.2565  458 VAL A O   
95   C CB  . VAL A 17  ? 1.1761 1.1981 1.0312 -0.0024 -0.0830 0.1814  458 VAL A CB  
96   C CG1 . VAL A 17  ? 1.2010 1.1512 1.0861 -0.0001 -0.0862 0.2105  458 VAL A CG1 
97   C CG2 . VAL A 17  ? 1.1211 1.1519 1.0360 0.0213  -0.0791 0.1398  458 VAL A CG2 
98   N N   . GLY A 18  ? 1.2194 1.2418 1.0124 -0.0714 -0.0347 0.2260  459 GLY A N   
99   C CA  . GLY A 18  ? 1.2629 1.2757 1.0359 -0.1116 -0.0381 0.2788  459 GLY A CA  
100  C C   . GLY A 18  ? 1.3114 1.2178 1.1012 -0.1161 -0.0681 0.3082  459 GLY A C   
101  O O   . GLY A 18  ? 1.3163 1.1798 1.1191 -0.0882 -0.0910 0.3117  459 GLY A O   
102  N N   . GLN A 19  ? 1.3549 1.2155 1.1496 -0.1498 -0.0721 0.3287  460 GLN A N   
103  C CA  . GLN A 19  ? 1.4558 1.1971 1.2531 -0.1571 -0.1059 0.3580  460 GLN A CA  
104  C C   . GLN A 19  ? 1.4379 1.0907 1.2588 -0.1099 -0.1068 0.3094  460 GLN A C   
105  O O   . GLN A 19  ? 1.3904 1.0533 1.2201 -0.0941 -0.0826 0.2597  460 GLN A O   
106  C CB  . GLN A 19  ? 1.5329 1.2417 1.3264 -0.2143 -0.1184 0.3938  460 GLN A CB  
107  C CG  . GLN A 19  ? 1.6164 1.3830 1.3903 -0.2633 -0.1244 0.4687  460 GLN A CG  
108  C CD  . GLN A 19  ? 1.6705 1.4325 1.4617 -0.3294 -0.1346 0.5113  460 GLN A CD  
109  O OE1 . GLN A 19  ? 1.6706 1.4231 1.4881 -0.3401 -0.1327 0.4782  460 GLN A OE1 
110  N NE2 . GLN A 19  ? 1.7341 1.5052 1.5123 -0.3784 -0.1494 0.5908  460 GLN A NE2 
111  N N   . ARG A 20  ? 1.5018 1.0697 1.3322 -0.0845 -0.1328 0.3272  461 ARG A N   
112  C CA  . ARG A 20  ? 1.5155 0.9991 1.3696 -0.0323 -0.1261 0.2850  461 ARG A CA  
113  C C   . ARG A 20  ? 1.5684 0.9556 1.3898 -0.0476 -0.1253 0.2578  461 ARG A C   
114  O O   . ARG A 20  ? 1.6542 1.0042 1.4494 -0.1000 -0.1506 0.2888  461 ARG A O   
115  C CB  . ARG A 20  ? 1.5873 0.9963 1.4658 0.0018  -0.1569 0.3152  461 ARG A CB  
116  C CG  . ARG A 20  ? 1.5714 0.9600 1.5021 0.0723  -0.1356 0.2744  461 ARG A CG  
117  C CD  . ARG A 20  ? 1.6779 0.9627 1.6376 0.1158  -0.1632 0.2956  461 ARG A CD  
118  N NE  . ARG A 20  ? 1.7927 0.9259 1.7032 0.1116  -0.1756 0.2842  461 ARG A NE  
119  C CZ  . ARG A 20  ? 1.9061 0.9435 1.7841 0.0759  -0.2235 0.3308  461 ARG A CZ  
120  N NH1 . ARG A 20  ? 1.9116 0.9942 1.7957 0.0416  -0.2588 0.3985  461 ARG A NH1 
121  N NH2 . ARG A 20  ? 2.0170 0.9035 1.8480 0.0718  -0.2395 0.3111  461 ARG A NH2 
122  N N   . ILE A 21  ? 1.5496 0.8991 1.3698 -0.0059 -0.0982 0.2028  462 ILE A N   
123  C CA  . ILE A 21  ? 1.6324 0.8788 1.4006 -0.0157 -0.1012 0.1692  462 ILE A CA  
124  C C   . ILE A 21  ? 1.7416 0.8550 1.4900 0.0423  -0.0961 0.1360  462 ILE A C   
125  O O   . ILE A 21  ? 1.8789 0.8561 1.5710 0.0313  -0.1234 0.1248  462 ILE A O   
126  C CB  . ILE A 21  ? 1.5742 0.8899 1.3291 -0.0246 -0.0714 0.1312  462 ILE A CB  
127  C CG1 . ILE A 21  ? 1.5103 0.9442 1.2843 -0.0773 -0.0771 0.1615  462 ILE A CG1 
128  C CG2 . ILE A 21  ? 1.6599 0.8623 1.3470 -0.0310 -0.0802 0.0939  462 ILE A CG2 
129  C CD1 . ILE A 21  ? 1.5831 0.9839 1.3419 -0.1405 -0.1155 0.2013  462 ILE A CD1 
130  N N   . GLY A 22  ? 1.7160 0.8671 1.5125 0.1047  -0.0622 0.1198  463 GLY A N   
131  C CA  . GLY A 22  ? 1.8412 0.8846 1.6309 0.1729  -0.0444 0.0878  463 GLY A CA  
132  C C   . GLY A 22  ? 1.8089 0.9349 1.6923 0.2338  -0.0142 0.0939  463 GLY A C   
133  O O   . GLY A 22  ? 1.7065 0.9648 1.6411 0.2283  0.0078  0.0980  463 GLY A O   
134  N N   . SER A 23  ? 1.9348 0.9799 1.8469 0.2931  -0.0165 0.0942  464 SER A N   
135  C CA  . SER A 23  ? 1.9162 1.0462 1.9418 0.3463  -0.0044 0.1165  464 SER A CA  
136  C C   . SER A 23  ? 1.9992 1.0752 2.0527 0.4355  0.0457  0.0780  464 SER A C   
137  O O   . SER A 23  ? 2.1501 1.0734 2.1326 0.4652  0.0444  0.0480  464 SER A O   
138  C CB  . SER A 23  ? 1.9804 1.0876 2.0395 0.3323  -0.0683 0.1764  464 SER A CB  
139  O OG  . SER A 23  ? 1.9172 1.1612 2.0699 0.3352  -0.0803 0.2143  464 SER A OG  
140  N N   . GLY A 24  ? 1.9344 1.1360 2.0906 0.4773  0.0904  0.0788  465 GLY A N   
141  C CA  . GLY A 24  ? 2.0298 1.2202 2.2458 0.5702  0.1484  0.0538  465 GLY A CA  
142  C C   . GLY A 24  ? 1.9347 1.3057 2.2869 0.5886  0.1885  0.0727  465 GLY A C   
143  O O   . GLY A 24  ? 1.8518 1.3185 2.2008 0.5325  0.1922  0.0773  465 GLY A O   
144  N N   . SER A 25  ? 1.9506 1.3691 2.4294 0.6663  0.2168  0.0849  466 SER A N   
145  C CA  . SER A 25  ? 1.8474 1.4511 2.4902 0.6743  0.2347  0.1198  466 SER A CA  
146  C C   . SER A 25  ? 1.7875 1.4973 2.4290 0.6373  0.2881  0.1062  466 SER A C   
147  O O   . SER A 25  ? 1.7197 1.5726 2.4812 0.6135  0.2775  0.1407  466 SER A O   
148  C CB  . SER A 25  ? 1.8968 1.5426 2.6874 0.7725  0.2709  0.1325  466 SER A CB  
149  O OG  . SER A 25  ? 1.9687 1.5931 2.7324 0.8363  0.3680  0.0872  466 SER A OG  
150  N N   . PHE A 26  ? 1.8273 1.4610 2.3319 0.6278  0.3355  0.0597  467 PHE A N   
151  C CA  . PHE A 26  ? 1.6963 1.4103 2.1796 0.5851  0.3762  0.0516  467 PHE A CA  
152  C C   . PHE A 26  ? 1.5579 1.2966 1.9966 0.4955  0.3121  0.0647  467 PHE A C   
153  O O   . PHE A 26  ? 1.4599 1.2479 1.8731 0.4549  0.3311  0.0587  467 PHE A O   
154  C CB  . PHE A 26  ? 1.7830 1.4017 2.1214 0.6056  0.4427  0.0005  467 PHE A CB  
155  C CG  . PHE A 26  ? 1.9335 1.4757 2.2577 0.7002  0.5029  -0.0294 467 PHE A CG  
156  C CD1 . PHE A 26  ? 2.0563 1.4190 2.2090 0.7201  0.5054  -0.0821 467 PHE A CD1 
157  C CD2 . PHE A 26  ? 1.9298 1.5775 2.4144 0.7713  0.5545  -0.0065 467 PHE A CD2 
158  C CE1 . PHE A 26  ? 2.2114 1.4868 2.3355 0.8136  0.5601  -0.1186 467 PHE A CE1 
159  C CE2 . PHE A 26  ? 2.0675 1.6459 2.5400 0.8692  0.6164  -0.0383 467 PHE A CE2 
160  C CZ  . PHE A 26  ? 2.2170 1.6013 2.5001 0.8929  0.6204  -0.0983 467 PHE A CZ  
161  N N   . GLY A 27  ? 1.5318 1.2336 1.9582 0.4685  0.2392  0.0841  468 GLY A N   
162  C CA  . GLY A 27  ? 1.4352 1.1612 1.8156 0.3934  0.1834  0.0960  468 GLY A CA  
163  C C   . GLY A 27  ? 1.4640 1.0846 1.7433 0.3632  0.1318  0.0979  468 GLY A C   
164  O O   . GLY A 27  ? 1.5508 1.0571 1.7811 0.3936  0.1326  0.0859  468 GLY A O   
165  N N   . THR A 28  ? 1.3759 1.0345 1.6245 0.3028  0.0877  0.1140  469 THR A N   
166  C CA  . THR A 28  ? 1.3980 0.9837 1.5578 0.2613  0.0440  0.1253  469 THR A CA  
167  C C   . THR A 28  ? 1.3166 0.9258 1.4033 0.2066  0.0479  0.1069  469 THR A C   
168  O O   . THR A 28  ? 1.2283 0.9277 1.3436 0.1904  0.0560  0.1018  469 THR A O   
169  C CB  . THR A 28  ? 1.4005 1.0222 1.5960 0.2448  -0.0136 0.1738  469 THR A CB  
170  O OG1 . THR A 28  ? 1.4643 1.0952 1.7573 0.2992  -0.0213 0.1951  469 THR A OG1 
171  C CG2 . THR A 28  ? 1.4564 0.9935 1.5698 0.2077  -0.0524 0.1974  469 THR A CG2 
172  N N   . VAL A 29  ? 1.3396 0.8655 1.3396 0.1784  0.0372  0.0984  470 VAL A N   
173  C CA  . VAL A 29  ? 1.2767 0.8249 1.2198 0.1330  0.0407  0.0823  470 VAL A CA  
174  C C   . VAL A 29  ? 1.2440 0.8122 1.1595 0.0812  0.0021  0.1142  470 VAL A C   
175  O O   . VAL A 29  ? 1.3101 0.8053 1.1974 0.0654  -0.0260 0.1376  470 VAL A O   
176  C CB  . VAL A 29  ? 1.3508 0.8012 1.2185 0.1357  0.0580  0.0479  470 VAL A CB  
177  C CG1 . VAL A 29  ? 1.3194 0.8060 1.1459 0.0923  0.0567  0.0359  470 VAL A CG1 
178  C CG2 . VAL A 29  ? 1.3792 0.8092 1.2590 0.1916  0.1071  0.0185  470 VAL A CG2 
179  N N   . TYR A 30  ? 1.1565 0.8216 1.0794 0.0560  0.0029  0.1161  471 TYR A N   
180  C CA  . TYR A 30  ? 1.1528 0.8598 1.0497 0.0120  -0.0198 0.1461  471 TYR A CA  
181  C C   . TYR A 30  ? 1.0789 0.8291 0.9524 -0.0159 -0.0063 0.1278  471 TYR A C   
182  O O   . TYR A 30  ? 1.0182 0.7922 0.9012 -0.0008 0.0153  0.0945  471 TYR A O   
183  C CB  . TYR A 30  ? 1.1279 0.9185 1.0462 0.0141  -0.0323 0.1646  471 TYR A CB  
184  C CG  . TYR A 30  ? 1.1810 0.9519 1.1344 0.0396  -0.0570 0.1918  471 TYR A CG  
185  C CD1 . TYR A 30  ? 1.1563 0.9471 1.1749 0.0790  -0.0500 0.1759  471 TYR A CD1 
186  C CD2 . TYR A 30  ? 1.2767 1.0184 1.2069 0.0221  -0.0905 0.2406  471 TYR A CD2 
187  C CE1 . TYR A 30  ? 1.2131 0.9994 1.2822 0.1049  -0.0777 0.2051  471 TYR A CE1 
188  C CE2 . TYR A 30  ? 1.3281 1.0518 1.2949 0.0483  -0.1211 0.2704  471 TYR A CE2 
189  C CZ  . TYR A 30  ? 1.2851 1.0344 1.3262 0.0918  -0.1158 0.2511  471 TYR A CZ  
190  O OH  . TYR A 30  ? 1.3193 1.0628 1.4154 0.1208  -0.1501 0.2836  471 TYR A OH  
191  N N   . LYS A 31  ? 1.1019 0.8678 0.9534 -0.0573 -0.0200 0.1557  472 LYS A N   
192  C CA  . LYS A 31  ? 1.0594 0.9005 0.9101 -0.0802 -0.0078 0.1476  472 LYS A CA  
193  C C   . LYS A 31  ? 1.0286 0.9658 0.8850 -0.0708 0.0030  0.1487  472 LYS A C   
194  O O   . LYS A 31  ? 1.0933 1.0474 0.9361 -0.0772 -0.0087 0.1806  472 LYS A O   
195  C CB  . LYS A 31  ? 1.1057 0.9483 0.9488 -0.1294 -0.0239 0.1851  472 LYS A CB  
196  C CG  . LYS A 31  ? 1.0619 1.0106 0.9251 -0.1476 -0.0074 0.1851  472 LYS A CG  
197  C CD  . LYS A 31  ? 1.1099 1.0683 0.9887 -0.2011 -0.0250 0.2259  472 LYS A CD  
198  C CE  . LYS A 31  ? 1.0682 1.1397 0.9879 -0.2100 -0.0065 0.2229  472 LYS A CE  
199  N NZ  . LYS A 31  ? 1.1165 1.1795 1.0681 -0.2593 -0.0346 0.2493  472 LYS A NZ  
200  N N   . GLY A 32  ? 0.9763 0.9662 0.8433 -0.0552 0.0211  0.1139  473 GLY A N   
201  C CA  . GLY A 32  ? 0.9487 1.0100 0.8080 -0.0410 0.0274  0.1027  473 GLY A CA  
202  C C   . GLY A 32  ? 0.9275 1.0561 0.7896 -0.0384 0.0473  0.0802  473 GLY A C   
203  O O   . GLY A 32  ? 0.9168 1.0456 0.7984 -0.0492 0.0530  0.0777  473 GLY A O   
204  N N   . LYS A 33  ? 0.9565 1.1376 0.7963 -0.0214 0.0535  0.0629  474 LYS A N   
205  C CA  . LYS A 33  ? 0.9380 1.1789 0.7789 -0.0048 0.0742  0.0338  474 LYS A CA  
206  C C   . LYS A 33  ? 0.9309 1.1457 0.7737 0.0253  0.0647  -0.0136 474 LYS A C   
207  O O   . LYS A 33  ? 0.9562 1.1556 0.7738 0.0330  0.0460  -0.0228 474 LYS A O   
208  C CB  . LYS A 33  ? 1.0019 1.3202 0.7992 -0.0067 0.0937  0.0498  474 LYS A CB  
209  C CG  . LYS A 33  ? 1.0350 1.4041 0.8494 -0.0413 0.1102  0.1011  474 LYS A CG  
210  C CD  . LYS A 33  ? 1.0202 1.4396 0.8947 -0.0395 0.1280  0.0929  474 LYS A CD  
211  C CE  . LYS A 33  ? 1.0620 1.5865 0.9585 -0.0628 0.1577  0.1376  474 LYS A CE  
212  N NZ  . LYS A 33  ? 1.0386 1.6398 1.0002 -0.0428 0.1793  0.1203  474 LYS A NZ  
213  N N   . TRP A 34  ? 1.1623 0.9045 0.7961 -0.0753 0.1031  -0.0202 475 TRP A N   
214  C CA  . TRP A 34  ? 1.1465 0.8995 0.8010 -0.0732 0.0888  -0.0294 475 TRP A CA  
215  C C   . TRP A 34  ? 1.0908 0.8754 0.8007 -0.0654 0.1151  -0.0456 475 TRP A C   
216  O O   . TRP A 34  ? 1.0284 0.8505 0.7995 -0.0521 0.1129  -0.0398 475 TRP A O   
217  C CB  . TRP A 34  ? 1.1076 0.8851 0.8023 -0.0646 0.0508  -0.0148 475 TRP A CB  
218  C CG  . TRP A 34  ? 1.0802 0.8613 0.7887 -0.0672 0.0370  -0.0247 475 TRP A CG  
219  C CD1 . TRP A 34  ? 1.1407 0.8875 0.7979 -0.0791 0.0212  -0.0326 475 TRP A CD1 
220  C CD2 . TRP A 34  ? 1.0276 0.8422 0.7996 -0.0592 0.0375  -0.0279 475 TRP A CD2 
221  N NE1 . TRP A 34  ? 1.1073 0.8677 0.7980 -0.0797 0.0126  -0.0413 475 TRP A NE1 
222  C CE2 . TRP A 34  ? 1.0449 0.8444 0.8039 -0.0678 0.0235  -0.0379 475 TRP A CE2 
223  C CE3 . TRP A 34  ? 0.9536 0.8029 0.7852 -0.0466 0.0483  -0.0233 475 TRP A CE3 
224  C CZ2 . TRP A 34  ? 1.0028 0.8194 0.8066 -0.0652 0.0224  -0.0427 475 TRP A CZ2 
225  C CZ3 . TRP A 34  ? 0.9092 0.7717 0.7790 -0.0432 0.0460  -0.0273 475 TRP A CZ3 
226  C CH2 . TRP A 34  ? 0.9390 0.7844 0.7949 -0.0528 0.0344  -0.0366 475 TRP A CH2 
227  N N   . HIS A 35  ? 1.1205 0.8854 0.8051 -0.0729 0.1392  -0.0669 476 HIS A N   
228  C CA  . HIS A 35  ? 1.0767 0.8661 0.8103 -0.0641 0.1653  -0.0867 476 HIS A CA  
229  C C   . HIS A 35  ? 1.0604 0.8792 0.8354 -0.0571 0.1827  -0.0848 476 HIS A C   
230  O O   . HIS A 35  ? 1.0066 0.8606 0.8427 -0.0414 0.1781  -0.0840 476 HIS A O   
231  C CB  . HIS A 35  ? 1.0111 0.8195 0.7894 -0.0516 0.1468  -0.0877 476 HIS A CB  
232  C CG  . HIS A 35  ? 1.0264 0.8048 0.7662 -0.0608 0.1327  -0.0935 476 HIS A CG  
233  N ND1 . HIS A 35  ? 1.0762 0.8229 0.7735 -0.0705 0.1523  -0.1146 476 HIS A ND1 
234  C CD2 . HIS A 35  ? 1.0072 0.7819 0.7452 -0.0637 0.1020  -0.0831 476 HIS A CD2 
235  C CE1 . HIS A 35  ? 1.0979 0.8199 0.7644 -0.0783 0.1320  -0.1160 476 HIS A CE1 
236  N NE2 . HIS A 35  ? 1.0639 0.8041 0.7571 -0.0748 0.1008  -0.0975 476 HIS A NE2 
237  N N   . GLY A 36  ? 1.1030 0.9008 0.8372 -0.0704 0.2019  -0.0840 477 GLY A N   
238  C CA  . GLY A 36  ? 1.1068 0.9258 0.8710 -0.0687 0.2190  -0.0815 477 GLY A CA  
239  C C   . GLY A 36  ? 1.1228 0.9366 0.8721 -0.0675 0.1959  -0.0540 477 GLY A C   
240  O O   . GLY A 36  ? 1.1812 0.9690 0.8873 -0.0706 0.1693  -0.0386 477 GLY A O   
241  N N   . ASP A 37  ? 1.1054 0.9443 0.8938 -0.0620 0.2043  -0.0497 478 ASP A N   
242  C CA  . ASP A 37  ? 1.0988 0.9325 0.8779 -0.0595 0.1866  -0.0260 478 ASP A CA  
243  C C   . ASP A 37  ? 1.0362 0.8973 0.8573 -0.0428 0.1538  -0.0110 478 ASP A C   
244  O O   . ASP A 37  ? 1.0226 0.9173 0.8988 -0.0308 0.1534  -0.0174 478 ASP A O   
245  C CB  . ASP A 37  ? 1.1242 0.9744 0.9325 -0.0607 0.2094  -0.0293 478 ASP A CB  
246  C CG  . ASP A 37  ? 1.2447 1.0646 1.0106 -0.0817 0.2469  -0.0431 478 ASP A CG  
247  O OD1 . ASP A 37  ? 1.3558 1.1280 1.0489 -0.0962 0.2521  -0.0424 478 ASP A OD1 
248  O OD2 . ASP A 37  ? 1.2686 1.1102 1.0728 -0.0851 0.2721  -0.0557 478 ASP A OD2 
249  N N   . VAL A 38  ? 1.0374 0.8812 0.8319 -0.0421 0.1268  0.0080  479 VAL A N   
250  C CA  . VAL A 38  ? 0.9631 0.8334 0.8012 -0.0286 0.0997  0.0212  479 VAL A CA  
251  C C   . VAL A 38  ? 0.9550 0.8172 0.7862 -0.0240 0.0842  0.0401  479 VAL A C   
252  O O   . VAL A 38  ? 1.0095 0.8350 0.7878 -0.0317 0.0864  0.0461  479 VAL A O   
253  C CB  . VAL A 38  ? 0.9881 0.8541 0.8197 -0.0299 0.0754  0.0208  479 VAL A CB  
254  C CG1 . VAL A 38  ? 1.0018 0.8750 0.8458 -0.0316 0.0892  0.0025  479 VAL A CG1 
255  C CG2 . VAL A 38  ? 1.0565 0.8795 0.8202 -0.0400 0.0582  0.0260  479 VAL A CG2 
256  N N   . ALA A 39  ? 0.9044 0.7967 0.7869 -0.0116 0.0706  0.0487  480 ALA A N   
257  C CA  . ALA A 39  ? 0.8999 0.7884 0.7864 -0.0040 0.0491  0.0649  480 ALA A CA  
258  C C   . ALA A 39  ? 0.8966 0.7905 0.7936 -0.0018 0.0178  0.0676  480 ALA A C   
259  O O   . ALA A 39  ? 0.8585 0.7724 0.7831 -0.0035 0.0173  0.0590  480 ALA A O   
260  C CB  . ALA A 39  ? 0.8550 0.7730 0.7937 0.0071  0.0570  0.0694  480 ALA A CB  
261  N N   . VAL A 40  ? 0.9532 0.8274 0.8292 0.0020  -0.0096 0.0785  481 VAL A N   
262  C CA  . VAL A 40  ? 0.9940 0.8724 0.8811 0.0040  -0.0454 0.0790  481 VAL A CA  
263  C C   . VAL A 40  ? 1.0130 0.9040 0.9377 0.0192  -0.0713 0.0899  481 VAL A C   
264  O O   . VAL A 40  ? 1.0641 0.9209 0.9485 0.0248  -0.0843 0.1007  481 VAL A O   
265  C CB  . VAL A 40  ? 1.0938 0.9223 0.9011 -0.0060 -0.0629 0.0782  481 VAL A CB  
266  C CG1 . VAL A 40  ? 1.1370 0.9673 0.9544 -0.0029 -0.1076 0.0781  481 VAL A CG1 
267  C CG2 . VAL A 40  ? 1.1215 0.9382 0.8960 -0.0207 -0.0360 0.0641  481 VAL A CG2 
268  N N   . LYS A 41  ? 0.9739 0.9100 0.9743 0.0255  -0.0770 0.0861  482 LYS A N   
269  C CA  . LYS A 41  ? 0.9839 0.9390 1.0342 0.0407  -0.1014 0.0918  482 LYS A CA  
270  C C   . LYS A 41  ? 1.0122 0.9691 1.0718 0.0410  -0.1438 0.0870  482 LYS A C   
271  O O   . LYS A 41  ? 1.0096 0.9833 1.0865 0.0298  -0.1451 0.0759  482 LYS A O   
272  C CB  . LYS A 41  ? 0.9552 0.9576 1.0851 0.0452  -0.0802 0.0871  482 LYS A CB  
273  C CG  . LYS A 41  ? 0.9634 0.9876 1.1515 0.0618  -0.0960 0.0903  482 LYS A CG  
274  C CD  . LYS A 41  ? 0.9178 0.9851 1.1806 0.0625  -0.0700 0.0829  482 LYS A CD  
275  C CE  . LYS A 41  ? 0.9167 0.9771 1.1691 0.0663  -0.0358 0.0885  482 LYS A CE  
276  N NZ  . LYS A 41  ? 0.8885 0.9808 1.2018 0.0666  -0.0104 0.0815  482 LYS A NZ  
277  N N   . MET A 42  ? 1.1070 1.0442 1.1550 0.0543  -0.1808 0.0946  483 MET A N   
278  C CA  . MET A 42  ? 1.1922 1.1257 1.2435 0.0567  -0.2304 0.0895  483 MET A CA  
279  C C   . MET A 42  ? 1.2210 1.1808 1.3426 0.0782  -0.2654 0.0898  483 MET A C   
280  O O   . MET A 42  ? 1.2188 1.1722 1.3477 0.0931  -0.2587 0.0996  483 MET A O   
281  C CB  . MET A 42  ? 1.2786 1.1412 1.2186 0.0521  -0.2529 0.0975  483 MET A CB  
282  C CG  . MET A 42  ? 1.3188 1.1606 1.2031 0.0308  -0.2411 0.0886  483 MET A CG  
283  S SD  . MET A 42  ? 1.4997 1.2575 1.2594 0.0255  -0.2803 0.0940  483 MET A SD  
284  C CE  . MET A 42  ? 1.5219 1.2835 1.2654 0.0033  -0.2769 0.0754  483 MET A CE  
285  N N   . LEU A 43  ? 1.2533 1.2432 1.4303 0.0801  -0.3031 0.0773  484 LEU A N   
286  C CA  . LEU A 43  ? 1.2904 1.2994 1.5294 0.1030  -0.3477 0.0751  484 LEU A CA  
287  C C   . LEU A 43  ? 1.3952 1.3409 1.5493 0.1122  -0.4027 0.0841  484 LEU A C   
288  O O   . LEU A 43  ? 1.4498 1.3732 1.5571 0.0995  -0.4269 0.0785  484 LEU A O   
289  C CB  . LEU A 43  ? 1.2888 1.3671 1.6433 0.1006  -0.3626 0.0533  484 LEU A CB  
290  C CG  . LEU A 43  ? 1.2554 1.3967 1.7254 0.1092  -0.3352 0.0441  484 LEU A CG  
291  C CD1 . LEU A 43  ? 1.2675 1.3987 1.7531 0.1379  -0.3520 0.0535  484 LEU A CD1 
292  C CD2 . LEU A 43  ? 1.2148 1.3691 1.6845 0.0922  -0.2689 0.0453  484 LEU A CD2 
293  N N   . ASN A 44  ? 1.4555 1.3655 1.5833 0.1341  -0.4229 0.0980  485 ASN A N   
294  C CA  . ASN A 44  ? 1.5855 1.4182 1.6129 0.1436  -0.4742 0.1101  485 ASN A CA  
295  C C   . ASN A 44  ? 1.6181 1.4665 1.7026 0.1664  -0.5466 0.1009  485 ASN A C   
296  O O   . ASN A 44  ? 1.6644 1.4880 1.7503 0.1934  -0.5821 0.1096  485 ASN A O   
297  C CB  . ASN A 44  ? 1.6442 1.4124 1.5913 0.1529  -0.4584 0.1316  485 ASN A CB  
298  C CG  . ASN A 44  ? 1.7074 1.4110 1.5300 0.1285  -0.4216 0.1419  485 ASN A CG  
299  O OD1 . ASN A 44  ? 1.8477 1.4671 1.5583 0.1294  -0.4406 0.1562  485 ASN A OD1 
300  N ND2 . ASN A 44  ? 1.6353 1.3748 1.4760 0.1065  -0.3687 0.1336  485 ASN A ND2 
301  N N   . VAL A 45  ? 1.5901 1.4790 1.7239 0.1557  -0.5697 0.0819  486 VAL A N   
302  C CA  . VAL A 45  ? 1.6340 1.5406 1.8241 0.1741  -0.6440 0.0687  486 VAL A CA  
303  C C   . VAL A 45  ? 1.6573 1.5603 1.8205 0.1531  -0.6704 0.0547  486 VAL A C   
304  O O   . VAL A 45  ? 1.6151 1.5206 1.7466 0.1250  -0.6249 0.0516  486 VAL A O   
305  C CB  . VAL A 45  ? 1.5593 1.5632 1.9204 0.1888  -0.6448 0.0485  486 VAL A CB  
306  C CG1 . VAL A 45  ? 1.5694 1.5652 1.9614 0.2230  -0.6623 0.0578  486 VAL A CG1 
307  C CG2 . VAL A 45  ? 1.4582 1.5258 1.8884 0.1652  -0.5702 0.0388  486 VAL A CG2 
308  N N   . THR A 46  ? 1.7363 1.6314 1.9125 0.1680  -0.7469 0.0451  487 THR A N   
309  C CA  . THR A 46  ? 1.7797 1.6751 1.9413 0.1493  -0.7806 0.0282  487 THR A CA  
310  C C   . THR A 46  ? 1.6852 1.6843 1.9951 0.1331  -0.7551 0.0008  487 THR A C   
311  O O   . THR A 46  ? 1.6284 1.6386 1.9236 0.1042  -0.7035 -0.0033 487 THR A O   
312  C CB  . THR A 46  ? 1.8842 1.7351 2.0107 0.1711  -0.8769 0.0252  487 THR A CB  
313  O OG1 . THR A 46  ? 1.8458 1.7579 2.1064 0.2022  -0.9188 0.0130  487 THR A OG1 
314  C CG2 . THR A 46  ? 1.9865 1.7170 1.9401 0.1807  -0.8960 0.0536  487 THR A CG2 
315  N N   . ALA A 47  ? 1.6680 1.7394 2.1195 0.1514  -0.7882 -0.0182 488 ALA A N   
316  C CA  . ALA A 47  ? 1.5543 1.7243 2.1550 0.1347  -0.7613 -0.0464 488 ALA A CA  
317  C C   . ALA A 47  ? 1.4511 1.6801 2.1495 0.1403  -0.6980 -0.0463 488 ALA A C   
318  O O   . ALA A 47  ? 1.4768 1.7254 2.2379 0.1698  -0.7175 -0.0460 488 ALA A O   
319  C CB  . ALA A 47  ? 1.5772 1.7956 2.2834 0.1468  -0.8363 -0.0741 488 ALA A CB  
320  N N   . PRO A 48  ? 1.3281 1.5804 2.0358 0.1131  -0.6235 -0.0471 489 PRO A N   
321  C CA  . PRO A 48  ? 1.2215 1.5197 2.0060 0.1159  -0.5619 -0.0468 489 PRO A CA  
322  C C   . PRO A 48  ? 1.1637 1.5537 2.1183 0.1169  -0.5610 -0.0770 489 PRO A C   
323  O O   . PRO A 48  ? 1.1392 1.5669 2.1583 0.1036  -0.5903 -0.1010 489 PRO A O   
324  C CB  . PRO A 48  ? 1.1711 1.4538 1.8967 0.0855  -0.4928 -0.0391 489 PRO A CB  
325  C CG  . PRO A 48  ? 1.1998 1.4684 1.8880 0.0622  -0.5152 -0.0498 489 PRO A CG  
326  C CD  . PRO A 48  ? 1.3017 1.5332 1.9446 0.0796  -0.5949 -0.0489 489 PRO A CD  
327  N N   . THR A 49  ? 1.1244 1.5490 2.1510 0.1306  -0.5246 -0.0777 490 THR A N   
328  C CA  . THR A 49  ? 1.0911 1.6028 2.2832 0.1317  -0.5141 -0.1081 490 THR A CA  
329  C C   . THR A 49  ? 1.0378 1.5879 2.2761 0.0939  -0.4450 -0.1227 490 THR A C   
330  O O   . THR A 49  ? 1.0537 1.5614 2.1955 0.0726  -0.4033 -0.1062 490 THR A O   
331  C CB  . THR A 49  ? 1.0647 1.5937 2.3129 0.1607  -0.4966 -0.1048 490 THR A CB  
332  O OG1 . THR A 49  ? 1.0198 1.5167 2.1972 0.1513  -0.4274 -0.0839 490 THR A OG1 
333  C CG2 . THR A 49  ? 1.1219 1.6089 2.3295 0.2002  -0.5666 -0.0912 490 THR A CG2 
334  N N   . PRO A 50  ? 0.9880 1.6157 2.3744 0.0854  -0.4325 -0.1549 491 PRO A N   
335  C CA  . PRO A 50  ? 0.9261 1.5827 2.3542 0.0498  -0.3586 -0.1677 491 PRO A CA  
336  C C   . PRO A 50  ? 0.8906 1.5223 2.2719 0.0477  -0.2852 -0.1492 491 PRO A C   
337  O O   . PRO A 50  ? 0.8894 1.5036 2.2290 0.0187  -0.2309 -0.1454 491 PRO A O   
338  C CB  . PRO A 50  ? 0.9123 1.6569 2.5163 0.0468  -0.3627 -0.2073 491 PRO A CB  
339  C CG  . PRO A 50  ? 0.9613 1.7207 2.6016 0.0703  -0.4538 -0.2183 491 PRO A CG  
340  C CD  . PRO A 50  ? 0.9998 1.6882 2.5166 0.1034  -0.4924 -0.1840 491 PRO A CD  
341  N N   . GLN A 51  ? 0.8855 1.5108 2.2694 0.0782  -0.2860 -0.1381 492 GLN A N   
342  C CA  . GLN A 51  ? 0.8515 1.4517 2.1906 0.0774  -0.2205 -0.1219 492 GLN A CA  
343  C C   . GLN A 51  ? 0.8649 1.3891 2.0485 0.0750  -0.2107 -0.0886 492 GLN A C   
344  O O   . GLN A 51  ? 0.8460 1.3467 1.9806 0.0612  -0.1538 -0.0781 492 GLN A O   
345  C CB  . GLN A 51  ? 0.8436 1.4605 2.2388 0.1105  -0.2233 -0.1231 492 GLN A CB  
346  C CG  . GLN A 51  ? 0.8376 1.5318 2.3934 0.1104  -0.2028 -0.1581 492 GLN A CG  
347  C CD  . GLN A 51  ? 0.8609 1.6100 2.5261 0.1211  -0.2683 -0.1846 492 GLN A CD  
348  O OE1 . GLN A 51  ? 0.8886 1.6117 2.5004 0.1308  -0.3340 -0.1750 492 GLN A OE1 
349  N NE2 . GLN A 51  ? 0.8481 1.6725 2.6678 0.1189  -0.2505 -0.2202 492 GLN A NE2 
350  N N   . GLN A 52  ? 0.8969 1.3808 2.0031 0.0888  -0.2661 -0.0732 493 GLN A N   
351  C CA  . GLN A 52  ? 0.8990 1.3135 1.8637 0.0848  -0.2574 -0.0454 493 GLN A CA  
352  C C   . GLN A 52  ? 0.8722 1.2715 1.7878 0.0532  -0.2378 -0.0470 493 GLN A C   
353  O O   . GLN A 52  ? 0.8405 1.1990 1.6696 0.0432  -0.2027 -0.0309 493 GLN A O   
354  C CB  . GLN A 52  ? 0.9650 1.3344 1.8570 0.1068  -0.3191 -0.0300 493 GLN A CB  
355  C CG  . GLN A 52  ? 0.9842 1.3485 1.8970 0.1404  -0.3407 -0.0228 493 GLN A CG  
356  C CD  . GLN A 52  ? 1.0674 1.3932 1.9318 0.1619  -0.4143 -0.0146 493 GLN A CD  
357  O OE1 . GLN A 52  ? 1.0774 1.4267 1.9890 0.1634  -0.4646 -0.0308 493 GLN A OE1 
358  N NE2 . GLN A 52  ? 1.1110 1.3727 1.8766 0.1775  -0.4218 0.0100  493 GLN A NE2 
359  N N   . LEU A 53  ? 0.8679 1.2988 1.8398 0.0386  -0.2630 -0.0676 494 LEU A N   
360  C CA  . LEU A 53  ? 0.8730 1.2892 1.8055 0.0080  -0.2449 -0.0719 494 LEU A CA  
361  C C   . LEU A 53  ? 0.8286 1.2567 1.7859 -0.0139 -0.1755 -0.0769 494 LEU A C   
362  O O   . LEU A 53  ? 0.8181 1.2080 1.6997 -0.0306 -0.1454 -0.0671 494 LEU A O   
363  C CB  . LEU A 53  ? 0.9031 1.3525 1.8990 -0.0036 -0.2891 -0.0958 494 LEU A CB  
364  C CG  . LEU A 53  ? 0.9209 1.3491 1.8713 -0.0345 -0.2804 -0.1017 494 LEU A CG  
365  C CD1 . LEU A 53  ? 0.9569 1.3175 1.7729 -0.0310 -0.3034 -0.0816 494 LEU A CD1 
366  C CD2 . LEU A 53  ? 0.9491 1.4245 1.9931 -0.0486 -0.3167 -0.1314 494 LEU A CD2 
367  N N   . GLN A 54  ? 0.8112 1.2886 1.8725 -0.0133 -0.1503 -0.0930 495 GLN A N   
368  C CA  . GLN A 54  ? 0.7872 1.2685 1.8665 -0.0351 -0.0825 -0.0982 495 GLN A CA  
369  C C   . GLN A 54  ? 0.7701 1.2002 1.7519 -0.0279 -0.0467 -0.0729 495 GLN A C   
370  O O   . GLN A 54  ? 0.7767 1.1740 1.7022 -0.0469 -0.0083 -0.0669 495 GLN A O   
371  C CB  . GLN A 54  ? 0.7798 1.3208 1.9870 -0.0341 -0.0594 -0.1214 495 GLN A CB  
372  C CG  . GLN A 54  ? 0.7768 1.3196 2.0065 -0.0640 0.0116  -0.1321 495 GLN A CG  
373  C CD  . GLN A 54  ? 0.7850 1.3158 1.9984 -0.0984 0.0217  -0.1412 495 GLN A CD  
374  O OE1 . GLN A 54  ? 0.7763 1.3490 2.0696 -0.1114 -0.0028 -0.1646 495 GLN A OE1 
375  N NE2 . GLN A 54  ? 0.7849 1.2567 1.8956 -0.1123 0.0553  -0.1237 495 GLN A NE2 
376  N N   . ALA A 55  ? 0.7786 1.2001 1.7416 0.0001  -0.0619 -0.0592 496 ALA A N   
377  C CA  . ALA A 55  ? 0.7800 1.1583 1.6619 0.0087  -0.0309 -0.0378 496 ALA A CA  
378  C C   . ALA A 55  ? 0.7852 1.1097 1.5516 0.0045  -0.0381 -0.0189 496 ALA A C   
379  O O   . ALA A 55  ? 0.7689 1.0591 1.4711 0.0031  -0.0059 -0.0058 496 ALA A O   
380  C CB  . ALA A 55  ? 0.7817 1.1644 1.6785 0.0386  -0.0481 -0.0302 496 ALA A CB  
381  N N   . PHE A 56  ? 0.8016 1.1190 1.5444 0.0032  -0.0813 -0.0196 497 PHE A N   
382  C CA  . PHE A 56  ? 0.7938 1.0638 1.4365 -0.0033 -0.0876 -0.0071 497 PHE A CA  
383  C C   . PHE A 56  ? 0.7893 1.0487 1.4178 -0.0283 -0.0522 -0.0134 497 PHE A C   
384  O O   . PHE A 56  ? 0.7873 1.0103 1.3476 -0.0310 -0.0265 -0.0023 497 PHE A O   
385  C CB  . PHE A 56  ? 0.8232 1.0863 1.4469 0.0004  -0.1430 -0.0094 497 PHE A CB  
386  C CG  . PHE A 56  ? 0.8375 1.0575 1.3724 -0.0119 -0.1473 -0.0041 497 PHE A CG  
387  C CD1 . PHE A 56  ? 0.8426 1.0175 1.2866 -0.0033 -0.1449 0.0127  497 PHE A CD1 
388  C CD2 . PHE A 56  ? 0.8492 1.0736 1.3946 -0.0331 -0.1526 -0.0184 497 PHE A CD2 
389  C CE1 . PHE A 56  ? 0.8579 0.9951 1.2262 -0.0145 -0.1456 0.0143  497 PHE A CE1 
390  C CE2 . PHE A 56  ? 0.8560 1.0389 1.3207 -0.0433 -0.1556 -0.0154 497 PHE A CE2 
391  C CZ  . PHE A 56  ? 0.8694 1.0099 1.2471 -0.0333 -0.1514 0.0003  497 PHE A CZ  
392  N N   . LYS A 57  ? 0.7962 1.0862 1.4918 -0.0464 -0.0519 -0.0323 498 LYS A N   
393  C CA  . LYS A 57  ? 0.8131 1.0899 1.5016 -0.0723 -0.0156 -0.0397 498 LYS A CA  
394  C C   . LYS A 57  ? 0.8087 1.0705 1.4867 -0.0753 0.0372  -0.0336 498 LYS A C   
395  O O   . LYS A 57  ? 0.8407 1.0654 1.4672 -0.0889 0.0653  -0.0299 498 LYS A O   
396  C CB  . LYS A 57  ? 0.8295 1.1469 1.6062 -0.0929 -0.0218 -0.0639 498 LYS A CB  
397  C CG  . LYS A 57  ? 0.8827 1.2045 1.6562 -0.0953 -0.0743 -0.0718 498 LYS A CG  
398  C CD  . LYS A 57  ? 0.9163 1.2812 1.7834 -0.1176 -0.0821 -0.0987 498 LYS A CD  
399  C CE  . LYS A 57  ? 0.9643 1.3188 1.8057 -0.1248 -0.1306 -0.1062 498 LYS A CE  
400  N NZ  . LYS A 57  ? 1.0005 1.4058 1.9464 -0.1431 -0.1499 -0.1352 498 LYS A NZ  
401  N N   . ASN A 58  ? 0.7943 1.0799 1.5168 -0.0616 0.0490  -0.0332 499 ASN A N   
402  C CA  . ASN A 58  ? 0.7937 1.0600 1.4984 -0.0631 0.0970  -0.0275 499 ASN A CA  
403  C C   . ASN A 58  ? 0.7954 1.0164 1.4069 -0.0492 0.1003  -0.0070 499 ASN A C   
404  O O   . ASN A 58  ? 0.8496 1.0353 1.4142 -0.0565 0.1334  -0.0016 499 ASN A O   
405  C CB  . ASN A 58  ? 0.8096 1.1140 1.5905 -0.0521 0.1092  -0.0354 499 ASN A CB  
406  C CG  . ASN A 58  ? 0.8425 1.1897 1.7224 -0.0719 0.1288  -0.0600 499 ASN A CG  
407  O OD1 . ASN A 58  ? 0.8660 1.1969 1.7388 -0.0985 0.1615  -0.0676 499 ASN A OD1 
408  N ND2 . ASN A 58  ? 0.8483 1.2487 1.8227 -0.0594 0.1093  -0.0741 499 ASN A ND2 
409  N N   . GLU A 59  ? 0.7839 1.0033 1.3683 -0.0296 0.0658  0.0032  500 GLU A N   
410  C CA  . GLU A 59  ? 0.7446 0.9259 1.2483 -0.0177 0.0679  0.0198  500 GLU A CA  
411  C C   . GLU A 59  ? 0.7620 0.9090 1.2039 -0.0292 0.0703  0.0217  500 GLU A C   
412  O O   . GLU A 59  ? 0.7648 0.8805 1.1593 -0.0297 0.0931  0.0278  500 GLU A O   
413  C CB  . GLU A 59  ? 0.7462 0.9295 1.2342 0.0014  0.0327  0.0286  500 GLU A CB  
414  C CG  . GLU A 59  ? 0.7562 0.9074 1.1773 0.0130  0.0409  0.0429  500 GLU A CG  
415  C CD  . GLU A 59  ? 0.7948 0.9419 1.2001 0.0299  0.0128  0.0517  500 GLU A CD  
416  O OE1 . GLU A 59  ? 0.8240 0.9926 1.2730 0.0372  -0.0144 0.0481  500 GLU A OE1 
417  O OE2 . GLU A 59  ? 0.7957 0.9156 1.1446 0.0359  0.0172  0.0616  500 GLU A OE2 
418  N N   . VAL A 60  ? 0.7915 0.9430 1.2353 -0.0376 0.0446  0.0151  501 VAL A N   
419  C CA  . VAL A 60  ? 0.8018 0.9208 1.1914 -0.0482 0.0451  0.0143  501 VAL A CA  
420  C C   . VAL A 60  ? 0.8058 0.9056 1.1937 -0.0647 0.0793  0.0095  501 VAL A C   
421  O O   . VAL A 60  ? 0.8424 0.9038 1.1735 -0.0648 0.0914  0.0142  501 VAL A O   
422  C CB  . VAL A 60  ? 0.8230 0.9499 1.2185 -0.0562 0.0107  0.0055  501 VAL A CB  
423  C CG1 . VAL A 60  ? 0.8292 0.9219 1.1752 -0.0690 0.0150  0.0014  501 VAL A CG1 
424  C CG2 . VAL A 60  ? 0.8356 0.9624 1.2064 -0.0401 -0.0224 0.0129  501 VAL A CG2 
425  N N   . GLY A 61  ? 0.7753 0.8987 1.2248 -0.0783 0.0954  -0.0006 502 GLY A N   
426  C CA  . GLY A 61  ? 0.7974 0.8946 1.2394 -0.0970 0.1324  -0.0050 502 GLY A CA  
427  C C   . GLY A 61  ? 0.8082 0.8677 1.1978 -0.0884 0.1604  0.0067  502 GLY A C   
428  O O   . GLY A 61  ? 0.8508 0.8654 1.1957 -0.0989 0.1824  0.0082  502 GLY A O   
429  N N   . VAL A 62  ? 0.7761 0.8493 1.1682 -0.0694 0.1577  0.0147  503 VAL A N   
430  C CA  . VAL A 62  ? 0.7842 0.8231 1.1264 -0.0597 0.1787  0.0248  503 VAL A CA  
431  C C   . VAL A 62  ? 0.7720 0.7812 1.0488 -0.0466 0.1613  0.0334  503 VAL A C   
432  O O   . VAL A 62  ? 0.8052 0.7714 1.0298 -0.0458 0.1735  0.0375  503 VAL A O   
433  C CB  . VAL A 62  ? 0.7726 0.8368 1.1445 -0.0449 0.1829  0.0281  503 VAL A CB  
434  C CG1 . VAL A 62  ? 0.7826 0.8114 1.0952 -0.0321 0.1938  0.0386  503 VAL A CG1 
435  C CG2 . VAL A 62  ? 0.7727 0.8604 1.2082 -0.0571 0.2103  0.0170  503 VAL A CG2 
436  N N   . LEU A 63  ? 0.7666 0.7967 1.0464 -0.0363 0.1326  0.0350  504 LEU A N   
437  C CA  . LEU A 63  ? 0.7947 0.8042 1.0229 -0.0241 0.1196  0.0401  504 LEU A CA  
438  C C   . LEU A 63  ? 0.8000 0.7750 0.9890 -0.0307 0.1200  0.0362  504 LEU A C   
439  O O   . LEU A 63  ? 0.7612 0.7085 0.9080 -0.0205 0.1213  0.0386  504 LEU A O   
440  C CB  . LEU A 63  ? 0.8230 0.8558 1.0582 -0.0166 0.0929  0.0411  504 LEU A CB  
441  C CG  . LEU A 63  ? 0.8418 0.8922 1.0901 -0.0030 0.0894  0.0482  504 LEU A CG  
442  C CD1 . LEU A 63  ? 0.8694 0.9315 1.1155 0.0014  0.0619  0.0497  504 LEU A CD1 
443  C CD2 . LEU A 63  ? 0.8844 0.9141 1.0953 0.0077  0.1017  0.0536  504 LEU A CD2 
444  N N   . ARG A 64  ? 0.8169 0.7936 1.0234 -0.0471 0.1175  0.0285  505 ARG A N   
445  C CA  . ARG A 64  ? 0.8378 0.7783 1.0079 -0.0542 0.1175  0.0237  505 ARG A CA  
446  C C   . ARG A 64  ? 0.8566 0.7516 0.9940 -0.0580 0.1413  0.0267  505 ARG A C   
447  O O   . ARG A 64  ? 0.9170 0.7714 1.0123 -0.0566 0.1402  0.0252  505 ARG A O   
448  C CB  . ARG A 64  ? 0.8793 0.8324 1.0763 -0.0725 0.1070  0.0134  505 ARG A CB  
449  C CG  . ARG A 64  ? 0.9626 0.9150 1.1932 -0.0941 0.1276  0.0074  505 ARG A CG  
450  C CD  . ARG A 64  ? 1.0241 1.0176 1.3145 -0.1090 0.1118  -0.0042 505 ARG A CD  
451  N NE  . ARG A 64  ? 1.0686 1.0581 1.3403 -0.1111 0.0844  -0.0104 505 ARG A NE  
452  C CZ  . ARG A 64  ? 1.1337 1.1058 1.4026 -0.1302 0.0828  -0.0214 505 ARG A CZ  
453  N NH1 . ARG A 64  ? 1.1746 1.1298 1.4581 -0.1507 0.1086  -0.0270 505 ARG A NH1 
454  N NH2 . ARG A 64  ? 1.1740 1.1405 1.4203 -0.1306 0.0573  -0.0274 505 ARG A NH2 
455  N N   . LYS A 65  ? 0.8471 0.7433 0.9987 -0.0618 0.1625  0.0305  506 LYS A N   
456  C CA  . LYS A 65  ? 0.8943 0.7372 0.9996 -0.0642 0.1850  0.0351  506 LYS A CA  
457  C C   . LYS A 65  ? 0.8908 0.7097 0.9500 -0.0413 0.1777  0.0429  506 LYS A C   
458  O O   . LYS A 65  ? 0.9320 0.7007 0.9439 -0.0400 0.1905  0.0475  506 LYS A O   
459  C CB  . LYS A 65  ? 0.9463 0.7942 1.0798 -0.0801 0.2155  0.0338  506 LYS A CB  
460  C CG  . LYS A 65  ? 1.0191 0.8739 1.1902 -0.1075 0.2304  0.0231  506 LYS A CG  
461  C CD  . LYS A 65  ? 1.0807 0.9303 1.2739 -0.1261 0.2697  0.0190  506 LYS A CD  
462  C CE  . LYS A 65  ? 1.0781 0.9985 1.3587 -0.1261 0.2702  0.0109  506 LYS A CE  
463  N NZ  . LYS A 65  ? 1.1338 1.0542 1.4472 -0.1462 0.3133  0.0021  506 LYS A NZ  
464  N N   . THR A 66  ? 0.8494 0.6997 0.9195 -0.0245 0.1571  0.0433  507 THR A N   
465  C CA  . THR A 66  ? 0.8360 0.6723 0.8752 -0.0044 0.1496  0.0472  507 THR A CA  
466  C C   . THR A 66  ? 0.8077 0.6409 0.8307 0.0097  0.1291  0.0420  507 THR A C   
467  O O   . THR A 66  ? 0.7777 0.6419 0.8229 0.0092  0.1182  0.0373  507 THR A O   
468  C CB  . THR A 66  ? 0.7953 0.6700 0.8630 0.0035  0.1494  0.0507  507 THR A CB  
469  O OG1 . THR A 66  ? 0.7847 0.7014 0.8854 0.0045  0.1346  0.0482  507 THR A OG1 
470  C CG2 . THR A 66  ? 0.8025 0.6816 0.8902 -0.0069 0.1719  0.0535  507 THR A CG2 
471  N N   . ARG A 67  ? 0.8343 0.6283 0.8180 0.0231  0.1236  0.0417  508 ARG A N   
472  C CA  . ARG A 67  ? 0.8445 0.6367 0.8202 0.0399  0.1054  0.0334  508 ARG A CA  
473  C C   . ARG A 67  ? 0.8489 0.6201 0.8013 0.0584  0.0966  0.0335  508 ARG A C   
474  O O   . ARG A 67  ? 0.8829 0.6016 0.7932 0.0654  0.0913  0.0349  508 ARG A O   
475  C CB  . ARG A 67  ? 0.9004 0.6547 0.8519 0.0386  0.1003  0.0279  508 ARG A CB  
476  C CG  . ARG A 67  ? 0.8973 0.6706 0.8694 0.0229  0.1023  0.0230  508 ARG A CG  
477  C CD  . ARG A 67  ? 0.9412 0.6666 0.8828 0.0207  0.0995  0.0178  508 ARG A CD  
478  N NE  . ARG A 67  ? 0.9116 0.6541 0.8695 0.0093  0.0966  0.0090  508 ARG A NE  
479  C CZ  . ARG A 67  ? 0.8857 0.6411 0.8485 0.0189  0.0866  -0.0022 508 ARG A CZ  
480  N NH1 . ARG A 67  ? 0.8693 0.6287 0.8322 0.0402  0.0792  -0.0080 508 ARG A NH1 
481  N NH2 . ARG A 67  ? 0.9227 0.6867 0.8916 0.0060  0.0849  -0.0098 508 ARG A NH2 
482  N N   . HIS A 68  ? 0.7868 0.5941 0.7631 0.0661  0.0930  0.0315  509 HIS A N   
483  C CA  . HIS A 68  ? 0.7981 0.5907 0.7582 0.0820  0.0827  0.0297  509 HIS A CA  
484  C C   . HIS A 68  ? 0.7403 0.5796 0.7371 0.0886  0.0777  0.0217  509 HIS A C   
485  O O   . HIS A 68  ? 0.7198 0.5943 0.7424 0.0785  0.0880  0.0249  509 HIS A O   
486  C CB  . HIS A 68  ? 0.8362 0.6025 0.7693 0.0755  0.0958  0.0410  509 HIS A CB  
487  C CG  . HIS A 68  ? 0.8789 0.6164 0.7811 0.0906  0.0827  0.0396  509 HIS A CG  
488  N ND1 . HIS A 68  ? 0.8598 0.6292 0.7857 0.0987  0.0755  0.0342  509 HIS A ND1 
489  C CD2 . HIS A 68  ? 0.9664 0.6415 0.8118 0.0988  0.0729  0.0421  509 HIS A CD2 
490  C CE1 . HIS A 68  ? 0.9105 0.6436 0.8010 0.1114  0.0603  0.0321  509 HIS A CE1 
491  N NE2 . HIS A 68  ? 0.9816 0.6548 0.8193 0.1127  0.0571  0.0376  509 HIS A NE2 
492  N N   . VAL A 69  ? 0.7684 0.6053 0.7674 0.1053  0.0612  0.0103  510 VAL A N   
493  C CA  . VAL A 69  ? 0.7766 0.6574 0.8145 0.1091  0.0594  -0.0013 510 VAL A CA  
494  C C   . VAL A 69  ? 0.7635 0.6669 0.8122 0.1004  0.0713  0.0064  510 VAL A C   
495  O O   . VAL A 69  ? 0.7492 0.6870 0.8257 0.0951  0.0783  0.0014  510 VAL A O   
496  C CB  . VAL A 69  ? 0.8061 0.6832 0.8534 0.1289  0.0379  -0.0178 510 VAL A CB  
497  C CG1 . VAL A 69  ? 0.8621 0.7280 0.9146 0.1406  0.0258  -0.0308 510 VAL A CG1 
498  C CG2 . VAL A 69  ? 0.8456 0.6824 0.8552 0.1387  0.0236  -0.0118 510 VAL A CG2 
499  N N   . ASN A 70  ? 0.7679 0.6463 0.7903 0.0989  0.0749  0.0176  511 ASN A N   
500  C CA  . ASN A 70  ? 0.7628 0.6563 0.7931 0.0928  0.0862  0.0242  511 ASN A CA  
501  C C   . ASN A 70  ? 0.7438 0.6513 0.7850 0.0789  0.1038  0.0361  511 ASN A C   
502  O O   . ASN A 70  ? 0.7248 0.6395 0.7718 0.0754  0.1138  0.0422  511 ASN A O   
503  C CB  . ASN A 70  ? 0.7878 0.6451 0.7831 0.0991  0.0821  0.0272  511 ASN A CB  
504  C CG  . ASN A 70  ? 0.8023 0.6547 0.7965 0.1141  0.0594  0.0133  511 ASN A CG  
505  O OD1 . ASN A 70  ? 0.8491 0.6593 0.8057 0.1249  0.0427  0.0117  511 ASN A OD1 
506  N ND2 . ASN A 70  ? 0.7924 0.6853 0.8273 0.1143  0.0577  0.0021  511 ASN A ND2 
507  N N   . ILE A 71  ? 0.7520 0.6628 0.7983 0.0720  0.1056  0.0377  512 ILE A N   
508  C CA  . ILE A 71  ? 0.7506 0.6802 0.8160 0.0600  0.1159  0.0458  512 ILE A CA  
509  C C   . ILE A 71  ? 0.7486 0.7024 0.8303 0.0560  0.1101  0.0415  512 ILE A C   
510  O O   . ILE A 71  ? 0.7891 0.7368 0.8641 0.0574  0.1037  0.0335  512 ILE A O   
511  C CB  . ILE A 71  ? 0.7685 0.6774 0.8249 0.0508  0.1248  0.0509  512 ILE A CB  
512  C CG1 . ILE A 71  ? 0.8053 0.6948 0.8494 0.0488  0.1399  0.0567  512 ILE A CG1 
513  C CG2 . ILE A 71  ? 0.7709 0.7058 0.8571 0.0393  0.1270  0.0533  512 ILE A CG2 
514  C CD1 . ILE A 71  ? 0.8810 0.7220 0.8773 0.0549  0.1381  0.0560  512 ILE A CD1 
515  N N   . LEU A 72  ? 0.7222 0.6976 0.8204 0.0516  0.1123  0.0464  513 LEU A N   
516  C CA  . LEU A 72  ? 0.7166 0.7055 0.8181 0.0459  0.1070  0.0444  513 LEU A CA  
517  C C   . LEU A 72  ? 0.7091 0.6911 0.8060 0.0396  0.1019  0.0412  513 LEU A C   
518  O O   . LEU A 72  ? 0.7312 0.7104 0.8364 0.0340  0.1028  0.0457  513 LEU A O   
519  C CB  . LEU A 72  ? 0.7675 0.7695 0.8816 0.0426  0.1059  0.0537  513 LEU A CB  
520  C CG  . LEU A 72  ? 0.8328 0.8384 0.9373 0.0369  0.0977  0.0542  513 LEU A CG  
521  C CD1 . LEU A 72  ? 0.8225 0.8246 0.9111 0.0370  0.1045  0.0487  513 LEU A CD1 
522  C CD2 . LEU A 72  ? 0.8494 0.8625 0.9682 0.0367  0.0891  0.0643  513 LEU A CD2 
523  N N   . LEU A 73  ? 0.7246 0.7033 0.8102 0.0394  0.0989  0.0313  514 LEU A N   
524  C CA  . LEU A 73  ? 0.7096 0.6765 0.7863 0.0342  0.0944  0.0258  514 LEU A CA  
525  C C   . LEU A 73  ? 0.7263 0.7002 0.8048 0.0225  0.0871  0.0297  514 LEU A C   
526  O O   . LEU A 73  ? 0.7514 0.7297 0.8190 0.0188  0.0834  0.0283  514 LEU A O   
527  C CB  . LEU A 73  ? 0.6959 0.6580 0.7627 0.0384  0.0953  0.0113  514 LEU A CB  
528  C CG  . LEU A 73  ? 0.7151 0.6599 0.7697 0.0349  0.0916  0.0030  514 LEU A CG  
529  C CD1 . LEU A 73  ? 0.7237 0.6451 0.7738 0.0389  0.0892  0.0059  514 LEU A CD1 
530  C CD2 . LEU A 73  ? 0.7115 0.6556 0.7630 0.0404  0.0960  -0.0141 514 LEU A CD2 
531  N N   . PHE A 74  ? 0.7368 0.7086 0.8271 0.0156  0.0848  0.0332  515 PHE A N   
532  C CA  . PHE A 74  ? 0.7493 0.7282 0.8464 0.0044  0.0730  0.0329  515 PHE A CA  
533  C C   . PHE A 74  ? 0.7961 0.7588 0.8667 -0.0004 0.0681  0.0223  515 PHE A C   
534  O O   . PHE A 74  ? 0.8494 0.7940 0.9090 0.0024  0.0746  0.0154  515 PHE A O   
535  C CB  . PHE A 74  ? 0.7634 0.7446 0.8860 -0.0042 0.0758  0.0344  515 PHE A CB  
536  C CG  . PHE A 74  ? 0.7787 0.7682 0.9149 -0.0171 0.0610  0.0298  515 PHE A CG  
537  C CD1 . PHE A 74  ? 0.7697 0.7798 0.9222 -0.0174 0.0433  0.0327  515 PHE A CD1 
538  C CD2 . PHE A 74  ? 0.7896 0.7623 0.9203 -0.0284 0.0622  0.0220  515 PHE A CD2 
539  C CE1 . PHE A 74  ? 0.7841 0.8015 0.9499 -0.0283 0.0239  0.0268  515 PHE A CE1 
540  C CE2 . PHE A 74  ? 0.8120 0.7931 0.9574 -0.0417 0.0466  0.0156  515 PHE A CE2 
541  C CZ  . PHE A 74  ? 0.8133 0.8185 0.9776 -0.0413 0.0259  0.0175  515 PHE A CZ  
542  N N   . MET A 75  ? 0.8126 0.7763 0.8685 -0.0068 0.0561  0.0204  516 MET A N   
543  C CA  . MET A 75  ? 0.8336 0.7778 0.8587 -0.0131 0.0535  0.0086  516 MET A CA  
544  C C   . MET A 75  ? 0.8621 0.8024 0.8859 -0.0264 0.0359  0.0057  516 MET A C   
545  O O   . MET A 75  ? 0.8981 0.8203 0.9072 -0.0331 0.0359  -0.0046 516 MET A O   
546  C CB  . MET A 75  ? 0.8461 0.7827 0.8392 -0.0120 0.0583  0.0048  516 MET A CB  
547  C CG  . MET A 75  ? 0.8340 0.7745 0.8324 -0.0013 0.0770  0.0001  516 MET A CG  
548  S SD  . MET A 75  ? 0.8815 0.8140 0.8481 -0.0050 0.0908  -0.0071 516 MET A SD  
549  C CE  . MET A 75  ? 0.9344 0.8424 0.8680 -0.0136 0.0955  -0.0254 516 MET A CE  
550  N N   . GLY A 76  ? 0.8590 0.8157 0.9003 -0.0294 0.0188  0.0131  517 GLY A N   
551  C CA  . GLY A 76  ? 0.8597 0.8188 0.9114 -0.0417 -0.0028 0.0083  517 GLY A CA  
552  C C   . GLY A 76  ? 0.8288 0.8087 0.9057 -0.0404 -0.0269 0.0151  517 GLY A C   
553  O O   . GLY A 76  ? 0.7833 0.7747 0.8709 -0.0295 -0.0247 0.0252  517 GLY A O   
554  N N   . TYR A 77  ? 0.8494 0.8331 0.9380 -0.0507 -0.0520 0.0081  518 TYR A N   
555  C CA  . TYR A 77  ? 0.8570 0.8583 0.9702 -0.0476 -0.0841 0.0114  518 TYR A CA  
556  C C   . TYR A 77  ? 0.9061 0.8860 0.9818 -0.0562 -0.1178 0.0038  518 TYR A C   
557  O O   . TYR A 77  ? 0.9261 0.8838 0.9696 -0.0681 -0.1144 -0.0064 518 TYR A O   
558  C CB  . TYR A 77  ? 0.8285 0.8703 1.0235 -0.0505 -0.0850 0.0076  518 TYR A CB  
559  C CG  . TYR A 77  ? 0.8368 0.8838 1.0584 -0.0691 -0.0855 -0.0068 518 TYR A CG  
560  C CD1 . TYR A 77  ? 0.8782 0.9301 1.1108 -0.0790 -0.1206 -0.0179 518 TYR A CD1 
561  C CD2 . TYR A 77  ? 0.8315 0.8739 1.0641 -0.0774 -0.0522 -0.0098 518 TYR A CD2 
562  C CE1 . TYR A 77  ? 0.8926 0.9487 1.1517 -0.0986 -0.1200 -0.0330 518 TYR A CE1 
563  C CE2 . TYR A 77  ? 0.8529 0.8934 1.1058 -0.0966 -0.0500 -0.0230 518 TYR A CE2 
564  C CZ  . TYR A 77  ? 0.8700 0.9198 1.1393 -0.1082 -0.0826 -0.0352 518 TYR A CZ  
565  O OH  . TYR A 77  ? 0.8808 0.9280 1.1719 -0.1298 -0.0797 -0.0499 518 TYR A OH  
566  N N   . SER A 78  ? 0.9607 0.9429 1.0370 -0.0491 -0.1525 0.0084  519 SER A N   
567  C CA  . SER A 78  ? 1.0433 1.0067 1.0909 -0.0565 -0.1938 0.0005  519 SER A CA  
568  C C   . SER A 78  ? 1.0500 1.0486 1.1648 -0.0487 -0.2319 -0.0007 519 SER A C   
569  O O   . SER A 78  ? 0.9916 1.0121 1.1447 -0.0335 -0.2293 0.0088  519 SER A O   
570  C CB  . SER A 78  ? 1.1182 1.0271 1.0672 -0.0539 -0.2037 0.0075  519 SER A CB  
571  O OG  . SER A 78  ? 1.2119 1.0922 1.1181 -0.0625 -0.2436 -0.0010 519 SER A OG  
572  N N   . THR A 79  ? 1.1161 1.1217 1.2508 -0.0590 -0.2673 -0.0149 520 THR A N   
573  C CA  . THR A 79  ? 1.1623 1.1987 1.3586 -0.0502 -0.3145 -0.0200 520 THR A CA  
574  C C   . THR A 79  ? 1.2807 1.2770 1.4133 -0.0514 -0.3690 -0.0243 520 THR A C   
575  O O   . THR A 79  ? 1.3480 1.3597 1.5175 -0.0404 -0.4185 -0.0280 520 THR A O   
576  C CB  . THR A 79  ? 1.1243 1.2185 1.4298 -0.0626 -0.3112 -0.0384 520 THR A CB  
577  O OG1 . THR A 79  ? 1.1262 1.2069 1.4138 -0.0846 -0.3197 -0.0543 520 THR A OG1 
578  C CG2 . THR A 79  ? 1.0657 1.1866 1.4175 -0.0652 -0.2541 -0.0347 520 THR A CG2 
579  N N   . LYS A 80  ? 1.3819 1.3238 1.4169 -0.0634 -0.3605 -0.0245 521 LYS A N   
580  C CA  . LYS A 80  ? 1.4949 1.3950 1.4658 -0.0720 -0.4072 -0.0340 521 LYS A CA  
581  C C   . LYS A 80  ? 1.5964 1.4562 1.5079 -0.0549 -0.4565 -0.0224 521 LYS A C   
582  O O   . LYS A 80  ? 1.7038 1.5735 1.6450 -0.0496 -0.5147 -0.0310 521 LYS A O   
583  C CB  . LYS A 80  ? 1.5301 1.3792 1.4100 -0.0896 -0.3786 -0.0390 521 LYS A CB  
584  N N   . PRO A 81  ? 1.5925 1.4042 1.4201 -0.0464 -0.4356 -0.0038 522 PRO A N   
585  C CA  . PRO A 81  ? 1.6427 1.4154 1.4220 -0.0281 -0.4825 0.0092  522 PRO A CA  
586  C C   . PRO A 81  ? 1.5633 1.3898 1.4416 -0.0056 -0.4904 0.0168  522 PRO A C   
587  O O   . PRO A 81  ? 1.5962 1.4337 1.5118 0.0097  -0.5464 0.0142  522 PRO A O   
588  C CB  . PRO A 81  ? 1.6959 1.3960 1.3516 -0.0315 -0.4492 0.0245  522 PRO A CB  
589  C CG  . PRO A 81  ? 1.6285 1.3574 1.3117 -0.0420 -0.3801 0.0223  522 PRO A CG  
590  C CD  . PRO A 81  ? 1.5582 1.3471 1.3341 -0.0524 -0.3738 0.0044  522 PRO A CD  
591  N N   . GLN A 82  ? 1.4704 1.3295 1.3919 -0.0031 -0.4356 0.0241  523 GLN A N   
592  C CA  . GLN A 82  ? 1.3931 1.3043 1.4102 0.0159  -0.4328 0.0291  523 GLN A CA  
593  C C   . GLN A 82  ? 1.2634 1.2244 1.3476 0.0073  -0.3723 0.0256  523 GLN A C   
594  O O   . GLN A 82  ? 1.2671 1.2170 1.3177 -0.0101 -0.3364 0.0215  523 GLN A O   
595  C CB  . GLN A 82  ? 1.4516 1.3179 1.4083 0.0341  -0.4353 0.0501  523 GLN A CB  
596  C CG  . GLN A 82  ? 1.5826 1.3998 1.4855 0.0495  -0.5024 0.0559  523 GLN A CG  
597  C CD  . GLN A 82  ? 1.6634 1.4316 1.5075 0.0674  -0.5020 0.0777  523 GLN A CD  
598  O OE1 . GLN A 82  ? 1.6488 1.4131 1.4770 0.0639  -0.4486 0.0877  523 GLN A OE1 
599  N NE2 . GLN A 82  ? 1.7523 1.4792 1.5621 0.0867  -0.5639 0.0844  523 GLN A NE2 
600  N N   . LEU A 83  ? 1.1718 1.1829 1.3470 0.0206  -0.3617 0.0267  524 LEU A N   
601  C CA  . LEU A 83  ? 1.0922 1.1426 1.3231 0.0137  -0.3056 0.0247  524 LEU A CA  
602  C C   . LEU A 83  ? 1.0795 1.0960 1.2438 0.0167  -0.2654 0.0409  524 LEU A C   
603  O O   . LEU A 83  ? 1.1157 1.1071 1.2475 0.0320  -0.2745 0.0546  524 LEU A O   
604  C CB  . LEU A 83  ? 1.0468 1.1568 1.3914 0.0257  -0.3038 0.0191  524 LEU A CB  
605  C CG  . LEU A 83  ? 1.0436 1.2074 1.4885 0.0183  -0.3263 -0.0028 524 LEU A CG  
606  C CD1 . LEU A 83  ? 0.9882 1.2084 1.5422 0.0290  -0.3090 -0.0090 524 LEU A CD1 
607  C CD2 . LEU A 83  ? 1.0496 1.2197 1.4955 -0.0088 -0.3003 -0.0153 524 LEU A CD2 
608  N N   . ALA A 84  ? 1.0283 1.0439 1.1767 0.0025  -0.2220 0.0381  525 ALA A N   
609  C CA  . ALA A 84  ? 0.9858 0.9728 1.0762 0.0032  -0.1846 0.0490  525 ALA A CA  
610  C C   . ALA A 84  ? 0.9111 0.9198 1.0300 -0.0050 -0.1389 0.0441  525 ALA A C   
611  O O   . ALA A 84  ? 0.8975 0.9175 1.0359 -0.0179 -0.1336 0.0325  525 ALA A O   
612  C CB  . ALA A 84  ? 1.0475 0.9780 1.0373 -0.0051 -0.1912 0.0507  525 ALA A CB  
613  N N   . ILE A 85  ? 0.8831 0.8925 1.0003 0.0025  -0.1084 0.0527  526 ILE A N   
614  C CA  . ILE A 85  ? 0.8519 0.8706 0.9803 -0.0024 -0.0690 0.0495  526 ILE A CA  
615  C C   . ILE A 85  ? 0.8476 0.8368 0.9165 -0.0014 -0.0467 0.0539  526 ILE A C   
616  O O   . ILE A 85  ? 0.8903 0.8662 0.9366 0.0064  -0.0464 0.0632  526 ILE A O   
617  C CB  . ILE A 85  ? 0.8302 0.8812 1.0218 0.0050  -0.0512 0.0520  526 ILE A CB  
618  C CG1 . ILE A 85  ? 0.8718 0.9570 1.1335 0.0015  -0.0677 0.0434  526 ILE A CG1 
619  C CG2 . ILE A 85  ? 0.7969 0.8455 0.9844 0.0012  -0.0150 0.0502  526 ILE A CG2 
620  C CD1 . ILE A 85  ? 0.8598 0.9749 1.1846 0.0025  -0.0414 0.0409  526 ILE A CD1 
621  N N   . VAL A 86  ? 0.8375 0.8166 0.8853 -0.0096 -0.0275 0.0455  527 VAL A N   
622  C CA  . VAL A 86  ? 0.8419 0.7969 0.8409 -0.0104 -0.0070 0.0440  527 VAL A CA  
623  C C   . VAL A 86  ? 0.8228 0.7915 0.8467 -0.0054 0.0207  0.0415  527 VAL A C   
624  O O   . VAL A 86  ? 0.8232 0.8023 0.8744 -0.0072 0.0263  0.0365  527 VAL A O   
625  C CB  . VAL A 86  ? 0.8829 0.8117 0.8360 -0.0218 -0.0087 0.0326  527 VAL A CB  
626  C CG1 . VAL A 86  ? 0.9048 0.8106 0.8126 -0.0237 0.0152  0.0279  527 VAL A CG1 
627  C CG2 . VAL A 86  ? 0.9249 0.8360 0.8497 -0.0277 -0.0420 0.0336  527 VAL A CG2 
628  N N   . THR A 87  ? 0.8036 0.7681 0.8151 0.0000  0.0368  0.0445  528 THR A N   
629  C CA  . THR A 87  ? 0.7763 0.7505 0.8067 0.0061  0.0583  0.0405  528 THR A CA  
630  C C   . THR A 87  ? 0.8037 0.7655 0.8056 0.0047  0.0749  0.0325  528 THR A C   
631  O O   . THR A 87  ? 0.8515 0.7944 0.8161 -0.0022 0.0742  0.0324  528 THR A O   
632  C CB  . THR A 87  ? 0.7370 0.7274 0.7990 0.0151  0.0626  0.0501  528 THR A CB  
633  O OG1 . THR A 87  ? 0.7623 0.7453 0.8070 0.0174  0.0647  0.0562  528 THR A OG1 
634  C CG2 . THR A 87  ? 0.7206 0.7262 0.8168 0.0154  0.0493  0.0560  528 THR A CG2 
635  N N   . GLN A 88  ? 0.7814 0.7514 0.8005 0.0109  0.0898  0.0247  529 GLN A N   
636  C CA  . GLN A 88  ? 0.7995 0.7670 0.8091 0.0103  0.1072  0.0133  529 GLN A CA  
637  C C   . GLN A 88  ? 0.8109 0.7748 0.8087 0.0073  0.1129  0.0213  529 GLN A C   
638  O O   . GLN A 88  ? 0.8159 0.7842 0.8242 0.0118  0.1040  0.0348  529 GLN A O   
639  C CB  . GLN A 88  ? 0.8119 0.7922 0.8514 0.0212  0.1145  0.0038  529 GLN A CB  
640  C CG  . GLN A 88  ? 0.7817 0.7724 0.8436 0.0299  0.1117  0.0138  529 GLN A CG  
641  C CD  . GLN A 88  ? 0.7764 0.7718 0.8575 0.0413  0.1140  0.0034  529 GLN A CD  
642  O OE1 . GLN A 88  ? 0.7915 0.7816 0.8785 0.0486  0.1074  0.0090  529 GLN A OE1 
643  N NE2 . GLN A 88  ? 0.7924 0.7953 0.8826 0.0426  0.1231  -0.0130 529 GLN A NE2 
644  N N   . TRP A 89  ? 0.8780 0.8308 0.8535 -0.0010 0.1302  0.0114  530 TRP A N   
645  C CA  . TRP A 89  ? 0.8930 0.8346 0.8511 -0.0068 0.1403  0.0173  530 TRP A CA  
646  C C   . TRP A 89  ? 0.8659 0.8284 0.8597 -0.0027 0.1560  0.0072  530 TRP A C   
647  O O   . TRP A 89  ? 0.8335 0.8045 0.8397 -0.0062 0.1730  -0.0119 530 TRP A O   
648  C CB  . TRP A 89  ? 0.9562 0.8664 0.8623 -0.0230 0.1550  0.0111  530 TRP A CB  
649  C CG  . TRP A 89  ? 1.0079 0.8976 0.8886 -0.0316 0.1687  0.0169  530 TRP A CG  
650  C CD1 . TRP A 89  ? 1.0380 0.9277 0.9221 -0.0422 0.1986  0.0026  530 TRP A CD1 
651  C CD2 . TRP A 89  ? 1.0513 0.9155 0.9019 -0.0303 0.1530  0.0376  530 TRP A CD2 
652  N NE1 . TRP A 89  ? 1.0604 0.9215 0.9117 -0.0502 0.2048  0.0142  530 TRP A NE1 
653  C CE2 . TRP A 89  ? 1.0705 0.9133 0.8985 -0.0414 0.1756  0.0366  530 TRP A CE2 
654  C CE3 . TRP A 89  ? 1.0632 0.9208 0.9079 -0.0206 0.1215  0.0551  530 TRP A CE3 
655  C CZ2 . TRP A 89  ? 1.1189 0.9272 0.9107 -0.0417 0.1666  0.0546  530 TRP A CZ2 
656  C CZ3 . TRP A 89  ? 1.0816 0.9105 0.8978 -0.0185 0.1103  0.0715  530 TRP A CZ3 
657  C CH2 . TRP A 89  ? 1.1090 0.9102 0.8950 -0.0284 0.1323  0.0722  530 TRP A CH2 
658  N N   . CYS A 90  ? 0.9068 0.8778 0.9197 0.0048  0.1500  0.0178  531 CYS A N   
659  C CA  . CYS A 90  ? 0.8983 0.8865 0.9422 0.0081  0.1611  0.0078  531 CYS A CA  
660  C C   . CYS A 90  ? 0.9309 0.9074 0.9590 -0.0061 0.1827  0.0012  531 CYS A C   
661  O O   . CYS A 90  ? 0.9198 0.8688 0.9102 -0.0138 0.1836  0.0148  531 CYS A O   
662  C CB  . CYS A 90  ? 0.8973 0.8911 0.9578 0.0186  0.1501  0.0208  531 CYS A CB  
663  S SG  . CYS A 90  ? 0.9595 0.9596 1.0327 0.0305  0.1312  0.0296  531 CYS A SG  
664  N N   . GLU A 91  ? 0.9491 0.9438 1.0061 -0.0099 0.1995  -0.0208 532 GLU A N   
665  C CA  . GLU A 91  ? 1.0219 1.0111 1.0770 -0.0257 0.2244  -0.0311 532 GLU A CA  
666  C C   . GLU A 91  ? 0.9408 0.9449 1.0278 -0.0197 0.2201  -0.0310 532 GLU A C   
667  O O   . GLU A 91  ? 0.9263 0.9567 1.0539 -0.0061 0.2077  -0.0403 532 GLU A O   
668  C CB  . GLU A 91  ? 1.0838 1.0889 1.1620 -0.0353 0.2479  -0.0598 532 GLU A CB  
669  C CG  . GLU A 91  ? 1.2321 1.2128 1.2794 -0.0608 0.2824  -0.0683 532 GLU A CG  
670  C CD  . GLU A 91  ? 1.3543 1.2889 1.3276 -0.0724 0.2872  -0.0548 532 GLU A CD  
671  O OE1 . GLU A 91  ? 1.2887 1.2235 1.2533 -0.0679 0.2808  -0.0590 532 GLU A OE1 
672  O OE2 . GLU A 91  ? 1.4547 1.3476 1.3741 -0.0860 0.2957  -0.0403 532 GLU A OE2 
673  N N   . GLY A 92  ? 0.9197 0.9006 0.9819 -0.0292 0.2284  -0.0198 533 GLY A N   
674  C CA  . GLY A 92  ? 0.8914 0.8802 0.9773 -0.0257 0.2261  -0.0200 533 GLY A CA  
675  C C   . GLY A 92  ? 0.8651 0.8253 0.9198 -0.0218 0.2169  0.0043  533 GLY A C   
676  O O   . GLY A 92  ? 0.8568 0.7813 0.8663 -0.0314 0.2235  0.0170  533 GLY A O   
677  N N   . SER A 93  ? 0.7805 0.7519 0.8563 -0.0071 0.2015  0.0099  534 SER A N   
678  C CA  . SER A 93  ? 0.7650 0.7134 0.8220 -0.0013 0.1948  0.0290  534 SER A CA  
679  C C   . SER A 93  ? 0.7304 0.6919 0.8061 0.0167  0.1774  0.0362  534 SER A C   
680  O O   . SER A 93  ? 0.6717 0.6544 0.7717 0.0233  0.1716  0.0251  534 SER A O   
681  C CB  . SER A 93  ? 0.7726 0.7089 0.8308 -0.0111 0.2089  0.0230  534 SER A CB  
682  O OG  . SER A 93  ? 0.8154 0.7232 0.8412 -0.0299 0.2280  0.0229  534 SER A OG  
683  N N   . SER A 94  ? 0.7231 0.6683 0.7864 0.0248  0.1696  0.0537  535 SER A N   
684  C CA  . SER A 94  ? 0.7004 0.6534 0.7814 0.0386  0.1613  0.0586  535 SER A CA  
685  C C   . SER A 94  ? 0.6982 0.6489 0.7874 0.0379  0.1685  0.0493  535 SER A C   
686  O O   . SER A 94  ? 0.6861 0.6265 0.7687 0.0269  0.1790  0.0430  535 SER A O   
687  C CB  . SER A 94  ? 0.7018 0.6419 0.7786 0.0478  0.1534  0.0754  535 SER A CB  
688  O OG  . SER A 94  ? 0.7146 0.6299 0.7787 0.0476  0.1585  0.0812  535 SER A OG  
689  N N   . LEU A 95  ? 0.6973 0.6539 0.7970 0.0477  0.1635  0.0474  536 LEU A N   
690  C CA  . LEU A 95  ? 0.6938 0.6422 0.7944 0.0489  0.1667  0.0396  536 LEU A CA  
691  C C   . LEU A 95  ? 0.7004 0.6263 0.7911 0.0473  0.1754  0.0475  536 LEU A C   
692  O O   . LEU A 95  ? 0.7536 0.6698 0.8409 0.0385  0.1824  0.0392  536 LEU A O   
693  C CB  . LEU A 95  ? 0.7261 0.6719 0.8249 0.0596  0.1616  0.0405  536 LEU A CB  
694  C CG  . LEU A 95  ? 0.7770 0.7148 0.8691 0.0612  0.1571  0.0272  536 LEU A CG  
695  C CD1 . LEU A 95  ? 0.7912 0.7469 0.8957 0.0588  0.1457  0.0120  536 LEU A CD1 
696  C CD2 . LEU A 95  ? 0.7874 0.7086 0.8621 0.0700  0.1563  0.0313  536 LEU A CD2 
697  N N   . TYR A 96  ? 0.6747 0.5922 0.7639 0.0559  0.1741  0.0622  537 TYR A N   
698  C CA  . TYR A 96  ? 0.6907 0.5829 0.7709 0.0585  0.1787  0.0712  537 TYR A CA  
699  C C   . TYR A 96  ? 0.7111 0.5838 0.7705 0.0446  0.1849  0.0703  537 TYR A C   
700  O O   . TYR A 96  ? 0.7708 0.6184 0.8187 0.0411  0.1931  0.0698  537 TYR A O   
701  C CB  . TYR A 96  ? 0.6846 0.5766 0.7731 0.0703  0.1696  0.0854  537 TYR A CB  
702  C CG  . TYR A 96  ? 0.7125 0.5755 0.7932 0.0777  0.1684  0.0953  537 TYR A CG  
703  C CD1 . TYR A 96  ? 0.7241 0.5805 0.8219 0.0904  0.1735  0.0957  537 TYR A CD1 
704  C CD2 . TYR A 96  ? 0.7604 0.5972 0.8127 0.0726  0.1626  0.1040  537 TYR A CD2 
705  C CE1 . TYR A 96  ? 0.7487 0.5764 0.8424 0.1004  0.1703  0.1038  537 TYR A CE1 
706  C CE2 . TYR A 96  ? 0.7990 0.6005 0.8379 0.0817  0.1578  0.1143  537 TYR A CE2 
707  C CZ  . TYR A 96  ? 0.7946 0.5936 0.8579 0.0970  0.1603  0.1139  537 TYR A CZ  
708  O OH  . TYR A 96  ? 0.8144 0.5767 0.8680 0.1093  0.1536  0.1230  537 TYR A OH  
709  N N   . HIS A 97  ? 0.7025 0.5823 0.7535 0.0351  0.1839  0.0692  538 HIS A N   
710  C CA  . HIS A 97  ? 0.7426 0.5976 0.7672 0.0187  0.1951  0.0682  538 HIS A CA  
711  C C   . HIS A 97  ? 0.7570 0.6177 0.7930 0.0043  0.2095  0.0494  538 HIS A C   
712  O O   . HIS A 97  ? 0.7977 0.6296 0.8165 -0.0069 0.2220  0.0484  538 HIS A O   
713  C CB  . HIS A 97  ? 0.7491 0.6085 0.7593 0.0106  0.1941  0.0689  538 HIS A CB  
714  C CG  . HIS A 97  ? 0.8042 0.6252 0.7728 -0.0066 0.2077  0.0717  538 HIS A CG  
715  N ND1 . HIS A 97  ? 0.8172 0.6420 0.7837 -0.0279 0.2284  0.0552  538 HIS A ND1 
716  C CD2 . HIS A 97  ? 0.8621 0.6352 0.7867 -0.0064 0.2044  0.0883  538 HIS A CD2 
717  C CE1 . HIS A 97  ? 0.8804 0.6584 0.7983 -0.0431 0.2418  0.0619  538 HIS A CE1 
718  N NE2 . HIS A 97  ? 0.9360 0.6783 0.8230 -0.0296 0.2254  0.0833  538 HIS A NE2 
719  N N   . HIS A 98  ? 0.7364 0.6321 0.8017 0.0052  0.2056  0.0338  539 HIS A N   
720  C CA  . HIS A 98  ? 0.7339 0.6428 0.8210 -0.0049 0.2117  0.0123  539 HIS A CA  
721  C C   . HIS A 98  ? 0.7683 0.6571 0.8510 -0.0030 0.2130  0.0114  539 HIS A C   
722  O O   . HIS A 98  ? 0.7742 0.6503 0.8568 -0.0186 0.2255  0.0007  539 HIS A O   
723  C CB  . HIS A 98  ? 0.6981 0.6421 0.8140 0.0037  0.1975  -0.0013 539 HIS A CB  
724  C CG  . HIS A 98  ? 0.6786 0.6465 0.8106 -0.0031 0.2004  -0.0123 539 HIS A CG  
725  N ND1 . HIS A 98  ? 0.6950 0.6711 0.8425 -0.0221 0.2174  -0.0302 539 HIS A ND1 
726  C CD2 . HIS A 98  ? 0.6589 0.6429 0.7952 0.0054  0.1912  -0.0100 539 HIS A CD2 
727  C CE1 . HIS A 98  ? 0.6794 0.6766 0.8408 -0.0238 0.2193  -0.0389 539 HIS A CE1 
728  N NE2 . HIS A 98  ? 0.6725 0.6736 0.8258 -0.0066 0.2021  -0.0264 539 HIS A NE2 
729  N N   . LEU A 99  ? 0.7262 0.6108 0.8053 0.0145  0.2027  0.0209  540 LEU A N   
730  C CA  . LEU A 99  ? 0.7348 0.6001 0.8079 0.0187  0.2039  0.0180  540 LEU A CA  
731  C C   . LEU A 99  ? 0.7554 0.5829 0.8078 0.0172  0.2149  0.0291  540 LEU A C   
732  O O   . LEU A 99  ? 0.8012 0.6092 0.8480 0.0115  0.2211  0.0209  540 LEU A O   
733  C CB  . LEU A 99  ? 0.7265 0.5949 0.7984 0.0363  0.1949  0.0234  540 LEU A CB  
734  C CG  . LEU A 99  ? 0.7149 0.5934 0.7891 0.0399  0.1834  0.0091  540 LEU A CG  
735  C CD1 . LEU A 99  ? 0.7104 0.6117 0.8045 0.0295  0.1752  -0.0100 540 LEU A CD1 
736  C CD2 . LEU A 99  ? 0.7000 0.5869 0.7712 0.0525  0.1768  0.0177  540 LEU A CD2 
737  N N   . HIS A 100 ? 0.7656 0.5797 0.8055 0.0237  0.2143  0.0471  541 HIS A N   
738  C CA  . HIS A 100 ? 0.7986 0.5725 0.8187 0.0294  0.2189  0.0595  541 HIS A CA  
739  C C   . HIS A 100 ? 0.8226 0.5634 0.8124 0.0191  0.2237  0.0699  541 HIS A C   
740  O O   . HIS A 100 ? 0.8472 0.5467 0.8150 0.0247  0.2248  0.0808  541 HIS A O   
741  C CB  . HIS A 100 ? 0.8001 0.5769 0.8311 0.0521  0.2097  0.0722  541 HIS A CB  
742  C CG  . HIS A 100 ? 0.7813 0.5819 0.8321 0.0609  0.2090  0.0641  541 HIS A CG  
743  N ND1 . HIS A 100 ? 0.8085 0.5977 0.8548 0.0594  0.2164  0.0524  541 HIS A ND1 
744  C CD2 . HIS A 100 ? 0.7694 0.5975 0.8375 0.0699  0.2026  0.0661  541 HIS A CD2 
745  C CE1 . HIS A 100 ? 0.8117 0.6163 0.8657 0.0674  0.2150  0.0484  541 HIS A CE1 
746  N NE2 . HIS A 100 ? 0.7700 0.5985 0.8386 0.0732  0.2080  0.0567  541 HIS A NE2 
747  N N   . ILE A 101 ? 0.8296 0.5823 0.8134 0.0046  0.2270  0.0666  542 ILE A N   
748  C CA  . ILE A 101 ? 0.8923 0.6038 0.8341 -0.0074 0.2340  0.0768  542 ILE A CA  
749  C C   . ILE A 101 ? 0.9002 0.6070 0.8370 -0.0363 0.2571  0.0595  542 ILE A C   
750  O O   . ILE A 101 ? 0.9506 0.6141 0.8605 -0.0496 0.2717  0.0598  542 ILE A O   
751  C CB  . ILE A 101 ? 0.8965 0.6145 0.8249 -0.0019 0.2213  0.0884  542 ILE A CB  
752  C CG1 . ILE A 101 ? 0.8582 0.5895 0.8047 0.0250  0.1982  0.1016  542 ILE A CG1 
753  C CG2 . ILE A 101 ? 0.9746 0.6363 0.8440 -0.0148 0.2277  0.1001  542 ILE A CG2 
754  C CD1 . ILE A 101 ? 0.8917 0.5816 0.8223 0.0407  0.1893  0.1159  542 ILE A CD1 
755  N N   . ILE A 102 ? 0.8728 0.6232 0.8383 -0.0460 0.2613  0.0430  543 ILE A N   
756  C CA  . ILE A 102 ? 0.8983 0.6565 0.8768 -0.0734 0.2843  0.0206  543 ILE A CA  
757  C C   . ILE A 102 ? 0.8856 0.6750 0.9092 -0.0750 0.2822  -0.0010 543 ILE A C   
758  O O   . ILE A 102 ? 0.8722 0.6704 0.9164 -0.0971 0.2989  -0.0227 543 ILE A O   
759  C CB  . ILE A 102 ? 0.8885 0.6755 0.8785 -0.0845 0.2926  0.0097  543 ILE A CB  
760  C CG1 . ILE A 102 ? 0.8278 0.6697 0.8609 -0.0657 0.2716  0.0030  543 ILE A CG1 
761  C CG2 . ILE A 102 ? 0.9363 0.6801 0.8683 -0.0883 0.2969  0.0292  543 ILE A CG2 
762  C CD1 . ILE A 102 ? 0.8076 0.6811 0.8624 -0.0766 0.2812  -0.0140 543 ILE A CD1 
763  N N   . GLU A 103 ? 0.9324 0.7356 0.9697 -0.0525 0.2620  0.0035  544 GLU A N   
764  C CA  . GLU A 103 ? 0.9346 0.7522 0.9981 -0.0516 0.2559  -0.0138 544 GLU A CA  
765  C C   . GLU A 103 ? 0.9210 0.7843 1.0302 -0.0622 0.2532  -0.0418 544 GLU A C   
766  O O   . GLU A 103 ? 0.9370 0.8045 1.0671 -0.0766 0.2579  -0.0625 544 GLU A O   
767  C CB  . GLU A 103 ? 0.9661 0.7406 1.0092 -0.0637 0.2696  -0.0150 544 GLU A CB  
768  C CG  . GLU A 103 ? 0.9994 0.7337 1.0101 -0.0450 0.2648  0.0070  544 GLU A CG  
769  C CD  . GLU A 103 ? 1.0784 0.7661 1.0682 -0.0555 0.2776  0.0042  544 GLU A CD  
770  O OE1 . GLU A 103 ? 1.0699 0.7589 1.0726 -0.0784 0.2891  -0.0165 544 GLU A OE1 
771  O OE2 . GLU A 103 ? 1.1255 0.7749 1.0891 -0.0404 0.2758  0.0214  544 GLU A OE2 
772  N N   . THR A 104 ? 0.8795 0.7771 1.0074 -0.0542 0.2439  -0.0438 545 THR A N   
773  C CA  . THR A 104 ? 0.8421 0.7845 1.0185 -0.0573 0.2352  -0.0707 545 THR A CA  
774  C C   . THR A 104 ? 0.8427 0.7921 1.0326 -0.0460 0.2126  -0.0821 545 THR A C   
775  O O   . THR A 104 ? 0.8157 0.7470 0.9783 -0.0279 0.1996  -0.0665 545 THR A O   
776  C CB  . THR A 104 ? 0.8264 0.7965 1.0134 -0.0443 0.2246  -0.0674 545 THR A CB  
777  O OG1 . THR A 104 ? 0.8576 0.8184 1.0278 -0.0569 0.2455  -0.0599 545 THR A OG1 
778  C CG2 . THR A 104 ? 0.7972 0.8117 1.0370 -0.0416 0.2099  -0.0958 545 THR A CG2 
779  N N   . LYS A 105 ? 0.8803 0.8537 1.1115 -0.0575 0.2084  -0.1112 546 LYS A N   
780  C CA  . LYS A 105 ? 0.9084 0.8861 1.1485 -0.0464 0.1810  -0.1247 546 LYS A CA  
781  C C   . LYS A 105 ? 0.8807 0.8994 1.1618 -0.0343 0.1551  -0.1439 546 LYS A C   
782  O O   . LYS A 105 ? 0.9084 0.9634 1.2444 -0.0460 0.1564  -0.1711 546 LYS A O   
783  C CB  . LYS A 105 ? 0.9450 0.9131 1.1987 -0.0657 0.1872  -0.1444 546 LYS A CB  
784  C CG  . LYS A 105 ? 0.9933 0.9533 1.2403 -0.0539 0.1569  -0.1558 546 LYS A CG  
785  C CD  . LYS A 105 ? 1.0363 0.9566 1.2558 -0.0657 0.1673  -0.1559 546 LYS A CD  
786  C CE  . LYS A 105 ? 1.0569 0.9758 1.2828 -0.0628 0.1375  -0.1794 546 LYS A CE  
787  N NZ  . LYS A 105 ? 1.0586 1.0209 1.3532 -0.0802 0.1288  -0.2156 546 LYS A NZ  
788  N N   . PHE A 106 ? 0.8608 0.8712 1.1155 -0.0108 0.1331  -0.1302 547 PHE A N   
789  C CA  . PHE A 106 ? 0.8149 0.8515 1.0952 0.0053  0.1045  -0.1438 547 PHE A CA  
790  C C   . PHE A 106 ? 0.8286 0.8624 1.1161 0.0130  0.0710  -0.1645 547 PHE A C   
791  O O   . PHE A 106 ? 0.8508 0.8526 1.1043 0.0105  0.0689  -0.1608 547 PHE A O   
792  C CB  . PHE A 106 ? 0.7940 0.8121 1.0326 0.0251  0.0965  -0.1189 547 PHE A CB  
793  C CG  . PHE A 106 ? 0.7551 0.7750 0.9845 0.0205  0.1216  -0.0989 547 PHE A CG  
794  C CD1 . PHE A 106 ? 0.7576 0.7475 0.9453 0.0208  0.1372  -0.0727 547 PHE A CD1 
795  C CD2 . PHE A 106 ? 0.7101 0.7609 0.9735 0.0169  0.1281  -0.1081 547 PHE A CD2 
796  C CE1 . PHE A 106 ? 0.7430 0.7330 0.9215 0.0180  0.1539  -0.0555 547 PHE A CE1 
797  C CE2 . PHE A 106 ? 0.6997 0.7466 0.9468 0.0121  0.1484  -0.0905 547 PHE A CE2 
798  C CZ  . PHE A 106 ? 0.7132 0.7292 0.9168 0.0130  0.1588  -0.0637 547 PHE A CZ  
799  N N   . GLU A 107 ? 0.8330 0.8968 1.1620 0.0240  0.0426  -0.1869 548 GLU A N   
800  C CA  . GLU A 107 ? 0.8767 0.9318 1.2046 0.0366  0.0009  -0.2054 548 GLU A CA  
801  C C   . GLU A 107 ? 0.8946 0.8992 1.1453 0.0574  -0.0170 -0.1812 548 GLU A C   
802  O O   . GLU A 107 ? 0.8494 0.8456 1.0757 0.0669  -0.0083 -0.1601 548 GLU A O   
803  C CB  . GLU A 107 ? 0.9020 1.0037 1.3017 0.0457  -0.0280 -0.2376 548 GLU A CB  
804  C CG  . GLU A 107 ? 0.9152 1.0706 1.3962 0.0230  0.0003  -0.2618 548 GLU A CG  
805  C CD  . GLU A 107 ? 0.9556 1.1577 1.5213 0.0236  -0.0290 -0.3057 548 GLU A CD  
806  O OE1 . GLU A 107 ? 0.9357 1.1487 1.5320 0.0037  -0.0244 -0.3262 548 GLU A OE1 
807  O OE2 . GLU A 107 ? 0.9776 1.2060 1.5831 0.0442  -0.0573 -0.3212 548 GLU A OE2 
808  N N   . MET A 108 ? 0.9422 0.9100 1.1518 0.0622  -0.0400 -0.1854 549 MET A N   
809  C CA  . MET A 108 ? 0.9714 0.8818 1.0986 0.0783  -0.0531 -0.1650 549 MET A CA  
810  C C   . MET A 108 ? 0.9536 0.8591 1.0687 0.0990  -0.0757 -0.1591 549 MET A C   
811  O O   . MET A 108 ? 0.9543 0.8224 1.0114 0.1065  -0.0660 -0.1348 549 MET A O   
812  C CB  . MET A 108 ? 1.0405 0.9120 1.1281 0.0815  -0.0842 -0.1791 549 MET A CB  
813  C CG  . MET A 108 ? 1.1027 0.9042 1.0932 0.0929  -0.0888 -0.1585 549 MET A CG  
814  S SD  . MET A 108 ? 1.1166 0.9005 1.0735 0.0834  -0.0321 -0.1251 549 MET A SD  
815  C CE  . MET A 108 ? 1.0816 0.8672 1.0537 0.0628  -0.0080 -0.1335 549 MET A CE  
816  N N   . ILE A 109 ? 0.9448 0.8876 1.1182 0.1079  -0.1050 -0.1834 550 ILE A N   
817  C CA  . ILE A 109 ? 0.9607 0.8999 1.1302 0.1292  -0.1290 -0.1811 550 ILE A CA  
818  C C   . ILE A 109 ? 0.8788 0.8301 1.0491 0.1251  -0.0920 -0.1582 550 ILE A C   
819  O O   . ILE A 109 ? 0.8426 0.7634 0.9694 0.1381  -0.0976 -0.1413 550 ILE A O   
820  C CB  . ILE A 109 ? 0.9811 0.9685 1.2323 0.1396  -0.1650 -0.2167 550 ILE A CB  
821  C CG1 . ILE A 109 ? 1.0585 1.0092 1.2750 0.1689  -0.2176 -0.2208 550 ILE A CG1 
822  C CG2 . ILE A 109 ? 0.9255 0.9751 1.2564 0.1315  -0.1372 -0.2256 550 ILE A CG2 
823  C CD1 . ILE A 109 ? 1.1038 1.0928 1.3954 0.1822  -0.2652 -0.2601 550 ILE A CD1 
824  N N   . LYS A 110 ? 0.8315 0.8219 1.0462 0.1055  -0.0549 -0.1579 551 LYS A N   
825  C CA  . LYS A 110 ? 0.8099 0.8134 1.0279 0.0996  -0.0220 -0.1390 551 LYS A CA  
826  C C   . LYS A 110 ? 0.8177 0.7803 0.9706 0.0963  0.0011  -0.1075 551 LYS A C   
827  O O   . LYS A 110 ? 0.8037 0.7551 0.9337 0.1019  0.0092  -0.0897 551 LYS A O   
828  C CB  . LYS A 110 ? 0.7921 0.8418 1.0704 0.0790  0.0075  -0.1510 551 LYS A CB  
829  C CG  . LYS A 110 ? 0.8037 0.8593 1.0752 0.0691  0.0427  -0.1308 551 LYS A CG  
830  C CD  . LYS A 110 ? 0.8034 0.8739 1.0899 0.0803  0.0371  -0.1316 551 LYS A CD  
831  C CE  . LYS A 110 ? 0.7814 0.8808 1.0989 0.0639  0.0694  -0.1337 551 LYS A CE  
832  N NZ  . LYS A 110 ? 0.8205 0.9352 1.1573 0.0755  0.0619  -0.1402 551 LYS A NZ  
833  N N   . LEU A 111 ? 0.8316 0.7731 0.9596 0.0869  0.0122  -0.1030 552 LEU A N   
834  C CA  . LEU A 111 ? 0.8387 0.7432 0.9130 0.0852  0.0340  -0.0778 552 LEU A CA  
835  C C   . LEU A 111 ? 0.8813 0.7441 0.8999 0.0996  0.0200  -0.0663 552 LEU A C   
836  O O   . LEU A 111 ? 0.8871 0.7357 0.8814 0.0996  0.0397  -0.0464 552 LEU A O   
837  C CB  . LEU A 111 ? 0.8698 0.7511 0.9229 0.0766  0.0417  -0.0802 552 LEU A CB  
838  C CG  . LEU A 111 ? 0.8650 0.7709 0.9559 0.0592  0.0651  -0.0846 552 LEU A CG  
839  C CD1 . LEU A 111 ? 0.9121 0.7867 0.9752 0.0528  0.0700  -0.0877 552 LEU A CD1 
840  C CD2 . LEU A 111 ? 0.8614 0.7766 0.9574 0.0539  0.0950  -0.0637 552 LEU A CD2 
841  N N   . ILE A 112 ? 0.9332 0.7730 0.9301 0.1112  -0.0148 -0.0799 553 ILE A N   
842  C CA  . ILE A 112 ? 0.9746 0.7617 0.9058 0.1245  -0.0307 -0.0698 553 ILE A CA  
843  C C   . ILE A 112 ? 0.9387 0.7395 0.8848 0.1323  -0.0323 -0.0627 553 ILE A C   
844  O O   . ILE A 112 ? 0.9008 0.6640 0.7980 0.1351  -0.0234 -0.0455 553 ILE A O   
845  C CB  . ILE A 112 ? 1.0275 0.7801 0.9262 0.1368  -0.0748 -0.0870 553 ILE A CB  
846  C CG1 . ILE A 112 ? 1.1115 0.8399 0.9816 0.1275  -0.0705 -0.0924 553 ILE A CG1 
847  C CG2 . ILE A 112 ? 1.0739 0.7614 0.8942 0.1506  -0.0931 -0.0759 553 ILE A CG2 
848  C CD1 . ILE A 112 ? 1.1995 0.9122 1.0614 0.1364  -0.1174 -0.1163 553 ILE A CD1 
849  N N   . ASP A 113 ? 0.9116 0.7640 0.9249 0.1341  -0.0406 -0.0774 554 ASP A N   
850  C CA  . ASP A 113 ? 0.9350 0.8004 0.9641 0.1409  -0.0405 -0.0727 554 ASP A CA  
851  C C   . ASP A 113 ? 0.9067 0.7795 0.9319 0.1285  -0.0026 -0.0511 554 ASP A C   
852  O O   . ASP A 113 ? 0.9455 0.7949 0.9407 0.1321  0.0017  -0.0372 554 ASP A O   
853  C CB  . ASP A 113 ? 0.9210 0.8415 1.0262 0.1439  -0.0514 -0.0957 554 ASP A CB  
854  C CG  . ASP A 113 ? 0.9707 0.8935 1.0837 0.1557  -0.0592 -0.0947 554 ASP A CG  
855  O OD1 . ASP A 113 ? 1.0485 0.9270 1.1172 0.1726  -0.0861 -0.0913 554 ASP A OD1 
856  O OD2 . ASP A 113 ? 0.9709 0.9334 1.1282 0.1478  -0.0383 -0.0972 554 ASP A OD2 
857  N N   . ILE A 114 ? 0.8260 0.7283 0.8809 0.1137  0.0226  -0.0491 555 ILE A N   
858  C CA  . ILE A 114 ? 0.7603 0.6688 0.8133 0.1037  0.0530  -0.0300 555 ILE A CA  
859  C C   . ILE A 114 ? 0.8004 0.6651 0.7995 0.1053  0.0622  -0.0126 555 ILE A C   
860  O O   . ILE A 114 ? 0.8142 0.6756 0.8062 0.1037  0.0746  0.0003  555 ILE A O   
861  C CB  . ILE A 114 ? 0.7421 0.6724 0.8201 0.0900  0.0739  -0.0298 555 ILE A CB  
862  C CG1 . ILE A 114 ? 0.7205 0.6927 0.8500 0.0832  0.0755  -0.0450 555 ILE A CG1 
863  C CG2 . ILE A 114 ? 0.7405 0.6662 0.8077 0.0839  0.0989  -0.0089 555 ILE A CG2 
864  C CD1 . ILE A 114 ? 0.7317 0.7173 0.8816 0.0685  0.0920  -0.0505 555 ILE A CD1 
865  N N   . ALA A 115 ? 0.8497 0.6795 0.8107 0.1071  0.0573  -0.0145 556 ALA A N   
866  C CA  . ALA A 115 ? 0.9006 0.6827 0.8053 0.1065  0.0710  -0.0011 556 ALA A CA  
867  C C   . ALA A 115 ? 0.9382 0.6869 0.8050 0.1135  0.0604  0.0044  556 ALA A C   
868  O O   . ALA A 115 ? 0.9345 0.6649 0.7803 0.1079  0.0822  0.0176  556 ALA A O   
869  C CB  . ALA A 115 ? 0.9550 0.6986 0.8172 0.1071  0.0653  -0.0074 556 ALA A CB  
870  N N   . ARG A 116 ? 0.9952 0.7352 0.8561 0.1259  0.0266  -0.0072 557 ARG A N   
871  C CA  . ARG A 116 ? 1.0588 0.7580 0.8777 0.1354  0.0108  -0.0029 557 ARG A CA  
872  C C   . ARG A 116 ? 1.0074 0.7315 0.8551 0.1308  0.0271  0.0059  557 ARG A C   
873  O O   . ARG A 116 ? 1.0613 0.7478 0.8689 0.1287  0.0358  0.0170  557 ARG A O   
874  C CB  . ARG A 116 ? 1.1311 0.8284 0.9578 0.1532  -0.0331 -0.0204 557 ARG A CB  
875  C CG  . ARG A 116 ? 1.2512 0.8825 1.0112 0.1669  -0.0581 -0.0163 557 ARG A CG  
876  C CD  . ARG A 116 ? 1.2793 0.9293 1.0763 0.1854  -0.0928 -0.0306 557 ARG A CD  
877  N NE  . ARG A 116 ? 1.3122 0.9760 1.1269 0.1813  -0.0738 -0.0212 557 ARG A NE  
878  C CZ  . ARG A 116 ? 1.2436 0.9684 1.1306 0.1806  -0.0679 -0.0301 557 ARG A CZ  
879  N NH1 . ARG A 116 ? 1.2254 1.0066 1.1799 0.1830  -0.0768 -0.0496 557 ARG A NH1 
880  N NH2 . ARG A 116 ? 1.2341 0.9599 1.1232 0.1757  -0.0512 -0.0206 557 ARG A NH2 
881  N N   . GLN A 117 ? 0.9310 0.7148 0.8447 0.1275  0.0317  0.0000  558 GLN A N   
882  C CA  . GLN A 117 ? 0.8901 0.6973 0.8297 0.1233  0.0432  0.0058  558 GLN A CA  
883  C C   . GLN A 117 ? 0.8756 0.6816 0.8091 0.1094  0.0748  0.0220  558 GLN A C   
884  O O   . GLN A 117 ? 0.9052 0.6946 0.8232 0.1056  0.0835  0.0306  558 GLN A O   
885  C CB  . GLN A 117 ? 0.8622 0.7263 0.8649 0.1217  0.0422  -0.0058 558 GLN A CB  
886  C CG  . GLN A 117 ? 0.8513 0.7269 0.8779 0.1355  0.0133  -0.0264 558 GLN A CG  
887  C CD  . GLN A 117 ? 0.8093 0.7387 0.8969 0.1300  0.0217  -0.0390 558 GLN A CD  
888  O OE1 . GLN A 117 ? 0.7993 0.7425 0.8969 0.1228  0.0376  -0.0322 558 GLN A OE1 
889  N NE2 . GLN A 117 ? 0.8152 0.7728 0.9421 0.1313  0.0126  -0.0586 558 GLN A NE2 
890  N N   . THR A 118 ? 0.8532 0.6766 0.8024 0.1021  0.0913  0.0247  559 THR A N   
891  C CA  . THR A 118 ? 0.8379 0.6625 0.7898 0.0918  0.1190  0.0372  559 THR A CA  
892  C C   . THR A 118 ? 0.9172 0.6920 0.8189 0.0889  0.1302  0.0441  559 THR A C   
893  O O   . THR A 118 ? 0.9420 0.7184 0.8510 0.0803  0.1488  0.0515  559 THR A O   
894  C CB  . THR A 118 ? 0.8124 0.6467 0.7760 0.0884  0.1322  0.0375  559 THR A CB  
895  O OG1 . THR A 118 ? 0.7768 0.6473 0.7776 0.0885  0.1239  0.0306  559 THR A OG1 
896  C CG2 . THR A 118 ? 0.8027 0.6463 0.7838 0.0809  0.1580  0.0476  559 THR A CG2 
897  N N   . ALA A 119 ? 0.9760 0.7034 0.8243 0.0948  0.1190  0.0404  560 ALA A N   
898  C CA  . ALA A 119 ? 1.0291 0.6942 0.8125 0.0906  0.1307  0.0466  560 ALA A CA  
899  C C   . ALA A 119 ? 1.0334 0.6775 0.7989 0.0917  0.1220  0.0502  560 ALA A C   
900  O O   . ALA A 119 ? 1.0609 0.6730 0.7981 0.0806  0.1444  0.0577  560 ALA A O   
901  C CB  . ALA A 119 ? 1.0881 0.6996 0.8082 0.0978  0.1147  0.0414  560 ALA A CB  
902  N N   . GLN A 120 ? 1.0154 0.6770 0.7998 0.1042  0.0915  0.0430  561 GLN A N   
903  C CA  . GLN A 120 ? 1.0513 0.6939 0.8228 0.1082  0.0798  0.0444  561 GLN A CA  
904  C C   . GLN A 120 ? 1.0313 0.7024 0.8377 0.0934  0.1053  0.0515  561 GLN A C   
905  O O   . GLN A 120 ? 1.1017 0.7351 0.8758 0.0860  0.1155  0.0576  561 GLN A O   
906  C CB  . GLN A 120 ? 1.0358 0.7086 0.8429 0.1246  0.0465  0.0314  561 GLN A CB  
907  C CG  . GLN A 120 ? 1.0802 0.7207 0.8646 0.1346  0.0273  0.0300  561 GLN A CG  
908  C CD  . GLN A 120 ? 1.1670 0.7294 0.8732 0.1471  0.0038  0.0311  561 GLN A CD  
909  O OE1 . GLN A 120 ? 1.1892 0.7466 0.8935 0.1648  -0.0297 0.0194  561 GLN A OE1 
910  N NE2 . GLN A 120 ? 1.2384 0.7363 0.8779 0.1371  0.0208  0.0442  561 GLN A NE2 
911  N N   . GLY A 121 ? 0.9554 0.6888 0.8245 0.0887  0.1141  0.0500  562 GLY A N   
912  C CA  . GLY A 121 ? 0.9101 0.6760 0.8180 0.0763  0.1317  0.0548  562 GLY A CA  
913  C C   . GLY A 121 ? 0.9406 0.6884 0.8380 0.0614  0.1619  0.0620  562 GLY A C   
914  O O   . GLY A 121 ? 0.9649 0.7091 0.8681 0.0504  0.1736  0.0647  562 GLY A O   
915  N N   . MET A 122 ? 0.9452 0.6820 0.8300 0.0600  0.1763  0.0629  563 MET A N   
916  C CA  . MET A 122 ? 0.9576 0.6779 0.8367 0.0458  0.2100  0.0661  563 MET A CA  
917  C C   . MET A 122 ? 1.0491 0.7016 0.8619 0.0374  0.2212  0.0690  563 MET A C   
918  O O   . MET A 122 ? 1.0663 0.7120 0.8865 0.0210  0.2478  0.0702  563 MET A O   
919  C CB  . MET A 122 ? 0.9669 0.6835 0.8405 0.0479  0.2230  0.0643  563 MET A CB  
920  C CG  . MET A 122 ? 0.9376 0.7125 0.8719 0.0543  0.2159  0.0626  563 MET A CG  
921  S SD  . MET A 122 ? 0.8995 0.7322 0.9102 0.0469  0.2257  0.0645  563 MET A SD  
922  C CE  . MET A 122 ? 0.9515 0.7712 0.9715 0.0349  0.2667  0.0619  563 MET A CE  
923  N N   . ASP A 123 ? 1.1241 0.7236 0.8713 0.0482  0.2000  0.0693  564 ASP A N   
924  C CA  . ASP A 123 ? 1.2548 0.7769 0.9252 0.0423  0.2050  0.0737  564 ASP A CA  
925  C C   . ASP A 123 ? 1.2340 0.7658 0.9278 0.0323  0.2103  0.0755  564 ASP A C   
926  O O   . ASP A 123 ? 1.2704 0.7642 0.9371 0.0138  0.2395  0.0785  564 ASP A O   
927  C CB  . ASP A 123 ? 1.3567 0.8279 0.9639 0.0618  0.1665  0.0726  564 ASP A CB  
928  C CG  . ASP A 123 ? 1.4923 0.8657 1.0013 0.0573  0.1692  0.0790  564 ASP A CG  
929  O OD1 . ASP A 123 ? 1.5607 0.8873 1.0230 0.0392  0.2056  0.0831  564 ASP A OD1 
930  O OD2 . ASP A 123 ? 1.5472 0.8865 1.0236 0.0720  0.1360  0.0792  564 ASP A OD2 
931  N N   . TYR A 124 ? 1.1571 0.7391 0.9016 0.0426  0.1850  0.0722  565 TYR A N   
932  C CA  . TYR A 124 ? 1.1070 0.7011 0.8754 0.0346  0.1855  0.0721  565 TYR A CA  
933  C C   . TYR A 124 ? 1.0630 0.6913 0.8805 0.0126  0.2180  0.0719  565 TYR A C   
934  O O   . TYR A 124 ? 1.1202 0.7225 0.9255 -0.0034 0.2344  0.0727  565 TYR A O   
935  C CB  . TYR A 124 ? 1.0420 0.6883 0.8583 0.0490  0.1559  0.0663  565 TYR A CB  
936  C CG  . TYR A 124 ? 1.0334 0.6884 0.8687 0.0424  0.1531  0.0644  565 TYR A CG  
937  C CD1 . TYR A 124 ? 1.0777 0.6794 0.8662 0.0483  0.1392  0.0642  565 TYR A CD1 
938  C CD2 . TYR A 124 ? 0.9616 0.6738 0.8584 0.0313  0.1614  0.0623  565 TYR A CD2 
939  C CE1 . TYR A 124 ? 1.0761 0.6821 0.8796 0.0419  0.1373  0.0613  565 TYR A CE1 
940  C CE2 . TYR A 124 ? 0.9632 0.6799 0.8730 0.0243  0.1574  0.0593  565 TYR A CE2 
941  C CZ  . TYR A 124 ? 1.0267 0.6910 0.8905 0.0289  0.1470  0.0584  565 TYR A CZ  
942  O OH  . TYR A 124 ? 1.0524 0.7173 0.9266 0.0215  0.1437  0.0542  565 TYR A OH  
943  N N   . LEU A 125 ? 0.9963 0.6817 0.8715 0.0123  0.2259  0.0697  566 LEU A N   
944  C CA  . LEU A 125 ? 0.9694 0.6955 0.9043 -0.0043 0.2506  0.0668  566 LEU A CA  
945  C C   . LEU A 125 ? 1.0415 0.7264 0.9508 -0.0238 0.2906  0.0658  566 LEU A C   
946  O O   . LEU A 125 ? 1.0721 0.7620 1.0074 -0.0431 0.3118  0.0618  566 LEU A O   
947  C CB  . LEU A 125 ? 0.9165 0.7025 0.9107 0.0038  0.2468  0.0650  566 LEU A CB  
948  C CG  . LEU A 125 ? 0.8871 0.7157 0.9107 0.0177  0.2148  0.0651  566 LEU A CG  
949  C CD1 . LEU A 125 ? 0.8660 0.7360 0.9314 0.0250  0.2144  0.0650  566 LEU A CD1 
950  C CD2 . LEU A 125 ? 0.8758 0.7303 0.9322 0.0102  0.2053  0.0628  566 LEU A CD2 
951  N N   . HIS A 126 ? 1.0554 0.6977 0.9130 -0.0204 0.3027  0.0678  567 HIS A N   
952  C CA  . HIS A 126 ? 1.1176 0.7116 0.9394 -0.0401 0.3454  0.0658  567 HIS A CA  
953  C C   . HIS A 126 ? 1.2150 0.7375 0.9690 -0.0546 0.3552  0.0694  567 HIS A C   
954  O O   . HIS A 126 ? 1.3290 0.8222 1.0723 -0.0790 0.3965  0.0656  567 HIS A O   
955  C CB  . HIS A 126 ? 1.1622 0.7157 0.9280 -0.0323 0.3522  0.0671  567 HIS A CB  
956  C CG  . HIS A 126 ? 1.0928 0.7050 0.9226 -0.0250 0.3584  0.0618  567 HIS A CG  
957  N ND1 . HIS A 126 ? 1.1326 0.7163 0.9307 -0.0254 0.3807  0.0588  567 HIS A ND1 
958  C CD2 . HIS A 126 ? 1.0043 0.6956 0.9235 -0.0175 0.3459  0.0587  567 HIS A CD2 
959  C CE1 . HIS A 126 ? 1.0836 0.7288 0.9533 -0.0171 0.3811  0.0540  567 HIS A CE1 
960  N NE2 . HIS A 126 ? 0.9980 0.7071 0.9398 -0.0119 0.3590  0.0546  567 HIS A NE2 
961  N N   . ALA A 127 ? 1.2314 0.7230 0.9398 -0.0399 0.3190  0.0754  568 ALA A N   
962  C CA  . ALA A 127 ? 1.2885 0.7081 0.9307 -0.0501 0.3218  0.0797  568 ALA A CA  
963  C C   . ALA A 127 ? 1.2654 0.7233 0.9696 -0.0691 0.3347  0.0745  568 ALA A C   
964  O O   . ALA A 127 ? 1.3289 0.7350 0.9976 -0.0918 0.3619  0.0744  568 ALA A O   
965  C CB  . ALA A 127 ? 1.2994 0.6851 0.8914 -0.0248 0.2751  0.0849  568 ALA A CB  
966  N N   . LYS A 128 ? 1.3141 0.7782 0.9512 -0.1972 0.2348  0.0263  569 LYS A N   
967  C CA  . LYS A 128 ? 1.2779 0.7742 0.9989 -0.2236 0.2332  0.0047  569 LYS A CA  
968  C C   . LYS A 128 ? 1.2563 0.8095 1.0386 -0.2459 0.2628  0.0013  569 LYS A C   
969  O O   . LYS A 128 ? 1.2362 0.8185 1.0972 -0.2677 0.2583  -0.0191 569 LYS A O   
970  C CB  . LYS A 128 ? 1.2166 0.7528 0.9612 -0.2084 0.1934  -0.0291 569 LYS A CB  
971  C CG  . LYS A 128 ? 1.2354 0.7264 0.9490 -0.1909 0.1660  -0.0362 569 LYS A CG  
972  C CD  . LYS A 128 ? 1.2576 0.7282 1.0185 -0.2080 0.1531  -0.0564 569 LYS A CD  
973  C CE  . LYS A 128 ? 1.2829 0.7076 1.0174 -0.1883 0.1275  -0.0668 569 LYS A CE  
974  N NZ  . LYS A 128 ? 1.3381 0.7286 1.1169 -0.2055 0.1160  -0.0845 569 LYS A NZ  
975  N N   . SER A 129 ? 1.2758 0.8454 1.0271 -0.2386 0.2904  0.0173  570 SER A N   
976  C CA  . SER A 129 ? 1.2677 0.9003 1.0811 -0.2536 0.3188  0.0095  570 SER A CA  
977  C C   . SER A 129 ? 1.2056 0.9111 1.0739 -0.2437 0.2855  -0.0239 570 SER A C   
978  O O   . SER A 129 ? 1.2411 0.9987 1.1924 -0.2606 0.2921  -0.0417 570 SER A O   
979  C CB  . SER A 129 ? 1.2898 0.9190 1.1775 -0.2928 0.3530  0.0145  570 SER A CB  
980  O OG  . SER A 129 ? 1.3936 0.9483 1.2247 -0.3035 0.3872  0.0514  570 SER A OG  
981  N N   . ILE A 130 ? 1.1481 0.8553 0.9727 -0.2163 0.2494  -0.0318 571 ILE A N   
982  C CA  . ILE A 130 ? 1.0826 0.8483 0.9392 -0.2037 0.2199  -0.0555 571 ILE A CA  
983  C C   . ILE A 130 ? 1.0693 0.8557 0.8930 -0.1818 0.2257  -0.0480 571 ILE A C   
984  O O   . ILE A 130 ? 1.0836 0.8354 0.8401 -0.1624 0.2226  -0.0336 571 ILE A O   
985  C CB  . ILE A 130 ? 1.0701 0.8254 0.9031 -0.1890 0.1808  -0.0682 571 ILE A CB  
986  C CG1 . ILE A 130 ? 1.1111 0.8505 0.9826 -0.2078 0.1694  -0.0846 571 ILE A CG1 
987  C CG2 . ILE A 130 ? 1.0014 0.8068 0.8457 -0.1728 0.1539  -0.0835 571 ILE A CG2 
988  C CD1 . ILE A 130 ? 1.1155 0.8255 0.9488 -0.1931 0.1426  -0.0939 571 ILE A CD1 
989  N N   . ILE A 131 ? 1.0418 0.8835 0.9193 -0.1839 0.2311  -0.0610 572 ILE A N   
990  C CA  . ILE A 131 ? 1.0081 0.8761 0.8685 -0.1612 0.2286  -0.0616 572 ILE A CA  
991  C C   . ILE A 131 ? 0.9543 0.8533 0.8325 -0.1472 0.1850  -0.0772 572 ILE A C   
992  O O   . ILE A 131 ? 0.9765 0.9073 0.9106 -0.1569 0.1674  -0.0951 572 ILE A O   
993  C CB  . ILE A 131 ? 1.0211 0.9323 0.9361 -0.1696 0.2608  -0.0693 572 ILE A CB  
994  C CG1 . ILE A 131 ? 1.0868 0.9641 0.9751 -0.1848 0.3135  -0.0488 572 ILE A CG1 
995  C CG2 . ILE A 131 ? 1.0143 0.9539 0.9193 -0.1431 0.2512  -0.0763 572 ILE A CG2 
996  C CD1 . ILE A 131 ? 1.0886 1.0117 1.0592 -0.2067 0.3544  -0.0581 572 ILE A CD1 
997  N N   . HIS A 132 ? 0.9222 0.8090 0.7530 -0.1244 0.1663  -0.0700 573 HIS A N   
998  C CA  . HIS A 132 ? 0.8928 0.7985 0.7292 -0.1127 0.1299  -0.0774 573 HIS A CA  
999  C C   . HIS A 132 ? 0.8851 0.8387 0.7711 -0.1063 0.1147  -0.0905 573 HIS A C   
1000 O O   . HIS A 132 ? 0.9036 0.8761 0.8108 -0.1058 0.0863  -0.1005 573 HIS A O   
1001 C CB  . HIS A 132 ? 0.8935 0.7729 0.6787 -0.0933 0.1177  -0.0645 573 HIS A CB  
1002 C CG  . HIS A 132 ? 0.8951 0.7832 0.6769 -0.0862 0.0901  -0.0658 573 HIS A CG  
1003 N ND1 . HIS A 132 ? 0.8834 0.7906 0.6736 -0.0726 0.0713  -0.0630 573 HIS A ND1 
1004 C CD2 . HIS A 132 ? 0.9420 0.8202 0.7098 -0.0905 0.0804  -0.0690 573 HIS A CD2 
1005 C CE1 . HIS A 132 ? 0.9167 0.8231 0.6929 -0.0703 0.0546  -0.0600 573 HIS A CE1 
1006 N NE2 . HIS A 132 ? 0.9406 0.8318 0.7009 -0.0799 0.0607  -0.0654 573 HIS A NE2 
1007 N N   . ARG A 133 ? 0.8661 0.8351 0.7643 -0.0980 0.1311  -0.0915 574 ARG A N   
1008 C CA  . ARG A 133 ? 0.8346 0.8486 0.7871 -0.0885 0.1183  -0.1069 574 ARG A CA  
1009 C C   . ARG A 133 ? 0.8220 0.8385 0.7644 -0.0675 0.0807  -0.1039 574 ARG A C   
1010 O O   . ARG A 133 ? 0.8481 0.8923 0.8282 -0.0548 0.0694  -0.1147 574 ARG A O   
1011 C CB  . ARG A 133 ? 0.8309 0.8835 0.8573 -0.1040 0.1112  -0.1268 574 ARG A CB  
1012 C CG  . ARG A 133 ? 0.8637 0.9324 0.9370 -0.1251 0.1530  -0.1341 574 ARG A CG  
1013 C CD  . ARG A 133 ? 0.8857 0.9876 1.0396 -0.1422 0.1367  -0.1561 574 ARG A CD  
1014 N NE  . ARG A 133 ? 0.9333 1.0682 1.1635 -0.1612 0.1772  -0.1675 574 ARG A NE  
1015 C CZ  . ARG A 133 ? 0.9991 1.1171 1.2424 -0.1882 0.2152  -0.1599 574 ARG A CZ  
1016 N NH1 . ARG A 133 ? 1.0364 1.1899 1.3572 -0.2061 0.2580  -0.1688 574 ARG A NH1 
1017 N NH2 . ARG A 133 ? 1.0056 1.0713 1.1906 -0.1978 0.2131  -0.1435 574 ARG A NH2 
1018 N N   . ASP A 134 ? 0.8240 0.8119 0.7215 -0.0641 0.0631  -0.0895 575 ASP A N   
1019 C CA  . ASP A 134 ? 0.8386 0.8244 0.7280 -0.0480 0.0326  -0.0811 575 ASP A CA  
1020 C C   . ASP A 134 ? 0.8416 0.7921 0.6828 -0.0424 0.0328  -0.0626 575 ASP A C   
1021 O O   . ASP A 134 ? 0.8421 0.7839 0.6679 -0.0393 0.0157  -0.0508 575 ASP A O   
1022 C CB  . ASP A 134 ? 0.8564 0.8567 0.7603 -0.0498 0.0029  -0.0855 575 ASP A CB  
1023 C CG  . ASP A 134 ? 0.8997 0.8996 0.8054 -0.0330 -0.0291 -0.0757 575 ASP A CG  
1024 O OD1 . ASP A 134 ? 0.8992 0.9013 0.8233 -0.0201 -0.0319 -0.0748 575 ASP A OD1 
1025 O OD2 . ASP A 134 ? 0.9651 0.9582 0.8499 -0.0316 -0.0529 -0.0690 575 ASP A OD2 
1026 N N   . LEU A 135 ? 0.8304 0.7599 0.6489 -0.0399 0.0523  -0.0601 576 LEU A N   
1027 C CA  . LEU A 135 ? 0.8310 0.7304 0.6186 -0.0328 0.0490  -0.0477 576 LEU A CA  
1028 C C   . LEU A 135 ? 0.8468 0.7482 0.6517 -0.0171 0.0281  -0.0436 576 LEU A C   
1029 O O   . LEU A 135 ? 0.8932 0.8066 0.7179 -0.0066 0.0236  -0.0535 576 LEU A O   
1030 C CB  . LEU A 135 ? 0.8536 0.7249 0.6099 -0.0299 0.0674  -0.0483 576 LEU A CB  
1031 C CG  . LEU A 135 ? 0.8564 0.6965 0.5899 -0.0188 0.0584  -0.0410 576 LEU A CG  
1032 C CD1 . LEU A 135 ? 0.8345 0.6685 0.5649 -0.0276 0.0574  -0.0344 576 LEU A CD1 
1033 C CD2 . LEU A 135 ? 0.9187 0.7255 0.6124 -0.0116 0.0701  -0.0425 576 LEU A CD2 
1034 N N   . LYS A 136 ? 0.8498 0.7397 0.6520 -0.0159 0.0171  -0.0297 577 LYS A N   
1035 C CA  . LYS A 136 ? 0.8200 0.7055 0.6464 -0.0043 -0.0026 -0.0223 577 LYS A CA  
1036 C C   . LYS A 136 ? 0.8095 0.6822 0.6337 -0.0094 -0.0018 -0.0046 577 LYS A C   
1037 O O   . LYS A 136 ? 0.8314 0.7040 0.6323 -0.0197 0.0118  -0.0001 577 LYS A O   
1038 C CB  . LYS A 136 ? 0.8029 0.7065 0.6551 -0.0009 -0.0213 -0.0215 577 LYS A CB  
1039 C CG  . LYS A 136 ? 0.8062 0.7221 0.6453 -0.0120 -0.0223 -0.0168 577 LYS A CG  
1040 C CD  . LYS A 136 ? 0.8178 0.7359 0.6712 -0.0061 -0.0489 -0.0054 577 LYS A CD  
1041 C CE  . LYS A 136 ? 0.8598 0.8005 0.7213 -0.0073 -0.0612 -0.0193 577 LYS A CE  
1042 N NZ  . LYS A 136 ? 0.9319 0.8660 0.7923 0.0001  -0.0927 -0.0056 577 LYS A NZ  
1043 N N   . SER A 137 ? 0.7936 0.6566 0.6473 -0.0023 -0.0156 0.0037  578 SER A N   
1044 C CA  . SER A 137 ? 0.7863 0.6397 0.6517 -0.0079 -0.0083 0.0186  578 SER A CA  
1045 C C   . SER A 137 ? 0.8023 0.6616 0.6456 -0.0202 0.0049  0.0377  578 SER A C   
1046 O O   . SER A 137 ? 0.8155 0.6723 0.6576 -0.0266 0.0228  0.0468  578 SER A O   
1047 C CB  . SER A 137 ? 0.7822 0.6247 0.6982 -0.0005 -0.0268 0.0242  578 SER A CB  
1048 O OG  . SER A 137 ? 0.8018 0.6443 0.7356 -0.0011 -0.0412 0.0395  578 SER A OG  
1049 N N   . ASN A 138 ? 0.8343 0.7011 0.6590 -0.0213 -0.0045 0.0416  579 ASN A N   
1050 C CA  . ASN A 138 ? 0.8849 0.7506 0.6734 -0.0286 0.0026  0.0591  579 ASN A CA  
1051 C C   . ASN A 138 ? 0.8862 0.7593 0.6335 -0.0342 0.0173  0.0448  579 ASN A C   
1052 O O   . ASN A 138 ? 0.9401 0.8102 0.6478 -0.0377 0.0260  0.0543  579 ASN A O   
1053 C CB  . ASN A 138 ? 0.9235 0.7880 0.7070 -0.0236 -0.0228 0.0684  579 ASN A CB  
1054 C CG  . ASN A 138 ? 1.0297 0.8776 0.7747 -0.0273 -0.0198 0.0987  579 ASN A CG  
1055 O OD1 . ASN A 138 ? 1.1383 0.9732 0.8828 -0.0218 -0.0431 0.1149  579 ASN A OD1 
1056 N ND2 . ASN A 138 ? 1.0901 0.9352 0.7993 -0.0348 0.0090  0.1069  579 ASN A ND2 
1057 N N   . ASN A 139 ? 0.8636 0.7427 0.6165 -0.0343 0.0201  0.0224  580 ASN A N   
1058 C CA  . ASN A 139 ? 0.8896 0.7706 0.6133 -0.0408 0.0319  0.0076  580 ASN A CA  
1059 C C   . ASN A 139 ? 0.8874 0.7570 0.6133 -0.0416 0.0500  0.0011  580 ASN A C   
1060 O O   . ASN A 139 ? 0.8842 0.7488 0.5976 -0.0456 0.0571  -0.0138 580 ASN A O   
1061 C CB  . ASN A 139 ? 0.8867 0.7799 0.6193 -0.0435 0.0227  -0.0108 580 ASN A CB  
1062 C CG  . ASN A 139 ? 0.8889 0.7958 0.6260 -0.0404 -0.0007 -0.0102 580 ASN A CG  
1063 O OD1 . ASN A 139 ? 0.9283 0.8295 0.6366 -0.0379 -0.0104 0.0024  580 ASN A OD1 
1064 N ND2 . ASN A 139 ? 0.8753 0.7991 0.6469 -0.0391 -0.0096 -0.0243 580 ASN A ND2 
1065 N N   . ILE A 140 ? 0.8818 0.7455 0.6307 -0.0373 0.0545  0.0118  581 ILE A N   
1066 C CA  . ILE A 140 ? 0.8481 0.7018 0.6087 -0.0347 0.0661  0.0047  581 ILE A CA  
1067 C C   . ILE A 140 ? 0.8497 0.7095 0.6222 -0.0368 0.0827  0.0176  581 ILE A C   
1068 O O   . ILE A 140 ? 0.8150 0.6771 0.6197 -0.0368 0.0802  0.0337  581 ILE A O   
1069 C CB  . ILE A 140 ? 0.8457 0.6878 0.6362 -0.0249 0.0522  0.0000  581 ILE A CB  
1070 C CG1 . ILE A 140 ? 0.8587 0.6962 0.6305 -0.0229 0.0440  -0.0101 581 ILE A CG1 
1071 C CG2 . ILE A 140 ? 0.8550 0.6834 0.6597 -0.0187 0.0562  -0.0095 581 ILE A CG2 
1072 C CD1 . ILE A 140 ? 0.8859 0.7038 0.6622 -0.0098 0.0330  -0.0186 581 ILE A CD1 
1073 N N   . PHE A 141 ? 0.8918 0.7539 0.6412 -0.0389 0.1018  0.0099  582 PHE A N   
1074 C CA  . PHE A 141 ? 0.9108 0.7826 0.6669 -0.0409 0.1275  0.0202  582 PHE A CA  
1075 C C   . PHE A 141 ? 0.8793 0.7526 0.6893 -0.0356 0.1359  0.0089  582 PHE A C   
1076 O O   . PHE A 141 ? 0.8732 0.7340 0.6888 -0.0289 0.1233  -0.0101 582 PHE A O   
1077 C CB  . PHE A 141 ? 0.9616 0.8365 0.6588 -0.0420 0.1433  0.0133  582 PHE A CB  
1078 C CG  . PHE A 141 ? 1.0791 0.9601 0.7483 -0.0450 0.1663  0.0360  582 PHE A CG  
1079 C CD1 . PHE A 141 ? 1.1374 1.0113 0.7617 -0.0465 0.1532  0.0549  582 PHE A CD1 
1080 C CD2 . PHE A 141 ? 1.1306 1.0231 0.8187 -0.0453 0.2025  0.0398  582 PHE A CD2 
1081 C CE1 . PHE A 141 ? 1.2081 1.0781 0.7921 -0.0482 0.1753  0.0813  582 PHE A CE1 
1082 C CE2 . PHE A 141 ? 1.1651 1.0601 0.8198 -0.0493 0.2319  0.0654  582 PHE A CE2 
1083 C CZ  . PHE A 141 ? 1.2009 1.0807 0.7961 -0.0507 0.2181  0.0884  582 PHE A CZ  
1084 N N   . LEU A 142 ? 0.8770 0.7635 0.7307 -0.0385 0.1559  0.0218  583 LEU A N   
1085 C CA  . LEU A 142 ? 0.8548 0.7485 0.7799 -0.0330 0.1610  0.0095  583 LEU A CA  
1086 C C   . LEU A 142 ? 0.8857 0.7981 0.8106 -0.0337 0.1998  0.0026  583 LEU A C   
1087 O O   . LEU A 142 ? 0.9016 0.8334 0.8634 -0.0407 0.2313  0.0174  583 LEU A O   
1088 C CB  . LEU A 142 ? 0.8842 0.7835 0.8801 -0.0375 0.1558  0.0265  583 LEU A CB  
1089 C CG  . LEU A 142 ? 0.8982 0.7920 0.9693 -0.0268 0.1276  0.0089  583 LEU A CG  
1090 C CD1 . LEU A 142 ? 0.9310 0.8275 1.0274 -0.0152 0.1293  -0.0185 583 LEU A CD1 
1091 C CD2 . LEU A 142 ? 0.9037 0.7729 0.9432 -0.0181 0.0880  0.0033  583 LEU A CD2 
1092 N N   . HIS A 143 ? 0.9009 0.8065 0.7849 -0.0266 0.1998  -0.0203 584 HIS A N   
1093 C CA  . HIS A 143 ? 0.9355 0.8561 0.7967 -0.0244 0.2352  -0.0313 584 HIS A CA  
1094 C C   . HIS A 143 ? 0.9513 0.8963 0.8949 -0.0202 0.2609  -0.0412 584 HIS A C   
1095 O O   . HIS A 143 ? 0.9254 0.8669 0.9347 -0.0119 0.2388  -0.0568 584 HIS A O   
1096 C CB  . HIS A 143 ? 0.9427 0.8465 0.7559 -0.0162 0.2227  -0.0590 584 HIS A CB  
1097 C CG  . HIS A 143 ? 0.9857 0.9026 0.7681 -0.0103 0.2555  -0.0765 584 HIS A CG  
1098 N ND1 . HIS A 143 ? 0.9693 0.8820 0.7663 0.0021  0.2557  -0.1100 584 HIS A ND1 
1099 C CD2 . HIS A 143 ? 1.0259 0.9576 0.7605 -0.0128 0.2897  -0.0658 584 HIS A CD2 
1100 C CE1 . HIS A 143 ? 1.0286 0.9568 0.7911 0.0078  0.2891  -0.1232 584 HIS A CE1 
1101 N NE2 . HIS A 143 ? 1.0618 1.0013 0.7806 -0.0009 0.3117  -0.0959 584 HIS A NE2 
1102 N N   . GLU A 144 ? 1.0326 1.0019 0.9720 -0.0250 0.3079  -0.0321 585 GLU A N   
1103 C CA  . GLU A 144 ? 1.0758 1.0776 1.1049 -0.0237 0.3433  -0.0405 585 GLU A CA  
1104 C C   . GLU A 144 ? 1.0109 1.0170 1.1489 -0.0256 0.3178  -0.0382 585 GLU A C   
1105 O O   . GLU A 144 ? 0.9460 0.9705 1.1746 -0.0167 0.3185  -0.0622 585 GLU A O   
1106 C CB  . GLU A 144 ? 1.1314 1.1419 1.1672 -0.0069 0.3530  -0.0809 585 GLU A CB  
1107 C CG  . GLU A 144 ? 1.2110 1.2630 1.2964 -0.0055 0.4124  -0.0895 585 GLU A CG  
1108 C CD  . GLU A 144 ? 1.3241 1.3831 1.3160 -0.0124 0.4622  -0.0693 585 GLU A CD  
1109 O OE1 . GLU A 144 ? 1.4005 1.4349 1.2848 -0.0065 0.4483  -0.0751 585 GLU A OE1 
1110 O OE2 . GLU A 144 ? 1.3833 1.4701 1.4086 -0.0232 0.5152  -0.0477 585 GLU A OE2 
1111 N N   . ASP A 145 ? 1.0182 1.0062 1.1471 -0.0349 0.2913  -0.0125 586 ASP A N   
1112 C CA  . ASP A 145 ? 0.9745 0.9587 1.1915 -0.0351 0.2579  -0.0112 586 ASP A CA  
1113 C C   . ASP A 145 ? 0.9523 0.9200 1.2024 -0.0156 0.2111  -0.0445 586 ASP A C   
1114 O O   . ASP A 145 ? 0.9420 0.9099 1.2754 -0.0106 0.1838  -0.0523 586 ASP A O   
1115 C CB  . ASP A 145 ? 0.9912 1.0084 1.3157 -0.0471 0.2938  0.0003  586 ASP A CB  
1116 C CG  . ASP A 145 ? 1.0532 1.0705 1.3497 -0.0682 0.3271  0.0445  586 ASP A CG  
1117 O OD1 . ASP A 145 ? 1.1005 1.0895 1.3302 -0.0714 0.3010  0.0646  586 ASP A OD1 
1118 O OD2 . ASP A 145 ? 1.1025 1.1466 1.4459 -0.0811 0.3804  0.0600  586 ASP A OD2 
1119 N N   . LEU A 146 ? 1.1037 0.7479 1.0961 0.0473  0.3457  -0.1184 587 LEU A N   
1120 C CA  . LEU A 146 ? 1.0563 0.7284 1.1097 0.0607  0.3146  -0.1259 587 LEU A CA  
1121 C C   . LEU A 146 ? 1.0308 0.6971 1.0381 0.0621  0.2716  -0.1124 587 LEU A C   
1122 O O   . LEU A 146 ? 1.0583 0.7539 1.0953 0.0695  0.2379  -0.1054 587 LEU A O   
1123 C CB  . LEU A 146 ? 1.0777 0.7368 1.1653 0.0718  0.3401  -0.1443 587 LEU A CB  
1124 C CG  . LEU A 146 ? 1.0969 0.7800 1.2770 0.0774  0.3765  -0.1646 587 LEU A CG  
1125 C CD1 . LEU A 146 ? 1.1410 0.8150 1.3575 0.0939  0.3887  -0.1812 587 LEU A CD1 
1126 C CD2 . LEU A 146 ? 1.0630 0.8047 1.3358 0.0832  0.3522  -0.1712 587 LEU A CD2 
1127 N N   . THR A 147 ? 1.0139 0.6429 0.9511 0.0551  0.2746  -0.1116 588 THR A N   
1128 C CA  . THR A 147 ? 0.9762 0.5956 0.8808 0.0529  0.2427  -0.1034 588 THR A CA  
1129 C C   . THR A 147 ? 0.9875 0.6085 0.8349 0.0390  0.2250  -0.0922 588 THR A C   
1130 O O   . THR A 147 ? 1.0472 0.6534 0.8444 0.0320  0.2398  -0.0948 588 THR A O   
1131 C CB  . THR A 147 ? 1.0048 0.5847 0.8814 0.0516  0.2556  -0.1174 588 THR A CB  
1132 O OG1 . THR A 147 ? 1.0339 0.6085 0.9616 0.0659  0.2798  -0.1304 588 THR A OG1 
1133 C CG2 . THR A 147 ? 1.0151 0.5831 0.8836 0.0501  0.2297  -0.1100 588 THR A CG2 
1134 N N   . VAL A 148 ? 0.9565 0.5939 0.8084 0.0380  0.1941  -0.0795 589 VAL A N   
1135 C CA  . VAL A 148 ? 0.9669 0.6102 0.7759 0.0261  0.1756  -0.0711 589 VAL A CA  
1136 C C   . VAL A 148 ? 1.0050 0.6241 0.7703 0.0150  0.1712  -0.0820 589 VAL A C   
1137 O O   . VAL A 148 ? 1.0165 0.6171 0.7941 0.0141  0.1712  -0.0881 589 VAL A O   
1138 C CB  . VAL A 148 ? 0.9463 0.6149 0.7769 0.0281  0.1490  -0.0566 589 VAL A CB  
1139 C CG1 . VAL A 148 ? 0.9464 0.6198 0.7413 0.0153  0.1319  -0.0516 589 VAL A CG1 
1140 C CG2 . VAL A 148 ? 0.9285 0.6277 0.7978 0.0357  0.1475  -0.0523 589 VAL A CG2 
1141 N N   . LYS A 149 ? 1.0275 0.6471 0.7443 0.0079  0.1664  -0.0858 590 LYS A N   
1142 C CA  . LYS A 149 ? 1.0514 0.6615 0.7334 -0.0035 0.1534  -0.1025 590 LYS A CA  
1143 C C   . LYS A 149 ? 1.0101 0.6485 0.6812 -0.0093 0.1259  -0.0949 590 LYS A C   
1144 O O   . LYS A 149 ? 1.0076 0.6571 0.6483 -0.0028 0.1211  -0.0868 590 LYS A O   
1145 C CB  . LYS A 149 ? 1.1085 0.6964 0.7351 -0.0016 0.1682  -0.1218 590 LYS A CB  
1146 C CG  . LYS A 149 ? 1.1351 0.6956 0.7723 0.0053  0.2019  -0.1310 590 LYS A CG  
1147 C CD  . LYS A 149 ? 1.1520 0.6913 0.8194 0.0000  0.2058  -0.1480 590 LYS A CD  
1148 C CE  . LYS A 149 ? 1.1783 0.6891 0.8505 0.0084  0.2406  -0.1630 590 LYS A CE  
1149 N NZ  . LYS A 149 ? 1.1818 0.6685 0.8954 0.0082  0.2468  -0.1738 590 LYS A NZ  
1150 N N   . ILE A 150 ? 0.9884 0.6353 0.6866 -0.0203 0.1116  -0.0965 591 ILE A N   
1151 C CA  . ILE A 150 ? 0.9675 0.6437 0.6657 -0.0277 0.0879  -0.0954 591 ILE A CA  
1152 C C   . ILE A 150 ? 0.9965 0.6756 0.6633 -0.0355 0.0740  -0.1238 591 ILE A C   
1153 O O   . ILE A 150 ? 1.0406 0.6983 0.7063 -0.0449 0.0813  -0.1477 591 ILE A O   
1154 C CB  . ILE A 150 ? 0.9583 0.6400 0.6992 -0.0373 0.0853  -0.0871 591 ILE A CB  
1155 C CG1 . ILE A 150 ? 0.9355 0.6197 0.6962 -0.0239 0.0921  -0.0618 591 ILE A CG1 
1156 C CG2 . ILE A 150 ? 0.9424 0.6573 0.6935 -0.0469 0.0654  -0.0907 591 ILE A CG2 
1157 C CD1 . ILE A 150 ? 0.9431 0.6293 0.7285 -0.0270 0.0913  -0.0483 591 ILE A CD1 
1158 N N   . GLY A 151 ? 1.0256 0.7317 0.6671 -0.0292 0.0524  -0.1231 592 GLY A N   
1159 C CA  . GLY A 151 ? 1.1041 0.8231 0.7115 -0.0306 0.0296  -0.1525 592 GLY A CA  
1160 C C   . GLY A 151 ? 1.1347 0.8970 0.7505 -0.0259 -0.0008 -0.1492 592 GLY A C   
1161 O O   . GLY A 151 ? 1.0980 0.8797 0.7631 -0.0325 -0.0018 -0.1345 592 GLY A O   
1162 N N   . ASP A 152 ? 1.2288 1.0061 0.7940 -0.0115 -0.0260 -0.1635 593 ASP A N   
1163 C CA  . ASP A 152 ? 1.3144 1.1331 0.8815 0.0020  -0.0577 -0.1578 593 ASP A CA  
1164 C C   . ASP A 152 ? 1.4298 1.2438 0.9096 0.0325  -0.0757 -0.1559 593 ASP A C   
1165 O O   . ASP A 152 ? 1.5020 1.3359 0.9507 0.0381  -0.1067 -0.1893 593 ASP A O   
1166 C CB  . ASP A 152 ? 1.3478 1.2122 0.9781 -0.0172 -0.0843 -0.1917 593 ASP A CB  
1167 C CG  . ASP A 152 ? 1.4190 1.3336 1.0665 -0.0017 -0.1180 -0.1887 593 ASP A CG  
1168 O OD1 . ASP A 152 ? 1.5340 1.4939 1.2209 -0.0104 -0.1482 -0.2256 593 ASP A OD1 
1169 O OD2 . ASP A 152 ? 1.3751 1.2854 1.0045 0.0189  -0.1138 -0.1529 593 ASP A OD2 
1170 N N   . PHE A 153 ? 1.4920 1.2782 0.9318 0.0533  -0.0554 -0.1174 594 PHE A N   
1171 C CA  . PHE A 153 ? 1.6148 1.3762 0.9571 0.0852  -0.0575 -0.1049 594 PHE A CA  
1172 C C   . PHE A 153 ? 1.6796 1.4679 0.9982 0.1151  -0.0917 -0.0898 594 PHE A C   
1173 O O   . PHE A 153 ? 1.7263 1.4881 0.9559 0.1480  -0.0925 -0.0713 594 PHE A O   
1174 C CB  . PHE A 153 ? 1.6097 1.3166 0.9219 0.0908  -0.0070 -0.0725 594 PHE A CB  
1175 C CG  . PHE A 153 ? 1.5746 1.2598 0.9217 0.0662  0.0253  -0.0855 594 PHE A CG  
1176 C CD1 . PHE A 153 ? 1.5397 1.2083 0.9359 0.0571  0.0603  -0.0636 594 PHE A CD1 
1177 C CD2 . PHE A 153 ? 1.5865 1.2696 0.9221 0.0538  0.0190  -0.1224 594 PHE A CD2 
1178 C CE1 . PHE A 153 ? 1.4843 1.1368 0.9156 0.0405  0.0856  -0.0749 594 PHE A CE1 
1179 C CE2 . PHE A 153 ? 1.5619 1.2217 0.9320 0.0354  0.0494  -0.1323 594 PHE A CE2 
1180 C CZ  . PHE A 153 ? 1.5114 1.1569 0.9287 0.0308  0.0814  -0.1069 594 PHE A CZ  
1181 N N   . GLY A 154 ? 1.6514 1.4893 1.0467 0.1064  -0.1173 -0.0969 595 GLY A N   
1182 C CA  . GLY A 154 ? 1.6801 1.5522 1.0693 0.1358  -0.1539 -0.0879 595 GLY A CA  
1183 C C   . GLY A 154 ? 1.7576 1.6411 1.0618 0.1693  -0.1948 -0.1044 595 GLY A C   
1184 O O   . GLY A 154 ? 1.7477 1.6908 1.0821 0.1744  -0.2440 -0.1379 595 GLY A O   
1185 N N   . GLY A 173 ? 1.1796 1.3080 1.0108 0.2173  -0.2384 -0.0336 614 GLY A N   
1186 C CA  . GLY A 173 ? 1.1450 1.2617 1.0114 0.1690  -0.2017 -0.0444 614 GLY A CA  
1187 C C   . GLY A 173 ? 1.1847 1.2390 1.0246 0.1608  -0.1552 -0.0126 614 GLY A C   
1188 O O   . GLY A 173 ? 1.2156 1.2359 1.0268 0.1883  -0.1448 0.0168  614 GLY A O   
1189 N N   . SER A 174 ? 1.1200 1.1594 0.9742 0.1242  -0.1273 -0.0204 615 SER A N   
1190 C CA  . SER A 174 ? 1.0556 1.0431 0.8876 0.1143  -0.0887 0.0010  615 SER A CA  
1191 C C   . SER A 174 ? 0.9317 0.9290 0.8203 0.0958  -0.0654 -0.0016 615 SER A C   
1192 O O   . SER A 174 ? 0.8323 0.8314 0.7386 0.0688  -0.0511 -0.0125 615 SER A O   
1193 C CB  . SER A 174 ? 1.1026 1.0588 0.8929 0.0959  -0.0763 -0.0023 615 SER A CB  
1194 O OG  . SER A 174 ? 1.2474 1.1594 0.9692 0.1171  -0.0695 0.0182  615 SER A OG  
1195 N N   . ILE A 175 ? 0.9076 0.9029 0.8148 0.1144  -0.0594 0.0108  616 ILE A N   
1196 C CA  . ILE A 175 ? 0.8249 0.8425 0.7895 0.1057  -0.0453 0.0029  616 ILE A CA  
1197 C C   . ILE A 175 ? 0.7746 0.7654 0.7372 0.0857  -0.0152 0.0040  616 ILE A C   
1198 O O   . ILE A 175 ? 0.7689 0.7787 0.7629 0.0692  -0.0038 -0.0083 616 ILE A O   
1199 C CB  . ILE A 175 ? 0.8725 0.8922 0.8552 0.1372  -0.0498 0.0148  616 ILE A CB  
1200 C CG1 . ILE A 175 ? 0.9084 0.9874 0.9433 0.1481  -0.0768 -0.0017 616 ILE A CG1 
1201 C CG2 . ILE A 175 ? 0.8720 0.8747 0.8823 0.1335  -0.0200 0.0169  616 ILE A CG2 
1202 C CD1 . ILE A 175 ? 0.9258 1.0374 0.9528 0.1451  -0.1095 -0.0180 616 ILE A CD1 
1203 N N   . LEU A 176 ? 0.7700 0.7177 0.6955 0.0888  -0.0017 0.0176  617 LEU A N   
1204 C CA  . LEU A 176 ? 0.7313 0.6593 0.6628 0.0752  0.0218  0.0146  617 LEU A CA  
1205 C C   . LEU A 176 ? 0.7328 0.6707 0.6612 0.0523  0.0232  0.0030  617 LEU A C   
1206 O O   . LEU A 176 ? 0.7435 0.6825 0.6828 0.0430  0.0351  -0.0046 617 LEU A O   
1207 C CB  . LEU A 176 ? 0.7444 0.6278 0.6494 0.0820  0.0380  0.0280  617 LEU A CB  
1208 C CG  . LEU A 176 ? 0.7887 0.6450 0.6837 0.1078  0.0438  0.0473  617 LEU A CG  
1209 C CD1 . LEU A 176 ? 0.8177 0.6243 0.6792 0.1112  0.0663  0.0624  617 LEU A CD1 
1210 C CD2 . LEU A 176 ? 0.8040 0.6616 0.7431 0.1146  0.0564  0.0432  617 LEU A CD2 
1211 N N   . TRP A 177 ? 0.7633 0.7070 0.6749 0.0455  0.0105  0.0007  618 TRP A N   
1212 C CA  . TRP A 177 ? 0.7731 0.7166 0.6807 0.0260  0.0154  -0.0068 618 TRP A CA  
1213 C C   . TRP A 177 ? 0.7520 0.7254 0.6909 0.0137  0.0153  -0.0179 618 TRP A C   
1214 O O   . TRP A 177 ? 0.7847 0.7515 0.7197 -0.0014 0.0240  -0.0212 618 TRP A O   
1215 C CB  . TRP A 177 ? 0.7879 0.7129 0.6631 0.0225  0.0089  -0.0064 618 TRP A CB  
1216 C CG  . TRP A 177 ? 0.7891 0.6811 0.6371 0.0300  0.0195  0.0034  618 TRP A CG  
1217 C CD1 . TRP A 177 ? 0.7825 0.6563 0.6263 0.0232  0.0326  0.0028  618 TRP A CD1 
1218 C CD2 . TRP A 177 ? 0.8018 0.6745 0.6272 0.0470  0.0214  0.0153  618 TRP A CD2 
1219 N NE1 . TRP A 177 ? 0.7797 0.6284 0.6096 0.0311  0.0445  0.0098  618 TRP A NE1 
1220 C CE2 . TRP A 177 ? 0.7994 0.6418 0.6132 0.0453  0.0411  0.0198  618 TRP A CE2 
1221 C CE3 . TRP A 177 ? 0.8234 0.6997 0.6363 0.0664  0.0092  0.0239  618 TRP A CE3 
1222 C CZ2 . TRP A 177 ? 0.8473 0.6577 0.6374 0.0584  0.0565  0.0336  618 TRP A CZ2 
1223 C CZ3 . TRP A 177 ? 0.8605 0.7011 0.6390 0.0840  0.0210  0.0415  618 TRP A CZ3 
1224 C CH2 . TRP A 177 ? 0.8752 0.6804 0.6424 0.0781  0.0481  0.0468  618 TRP A CH2 
1225 N N   . MET A 178 ? 0.7353 0.7384 0.7084 0.0210  0.0098  -0.0229 619 MET A N   
1226 C CA  . MET A 178 ? 0.7322 0.7692 0.7480 0.0087  0.0122  -0.0368 619 MET A CA  
1227 C C   . MET A 178 ? 0.7263 0.7663 0.7570 0.0025  0.0376  -0.0378 619 MET A C   
1228 O O   . MET A 178 ? 0.7573 0.7982 0.7928 0.0152  0.0430  -0.0358 619 MET A O   
1229 C CB  . MET A 178 ? 0.7572 0.8319 0.8095 0.0238  -0.0095 -0.0449 619 MET A CB  
1230 C CG  . MET A 178 ? 0.7797 0.8909 0.8694 0.0124  -0.0253 -0.0659 619 MET A CG  
1231 S SD  . MET A 178 ? 0.8280 0.9730 0.9251 0.0425  -0.0691 -0.0721 619 MET A SD  
1232 C CE  . MET A 178 ? 0.8421 1.0508 1.0313 0.0479  -0.0724 -0.0911 619 MET A CE  
1233 N N   . ALA A 179 ? 0.7240 0.7617 0.7594 -0.0160 0.0560  -0.0414 620 ALA A N   
1234 C CA  . ALA A 179 ? 0.7276 0.7641 0.7647 -0.0207 0.0844  -0.0410 620 ALA A CA  
1235 C C   . ALA A 179 ? 0.7235 0.7996 0.8176 -0.0194 0.0925  -0.0539 620 ALA A C   
1236 O O   . ALA A 179 ? 0.7288 0.8381 0.8712 -0.0208 0.0771  -0.0658 620 ALA A O   
1237 C CB  . ALA A 179 ? 0.7548 0.7693 0.7767 -0.0385 0.1073  -0.0364 620 ALA A CB  
1238 N N   . PRO A 180 ? 0.7244 0.7999 0.8144 -0.0154 0.1160  -0.0549 621 PRO A N   
1239 C CA  . PRO A 180 ? 0.6983 0.8104 0.8454 -0.0124 0.1288  -0.0686 621 PRO A CA  
1240 C C   . PRO A 180 ? 0.7153 0.8604 0.9259 -0.0300 0.1387  -0.0818 621 PRO A C   
1241 O O   . PRO A 180 ? 0.7139 0.9036 0.9904 -0.0235 0.1245  -0.0968 621 PRO A O   
1242 C CB  . PRO A 180 ? 0.7212 0.8156 0.8343 -0.0115 0.1615  -0.0677 621 PRO A CB  
1243 C CG  . PRO A 180 ? 0.7296 0.7886 0.7763 -0.0023 0.1482  -0.0575 621 PRO A CG  
1244 C CD  . PRO A 180 ? 0.7374 0.7804 0.7681 -0.0102 0.1292  -0.0466 621 PRO A CD  
1245 N N   . GLU A 181 ? 0.7343 0.8582 0.9310 -0.0512 0.1629  -0.0778 622 GLU A N   
1246 C CA  . GLU A 181 ? 0.7382 0.8919 1.0071 -0.0730 0.1818  -0.0949 622 GLU A CA  
1247 C C   . GLU A 181 ? 0.7244 0.9148 1.0436 -0.0747 0.1409  -0.1126 622 GLU A C   
1248 O O   . GLU A 181 ? 0.7396 0.9792 1.1439 -0.0850 0.1408  -0.1377 622 GLU A O   
1249 C CB  . GLU A 181 ? 0.7784 0.8903 1.0203 -0.0953 0.2251  -0.0841 622 GLU A CB  
1250 C CG  . GLU A 181 ? 0.8082 0.8881 1.0245 -0.1075 0.2136  -0.0778 622 GLU A CG  
1251 C CD  . GLU A 181 ? 0.8279 0.8549 0.9488 -0.0928 0.2045  -0.0517 622 GLU A CD  
1252 O OE1 . GLU A 181 ? 0.7978 0.8210 0.8763 -0.0718 0.1946  -0.0431 622 GLU A OE1 
1253 O OE2 . GLU A 181 ? 0.8424 0.8337 0.9388 -0.1025 0.2075  -0.0434 622 GLU A OE2 
1254 N N   . VAL A 182 ? 0.7165 0.8861 0.9845 -0.0628 0.1058  -0.1025 623 VAL A N   
1255 C CA  . VAL A 182 ? 0.7291 0.9298 1.0249 -0.0579 0.0637  -0.1185 623 VAL A CA  
1256 C C   . VAL A 182 ? 0.7170 0.9577 1.0417 -0.0291 0.0339  -0.1233 623 VAL A C   
1257 O O   . VAL A 182 ? 0.7266 1.0193 1.1127 -0.0239 0.0075  -0.1459 623 VAL A O   
1258 C CB  . VAL A 182 ? 0.7438 0.9038 0.9682 -0.0535 0.0419  -0.1053 623 VAL A CB  
1259 C CG1 . VAL A 182 ? 0.7512 0.9429 0.9924 -0.0445 -0.0014 -0.1233 623 VAL A CG1 
1260 C CG2 . VAL A 182 ? 0.7556 0.8732 0.9537 -0.0776 0.0695  -0.0996 623 VAL A CG2 
1261 N N   . ILE A 183 ? 0.7193 0.9350 1.0015 -0.0088 0.0372  -0.1035 624 ILE A N   
1262 C CA  . ILE A 183 ? 0.7378 0.9782 1.0439 0.0208  0.0172  -0.1030 624 ILE A CA  
1263 C C   . ILE A 183 ? 0.7420 1.0371 1.1375 0.0205  0.0288  -0.1245 624 ILE A C   
1264 O O   . ILE A 183 ? 0.7531 1.0936 1.2001 0.0411  -0.0009 -0.1365 624 ILE A O   
1265 C CB  . ILE A 183 ? 0.7687 0.9668 1.0236 0.0360  0.0301  -0.0827 624 ILE A CB  
1266 C CG1 . ILE A 183 ? 0.7850 0.9427 0.9733 0.0468  0.0095  -0.0643 624 ILE A CG1 
1267 C CG2 . ILE A 183 ? 0.7969 1.0182 1.0956 0.0608  0.0295  -0.0861 624 ILE A CG2 
1268 C CD1 . ILE A 183 ? 0.8279 0.9502 0.9843 0.0642  0.0175  -0.0492 624 ILE A CD1 
1269 N N   . ARG A 184 ? 0.7603 1.0506 1.1724 0.0001  0.0731  -0.1288 625 ARG A N   
1270 C CA  . ARG A 184 ? 0.7760 1.1169 1.2783 -0.0039 0.0947  -0.1510 625 ARG A CA  
1271 C C   . ARG A 184 ? 0.8009 1.1969 1.3868 -0.0196 0.0799  -0.1795 625 ARG A C   
1272 O O   . ARG A 184 ? 0.8055 1.2611 1.4860 -0.0156 0.0807  -0.2037 625 ARG A O   
1273 C CB  . ARG A 184 ? 0.7783 1.0935 1.2661 -0.0236 0.1526  -0.1478 625 ARG A CB  
1274 C CG  . ARG A 184 ? 0.7679 1.0607 1.2194 -0.0046 0.1695  -0.1385 625 ARG A CG  
1275 C CD  . ARG A 184 ? 0.7929 1.0628 1.2209 -0.0206 0.2256  -0.1381 625 ARG A CD  
1276 N NE  . ARG A 184 ? 0.7980 1.0083 1.1239 -0.0267 0.2343  -0.1168 625 ARG A NE  
1277 C CZ  . ARG A 184 ? 0.8279 1.0092 1.1202 -0.0477 0.2562  -0.1065 625 ARG A CZ  
1278 N NH1 . ARG A 184 ? 0.8683 1.0706 1.2232 -0.0706 0.2771  -0.1170 625 ARG A NH1 
1279 N NH2 . ARG A 184 ? 0.8462 0.9764 1.0462 -0.0450 0.2578  -0.0868 625 ARG A NH2 
1280 N N   . MET A 185 ? 0.8552 1.2339 1.4129 -0.0374 0.0665  -0.1805 626 MET A N   
1281 C CA  . MET A 185 ? 0.9338 1.3596 1.5710 -0.0592 0.0564  -0.2138 626 MET A CA  
1282 C C   . MET A 185 ? 0.9562 1.4050 1.6775 -0.0885 0.1109  -0.2330 626 MET A C   
1283 O O   . MET A 185 ? 1.0118 1.4115 1.6999 -0.1150 0.1591  -0.2204 626 MET A O   
1284 C CB  . MET A 185 ? 0.9663 1.4579 1.6565 -0.0321 -0.0039 -0.2370 626 MET A CB  
1285 C CG  . MET A 185 ? 1.0228 1.4914 1.6350 -0.0156 -0.0527 -0.2273 626 MET A CG  
1286 S SD  . MET A 185 ? 1.0853 1.5492 1.7020 -0.0523 -0.0583 -0.2537 626 MET A SD  
1287 C CE  . MET A 185 ? 1.0842 1.4803 1.5634 -0.0321 -0.0857 -0.2207 626 MET A CE  
1288 N N   . GLN A 186 ? 0.9352 1.4552 1.7631 -0.0814 0.1065  -0.2614 627 GLN A N   
1289 C CA  . GLN A 186 ? 0.9882 1.5377 1.9129 -0.1105 0.1618  -0.2847 627 GLN A CA  
1290 C C   . GLN A 186 ? 1.0479 1.5943 2.0154 -0.1527 0.1826  -0.3062 627 GLN A C   
1291 O O   . GLN A 186 ? 1.0734 1.6889 2.1643 -0.1693 0.1759  -0.3502 627 GLN A O   
1292 C CB  . GLN A 186 ? 1.0033 1.4997 1.8731 -0.1138 0.2251  -0.2572 627 GLN A CB  
1293 C CG  . GLN A 186 ? 0.9817 1.4687 1.8013 -0.0758 0.2098  -0.2378 627 GLN A CG  
1294 C CD  . GLN A 186 ? 1.0064 1.4757 1.8215 -0.0782 0.2715  -0.2319 627 GLN A CD  
1295 O OE1 . GLN A 186 ? 1.0424 1.5093 1.8950 -0.1064 0.3293  -0.2407 627 GLN A OE1 
1296 N NE2 . GLN A 186 ? 0.9919 1.4455 1.7601 -0.0483 0.2629  -0.2184 627 GLN A NE2 
1297 N N   . ASP A 187 ? 1.0827 1.5499 1.9546 -0.1689 0.2076  -0.2776 628 ASP A N   
1298 C CA  . ASP A 187 ? 1.1525 1.5981 2.0525 -0.2081 0.2343  -0.2921 628 ASP A CA  
1299 C C   . ASP A 187 ? 1.1155 1.5924 2.0316 -0.2066 0.1695  -0.3195 628 ASP A C   
1300 O O   . ASP A 187 ? 1.0997 1.5666 1.9367 -0.1759 0.1170  -0.3031 628 ASP A O   
1301 C CB  . ASP A 187 ? 1.1962 1.5421 1.9793 -0.2173 0.2796  -0.2479 628 ASP A CB  
1302 C CG  . ASP A 187 ? 1.2668 1.5777 2.0922 -0.2581 0.3524  -0.2520 628 ASP A CG  
1303 O OD1 . ASP A 187 ? 1.2524 1.6111 2.1958 -0.2807 0.3874  -0.2836 628 ASP A OD1 
1304 O OD2 . ASP A 187 ? 1.2950 1.5272 2.0364 -0.2662 0.3778  -0.2222 628 ASP A OD2 
1305 N N   . LYS A 188 ? 1.0996 1.6136 2.1183 -0.2398 0.1758  -0.3637 629 LYS A N   
1306 C CA  . LYS A 188 ? 1.0986 1.6430 2.1331 -0.2412 0.1162  -0.3979 629 LYS A CA  
1307 C C   . LYS A 188 ? 1.0581 1.5207 1.9654 -0.2388 0.1077  -0.3667 629 LYS A C   
1308 O O   . LYS A 188 ? 1.0349 1.5098 1.8998 -0.2196 0.0483  -0.3762 629 LYS A O   
1309 C CB  . LYS A 188 ? 1.1674 1.7617 2.3445 -0.2844 0.1339  -0.4571 629 LYS A CB  
1310 C CG  . LYS A 188 ? 1.2275 1.8282 2.4078 -0.2977 0.0907  -0.4938 629 LYS A CG  
1311 C CD  . LYS A 188 ? 1.2343 1.9024 2.4003 -0.2580 -0.0023 -0.5179 629 LYS A CD  
1312 C CE  . LYS A 188 ? 1.2619 1.9181 2.3924 -0.2664 -0.0421 -0.5463 629 LYS A CE  
1313 N NZ  . LYS A 188 ? 1.2773 2.0280 2.4537 -0.2410 -0.1264 -0.5983 629 LYS A NZ  
1314 N N   . ASN A 189 ? 1.0430 1.4228 1.8897 -0.2561 0.1677  -0.3303 630 ASN A N   
1315 C CA  . ASN A 189 ? 1.0225 1.3232 1.7513 -0.2502 0.1640  -0.2971 630 ASN A CA  
1316 C C   . ASN A 189 ? 0.9766 1.2100 1.6035 -0.2333 0.1993  -0.2412 630 ASN A C   
1317 O O   . ASN A 189 ? 0.9875 1.1662 1.5988 -0.2514 0.2591  -0.2205 630 ASN A O   
1318 C CB  . ASN A 189 ? 1.0706 1.3329 1.8294 -0.2884 0.1949  -0.3164 630 ASN A CB  
1319 C CG  . ASN A 189 ? 1.0929 1.2999 1.7557 -0.2790 0.1692  -0.3013 630 ASN A CG  
1320 O OD1 . ASN A 189 ? 1.0664 1.2529 1.6326 -0.2462 0.1390  -0.2694 630 ASN A OD1 
1321 N ND2 . ASN A 189 ? 1.1441 1.3260 1.8403 -0.3090 0.1848  -0.3271 630 ASN A ND2 
1322 N N   . PRO A 190 ? 0.9153 1.1521 1.4725 -0.1970 0.1624  -0.2180 631 PRO A N   
1323 C CA  . PRO A 190 ? 0.9002 1.0825 1.3621 -0.1779 0.1838  -0.1732 631 PRO A CA  
1324 C C   . PRO A 190 ? 0.8952 1.0111 1.2584 -0.1707 0.1765  -0.1458 631 PRO A C   
1325 O O   . PRO A 190 ? 0.9182 0.9881 1.2046 -0.1563 0.1936  -0.1122 631 PRO A O   
1326 C CB  . PRO A 190 ? 0.8678 1.0913 1.3225 -0.1451 0.1444  -0.1710 631 PRO A CB  
1327 C CG  . PRO A 190 ? 0.8523 1.1209 1.3375 -0.1370 0.0882  -0.1979 631 PRO A CG  
1328 C CD  . PRO A 190 ? 0.8649 1.1603 1.4355 -0.1703 0.0981  -0.2360 631 PRO A CD  
1329 N N   . TYR A 191 ? 0.8651 0.9801 1.2334 -0.1792 0.1497  -0.1640 632 TYR A N   
1330 C CA  . TYR A 191 ? 0.8399 0.8978 1.1276 -0.1725 0.1417  -0.1440 632 TYR A CA  
1331 C C   . TYR A 191 ? 0.8812 0.8756 1.1521 -0.1918 0.1930  -0.1271 632 TYR A C   
1332 O O   . TYR A 191 ? 0.9204 0.9150 1.2568 -0.2201 0.2283  -0.1443 632 TYR A O   
1333 C CB  . TYR A 191 ? 0.8314 0.9090 1.1290 -0.1744 0.0995  -0.1729 632 TYR A CB  
1334 C CG  . TYR A 191 ? 0.7997 0.9236 1.0846 -0.1462 0.0477  -0.1793 632 TYR A CG  
1335 C CD1 . TYR A 191 ? 0.7804 0.9732 1.1352 -0.1456 0.0154  -0.2157 632 TYR A CD1 
1336 C CD2 . TYR A 191 ? 0.7865 0.8842 0.9921 -0.1181 0.0324  -0.1489 632 TYR A CD2 
1337 C CE1 . TYR A 191 ? 0.7578 0.9854 1.0911 -0.1133 -0.0312 -0.2158 632 TYR A CE1 
1338 C CE2 . TYR A 191 ? 0.7572 0.8854 0.9465 -0.0909 -0.0072 -0.1495 632 TYR A CE2 
1339 C CZ  . TYR A 191 ? 0.7555 0.9453 1.0025 -0.0863 -0.0390 -0.1799 632 TYR A CZ  
1340 O OH  . TYR A 191 ? 0.7532 0.9656 0.9740 -0.0531 -0.0776 -0.1749 632 TYR A OH  
1341 N N   . SER A 192 ? 0.8890 0.8281 1.0747 -0.1747 0.1976  -0.0934 633 SER A N   
1342 C CA  . SER A 192 ? 0.9339 0.8052 1.0823 -0.1805 0.2438  -0.0665 633 SER A CA  
1343 C C   . SER A 192 ? 0.9438 0.7720 1.0130 -0.1582 0.2244  -0.0436 633 SER A C   
1344 O O   . SER A 192 ? 0.9207 0.7731 0.9682 -0.1413 0.1830  -0.0482 633 SER A O   
1345 C CB  . SER A 192 ? 0.9508 0.8133 1.0783 -0.1727 0.2796  -0.0430 633 SER A CB  
1346 O OG  . SER A 192 ? 0.9190 0.8286 1.0398 -0.1529 0.2507  -0.0452 633 SER A OG  
1347 N N   . PHE A 193 ? 0.9840 0.7473 1.0120 -0.1560 0.2557  -0.0185 634 PHE A N   
1348 C CA  . PHE A 193 ? 0.9703 0.7001 0.9285 -0.1297 0.2365  0.0035  634 PHE A CA  
1349 C C   . PHE A 193 ? 0.9480 0.7028 0.8627 -0.1026 0.2144  0.0177  634 PHE A C   
1350 O O   . PHE A 193 ? 0.9318 0.6944 0.8181 -0.0843 0.1822  0.0191  634 PHE A O   
1351 C CB  . PHE A 193 ? 1.0262 0.6820 0.9429 -0.1235 0.2733  0.0331  634 PHE A CB  
1352 C CG  . PHE A 193 ? 1.0633 0.6828 1.0233 -0.1499 0.2994  0.0190  634 PHE A CG  
1353 C CD1 . PHE A 193 ? 1.1223 0.6796 1.0793 -0.1590 0.3541  0.0400  634 PHE A CD1 
1354 C CD2 . PHE A 193 ? 1.0455 0.6881 1.0459 -0.1648 0.2724  -0.0160 634 PHE A CD2 
1355 C CE1 . PHE A 193 ? 1.1617 0.6803 1.1663 -0.1856 0.3828  0.0242  634 PHE A CE1 
1356 C CE2 . PHE A 193 ? 1.0689 0.6780 1.1126 -0.1905 0.2964  -0.0356 634 PHE A CE2 
1357 C CZ  . PHE A 193 ? 1.1262 0.6731 1.1778 -0.2025 0.3525  -0.0165 634 PHE A CZ  
1358 N N   . GLN A 194 ? 0.9397 0.7073 0.8547 -0.1019 0.2348  0.0246  635 GLN A N   
1359 C CA  . GLN A 194 ? 0.9349 0.7244 0.8121 -0.0781 0.2174  0.0328  635 GLN A CA  
1360 C C   . GLN A 194 ? 0.8822 0.7268 0.7917 -0.0752 0.1794  0.0113  635 GLN A C   
1361 O O   . GLN A 194 ? 0.8538 0.7097 0.7338 -0.0552 0.1594  0.0153  635 GLN A O   
1362 C CB  . GLN A 194 ? 0.9791 0.7647 0.8441 -0.0777 0.2535  0.0432  635 GLN A CB  
1363 C CG  . GLN A 194 ? 1.0662 0.7874 0.8700 -0.0685 0.2915  0.0743  635 GLN A CG  
1364 C CD  . GLN A 194 ? 1.1209 0.8119 0.9637 -0.0962 0.3428  0.0766  635 GLN A CD  
1365 O OE1 . GLN A 194 ? 1.1181 0.8374 1.0419 -0.1247 0.3433  0.0495  635 GLN A OE1 
1366 N NE2 . GLN A 194 ? 1.2218 0.8540 1.0071 -0.0867 0.3875  0.1078  635 GLN A NE2 
1367 N N   . SER A 195 ? 0.8549 0.7329 0.8246 -0.0929 0.1692  -0.0122 636 SER A N   
1368 C CA  . SER A 195 ? 0.7986 0.7201 0.7873 -0.0837 0.1326  -0.0269 636 SER A CA  
1369 C C   . SER A 195 ? 0.8140 0.7174 0.7645 -0.0712 0.1067  -0.0223 636 SER A C   
1370 O O   . SER A 195 ? 0.8274 0.7403 0.7584 -0.0538 0.0880  -0.0182 636 SER A O   
1371 C CB  . SER A 195 ? 0.7698 0.7359 0.8276 -0.0993 0.1224  -0.0542 636 SER A CB  
1372 O OG  . SER A 195 ? 0.8088 0.7646 0.8828 -0.1154 0.1173  -0.0692 636 SER A OG  
1373 N N   . ASP A 196 ? 0.8497 0.7235 0.7934 -0.0807 0.1109  -0.0240 637 ASP A N   
1374 C CA  . ASP A 196 ? 0.8556 0.7077 0.7648 -0.0695 0.0942  -0.0201 637 ASP A CA  
1375 C C   . ASP A 196 ? 0.8771 0.7102 0.7442 -0.0486 0.0950  0.0001  637 ASP A C   
1376 O O   . ASP A 196 ? 0.8519 0.6864 0.7035 -0.0357 0.0782  0.0003  637 ASP A O   
1377 C CB  . ASP A 196 ? 0.8896 0.7067 0.8006 -0.0831 0.1061  -0.0258 637 ASP A CB  
1378 C CG  . ASP A 196 ? 0.8944 0.7341 0.8409 -0.1000 0.0919  -0.0558 637 ASP A CG  
1379 O OD1 . ASP A 196 ? 0.9000 0.7849 0.8703 -0.0992 0.0712  -0.0702 637 ASP A OD1 
1380 O OD2 . ASP A 196 ? 0.8907 0.7024 0.8408 -0.1120 0.1001  -0.0668 637 ASP A OD2 
1381 N N   . VAL A 197 ? 0.9126 0.7276 0.7613 -0.0445 0.1157  0.0153  638 VAL A N   
1382 C CA  . VAL A 197 ? 0.8950 0.7003 0.7036 -0.0216 0.1107  0.0292  638 VAL A CA  
1383 C C   . VAL A 197 ? 0.8737 0.7159 0.6917 -0.0132 0.0930  0.0194  638 VAL A C   
1384 O O   . VAL A 197 ? 0.8974 0.7434 0.7061 0.0004  0.0768  0.0173  638 VAL A O   
1385 C CB  . VAL A 197 ? 0.9304 0.7095 0.7049 -0.0146 0.1357  0.0477  638 VAL A CB  
1386 C CG1 . VAL A 197 ? 0.9563 0.7408 0.6895 0.0117  0.1223  0.0538  638 VAL A CG1 
1387 C CG2 . VAL A 197 ? 0.9881 0.7176 0.7463 -0.0162 0.1549  0.0628  638 VAL A CG2 
1388 N N   . TYR A 198 ? 0.8502 0.7192 0.6944 -0.0215 0.0982  0.0116  639 TYR A N   
1389 C CA  . TYR A 198 ? 0.8105 0.7083 0.6672 -0.0125 0.0849  0.0027  639 TYR A CA  
1390 C C   . TYR A 198 ? 0.7728 0.6746 0.6392 -0.0091 0.0650  -0.0026 639 TYR A C   
1391 O O   . TYR A 198 ? 0.7517 0.6554 0.6136 0.0021  0.0568  -0.0047 639 TYR A O   
1392 C CB  . TYR A 198 ? 0.7982 0.7249 0.6900 -0.0199 0.0935  -0.0057 639 TYR A CB  
1393 C CG  . TYR A 198 ? 0.7900 0.7392 0.6948 -0.0079 0.0840  -0.0137 639 TYR A CG  
1394 C CD1 . TYR A 198 ? 0.7844 0.7377 0.6755 0.0002  0.0948  -0.0170 639 TYR A CD1 
1395 C CD2 . TYR A 198 ? 0.7745 0.7357 0.7008 -0.0031 0.0662  -0.0181 639 TYR A CD2 
1396 C CE1 . TYR A 198 ? 0.7568 0.7268 0.6658 0.0097  0.0891  -0.0280 639 TYR A CE1 
1397 C CE2 . TYR A 198 ? 0.7498 0.7225 0.6906 0.0085  0.0628  -0.0233 639 TYR A CE2 
1398 C CZ  . TYR A 198 ? 0.7442 0.7218 0.6816 0.0133  0.0746  -0.0301 639 TYR A CZ  
1399 O OH  . TYR A 198 ? 0.7448 0.7299 0.7021 0.0236  0.0738  -0.0389 639 TYR A OH  
1400 N N   . ALA A 199 ? 0.7710 0.6726 0.6499 -0.0188 0.0595  -0.0066 640 ALA A N   
1401 C CA  . ALA A 199 ? 0.7927 0.6908 0.6662 -0.0133 0.0450  -0.0090 640 ALA A CA  
1402 C C   . ALA A 199 ? 0.8127 0.6878 0.6652 -0.0051 0.0464  -0.0040 640 ALA A C   
1403 O O   . ALA A 199 ? 0.7862 0.6613 0.6397 0.0036  0.0430  -0.0046 640 ALA A O   
1404 C CB  . ALA A 199 ? 0.8108 0.7083 0.6885 -0.0238 0.0383  -0.0177 640 ALA A CB  
1405 N N   . PHE A 200 ? 0.8187 0.6736 0.6577 -0.0072 0.0537  0.0006  641 PHE A N   
1406 C CA  . PHE A 200 ? 0.8192 0.6575 0.6460 0.0036  0.0528  0.0037  641 PHE A CA  
1407 C C   . PHE A 200 ? 0.8195 0.6748 0.6519 0.0162  0.0468  0.0001  641 PHE A C   
1408 O O   . PHE A 200 ? 0.8318 0.6891 0.6764 0.0230  0.0429  -0.0064 641 PHE A O   
1409 C CB  . PHE A 200 ? 0.8243 0.6370 0.6339 0.0050  0.0618  0.0132  641 PHE A CB  
1410 C CG  . PHE A 200 ? 0.8049 0.6057 0.6056 0.0223  0.0568  0.0165  641 PHE A CG  
1411 C CD1 . PHE A 200 ? 0.8127 0.6001 0.6215 0.0233  0.0570  0.0117  641 PHE A CD1 
1412 C CD2 . PHE A 200 ? 0.8494 0.6550 0.6339 0.0398  0.0508  0.0218  641 PHE A CD2 
1413 C CE1 . PHE A 200 ? 0.8353 0.6175 0.6479 0.0409  0.0520  0.0119  641 PHE A CE1 
1414 C CE2 . PHE A 200 ? 0.8917 0.6940 0.6742 0.0600  0.0401  0.0215  641 PHE A CE2 
1415 C CZ  . PHE A 200 ? 0.8691 0.6614 0.6717 0.0602  0.0410  0.0164  641 PHE A CZ  
1416 N N   . GLY A 201 ? 0.8082 0.6768 0.6365 0.0179  0.0487  0.0005  642 GLY A N   
1417 C CA  . GLY A 201 ? 0.8046 0.6916 0.6381 0.0288  0.0421  -0.0096 642 GLY A CA  
1418 C C   . GLY A 201 ? 0.7639 0.6628 0.6283 0.0271  0.0403  -0.0204 642 GLY A C   
1419 O O   . GLY A 201 ? 0.7821 0.6908 0.6635 0.0337  0.0358  -0.0339 642 GLY A O   
1420 N N   . ILE A 202 ? 0.7508 0.6480 0.6238 0.0198  0.0442  -0.0154 643 ILE A N   
1421 C CA  . ILE A 202 ? 0.7402 0.6367 0.6332 0.0222  0.0470  -0.0185 643 ILE A CA  
1422 C C   . ILE A 202 ? 0.7813 0.6596 0.6748 0.0227  0.0514  -0.0176 643 ILE A C   
1423 O O   . ILE A 202 ? 0.8115 0.6845 0.7261 0.0251  0.0604  -0.0229 643 ILE A O   
1424 C CB  . ILE A 202 ? 0.7518 0.6520 0.6463 0.0216  0.0460  -0.0112 643 ILE A CB  
1425 C CG1 . ILE A 202 ? 0.7172 0.6395 0.6244 0.0210  0.0464  -0.0153 643 ILE A CG1 
1426 C CG2 . ILE A 202 ? 0.7728 0.6600 0.6761 0.0296  0.0521  -0.0073 643 ILE A CG2 
1427 C CD1 . ILE A 202 ? 0.7139 0.6440 0.6398 0.0273  0.0521  -0.0260 643 ILE A CD1 
1428 N N   . VAL A 203 ? 0.8184 0.6844 0.6931 0.0196  0.0500  -0.0125 644 VAL A N   
1429 C CA  . VAL A 203 ? 0.7993 0.6486 0.6766 0.0207  0.0582  -0.0140 644 VAL A CA  
1430 C C   . VAL A 203 ? 0.7943 0.6553 0.7013 0.0263  0.0573  -0.0272 644 VAL A C   
1431 O O   . VAL A 203 ? 0.8327 0.6911 0.7681 0.0262  0.0692  -0.0354 644 VAL A O   
1432 C CB  . VAL A 203 ? 0.8392 0.6717 0.6931 0.0170  0.0582  -0.0098 644 VAL A CB  
1433 C CG1 . VAL A 203 ? 0.8541 0.6707 0.7151 0.0197  0.0705  -0.0141 644 VAL A CG1 
1434 C CG2 . VAL A 203 ? 0.8842 0.7118 0.7148 0.0117  0.0548  -0.0052 644 VAL A CG2 
1435 N N   . LEU A 204 ? 0.7518 0.6257 0.6532 0.0323  0.0441  -0.0304 645 LEU A N   
1436 C CA  . LEU A 204 ? 0.7586 0.6527 0.6874 0.0424  0.0345  -0.0478 645 LEU A CA  
1437 C C   . LEU A 204 ? 0.7460 0.6556 0.7136 0.0388  0.0395  -0.0657 645 LEU A C   
1438 O O   . LEU A 204 ? 0.7607 0.6832 0.7732 0.0400  0.0413  -0.0855 645 LEU A O   
1439 C CB  . LEU A 204 ? 0.7848 0.6895 0.6860 0.0548  0.0177  -0.0465 645 LEU A CB  
1440 C CG  . LEU A 204 ? 0.8283 0.7122 0.6954 0.0628  0.0153  -0.0292 645 LEU A CG  
1441 C CD1 . LEU A 204 ? 0.8736 0.7662 0.7116 0.0832  -0.0007 -0.0285 645 LEU A CD1 
1442 C CD2 . LEU A 204 ? 0.8500 0.7238 0.7381 0.0662  0.0182  -0.0311 645 LEU A CD2 
1443 N N   . TYR A 205 ? 0.7303 0.6388 0.6887 0.0342  0.0437  -0.0612 646 TYR A N   
1444 C CA  . TYR A 205 ? 0.7416 0.6568 0.7376 0.0310  0.0526  -0.0772 646 TYR A CA  
1445 C C   . TYR A 205 ? 0.7489 0.6424 0.7736 0.0248  0.0760  -0.0750 646 TYR A C   
1446 O O   . TYR A 205 ? 0.7396 0.6389 0.8148 0.0210  0.0867  -0.0960 646 TYR A O   
1447 C CB  . TYR A 205 ? 0.7344 0.6482 0.7150 0.0303  0.0552  -0.0693 646 TYR A CB  
1448 C CG  . TYR A 205 ? 0.7496 0.6642 0.7688 0.0286  0.0668  -0.0853 646 TYR A CG  
1449 C CD1 . TYR A 205 ? 0.7721 0.7100 0.8077 0.0310  0.0584  -0.1118 646 TYR A CD1 
1450 C CD2 . TYR A 205 ? 0.7881 0.6754 0.8230 0.0265  0.0882  -0.0739 646 TYR A CD2 
1451 C CE1 . TYR A 205 ? 0.7717 0.7069 0.8487 0.0280  0.0718  -0.1309 646 TYR A CE1 
1452 C CE2 . TYR A 205 ? 0.8067 0.6856 0.8803 0.0255  0.1044  -0.0868 646 TYR A CE2 
1453 C CZ  . TYR A 205 ? 0.7923 0.6958 0.8921 0.0245  0.0965  -0.1173 646 TYR A CZ  
1454 O OH  . TYR A 205 ? 0.8021 0.6937 0.9459 0.0220  0.1153  -0.1339 646 TYR A OH  
1455 N N   . GLU A 206 ? 0.7730 0.6406 0.7651 0.0237  0.0858  -0.0517 647 GLU A N   
1456 C CA  . GLU A 206 ? 0.8147 0.6538 0.8166 0.0208  0.1126  -0.0450 647 GLU A CA  
1457 C C   . GLU A 206 ? 0.7869 0.6333 0.8286 0.0177  0.1212  -0.0622 647 GLU A C   
1458 O O   . GLU A 206 ? 0.8074 0.6427 0.8914 0.0121  0.1476  -0.0715 647 GLU A O   
1459 C CB  . GLU A 206 ? 0.8664 0.6796 0.8132 0.0239  0.1160  -0.0205 647 GLU A CB  
1460 C CG  . GLU A 206 ? 0.8947 0.7053 0.8103 0.0298  0.1060  -0.0053 647 GLU A CG  
1461 C CD  . GLU A 206 ? 0.9335 0.7280 0.7968 0.0343  0.1011  0.0105  647 GLU A CD  
1462 O OE1 . GLU A 206 ? 0.9767 0.7405 0.8140 0.0419  0.1187  0.0239  647 GLU A OE1 
1463 O OE2 . GLU A 206 ? 0.9037 0.7142 0.7505 0.0307  0.0815  0.0081  647 GLU A OE2 
1464 N N   . LEU A 207 ? 0.7626 0.6257 0.7955 0.0221  0.1018  -0.0665 648 LEU A N   
1465 C CA  . LEU A 207 ? 0.7363 0.6126 0.8134 0.0236  0.1056  -0.0844 648 LEU A CA  
1466 C C   . LEU A 207 ? 0.7209 0.6323 0.8676 0.0229  0.0993  -0.1175 648 LEU A C   
1467 O O   . LEU A 207 ? 0.7381 0.6533 0.9460 0.0161  0.1210  -0.1358 648 LEU A O   
1468 C CB  . LEU A 207 ? 0.7226 0.6069 0.7741 0.0339  0.0834  -0.0800 648 LEU A CB  
1469 C CG  . LEU A 207 ? 0.7630 0.6153 0.7645 0.0325  0.0920  -0.0588 648 LEU A CG  
1470 C CD1 . LEU A 207 ? 0.7947 0.6506 0.7802 0.0433  0.0731  -0.0560 648 LEU A CD1 
1471 C CD2 . LEU A 207 ? 0.7837 0.6134 0.7979 0.0276  0.1234  -0.0595 648 LEU A CD2 
1472 N N   . MET A 208 ? 0.7231 0.6605 0.8624 0.0293  0.0716  -0.1282 649 MET A N   
1473 C CA  . MET A 208 ? 0.7294 0.7071 0.9292 0.0313  0.0567  -0.1670 649 MET A CA  
1474 C C   . MET A 208 ? 0.7038 0.6765 0.9563 0.0162  0.0811  -0.1861 649 MET A C   
1475 O O   . MET A 208 ? 0.6953 0.6991 1.0209 0.0120  0.0785  -0.2254 649 MET A O   
1476 C CB  . MET A 208 ? 0.7589 0.7628 0.9185 0.0468  0.0192  -0.1729 649 MET A CB  
1477 C CG  . MET A 208 ? 0.7918 0.7936 0.8968 0.0644  -0.0019 -0.1522 649 MET A CG  
1478 S SD  . MET A 208 ? 0.8438 0.8453 0.9776 0.0726  0.0000  -0.1506 649 MET A SD  
1479 C CE  . MET A 208 ? 0.8465 0.9064 1.0716 0.0812  -0.0209 -0.2017 649 MET A CE  
1480 N N   . THR A 209 ? 0.6693 0.6041 0.8894 0.0098  0.1034  -0.1608 650 THR A N   
1481 C CA  . THR A 209 ? 0.6562 0.5736 0.9217 -0.0014 0.1321  -0.1724 650 THR A CA  
1482 C C   . THR A 209 ? 0.7040 0.5742 0.9808 -0.0099 0.1783  -0.1519 650 THR A C   
1483 O O   . THR A 209 ? 0.7503 0.5999 1.0785 -0.0203 0.2112  -0.1631 650 THR A O   
1484 C CB  . THR A 209 ? 0.6436 0.5474 0.8693 0.0023  0.1282  -0.1585 650 THR A CB  
1485 O OG1 . THR A 209 ? 0.6197 0.4876 0.7835 0.0076  0.1380  -0.1161 650 THR A OG1 
1486 C CG2 . THR A 209 ? 0.6362 0.5774 0.8333 0.0119  0.0901  -0.1722 650 THR A CG2 
1487 N N   . GLY A 210 ? 0.6425 0.7466 0.7987 0.0248  0.0152  -0.0893 651 GLY A N   
1488 C CA  . GLY A 210 ? 0.6522 0.7418 0.8146 0.0135  0.0425  -0.0850 651 GLY A CA  
1489 C C   . GLY A 210 ? 0.6799 0.7437 0.8118 0.0011  0.0522  -0.0771 651 GLY A C   
1490 O O   . GLY A 210 ? 0.7353 0.7901 0.8768 -0.0089 0.0729  -0.0749 651 GLY A O   
1491 N N   . GLN A 211 ? 0.6891 0.7403 0.7849 0.0030  0.0390  -0.0718 652 GLN A N   
1492 C CA  . GLN A 211 ? 0.7045 0.7358 0.7772 -0.0058 0.0445  -0.0651 652 GLN A CA  
1493 C C   . GLN A 211 ? 0.7269 0.7409 0.7565 -0.0015 0.0370  -0.0558 652 GLN A C   
1494 O O   . GLN A 211 ? 0.7620 0.7785 0.7793 0.0071  0.0258  -0.0555 652 GLN A O   
1495 C CB  . GLN A 211 ? 0.7086 0.7500 0.8021 -0.0122 0.0367  -0.0759 652 GLN A CB  
1496 C CG  . GLN A 211 ? 0.7427 0.8005 0.8865 -0.0210 0.0457  -0.0885 652 GLN A CG  
1497 C CD  . GLN A 211 ? 0.7702 0.8256 0.9291 -0.0311 0.0451  -0.0978 652 GLN A CD  
1498 O OE1 . GLN A 211 ? 0.8081 0.8388 0.9478 -0.0355 0.0558  -0.0875 652 GLN A OE1 
1499 N NE2 . GLN A 211 ? 0.7604 0.8416 0.9543 -0.0336 0.0316  -0.1184 652 GLN A NE2 
1500 N N   . LEU A 212 ? 0.7203 0.7171 0.7294 -0.0069 0.0437  -0.0477 653 LEU A N   
1501 C CA  . LEU A 212 ? 0.7083 0.6939 0.6873 -0.0051 0.0364  -0.0419 653 LEU A CA  
1502 C C   . LEU A 212 ? 0.6864 0.6772 0.6691 -0.0056 0.0265  -0.0470 653 LEU A C   
1503 O O   . LEU A 212 ? 0.7075 0.7036 0.7111 -0.0101 0.0278  -0.0533 653 LEU A O   
1504 C CB  . LEU A 212 ? 0.7025 0.6733 0.6627 -0.0087 0.0437  -0.0330 653 LEU A CB  
1505 C CG  . LEU A 212 ? 0.7144 0.6763 0.6607 -0.0086 0.0549  -0.0286 653 LEU A CG  
1506 C CD1 . LEU A 212 ? 0.7328 0.6819 0.6584 -0.0098 0.0592  -0.0192 653 LEU A CD1 
1507 C CD2 . LEU A 212 ? 0.7661 0.7249 0.6959 -0.0052 0.0508  -0.0308 653 LEU A CD2 
1508 N N   . PRO A 213 ? 0.6787 0.6656 0.6414 -0.0018 0.0194  -0.0452 654 PRO A N   
1509 C CA  . PRO A 213 ? 0.6874 0.6772 0.6487 -0.0016 0.0130  -0.0508 654 PRO A CA  
1510 C C   . PRO A 213 ? 0.7020 0.6846 0.6669 -0.0069 0.0181  -0.0488 654 PRO A C   
1511 O O   . PRO A 213 ? 0.6982 0.6731 0.6589 -0.0086 0.0236  -0.0403 654 PRO A O   
1512 C CB  . PRO A 213 ? 0.6972 0.6802 0.6341 0.0036  0.0103  -0.0464 654 PRO A CB  
1513 C CG  . PRO A 213 ? 0.6955 0.6687 0.6244 0.0014  0.0167  -0.0387 654 PRO A CG  
1514 C CD  . PRO A 213 ? 0.6911 0.6677 0.6323 0.0005  0.0206  -0.0389 654 PRO A CD  
1515 N N   . TYR A 214 ? 0.7005 0.6851 0.6716 -0.0079 0.0158  -0.0570 655 TYR A N   
1516 C CA  . TYR A 214 ? 0.7024 0.6788 0.6795 -0.0102 0.0212  -0.0555 655 TYR A CA  
1517 C C   . TYR A 214 ? 0.7027 0.6714 0.6953 -0.0135 0.0296  -0.0496 655 TYR A C   
1518 O O   . TYR A 214 ? 0.7203 0.6796 0.7095 -0.0115 0.0335  -0.0394 655 TYR A O   
1519 C CB  . TYR A 214 ? 0.7102 0.6825 0.6729 -0.0077 0.0218  -0.0474 655 TYR A CB  
1520 C CG  . TYR A 214 ? 0.7120 0.6859 0.6563 -0.0051 0.0192  -0.0486 655 TYR A CG  
1521 C CD1 . TYR A 214 ? 0.7348 0.7114 0.6698 -0.0022 0.0159  -0.0570 655 TYR A CD1 
1522 C CD2 . TYR A 214 ? 0.7006 0.6717 0.6353 -0.0053 0.0207  -0.0416 655 TYR A CD2 
1523 C CE1 . TYR A 214 ? 0.7727 0.7454 0.6847 0.0023  0.0160  -0.0542 655 TYR A CE1 
1524 C CE2 . TYR A 214 ? 0.7336 0.7004 0.6525 -0.0034 0.0228  -0.0408 655 TYR A CE2 
1525 C CZ  . TYR A 214 ? 0.7827 0.7484 0.6882 0.0013  0.0215  -0.0450 655 TYR A CZ  
1526 O OH  . TYR A 214 ? 0.8839 0.8402 0.7679 0.0052  0.0260  -0.0406 655 TYR A OH  
1527 N N   . SER A 215 ? 0.7377 0.7109 0.7483 -0.0178 0.0326  -0.0558 656 SER A N   
1528 C CA  . SER A 215 ? 0.7648 0.7274 0.7901 -0.0219 0.0458  -0.0494 656 SER A CA  
1529 C C   . SER A 215 ? 0.7581 0.7074 0.8008 -0.0249 0.0539  -0.0518 656 SER A C   
1530 O O   . SER A 215 ? 0.7849 0.7170 0.8323 -0.0256 0.0673  -0.0405 656 SER A O   
1531 C CB  . SER A 215 ? 0.7768 0.7509 0.8245 -0.0268 0.0497  -0.0575 656 SER A CB  
1532 O OG  . SER A 215 ? 0.7659 0.7566 0.8352 -0.0299 0.0404  -0.0767 656 SER A OG  
1533 N N   . ASN A 216 ? 0.7304 0.6843 0.7796 -0.0257 0.0476  -0.0659 657 ASN A N   
1534 C CA  . ASN A 216 ? 0.7616 0.7003 0.8290 -0.0282 0.0567  -0.0709 657 ASN A CA  
1535 C C   . ASN A 216 ? 0.7708 0.6971 0.8255 -0.0194 0.0583  -0.0585 657 ASN A C   
1536 O O   . ASN A 216 ? 0.7708 0.6831 0.8405 -0.0187 0.0661  -0.0621 657 ASN A O   
1537 C CB  . ASN A 216 ? 0.7602 0.7090 0.8425 -0.0339 0.0508  -0.0964 657 ASN A CB  
1538 C CG  . ASN A 216 ? 0.7946 0.7575 0.8502 -0.0280 0.0364  -0.1031 657 ASN A CG  
1539 O OD1 . ASN A 216 ? 0.8162 0.7824 0.8480 -0.0215 0.0319  -0.0896 657 ASN A OD1 
1540 N ND2 . ASN A 216 ? 0.8375 0.8067 0.8952 -0.0304 0.0306  -0.1248 657 ASN A ND2 
1541 N N   . ILE A 217 ? 0.7366 0.6690 0.7684 -0.0127 0.0511  -0.0455 658 ILE A N   
1542 C CA  . ILE A 217 ? 0.7210 0.6500 0.7469 -0.0040 0.0492  -0.0357 658 ILE A CA  
1543 C C   . ILE A 217 ? 0.7203 0.6451 0.7311 0.0021  0.0475  -0.0165 658 ILE A C   
1544 O O   . ILE A 217 ? 0.7449 0.6780 0.7388 0.0003  0.0422  -0.0139 658 ILE A O   
1545 C CB  . ILE A 217 ? 0.6971 0.6413 0.7121 -0.0027 0.0409  -0.0428 658 ILE A CB  
1546 C CG1 . ILE A 217 ? 0.7045 0.6503 0.7250 -0.0064 0.0429  -0.0616 658 ILE A CG1 
1547 C CG2 . ILE A 217 ? 0.6898 0.6367 0.7071 0.0053  0.0388  -0.0339 658 ILE A CG2 
1548 C CD1 . ILE A 217 ? 0.7278 0.6842 0.7301 -0.0052 0.0385  -0.0674 658 ILE A CD1 
1549 N N   . ASN A 218 ? 0.7173 0.6282 0.7323 0.0108  0.0516  -0.0037 659 ASN A N   
1550 C CA  . ASN A 218 ? 0.7494 0.6537 0.7440 0.0193  0.0490  0.0155  659 ASN A CA  
1551 C C   . ASN A 218 ? 0.7800 0.6974 0.7703 0.0306  0.0347  0.0217  659 ASN A C   
1552 O O   . ASN A 218 ? 0.8537 0.7654 0.8293 0.0421  0.0297  0.0377  659 ASN A O   
1553 C CB  . ASN A 218 ? 0.7690 0.6448 0.7673 0.0237  0.0645  0.0295  659 ASN A CB  
1554 C CG  . ASN A 218 ? 0.7894 0.6528 0.8104 0.0318  0.0692  0.0310  659 ASN A CG  
1555 O OD1 . ASN A 218 ? 0.7932 0.6712 0.8214 0.0395  0.0582  0.0284  659 ASN A OD1 
1556 N ND2 . ASN A 218 ? 0.8069 0.6430 0.8440 0.0294  0.0879  0.0337  659 ASN A ND2 
1557 N N   . ASN A 219 ? 0.7691 0.7049 0.7725 0.0279  0.0284  0.0087  660 ASN A N   
1558 C CA  . ASN A 219 ? 0.7520 0.7052 0.7639 0.0367  0.0167  0.0106  660 ASN A CA  
1559 C C   . ASN A 219 ? 0.7233 0.6973 0.7312 0.0283  0.0092  -0.0004 660 ASN A C   
1560 O O   . ASN A 219 ? 0.7125 0.6898 0.7266 0.0202  0.0155  -0.0126 660 ASN A O   
1561 C CB  . ASN A 219 ? 0.7555 0.7079 0.7973 0.0426  0.0228  0.0059  660 ASN A CB  
1562 C CG  . ASN A 219 ? 0.7532 0.7262 0.8134 0.0541  0.0112  0.0090  660 ASN A CG  
1563 O OD1 . ASN A 219 ? 0.7633 0.7588 0.8326 0.0489  0.0058  -0.0011 660 ASN A OD1 
1564 N ND2 . ASN A 219 ? 0.7805 0.7458 0.8490 0.0705  0.0080  0.0233  660 ASN A ND2 
1565 N N   . ARG A 220 ? 0.7135 0.6995 0.7093 0.0309  -0.0037 0.0034  661 ARG A N   
1566 C CA  . ARG A 220 ? 0.7011 0.7033 0.6949 0.0218  -0.0092 -0.0073 661 ARG A CA  
1567 C C   . ARG A 220 ? 0.6853 0.7045 0.7093 0.0195  -0.0075 -0.0176 661 ARG A C   
1568 O O   . ARG A 220 ? 0.6552 0.6766 0.6799 0.0096  -0.0005 -0.0270 661 ARG A O   
1569 C CB  . ARG A 220 ? 0.7422 0.7539 0.7193 0.0256  -0.0246 -0.0039 661 ARG A CB  
1570 C CG  . ARG A 220 ? 0.7716 0.7951 0.7449 0.0147  -0.0292 -0.0165 661 ARG A CG  
1571 C CD  . ARG A 220 ? 0.8366 0.8694 0.7907 0.0194  -0.0464 -0.0159 661 ARG A CD  
1572 N NE  . ARG A 220 ? 0.8284 0.8828 0.7976 0.0111  -0.0564 -0.0320 661 ARG A NE  
1573 C CZ  . ARG A 220 ? 0.8439 0.8933 0.8033 -0.0014 -0.0515 -0.0432 661 ARG A CZ  
1574 N NH1 . ARG A 220 ? 0.9112 0.9378 0.8461 -0.0052 -0.0382 -0.0393 661 ARG A NH1 
1575 N NH2 . ARG A 220 ? 0.8265 0.8943 0.8055 -0.0101 -0.0591 -0.0594 661 ARG A NH2 
1576 N N   . ASP A 221 ? 0.7136 0.7434 0.7631 0.0298  -0.0118 -0.0149 662 ASP A N   
1577 C CA  . ASP A 221 ? 0.7412 0.7895 0.8248 0.0278  -0.0071 -0.0255 662 ASP A CA  
1578 C C   . ASP A 221 ? 0.7322 0.7675 0.8163 0.0210  0.0123  -0.0329 662 ASP A C   
1579 O O   . ASP A 221 ? 0.7474 0.7899 0.8406 0.0130  0.0216  -0.0421 662 ASP A O   
1580 C CB  . ASP A 221 ? 0.7805 0.8436 0.8965 0.0429  -0.0148 -0.0211 662 ASP A CB  
1581 C CG  . ASP A 221 ? 0.8446 0.9350 0.9714 0.0485  -0.0371 -0.0211 662 ASP A CG  
1582 O OD1 . ASP A 221 ? 0.8599 0.9527 0.9628 0.0403  -0.0462 -0.0241 662 ASP A OD1 
1583 O OD2 . ASP A 221 ? 0.9078 1.0187 1.0690 0.0619  -0.0462 -0.0198 662 ASP A OD2 
1584 N N   . GLN A 222 ? 0.6984 0.7136 0.7720 0.0243  0.0193  -0.0295 663 GLN A N   
1585 C CA  . GLN A 222 ? 0.7071 0.7111 0.7770 0.0192  0.0345  -0.0392 663 GLN A CA  
1586 C C   . GLN A 222 ? 0.6942 0.6935 0.7364 0.0087  0.0368  -0.0434 663 GLN A C   
1587 O O   . GLN A 222 ? 0.6952 0.6932 0.7318 0.0044  0.0474  -0.0510 663 GLN A O   
1588 C CB  . GLN A 222 ? 0.7682 0.7527 0.8360 0.0231  0.0396  -0.0381 663 GLN A CB  
1589 C CG  . GLN A 222 ? 0.8195 0.8025 0.9164 0.0353  0.0428  -0.0346 663 GLN A CG  
1590 C CD  . GLN A 222 ? 0.8385 0.8319 0.9593 0.0370  0.0540  -0.0458 663 GLN A CD  
1591 O OE1 . GLN A 222 ? 0.8149 0.8033 0.9239 0.0294  0.0659  -0.0583 663 GLN A OE1 
1592 N NE2 . GLN A 222 ? 0.8796 0.8885 1.0334 0.0481  0.0505  -0.0415 663 GLN A NE2 
1593 N N   . ILE A 223 ? 0.6625 0.6574 0.6855 0.0062  0.0282  -0.0375 664 ILE A N   
1594 C CA  . ILE A 223 ? 0.6476 0.6373 0.6473 -0.0007 0.0297  -0.0402 664 ILE A CA  
1595 C C   . ILE A 223 ? 0.6475 0.6447 0.6500 -0.0057 0.0339  -0.0433 664 ILE A C   
1596 O O   . ILE A 223 ? 0.6403 0.6296 0.6268 -0.0090 0.0424  -0.0461 664 ILE A O   
1597 C CB  . ILE A 223 ? 0.6554 0.6408 0.6396 -0.0017 0.0218  -0.0338 664 ILE A CB  
1598 C CG1 . ILE A 223 ? 0.6611 0.6363 0.6453 0.0005  0.0234  -0.0317 664 ILE A CG1 
1599 C CG2 . ILE A 223 ? 0.6898 0.6712 0.6551 -0.0067 0.0233  -0.0362 664 ILE A CG2 
1600 C CD1 . ILE A 223 ? 0.6704 0.6403 0.6436 0.0007  0.0202  -0.0236 664 ILE A CD1 
1601 N N   . ILE A 224 ? 0.6515 0.6637 0.6749 -0.0057 0.0281  -0.0430 665 ILE A N   
1602 C CA  . ILE A 224 ? 0.6524 0.6731 0.6875 -0.0133 0.0333  -0.0484 665 ILE A CA  
1603 C C   . ILE A 224 ? 0.6650 0.6853 0.7127 -0.0145 0.0509  -0.0535 665 ILE A C   
1604 O O   . ILE A 224 ? 0.6802 0.6904 0.7161 -0.0206 0.0647  -0.0550 665 ILE A O   
1605 C CB  . ILE A 224 ? 0.6467 0.6898 0.7083 -0.0131 0.0199  -0.0511 665 ILE A CB  
1606 C CG1 . ILE A 224 ? 0.6769 0.7171 0.7161 -0.0138 0.0056  -0.0482 665 ILE A CG1 
1607 C CG2 . ILE A 224 ? 0.6233 0.6791 0.7122 -0.0230 0.0287  -0.0609 665 ILE A CG2 
1608 C CD1 . ILE A 224 ? 0.6951 0.7576 0.7504 -0.0105 -0.0129 -0.0511 665 ILE A CD1 
1609 N N   . PHE A 225 ? 0.6838 0.7123 0.7537 -0.0074 0.0524  -0.0552 666 PHE A N   
1610 C CA  . PHE A 225 ? 0.6931 0.7214 0.7766 -0.0072 0.0715  -0.0616 666 PHE A CA  
1611 C C   . PHE A 225 ? 0.7340 0.7394 0.7785 -0.0080 0.0844  -0.0630 666 PHE A C   
1612 O O   . PHE A 225 ? 0.7553 0.7536 0.7912 -0.0114 0.1031  -0.0659 666 PHE A O   
1613 C CB  . PHE A 225 ? 0.6717 0.7101 0.7856 0.0030  0.0695  -0.0631 666 PHE A CB  
1614 C CG  . PHE A 225 ? 0.6814 0.7163 0.8063 0.0047  0.0914  -0.0714 666 PHE A CG  
1615 C CD1 . PHE A 225 ? 0.6848 0.7327 0.8369 -0.0001 0.1079  -0.0774 666 PHE A CD1 
1616 C CD2 . PHE A 225 ? 0.7051 0.7229 0.8136 0.0101  0.0976  -0.0752 666 PHE A CD2 
1617 C CE1 . PHE A 225 ? 0.7201 0.7630 0.8792 0.0016  0.1319  -0.0853 666 PHE A CE1 
1618 C CE2 . PHE A 225 ? 0.7329 0.7457 0.8467 0.0120  0.1191  -0.0852 666 PHE A CE2 
1619 C CZ  . PHE A 225 ? 0.7523 0.7771 0.8894 0.0084  0.1372  -0.0894 666 PHE A CZ  
1620 N N   . MET A 226 ? 0.7584 0.7528 0.7791 -0.0044 0.0744  -0.0611 667 MET A N   
1621 C CA  . MET A 226 ? 0.8083 0.7866 0.7939 -0.0035 0.0802  -0.0651 667 MET A CA  
1622 C C   . MET A 226 ? 0.8232 0.7913 0.7765 -0.0065 0.0818  -0.0599 667 MET A C   
1623 O O   . MET A 226 ? 0.8681 0.8237 0.7922 -0.0046 0.0932  -0.0616 667 MET A O   
1624 C CB  . MET A 226 ? 0.8389 0.8129 0.8192 -0.0004 0.0683  -0.0674 667 MET A CB  
1625 C CG  . MET A 226 ? 0.8636 0.8391 0.8714 0.0040  0.0712  -0.0722 667 MET A CG  
1626 S SD  . MET A 226 ? 0.8634 0.8268 0.8639 0.0045  0.0656  -0.0804 667 MET A SD  
1627 C CE  . MET A 226 ? 0.9262 0.8815 0.9047 0.0049  0.0787  -0.0981 667 MET A CE  
1628 N N   . VAL A 227 ? 0.7578 0.7283 0.7125 -0.0095 0.0714  -0.0531 668 VAL A N   
1629 C CA  . VAL A 227 ? 0.7640 0.7219 0.6926 -0.0110 0.0748  -0.0472 668 VAL A CA  
1630 C C   . VAL A 227 ? 0.7700 0.7220 0.7034 -0.0162 0.0949  -0.0459 668 VAL A C   
1631 O O   . VAL A 227 ? 0.8192 0.7528 0.7220 -0.0140 0.1074  -0.0409 668 VAL A O   
1632 C CB  . VAL A 227 ? 0.7265 0.6862 0.6575 -0.0133 0.0622  -0.0425 668 VAL A CB  
1633 C CG1 . VAL A 227 ? 0.7392 0.6823 0.6472 -0.0135 0.0688  -0.0363 668 VAL A CG1 
1634 C CG2 . VAL A 227 ? 0.7187 0.6817 0.6448 -0.0089 0.0478  -0.0430 668 VAL A CG2 
1635 N N   . GLY A 228 ? 0.7516 0.7194 0.7241 -0.0222 0.0985  -0.0502 669 GLY A N   
1636 C CA  . GLY A 228 ? 0.7688 0.7353 0.7587 -0.0298 0.1201  -0.0519 669 GLY A CA  
1637 C C   . GLY A 228 ? 0.7990 0.7520 0.7692 -0.0264 0.1430  -0.0522 669 GLY A C   
1638 O O   . GLY A 228 ? 0.8027 0.7381 0.7584 -0.0301 0.1651  -0.0475 669 GLY A O   
1639 N N   . ARG A 229 ? 0.8321 0.7901 0.7991 -0.0191 0.1393  -0.0579 670 ARG A N   
1640 C CA  . ARG A 229 ? 0.8576 0.8041 0.8041 -0.0150 0.1603  -0.0623 670 ARG A CA  
1641 C C   . ARG A 229 ? 0.8898 0.8138 0.7743 -0.0070 0.1586  -0.0590 670 ARG A C   
1642 O O   . ARG A 229 ? 0.9291 0.8391 0.7826 -0.0027 0.1768  -0.0620 670 ARG A O   
1643 C CB  . ARG A 229 ? 0.8505 0.8120 0.8256 -0.0105 0.1570  -0.0732 670 ARG A CB  
1644 C CG  . ARG A 229 ? 0.8710 0.8560 0.9067 -0.0141 0.1635  -0.0776 670 ARG A CG  
1645 C CD  . ARG A 229 ? 0.9471 0.9282 0.9919 -0.0184 0.1969  -0.0811 670 ARG A CD  
1646 N NE  . ARG A 229 ? 0.9685 0.9774 1.0798 -0.0203 0.2040  -0.0887 670 ARG A NE  
1647 C CZ  . ARG A 229 ? 0.9938 1.0128 1.1324 -0.0126 0.2111  -0.0976 670 ARG A CZ  
1648 N NH1 . ARG A 229 ? 1.0205 1.0218 1.1244 -0.0045 0.2133  -0.1022 670 ARG A NH1 
1649 N NH2 . ARG A 229 ? 0.9847 1.0330 1.1895 -0.0128 0.2154  -0.1037 670 ARG A NH2 
1650 N N   . GLY A 230 ? 0.8490 0.7714 0.7156 -0.0038 0.1362  -0.0542 671 GLY A N   
1651 C CA  . GLY A 230 ? 0.8619 0.7701 0.6761 0.0056  0.1282  -0.0526 671 GLY A CA  
1652 C C   . GLY A 230 ? 0.8492 0.7660 0.6580 0.0103  0.1127  -0.0665 671 GLY A C   
1653 O O   . GLY A 230 ? 0.8621 0.7726 0.6311 0.0181  0.1030  -0.0697 671 GLY A O   
1654 N N   . TYR A 231 ? 0.8239 0.7549 0.6738 0.0062  0.1090  -0.0752 672 TYR A N   
1655 C CA  . TYR A 231 ? 0.8304 0.7655 0.6807 0.0087  0.0979  -0.0897 672 TYR A CA  
1656 C C   . TYR A 231 ? 0.8225 0.7651 0.6764 0.0087  0.0741  -0.0895 672 TYR A C   
1657 O O   . TYR A 231 ? 0.8496 0.7948 0.7016 0.0096  0.0645  -0.1029 672 TYR A O   
1658 C CB  . TYR A 231 ? 0.8115 0.7538 0.7045 0.0065  0.1051  -0.0975 672 TYR A CB  
1659 C CG  . TYR A 231 ? 0.8030 0.7437 0.7084 0.0064  0.1299  -0.0998 672 TYR A CG  
1660 C CD1 . TYR A 231 ? 0.7742 0.7272 0.7302 0.0059  0.1348  -0.1004 672 TYR A CD1 
1661 C CD2 . TYR A 231 ? 0.8320 0.7592 0.6996 0.0083  0.1495  -0.1006 672 TYR A CD2 
1662 C CE1 . TYR A 231 ? 0.7909 0.7473 0.7680 0.0062  0.1579  -0.1041 672 TYR A CE1 
1663 C CE2 . TYR A 231 ? 0.8289 0.7552 0.7127 0.0072  0.1765  -0.1035 672 TYR A CE2 
1664 C CZ  . TYR A 231 ? 0.8251 0.7681 0.7678 0.0057  0.1805  -0.1063 672 TYR A CZ  
1665 O OH  . TYR A 231 ? 0.8513 0.7982 0.8197 0.0051  0.2077  -0.1106 672 TYR A OH  
1666 N N   . LEU A 232 ? 0.8198 0.7658 0.6815 0.0069  0.0666  -0.0764 673 LEU A N   
1667 C CA  . LEU A 232 ? 0.7846 0.7384 0.6554 0.0065  0.0484  -0.0752 673 LEU A CA  
1668 C C   . LEU A 232 ? 0.8121 0.7618 0.6570 0.0113  0.0421  -0.0658 673 LEU A C   
1669 O O   . LEU A 232 ? 0.8451 0.7854 0.6807 0.0112  0.0523  -0.0548 673 LEU A O   
1670 C CB  . LEU A 232 ? 0.7336 0.6941 0.6392 0.0013  0.0465  -0.0678 673 LEU A CB  
1671 C CG  . LEU A 232 ? 0.7247 0.6907 0.6546 -0.0008 0.0379  -0.0710 673 LEU A CG  
1672 C CD1 . LEU A 232 ? 0.7141 0.6834 0.6564 -0.0030 0.0335  -0.0593 673 LEU A CD1 
1673 C CD2 . LEU A 232 ? 0.7425 0.7114 0.6658 -0.0003 0.0281  -0.0811 673 LEU A CD2 
1674 N N   . SER A 233 ? 0.8336 0.7906 0.6722 0.0156  0.0263  -0.0708 674 SER A N   
1675 C CA  . SER A 233 ? 0.8622 0.8180 0.6848 0.0227  0.0178  -0.0613 674 SER A CA  
1676 C C   . SER A 233 ? 0.8702 0.8425 0.7184 0.0216  0.0026  -0.0677 674 SER A C   
1677 O O   . SER A 233 ? 0.9063 0.8886 0.7738 0.0168  -0.0022 -0.0814 674 SER A O   
1678 C CB  . SER A 233 ? 0.9055 0.8542 0.6832 0.0354  0.0136  -0.0606 674 SER A CB  
1679 O OG  . SER A 233 ? 0.9657 0.9036 0.7181 0.0360  0.0263  -0.0650 674 SER A OG  
1680 N N   . PRO A 234 ? 0.8572 0.8309 0.7082 0.0258  -0.0022 -0.0589 675 PRO A N   
1681 C CA  . PRO A 234 ? 0.8175 0.8084 0.6961 0.0250  -0.0134 -0.0656 675 PRO A CA  
1682 C C   . PRO A 234 ? 0.8229 0.8310 0.7006 0.0308  -0.0300 -0.0810 675 PRO A C   
1683 O O   . PRO A 234 ? 0.8322 0.8387 0.6768 0.0425  -0.0381 -0.0806 675 PRO A O   
1684 C CB  . PRO A 234 ? 0.8257 0.8121 0.7013 0.0316  -0.0132 -0.0533 675 PRO A CB  
1685 C CG  . PRO A 234 ? 0.8348 0.8003 0.6935 0.0289  0.0013  -0.0413 675 PRO A CG  
1686 C CD  . PRO A 234 ? 0.8618 0.8200 0.6973 0.0298  0.0059  -0.0435 675 PRO A CD  
1687 N N   . ASP A 235 ? 0.8181 0.8421 0.7317 0.0228  -0.0347 -0.0949 676 ASP A N   
1688 C CA  . ASP A 235 ? 0.8604 0.9050 0.7831 0.0246  -0.0514 -0.1155 676 ASP A CA  
1689 C C   . ASP A 235 ? 0.8797 0.9455 0.8127 0.0357  -0.0684 -0.1166 676 ASP A C   
1690 O O   . ASP A 235 ? 0.8564 0.9356 0.8297 0.0309  -0.0671 -0.1186 676 ASP A O   
1691 C CB  . ASP A 235 ? 0.8701 0.9206 0.8346 0.0094  -0.0457 -0.1308 676 ASP A CB  
1692 C CG  . ASP A 235 ? 0.9092 0.9827 0.8927 0.0074  -0.0623 -0.1577 676 ASP A CG  
1693 O OD1 . ASP A 235 ? 0.9305 1.0158 0.8862 0.0192  -0.0809 -0.1656 676 ASP A OD1 
1694 O OD2 . ASP A 235 ? 0.8933 0.9723 0.9196 -0.0059 -0.0565 -0.1712 676 ASP A OD2 
1695 N N   . LEU A 236 ? 0.9092 0.9777 0.8054 0.0521  -0.0833 -0.1147 677 LEU A N   
1696 C CA  . LEU A 236 ? 0.9134 1.0001 0.8156 0.0679  -0.1003 -0.1114 677 LEU A CA  
1697 C C   . LEU A 236 ? 0.9049 1.0308 0.8471 0.0680  -0.1230 -0.1364 677 LEU A C   
1698 O O   . LEU A 236 ? 0.9066 1.0547 0.8666 0.0812  -0.1386 -0.1363 677 LEU A O   
1699 C CB  . LEU A 236 ? 0.9625 1.0340 0.8065 0.0888  -0.1076 -0.0963 677 LEU A CB  
1700 C CG  . LEU A 236 ? 0.9711 1.0047 0.7817 0.0889  -0.0838 -0.0719 677 LEU A CG  
1701 C CD1 . LEU A 236 ? 1.0275 1.0436 0.7810 0.1104  -0.0888 -0.0565 677 LEU A CD1 
1702 C CD2 . LEU A 236 ? 0.9476 0.9740 0.7877 0.0843  -0.0703 -0.0594 677 LEU A CD2 
1703 N N   . SER A 237 ? 0.8843 1.0193 0.8453 0.0534  -0.1244 -0.1591 678 SER A N   
1704 C CA  . SER A 237 ? 0.8769 1.0499 0.8874 0.0482  -0.1429 -0.1873 678 SER A CA  
1705 C C   . SER A 237 ? 0.8116 0.9968 0.8875 0.0354  -0.1295 -0.1883 678 SER A C   
1706 O O   . SER A 237 ? 0.7793 0.9993 0.9062 0.0325  -0.1425 -0.2086 678 SER A O   
1707 C CB  . SER A 237 ? 0.9035 1.0772 0.9159 0.0343  -0.1446 -0.2134 678 SER A CB  
1708 O OG  . SER A 237 ? 0.8726 1.0214 0.9033 0.0158  -0.1166 -0.2087 678 SER A OG  
1709 N N   . LYS A 238 ? 0.7962 0.9539 0.8710 0.0280  -0.1032 -0.1674 679 LYS A N   
1710 C CA  . LYS A 238 ? 0.7915 0.9554 0.9184 0.0168  -0.0865 -0.1661 679 LYS A CA  
1711 C C   . LYS A 238 ? 0.7832 0.9641 0.9283 0.0303  -0.0913 -0.1575 679 LYS A C   
1712 O O   . LYS A 238 ? 0.7646 0.9514 0.9516 0.0224  -0.0754 -0.1569 679 LYS A O   
1713 C CB  . LYS A 238 ? 0.7783 0.9068 0.8919 0.0058  -0.0584 -0.1476 679 LYS A CB  
1714 C CG  . LYS A 238 ? 0.7923 0.9019 0.8934 -0.0053 -0.0504 -0.1532 679 LYS A CG  
1715 C CD  . LYS A 238 ? 0.7998 0.8782 0.8869 -0.0115 -0.0272 -0.1330 679 LYS A CD  
1716 C CE  . LYS A 238 ? 0.8309 0.9069 0.9582 -0.0235 -0.0083 -0.1317 679 LYS A CE  
1717 N NZ  . LYS A 238 ? 0.8534 0.9007 0.9598 -0.0256 0.0105  -0.1103 679 LYS A NZ  
1718 N N   . VAL A 239 ? 0.7924 0.9786 0.9054 0.0515  -0.1105 -0.1500 680 VAL A N   
1719 C CA  . VAL A 239 ? 0.8063 1.0063 0.9373 0.0674  -0.1149 -0.1412 680 VAL A CA  
1720 C C   . VAL A 239 ? 0.7765 1.0240 0.9759 0.0676  -0.1292 -0.1638 680 VAL A C   
1721 O O   . VAL A 239 ? 0.7783 1.0543 0.9962 0.0648  -0.1503 -0.1875 680 VAL A O   
1722 C CB  . VAL A 239 ? 0.8736 1.0648 0.9534 0.0931  -0.1321 -0.1257 680 VAL A CB  
1723 C CG1 . VAL A 239 ? 0.8901 1.0350 0.9107 0.0918  -0.1139 -0.1035 680 VAL A CG1 
1724 C CG2 . VAL A 239 ? 0.9125 1.1302 0.9785 0.1052  -0.1647 -0.1421 680 VAL A CG2 
1725 N N   . ARG A 240 ? 0.7576 1.0146 0.9962 0.0709  -0.1172 -0.1585 681 ARG A N   
1726 C CA  . ARG A 240 ? 0.7609 1.0663 1.0735 0.0727  -0.1279 -0.1790 681 ARG A CA  
1727 C C   . ARG A 240 ? 0.7613 1.1056 1.0773 0.0904  -0.1689 -0.1957 681 ARG A C   
1728 O O   . ARG A 240 ? 0.7537 1.0858 1.0118 0.1122  -0.1875 -0.1817 681 ARG A O   
1729 C CB  . ARG A 240 ? 0.7883 1.0968 1.1254 0.0859  -0.1155 -0.1662 681 ARG A CB  
1730 C CG  . ARG A 240 ? 0.8042 1.0784 1.1387 0.0710  -0.0759 -0.1521 681 ARG A CG  
1731 C CD  . ARG A 240 ? 0.8128 1.1128 1.2217 0.0610  -0.0561 -0.1648 681 ARG A CD  
1732 N NE  . ARG A 240 ? 0.8035 1.0754 1.2018 0.0617  -0.0251 -0.1479 681 ARG A NE  
1733 C CZ  . ARG A 240 ? 0.7904 1.0775 1.2233 0.0756  -0.0181 -0.1471 681 ARG A CZ  
1734 N NH1 . ARG A 240 ? 0.8154 1.1493 1.3014 0.0919  -0.0416 -0.1607 681 ARG A NH1 
1735 N NH2 . ARG A 240 ? 0.7879 1.0442 1.2030 0.0742  0.0120  -0.1340 681 ARG A NH2 
1736 N N   . SER A 241 ? 0.7547 1.1461 1.1393 0.0813  -0.1824 -0.2259 682 SER A N   
1737 C CA  . SER A 241 ? 0.7880 1.2251 1.1833 0.0975  -0.2260 -0.2477 682 SER A CA  
1738 C C   . SER A 241 ? 0.7967 1.2505 1.1801 0.1334  -0.2498 -0.2324 682 SER A C   
1739 O O   . SER A 241 ? 0.8060 1.2708 1.1464 0.1557  -0.2845 -0.2331 682 SER A O   
1740 C CB  . SER A 241 ? 0.7898 1.2793 1.2782 0.0793  -0.2331 -0.2854 682 SER A CB  
1741 O OG  . SER A 241 ? 0.7992 1.3102 1.3594 0.0781  -0.2147 -0.2846 682 SER A OG  
1742 N N   . ASN A 242 ? 0.7763 1.2285 1.1936 0.1402  -0.2300 -0.2179 683 ASN A N   
1743 C CA  . ASN A 242 ? 0.8062 1.2723 1.2219 0.1756  -0.2487 -0.2027 683 ASN A CA  
1744 C C   . ASN A 242 ? 0.8070 1.2145 1.1411 0.1929  -0.2350 -0.1653 683 ASN A C   
1745 O O   . ASN A 242 ? 0.7790 1.1844 1.1139 0.2193  -0.2380 -0.1482 683 ASN A O   
1746 C CB  . ASN A 242 ? 0.8063 1.3071 1.3121 0.1764  -0.2354 -0.2111 683 ASN A CB  
1747 C CG  . ASN A 242 ? 0.8169 1.2765 1.3264 0.1567  -0.1855 -0.1963 683 ASN A CG  
1748 O OD1 . ASN A 242 ? 0.8517 1.2684 1.3165 0.1349  -0.1623 -0.1881 683 ASN A OD1 
1749 N ND2 . ASN A 242 ? 0.8187 1.2927 1.3816 0.1655  -0.1693 -0.1938 683 ASN A ND2 
1750 N N   . CYS A 243 ? 0.8296 1.1899 1.0980 0.1779  -0.2188 -0.1536 684 CYS A N   
1751 C CA  . CYS A 243 ? 0.8724 1.1781 1.0657 0.1907  -0.2055 -0.1216 684 CYS A CA  
1752 C C   . CYS A 243 ? 0.9160 1.2205 1.0499 0.2196  -0.2379 -0.1121 684 CYS A C   
1753 O O   . CYS A 243 ? 0.9289 1.2415 1.0335 0.2144  -0.2559 -0.1253 684 CYS A O   
1754 C CB  . CYS A 243 ? 0.8793 1.1409 1.0323 0.1639  -0.1772 -0.1150 684 CYS A CB  
1755 S SG  . CYS A 243 ? 0.9803 1.1779 1.0485 0.1745  -0.1596 -0.0806 684 CYS A SG  
1756 N N   . PRO A 244 ? 0.9401 1.2308 1.0521 0.2509  -0.2436 -0.0886 685 PRO A N   
1757 C CA  . PRO A 244 ? 0.9776 1.2694 1.0339 0.2839  -0.2763 -0.0773 685 PRO A CA  
1758 C C   . PRO A 244 ? 0.9819 1.2286 0.9490 0.2798  -0.2700 -0.0640 685 PRO A C   
1759 O O   . PRO A 244 ? 0.9814 1.1828 0.9230 0.2601  -0.2358 -0.0514 685 PRO A O   
1760 C CB  . PRO A 244 ? 1.0025 1.2733 1.0545 0.3150  -0.2707 -0.0493 685 PRO A CB  
1761 C CG  . PRO A 244 ? 0.9610 1.2376 1.0834 0.2992  -0.2429 -0.0552 685 PRO A CG  
1762 C CD  . PRO A 244 ? 0.9289 1.1938 1.0576 0.2581  -0.2170 -0.0692 685 PRO A CD  
1763 N N   . LYS A 245 ? 1.1028 1.3328 1.1036 0.1603  -0.3139 -0.0658 686 LYS A N   
1764 C CA  . LYS A 245 ? 1.1264 1.2975 1.0161 0.1749  -0.3188 -0.0746 686 LYS A CA  
1765 C C   . LYS A 245 ? 1.1140 1.2587 0.9471 0.1924  -0.2699 -0.0583 686 LYS A C   
1766 O O   . LYS A 245 ? 1.1088 1.2175 0.8825 0.1875  -0.2438 -0.0618 686 LYS A O   
1767 C CB  . LYS A 245 ? 1.1926 1.3512 1.0386 0.1984  -0.3763 -0.0839 686 LYS A CB  
1768 C CG  . LYS A 245 ? 1.2225 1.3881 1.0999 0.1800  -0.4326 -0.1053 686 LYS A CG  
1769 C CD  . LYS A 245 ? 1.2798 1.4533 1.1537 0.2016  -0.4954 -0.1092 686 LYS A CD  
1770 C CE  . LYS A 245 ? 1.3206 1.4819 1.1987 0.1847  -0.5569 -0.1345 686 LYS A CE  
1771 N NZ  . LYS A 245 ? 1.3836 1.5636 1.2846 0.1998  -0.6239 -0.1368 686 LYS A NZ  
1772 N N   . ALA A 246 ? 1.1271 1.2900 0.9849 0.2124  -0.2596 -0.0407 687 ALA A N   
1773 C CA  . ALA A 246 ? 1.1289 1.2613 0.9354 0.2284  -0.2187 -0.0231 687 ALA A CA  
1774 C C   . ALA A 246 ? 1.0983 1.2154 0.9012 0.2054  -0.1688 -0.0219 687 ALA A C   
1775 O O   . ALA A 246 ? 1.1034 1.1824 0.8404 0.2083  -0.1433 -0.0159 687 ALA A O   
1776 C CB  . ALA A 246 ? 1.1363 1.2919 0.9902 0.2508  -0.2164 -0.0071 687 ALA A CB  
1777 N N   . MET A 247 ? 1.0829 1.2305 0.9576 0.1812  -0.1562 -0.0263 688 MET A N   
1778 C CA  . MET A 247 ? 1.0455 1.1766 0.9179 0.1575  -0.1141 -0.0250 688 MET A CA  
1779 C C   . MET A 247 ? 1.0275 1.1263 0.8504 0.1422  -0.1203 -0.0379 688 MET A C   
1780 O O   . MET A 247 ? 1.0062 1.0740 0.7892 0.1362  -0.0917 -0.0350 688 MET A O   
1781 C CB  . MET A 247 ? 1.0398 1.2108 0.9948 0.1339  -0.1023 -0.0258 688 MET A CB  
1782 C CG  . MET A 247 ? 1.0558 1.2045 1.0012 0.1079  -0.0623 -0.0237 688 MET A CG  
1783 S SD  . MET A 247 ? 1.0966 1.2096 0.9983 0.1230  -0.0157 -0.0102 688 MET A SD  
1784 C CE  . MET A 247 ? 1.0796 1.2397 1.0573 0.1340  0.0058  -0.0041 688 MET A CE  
1785 N N   . LYS A 248 ? 1.0488 1.1546 0.8782 0.1369  -0.1607 -0.0536 689 LYS A N   
1786 C CA  . LYS A 248 ? 1.0721 1.1463 0.8588 0.1266  -0.1716 -0.0703 689 LYS A CA  
1787 C C   . LYS A 248 ? 1.0854 1.1275 0.7897 0.1495  -0.1598 -0.0706 689 LYS A C   
1788 O O   . LYS A 248 ? 1.0683 1.0864 0.7423 0.1428  -0.1422 -0.0768 689 LYS A O   
1789 C CB  . LYS A 248 ? 1.1233 1.2047 0.9294 0.1194  -0.2229 -0.0889 689 LYS A CB  
1790 C CG  . LYS A 248 ? 1.1498 1.2023 0.9463 0.0975  -0.2338 -0.1062 689 LYS A CG  
1791 C CD  . LYS A 248 ? 1.2039 1.2608 1.0306 0.0847  -0.2873 -0.1229 689 LYS A CD  
1792 C CE  . LYS A 248 ? 1.2477 1.2571 1.0297 0.0804  -0.3102 -0.1471 689 LYS A CE  
1793 N NZ  . LYS A 248 ? 1.2823 1.2876 1.1094 0.0528  -0.3559 -0.1591 689 LYS A NZ  
1794 N N   . ARG A 249 ? 1.1078 1.1511 0.7793 0.1757  -0.1686 -0.0619 690 ARG A N   
1795 C CA  . ARG A 249 ? 1.1461 1.1617 0.7377 0.1953  -0.1516 -0.0561 690 ARG A CA  
1796 C C   . ARG A 249 ? 1.1239 1.1281 0.7106 0.1895  -0.1038 -0.0369 690 ARG A C   
1797 O O   . ARG A 249 ? 1.1327 1.1181 0.6725 0.1916  -0.0813 -0.0350 690 ARG A O   
1798 C CB  . ARG A 249 ? 1.2144 1.2267 0.7649 0.2226  -0.1762 -0.0478 690 ARG A CB  
1799 C CG  . ARG A 249 ? 1.3015 1.3087 0.8211 0.2326  -0.2247 -0.0697 690 ARG A CG  
1800 C CD  . ARG A 249 ? 1.4131 1.4056 0.8695 0.2609  -0.2497 -0.0606 690 ARG A CD  
1801 N NE  . ARG A 249 ? 1.4697 1.4864 0.9784 0.2671  -0.2952 -0.0589 690 ARG A NE  
1802 C CZ  . ARG A 249 ? 1.4965 1.5297 1.0437 0.2778  -0.2945 -0.0370 690 ARG A CZ  
1803 N NH1 . ARG A 249 ? 1.4951 1.5153 1.0279 0.2827  -0.2516 -0.0141 690 ARG A NH1 
1804 N NH2 . ARG A 249 ? 1.5040 1.5667 1.1092 0.2846  -0.3400 -0.0390 690 ARG A NH2 
1805 N N   . LEU A 250 ? 1.1077 1.1239 0.7443 0.1822  -0.0882 -0.0236 691 LEU A N   
1806 C CA  . LEU A 250 ? 1.0951 1.0930 0.7257 0.1745  -0.0479 -0.0085 691 LEU A CA  
1807 C C   . LEU A 250 ? 1.0777 1.0643 0.7099 0.1516  -0.0320 -0.0186 691 LEU A C   
1808 O O   . LEU A 250 ? 1.0881 1.0553 0.6886 0.1490  -0.0094 -0.0125 691 LEU A O   
1809 C CB  . LEU A 250 ? 1.0764 1.0865 0.7580 0.1735  -0.0354 0.0020  691 LEU A CB  
1810 C CG  . LEU A 250 ? 1.0688 1.0512 0.7393 0.1673  0.0017  0.0158  691 LEU A CG  
1811 C CD1 . LEU A 250 ? 1.1077 1.0594 0.7193 0.1809  0.0110  0.0321  691 LEU A CD1 
1812 C CD2 . LEU A 250 ? 1.0677 1.0629 0.7855 0.1729  0.0124  0.0210  691 LEU A CD2 
1813 N N   . MET A 251 ? 1.0635 1.0620 0.7358 0.1339  -0.0461 -0.0326 692 MET A N   
1814 C CA  . MET A 251 ? 1.0665 1.0489 0.7378 0.1142  -0.0407 -0.0432 692 MET A CA  
1815 C C   . MET A 251 ? 1.0955 1.0649 0.7190 0.1264  -0.0419 -0.0527 692 MET A C   
1816 O O   . MET A 251 ? 1.0645 1.0204 0.6746 0.1211  -0.0195 -0.0486 692 MET A O   
1817 C CB  . MET A 251 ? 1.0876 1.0789 0.7972 0.0961  -0.0669 -0.0575 692 MET A CB  
1818 C CG  . MET A 251 ? 1.0847 1.0743 0.8324 0.0690  -0.0507 -0.0504 692 MET A CG  
1819 S SD  . MET A 251 ? 1.1412 1.1461 0.9388 0.0444  -0.0824 -0.0609 692 MET A SD  
1820 C CE  . MET A 251 ? 1.1395 1.1944 0.9848 0.0582  -0.0909 -0.0537 692 MET A CE  
1821 N N   . ALA A 252 ? 1.1224 1.0973 0.7208 0.1436  -0.0679 -0.0661 693 ALA A N   
1822 C CA  . ALA A 252 ? 1.1497 1.1151 0.7015 0.1577  -0.0671 -0.0801 693 ALA A CA  
1823 C C   . ALA A 252 ? 1.1717 1.1347 0.6901 0.1656  -0.0307 -0.0625 693 ALA A C   
1824 O O   . ALA A 252 ? 1.1995 1.1610 0.7067 0.1660  -0.0145 -0.0693 693 ALA A O   
1825 C CB  . ALA A 252 ? 1.1931 1.1587 0.7092 0.1780  -0.1002 -0.0968 693 ALA A CB  
1826 N N   . GLU A 253 ? 1.1915 1.1543 0.6989 0.1712  -0.0193 -0.0395 694 GLU A N   
1827 C CA  . GLU A 253 ? 1.2074 1.1624 0.6826 0.1743  0.0133  -0.0181 694 GLU A CA  
1828 C C   . GLU A 253 ? 1.1371 1.0844 0.6457 0.1522  0.0384  -0.0086 694 GLU A C   
1829 O O   . GLU A 253 ? 1.1378 1.0847 0.6352 0.1476  0.0616  -0.0020 694 GLU A O   
1830 C CB  . GLU A 253 ? 1.2670 1.2131 0.7154 0.1878  0.0119  0.0045  694 GLU A CB  
1831 C CG  . GLU A 253 ? 1.3660 1.3107 0.7555 0.2115  -0.0077 0.0013  694 GLU A CG  
1832 C CD  . GLU A 253 ? 1.4817 1.4237 0.8107 0.2189  0.0162  0.0027  694 GLU A CD  
1833 O OE1 . GLU A 253 ? 1.5551 1.4948 0.8287 0.2379  0.0009  -0.0091 694 GLU A OE1 
1834 O OE2 . GLU A 253 ? 1.5318 1.4750 0.8678 0.2057  0.0510  0.0152  694 GLU A OE2 
1835 N N   . CYS A 254 ? 1.1024 1.0444 0.6518 0.1376  0.0335  -0.0085 695 CYS A N   
1836 C CA  . CYS A 254 ? 1.0743 1.0011 0.6452 0.1166  0.0520  -0.0020 695 CYS A CA  
1837 C C   . CYS A 254 ? 1.0486 0.9778 0.6313 0.1070  0.0488  -0.0182 695 CYS A C   
1838 O O   . CYS A 254 ? 1.1036 1.0226 0.6955 0.0934  0.0629  -0.0121 695 CYS A O   
1839 C CB  . CYS A 254 ? 1.0605 0.9793 0.6631 0.1044  0.0492  -0.0007 695 CYS A CB  
1840 S SG  . CYS A 254 ? 1.1304 1.0455 0.7312 0.1192  0.0557  0.0171  695 CYS A SG  
1841 N N   . LEU A 255 ? 1.0274 0.9668 0.6118 0.1145  0.0261  -0.0397 696 LEU A N   
1842 C CA  . LEU A 255 ? 0.9975 0.9338 0.5963 0.1088  0.0171  -0.0577 696 LEU A CA  
1843 C C   . LEU A 255 ? 1.0225 0.9752 0.5996 0.1281  0.0249  -0.0689 696 LEU A C   
1844 O O   . LEU A 255 ? 1.0420 0.9951 0.6331 0.1304  0.0165  -0.0872 696 LEU A O   
1845 C CB  . LEU A 255 ? 0.9895 0.9182 0.6050 0.1031  -0.0147 -0.0759 696 LEU A CB  
1846 C CG  . LEU A 255 ? 0.9649 0.8802 0.6083 0.0790  -0.0186 -0.0670 696 LEU A CG  
1847 C CD1 . LEU A 255 ? 0.9847 0.8990 0.6444 0.0728  -0.0499 -0.0815 696 LEU A CD1 
1848 C CD2 . LEU A 255 ? 0.9508 0.8426 0.6052 0.0589  -0.0108 -0.0623 696 LEU A CD2 
1849 N N   . LYS A 256 ? 1.0526 1.0177 0.5940 0.1433  0.0417  -0.0578 697 LYS A N   
1850 C CA  . LYS A 256 ? 1.0793 1.0641 0.5936 0.1615  0.0589  -0.0657 697 LYS A CA  
1851 C C   . LYS A 256 ? 1.0504 1.0483 0.6018 0.1522  0.0767  -0.0672 697 LYS A C   
1852 O O   . LYS A 256 ? 1.0189 1.0110 0.5965 0.1316  0.0890  -0.0480 697 LYS A O   
1853 C CB  . LYS A 256 ? 1.1076 1.0976 0.5761 0.1703  0.0823  -0.0425 697 LYS A CB  
1854 C CG  . LYS A 256 ? 1.1471 1.1280 0.5687 0.1882  0.0614  -0.0447 697 LYS A CG  
1855 C CD  . LYS A 256 ? 1.2190 1.2065 0.5981 0.2127  0.0509  -0.0721 697 LYS A CD  
1856 C CE  . LYS A 256 ? 1.2892 1.2646 0.6052 0.2316  0.0329  -0.0699 697 LYS A CE  
1857 N NZ  . LYS A 256 ? 1.2938 1.2572 0.6268 0.2321  -0.0133 -0.0850 697 LYS A NZ  
1858 N N   . LYS A 257 ? 1.0938 1.1080 0.6482 0.1694  0.0751  -0.0919 698 LYS A N   
1859 C CA  . LYS A 257 ? 1.1000 1.1327 0.7005 0.1655  0.0858  -0.0980 698 LYS A CA  
1860 C C   . LYS A 257 ? 1.1023 1.1656 0.7134 0.1578  0.1259  -0.0740 698 LYS A C   
1861 O O   . LYS A 257 ? 1.0466 1.1250 0.7085 0.1453  0.1328  -0.0703 698 LYS A O   
1862 C CB  . LYS A 257 ? 1.1468 1.1909 0.7466 0.1933  0.0747  -0.1338 698 LYS A CB  
1863 C CG  . LYS A 257 ? 1.1620 1.1692 0.7666 0.1932  0.0299  -0.1562 698 LYS A CG  
1864 C CD  . LYS A 257 ? 1.2396 1.2409 0.8120 0.2242  0.0120  -0.1913 698 LYS A CD  
1865 C CE  . LYS A 257 ? 1.2696 1.2272 0.8418 0.2153  -0.0351 -0.2054 698 LYS A CE  
1866 N NZ  . LYS A 257 ? 1.3515 1.2908 0.8935 0.2434  -0.0618 -0.2428 698 LYS A NZ  
1867 N N   . LYS A 258 ? 1.1465 1.2169 0.7100 0.1638  0.1492  -0.0567 699 LYS A N   
1868 C CA  . LYS A 258 ? 1.1668 1.2603 0.7329 0.1516  0.1880  -0.0281 699 LYS A CA  
1869 C C   . LYS A 258 ? 1.1493 1.2106 0.7124 0.1260  0.1876  0.0042  699 LYS A C   
1870 O O   . LYS A 258 ? 1.1558 1.1880 0.6792 0.1302  0.1742  0.0112  699 LYS A O   
1871 C CB  . LYS A 258 ? 1.2257 1.3376 0.7295 0.1725  0.2147  -0.0250 699 LYS A CB  
1872 C CG  . LYS A 258 ? 1.2770 1.4278 0.7837 0.1987  0.2295  -0.0546 699 LYS A CG  
1873 C CD  . LYS A 258 ? 1.3948 1.5507 0.8178 0.2236  0.2496  -0.0575 699 LYS A CD  
1874 C CE  . LYS A 258 ? 1.4290 1.5567 0.8047 0.2513  0.2126  -0.0924 699 LYS A CE  
1875 N NZ  . LYS A 258 ? 1.5078 1.6540 0.8216 0.2841  0.2352  -0.1143 699 LYS A NZ  
1876 N N   . ARG A 259 ? 1.1279 1.1933 0.7342 0.1011  0.2002  0.0226  700 ARG A N   
1877 C CA  . ARG A 259 ? 1.1350 1.1634 0.7341 0.0779  0.2009  0.0518  700 ARG A CA  
1878 C C   . ARG A 259 ? 1.1942 1.2063 0.7319 0.0853  0.2141  0.0741  700 ARG A C   
1879 O O   . ARG A 259 ? 1.1992 1.1731 0.7124 0.0858  0.1984  0.0824  700 ARG A O   
1880 C CB  . ARG A 259 ? 1.1520 1.1927 0.7951 0.0510  0.2191  0.0721  700 ARG A CB  
1881 C CG  . ARG A 259 ? 1.1379 1.1894 0.8449 0.0398  0.2020  0.0562  700 ARG A CG  
1882 C CD  . ARG A 259 ? 1.1710 1.2036 0.9107 0.0065  0.2025  0.0793  700 ARG A CD  
1883 N NE  . ARG A 259 ? 1.1879 1.2545 0.9445 -0.0074 0.2355  0.1040  700 ARG A NE  
1884 C CZ  . ARG A 259 ? 1.2046 1.2817 1.0155 -0.0363 0.2380  0.1192  700 ARG A CZ  
1885 N NH1 . ARG A 259 ? 1.1561 1.2074 1.0035 -0.0522 0.2064  0.1107  700 ARG A NH1 
1886 N NH2 . ARG A 259 ? 1.2647 1.3776 1.0921 -0.0512 0.2717  0.1442  700 ARG A NH2 
1887 N N   . ASP A 260 ? 1.2490 1.2907 0.7617 0.0919  0.2440  0.0843  701 ASP A N   
1888 C CA  . ASP A 260 ? 1.3166 1.3376 0.7686 0.0921  0.2598  0.1143  701 ASP A CA  
1889 C C   . ASP A 260 ? 1.3452 1.3364 0.7396 0.1161  0.2344  0.1073  701 ASP A C   
1890 O O   . ASP A 260 ? 1.4121 1.3666 0.7677 0.1146  0.2307  0.1323  701 ASP A O   
1891 C CB  . ASP A 260 ? 1.3723 1.4343 0.8041 0.0934  0.3011  0.1262  701 ASP A CB  
1892 C CG  . ASP A 260 ? 1.3578 1.4518 0.8560 0.0638  0.3274  0.1422  701 ASP A CG  
1893 O OD1 . ASP A 260 ? 1.2943 1.3712 0.8466 0.0433  0.3083  0.1427  701 ASP A OD1 
1894 O OD2 . ASP A 260 ? 1.3877 1.5248 0.8843 0.0603  0.3669  0.1544  701 ASP A OD2 
1895 N N   . GLU A 261 ? 1.3035 1.3078 0.6969 0.1375  0.2129  0.0737  702 GLU A N   
1896 C CA  . GLU A 261 ? 1.3143 1.2962 0.6632 0.1589  0.1830  0.0644  702 GLU A CA  
1897 C C   . GLU A 261 ? 1.2458 1.1998 0.6259 0.1524  0.1537  0.0640  702 GLU A C   
1898 O O   . GLU A 261 ? 1.2861 1.2244 0.6412 0.1670  0.1298  0.0628  702 GLU A O   
1899 C CB  . GLU A 261 ? 1.3200 1.3222 0.6539 0.1826  0.1679  0.0280  702 GLU A CB  
1900 C CG  . GLU A 261 ? 1.4067 1.4184 0.6658 0.2037  0.1855  0.0276  702 GLU A CG  
1901 C CD  . GLU A 261 ? 1.4167 1.4582 0.6764 0.2223  0.1910  -0.0083 702 GLU A CD  
1902 O OE1 . GLU A 261 ? 1.3686 1.4060 0.6554 0.2305  0.1584  -0.0397 702 GLU A OE1 
1903 O OE2 . GLU A 261 ? 1.4537 1.5221 0.6870 0.2290  0.2295  -0.0049 702 GLU A OE2 
1904 N N   . ARG A 262 ? 1.1553 1.1042 0.5892 0.1313  0.1555  0.0646  703 ARG A N   
1905 C CA  . ARG A 262 ? 1.1096 1.0350 0.5708 0.1254  0.1342  0.0614  703 ARG A CA  
1906 C C   . ARG A 262 ? 1.1491 1.0411 0.5878 0.1244  0.1384  0.0893  703 ARG A C   
1907 O O   . ARG A 262 ? 1.1803 1.0591 0.6043 0.1127  0.1594  0.1132  703 ARG A O   
1908 C CB  . ARG A 262 ? 1.0413 0.9640 0.5538 0.1037  0.1340  0.0526  703 ARG A CB  
1909 C CG  . ARG A 262 ? 1.0159 0.9667 0.5529 0.1055  0.1287  0.0273  703 ARG A CG  
1910 C CD  . ARG A 262 ? 0.9786 0.9177 0.5545 0.0922  0.1096  0.0115  703 ARG A CD  
1911 N NE  . ARG A 262 ? 0.9745 0.9096 0.5825 0.0720  0.1171  0.0163  703 ARG A NE  
1912 C CZ  . ARG A 262 ? 0.9494 0.9062 0.5873 0.0712  0.1150  0.0025  703 ARG A CZ  
1913 N NH1 . ARG A 262 ? 0.9313 0.9131 0.5678 0.0913  0.1085  -0.0195 703 ARG A NH1 
1914 N NH2 . ARG A 262 ? 0.9479 0.8992 0.6184 0.0513  0.1169  0.0096  703 ARG A NH2 
1915 N N   . PRO A 263 ? 1.1624 1.0408 0.6022 0.1367  0.1175  0.0867  704 PRO A N   
1916 C CA  . PRO A 263 ? 1.1878 1.0308 0.6125 0.1407  0.1179  0.1097  704 PRO A CA  
1917 C C   . PRO A 263 ? 1.1630 0.9772 0.6158 0.1218  0.1278  0.1154  704 PRO A C   
1918 O O   . PRO A 263 ? 1.1142 0.9370 0.6008 0.1072  0.1283  0.0993  704 PRO A O   
1919 C CB  . PRO A 263 ? 1.1905 1.0413 0.6245 0.1622  0.0909  0.0985  704 PRO A CB  
1920 C CG  . PRO A 263 ? 1.1389 1.0206 0.6108 0.1566  0.0795  0.0701  704 PRO A CG  
1921 C CD  . PRO A 263 ? 1.1456 1.0430 0.6053 0.1481  0.0914  0.0621  704 PRO A CD  
1922 N N   . LEU A 264 ? 1.2274 1.0008 0.6597 0.1230  0.1325  0.1381  705 LEU A N   
1923 C CA  . LEU A 264 ? 1.2352 0.9690 0.6832 0.1097  0.1381  0.1418  705 LEU A CA  
1924 C C   . LEU A 264 ? 1.2214 0.9445 0.6844 0.1298  0.1262  0.1318  705 LEU A C   
1925 O O   . LEU A 264 ? 1.2465 0.9906 0.7103 0.1531  0.1116  0.1283  705 LEU A O   
1926 C CB  . LEU A 264 ? 1.2980 0.9863 0.7149 0.0986  0.1488  0.1715  705 LEU A CB  
1927 C CG  . LEU A 264 ? 1.3184 1.0255 0.7319 0.0750  0.1663  0.1836  705 LEU A CG  
1928 C CD1 . LEU A 264 ? 1.4067 1.0800 0.7788 0.0683  0.1766  0.2189  705 LEU A CD1 
1929 C CD2 . LEU A 264 ? 1.2841 0.9891 0.7352 0.0476  0.1710  0.1741  705 LEU A CD2 
1930 N N   . PHE A 265 ? 1.2003 0.8917 0.6759 0.1215  0.1321  0.1267  706 PHE A N   
1931 C CA  . PHE A 265 ? 1.1954 0.8878 0.6933 0.1398  0.1282  0.1128  706 PHE A CA  
1932 C C   . PHE A 265 ? 1.2244 0.9005 0.7143 0.1710  0.1188  0.1234  706 PHE A C   
1933 O O   . PHE A 265 ? 1.2204 0.9265 0.7421 0.1915  0.1112  0.1110  706 PHE A O   
1934 C CB  . PHE A 265 ? 1.2045 0.8633 0.7072 0.1249  0.1398  0.1024  706 PHE A CB  
1935 C CG  . PHE A 265 ? 1.1685 0.8552 0.6921 0.1043  0.1416  0.0847  706 PHE A CG  
1936 C CD1 . PHE A 265 ? 1.1509 0.8792 0.7055 0.1113  0.1386  0.0685  706 PHE A CD1 
1937 C CD2 . PHE A 265 ? 1.1716 0.8437 0.6875 0.0770  0.1432  0.0858  706 PHE A CD2 
1938 C CE1 . PHE A 265 ? 1.1236 0.8693 0.6925 0.0909  0.1374  0.0549  706 PHE A CE1 
1939 C CE2 . PHE A 265 ? 1.1389 0.8308 0.6717 0.0602  0.1397  0.0705  706 PHE A CE2 
1940 C CZ  . PHE A 265 ? 1.1237 0.8481 0.6785 0.0669  0.1369  0.0557  706 PHE A CZ  
1941 N N   . PRO A 266 ? 1.2791 0.9079 0.7304 0.1743  0.1175  0.1472  707 PRO A N   
1942 C CA  . PRO A 266 ? 1.3166 0.9291 0.7580 0.2073  0.1017  0.1584  707 PRO A CA  
1943 C C   . PRO A 266 ? 1.3041 0.9704 0.7581 0.2273  0.0818  0.1540  707 PRO A C   
1944 O O   . PRO A 266 ? 1.2801 0.9630 0.7647 0.2551  0.0675  0.1461  707 PRO A O   
1945 C CB  . PRO A 266 ? 1.3747 0.9288 0.7635 0.1987  0.1021  0.1892  707 PRO A CB  
1946 C CG  . PRO A 266 ? 1.3617 0.8858 0.7476 0.1656  0.1197  0.1889  707 PRO A CG  
1947 C CD  . PRO A 266 ? 1.3009 0.8794 0.7226 0.1488  0.1282  0.1642  707 PRO A CD  
1948 N N   . GLN A 267 ? 1.3108 1.0051 0.7444 0.2142  0.0802  0.1568  708 GLN A N   
1949 C CA  . GLN A 267 ? 1.3312 1.0689 0.7669 0.2317  0.0571  0.1498  708 GLN A CA  
1950 C C   . GLN A 267 ? 1.2548 1.0456 0.7518 0.2326  0.0503  0.1215  708 GLN A C   
1951 O O   . GLN A 267 ? 1.2705 1.0904 0.7947 0.2538  0.0268  0.1144  708 GLN A O   
1952 C CB  . GLN A 267 ? 1.3725 1.1252 0.7664 0.2191  0.0600  0.1544  708 GLN A CB  
1953 C CG  . GLN A 267 ? 1.4721 1.1863 0.8117 0.2040  0.0788  0.1817  708 GLN A CG  
1954 C CD  . GLN A 267 ? 1.5286 1.2744 0.8454 0.1894  0.0921  0.1772  708 GLN A CD  
1955 O OE1 . GLN A 267 ? 1.5465 1.2964 0.8736 0.1643  0.1161  0.1779  708 GLN A OE1 
1956 N NE2 . GLN A 267 ? 1.5420 1.3109 0.8297 0.2069  0.0745  0.1702  708 GLN A NE2 
1957 N N   . ILE A 268 ? 1.1901 0.9925 0.7089 0.2076  0.0685  0.1071  709 ILE A N   
1958 C CA  . ILE A 268 ? 1.1248 0.9692 0.6976 0.2017  0.0659  0.0838  709 ILE A CA  
1959 C C   . ILE A 268 ? 1.1312 0.9849 0.7482 0.2213  0.0648  0.0793  709 ILE A C   
1960 O O   . ILE A 268 ? 1.0979 0.9977 0.7621 0.2303  0.0498  0.0677  709 ILE A O   
1961 C CB  . ILE A 268 ? 1.0702 0.9056 0.6494 0.1724  0.0870  0.0746  709 ILE A CB  
1962 C CG1 . ILE A 268 ? 1.0709 0.9128 0.6253 0.1559  0.0866  0.0734  709 ILE A CG1 
1963 C CG2 . ILE A 268 ? 1.0312 0.8989 0.6594 0.1648  0.0877  0.0557  709 ILE A CG2 
1964 C CD1 . ILE A 268 ? 1.0571 0.8808 0.6113 0.1290  0.1033  0.0701  709 ILE A CD1 
1965 N N   . LEU A 269 ? 1.1614 0.9712 0.7656 0.2275  0.0809  0.0878  710 LEU A N   
1966 C CA  . LEU A 269 ? 1.1646 0.9782 0.8075 0.2502  0.0861  0.0816  710 LEU A CA  
1967 C C   . LEU A 269 ? 1.1994 1.0368 0.8640 0.2837  0.0576  0.0874  710 LEU A C   
1968 O O   . LEU A 269 ? 1.1882 1.0740 0.9152 0.2992  0.0512  0.0754  710 LEU A O   
1969 C CB  . LEU A 269 ? 1.1954 0.9420 0.8048 0.2535  0.1041  0.0894  710 LEU A CB  
1970 C CG  . LEU A 269 ? 1.2068 0.9505 0.8480 0.2665  0.1246  0.0740  710 LEU A CG  
1971 C CD1 . LEU A 269 ? 1.1764 0.9446 0.8339 0.2378  0.1453  0.0572  710 LEU A CD1 
1972 C CD2 . LEU A 269 ? 1.2732 0.9377 0.8702 0.2744  0.1344  0.0812  710 LEU A CD2 
1973 N N   . ALA A 270 ? 1.2572 1.0612 0.8708 0.2937  0.0395  0.1070  711 ALA A N   
1974 C CA  . ALA A 270 ? 1.3010 1.1169 0.9215 0.3257  0.0055  0.1153  711 ALA A CA  
1975 C C   . ALA A 270 ? 1.2770 1.1599 0.9387 0.3237  -0.0179 0.1005  711 ALA A C   
1976 O O   . ALA A 270 ? 1.2934 1.2158 1.0108 0.3470  -0.0411 0.0943  711 ALA A O   
1977 C CB  . ALA A 270 ? 1.3566 1.1190 0.8981 0.3292  -0.0074 0.1417  711 ALA A CB  
1978 N N   . SER A 271 ? 1.2553 1.1502 0.8933 0.2960  -0.0138 0.0939  712 SER A N   
1979 C CA  . SER A 271 ? 1.2201 1.1674 0.8888 0.2898  -0.0378 0.0778  712 SER A CA  
1980 C C   . SER A 271 ? 1.1618 1.1628 0.9197 0.2881  -0.0355 0.0611  712 SER A C   
1981 O O   . SER A 271 ? 1.1780 1.2219 0.9854 0.3028  -0.0660 0.0554  712 SER A O   
1982 C CB  . SER A 271 ? 1.1901 1.1354 0.8241 0.2605  -0.0272 0.0694  712 SER A CB  
1983 O OG  . SER A 271 ? 1.2304 1.1585 0.7988 0.2671  -0.0451 0.0771  712 SER A OG  
1984 N N   . ILE A 272 ? 1.1138 1.1127 0.8916 0.2689  0.0001  0.0541  713 ILE A N   
1985 C CA  . ILE A 272 ? 1.0817 1.1315 0.9385 0.2630  0.0110  0.0403  713 ILE A CA  
1986 C C   . ILE A 272 ? 1.1306 1.2101 1.0458 0.2981  0.0000  0.0421  713 ILE A C   
1987 O O   . ILE A 272 ? 1.1015 1.2427 1.0895 0.3021  -0.0192 0.0341  713 ILE A O   
1988 C CB  . ILE A 272 ? 1.0409 1.0697 0.8922 0.2414  0.0538  0.0354  713 ILE A CB  
1989 C CG1 . ILE A 272 ? 1.0064 1.0143 0.8145 0.2078  0.0579  0.0321  713 ILE A CG1 
1990 C CG2 . ILE A 272 ? 1.0127 1.0945 0.9406 0.2366  0.0716  0.0239  713 ILE A CG2 
1991 C CD1 . ILE A 272 ? 1.0044 0.9885 0.8020 0.1840  0.0919  0.0275  713 ILE A CD1 
1992 N N   . GLU A 273 ? 1.2130 1.2476 1.0995 0.3237  0.0091  0.0527  714 GLU A N   
1993 C CA  . GLU A 273 ? 1.2634 1.3189 1.2056 0.3630  0.0006  0.0532  714 GLU A CA  
1994 C C   . GLU A 273 ? 1.2794 1.3714 1.2544 0.3865  -0.0506 0.0573  714 GLU A C   
1995 O O   . GLU A 273 ? 1.3114 1.4529 1.3675 0.4133  -0.0626 0.0520  714 GLU A O   
1996 C CB  . GLU A 273 ? 1.3407 1.3229 1.2307 0.3860  0.0138  0.0647  714 GLU A CB  
1997 C CG  . GLU A 273 ? 1.3588 1.3071 1.2304 0.3708  0.0608  0.0565  714 GLU A CG  
1998 C CD  . GLU A 273 ? 1.4391 1.3022 1.2490 0.3879  0.0681  0.0680  714 GLU A CD  
1999 O OE1 . GLU A 273 ? 1.4761 1.3184 1.2961 0.4006  0.0963  0.0571  714 GLU A OE1 
2000 O OE2 . GLU A 273 ? 1.4752 1.2893 1.2234 0.3878  0.0464  0.0878  714 GLU A OE2 
2001 N N   . LEU A 274 ? 1.2779 1.3468 1.1906 0.3777  -0.0811 0.0658  715 LEU A N   
2002 C CA  . LEU A 274 ? 1.3030 1.3968 1.2300 0.3976  -0.1353 0.0689  715 LEU A CA  
2003 C C   . LEU A 274 ? 1.2638 1.4352 1.2733 0.3810  -0.1543 0.0514  715 LEU A C   
2004 O O   . LEU A 274 ? 1.2956 1.5183 1.3816 0.4020  -0.1870 0.0481  715 LEU A O   
2005 C CB  . LEU A 274 ? 1.3370 1.3758 1.1576 0.3934  -0.1578 0.0825  715 LEU A CB  
2006 C CG  . LEU A 274 ? 1.3697 1.4232 1.1782 0.4072  -0.2160 0.0831  715 LEU A CG  
2007 C CD1 . LEU A 274 ? 1.4070 1.4801 1.2706 0.4472  -0.2555 0.0893  715 LEU A CD1 
2008 C CD2 . LEU A 274 ? 1.4236 1.4125 1.1097 0.4041  -0.2235 0.0985  715 LEU A CD2 
2009 N N   . LEU A 275 ? 1.2175 1.3962 1.2149 0.3429  -0.1372 0.0409  716 LEU A N   
2010 C CA  . LEU A 275 ? 1.1888 1.4318 1.2600 0.3206  -0.1551 0.0257  716 LEU A CA  
2011 C C   . LEU A 275 ? 1.1566 1.4595 1.3302 0.3135  -0.1221 0.0186  716 LEU A C   
2012 O O   . LEU A 275 ? 1.1379 1.5064 1.3966 0.2996  -0.1386 0.0101  716 LEU A O   
2013 C CB  . LEU A 275 ? 1.1836 1.4052 1.2025 0.2842  -0.1512 0.0171  716 LEU A CB  
2014 C CG  . LEU A 275 ? 1.1680 1.3739 1.1760 0.2542  -0.1000 0.0136  716 LEU A CG  
2015 C CD1 . LEU A 275 ? 1.1349 1.3980 1.2313 0.2282  -0.0867 0.0039  716 LEU A CD1 
2016 C CD2 . LEU A 275 ? 1.1754 1.3353 1.1010 0.2336  -0.0994 0.0102  716 LEU A CD2 
2017 N N   . ALA A 276 ? 1.1663 1.4450 1.3287 0.3213  -0.0747 0.0221  717 ALA A N   
2018 C CA  . ALA A 276 ? 1.1443 1.4736 1.3898 0.3191  -0.0349 0.0148  717 ALA A CA  
2019 C C   . ALA A 276 ? 1.1850 1.5792 1.5307 0.3546  -0.0546 0.0133  717 ALA A C   
2020 O O   . ALA A 276 ? 1.1702 1.6443 1.6174 0.3431  -0.0525 0.0060  717 ALA A O   
2021 C CB  . ALA A 276 ? 1.1526 1.4271 1.3455 0.3238  0.0155  0.0165  717 ALA A CB  
2022 N N   . ARG A 277 ? 1.2544 1.6140 1.5743 0.3970  -0.0745 0.0216  718 ARG A N   
2023 C CA  . ARG A 277 ? 1.2952 1.7099 1.7085 0.4386  -0.1006 0.0207  718 ARG A CA  
2024 C C   . ARG A 277 ? 1.3037 1.7753 1.7748 0.4330  -0.1614 0.0195  718 ARG A C   
2025 O O   . ARG A 277 ? 1.3030 1.8523 1.8886 0.4526  -0.1813 0.0149  718 ARG A O   
2026 C CB  . ARG A 277 ? 1.3631 1.7107 1.7204 0.4847  -0.1156 0.0323  718 ARG A CB  
2027 C CG  . ARG A 277 ? 1.4225 1.7029 1.6781 0.4871  -0.1638 0.0480  718 ARG A CG  
2028 C CD  . ARG A 277 ? 1.5015 1.7056 1.6940 0.5269  -0.1739 0.0638  718 ARG A CD  
2029 N NE  . ARG A 277 ? 1.5729 1.7155 1.6650 0.5276  -0.2179 0.0820  718 ARG A NE  
2030 C CZ  . ARG A 277 ? 1.6278 1.7791 1.7260 0.5516  -0.2795 0.0897  718 ARG A CZ  
2031 N NH1 . ARG A 277 ? 1.6350 1.8597 1.8476 0.5781  -0.3105 0.0808  718 ARG A NH1 
2032 N NH2 . ARG A 277 ? 1.6701 1.7568 1.6580 0.5490  -0.3110 0.1067  718 ARG A NH2 
2033 N N   . SER A 278 ? 1.3216 1.7549 1.7152 0.4068  -0.1910 0.0221  719 SER A N   
2034 C CA  . SER A 278 ? 1.3487 1.8204 1.7766 0.3968  -0.2518 0.0179  719 SER A CA  
2035 C C   . SER A 278 ? 1.3185 1.8594 1.8305 0.3530  -0.2411 0.0060  719 SER A C   
2036 O O   . SER A 278 ? 1.2855 1.8073 1.7543 0.3196  -0.2590 0.0007  719 SER A O   
2037 C CB  . SER A 278 ? 1.3706 1.7648 1.6685 0.3900  -0.2837 0.0231  719 SER A CB  
2038 O OG  . SER A 278 ? 1.4097 1.8250 1.7223 0.3911  -0.3509 0.0187  719 SER A OG  
2039 N N   . LEU A 279 ? 1.3374 1.9574 1.9693 0.3543  -0.2116 0.0020  720 LEU A N   
2040 C CA  . LEU A 279 ? 1.3327 2.0179 2.0461 0.3091  -0.1886 -0.0046 720 LEU A CA  
2041 C C   . LEU A 279 ? 1.3684 2.1589 2.2349 0.3246  -0.1728 -0.0068 720 LEU A C   
2042 O O   . LEU A 279 ? 1.4056 2.2066 2.3015 0.3730  -0.1733 -0.0055 720 LEU A O   
2043 C CB  . LEU A 279 ? 1.2955 1.9343 1.9393 0.2789  -0.1237 -0.0048 720 LEU A CB  
2044 C CG  . LEU A 279 ? 1.2643 1.8976 1.8918 0.2235  -0.1185 -0.0081 720 LEU A CG  
2045 C CD1 . LEU A 279 ? 1.2883 1.8760 1.8478 0.2129  -0.1784 -0.0117 720 LEU A CD1 
2046 C CD2 . LEU A 279 ? 1.2366 1.8134 1.7854 0.2051  -0.0583 -0.0065 720 LEU A CD2 
2047 N N   . PRO A 280 ? 1.3790 2.2485 2.3469 0.2844  -0.1597 -0.0096 721 PRO A N   
2048 C CA  . PRO A 280 ? 1.3749 2.3528 2.4924 0.2954  -0.1280 -0.0112 721 PRO A CA  
2049 C C   . PRO A 280 ? 1.3631 2.3544 2.4847 0.2734  -0.0405 -0.0116 721 PRO A C   
2050 O O   . PRO A 280 ? 1.3817 2.3406 2.4611 0.3058  0.0070  -0.0143 721 PRO A O   
2051 C CB  . PRO A 280 ? 1.3366 2.3971 2.5687 0.2605  -0.1768 -0.0113 721 PRO A CB  
2052 C CG  . PRO A 280 ? 1.3279 2.3152 2.4588 0.2168  -0.2087 -0.0115 721 PRO A CG  
2053 C CD  . PRO A 280 ? 1.3447 2.2157 2.3104 0.2307  -0.1880 -0.0111 721 PRO A CD  
2054 N N   . ASP B 6   ? 1.2794 1.4960 1.8703 0.0040  -0.0934 0.0309  447 ASP B N   
2055 C CA  . ASP B 6   ? 1.3246 1.4967 1.8155 0.0086  -0.1320 0.0096  447 ASP B CA  
2056 C C   . ASP B 6   ? 1.2913 1.3906 1.6988 0.0026  -0.1096 -0.0020 447 ASP B C   
2057 O O   . ASP B 6   ? 1.3397 1.4028 1.6826 0.0008  -0.1371 -0.0241 447 ASP B O   
2058 C CB  . ASP B 6   ? 1.4068 1.6025 1.9306 -0.0131 -0.1937 -0.0092 447 ASP B CB  
2059 C CG  . ASP B 6   ? 1.4730 1.6276 1.8893 -0.0045 -0.2315 -0.0322 447 ASP B CG  
2060 O OD1 . ASP B 6   ? 1.4897 1.6432 1.8472 0.0238  -0.2329 -0.0238 447 ASP B OD1 
2061 O OD2 . ASP B 6   ? 1.5157 1.6352 1.9050 -0.0267 -0.2569 -0.0589 447 ASP B OD2 
2062 N N   . ASP B 7   ? 1.1975 1.2735 1.6017 0.0026  -0.0605 0.0125  448 ASP B N   
2063 C CA  . ASP B 7   ? 1.1457 1.1561 1.4894 -0.0053 -0.0451 0.0056  448 ASP B CA  
2064 C C   . ASP B 7   ? 1.0662 1.0422 1.3363 0.0181  -0.0138 0.0149  448 ASP B C   
2065 O O   . ASP B 7   ? 1.0057 1.0005 1.2798 0.0336  0.0112  0.0299  448 ASP B O   
2066 C CB  . ASP B 7   ? 1.1729 1.1732 1.5728 -0.0357 -0.0236 0.0152  448 ASP B CB  
2067 C CG  . ASP B 7   ? 1.2286 1.1582 1.5799 -0.0490 -0.0278 0.0044  448 ASP B CG  
2068 O OD1 . ASP B 7   ? 1.2681 1.1784 1.6591 -0.0768 -0.0128 0.0140  448 ASP B OD1 
2069 O OD2 . ASP B 7   ? 1.1839 1.0771 1.4623 -0.0312 -0.0441 -0.0122 448 ASP B OD2 
2070 N N   . TRP B 8   ? 1.0374 0.9620 1.2444 0.0208  -0.0176 0.0041  449 TRP B N   
2071 C CA  . TRP B 8   ? 0.9877 0.8851 1.1284 0.0418  -0.0006 0.0089  449 TRP B CA  
2072 C C   . TRP B 8   ? 0.9990 0.8462 1.1104 0.0369  0.0207  0.0189  449 TRP B C   
2073 O O   . TRP B 8   ? 1.0069 0.8275 1.0661 0.0518  0.0222  0.0183  449 TRP B O   
2074 C CB  . TRP B 8   ? 0.9671 0.8570 1.0592 0.0565  -0.0252 -0.0106 449 TRP B CB  
2075 C CG  . TRP B 8   ? 0.9541 0.8843 1.0488 0.0667  -0.0415 -0.0123 449 TRP B CG  
2076 C CD1 . TRP B 8   ? 0.9693 0.9204 1.0753 0.0615  -0.0746 -0.0262 449 TRP B CD1 
2077 C CD2 . TRP B 8   ? 0.9234 0.8712 1.0044 0.0836  -0.0283 0.0022  449 TRP B CD2 
2078 N NE1 . TRP B 8   ? 0.9493 0.9307 1.0463 0.0761  -0.0834 -0.0175 449 TRP B NE1 
2079 C CE2 . TRP B 8   ? 0.9300 0.9081 1.0151 0.0897  -0.0537 0.0002  449 TRP B CE2 
2080 C CE3 . TRP B 8   ? 0.8959 0.8303 0.9564 0.0932  -0.0004 0.0160  449 TRP B CE3 
2081 C CZ2 . TRP B 8   ? 0.9178 0.9105 0.9915 0.1062  -0.0491 0.0150  449 TRP B CZ2 
2082 C CZ3 . TRP B 8   ? 0.8877 0.8356 0.9384 0.1072  0.0041  0.0258  449 TRP B CZ3 
2083 C CH2 . TRP B 8   ? 0.9054 0.8813 0.9652 0.1143  -0.0186 0.0270  449 TRP B CH2 
2084 N N   . GLU B 9   ? 1.0315 0.8659 1.1770 0.0156  0.0363  0.0308  450 GLU B N   
2085 C CA  . GLU B 9   ? 1.0787 0.8572 1.1845 0.0115  0.0546  0.0453  450 GLU B CA  
2086 C C   . GLU B 9   ? 1.0747 0.8505 1.1413 0.0238  0.0846  0.0626  450 GLU B C   
2087 O O   . GLU B 9   ? 1.0702 0.8833 1.1641 0.0260  0.1043  0.0680  450 GLU B O   
2088 C CB  . GLU B 9   ? 1.1236 0.8805 1.2700 -0.0182 0.0665  0.0572  450 GLU B CB  
2089 C CG  . GLU B 9   ? 1.1679 0.8626 1.2633 -0.0221 0.0898  0.0809  450 GLU B CG  
2090 C CD  . GLU B 9   ? 1.2268 0.8734 1.3427 -0.0486 0.0880  0.0888  450 GLU B CD  
2091 O OE1 . GLU B 9   ? 1.2160 0.8885 1.4038 -0.0753 0.0888  0.0861  450 GLU B OE1 
2092 O OE2 . GLU B 9   ? 1.2869 0.8680 1.3500 -0.0429 0.0835  0.0992  450 GLU B OE2 
2093 N N   . ILE B 10  ? 1.1105 0.8398 1.1133 0.0331  0.0851  0.0698  451 ILE B N   
2094 C CA  . ILE B 10  ? 1.1385 0.8519 1.0882 0.0420  0.1077  0.0833  451 ILE B CA  
2095 C C   . ILE B 10  ? 1.2250 0.8876 1.1385 0.0280  0.1328  0.1073  451 ILE B C   
2096 O O   . ILE B 10  ? 1.2470 0.8626 1.1329 0.0254  0.1174  0.1151  451 ILE B O   
2097 C CB  . ILE B 10  ? 1.1361 0.8364 1.0365 0.0613  0.0843  0.0753  451 ILE B CB  
2098 C CG1 . ILE B 10  ? 1.0939 0.8399 1.0227 0.0728  0.0659  0.0557  451 ILE B CG1 
2099 C CG2 . ILE B 10  ? 1.1678 0.8455 1.0077 0.0669  0.1004  0.0856  451 ILE B CG2 
2100 C CD1 . ILE B 10  ? 1.0985 0.8406 0.9989 0.0881  0.0441  0.0469  451 ILE B CD1 
2101 N N   . PRO B 11  ? 1.2645 0.9325 1.1744 0.0210  0.1739  0.1203  452 PRO B N   
2102 C CA  . PRO B 11  ? 1.3475 0.9644 1.2124 0.0059  0.2045  0.1460  452 PRO B CA  
2103 C C   . PRO B 11  ? 1.4029 0.9542 1.1728 0.0144  0.1857  0.1573  452 PRO B C   
2104 O O   . PRO B 11  ? 1.3795 0.9309 1.1118 0.0331  0.1601  0.1453  452 PRO B O   
2105 C CB  . PRO B 11  ? 1.3601 0.9967 1.2208 0.0068  0.2538  0.1510  452 PRO B CB  
2106 C CG  . PRO B 11  ? 1.2793 0.9890 1.2315 0.0131  0.2494  0.1330  452 PRO B CG  
2107 C CD  . PRO B 11  ? 1.2170 0.9377 1.1709 0.0267  0.1974  0.1135  452 PRO B CD  
2108 N N   . ASP B 12  ? 1.4875 0.9839 1.2244 -0.0006 0.1966  0.1827  453 ASP B N   
2109 C CA  . ASP B 12  ? 1.5668 0.9956 1.2164 0.0072  0.1736  0.2000  453 ASP B CA  
2110 C C   . ASP B 12  ? 1.5736 0.9845 1.1331 0.0202  0.1771  0.2003  453 ASP B C   
2111 O O   . ASP B 12  ? 1.5969 1.0118 1.1293 0.0148  0.2199  0.2023  453 ASP B O   
2112 C CB  . ASP B 12  ? 1.7005 1.0681 1.3228 -0.0148 0.1968  0.2342  453 ASP B CB  
2113 C CG  . ASP B 12  ? 1.8259 1.1146 1.3403 -0.0063 0.1771  0.2606  453 ASP B CG  
2114 O OD1 . ASP B 12  ? 1.8362 1.1115 1.3421 0.0139  0.1268  0.2543  453 ASP B OD1 
2115 O OD2 . ASP B 12  ? 1.9105 1.1511 1.3487 -0.0195 0.2126  0.2891  453 ASP B OD2 
2116 N N   . GLY B 13  ? 1.5492 0.9417 1.0674 0.0375  0.1315  0.1961  454 GLY B N   
2117 C CA  . GLY B 13  ? 1.6089 0.9670 1.0282 0.0452  0.1227  0.2000  454 GLY B CA  
2118 C C   . GLY B 13  ? 1.5604 0.9572 0.9798 0.0538  0.1239  0.1727  454 GLY B C   
2119 O O   . GLY B 13  ? 1.6143 0.9772 0.9472 0.0556  0.1229  0.1720  454 GLY B O   
2120 N N   . GLN B 14  ? 1.4808 0.9410 0.9897 0.0584  0.1241  0.1505  455 GLN B N   
2121 C CA  . GLN B 14  ? 1.4420 0.9351 0.9583 0.0672  0.1206  0.1267  455 GLN B CA  
2122 C C   . GLN B 14  ? 1.3857 0.8970 0.9158 0.0780  0.0706  0.1148  455 GLN B C   
2123 O O   . GLN B 14  ? 1.3596 0.8800 0.8740 0.0812  0.0605  0.1001  455 GLN B O   
2124 C CB  . GLN B 14  ? 1.3656 0.9160 0.9673 0.0675  0.1459  0.1133  455 GLN B CB  
2125 C CG  . GLN B 14  ? 1.3885 0.9374 0.9983 0.0581  0.1987  0.1231  455 GLN B CG  
2126 C CD  . GLN B 14  ? 1.2868 0.8981 0.9891 0.0614  0.2164  0.1113  455 GLN B CD  
2127 O OE1 . GLN B 14  ? 1.2173 0.8681 0.9731 0.0681  0.1875  0.0984  455 GLN B OE1 
2128 N NE2 . GLN B 14  ? 1.3135 0.9348 1.0348 0.0577  0.2646  0.1170  455 GLN B NE2 
2129 N N   . ILE B 15  ? 1.3678 0.8833 0.9321 0.0831  0.0421  0.1208  456 ILE B N   
2130 C CA  . ILE B 15  ? 1.3424 0.8835 0.9352 0.0954  0.0005  0.1108  456 ILE B CA  
2131 C C   . ILE B 15  ? 1.4131 0.9131 0.9420 0.0994  -0.0346 0.1246  456 ILE B C   
2132 O O   . ILE B 15  ? 1.4767 0.9257 0.9575 0.0980  -0.0371 0.1470  456 ILE B O   
2133 C CB  . ILE B 15  ? 1.3069 0.8725 0.9708 0.1039  -0.0107 0.1064  456 ILE B CB  
2134 C CG1 . ILE B 15  ? 1.2676 0.8706 0.9859 0.0977  0.0166  0.0932  456 ILE B CG1 
2135 C CG2 . ILE B 15  ? 1.2889 0.8894 0.9906 0.1192  -0.0443 0.0945  456 ILE B CG2 
2136 C CD1 . ILE B 15  ? 1.2449 0.8633 1.0203 0.1029  0.0071  0.0837  456 ILE B CD1 
2137 N N   . THR B 16  ? 1.4031 0.9240 0.9315 0.1026  -0.0634 0.1130  457 THR B N   
2138 C CA  . THR B 16  ? 1.4673 0.9647 0.9551 0.1075  -0.1102 0.1235  457 THR B CA  
2139 C C   . THR B 16  ? 1.4169 0.9654 0.9924 0.1236  -0.1424 0.1180  457 THR B C   
2140 O O   . THR B 16  ? 1.3817 0.9838 1.0138 0.1233  -0.1452 0.1000  457 THR B O   
2141 C CB  . THR B 16  ? 1.4976 0.9834 0.9283 0.0961  -0.1253 0.1123  457 THR B CB  
2142 O OG1 . THR B 16  ? 1.5461 0.9952 0.9110 0.0846  -0.0821 0.1079  457 THR B OG1 
2143 C CG2 . THR B 16  ? 1.5721 1.0203 0.9394 0.0977  -0.1774 0.1269  457 THR B CG2 
2144 N N   . VAL B 17  ? 1.4578 0.9867 1.0453 0.1386  -0.1624 0.1346  458 VAL B N   
2145 C CA  . VAL B 17  ? 1.4147 0.9867 1.0840 0.1598  -0.1921 0.1301  458 VAL B CA  
2146 C C   . VAL B 17  ? 1.4277 1.0113 1.0888 0.1629  -0.2426 0.1356  458 VAL B C   
2147 O O   . VAL B 17  ? 1.5053 1.0360 1.0897 0.1609  -0.2712 0.1560  458 VAL B O   
2148 C CB  . VAL B 17  ? 1.4629 0.9987 1.1463 0.1778  -0.1973 0.1458  458 VAL B CB  
2149 C CG1 . VAL B 17  ? 1.4443 1.0198 1.2107 0.2063  -0.2289 0.1412  458 VAL B CG1 
2150 C CG2 . VAL B 17  ? 1.4323 0.9609 1.1333 0.1699  -0.1526 0.1365  458 VAL B CG2 
2151 N N   . GLY B 18  ? 1.3475 1.0003 1.0863 0.1656  -0.2542 0.1186  459 GLY B N   
2152 C CA  . GLY B 18  ? 1.3662 1.0442 1.1174 0.1629  -0.3038 0.1205  459 GLY B CA  
2153 C C   . GLY B 18  ? 1.3557 1.0800 1.1997 0.1906  -0.3398 0.1268  459 GLY B C   
2154 O O   . GLY B 18  ? 1.4000 1.0891 1.2359 0.2130  -0.3597 0.1459  459 GLY B O   
2155 N N   . GLN B 19  ? 1.3024 1.1051 1.2388 0.1895  -0.3459 0.1120  460 GLN B N   
2156 C CA  . GLN B 19  ? 1.3071 1.1693 1.3482 0.2158  -0.3791 0.1162  460 GLN B CA  
2157 C C   . GLN B 19  ? 1.2689 1.1547 1.3792 0.2440  -0.3396 0.1064  460 GLN B C   
2158 O O   . GLN B 19  ? 1.2262 1.1141 1.3288 0.2351  -0.2892 0.0900  460 GLN B O   
2159 C CB  . GLN B 19  ? 1.2768 1.2180 1.3948 0.1980  -0.3946 0.1041  460 GLN B CB  
2160 C CG  . GLN B 19  ? 1.2927 1.3054 1.5274 0.2211  -0.4385 0.1112  460 GLN B CG  
2161 C CD  . GLN B 19  ? 1.2437 1.3529 1.5889 0.2052  -0.4272 0.0961  460 GLN B CD  
2162 O OE1 . GLN B 19  ? 1.2144 1.3355 1.5532 0.1830  -0.3785 0.0808  460 GLN B OE1 
2163 N NE2 . GLN B 19  ? 1.2543 1.4344 1.7065 0.2165  -0.4725 0.1030  460 GLN B NE2 
2164 N N   . ARG B 20  ? 1.3139 1.2147 1.4900 0.2795  -0.3654 0.1156  461 ARG B N   
2165 C CA  . ARG B 20  ? 1.2923 1.2084 1.5336 0.3114  -0.3312 0.1027  461 ARG B CA  
2166 C C   . ARG B 20  ? 1.2206 1.2365 1.5745 0.3175  -0.3073 0.0818  461 ARG B C   
2167 O O   . ARG B 20  ? 1.2119 1.2924 1.6428 0.3203  -0.3402 0.0874  461 ARG B O   
2168 C CB  . ARG B 20  ? 1.3669 1.2497 1.6319 0.3507  -0.3699 0.1224  461 ARG B CB  
2169 C CG  . ARG B 20  ? 1.3789 1.2399 1.6808 0.3847  -0.3374 0.1097  461 ARG B CG  
2170 C CD  . ARG B 20  ? 1.4770 1.2924 1.7962 0.4237  -0.3820 0.1343  461 ARG B CD  
2171 N NE  . ARG B 20  ? 1.4883 1.3295 1.9071 0.4698  -0.3652 0.1176  461 ARG B NE  
2172 C CZ  . ARG B 20  ? 1.4640 1.4026 2.0034 0.4931  -0.3612 0.1029  461 ARG B CZ  
2173 N NH1 . ARG B 20  ? 1.4253 1.4479 2.0078 0.4702  -0.3756 0.1038  461 ARG B NH1 
2174 N NH2 . ARG B 20  ? 1.4886 1.4399 2.1092 0.5387  -0.3393 0.0856  461 ARG B NH2 
2175 N N   . ILE B 21  ? 1.1742 1.2035 1.5374 0.3180  -0.2510 0.0589  462 ILE B N   
2176 C CA  . ILE B 21  ? 1.1450 1.2635 1.6028 0.3234  -0.2180 0.0405  462 ILE B CA  
2177 C C   . ILE B 21  ? 1.1586 1.3002 1.6961 0.3702  -0.2005 0.0278  462 ILE B C   
2178 O O   . ILE B 21  ? 1.1240 1.3468 1.7701 0.3884  -0.1986 0.0241  462 ILE B O   
2179 C CB  . ILE B 21  ? 1.1077 1.2308 1.5223 0.2958  -0.1655 0.0235  462 ILE B CB  
2180 C CG1 . ILE B 21  ? 1.1091 1.2035 1.4470 0.2535  -0.1781 0.0337  462 ILE B CG1 
2181 C CG2 . ILE B 21  ? 1.0660 1.2778 1.5695 0.2988  -0.1292 0.0097  462 ILE B CG2 
2182 C CD1 . ILE B 21  ? 1.1095 1.2496 1.4886 0.2326  -0.2140 0.0443  462 ILE B CD1 
2183 N N   . GLY B 22  ? 1.2156 1.2859 1.7031 0.3889  -0.1852 0.0194  463 GLY B N   
2184 C CA  . GLY B 22  ? 1.2643 1.3358 1.8132 0.4359  -0.1674 0.0029  463 GLY B CA  
2185 C C   . GLY B 22  ? 1.3364 1.3058 1.8142 0.4480  -0.1653 -0.0012 463 GLY B C   
2186 O O   . GLY B 22  ? 1.3053 1.2158 1.6901 0.4163  -0.1623 0.0031  463 GLY B O   
2187 N N   . SER B 23  ? 1.4365 1.3848 1.9646 0.4938  -0.1652 -0.0102 464 SER B N   
2188 C CA  . SER B 23  ? 1.5595 1.4010 2.0292 0.5056  -0.1736 -0.0086 464 SER B CA  
2189 C C   . SER B 23  ? 1.6441 1.4628 2.1638 0.5539  -0.1491 -0.0374 464 SER B C   
2190 O O   . SER B 23  ? 1.7070 1.5462 2.3117 0.5990  -0.1672 -0.0315 464 SER B O   
2191 C CB  . SER B 23  ? 1.6270 1.4189 2.0764 0.5094  -0.2323 0.0330  464 SER B CB  
2192 O OG  . SER B 23  ? 1.7087 1.3901 2.0897 0.5099  -0.2381 0.0413  464 SER B OG  
2193 N N   . GLY B 24  ? 1.6927 1.4676 2.1598 0.5454  -0.1099 -0.0701 465 GLY B N   
2194 C CA  . GLY B 24  ? 1.7949 1.5101 2.2764 0.5855  -0.0904 -0.1007 465 GLY B CA  
2195 C C   . GLY B 24  ? 1.8641 1.4597 2.2632 0.5670  -0.1061 -0.0955 465 GLY B C   
2196 O O   . GLY B 24  ? 1.8678 1.4370 2.2063 0.5261  -0.1280 -0.0662 465 GLY B O   
2197 N N   . SER B 25  ? 1.9111 1.4325 2.3088 0.5956  -0.0920 -0.1249 466 SER B N   
2198 C CA  . SER B 25  ? 1.9378 1.3413 2.2654 0.5743  -0.1044 -0.1231 466 SER B CA  
2199 C C   . SER B 25  ? 1.8798 1.2691 2.1306 0.5243  -0.0817 -0.1476 466 SER B C   
2200 O O   . SER B 25  ? 1.9063 1.2068 2.1077 0.5003  -0.0903 -0.1488 466 SER B O   
2201 C CB  . SER B 25  ? 2.0421 1.3592 2.3971 0.6222  -0.1023 -0.1464 466 SER B CB  
2202 O OG  . SER B 25  ? 2.0687 1.3960 2.4276 0.6414  -0.0587 -0.2036 466 SER B OG  
2203 N N   . PHE B 26  ? 1.7823 1.2583 2.0278 0.5079  -0.0551 -0.1646 467 PHE B N   
2204 C CA  . PHE B 26  ? 1.7014 1.1781 1.8786 0.4608  -0.0413 -0.1797 467 PHE B CA  
2205 C C   . PHE B 26  ? 1.5938 1.1179 1.7496 0.4195  -0.0554 -0.1411 467 PHE B C   
2206 O O   . PHE B 26  ? 1.5359 1.1086 1.6634 0.3923  -0.0391 -0.1495 467 PHE B O   
2207 C CB  . PHE B 26  ? 1.6744 1.2032 1.8436 0.4694  -0.0018 -0.2229 467 PHE B CB  
2208 C CG  . PHE B 26  ? 1.7645 1.2594 1.9561 0.5169  0.0214  -0.2654 467 PHE B CG  
2209 C CD1 . PHE B 26  ? 1.7576 1.3234 1.9802 0.5460  0.0610  -0.2905 467 PHE B CD1 
2210 C CD2 . PHE B 26  ? 1.8597 1.2480 2.0417 0.5327  0.0077  -0.2807 467 PHE B CD2 
2211 C CE1 . PHE B 26  ? 1.8501 1.3845 2.0921 0.5937  0.0897  -0.3328 467 PHE B CE1 
2212 C CE2 . PHE B 26  ? 1.9392 1.2886 2.1399 0.5803  0.0316  -0.3239 467 PHE B CE2 
2213 C CZ  . PHE B 26  ? 1.9367 1.3608 2.1668 0.6127  0.0742  -0.3514 467 PHE B CZ  
2214 N N   . GLY B 27  ? 1.5576 1.0612 1.7205 0.4167  -0.0857 -0.0992 468 GLY B N   
2215 C CA  . GLY B 27  ? 1.4722 1.0128 1.6101 0.3826  -0.0985 -0.0642 468 GLY B CA  
2216 C C   . GLY B 27  ? 1.4084 1.0171 1.5923 0.3996  -0.1142 -0.0423 468 GLY B C   
2217 O O   . GLY B 27  ? 1.4184 1.0651 1.6666 0.4371  -0.1111 -0.0542 468 GLY B O   
2218 N N   . THR B 28  ? 1.3495 0.9735 1.5029 0.3717  -0.1313 -0.0115 469 THR B N   
2219 C CA  . THR B 28  ? 1.3139 1.0008 1.5031 0.3786  -0.1527 0.0080  469 THR B CA  
2220 C C   . THR B 28  ? 1.2387 0.9750 1.3977 0.3413  -0.1395 0.0090  469 THR B C   
2221 O O   . THR B 28  ? 1.2249 0.9266 1.3215 0.3102  -0.1323 0.0158  469 THR B O   
2222 C CB  . THR B 28  ? 1.3709 1.0092 1.5383 0.3833  -0.1967 0.0474  469 THR B CB  
2223 O OG1 . THR B 28  ? 1.4431 1.0242 1.6372 0.4199  -0.2109 0.0504  469 THR B OG1 
2224 C CG2 . THR B 28  ? 1.3465 1.0500 1.5500 0.3876  -0.2278 0.0650  469 THR B CG2 
2225 N N   . VAL B 29  ? 1.1949 1.0114 1.4038 0.3445  -0.1347 0.0031  470 VAL B N   
2226 C CA  . VAL B 29  ? 1.1548 1.0124 1.3384 0.3105  -0.1221 0.0042  470 VAL B CA  
2227 C C   . VAL B 29  ? 1.1568 1.0306 1.3360 0.2964  -0.1570 0.0295  470 VAL B C   
2228 O O   . VAL B 29  ? 1.1309 1.0495 1.3731 0.3127  -0.1812 0.0361  470 VAL B O   
2229 C CB  . VAL B 29  ? 1.1293 1.0575 1.3570 0.3133  -0.0871 -0.0191 470 VAL B CB  
2230 C CG1 . VAL B 29  ? 1.0852 1.0436 1.2834 0.2778  -0.0765 -0.0137 470 VAL B CG1 
2231 C CG2 . VAL B 29  ? 1.1466 1.0494 1.3567 0.3245  -0.0553 -0.0473 470 VAL B CG2 
2232 N N   . TYR B 30  ? 1.1756 1.0129 1.2809 0.2660  -0.1594 0.0416  471 TYR B N   
2233 C CA  . TYR B 30  ? 1.1934 1.0319 1.2691 0.2470  -0.1887 0.0600  471 TYR B CA  
2234 C C   . TYR B 30  ? 1.1404 1.0094 1.1986 0.2174  -0.1667 0.0510  471 TYR B C   
2235 O O   . TYR B 30  ? 1.1481 1.0118 1.1853 0.2075  -0.1323 0.0393  471 TYR B O   
2236 C CB  . TYR B 30  ? 1.2606 1.0191 1.2506 0.2370  -0.2039 0.0815  471 TYR B CB  
2237 C CG  . TYR B 30  ? 1.3341 1.0426 1.3245 0.2628  -0.2278 0.0980  471 TYR B CG  
2238 C CD1 . TYR B 30  ? 1.3471 1.0082 1.3286 0.2703  -0.2058 0.0935  471 TYR B CD1 
2239 C CD2 . TYR B 30  ? 1.3853 1.0887 1.3834 0.2785  -0.2767 0.1193  471 TYR B CD2 
2240 C CE1 . TYR B 30  ? 1.4386 1.0426 1.4189 0.2933  -0.2273 0.1104  471 TYR B CE1 
2241 C CE2 . TYR B 30  ? 1.4547 1.1048 1.4506 0.3048  -0.3012 0.1389  471 TYR B CE2 
2242 C CZ  . TYR B 30  ? 1.4916 1.0886 1.4780 0.3123  -0.2743 0.1348  471 TYR B CZ  
2243 O OH  . TYR B 30  ? 1.5464 1.0800 1.5297 0.3379  -0.2979 0.1557  471 TYR B OH  
2244 N N   . LYS B 31  ? 1.1326 1.0293 1.1991 0.2029  -0.1902 0.0568  472 LYS B N   
2245 C CA  . LYS B 31  ? 1.1048 1.0040 1.1347 0.1724  -0.1757 0.0524  472 LYS B CA  
2246 C C   . LYS B 31  ? 1.1522 0.9800 1.0854 0.1577  -0.1813 0.0629  472 LYS B C   
2247 O O   . LYS B 31  ? 1.2419 1.0343 1.1376 0.1604  -0.2156 0.0774  472 LYS B O   
2248 C CB  . LYS B 31  ? 1.1009 1.0489 1.1762 0.1585  -0.2003 0.0525  472 LYS B CB  
2249 C CG  . LYS B 31  ? 1.0966 1.0383 1.1365 0.1273  -0.1854 0.0468  472 LYS B CG  
2250 C CD  . LYS B 31  ? 1.1113 1.1002 1.2056 0.1088  -0.2107 0.0458  472 LYS B CD  
2251 C CE  . LYS B 31  ? 1.1295 1.0958 1.1821 0.0771  -0.1981 0.0398  472 LYS B CE  
2252 N NZ  . LYS B 31  ? 1.1713 1.1660 1.2639 0.0524  -0.2339 0.0387  472 LYS B NZ  
2253 N N   . GLY B 32  ? 1.1341 0.9416 1.0265 0.1435  -0.1470 0.0569  473 GLY B N   
2254 C CA  . GLY B 32  ? 1.1518 0.8966 0.9599 0.1319  -0.1398 0.0653  473 GLY B CA  
2255 C C   . GLY B 32  ? 1.1415 0.8770 0.9132 0.1120  -0.1181 0.0575  473 GLY B C   
2256 O O   . GLY B 32  ? 1.0747 0.8461 0.8806 0.1037  -0.1136 0.0478  473 GLY B O   
2257 N N   . LYS B 33  ? 1.1936 0.8773 0.8962 0.1052  -0.1016 0.0629  474 LYS B N   
2258 C CA  . LYS B 33  ? 1.1981 0.8631 0.8624 0.0918  -0.0773 0.0548  474 LYS B CA  
2259 C C   . LYS B 33  ? 1.1760 0.8215 0.8235 0.0936  -0.0382 0.0582  474 LYS B C   
2260 O O   . LYS B 33  ? 1.2223 0.8289 0.8258 0.0938  -0.0314 0.0701  474 LYS B O   
2261 C CB  . LYS B 33  ? 1.2894 0.9078 0.8779 0.0799  -0.0981 0.0542  474 LYS B CB  
2262 C CG  . LYS B 33  ? 1.3093 0.9527 0.9244 0.0688  -0.1314 0.0447  474 LYS B CG  
2263 C CD  . LYS B 33  ? 1.4178 1.0064 0.9471 0.0545  -0.1578 0.0402  474 LYS B CD  
2264 C CE  . LYS B 33  ? 1.4408 1.0546 1.0041 0.0376  -0.1961 0.0296  474 LYS B CE  
2265 N NZ  . LYS B 33  ? 1.5457 1.1057 1.0224 0.0240  -0.2382 0.0254  474 LYS B NZ  
2266 N N   . TRP B 34  ? 1.1342 0.8099 0.8222 0.0944  -0.0140 0.0501  475 TRP B N   
2267 C CA  . TRP B 34  ? 1.1223 0.7920 0.8109 0.0950  0.0208  0.0517  475 TRP B CA  
2268 C C   . TRP B 34  ? 1.0868 0.7774 0.7982 0.0950  0.0347  0.0426  475 TRP B C   
2269 O O   . TRP B 34  ? 1.0465 0.7758 0.8037 0.0980  0.0279  0.0391  475 TRP B O   
2270 C CB  . TRP B 34  ? 1.0884 0.7809 0.8237 0.1005  0.0242  0.0551  475 TRP B CB  
2271 C CG  . TRP B 34  ? 1.0792 0.7688 0.8239 0.0973  0.0543  0.0591  475 TRP B CG  
2272 C CD1 . TRP B 34  ? 1.1488 0.8032 0.8584 0.0910  0.0755  0.0704  475 TRP B CD1 
2273 C CD2 . TRP B 34  ? 1.0311 0.7582 0.8278 0.0993  0.0668  0.0536  475 TRP B CD2 
2274 N NE1 . TRP B 34  ? 1.1306 0.8055 0.8806 0.0882  0.1031  0.0716  475 TRP B NE1 
2275 C CE2 . TRP B 34  ? 1.0644 0.7845 0.8693 0.0938  0.0937  0.0611  475 TRP B CE2 
2276 C CE3 . TRP B 34  ? 0.9945 0.7605 0.8296 0.1047  0.0572  0.0448  475 TRP B CE3 
2277 C CZ2 . TRP B 34  ? 1.0289 0.7861 0.8907 0.0941  0.1051  0.0591  475 TRP B CZ2 
2278 C CZ3 . TRP B 34  ? 0.9614 0.7554 0.8366 0.1059  0.0665  0.0436  475 TRP B CZ3 
2279 C CH2 . TRP B 34  ? 0.9693 0.7617 0.8631 0.1009  0.0872  0.0502  475 TRP B CH2 
2280 N N   . HIS B 35  ? 1.1243 0.7837 0.7982 0.0928  0.0551  0.0393  476 HIS B N   
2281 C CA  . HIS B 35  ? 1.1136 0.7794 0.8037 0.0947  0.0660  0.0324  476 HIS B CA  
2282 C C   . HIS B 35  ? 1.0907 0.7768 0.8019 0.0877  0.0406  0.0291  476 HIS B C   
2283 O O   . HIS B 35  ? 1.0483 0.7617 0.7973 0.0902  0.0446  0.0307  476 HIS B O   
2284 C CB  . HIS B 35  ? 1.0812 0.7807 0.8236 0.1049  0.0860  0.0367  476 HIS B CB  
2285 C CG  . HIS B 35  ? 1.1243 0.8138 0.8640 0.1091  0.1151  0.0408  476 HIS B CG  
2286 N ND1 . HIS B 35  ? 1.1824 0.8301 0.8758 0.1112  0.1418  0.0369  476 HIS B ND1 
2287 C CD2 . HIS B 35  ? 1.0980 0.8137 0.8775 0.1098  0.1243  0.0478  476 HIS B CD2 
2288 C CE1 . HIS B 35  ? 1.1861 0.8405 0.8953 0.1138  0.1709  0.0437  476 HIS B CE1 
2289 N NE2 . HIS B 35  ? 1.1350 0.8314 0.9006 0.1110  0.1587  0.0511  476 HIS B NE2 
2290 N N   . GLY B 36  ? 1.1342 0.8080 0.8216 0.0782  0.0140  0.0267  477 GLY B N   
2291 C CA  . GLY B 36  ? 1.1315 0.8302 0.8490 0.0680  -0.0100 0.0243  477 GLY B CA  
2292 C C   . GLY B 36  ? 1.1081 0.8438 0.8607 0.0717  -0.0339 0.0288  477 GLY B C   
2293 O O   . GLY B 36  ? 1.1203 0.8504 0.8640 0.0816  -0.0355 0.0339  477 GLY B O   
2294 N N   . ASP B 37  ? 1.0987 0.8716 0.8966 0.0643  -0.0500 0.0278  478 ASP B N   
2295 C CA  . ASP B 37  ? 1.0804 0.8982 0.9289 0.0732  -0.0671 0.0307  478 ASP B CA  
2296 C C   . ASP B 37  ? 1.0467 0.8916 0.9244 0.0901  -0.0446 0.0310  478 ASP B C   
2297 O O   . ASP B 37  ? 1.0441 0.9044 0.9334 0.0895  -0.0225 0.0301  478 ASP B O   
2298 C CB  . ASP B 37  ? 1.0709 0.9319 0.9745 0.0602  -0.0816 0.0296  478 ASP B CB  
2299 C CG  . ASP B 37  ? 1.1490 0.9875 1.0320 0.0413  -0.1168 0.0269  478 ASP B CG  
2300 O OD1 . ASP B 37  ? 1.2225 1.0175 1.0477 0.0438  -0.1370 0.0270  478 ASP B OD1 
2301 O OD2 . ASP B 37  ? 1.1847 1.0466 1.1062 0.0214  -0.1254 0.0249  478 ASP B OD2 
2302 N N   . VAL B 38  ? 1.0546 0.8982 0.9379 0.1047  -0.0534 0.0324  479 VAL B N   
2303 C CA  . VAL B 38  ? 1.0306 0.8889 0.9349 0.1192  -0.0377 0.0282  479 VAL B CA  
2304 C C   . VAL B 38  ? 1.0285 0.9041 0.9696 0.1357  -0.0539 0.0263  479 VAL B C   
2305 O O   . VAL B 38  ? 1.0741 0.9377 1.0124 0.1379  -0.0802 0.0335  479 VAL B O   
2306 C CB  . VAL B 38  ? 1.0675 0.8869 0.9354 0.1200  -0.0264 0.0312  479 VAL B CB  
2307 C CG1 . VAL B 38  ? 1.0865 0.8963 0.9330 0.1105  -0.0064 0.0320  479 VAL B CG1 
2308 C CG2 . VAL B 38  ? 1.1006 0.8771 0.9308 0.1193  -0.0420 0.0411  479 VAL B CG2 
2309 N N   . ALA B 39  ? 1.0179 0.9179 0.9897 0.1493  -0.0398 0.0161  480 ALA B N   
2310 C CA  . ALA B 39  ? 1.0316 0.9376 1.0376 0.1711  -0.0501 0.0110  480 ALA B CA  
2311 C C   . ALA B 39  ? 1.0400 0.8972 1.0182 0.1773  -0.0509 0.0105  480 ALA B C   
2312 O O   . ALA B 39  ? 1.0396 0.8828 0.9948 0.1686  -0.0351 0.0057  480 ALA B O   
2313 C CB  . ALA B 39  ? 1.0136 0.9660 1.0627 0.1839  -0.0301 -0.0038 480 ALA B CB  
2314 N N   . VAL B 40  ? 1.0514 0.8828 1.0365 0.1913  -0.0715 0.0175  481 VAL B N   
2315 C CA  . VAL B 40  ? 1.0967 0.8733 1.0567 0.1938  -0.0732 0.0215  481 VAL B CA  
2316 C C   . VAL B 40  ? 1.1187 0.8859 1.1159 0.2208  -0.0817 0.0126  481 VAL B C   
2317 O O   . VAL B 40  ? 1.1416 0.9113 1.1635 0.2383  -0.1046 0.0223  481 VAL B O   
2318 C CB  . VAL B 40  ? 1.1711 0.9001 1.0823 0.1830  -0.0892 0.0457  481 VAL B CB  
2319 C CG1 . VAL B 40  ? 1.2181 0.8883 1.1066 0.1817  -0.0862 0.0542  481 VAL B CG1 
2320 C CG2 . VAL B 40  ? 1.1759 0.9076 1.0476 0.1600  -0.0760 0.0503  481 VAL B CG2 
2321 N N   . LYS B 41  ? 1.1220 0.8762 1.1235 0.2252  -0.0657 -0.0069 482 LYS B N   
2322 C CA  . LYS B 41  ? 1.1638 0.8932 1.1927 0.2515  -0.0696 -0.0207 482 LYS B CA  
2323 C C   . LYS B 41  ? 1.2045 0.8600 1.2040 0.2427  -0.0779 -0.0103 482 LYS B C   
2324 O O   . LYS B 41  ? 1.1833 0.8205 1.1621 0.2223  -0.0659 -0.0186 482 LYS B O   
2325 C CB  . LYS B 41  ? 1.1696 0.9230 1.2093 0.2589  -0.0458 -0.0535 482 LYS B CB  
2326 C CG  . LYS B 41  ? 1.2276 0.9632 1.2977 0.2919  -0.0420 -0.0769 482 LYS B CG  
2327 C CD  . LYS B 41  ? 1.2655 0.9903 1.3109 0.2897  -0.0217 -0.1114 482 LYS B CD  
2328 C CE  . LYS B 41  ? 1.3291 1.0695 1.4009 0.3241  -0.0014 -0.1422 482 LYS B CE  
2329 N NZ  . LYS B 41  ? 1.3203 1.1391 1.4119 0.3282  0.0226  -0.1441 482 LYS B NZ  
2330 N N   . MET B 42  ? 1.2855 0.8986 1.2849 0.2562  -0.1000 0.0107  483 MET B N   
2331 C CA  . MET B 42  ? 1.3865 0.9220 1.3545 0.2446  -0.1052 0.0269  483 MET B CA  
2332 C C   . MET B 42  ? 1.4240 0.9034 1.4138 0.2739  -0.1214 0.0272  483 MET B C   
2333 O O   . MET B 42  ? 1.4312 0.9279 1.4553 0.3058  -0.1389 0.0306  483 MET B O   
2334 C CB  . MET B 42  ? 1.4747 0.9874 1.3929 0.2240  -0.1133 0.0627  483 MET B CB  
2335 C CG  . MET B 42  ? 1.5492 1.0673 1.4609 0.2414  -0.1433 0.0856  483 MET B CG  
2336 S SD  . MET B 42  ? 1.6897 1.1410 1.5167 0.2214  -0.1553 0.1291  483 MET B SD  
2337 C CE  . MET B 42  ? 1.6009 1.0725 1.3903 0.1826  -0.1164 0.1236  483 MET B CE  
2338 N N   . LEU B 43  ? 1.4643 0.8766 1.4409 0.2627  -0.1162 0.0236  484 LEU B N   
2339 C CA  . LEU B 43  ? 1.5563 0.8949 1.5464 0.2879  -0.1317 0.0275  484 LEU B CA  
2340 C C   . LEU B 43  ? 1.6222 0.9089 1.5784 0.2871  -0.1544 0.0753  484 LEU B C   
2341 O O   . LEU B 43  ? 1.6401 0.9042 1.5482 0.2533  -0.1470 0.1009  484 LEU B O   
2342 C CB  . LEU B 43  ? 1.5957 0.8709 1.5822 0.2717  -0.1207 0.0059  484 LEU B CB  
2343 C CG  . LEU B 43  ? 1.6242 0.8859 1.6452 0.3047  -0.1174 -0.0368 484 LEU B CG  
2344 C CD1 . LEU B 43  ? 1.6685 0.8795 1.6771 0.2790  -0.1083 -0.0667 484 LEU B CD1 
2345 C CD2 . LEU B 43  ? 1.6989 0.9056 1.7450 0.3477  -0.1371 -0.0240 484 LEU B CD2 
2346 N N   . ASN B 44  ? 1.6634 0.9313 1.6444 0.3264  -0.1810 0.0873  485 ASN B N   
2347 C CA  . ASN B 44  ? 1.7228 0.9498 1.6681 0.3329  -0.2120 0.1343  485 ASN B CA  
2348 C C   . ASN B 44  ? 1.8377 0.9531 1.7671 0.3424  -0.2241 0.1567  485 ASN B C   
2349 O O   . ASN B 44  ? 1.8716 0.9529 1.8222 0.3817  -0.2555 0.1743  485 ASN B O   
2350 C CB  . ASN B 44  ? 1.7147 1.0039 1.7069 0.3709  -0.2418 0.1368  485 ASN B CB  
2351 C CG  . ASN B 44  ? 1.7144 1.0301 1.6596 0.3554  -0.2650 0.1681  485 ASN B CG  
2352 O OD1 . ASN B 44  ? 1.7761 1.0485 1.6918 0.3691  -0.3028 0.2051  485 ASN B OD1 
2353 N ND2 . ASN B 44  ? 1.6400 1.0210 1.5720 0.3272  -0.2448 0.1530  485 ASN B ND2 
2354 N N   . VAL B 45  ? 1.8684 0.9269 1.7666 0.3059  -0.2003 0.1575  486 VAL B N   
2355 C CA  . VAL B 45  ? 1.9876 0.9325 1.8744 0.3072  -0.2064 0.1757  486 VAL B CA  
2356 C C   . VAL B 45  ? 2.0366 0.9187 1.8580 0.2599  -0.1915 0.2154  486 VAL B C   
2357 O O   . VAL B 45  ? 1.9652 0.8948 1.7622 0.2226  -0.1664 0.2154  486 VAL B O   
2358 C CB  . VAL B 45  ? 2.0077 0.9260 1.9410 0.3113  -0.1908 0.1278  486 VAL B CB  
2359 C CG1 . VAL B 45  ? 1.9865 0.9516 1.9809 0.3636  -0.1989 0.0902  486 VAL B CG1 
2360 C CG2 . VAL B 45  ? 1.9437 0.9049 1.8746 0.2653  -0.1600 0.0983  486 VAL B CG2 
2361 N N   . THR B 46  ? 2.1602 0.9332 1.9566 0.2637  -0.2045 0.2504  487 THR B N   
2362 C CA  . THR B 46  ? 2.2329 0.9305 1.9720 0.2180  -0.1848 0.2911  487 THR B CA  
2363 C C   . THR B 46  ? 2.1919 0.8941 1.9635 0.1724  -0.1493 0.2607  487 THR B C   
2364 O O   . THR B 46  ? 2.1586 0.8831 1.9059 0.1280  -0.1193 0.2750  487 THR B O   
2365 C CB  . THR B 46  ? 2.3789 0.9468 2.0924 0.2349  -0.2079 0.3335  487 THR B CB  
2366 O OG1 . THR B 46  ? 2.4165 0.9836 2.1089 0.2818  -0.2499 0.3614  487 THR B OG1 
2367 C CG2 . THR B 46  ? 2.4706 0.9572 2.1171 0.1855  -0.1835 0.3841  487 THR B CG2 
2368 N N   . ALA B 47  ? 2.1906 0.8731 2.0184 0.1851  -0.1541 0.2171  488 ALA B N   
2369 C CA  . ALA B 47  ? 2.1703 0.8366 2.0295 0.1424  -0.1326 0.1878  488 ALA B CA  
2370 C C   . ALA B 47  ? 2.1005 0.8015 2.0113 0.1652  -0.1390 0.1216  488 ALA B C   
2371 O O   . ALA B 47  ? 2.1663 0.8055 2.0951 0.2018  -0.1560 0.1032  488 ALA B O   
2372 C CB  . ALA B 47  ? 2.3094 0.8454 2.1567 0.1201  -0.1330 0.2185  488 ALA B CB  
2373 N N   . PRO B 48  ? 1.9702 0.7655 1.9003 0.1456  -0.1242 0.0859  489 PRO B N   
2374 C CA  . PRO B 48  ? 1.9222 0.7512 1.8841 0.1659  -0.1281 0.0240  489 PRO B CA  
2375 C C   . PRO B 48  ? 1.9942 0.7340 1.9729 0.1506  -0.1338 -0.0093 489 PRO B C   
2376 O O   . PRO B 48  ? 2.0334 0.7283 2.0155 0.1017  -0.1287 0.0050  489 PRO B O   
2377 C CB  . PRO B 48  ? 1.8139 0.7507 1.7813 0.1380  -0.1126 0.0066  489 PRO B CB  
2378 C CG  . PRO B 48  ? 1.7742 0.7458 1.7166 0.1186  -0.1004 0.0561  489 PRO B CG  
2379 C CD  . PRO B 48  ? 1.8775 0.7500 1.7960 0.1076  -0.1026 0.1025  489 PRO B CD  
2380 N N   . THR B 49  ? 2.0319 0.7457 2.0226 0.1908  -0.1425 -0.0549 490 THR B N   
2381 C CA  . THR B 49  ? 2.1365 0.7581 2.1346 0.1785  -0.1497 -0.0967 490 THR B CA  
2382 C C   . THR B 49  ? 2.1249 0.8061 2.1243 0.1501  -0.1466 -0.1489 490 THR B C   
2383 O O   . THR B 49  ? 2.0393 0.8222 2.0339 0.1652  -0.1382 -0.1646 490 THR B O   
2384 C CB  . THR B 49  ? 2.1958 0.7491 2.2005 0.2387  -0.1574 -0.1271 490 THR B CB  
2385 O OG1 . THR B 49  ? 2.1099 0.7508 2.1192 0.2782  -0.1473 -0.1686 490 THR B OG1 
2386 C CG2 . THR B 49  ? 2.2433 0.7435 2.2508 0.2745  -0.1679 -0.0739 490 THR B CG2 
2387 N N   . PRO B 50  ? 1.6431 0.8032 2.1915 -0.0259 0.1792  0.2841  491 PRO B N   
2388 C CA  . PRO B 50  ? 1.6062 0.7918 2.1825 -0.0568 0.1691  0.2234  491 PRO B CA  
2389 C C   . PRO B 50  ? 1.5636 0.7860 2.1160 -0.0470 0.1376  0.1708  491 PRO B C   
2390 O O   . PRO B 50  ? 1.5304 0.8039 2.0728 -0.0624 0.1248  0.1372  491 PRO B O   
2391 C CB  . PRO B 50  ? 1.6638 0.7849 2.3157 -0.0805 0.1899  0.2080  491 PRO B CB  
2392 C CG  . PRO B 50  ? 1.7243 0.7994 2.3886 -0.0758 0.2207  0.2737  491 PRO B CG  
2393 C CD  . PRO B 50  ? 1.7156 0.8107 2.3134 -0.0355 0.2123  0.3225  491 PRO B CD  
2394 N N   . GLN B 51  ? 1.5840 0.7829 2.1284 -0.0207 0.1264  0.1653  492 GLN B N   
2395 C CA  . GLN B 51  ? 1.5437 0.7775 2.0660 -0.0101 0.0984  0.1181  492 GLN B CA  
2396 C C   . GLN B 51  ? 1.5051 0.7926 1.9596 0.0135  0.0790  0.1327  492 GLN B C   
2397 O O   . GLN B 51  ? 1.4510 0.7792 1.8836 0.0162  0.0578  0.0960  492 GLN B O   
2398 C CB  . GLN B 51  ? 1.5710 0.7590 2.1213 0.0049  0.0958  0.0979  492 GLN B CB  
2399 C CG  . GLN B 51  ? 1.6218 0.7817 2.1515 0.0409  0.0990  0.1437  492 GLN B CG  
2400 C CD  . GLN B 51  ? 1.6901 0.7823 2.2685 0.0499  0.1102  0.1353  492 GLN B CD  
2401 O OE1 . GLN B 51  ? 1.7254 0.7597 2.3373 0.0495  0.1352  0.1707  492 GLN B OE1 
2402 N NE2 . GLN B 51  ? 1.6767 0.7750 2.2612 0.0581  0.0937  0.0876  492 GLN B NE2 
2403 N N   . GLN B 52  ? 1.5179 0.8065 1.9402 0.0307  0.0867  0.1854  493 GLN B N   
2404 C CA  . GLN B 52  ? 1.4562 0.8006 1.8166 0.0457  0.0718  0.1983  493 GLN B CA  
2405 C C   . GLN B 52  ? 1.4161 0.8041 1.7649 0.0223  0.0715  0.1827  493 GLN B C   
2406 O O   . GLN B 52  ? 1.3537 0.7871 1.6698 0.0246  0.0537  0.1581  493 GLN B O   
2407 C CB  . GLN B 52  ? 1.4682 0.8092 1.7985 0.0680  0.0815  0.2574  493 GLN B CB  
2408 C CG  . GLN B 52  ? 1.4707 0.7978 1.7896 0.1009  0.0723  0.2725  493 GLN B CG  
2409 C CD  . GLN B 52  ? 1.5038 0.8268 1.7995 0.1238  0.0842  0.3344  493 GLN B CD  
2410 O OE1 . GLN B 52  ? 1.5418 0.8344 1.8577 0.1160  0.1082  0.3704  493 GLN B OE1 
2411 N NE2 . GLN B 52  ? 1.4907 0.8479 1.7448 0.1523  0.0679  0.3480  493 GLN B NE2 
2412 N N   . LEU B 53  ? 1.4242 0.7971 1.8025 0.0005  0.0929  0.1987  494 LEU B N   
2413 C CA  . LEU B 53  ? 1.3775 0.7898 1.7550 -0.0224 0.0963  0.1854  494 LEU B CA  
2414 C C   . LEU B 53  ? 1.3433 0.7791 1.7394 -0.0373 0.0806  0.1285  494 LEU B C   
2415 O O   . LEU B 53  ? 1.3217 0.8047 1.6977 -0.0439 0.0732  0.1124  494 LEU B O   
2416 C CB  . LEU B 53  ? 1.4240 0.8110 1.8427 -0.0451 0.1240  0.2102  494 LEU B CB  
2417 C CG  . LEU B 53  ? 1.3941 0.8241 1.8165 -0.0685 0.1312  0.2022  494 LEU B CG  
2418 C CD1 . LEU B 53  ? 1.3648 0.8392 1.7262 -0.0527 0.1288  0.2288  494 LEU B CD1 
2419 C CD2 . LEU B 53  ? 1.4418 0.8434 1.9181 -0.0951 0.1596  0.2209  494 LEU B CD2 
2420 N N   . GLN B 54  ? 1.3606 0.7653 1.7947 -0.0410 0.0764  0.0984  495 GLN B N   
2421 C CA  . GLN B 54  ? 1.3281 0.7602 1.7767 -0.0517 0.0601  0.0438  495 GLN B CA  
2422 C C   . GLN B 54  ? 1.2929 0.7591 1.6952 -0.0296 0.0366  0.0271  495 GLN B C   
2423 O O   . GLN B 54  ? 1.2791 0.7897 1.6698 -0.0351 0.0247  -0.0013 495 GLN B O   
2424 C CB  . GLN B 54  ? 1.3689 0.7602 1.8737 -0.0639 0.0639  0.0124  495 GLN B CB  
2425 C CG  . GLN B 54  ? 1.3954 0.7897 1.9534 -0.0988 0.0762  -0.0098 495 GLN B CG  
2426 C CD  . GLN B 54  ? 1.3203 0.7815 1.8695 -0.1107 0.0619  -0.0446 495 GLN B CD  
2427 O OE1 . GLN B 54  ? 1.3032 0.7896 1.8707 -0.1322 0.0718  -0.0425 495 GLN B OE1 
2428 N NE2 . GLN B 54  ? 1.2687 0.7609 1.7906 -0.0954 0.0398  -0.0745 495 GLN B NE2 
2429 N N   . ALA B 55  ? 1.2954 0.7433 1.6731 -0.0045 0.0309  0.0457  496 ALA B N   
2430 C CA  . ALA B 55  ? 1.2431 0.7241 1.5791 0.0151  0.0103  0.0319  496 ALA B CA  
2431 C C   . ALA B 55  ? 1.2018 0.7297 1.4946 0.0151  0.0056  0.0403  496 ALA B C   
2432 O O   . ALA B 55  ? 1.1284 0.6916 1.4030 0.0166  -0.0078 0.0140  496 ALA B O   
2433 C CB  . ALA B 55  ? 1.2549 0.7138 1.5735 0.0415  0.0069  0.0561  496 ALA B CB  
2434 N N   . PHE B 56  ? 1.2211 0.7475 1.4984 0.0144  0.0186  0.0781  497 PHE B N   
2435 C CA  . PHE B 56  ? 1.1786 0.7445 1.4190 0.0130  0.0191  0.0880  497 PHE B CA  
2436 C C   . PHE B 56  ? 1.1452 0.7409 1.4001 -0.0049 0.0179  0.0578  497 PHE B C   
2437 O O   . PHE B 56  ? 1.1077 0.7376 1.3354 0.0000  0.0073  0.0415  497 PHE B O   
2438 C CB  . PHE B 56  ? 1.2242 0.7802 1.4579 0.0116  0.0378  0.1320  497 PHE B CB  
2439 C CG  . PHE B 56  ? 1.2181 0.8137 1.4157 0.0100  0.0416  0.1425  497 PHE B CG  
2440 C CD1 . PHE B 56  ? 1.2135 0.8343 1.3611 0.0273  0.0319  0.1501  497 PHE B CD1 
2441 C CD2 . PHE B 56  ? 1.2053 0.8142 1.4212 -0.0090 0.0560  0.1435  497 PHE B CD2 
2442 C CE1 . PHE B 56  ? 1.1935 0.8483 1.3089 0.0260  0.0368  0.1561  497 PHE B CE1 
2443 C CE2 . PHE B 56  ? 1.1875 0.8324 1.3711 -0.0085 0.0612  0.1523  497 PHE B CE2 
2444 C CZ  . PHE B 56  ? 1.1858 0.8516 1.3185 0.0093  0.0518  0.1577  497 PHE B CZ  
2445 N N   . LYS B 57  ? 1.1764 0.7600 1.4765 -0.0254 0.0293  0.0503  498 LYS B N   
2446 C CA  . LYS B 57  ? 1.1557 0.7743 1.4749 -0.0426 0.0282  0.0221  498 LYS B CA  
2447 C C   . LYS B 57  ? 1.1101 0.7518 1.4284 -0.0376 0.0090  -0.0188 498 LYS B C   
2448 O O   . LYS B 57  ? 1.1011 0.7838 1.4058 -0.0376 0.0028  -0.0336 498 LYS B O   
2449 C CB  . LYS B 57  ? 1.1865 0.7896 1.5609 -0.0680 0.0439  0.0189  498 LYS B CB  
2450 C CG  . LYS B 57  ? 1.2247 0.8226 1.6007 -0.0769 0.0655  0.0579  498 LYS B CG  
2451 C CD  . LYS B 57  ? 1.3094 0.8904 1.7467 -0.1050 0.0822  0.0528  498 LYS B CD  
2452 C CE  . LYS B 57  ? 1.3615 0.9534 1.8040 -0.1177 0.1048  0.0866  498 LYS B CE  
2453 N NZ  . LYS B 57  ? 1.4118 0.9715 1.8291 -0.1039 0.1188  0.1369  498 LYS B NZ  
2454 N N   . ASN B 58  ? 1.0996 0.7163 1.4320 -0.0315 0.0008  -0.0352 499 ASN B N   
2455 C CA  . ASN B 58  ? 1.0680 0.7084 1.3946 -0.0236 -0.0166 -0.0710 499 ASN B CA  
2456 C C   . ASN B 58  ? 1.0569 0.7228 1.3336 -0.0048 -0.0272 -0.0647 499 ASN B C   
2457 O O   . ASN B 58  ? 1.0475 0.7494 1.3141 -0.0025 -0.0362 -0.0857 499 ASN B O   
2458 C CB  . ASN B 58  ? 1.0835 0.6907 1.4308 -0.0174 -0.0216 -0.0870 499 ASN B CB  
2459 C CG  . ASN B 58  ? 1.0878 0.6760 1.4901 -0.0379 -0.0144 -0.1110 499 ASN B CG  
2460 O OD1 . ASN B 58  ? 1.0659 0.6749 1.4925 -0.0583 -0.0086 -0.1212 499 ASN B OD1 
2461 N ND2 . ASN B 58  ? 1.1028 0.6526 1.5273 -0.0329 -0.0143 -0.1220 499 ASN B ND2 
2462 N N   . GLU B 59  ? 1.0828 0.7312 1.3301 0.0086  -0.0256 -0.0360 500 GLU B N   
2463 C CA  . GLU B 59  ? 1.0589 0.7293 1.2620 0.0238  -0.0344 -0.0313 500 GLU B CA  
2464 C C   . GLU B 59  ? 1.0258 0.7268 1.2098 0.0188  -0.0298 -0.0277 500 GLU B C   
2465 O O   . GLU B 59  ? 1.0207 0.7474 1.1854 0.0250  -0.0370 -0.0414 500 GLU B O   
2466 C CB  . GLU B 59  ? 1.1228 0.7745 1.3014 0.0375  -0.0337 -0.0022 500 GLU B CB  
2467 C CG  . GLU B 59  ? 1.1475 0.8210 1.2865 0.0514  -0.0442 -0.0032 500 GLU B CG  
2468 C CD  . GLU B 59  ? 1.2465 0.9078 1.3699 0.0670  -0.0486 0.0162  500 GLU B CD  
2469 O OE1 . GLU B 59  ? 1.3779 1.0109 1.5238 0.0719  -0.0464 0.0252  500 GLU B OE1 
2470 O OE2 . GLU B 59  ? 1.2540 0.9353 1.3443 0.0749  -0.0540 0.0219  500 GLU B OE2 
2471 N N   . VAL B 60  ? 1.0155 0.7132 1.2061 0.0086  -0.0160 -0.0080 501 VAL B N   
2472 C CA  . VAL B 60  ? 0.9789 0.7061 1.1546 0.0048  -0.0093 -0.0046 501 VAL B CA  
2473 C C   . VAL B 60  ? 0.9484 0.7043 1.1476 -0.0027 -0.0130 -0.0321 501 VAL B C   
2474 O O   . VAL B 60  ? 0.9510 0.7348 1.1318 0.0036  -0.0155 -0.0396 501 VAL B O   
2475 C CB  . VAL B 60  ? 0.9933 0.7146 1.1735 -0.0044 0.0080  0.0229  501 VAL B CB  
2476 C CG1 . VAL B 60  ? 0.9579 0.7129 1.1383 -0.0113 0.0165  0.0197  501 VAL B CG1 
2477 C CG2 . VAL B 60  ? 1.0041 0.7137 1.1474 0.0077  0.0107  0.0511  501 VAL B CG2 
2478 N N   . GLY B 61  ? 0.9547 0.7047 1.1954 -0.0157 -0.0130 -0.0475 502 GLY B N   
2479 C CA  . GLY B 61  ? 0.9428 0.7276 1.2075 -0.0225 -0.0191 -0.0769 502 GLY B CA  
2480 C C   . GLY B 61  ? 0.9166 0.7243 1.1580 -0.0066 -0.0333 -0.0949 502 GLY B C   
2481 O O   . GLY B 61  ? 0.9340 0.7808 1.1766 -0.0046 -0.0365 -0.1080 502 GLY B O   
2482 N N   . VAL B 62  ? 0.8891 0.6752 1.1103 0.0056  -0.0409 -0.0935 503 VAL B N   
2483 C CA  . VAL B 62  ? 0.8705 0.6760 1.0734 0.0195  -0.0528 -0.1098 503 VAL B CA  
2484 C C   . VAL B 62  ? 0.8663 0.6823 1.0307 0.0314  -0.0510 -0.0956 503 VAL B C   
2485 O O   . VAL B 62  ? 0.8590 0.7036 1.0140 0.0391  -0.0540 -0.1045 503 VAL B O   
2486 C CB  . VAL B 62  ? 0.8837 0.6647 1.0869 0.0269  -0.0609 -0.1169 503 VAL B CB  
2487 C CG1 . VAL B 62  ? 0.8677 0.6653 1.0433 0.0426  -0.0697 -0.1235 503 VAL B CG1 
2488 C CG2 . VAL B 62  ? 0.9102 0.6888 1.1527 0.0175  -0.0644 -0.1429 503 VAL B CG2 
2489 N N   . LEU B 63  ? 0.8768 0.6697 1.0194 0.0337  -0.0456 -0.0738 504 LEU B N   
2490 C CA  . LEU B 63  ? 0.8721 0.6715 0.9806 0.0418  -0.0419 -0.0628 504 LEU B CA  
2491 C C   . LEU B 63  ? 0.8743 0.6989 0.9831 0.0404  -0.0334 -0.0627 504 LEU B C   
2492 O O   . LEU B 63  ? 0.8639 0.7025 0.9553 0.0499  -0.0329 -0.0660 504 LEU B O   
2493 C CB  . LEU B 63  ? 0.8884 0.6663 0.9772 0.0418  -0.0368 -0.0412 504 LEU B CB  
2494 C CG  . LEU B 63  ? 0.8973 0.6579 0.9757 0.0492  -0.0454 -0.0380 504 LEU B CG  
2495 C CD1 . LEU B 63  ? 0.9311 0.6818 0.9875 0.0507  -0.0402 -0.0153 504 LEU B CD1 
2496 C CD2 . LEU B 63  ? 0.8969 0.6691 0.9582 0.0582  -0.0532 -0.0509 504 LEU B CD2 
2497 N N   . ARG B 64  ? 0.9103 0.7407 1.0410 0.0293  -0.0255 -0.0581 505 ARG B N   
2498 C CA  . ARG B 64  ? 0.9454 0.8049 1.0798 0.0294  -0.0171 -0.0579 505 ARG B CA  
2499 C C   . ARG B 64  ? 0.9138 0.8083 1.0620 0.0356  -0.0242 -0.0767 505 ARG B C   
2500 O O   . ARG B 64  ? 0.8675 0.7885 1.0137 0.0421  -0.0182 -0.0750 505 ARG B O   
2501 C CB  . ARG B 64  ? 0.9982 0.8609 1.1558 0.0149  -0.0058 -0.0478 505 ARG B CB  
2502 C CG  . ARG B 64  ? 1.0553 0.9250 1.2566 0.0000  -0.0091 -0.0616 505 ARG B CG  
2503 C CD  . ARG B 64  ? 1.1387 1.0064 1.3631 -0.0161 0.0053  -0.0473 505 ARG B CD  
2504 N NE  . ARG B 64  ? 1.1762 1.0808 1.4029 -0.0154 0.0147  -0.0444 505 ARG B NE  
2505 C CZ  . ARG B 64  ? 1.2208 1.1295 1.4510 -0.0229 0.0308  -0.0259 505 ARG B CZ  
2506 N NH1 . ARG B 64  ? 1.2471 1.1247 1.4770 -0.0318 0.0400  -0.0054 505 ARG B NH1 
2507 N NH2 . ARG B 64  ? 1.2121 1.1587 1.4460 -0.0196 0.0390  -0.0259 505 ARG B NH2 
2508 N N   . LYS B 65  ? 0.9081 0.8057 1.0693 0.0357  -0.0364 -0.0938 506 LYS B N   
2509 C CA  . LYS B 65  ? 0.8871 0.8224 1.0536 0.0454  -0.0443 -0.1102 506 LYS B CA  
2510 C C   . LYS B 65  ? 0.8381 0.7725 0.9723 0.0635  -0.0455 -0.1049 506 LYS B C   
2511 O O   . LYS B 65  ? 0.8016 0.7679 0.9361 0.0747  -0.0500 -0.1128 506 LYS B O   
2512 C CB  . LYS B 65  ? 0.9285 0.8730 1.1201 0.0393  -0.0564 -0.1339 506 LYS B CB  
2513 C CG  . LYS B 65  ? 0.9984 0.9440 1.2297 0.0191  -0.0549 -0.1449 506 LYS B CG  
2514 C CD  . LYS B 65  ? 1.0402 1.0354 1.3014 0.0147  -0.0637 -0.1729 506 LYS B CD  
2515 C CE  . LYS B 65  ? 1.0733 1.0773 1.3343 0.0214  -0.0771 -0.1971 506 LYS B CE  
2516 N NZ  . LYS B 65  ? 1.0925 1.0561 1.3719 0.0098  -0.0791 -0.2092 506 LYS B NZ  
2517 N N   . THR B 66  ? 0.8136 0.7148 0.9216 0.0661  -0.0411 -0.0917 507 THR B N   
2518 C CA  . THR B 66  ? 0.8008 0.6970 0.8829 0.0794  -0.0408 -0.0883 507 THR B CA  
2519 C C   . THR B 66  ? 0.8023 0.6916 0.8635 0.0862  -0.0278 -0.0754 507 THR B C   
2520 O O   . THR B 66  ? 0.7837 0.6568 0.8368 0.0800  -0.0200 -0.0670 507 THR B O   
2521 C CB  . THR B 66  ? 0.8000 0.6689 0.8696 0.0779  -0.0469 -0.0886 507 THR B CB  
2522 O OG1 . THR B 66  ? 0.7880 0.6307 0.8468 0.0705  -0.0422 -0.0771 507 THR B OG1 
2523 C CG2 . THR B 66  ? 0.8227 0.6956 0.9124 0.0745  -0.0582 -0.1030 507 THR B CG2 
2524 N N   . ARG B 67  ? 0.7915 0.6933 0.8442 0.1002  -0.0244 -0.0740 508 ARG B N   
2525 C CA  . ARG B 67  ? 0.8095 0.6977 0.8434 0.1086  -0.0107 -0.0642 508 ARG B CA  
2526 C C   . ARG B 67  ? 0.8102 0.6982 0.8342 0.1209  -0.0096 -0.0622 508 ARG B C   
2527 O O   . ARG B 67  ? 0.7908 0.7035 0.8198 0.1354  -0.0065 -0.0579 508 ARG B O   
2528 C CB  . ARG B 67  ? 0.8024 0.7117 0.8447 0.1162  -0.0006 -0.0586 508 ARG B CB  
2529 C CG  . ARG B 67  ? 0.7953 0.7012 0.8427 0.1049  0.0048  -0.0562 508 ARG B CG  
2530 C CD  . ARG B 67  ? 0.7863 0.7227 0.8474 0.1139  0.0139  -0.0521 508 ARG B CD  
2531 N NE  . ARG B 67  ? 0.7857 0.7193 0.8485 0.1049  0.0234  -0.0476 508 ARG B NE  
2532 C CZ  . ARG B 67  ? 0.7860 0.6987 0.8282 0.1078  0.0367  -0.0427 508 ARG B CZ  
2533 N NH1 . ARG B 67  ? 0.7835 0.6722 0.8047 0.1175  0.0426  -0.0431 508 ARG B NH1 
2534 N NH2 . ARG B 67  ? 0.8066 0.7237 0.8506 0.1000  0.0453  -0.0382 508 ARG B NH2 
2535 N N   . HIS B 68  ? 0.8194 0.6830 0.8307 0.1154  -0.0116 -0.0641 509 HIS B N   
2536 C CA  . HIS B 68  ? 0.8367 0.6985 0.8408 0.1236  -0.0096 -0.0617 509 HIS B CA  
2537 C C   . HIS B 68  ? 0.8451 0.6762 0.8353 0.1142  -0.0064 -0.0634 509 HIS B C   
2538 O O   . HIS B 68  ? 0.8638 0.6854 0.8516 0.1028  -0.0142 -0.0690 509 HIS B O   
2539 C CB  . HIS B 68  ? 0.8483 0.7353 0.8626 0.1262  -0.0231 -0.0691 509 HIS B CB  
2540 C CG  . HIS B 68  ? 0.8604 0.7565 0.8687 0.1378  -0.0193 -0.0635 509 HIS B CG  
2541 N ND1 . HIS B 68  ? 0.8558 0.7332 0.8556 0.1332  -0.0172 -0.0631 509 HIS B ND1 
2542 C CD2 . HIS B 68  ? 0.8832 0.8086 0.8930 0.1543  -0.0162 -0.0561 509 HIS B CD2 
2543 C CE1 . HIS B 68  ? 0.8568 0.7482 0.8541 0.1451  -0.0114 -0.0548 509 HIS B CE1 
2544 N NE2 . HIS B 68  ? 0.8622 0.7828 0.8636 0.1593  -0.0107 -0.0493 509 HIS B NE2 
2545 N N   . VAL B 69  ? 0.8900 0.7082 0.8730 0.1195  0.0055  -0.0580 510 VAL B N   
2546 C CA  . VAL B 69  ? 0.9193 0.7101 0.8918 0.1089  0.0116  -0.0624 510 VAL B CA  
2547 C C   . VAL B 69  ? 0.9313 0.7248 0.9038 0.0983  -0.0017 -0.0704 510 VAL B C   
2548 O O   . VAL B 69  ? 0.9640 0.7442 0.9287 0.0868  -0.0023 -0.0773 510 VAL B O   
2549 C CB  . VAL B 69  ? 0.9458 0.7226 0.9174 0.1152  0.0274  -0.0552 510 VAL B CB  
2550 C CG1 . VAL B 69  ? 0.9774 0.7221 0.9410 0.1049  0.0405  -0.0622 510 VAL B CG1 
2551 C CG2 . VAL B 69  ? 0.9730 0.7623 0.9496 0.1349  0.0371  -0.0406 510 VAL B CG2 
2552 N N   . ASN B 70  ? 0.8835 0.6982 0.8650 0.1038  -0.0117 -0.0705 511 ASN B N   
2553 C CA  . ASN B 70  ? 0.8528 0.6742 0.8376 0.0983  -0.0237 -0.0775 511 ASN B CA  
2554 C C   . ASN B 70  ? 0.8540 0.6810 0.8450 0.0950  -0.0381 -0.0831 511 ASN B C   
2555 O O   . ASN B 70  ? 0.8332 0.6666 0.8297 0.0940  -0.0483 -0.0885 511 ASN B O   
2556 C CB  . ASN B 70  ? 0.8220 0.6641 0.8129 0.1080  -0.0244 -0.0756 511 ASN B CB  
2557 C CG  . ASN B 70  ? 0.8152 0.6491 0.8024 0.1102  -0.0085 -0.0666 511 ASN B CG  
2558 O OD1 . ASN B 70  ? 0.8041 0.6532 0.7927 0.1228  -0.0021 -0.0571 511 ASN B OD1 
2559 N ND2 . ASN B 70  ? 0.8285 0.6399 0.8117 0.0979  -0.0015 -0.0696 511 ASN B ND2 
2560 N N   . ILE B 71  ? 0.8524 0.6767 0.8451 0.0940  -0.0375 -0.0809 512 ILE B N   
2561 C CA  . ILE B 71  ? 0.8499 0.6721 0.8499 0.0887  -0.0472 -0.0828 512 ILE B CA  
2562 C C   . ILE B 71  ? 0.8450 0.6514 0.8316 0.0809  -0.0429 -0.0776 512 ILE B C   
2563 O O   . ILE B 71  ? 0.8706 0.6713 0.8477 0.0805  -0.0320 -0.0749 512 ILE B O   
2564 C CB  . ILE B 71  ? 0.8391 0.6745 0.8551 0.0910  -0.0492 -0.0847 512 ILE B CB  
2565 C CG1 . ILE B 71  ? 0.8411 0.6951 0.8718 0.0963  -0.0587 -0.0954 512 ILE B CG1 
2566 C CG2 . ILE B 71  ? 0.8630 0.6878 0.8862 0.0826  -0.0520 -0.0818 512 ILE B CG2 
2567 C CD1 . ILE B 71  ? 0.8547 0.7226 0.8789 0.1054  -0.0571 -0.0966 512 ILE B CD1 
2568 N N   . LEU B 72  ? 0.8523 0.6538 0.8376 0.0768  -0.0509 -0.0760 513 LEU B N   
2569 C CA  . LEU B 72  ? 0.8863 0.6802 0.8570 0.0711  -0.0482 -0.0695 513 LEU B CA  
2570 C C   . LEU B 72  ? 0.8790 0.6711 0.8494 0.0696  -0.0387 -0.0636 513 LEU B C   
2571 O O   . LEU B 72  ? 0.8833 0.6790 0.8710 0.0700  -0.0396 -0.0612 513 LEU B O   
2572 C CB  . LEU B 72  ? 0.9141 0.7064 0.8888 0.0712  -0.0583 -0.0630 513 LEU B CB  
2573 C CG  . LEU B 72  ? 0.9609 0.7532 0.9167 0.0681  -0.0575 -0.0540 513 LEU B CG  
2574 C CD1 . LEU B 72  ? 0.9714 0.7737 0.9130 0.0666  -0.0622 -0.0616 513 LEU B CD1 
2575 C CD2 . LEU B 72  ? 1.0138 0.8009 0.9781 0.0710  -0.0629 -0.0397 513 LEU B CD2 
2576 N N   . LEU B 73  ? 0.8538 0.6425 0.8065 0.0673  -0.0289 -0.0634 514 LEU B N   
2577 C CA  . LEU B 73  ? 0.8282 0.6187 0.7808 0.0674  -0.0182 -0.0581 514 LEU B CA  
2578 C C   . LEU B 73  ? 0.8372 0.6290 0.7891 0.0629  -0.0191 -0.0462 514 LEU B C   
2579 O O   . LEU B 73  ? 0.8727 0.6644 0.8054 0.0605  -0.0192 -0.0418 514 LEU B O   
2580 C CB  . LEU B 73  ? 0.8498 0.6351 0.7847 0.0681  -0.0054 -0.0640 514 LEU B CB  
2581 C CG  . LEU B 73  ? 0.8610 0.6512 0.7967 0.0710  0.0076  -0.0595 514 LEU B CG  
2582 C CD1 . LEU B 73  ? 0.8490 0.6498 0.8074 0.0779  0.0089  -0.0569 514 LEU B CD1 
2583 C CD2 . LEU B 73  ? 0.8825 0.6638 0.8001 0.0727  0.0213  -0.0683 514 LEU B CD2 
2584 N N   . PHE B 74  ? 0.8179 0.6133 0.7919 0.0615  -0.0193 -0.0408 515 PHE B N   
2585 C CA  . PHE B 74  ? 0.8312 0.6261 0.8102 0.0562  -0.0152 -0.0267 515 PHE B CA  
2586 C C   . PHE B 74  ? 0.8537 0.6574 0.8200 0.0557  -0.0007 -0.0226 515 PHE B C   
2587 O O   . PHE B 74  ? 0.8576 0.6686 0.8271 0.0597  0.0060  -0.0305 515 PHE B O   
2588 C CB  . PHE B 74  ? 0.8155 0.6120 0.8278 0.0522  -0.0182 -0.0273 515 PHE B CB  
2589 C CG  . PHE B 74  ? 0.8483 0.6467 0.8746 0.0443  -0.0089 -0.0141 515 PHE B CG  
2590 C CD1 . PHE B 74  ? 0.8895 0.6750 0.9130 0.0410  -0.0074 0.0034  515 PHE B CD1 
2591 C CD2 . PHE B 74  ? 0.8647 0.6804 0.9091 0.0408  -0.0009 -0.0173 515 PHE B CD2 
2592 C CE1 . PHE B 74  ? 0.9142 0.7003 0.9528 0.0327  0.0038  0.0187  515 PHE B CE1 
2593 C CE2 . PHE B 74  ? 0.8781 0.6983 0.9395 0.0313  0.0091  -0.0050 515 PHE B CE2 
2594 C CZ  . PHE B 74  ? 0.8992 0.7027 0.9578 0.0264  0.0125  0.0135  515 PHE B CZ  
2595 N N   . MET B 75  ? 0.8793 0.6845 0.8306 0.0531  0.0049  -0.0094 516 MET B N   
2596 C CA  . MET B 75  ? 0.9031 0.7198 0.8399 0.0535  0.0199  -0.0064 516 MET B CA  
2597 C C   . MET B 75  ? 0.9176 0.7428 0.8663 0.0479  0.0299  0.0119  516 MET B C   
2598 O O   . MET B 75  ? 0.9509 0.7904 0.8991 0.0483  0.0435  0.0133  516 MET B O   
2599 C CB  . MET B 75  ? 0.9269 0.7459 0.8279 0.0559  0.0210  -0.0103 516 MET B CB  
2600 C CG  . MET B 75  ? 0.9219 0.7334 0.8133 0.0588  0.0172  -0.0309 516 MET B CG  
2601 S SD  . MET B 75  ? 0.9521 0.7698 0.8086 0.0573  0.0126  -0.0398 516 MET B SD  
2602 C CE  . MET B 75  ? 0.9818 0.8144 0.8145 0.0586  0.0303  -0.0404 516 MET B CE  
2603 N N   . GLY B 76  ? 0.9339 0.7500 0.8948 0.0433  0.0250  0.0270  517 GLY B N   
2604 C CA  . GLY B 76  ? 0.9651 0.7855 0.9407 0.0362  0.0367  0.0475  517 GLY B CA  
2605 C C   . GLY B 76  ? 0.9833 0.7877 0.9624 0.0347  0.0330  0.0685  517 GLY B C   
2606 O O   . GLY B 76  ? 0.9607 0.7543 0.9288 0.0409  0.0202  0.0666  517 GLY B O   
2607 N N   . TYR B 77  ? 1.0261 0.8296 1.0228 0.0271  0.0457  0.0899  518 TYR B N   
2608 C CA  . TYR B 77  ? 1.0758 0.8597 1.0809 0.0265  0.0466  0.1153  518 TYR B CA  
2609 C C   . TYR B 77  ? 1.1117 0.9058 1.1084 0.0240  0.0654  0.1460  518 TYR B C   
2610 O O   . TYR B 77  ? 1.1238 0.9386 1.1225 0.0183  0.0789  0.1455  518 TYR B O   
2611 C CB  . TYR B 77  ? 1.0700 0.8309 1.1228 0.0163  0.0436  0.1094  518 TYR B CB  
2612 C CG  . TYR B 77  ? 1.0713 0.8404 1.1608 0.0004  0.0574  0.1087  518 TYR B CG  
2613 C CD1 . TYR B 77  ? 1.1167 0.8772 1.2260 -0.0094 0.0744  0.1362  518 TYR B CD1 
2614 C CD2 . TYR B 77  ? 1.0280 0.8166 1.1348 -0.0044 0.0540  0.0818  518 TYR B CD2 
2615 C CE1 . TYR B 77  ? 1.1150 0.8868 1.2623 -0.0265 0.0874  0.1341  518 TYR B CE1 
2616 C CE2 . TYR B 77  ? 1.0232 0.8272 1.1663 -0.0190 0.0651  0.0795  518 TYR B CE2 
2617 C CZ  . TYR B 77  ? 1.0768 0.8728 1.2413 -0.0314 0.0818  0.1044  518 TYR B CZ  
2618 O OH  . TYR B 77  ? 1.0967 0.9115 1.3012 -0.0483 0.0936  0.1011  518 TYR B OH  
2619 N N   . SER B 78  ? 1.1561 0.9382 1.1434 0.0302  0.0669  0.1746  519 SER B N   
2620 C CA  . SER B 78  ? 1.2310 1.0187 1.2164 0.0279  0.0866  0.2105  519 SER B CA  
2621 C C   . SER B 78  ? 1.2515 1.0036 1.2670 0.0262  0.0902  0.2367  519 SER B C   
2622 O O   . SER B 78  ? 1.2283 0.9605 1.2441 0.0357  0.0757  0.2344  519 SER B O   
2623 C CB  . SER B 78  ? 1.2667 1.0838 1.1985 0.0423  0.0888  0.2263  519 SER B CB  
2624 O OG  . SER B 78  ? 1.3070 1.1387 1.2338 0.0400  0.1107  0.2591  519 SER B OG  
2625 N N   . THR B 79  ? 1.2902 1.0339 1.3346 0.0138  0.1108  0.2607  520 THR B N   
2626 C CA  . THR B 79  ? 1.3454 1.0535 1.4155 0.0132  0.1210  0.2949  520 THR B CA  
2627 C C   . THR B 79  ? 1.3811 1.1052 1.4233 0.0216  0.1398  0.3412  520 THR B C   
2628 O O   . THR B 79  ? 1.4008 1.0978 1.4583 0.0246  0.1520  0.3785  520 THR B O   
2629 C CB  . THR B 79  ? 1.3662 1.0488 1.4983 -0.0105 0.1334  0.2885  520 THR B CB  
2630 O OG1 . THR B 79  ? 1.3791 1.0913 1.5181 -0.0245 0.1512  0.2923  520 THR B OG1 
2631 C CG2 . THR B 79  ? 1.3372 1.0107 1.4958 -0.0178 0.1145  0.2419  520 THR B CG2 
2632 N N   . LYS B 80  ? 1.4159 1.1845 1.4162 0.0269  0.1428  0.3385  521 LYS B N   
2633 C CA  . LYS B 80  ? 1.4692 1.2638 1.4455 0.0309  0.1647  0.3778  521 LYS B CA  
2634 C C   . LYS B 80  ? 1.5156 1.3055 1.4653 0.0512  0.1667  0.4221  521 LYS B C   
2635 O O   . LYS B 80  ? 1.6116 1.3753 1.5877 0.0481  0.1853  0.4621  521 LYS B O   
2636 C CB  . LYS B 80  ? 1.4596 1.3044 1.3941 0.0347  0.1658  0.3587  521 LYS B CB  
2637 N N   . PRO B 81  ? 1.5070 1.3232 1.4071 0.0719  0.1483  0.4164  522 PRO B N   
2638 C CA  . PRO B 81  ? 1.5441 1.3587 1.4236 0.0935  0.1485  0.4602  522 PRO B CA  
2639 C C   . PRO B 81  ? 1.5415 1.3063 1.4568 0.0977  0.1366  0.4606  522 PRO B C   
2640 O O   . PRO B 81  ? 1.5724 1.3093 1.5037 0.1068  0.1482  0.5035  522 PRO B O   
2641 C CB  . PRO B 81  ? 1.5387 1.4060 1.3568 0.1118  0.1311  0.4464  522 PRO B CB  
2642 C CG  . PRO B 81  ? 1.5030 1.3747 1.3226 0.1003  0.1143  0.3882  522 PRO B CG  
2643 C CD  . PRO B 81  ? 1.4712 1.3191 1.3355 0.0770  0.1280  0.3729  522 PRO B CD  
2644 N N   . GLN B 82  ? 1.4862 1.2400 1.4138 0.0922  0.1153  0.4137  523 GLN B N   
2645 C CA  . GLN B 82  ? 1.4585 1.1671 1.4237 0.0936  0.1039  0.4036  523 GLN B CA  
2646 C C   . GLN B 82  ? 1.3893 1.0869 1.3816 0.0752  0.0922  0.3508  523 GLN B C   
2647 O O   . GLN B 82  ? 1.3954 1.1222 1.3719 0.0659  0.0904  0.3241  523 GLN B O   
2648 C CB  . GLN B 82  ? 1.4623 1.1857 1.3969 0.1185  0.0831  0.4064  523 GLN B CB  
2649 C CG  . GLN B 82  ? 1.5254 1.2634 1.4333 0.1422  0.0910  0.4601  523 GLN B CG  
2650 C CD  . GLN B 82  ? 1.5566 1.3133 1.4411 0.1670  0.0682  0.4593  523 GLN B CD  
2651 O OE1 . GLN B 82  ? 1.5062 1.2846 1.3770 0.1655  0.0468  0.4171  523 GLN B OE1 
2652 N NE2 . GLN B 82  ? 1.6047 1.3541 1.4872 0.1905  0.0736  0.5072  523 GLN B NE2 
2653 N N   . LEU B 83  ? 1.3565 1.0137 1.3884 0.0721  0.0848  0.3364  524 LEU B N   
2654 C CA  . LEU B 83  ? 1.2896 0.9404 1.3448 0.0585  0.0718  0.2877  524 LEU B CA  
2655 C C   . LEU B 83  ? 1.2583 0.9381 1.2767 0.0708  0.0491  0.2604  524 LEU B C   
2656 O O   . LEU B 83  ? 1.2986 0.9802 1.2997 0.0893  0.0377  0.2709  524 LEU B O   
2657 C CB  . LEU B 83  ? 1.3022 0.9050 1.4077 0.0537  0.0704  0.2789  524 LEU B CB  
2658 C CG  . LEU B 83  ? 1.3582 0.9215 1.5107 0.0394  0.0936  0.3031  524 LEU B CG  
2659 C CD1 . LEU B 83  ? 1.3583 0.8771 1.5602 0.0331  0.0891  0.2798  524 LEU B CD1 
2660 C CD2 . LEU B 83  ? 1.3535 0.9343 1.5211 0.0158  0.1094  0.2985  524 LEU B CD2 
2661 N N   . ALA B 84  ? 1.1976 0.9005 1.2066 0.0610  0.0434  0.2266  525 ALA B N   
2662 C CA  . ALA B 84  ? 1.1241 0.8524 1.1010 0.0696  0.0250  0.2000  525 ALA B CA  
2663 C C   . ALA B 84  ? 1.0678 0.8034 1.0536 0.0579  0.0197  0.1607  525 ALA B C   
2664 O O   . ALA B 84  ? 1.0692 0.8085 1.0702 0.0451  0.0312  0.1552  525 ALA B O   
2665 C CB  . ALA B 84  ? 1.1362 0.9019 1.0644 0.0793  0.0266  0.2138  525 ALA B CB  
2666 N N   . ILE B 85  ? 1.0294 0.7702 1.0061 0.0636  0.0030  0.1355  526 ILE B N   
2667 C CA  . ILE B 85  ? 0.9861 0.7352 0.9668 0.0567  -0.0024 0.1017  526 ILE B CA  
2668 C C   . ILE B 85  ? 0.9614 0.7353 0.9038 0.0630  -0.0100 0.0874  526 ILE B C   
2669 O O   . ILE B 85  ? 0.9730 0.7540 0.8985 0.0725  -0.0208 0.0896  526 ILE B O   
2670 C CB  . ILE B 85  ? 0.9819 0.7124 0.9928 0.0561  -0.0136 0.0819  526 ILE B CB  
2671 C CG1 . ILE B 85  ? 1.0248 0.7267 1.0747 0.0502  -0.0067 0.0941  526 ILE B CG1 
2672 C CG2 . ILE B 85  ? 0.9440 0.6852 0.9622 0.0496  -0.0164 0.0523  526 ILE B CG2 
2673 C CD1 . ILE B 85  ? 1.0293 0.7156 1.1112 0.0481  -0.0161 0.0697  526 ILE B CD1 
2674 N N   . VAL B 86  ? 0.9480 0.7358 0.8802 0.0576  -0.0037 0.0716  527 VAL B N   
2675 C CA  . VAL B 86  ? 0.9475 0.7542 0.8472 0.0609  -0.0072 0.0552  527 VAL B CA  
2676 C C   . VAL B 86  ? 0.9210 0.7226 0.8313 0.0585  -0.0127 0.0277  527 VAL B C   
2677 O O   . VAL B 86  ? 0.9090 0.7063 0.8388 0.0541  -0.0064 0.0204  527 VAL B O   
2678 C CB  . VAL B 86  ? 0.9771 0.8016 0.8553 0.0588  0.0075  0.0579  527 VAL B CB  
2679 C CG1 . VAL B 86  ? 0.9777 0.8174 0.8266 0.0605  0.0054  0.0348  527 VAL B CG1 
2680 C CG2 . VAL B 86  ? 1.0290 0.8642 0.8926 0.0623  0.0151  0.0884  527 VAL B CG2 
2681 N N   . THR B 87  ? 0.9206 0.7263 0.8189 0.0618  -0.0237 0.0137  528 THR B N   
2682 C CA  . THR B 87  ? 0.9281 0.7298 0.8329 0.0601  -0.0262 -0.0093 528 THR B CA  
2683 C C   . THR B 87  ? 0.9488 0.7617 0.8272 0.0592  -0.0258 -0.0247 528 THR B C   
2684 O O   . THR B 87  ? 0.9714 0.7999 0.8262 0.0600  -0.0269 -0.0202 528 THR B O   
2685 C CB  . THR B 87  ? 0.9206 0.7146 0.8440 0.0629  -0.0389 -0.0149 528 THR B CB  
2686 O OG1 . THR B 87  ? 0.9652 0.7688 0.8747 0.0670  -0.0490 -0.0117 528 THR B OG1 
2687 C CG2 . THR B 87  ? 0.9395 0.7206 0.8912 0.0630  -0.0398 -0.0048 528 THR B CG2 
2688 N N   . GLN B 88  ? 0.9441 0.7504 0.8273 0.0574  -0.0237 -0.0430 529 GLN B N   
2689 C CA  . GLN B 88  ? 0.9695 0.7813 0.8344 0.0537  -0.0228 -0.0611 529 GLN B CA  
2690 C C   . GLN B 88  ? 0.9615 0.7877 0.8199 0.0533  -0.0373 -0.0623 529 GLN B C   
2691 O O   . GLN B 88  ? 0.9176 0.7430 0.7910 0.0577  -0.0475 -0.0521 529 GLN B O   
2692 C CB  . GLN B 88  ? 0.9720 0.7695 0.8488 0.0527  -0.0170 -0.0761 529 GLN B CB  
2693 C CG  . GLN B 88  ? 0.9647 0.7584 0.8616 0.0545  -0.0270 -0.0762 529 GLN B CG  
2694 C CD  . GLN B 88  ? 0.9593 0.7419 0.8648 0.0546  -0.0194 -0.0872 529 GLN B CD  
2695 O OE1 . GLN B 88  ? 0.9083 0.6880 0.8308 0.0601  -0.0203 -0.0831 529 GLN B OE1 
2696 N NE2 . GLN B 88  ? 0.9857 0.7625 0.8797 0.0487  -0.0109 -0.1012 529 GLN B NE2 
2697 N N   . TRP B 89  ? 1.0123 0.8544 0.8497 0.0483  -0.0378 -0.0765 530 TRP B N   
2698 C CA  . TRP B 89  ? 1.0261 0.8903 0.8584 0.0467  -0.0517 -0.0827 530 TRP B CA  
2699 C C   . TRP B 89  ? 1.0352 0.8906 0.8826 0.0394  -0.0517 -0.1023 530 TRP B C   
2700 O O   . TRP B 89  ? 1.0928 0.9323 0.9402 0.0332  -0.0392 -0.1172 530 TRP B O   
2701 C CB  . TRP B 89  ? 1.0385 0.9312 0.8414 0.0431  -0.0523 -0.0928 530 TRP B CB  
2702 C CG  . TRP B 89  ? 1.0557 0.9805 0.8543 0.0414  -0.0678 -0.1009 530 TRP B CG  
2703 C CD1 . TRP B 89  ? 1.0764 1.0164 0.8733 0.0293  -0.0702 -0.1292 530 TRP B CD1 
2704 C CD2 . TRP B 89  ? 1.0658 1.0134 0.8648 0.0524  -0.0824 -0.0802 530 TRP B CD2 
2705 N NE1 . TRP B 89  ? 1.0794 1.0565 0.8756 0.0316  -0.0869 -0.1286 530 TRP B NE1 
2706 C CE2 . TRP B 89  ? 1.0704 1.0527 0.8670 0.0476  -0.0948 -0.0975 530 TRP B CE2 
2707 C CE3 . TRP B 89  ? 1.0617 1.0029 0.8657 0.0661  -0.0852 -0.0487 530 TRP B CE3 
2708 C CZ2 . TRP B 89  ? 1.0848 1.0994 0.8821 0.0589  -0.1107 -0.0828 530 TRP B CZ2 
2709 C CZ3 . TRP B 89  ? 1.0856 1.0517 0.8903 0.0775  -0.0993 -0.0332 530 TRP B CZ3 
2710 C CH2 . TRP B 89  ? 1.1056 1.1101 0.9061 0.0754  -0.1124 -0.0495 530 TRP B CH2 
2711 N N   . CYS B 90  ? 1.0512 0.9163 0.9127 0.0410  -0.0639 -0.1011 531 CYS B N   
2712 C CA  . CYS B 90  ? 1.0745 0.9350 0.9512 0.0332  -0.0623 -0.1177 531 CYS B CA  
2713 C C   . CYS B 90  ? 1.0697 0.9600 0.9412 0.0232  -0.0702 -0.1359 531 CYS B C   
2714 O O   . CYS B 90  ? 1.0563 0.9778 0.9189 0.0276  -0.0835 -0.1306 531 CYS B O   
2715 C CB  . CYS B 90  ? 1.0854 0.9384 0.9853 0.0409  -0.0677 -0.1073 531 CYS B CB  
2716 S SG  . CYS B 90  ? 1.0792 0.9056 0.9894 0.0502  -0.0603 -0.0919 531 CYS B SG  
2717 N N   . GLU B 91  ? 1.0676 0.9496 0.9465 0.0098  -0.0610 -0.1569 532 GLU B N   
2718 C CA  . GLU B 91  ? 1.1048 1.0143 0.9824 -0.0047 -0.0656 -0.1806 532 GLU B CA  
2719 C C   . GLU B 91  ? 1.0570 0.9746 0.9603 -0.0096 -0.0695 -0.1841 532 GLU B C   
2720 O O   . GLU B 91  ? 1.0504 0.9402 0.9700 -0.0111 -0.0579 -0.1819 532 GLU B O   
2721 C CB  . GLU B 91  ? 1.1544 1.0444 1.0262 -0.0191 -0.0488 -0.2049 532 GLU B CB  
2722 C CG  . GLU B 91  ? 1.2149 1.1389 1.0702 -0.0317 -0.0541 -0.2310 532 GLU B CG  
2723 C CD  . GLU B 91  ? 1.2419 1.1787 1.0662 -0.0228 -0.0556 -0.2255 532 GLU B CD  
2724 O OE1 . GLU B 91  ? 1.1899 1.1045 1.0087 -0.0088 -0.0504 -0.2018 532 GLU B OE1 
2725 O OE2 . GLU B 91  ? 1.2599 1.2330 1.0660 -0.0302 -0.0617 -0.2458 532 GLU B OE2 
2726 N N   . GLY B 92  ? 1.0529 1.0126 0.9598 -0.0105 -0.0854 -0.1878 533 GLY B N   
2727 C CA  . GLY B 92  ? 1.0190 0.9948 0.9515 -0.0141 -0.0900 -0.1905 533 GLY B CA  
2728 C C   . GLY B 92  ? 0.9935 0.9942 0.9310 0.0043  -0.1067 -0.1707 533 GLY B C   
2729 O O   . GLY B 92  ? 1.0110 1.0451 0.9358 0.0119  -0.1206 -0.1661 533 GLY B O   
2730 N N   . SER B 93  ? 0.9548 0.9402 0.9104 0.0133  -0.1045 -0.1588 534 SER B N   
2731 C CA  . SER B 93  ? 0.9167 0.9220 0.8823 0.0312  -0.1181 -0.1435 534 SER B CA  
2732 C C   . SER B 93  ? 0.8619 0.8435 0.8440 0.0404  -0.1122 -0.1344 534 SER B C   
2733 O O   . SER B 93  ? 0.8141 0.7714 0.8010 0.0328  -0.0985 -0.1388 534 SER B O   
2734 C CB  . SER B 93  ? 0.9252 0.9817 0.9036 0.0273  -0.1300 -0.1541 534 SER B CB  
2735 O OG  . SER B 93  ? 0.9358 0.9968 0.9323 0.0084  -0.1205 -0.1722 534 SER B OG  
2736 N N   . SER B 94  ? 0.8521 0.8425 0.8430 0.0583  -0.1223 -0.1218 535 SER B N   
2737 C CA  . SER B 94  ? 0.8071 0.7778 0.8117 0.0688  -0.1181 -0.1159 535 SER B CA  
2738 C C   . SER B 94  ? 0.7927 0.7814 0.8162 0.0640  -0.1137 -0.1255 535 SER B C   
2739 O O   . SER B 94  ? 0.7836 0.8044 0.8156 0.0547  -0.1165 -0.1351 535 SER B O   
2740 C CB  . SER B 94  ? 0.7844 0.7540 0.7947 0.0894  -0.1283 -0.1021 535 SER B CB  
2741 O OG  . SER B 94  ? 0.7679 0.7729 0.7920 0.0987  -0.1387 -0.1025 535 SER B OG  
2742 N N   . LEU B 95  ? 0.7865 0.7581 0.8173 0.0702  -0.1062 -0.1230 536 LEU B N   
2743 C CA  . LEU B 95  ? 0.7826 0.7724 0.8302 0.0694  -0.1006 -0.1282 536 LEU B CA  
2744 C C   . LEU B 95  ? 0.7932 0.8189 0.8568 0.0807  -0.1123 -0.1296 536 LEU B C   
2745 O O   . LEU B 95  ? 0.8038 0.8607 0.8821 0.0738  -0.1102 -0.1365 536 LEU B O   
2746 C CB  . LEU B 95  ? 0.7784 0.7486 0.8265 0.0784  -0.0926 -0.1242 536 LEU B CB  
2747 C CG  . LEU B 95  ? 0.7883 0.7769 0.8495 0.0802  -0.0840 -0.1265 536 LEU B CG  
2748 C CD1 . LEU B 95  ? 0.8058 0.8044 0.8729 0.0614  -0.0723 -0.1298 536 LEU B CD1 
2749 C CD2 . LEU B 95  ? 0.7876 0.7583 0.8425 0.0887  -0.0766 -0.1222 536 LEU B CD2 
2750 N N   . TYR B 96  ? 0.8074 0.8288 0.8706 0.0982  -0.1232 -0.1224 537 TYR B N   
2751 C CA  . TYR B 96  ? 0.8232 0.8768 0.9017 0.1131  -0.1345 -0.1213 537 TYR B CA  
2752 C C   . TYR B 96  ? 0.8556 0.9496 0.9367 0.1027  -0.1409 -0.1260 537 TYR B C   
2753 O O   . TYR B 96  ? 0.9172 1.0501 1.0168 0.1023  -0.1425 -0.1328 537 TYR B O   
2754 C CB  . TYR B 96  ? 0.8117 0.8463 0.8877 0.1322  -0.1431 -0.1093 537 TYR B CB  
2755 C CG  . TYR B 96  ? 0.8041 0.8671 0.8968 0.1525  -0.1536 -0.1049 537 TYR B CG  
2756 C CD1 . TYR B 96  ? 0.8208 0.8795 0.9312 0.1705  -0.1528 -0.1081 537 TYR B CD1 
2757 C CD2 . TYR B 96  ? 0.8250 0.9214 0.9158 0.1558  -0.1642 -0.0983 537 TYR B CD2 
2758 C CE1 . TYR B 96  ? 0.8177 0.9003 0.9453 0.1921  -0.1609 -0.1038 537 TYR B CE1 
2759 C CE2 . TYR B 96  ? 0.8413 0.9668 0.9487 0.1779  -0.1736 -0.0917 537 TYR B CE2 
2760 C CZ  . TYR B 96  ? 0.8353 0.9512 0.9619 0.1966  -0.1713 -0.0939 537 TYR B CZ  
2761 O OH  . TYR B 96  ? 0.8346 0.9774 0.9794 0.2212  -0.1791 -0.0871 537 TYR B OH  
2762 N N   . HIS B 97  ? 0.8499 0.9388 0.9130 0.0937  -0.1444 -0.1239 538 HIS B N   
2763 C CA  . HIS B 97  ? 0.8350 0.9662 0.8974 0.0827  -0.1523 -0.1317 538 HIS B CA  
2764 C C   . HIS B 97  ? 0.8094 0.9629 0.8865 0.0594  -0.1437 -0.1499 538 HIS B C   
2765 O O   . HIS B 97  ? 0.7825 0.9858 0.8753 0.0544  -0.1508 -0.1589 538 HIS B O   
2766 C CB  . HIS B 97  ? 0.8492 0.9648 0.8852 0.0756  -0.1538 -0.1290 538 HIS B CB  
2767 C CG  . HIS B 97  ? 0.8736 1.0370 0.9040 0.0683  -0.1650 -0.1371 538 HIS B CG  
2768 N ND1 . HIS B 97  ? 0.8825 1.0620 0.9125 0.0424  -0.1602 -0.1590 538 HIS B ND1 
2769 C CD2 . HIS B 97  ? 0.8861 1.0871 0.9113 0.0841  -0.1805 -0.1269 538 HIS B CD2 
2770 C CE1 . HIS B 97  ? 0.8963 1.1257 0.9206 0.0409  -0.1738 -0.1655 538 HIS B CE1 
2771 N NE2 . HIS B 97  ? 0.9038 1.1494 0.9239 0.0673  -0.1866 -0.1444 538 HIS B NE2 
2772 N N   . HIS B 98  ? 0.7700 0.8878 0.8439 0.0457  -0.1274 -0.1539 539 HIS B N   
2773 C CA  . HIS B 98  ? 0.7516 0.8803 0.8417 0.0238  -0.1145 -0.1670 539 HIS B CA  
2774 C C   . HIS B 98  ? 0.7377 0.8985 0.8533 0.0307  -0.1134 -0.1664 539 HIS B C   
2775 O O   . HIS B 98  ? 0.7542 0.9542 0.8905 0.0165  -0.1121 -0.1774 539 HIS B O   
2776 C CB  . HIS B 98  ? 0.7555 0.8354 0.8371 0.0144  -0.0955 -0.1648 539 HIS B CB  
2777 C CG  . HIS B 98  ? 0.7665 0.8213 0.8310 -0.0012 -0.0902 -0.1727 539 HIS B CG  
2778 N ND1 . HIS B 98  ? 0.7644 0.8343 0.8362 -0.0254 -0.0859 -0.1916 539 HIS B ND1 
2779 C CD2 . HIS B 98  ? 0.7641 0.7809 0.8063 0.0033  -0.0873 -0.1665 539 HIS B CD2 
2780 C CE1 . HIS B 98  ? 0.7811 0.8219 0.8341 -0.0336 -0.0805 -0.1977 539 HIS B CE1 
2781 N NE2 . HIS B 98  ? 0.7937 0.8031 0.8282 -0.0158 -0.0811 -0.1813 539 HIS B NE2 
2782 N N   . LEU B 99  ? 0.7329 0.8790 0.8482 0.0518  -0.1130 -0.1553 540 LEU B N   
2783 C CA  . LEU B 99  ? 0.7162 0.8888 0.8527 0.0598  -0.1084 -0.1553 540 LEU B CA  
2784 C C   . LEU B 99  ? 0.7330 0.9569 0.8878 0.0725  -0.1226 -0.1578 540 LEU B C   
2785 O O   . LEU B 99  ? 0.7705 1.0340 0.9484 0.0686  -0.1182 -0.1633 540 LEU B O   
2786 C CB  . LEU B 99  ? 0.7002 0.8436 0.8292 0.0787  -0.1039 -0.1470 540 LEU B CB  
2787 C CG  . LEU B 99  ? 0.7049 0.8285 0.8311 0.0715  -0.0852 -0.1440 540 LEU B CG  
2788 C CD1 . LEU B 99  ? 0.7106 0.8194 0.8347 0.0460  -0.0716 -0.1457 540 LEU B CD1 
2789 C CD2 . LEU B 99  ? 0.7238 0.8108 0.8328 0.0860  -0.0851 -0.1379 540 LEU B CD2 
2790 N N   . HIS B 100 ? 0.7394 0.9644 0.8851 0.0888  -0.1384 -0.1518 541 HIS B N   
2791 C CA  . HIS B 100 ? 0.7125 0.9800 0.8749 0.1103  -0.1516 -0.1489 541 HIS B CA  
2792 C C   . HIS B 100 ? 0.7311 1.0379 0.8925 0.1095  -0.1671 -0.1491 541 HIS B C   
2793 O O   . HIS B 100 ? 0.7367 1.0891 0.9151 0.1263  -0.1778 -0.1467 541 HIS B O   
2794 C CB  . HIS B 100 ? 0.6946 0.9302 0.8517 0.1386  -0.1555 -0.1377 541 HIS B CB  
2795 C CG  . HIS B 100 ? 0.6819 0.8819 0.8361 0.1402  -0.1425 -0.1398 541 HIS B CG  
2796 N ND1 . HIS B 100 ? 0.6826 0.9052 0.8531 0.1417  -0.1331 -0.1469 541 HIS B ND1 
2797 C CD2 . HIS B 100 ? 0.6859 0.8358 0.8228 0.1406  -0.1373 -0.1362 541 HIS B CD2 
2798 C CE1 . HIS B 100 ? 0.6755 0.8648 0.8364 0.1442  -0.1236 -0.1474 541 HIS B CE1 
2799 N NE2 . HIS B 100 ? 0.6820 0.8276 0.8238 0.1432  -0.1265 -0.1418 541 HIS B NE2 
2800 N N   . ILE B 101 ? 0.7611 1.0548 0.9026 0.0920  -0.1685 -0.1523 542 ILE B N   
2801 C CA  . ILE B 101 ? 0.7921 1.1280 0.9277 0.0924  -0.1843 -0.1532 542 ILE B CA  
2802 C C   . ILE B 101 ? 0.8195 1.1935 0.9653 0.0605  -0.1819 -0.1760 542 ILE B C   
2803 O O   . ILE B 101 ? 0.8282 1.2629 0.9988 0.0575  -0.1884 -0.1853 542 ILE B O   
2804 C CB  . ILE B 101 ? 0.8103 1.1105 0.9142 0.1004  -0.1892 -0.1398 542 ILE B CB  
2805 C CG1 . ILE B 101 ? 0.8151 1.0774 0.9159 0.1300  -0.1901 -0.1182 542 ILE B CG1 
2806 C CG2 . ILE B 101 ? 0.8291 1.1799 0.9231 0.1023  -0.2053 -0.1397 542 ILE B CG2 
2807 C CD1 . ILE B 101 ? 0.8078 1.1056 0.9300 0.1580  -0.2000 -0.1088 542 ILE B CD1 
2808 N N   . ILE B 102 ? 0.8443 1.1838 0.9746 0.0361  -0.1716 -0.1865 543 ILE B N   
2809 C CA  . ILE B 102 ? 0.8566 1.2236 1.0004 0.0028  -0.1660 -0.2116 543 ILE B CA  
2810 C C   . ILE B 102 ? 0.8662 1.2280 1.0381 -0.0132 -0.1478 -0.2183 543 ILE B C   
2811 O O   . ILE B 102 ? 0.8719 1.2534 1.0625 -0.0425 -0.1396 -0.2382 543 ILE B O   
2812 C CB  . ILE B 102 ? 0.8653 1.1972 0.9843 -0.0169 -0.1599 -0.2230 543 ILE B CB  
2813 C CG1 . ILE B 102 ? 0.8471 1.1042 0.9537 -0.0186 -0.1406 -0.2137 543 ILE B CG1 
2814 C CG2 . ILE B 102 ? 0.8790 1.2263 0.9698 -0.0012 -0.1772 -0.2156 543 ILE B CG2 
2815 C CD1 . ILE B 102 ? 0.8627 1.0836 0.9464 -0.0348 -0.1328 -0.2241 543 ILE B CD1 
2816 N N   . GLU B 103 ? 0.8788 1.2147 1.0537 0.0055  -0.1405 -0.2018 544 GLU B N   
2817 C CA  . GLU B 103 ? 0.8849 1.2227 1.0840 -0.0030 -0.1233 -0.2027 544 GLU B CA  
2818 C C   . GLU B 103 ? 0.8790 1.1887 1.0831 -0.0358 -0.1029 -0.2140 544 GLU B C   
2819 O O   . GLU B 103 ? 0.8994 1.2394 1.1318 -0.0584 -0.0935 -0.2262 544 GLU B O   
2820 C CB  . GLU B 103 ? 0.9026 1.3115 1.1341 0.0010  -0.1308 -0.2080 544 GLU B CB  
2821 C CG  . GLU B 103 ? 0.9069 1.3301 1.1389 0.0381  -0.1426 -0.1931 544 GLU B CG  
2822 C CD  . GLU B 103 ? 0.9180 1.4115 1.1847 0.0448  -0.1468 -0.1976 544 GLU B CD  
2823 O OE1 . GLU B 103 ? 0.9089 1.4051 1.1903 0.0519  -0.1345 -0.1936 544 GLU B OE1 
2824 O OE2 . GLU B 103 ? 0.9167 1.4678 1.1958 0.0439  -0.1623 -0.2053 544 GLU B OE2 
2825 N N   . THR B 104 ? 0.8792 1.1298 1.0577 -0.0375 -0.0949 -0.2091 545 THR B N   
2826 C CA  . THR B 104 ? 0.9005 1.1123 1.0814 -0.0629 -0.0731 -0.2157 545 THR B CA  
2827 C C   . THR B 104 ? 0.9224 1.1242 1.1208 -0.0636 -0.0526 -0.2036 545 THR B C   
2828 O O   . THR B 104 ? 0.9232 1.1152 1.1131 -0.0395 -0.0525 -0.1865 545 THR B O   
2829 C CB  . THR B 104 ? 0.8988 1.0511 1.0475 -0.0576 -0.0694 -0.2094 545 THR B CB  
2830 O OG1 . THR B 104 ? 0.8719 1.0355 1.0040 -0.0613 -0.0846 -0.2220 545 THR B OG1 
2831 C CG2 . THR B 104 ? 0.9112 1.0166 1.0632 -0.0769 -0.0439 -0.2109 545 THR B CG2 
2832 N N   . LYS B 105 ? 0.9705 1.1757 1.1938 -0.0918 -0.0343 -0.2132 546 LYS B N   
2833 C CA  . LYS B 105 ? 1.0019 1.1985 1.2428 -0.0952 -0.0108 -0.1990 546 LYS B CA  
2834 C C   . LYS B 105 ? 0.9966 1.1274 1.2247 -0.1011 0.0121  -0.1880 546 LYS B C   
2835 O O   . LYS B 105 ? 1.0023 1.1115 1.2451 -0.1284 0.0291  -0.1984 546 LYS B O   
2836 C CB  . LYS B 105 ? 1.0622 1.3038 1.3439 -0.1229 -0.0012 -0.2126 546 LYS B CB  
2837 C CG  . LYS B 105 ? 1.0878 1.4032 1.3872 -0.1171 -0.0231 -0.2239 546 LYS B CG  
2838 C CD  . LYS B 105 ? 1.0633 1.3998 1.3557 -0.0822 -0.0318 -0.2059 546 LYS B CD  
2839 C CE  . LYS B 105 ? 1.0387 1.4493 1.3529 -0.0744 -0.0509 -0.2156 546 LYS B CE  
2840 N NZ  . LYS B 105 ? 1.0181 1.4460 1.3288 -0.0402 -0.0563 -0.2007 546 LYS B NZ  
2841 N N   . PHE B 106 ? 0.9442 1.0449 1.1469 -0.0751 0.0125  -0.1681 547 PHE B N   
2842 C CA  . PHE B 106 ? 0.9349 0.9794 1.1238 -0.0736 0.0328  -0.1533 547 PHE B CA  
2843 C C   . PHE B 106 ? 0.9263 0.9700 1.1327 -0.0762 0.0585  -0.1345 547 PHE B C   
2844 O O   . PHE B 106 ? 0.9063 0.9890 1.1212 -0.0648 0.0567  -0.1265 547 PHE B O   
2845 C CB  . PHE B 106 ? 0.9381 0.9620 1.0958 -0.0438 0.0222  -0.1394 547 PHE B CB  
2846 C CG  . PHE B 106 ? 0.9355 0.9502 1.0725 -0.0383 0.0014  -0.1507 547 PHE B CG  
2847 C CD1 . PHE B 106 ? 0.9067 0.9445 1.0334 -0.0176 -0.0206 -0.1501 547 PHE B CD1 
2848 C CD2 . PHE B 106 ? 0.9692 0.9503 1.0970 -0.0525 0.0059  -0.1608 547 PHE B CD2 
2849 C CE1 . PHE B 106 ? 0.9066 0.9351 1.0147 -0.0119 -0.0373 -0.1559 547 PHE B CE1 
2850 C CE2 . PHE B 106 ? 0.9753 0.9518 1.0823 -0.0464 -0.0117 -0.1689 547 PHE B CE2 
2851 C CZ  . PHE B 106 ? 0.9383 0.9385 1.0353 -0.0263 -0.0330 -0.1645 547 PHE B CZ  
2852 N N   . GLU B 107 ? 0.9520 0.9508 1.1626 -0.0886 0.0838  -0.1255 548 GLU B N   
2853 C CA  . GLU B 107 ? 0.9844 0.9761 1.2051 -0.0846 0.1107  -0.0991 548 GLU B CA  
2854 C C   . GLU B 107 ? 0.9547 0.9476 1.1469 -0.0495 0.1054  -0.0768 548 GLU B C   
2855 O O   . GLU B 107 ? 0.9477 0.9277 1.1146 -0.0333 0.0874  -0.0811 548 GLU B O   
2856 C CB  . GLU B 107 ? 1.0622 0.9982 1.2927 -0.1019 0.1399  -0.0916 548 GLU B CB  
2857 C CG  . GLU B 107 ? 1.1328 1.0683 1.4002 -0.1405 0.1532  -0.1126 548 GLU B CG  
2858 C CD  . GLU B 107 ? 1.2366 1.1122 1.5194 -0.1561 0.1885  -0.1009 548 GLU B CD  
2859 O OE1 . GLU B 107 ? 1.2594 1.0863 1.5197 -0.1394 0.1962  -0.0868 548 GLU B OE1 
2860 O OE2 . GLU B 107 ? 1.3050 1.1820 1.6252 -0.1850 0.2098  -0.1053 548 GLU B OE2 
2861 N N   . MET B 108 ? 0.9381 0.8120 1.3082 -0.1845 0.1329  -0.0808 549 MET B N   
2862 C CA  . MET B 108 ? 0.9492 0.7997 1.2395 -0.1722 0.1406  -0.0455 549 MET B CA  
2863 C C   . MET B 108 ? 0.9695 0.7814 1.2168 -0.1545 0.1197  -0.0338 549 MET B C   
2864 O O   . MET B 108 ? 0.9517 0.7667 1.1418 -0.1364 0.1088  -0.0226 549 MET B O   
2865 C CB  . MET B 108 ? 1.0214 0.8401 1.2970 -0.1909 0.1792  -0.0122 549 MET B CB  
2866 C CG  . MET B 108 ? 1.0659 0.8695 1.2566 -0.1796 0.1882  0.0187  549 MET B CG  
2867 S SD  . MET B 108 ? 1.0874 0.9487 1.2570 -0.1684 0.1901  0.0052  549 MET B SD  
2868 C CE  . MET B 108 ? 1.0927 0.9878 1.3365 -0.1931 0.2243  -0.0081 549 MET B CE  
2869 N N   . ILE B 109 ? 0.9959 0.7732 1.2788 -0.1597 0.1138  -0.0394 550 ILE B N   
2870 C CA  . ILE B 109 ? 0.9958 0.7400 1.2545 -0.1411 0.0923  -0.0341 550 ILE B CA  
2871 C C   . ILE B 109 ? 0.9403 0.7274 1.1743 -0.1184 0.0663  -0.0567 550 ILE B C   
2872 O O   . ILE B 109 ? 0.9080 0.6822 1.0983 -0.1005 0.0541  -0.0431 550 ILE B O   
2873 C CB  . ILE B 109 ? 1.0320 0.7446 1.3520 -0.1481 0.0862  -0.0522 550 ILE B CB  
2874 C CG1 . ILE B 109 ? 1.1332 0.8097 1.4980 -0.1761 0.1156  -0.0372 550 ILE B CG1 
2875 C CG2 . ILE B 109 ? 1.0439 0.7109 1.3399 -0.1286 0.0698  -0.0370 550 ILE B CG2 
2876 C CD1 . ILE B 109 ? 1.1770 0.8240 1.6168 -0.1870 0.1121  -0.0613 550 ILE B CD1 
2877 N N   . LYS B 110 ? 0.9203 0.7594 1.1835 -0.1191 0.0580  -0.0905 551 LYS B N   
2878 C CA  . LYS B 110 ? 0.9013 0.7792 1.1417 -0.0991 0.0369  -0.1107 551 LYS B CA  
2879 C C   . LYS B 110 ? 0.8540 0.7571 1.0470 -0.0903 0.0410  -0.0945 551 LYS B C   
2880 O O   . LYS B 110 ? 0.8247 0.7351 0.9824 -0.0736 0.0301  -0.0926 551 LYS B O   
2881 C CB  . LYS B 110 ? 0.9103 0.8318 1.1932 -0.1008 0.0233  -0.1523 551 LYS B CB  
2882 C CG  . LYS B 110 ? 0.9230 0.8719 1.1826 -0.0806 0.0032  -0.1742 551 LYS B CG  
2883 C CD  . LYS B 110 ? 0.9698 0.9512 1.2681 -0.0825 -0.0121 -0.2183 551 LYS B CD  
2884 C CE  . LYS B 110 ? 0.9812 0.9767 1.2577 -0.0644 -0.0270 -0.2422 551 LYS B CE  
2885 N NZ  . LYS B 110 ? 1.0157 1.0167 1.3366 -0.0691 -0.0388 -0.2868 551 LYS B NZ  
2886 N N   . LEU B 111 ? 0.8153 0.7323 1.0142 -0.1020 0.0583  -0.0854 552 LEU B N   
2887 C CA  . LEU B 111 ? 0.7770 0.7132 0.9372 -0.0945 0.0651  -0.0717 552 LEU B CA  
2888 C C   . LEU B 111 ? 0.7925 0.6948 0.8982 -0.0865 0.0666  -0.0460 552 LEU B C   
2889 O O   . LEU B 111 ? 0.7556 0.6712 0.8283 -0.0736 0.0603  -0.0437 552 LEU B O   
2890 C CB  . LEU B 111 ? 0.7842 0.7338 0.9648 -0.1094 0.0884  -0.0658 552 LEU B CB  
2891 C CG  . LEU B 111 ? 0.7570 0.7517 0.9972 -0.1156 0.0849  -0.0924 552 LEU B CG  
2892 C CD1 . LEU B 111 ? 0.7611 0.7635 1.0287 -0.1323 0.1134  -0.0846 552 LEU B CD1 
2893 C CD2 . LEU B 111 ? 0.7012 0.7401 0.9338 -0.0967 0.0646  -0.1074 552 LEU B CD2 
2894 N N   . ILE B 112 ? 0.8436 0.7011 0.9417 -0.0938 0.0738  -0.0265 553 ILE B N   
2895 C CA  . ILE B 112 ? 0.8744 0.7003 0.9199 -0.0841 0.0695  -0.0021 553 ILE B CA  
2896 C C   . ILE B 112 ? 0.8810 0.7084 0.9260 -0.0659 0.0438  -0.0141 553 ILE B C   
2897 O O   . ILE B 112 ? 0.9109 0.7431 0.9220 -0.0530 0.0338  -0.0091 553 ILE B O   
2898 C CB  . ILE B 112 ? 0.9338 0.7081 0.9680 -0.0946 0.0827  0.0266  553 ILE B CB  
2899 C CG1 . ILE B 112 ? 0.9595 0.7354 0.9881 -0.1134 0.1147  0.0396  553 ILE B CG1 
2900 C CG2 . ILE B 112 ? 0.9690 0.7118 0.9484 -0.0798 0.0690  0.0508  553 ILE B CG2 
2901 C CD1 . ILE B 112 ? 1.0349 0.7610 1.0622 -0.1292 0.1359  0.0680  553 ILE B CD1 
2902 N N   . ASP B 113 ? 0.8808 0.7066 0.9681 -0.0654 0.0343  -0.0336 554 ASP B N   
2903 C CA  . ASP B 113 ? 0.8941 0.7269 0.9867 -0.0485 0.0143  -0.0501 554 ASP B CA  
2904 C C   . ASP B 113 ? 0.8433 0.7219 0.9214 -0.0389 0.0097  -0.0655 554 ASP B C   
2905 O O   . ASP B 113 ? 0.8618 0.7455 0.9245 -0.0255 0.0000  -0.0665 554 ASP B O   
2906 C CB  . ASP B 113 ? 0.9313 0.7583 1.0737 -0.0506 0.0078  -0.0753 554 ASP B CB  
2907 C CG  . ASP B 113 ? 0.9423 0.7725 1.0931 -0.0327 -0.0088 -0.0933 554 ASP B CG  
2908 O OD1 . ASP B 113 ? 0.9825 0.7888 1.1173 -0.0207 -0.0172 -0.0760 554 ASP B OD1 
2909 O OD2 . ASP B 113 ? 0.9698 0.8291 1.1431 -0.0298 -0.0138 -0.1260 554 ASP B OD2 
2910 N N   . ILE B 114 ? 0.7902 0.7016 0.8767 -0.0454 0.0170  -0.0763 555 ILE B N   
2911 C CA  . ILE B 114 ? 0.7440 0.6924 0.8143 -0.0358 0.0145  -0.0844 555 ILE B CA  
2912 C C   . ILE B 114 ? 0.7471 0.6895 0.7814 -0.0323 0.0202  -0.0644 555 ILE B C   
2913 O O   . ILE B 114 ? 0.7039 0.6587 0.7244 -0.0221 0.0155  -0.0671 555 ILE B O   
2914 C CB  . ILE B 114 ? 0.7260 0.7087 0.8136 -0.0406 0.0179  -0.0964 555 ILE B CB  
2915 C CG1 . ILE B 114 ? 0.7346 0.7319 0.8542 -0.0413 0.0065  -0.1244 555 ILE B CG1 
2916 C CG2 . ILE B 114 ? 0.7069 0.7186 0.7723 -0.0298 0.0179  -0.0949 555 ILE B CG2 
2917 C CD1 . ILE B 114 ? 0.7291 0.7601 0.8739 -0.0470 0.0045  -0.1384 555 ILE B CD1 
2918 N N   . ALA B 115 ? 0.7856 0.7092 0.8060 -0.0419 0.0321  -0.0465 556 ALA B N   
2919 C CA  . ALA B 115 ? 0.7835 0.6990 0.7663 -0.0397 0.0368  -0.0315 556 ALA B CA  
2920 C C   . ALA B 115 ? 0.7963 0.6955 0.7629 -0.0288 0.0206  -0.0275 556 ALA B C   
2921 O O   . ALA B 115 ? 0.8028 0.7138 0.7541 -0.0219 0.0162  -0.0299 556 ALA B O   
2922 C CB  . ALA B 115 ? 0.8250 0.7193 0.7904 -0.0521 0.0538  -0.0138 556 ALA B CB  
2923 N N   . ARG B 116 ? 0.8355 0.7085 0.8128 -0.0268 0.0110  -0.0231 557 ARG B N   
2924 C CA  . ARG B 116 ? 0.8772 0.7352 0.8464 -0.0135 -0.0077 -0.0190 557 ARG B CA  
2925 C C   . ARG B 116 ? 0.8267 0.7146 0.8167 -0.0022 -0.0169 -0.0405 557 ARG B C   
2926 O O   . ARG B 116 ? 0.8586 0.7543 0.8391 0.0059  -0.0264 -0.0411 557 ARG B O   
2927 C CB  . ARG B 116 ? 0.9403 0.7613 0.9259 -0.0110 -0.0162 -0.0100 557 ARG B CB  
2928 C CG  . ARG B 116 ? 0.9964 0.7988 0.9702 0.0051  -0.0381 0.0005  557 ARG B CG  
2929 C CD  . ARG B 116 ? 1.0854 0.8436 1.0753 0.0106  -0.0476 0.0149  557 ARG B CD  
2930 N NE  . ARG B 116 ? 1.1623 0.9201 1.2039 0.0074  -0.0432 -0.0064 557 ARG B NE  
2931 C CZ  . ARG B 116 ? 1.1581 0.9427 1.2364 0.0169  -0.0503 -0.0370 557 ARG B CZ  
2932 N NH1 . ARG B 116 ? 1.1199 0.9348 1.1959 0.0290  -0.0599 -0.0484 557 ARG B NH1 
2933 N NH2 . ARG B 116 ? 1.1688 0.9512 1.2883 0.0129  -0.0460 -0.0588 557 ARG B NH2 
2934 N N   . GLN B 117 ? 0.7707 0.6769 0.7892 -0.0026 -0.0134 -0.0595 558 GLN B N   
2935 C CA  . GLN B 117 ? 0.7357 0.6694 0.7705 0.0070  -0.0169 -0.0791 558 GLN B CA  
2936 C C   . GLN B 117 ? 0.7312 0.6901 0.7499 0.0066  -0.0083 -0.0783 558 GLN B C   
2937 O O   . GLN B 117 ? 0.7364 0.7085 0.7624 0.0135  -0.0113 -0.0851 558 GLN B O   
2938 C CB  . GLN B 117 ? 0.7465 0.6957 0.8035 0.0063  -0.0135 -0.1000 558 GLN B CB  
2939 C CG  . GLN B 117 ? 0.7717 0.6960 0.8568 0.0078  -0.0217 -0.1086 558 GLN B CG  
2940 C CD  . GLN B 117 ? 0.7691 0.7148 0.8760 0.0088  -0.0203 -0.1383 558 GLN B CD  
2941 O OE1 . GLN B 117 ? 0.7592 0.7324 0.8654 0.0170  -0.0180 -0.1551 558 GLN B OE1 
2942 N NE2 . GLN B 117 ? 0.8207 0.7550 0.9469 -0.0004 -0.0206 -0.1466 558 GLN B NE2 
2943 N N   . THR B 118 ? 0.7469 0.7122 0.7509 -0.0017 0.0032  -0.0711 559 THR B N   
2944 C CA  . THR B 118 ? 0.7159 0.6982 0.7081 -0.0021 0.0127  -0.0683 559 THR B CA  
2945 C C   . THR B 118 ? 0.7196 0.6914 0.6990 -0.0011 0.0072  -0.0626 559 THR B C   
2946 O O   . THR B 118 ? 0.7114 0.6970 0.6976 0.0017  0.0088  -0.0687 559 THR B O   
2947 C CB  . THR B 118 ? 0.7136 0.7003 0.6976 -0.0093 0.0246  -0.0609 559 THR B CB  
2948 O OG1 . THR B 118 ? 0.7217 0.7208 0.7208 -0.0102 0.0242  -0.0686 559 THR B OG1 
2949 C CG2 . THR B 118 ? 0.6837 0.6851 0.6630 -0.0073 0.0348  -0.0589 559 THR B CG2 
2950 N N   . ALA B 119 ? 0.7468 0.6945 0.7076 -0.0037 0.0007  -0.0512 560 ALA B N   
2951 C CA  . ALA B 119 ? 0.8115 0.7514 0.7536 -0.0007 -0.0101 -0.0478 560 ALA B CA  
2952 C C   . ALA B 119 ? 0.8020 0.7490 0.7679 0.0104  -0.0281 -0.0577 560 ALA B C   
2953 O O   . ALA B 119 ? 0.7948 0.7520 0.7627 0.0135  -0.0372 -0.0646 560 ALA B O   
2954 C CB  . ALA B 119 ? 0.8555 0.7663 0.7628 -0.0040 -0.0136 -0.0300 560 ALA B CB  
2955 N N   . GLN B 120 ? 0.8152 0.7589 0.8053 0.0162  -0.0333 -0.0621 561 GLN B N   
2956 C CA  . GLN B 120 ? 0.8421 0.7925 0.8623 0.0286  -0.0497 -0.0730 561 GLN B CA  
2957 C C   . GLN B 120 ? 0.7727 0.7568 0.8183 0.0288  -0.0403 -0.0906 561 GLN B C   
2958 O O   . GLN B 120 ? 0.7781 0.7752 0.8417 0.0337  -0.0511 -0.0989 561 GLN B O   
2959 C CB  . GLN B 120 ? 0.8689 0.8070 0.9140 0.0349  -0.0537 -0.0779 561 GLN B CB  
2960 C CG  . GLN B 120 ? 0.9500 0.8702 1.0128 0.0496  -0.0776 -0.0747 561 GLN B CG  
2961 C CD  . GLN B 120 ? 1.0804 0.9625 1.1457 0.0511  -0.0818 -0.0630 561 GLN B CD  
2962 O OE1 . GLN B 120 ? 1.0672 0.9484 1.1492 0.0451  -0.0690 -0.0739 561 GLN B OE1 
2963 N NE2 . GLN B 120 ? 1.1400 0.9895 1.1891 0.0594  -0.1006 -0.0408 561 GLN B NE2 
2964 N N   . GLY B 121 ? 0.7237 0.7219 0.7707 0.0231  -0.0201 -0.0953 562 GLY B N   
2965 C CA  . GLY B 121 ? 0.7064 0.7316 0.7709 0.0215  -0.0047 -0.1058 562 GLY B CA  
2966 C C   . GLY B 121 ? 0.7060 0.7354 0.7650 0.0148  -0.0001 -0.1025 562 GLY B C   
2967 O O   . GLY B 121 ? 0.7129 0.7604 0.7992 0.0139  0.0055  -0.1129 562 GLY B O   
2968 N N   . MET B 122 ? 0.7468 0.7601 0.7751 0.0089  -0.0002 -0.0907 563 MET B N   
2969 C CA  . MET B 122 ? 0.7597 0.7747 0.7832 0.0023  0.0054  -0.0919 563 MET B CA  
2970 C C   . MET B 122 ? 0.7864 0.8041 0.8188 0.0047  -0.0149 -0.1024 563 MET B C   
2971 O O   . MET B 122 ? 0.7919 0.8206 0.8413 -0.0003 -0.0122 -0.1140 563 MET B O   
2972 C CB  . MET B 122 ? 0.8063 0.8051 0.7961 -0.0033 0.0124  -0.0803 563 MET B CB  
2973 C CG  . MET B 122 ? 0.8223 0.8256 0.8117 -0.0053 0.0313  -0.0728 563 MET B CG  
2974 S SD  . MET B 122 ? 0.8262 0.8430 0.8380 -0.0069 0.0509  -0.0748 563 MET B SD  
2975 C CE  . MET B 122 ? 0.8343 0.8442 0.8512 -0.0137 0.0494  -0.0854 563 MET B CE  
2976 N N   . ASP B 123 ? 0.8036 0.8107 0.8266 0.0131  -0.0371 -0.0985 564 ASP B N   
2977 C CA  . ASP B 123 ? 0.8291 0.8417 0.8603 0.0199  -0.0634 -0.1074 564 ASP B CA  
2978 C C   . ASP B 123 ? 0.7914 0.8329 0.8816 0.0241  -0.0653 -0.1267 564 ASP B C   
2979 O O   . ASP B 123 ? 0.7968 0.8568 0.9128 0.0238  -0.0776 -0.1429 564 ASP B O   
2980 C CB  . ASP B 123 ? 0.8877 0.8770 0.8935 0.0307  -0.0865 -0.0925 564 ASP B CB  
2981 C CG  . ASP B 123 ? 0.9576 0.9514 0.9608 0.0410  -0.1195 -0.0978 564 ASP B CG  
2982 O OD1 . ASP B 123 ? 1.0085 1.0150 1.0026 0.0354  -0.1241 -0.1101 564 ASP B OD1 
2983 O OD2 . ASP B 123 ? 1.0016 0.9866 1.0140 0.0558  -0.1425 -0.0910 564 ASP B OD2 
2984 N N   . TYR B 124 ? 0.7417 0.7896 0.8553 0.0274  -0.0520 -0.1279 565 TYR B N   
2985 C CA  . TYR B 124 ? 0.7074 0.7849 0.8775 0.0301  -0.0455 -0.1469 565 TYR B CA  
2986 C C   . TYR B 124 ? 0.6825 0.7782 0.8743 0.0170  -0.0234 -0.1558 565 TYR B C   
2987 O O   . TYR B 124 ? 0.6911 0.8106 0.9306 0.0155  -0.0279 -0.1741 565 TYR B O   
2988 C CB  . TYR B 124 ? 0.6629 0.7433 0.8424 0.0344  -0.0292 -0.1480 565 TYR B CB  
2989 C CG  . TYR B 124 ? 0.6471 0.7591 0.8816 0.0369  -0.0163 -0.1683 565 TYR B CG  
2990 C CD1 . TYR B 124 ? 0.6618 0.7880 0.9432 0.0497  -0.0364 -0.1840 565 TYR B CD1 
2991 C CD2 . TYR B 124 ? 0.6368 0.7647 0.8774 0.0275  0.0173  -0.1706 565 TYR B CD2 
2992 C CE1 . TYR B 124 ? 0.6707 0.8302 1.0102 0.0518  -0.0210 -0.2057 565 TYR B CE1 
2993 C CE2 . TYR B 124 ? 0.6384 0.7962 0.9283 0.0283  0.0352  -0.1888 565 TYR B CE2 
2994 C CZ  . TYR B 124 ? 0.6526 0.8281 0.9951 0.0398  0.0171  -0.2084 565 TYR B CZ  
2995 O OH  . TYR B 124 ? 0.6573 0.8668 1.0572 0.0407  0.0374  -0.2299 565 TYR B OH  
2996 N N   . LEU B 125 ? 0.6674 0.7513 0.8298 0.0076  0.0000  -0.1430 566 LEU B N   
2997 C CA  . LEU B 125 ? 0.6766 0.7691 0.8588 -0.0043 0.0238  -0.1464 566 LEU B CA  
2998 C C   . LEU B 125 ? 0.7065 0.8031 0.9067 -0.0105 0.0091  -0.1612 566 LEU B C   
2999 O O   . LEU B 125 ? 0.7320 0.8497 0.9842 -0.0168 0.0143  -0.1789 566 LEU B O   
3000 C CB  . LEU B 125 ? 0.6663 0.7407 0.8104 -0.0091 0.0447  -0.1270 566 LEU B CB  
3001 C CG  . LEU B 125 ? 0.6815 0.7574 0.8079 -0.0038 0.0591  -0.1158 566 LEU B CG  
3002 C CD1 . LEU B 125 ? 0.7217 0.7827 0.8144 -0.0063 0.0729  -0.0971 566 LEU B CD1 
3003 C CD2 . LEU B 125 ? 0.6738 0.7713 0.8309 -0.0044 0.0807  -0.1226 566 LEU B CD2 
3004 N N   . HIS B 126 ? 0.7245 0.8029 0.8826 -0.0091 -0.0088 -0.1565 567 HIS B N   
3005 C CA  . HIS B 126 ? 0.7488 0.8304 0.9105 -0.0140 -0.0257 -0.1736 567 HIS B CA  
3006 C C   . HIS B 126 ? 0.7699 0.8773 0.9723 -0.0078 -0.0557 -0.1957 567 HIS B C   
3007 O O   . HIS B 126 ? 0.8062 0.9289 1.0380 -0.0149 -0.0651 -0.2190 567 HIS B O   
3008 C CB  . HIS B 126 ? 0.7777 0.8353 0.8751 -0.0115 -0.0377 -0.1625 567 HIS B CB  
3009 C CG  . HIS B 126 ? 0.7673 0.8061 0.8387 -0.0189 -0.0104 -0.1496 567 HIS B CG  
3010 N ND1 . HIS B 126 ? 0.8097 0.8310 0.8345 -0.0208 -0.0115 -0.1459 567 HIS B ND1 
3011 C CD2 . HIS B 126 ? 0.7351 0.7713 0.8221 -0.0235 0.0183  -0.1397 567 HIS B CD2 
3012 C CE1 . HIS B 126 ? 0.7744 0.7850 0.7956 -0.0256 0.0147  -0.1362 567 HIS B CE1 
3013 N NE2 . HIS B 126 ? 0.7395 0.7579 0.7960 -0.0264 0.0309  -0.1307 567 HIS B NE2 
3014 N N   . ALA B 127 ? 0.7703 0.8834 0.9795 0.0061  -0.0725 -0.1908 568 ALA B N   
3015 C CA  . ALA B 127 ? 0.7706 0.9122 1.0301 0.0158  -0.1017 -0.2112 568 ALA B CA  
3016 C C   . ALA B 127 ? 0.7507 0.9251 1.0894 0.0065  -0.0796 -0.2322 568 ALA B C   
3017 O O   . ALA B 127 ? 0.7476 0.9522 1.1419 0.0059  -0.0978 -0.2581 568 ALA B O   
3018 C CB  . ALA B 127 ? 0.7891 0.9236 1.0413 0.0349  -0.1218 -0.1991 568 ALA B CB  
3019 N N   . LYS B 128 ? 0.7490 0.9187 1.0921 -0.0008 -0.0403 -0.2211 569 LYS B N   
3020 C CA  . LYS B 128 ? 0.7489 0.9437 1.1568 -0.0131 -0.0083 -0.2346 569 LYS B CA  
3021 C C   . LYS B 128 ? 0.7619 0.9484 1.1782 -0.0327 0.0147  -0.2371 569 LYS B C   
3022 O O   . LYS B 128 ? 0.8093 1.0082 1.2740 -0.0456 0.0478  -0.2420 569 LYS B O   
3023 C CB  . LYS B 128 ? 0.7290 0.9215 1.1284 -0.0112 0.0247  -0.2198 569 LYS B CB  
3024 C CG  . LYS B 128 ? 0.7239 0.9252 1.1295 0.0066  0.0091  -0.2232 569 LYS B CG  
3025 C CD  . LYS B 128 ? 0.7227 0.9645 1.2117 0.0107  0.0038  -0.2510 569 LYS B CD  
3026 C CE  . LYS B 128 ? 0.7254 0.9760 1.2284 0.0268  0.0045  -0.2556 569 LYS B CE  
3027 N NZ  . LYS B 128 ? 0.7473 1.0390 1.3381 0.0352  -0.0075 -0.2849 569 LYS B NZ  
3028 N N   . SER B 129 ? 0.7370 0.9011 1.1083 -0.0350 0.0002  -0.2338 570 SER B N   
3029 C CA  . SER B 129 ? 0.7400 0.8924 1.1222 -0.0517 0.0190  -0.2402 570 SER B CA  
3030 C C   . SER B 129 ? 0.7391 0.8670 1.1033 -0.0590 0.0616  -0.2139 570 SER B C   
3031 O O   . SER B 129 ? 0.7435 0.8632 1.1394 -0.0734 0.0870  -0.2167 570 SER B O   
3032 C CB  . SER B 129 ? 0.7474 0.9301 1.2140 -0.0647 0.0182  -0.2735 570 SER B CB  
3033 O OG  . SER B 129 ? 0.7768 0.9686 1.2417 -0.0635 -0.0203 -0.2997 570 SER B OG  
3034 N N   . ILE B 130 ? 0.7254 0.8403 1.0396 -0.0483 0.0675  -0.1883 571 ILE B N   
3035 C CA  . ILE B 130 ? 0.7299 0.8240 1.0184 -0.0508 0.1001  -0.1618 571 ILE B CA  
3036 C C   . ILE B 130 ? 0.7238 0.7909 0.9569 -0.0465 0.0925  -0.1481 571 ILE B C   
3037 O O   . ILE B 130 ? 0.7213 0.7844 0.9126 -0.0364 0.0728  -0.1418 571 ILE B O   
3038 C CB  . ILE B 130 ? 0.7450 0.8474 1.0159 -0.0417 0.1118  -0.1465 571 ILE B CB  
3039 C CG1 . ILE B 130 ? 0.7747 0.9047 1.1032 -0.0472 0.1306  -0.1593 571 ILE B CG1 
3040 C CG2 . ILE B 130 ? 0.7630 0.8445 0.9919 -0.0398 0.1353  -0.1176 571 ILE B CG2 
3041 C CD1 . ILE B 130 ? 0.7985 0.9433 1.1142 -0.0368 0.1380  -0.1551 571 ILE B CD1 
3042 N N   . ILE B 131 ? 0.7200 0.7679 0.9586 -0.0546 0.1106  -0.1438 572 ILE B N   
3043 C CA  . ILE B 131 ? 0.7188 0.7432 0.9137 -0.0498 0.1109  -0.1300 572 ILE B CA  
3044 C C   . ILE B 131 ? 0.7097 0.7239 0.8832 -0.0432 0.1324  -0.0994 572 ILE B C   
3045 O O   . ILE B 131 ? 0.7258 0.7333 0.9218 -0.0476 0.1580  -0.0873 572 ILE B O   
3046 C CB  . ILE B 131 ? 0.7452 0.7531 0.9601 -0.0592 0.1180  -0.1443 572 ILE B CB  
3047 C CG1 . ILE B 131 ? 0.7490 0.7714 0.9805 -0.0652 0.0927  -0.1789 572 ILE B CG1 
3048 C CG2 . ILE B 131 ? 0.7641 0.7514 0.9393 -0.0526 0.1204  -0.1324 572 ILE B CG2 
3049 C CD1 . ILE B 131 ? 0.7517 0.7612 1.0058 -0.0756 0.0976  -0.2026 572 ILE B CD1 
3050 N N   . HIS B 132 ? 0.7169 0.7295 0.8468 -0.0328 0.1214  -0.0869 573 HIS B N   
3051 C CA  . HIS B 132 ? 0.7062 0.7164 0.8121 -0.0241 0.1333  -0.0619 573 HIS B CA  
3052 C C   . HIS B 132 ? 0.7237 0.7134 0.8327 -0.0227 0.1519  -0.0443 573 HIS B C   
3053 O O   . HIS B 132 ? 0.6915 0.6773 0.7996 -0.0192 0.1703  -0.0234 573 HIS B O   
3054 C CB  . HIS B 132 ? 0.7058 0.7205 0.7748 -0.0155 0.1146  -0.0586 573 HIS B CB  
3055 C CG  . HIS B 132 ? 0.7385 0.7607 0.7856 -0.0063 0.1195  -0.0415 573 HIS B CG  
3056 N ND1 . HIS B 132 ? 0.7849 0.7998 0.8198 0.0004  0.1287  -0.0219 573 HIS B ND1 
3057 C CD2 . HIS B 132 ? 0.7493 0.7875 0.7848 -0.0016 0.1149  -0.0435 573 HIS B CD2 
3058 C CE1 . HIS B 132 ? 0.7922 0.8201 0.8040 0.0088  0.1272  -0.0124 573 HIS B CE1 
3059 N NE2 . HIS B 132 ? 0.7581 0.8000 0.7695 0.0068  0.1202  -0.0270 573 HIS B NE2 
3060 N N   . ARG B 133 ? 0.7482 0.7246 0.8580 -0.0237 0.1473  -0.0522 574 ARG B N   
3061 C CA  . ARG B 133 ? 0.7739 0.7280 0.8971 -0.0211 0.1634  -0.0409 574 ARG B CA  
3062 C C   . ARG B 133 ? 0.7844 0.7365 0.8844 -0.0064 0.1628  -0.0179 574 ARG B C   
3063 O O   . ARG B 133 ? 0.8291 0.7648 0.9425 -0.0013 0.1708  -0.0125 574 ARG B O   
3064 C CB  . ARG B 133 ? 0.8121 0.7511 0.9704 -0.0272 0.1877  -0.0311 574 ARG B CB  
3065 C CG  . ARG B 133 ? 0.8500 0.7895 1.0500 -0.0436 0.1905  -0.0590 574 ARG B CG  
3066 C CD  . ARG B 133 ? 0.9079 0.8290 1.1503 -0.0521 0.2200  -0.0472 574 ARG B CD  
3067 N NE  . ARG B 133 ? 0.9562 0.8692 1.2500 -0.0679 0.2237  -0.0781 574 ARG B NE  
3068 C CZ  . ARG B 133 ? 0.9837 0.9174 1.3114 -0.0815 0.2174  -0.1059 574 ARG B CZ  
3069 N NH1 . ARG B 133 ? 1.0111 0.9385 1.3877 -0.0956 0.2181  -0.1377 574 ARG B NH1 
3070 N NH2 . ARG B 133 ? 0.9454 0.9080 1.2639 -0.0804 0.2092  -0.1056 574 ARG B NH2 
3071 N N   . ASP B 134 ? 0.7705 0.7406 0.8416 0.0009  0.1522  -0.0075 575 ASP B N   
3072 C CA  . ASP B 134 ? 0.7986 0.7739 0.8515 0.0152  0.1470  0.0109  575 ASP B CA  
3073 C C   . ASP B 134 ? 0.7897 0.7875 0.8175 0.0172  0.1277  0.0031  575 ASP B C   
3074 O O   . ASP B 134 ? 0.7954 0.8074 0.8039 0.0259  0.1215  0.0138  575 ASP B O   
3075 C CB  . ASP B 134 ? 0.8624 0.8317 0.9084 0.0246  0.1599  0.0393  575 ASP B CB  
3076 C CG  . ASP B 134 ? 0.9314 0.9041 0.9645 0.0429  0.1519  0.0603  575 ASP B CG  
3077 O OD1 . ASP B 134 ? 0.9707 0.9424 1.0200 0.0475  0.1453  0.0541  575 ASP B OD1 
3078 O OD2 . ASP B 134 ? 0.9823 0.9612 0.9889 0.0536  0.1523  0.0825  575 ASP B OD2 
3079 N N   . LEU B 135 ? 0.7977 0.7972 0.8252 0.0089  0.1181  -0.0161 576 LEU B N   
3080 C CA  . LEU B 135 ? 0.7415 0.7549 0.7521 0.0090  0.1021  -0.0226 576 LEU B CA  
3081 C C   . LEU B 135 ? 0.7309 0.7508 0.7431 0.0155  0.0989  -0.0171 576 LEU B C   
3082 O O   . LEU B 135 ? 0.7552 0.7667 0.7806 0.0152  0.1066  -0.0188 576 LEU B O   
3083 C CB  . LEU B 135 ? 0.7633 0.7709 0.7700 -0.0006 0.0944  -0.0390 576 LEU B CB  
3084 C CG  . LEU B 135 ? 0.7549 0.7680 0.7473 -0.0022 0.0800  -0.0437 576 LEU B CG  
3085 C CD1 . LEU B 135 ? 0.7714 0.7966 0.7617 0.0018  0.0728  -0.0445 576 LEU B CD1 
3086 C CD2 . LEU B 135 ? 0.7702 0.7719 0.7530 -0.0094 0.0729  -0.0535 576 LEU B CD2 
3087 N N   . LYS B 136 ? 0.7176 0.7553 0.7211 0.0216  0.0876  -0.0141 577 LYS B N   
3088 C CA  . LYS B 136 ? 0.6970 0.7489 0.7106 0.0271  0.0806  -0.0131 577 LYS B CA  
3089 C C   . LYS B 136 ? 0.7138 0.7867 0.7181 0.0296  0.0644  -0.0188 577 LYS B C   
3090 O O   . LYS B 136 ? 0.7340 0.8109 0.7200 0.0316  0.0610  -0.0196 577 LYS B O   
3091 C CB  . LYS B 136 ? 0.6998 0.7527 0.7266 0.0408  0.0854  0.0024  577 LYS B CB  
3092 C CG  . LYS B 136 ? 0.7248 0.7775 0.7335 0.0517  0.0860  0.0206  577 LYS B CG  
3093 C CD  . LYS B 136 ? 0.7633 0.8131 0.7844 0.0683  0.0879  0.0412  577 LYS B CD  
3094 C CE  . LYS B 136 ? 0.8116 0.8433 0.8162 0.0744  0.1008  0.0644  577 LYS B CE  
3095 N NZ  . LYS B 136 ? 0.8826 0.9176 0.8786 0.0962  0.0937  0.0918  577 LYS B NZ  
3096 N N   . SER B 137 ? 0.6991 0.7873 0.7202 0.0290  0.0559  -0.0258 578 SER B N   
3097 C CA  . SER B 137 ? 0.6943 0.8017 0.7150 0.0282  0.0398  -0.0380 578 SER B CA  
3098 C C   . SER B 137 ? 0.7009 0.8279 0.7006 0.0416  0.0276  -0.0353 578 SER B C   
3099 O O   . SER B 137 ? 0.7070 0.8462 0.6992 0.0399  0.0163  -0.0505 578 SER B O   
3100 C CB  . SER B 137 ? 0.7149 0.8388 0.7687 0.0242  0.0348  -0.0470 578 SER B CB  
3101 O OG  . SER B 137 ? 0.7468 0.8835 0.8194 0.0359  0.0356  -0.0376 578 SER B OG  
3102 N N   . ASN B 138 ? 0.7248 0.8535 0.7126 0.0555  0.0304  -0.0163 579 ASN B N   
3103 C CA  . ASN B 138 ? 0.7923 0.9370 0.7460 0.0684  0.0213  -0.0102 579 ASN B CA  
3104 C C   . ASN B 138 ? 0.7717 0.9010 0.6977 0.0650  0.0373  -0.0053 579 ASN B C   
3105 O O   . ASN B 138 ? 0.7937 0.9346 0.6858 0.0736  0.0360  -0.0009 579 ASN B O   
3106 C CB  . ASN B 138 ? 0.8775 1.0335 0.8242 0.0883  0.0131  0.0116  579 ASN B CB  
3107 C CG  . ASN B 138 ? 0.9874 1.1216 0.9603 0.0912  0.0274  0.0297  579 ASN B CG  
3108 O OD1 . ASN B 138 ? 1.0508 1.1745 1.0557 0.0794  0.0363  0.0190  579 ASN B OD1 
3109 N ND2 . ASN B 138 ? 1.0895 1.2152 1.0477 0.1077  0.0305  0.0574  579 ASN B ND2 
3110 N N   . ASN B 139 ? 0.7512 0.8574 0.6919 0.0525  0.0524  -0.0076 580 ASN B N   
3111 C CA  . ASN B 139 ? 0.7579 0.8550 0.6872 0.0468  0.0660  -0.0103 580 ASN B CA  
3112 C C   . ASN B 139 ? 0.7407 0.8390 0.6797 0.0370  0.0587  -0.0346 580 ASN B C   
3113 O O   . ASN B 139 ? 0.7331 0.8226 0.6780 0.0310  0.0674  -0.0406 580 ASN B O   
3114 C CB  . ASN B 139 ? 0.7664 0.8395 0.7106 0.0412  0.0851  0.0020  580 ASN B CB  
3115 C CG  . ASN B 139 ? 0.8348 0.9003 0.7682 0.0512  0.0980  0.0288  580 ASN B CG  
3116 O OD1 . ASN B 139 ? 0.8956 0.9739 0.7985 0.0627  0.0954  0.0408  580 ASN B OD1 
3117 N ND2 . ASN B 139 ? 0.8391 0.8818 0.7955 0.0475  0.1118  0.0384  580 ASN B ND2 
3118 N N   . ILE B 140 ? 0.7489 0.8583 0.6952 0.0359  0.0422  -0.0487 581 ILE B N   
3119 C CA  . ILE B 140 ? 0.7453 0.8501 0.7044 0.0277  0.0348  -0.0693 581 ILE B CA  
3120 C C   . ILE B 140 ? 0.7468 0.8739 0.7007 0.0319  0.0202  -0.0880 581 ILE B C   
3121 O O   . ILE B 140 ? 0.7527 0.8921 0.7186 0.0318  0.0078  -0.0930 581 ILE B O   
3122 C CB  . ILE B 140 ? 0.7516 0.8394 0.7328 0.0174  0.0326  -0.0691 581 ILE B CB  
3123 C CG1 . ILE B 140 ? 0.7642 0.8318 0.7460 0.0131  0.0444  -0.0576 581 ILE B CG1 
3124 C CG2 . ILE B 140 ? 0.7822 0.8605 0.7765 0.0104  0.0242  -0.0853 581 ILE B CG2 
3125 C CD1 . ILE B 140 ? 0.8022 0.8556 0.7935 0.0048  0.0463  -0.0544 581 ILE B CD1 
3126 N N   . PHE B 141 ? 0.7762 0.9112 0.7161 0.0354  0.0222  -0.1018 582 PHE B N   
3127 C CA  . PHE B 141 ? 0.8175 0.9762 0.7459 0.0407  0.0092  -0.1244 582 PHE B CA  
3128 C C   . PHE B 141 ? 0.8044 0.9529 0.7653 0.0318  0.0000  -0.1497 582 PHE B C   
3129 O O   . PHE B 141 ? 0.8270 0.9542 0.8038 0.0273  0.0070  -0.1510 582 PHE B O   
3130 C CB  . PHE B 141 ? 0.8446 1.0170 0.7379 0.0493  0.0209  -0.1283 582 PHE B CB  
3131 C CG  . PHE B 141 ? 0.9219 1.1248 0.7796 0.0599  0.0089  -0.1400 582 PHE B CG  
3132 C CD1 . PHE B 141 ? 0.9458 1.1607 0.7645 0.0715  0.0097  -0.1148 582 PHE B CD1 
3133 C CD2 . PHE B 141 ? 0.9447 1.1634 0.8071 0.0594  -0.0049 -0.1771 582 PHE B CD2 
3134 C CE1 . PHE B 141 ? 0.9889 1.2339 0.7668 0.0837  -0.0056 -0.1246 582 PHE B CE1 
3135 C CE2 . PHE B 141 ? 0.9746 1.2253 0.8001 0.0696  -0.0195 -0.1926 582 PHE B CE2 
3136 C CZ  . PHE B 141 ? 1.0046 1.2699 0.7840 0.0825  -0.0211 -0.1654 582 PHE B CZ  
3137 N N   . LEU B 142 ? 0.8087 0.9714 0.7838 0.0295  -0.0165 -0.1693 583 LEU B N   
3138 C CA  . LEU B 142 ? 0.8256 0.9745 0.8367 0.0201  -0.0236 -0.1936 583 LEU B CA  
3139 C C   . LEU B 142 ? 0.8363 1.0032 0.8380 0.0262  -0.0295 -0.2280 583 LEU B C   
3140 O O   . LEU B 142 ? 0.8138 1.0068 0.8141 0.0278  -0.0450 -0.2520 583 LEU B O   
3141 C CB  . LEU B 142 ? 0.8791 1.0306 0.9241 0.0099  -0.0344 -0.1977 583 LEU B CB  
3142 C CG  . LEU B 142 ? 0.9324 1.0481 1.0129 -0.0044 -0.0277 -0.1893 583 LEU B CG  
3143 C CD1 . LEU B 142 ? 0.9751 1.1001 1.0962 -0.0163 -0.0357 -0.2019 583 LEU B CD1 
3144 C CD2 . LEU B 142 ? 0.9509 1.0385 1.0444 -0.0060 -0.0257 -0.2012 583 LEU B CD2 
3145 N N   . HIS B 143 ? 0.8444 1.0000 0.8418 0.0300  -0.0172 -0.2329 584 HIS B N   
3146 C CA  . HIS B 143 ? 0.8527 1.0272 0.8349 0.0379  -0.0148 -0.2644 584 HIS B CA  
3147 C C   . HIS B 143 ? 0.8806 1.0486 0.9011 0.0330  -0.0269 -0.3033 584 HIS B C   
3148 O O   . HIS B 143 ? 0.8694 1.0043 0.9327 0.0261  -0.0274 -0.3025 584 HIS B O   
3149 C CB  . HIS B 143 ? 0.8310 0.9972 0.8099 0.0429  0.0051  -0.2583 584 HIS B CB  
3150 C CG  . HIS B 143 ? 0.8822 1.0694 0.8472 0.0510  0.0137  -0.2917 584 HIS B CG  
3151 N ND1 . HIS B 143 ? 0.8730 1.0488 0.8751 0.0530  0.0191  -0.3171 584 HIS B ND1 
3152 C CD2 . HIS B 143 ? 0.9146 1.1343 0.8307 0.0588  0.0184  -0.3048 584 HIS B CD2 
3153 C CE1 . HIS B 143 ? 0.9032 1.1051 0.8832 0.0606  0.0295  -0.3478 584 HIS B CE1 
3154 N NE2 . HIS B 143 ? 0.9352 1.1640 0.8580 0.0637  0.0297  -0.3403 584 HIS B NE2 
3155 N N   . GLU B 144 ? 0.9421 1.1403 0.9456 0.0373  -0.0370 -0.3374 585 GLU B N   
3156 C CA  . GLU B 144 ? 1.0132 1.2089 1.0573 0.0311  -0.0512 -0.3810 585 GLU B CA  
3157 C C   . GLU B 144 ? 0.9600 1.1297 1.0573 0.0157  -0.0611 -0.3715 585 GLU B C   
3158 O O   . GLU B 144 ? 0.9613 1.1069 1.1087 0.0071  -0.0649 -0.3946 585 GLU B O   
3159 C CB  . GLU B 144 ? 1.0779 1.2572 1.1451 0.0354  -0.0399 -0.4090 585 GLU B CB  
3160 C CG  . GLU B 144 ? 1.1473 1.3581 1.1666 0.0488  -0.0263 -0.4285 585 GLU B CG  
3161 C CD  . GLU B 144 ? 1.2472 1.4937 1.2426 0.0525  -0.0389 -0.4775 585 GLU B CD  
3162 O OE1 . GLU B 144 ? 1.3308 1.5976 1.2960 0.0622  -0.0250 -0.5046 585 GLU B OE1 
3163 O OE2 . GLU B 144 ? 1.2752 1.5325 1.2825 0.0456  -0.0622 -0.4921 585 GLU B OE2 
3164 N N   . ASP B 145 ? 0.9313 1.1049 1.0186 0.0122  -0.0625 -0.3371 586 ASP B N   
3165 C CA  . ASP B 145 ? 0.9213 1.0743 1.0530 -0.0029 -0.0655 -0.3231 586 ASP B CA  
3166 C C   . ASP B 145 ? 0.8952 0.9973 1.0596 -0.0115 -0.0533 -0.3050 586 ASP B C   
3167 O O   . ASP B 145 ? 0.8874 0.9682 1.0901 -0.0259 -0.0526 -0.2980 586 ASP B O   
3168 C CB  . ASP B 145 ? 0.9355 1.1101 1.1059 -0.0125 -0.0841 -0.3604 586 ASP B CB  
3169 C CG  . ASP B 145 ? 0.9647 1.1897 1.1076 -0.0047 -0.1011 -0.3643 586 ASP B CG  
3170 O OD1 . ASP B 145 ? 0.9342 1.1655 1.0550 0.0000  -0.0966 -0.3276 586 ASP B OD1 
3171 O OD2 . ASP B 145 ? 1.0074 1.2655 1.1519 -0.0021 -0.1207 -0.4055 586 ASP B OD2 
3172 N N   . LEU B 146 ? 0.9053 0.9885 1.0551 -0.0025 -0.0434 -0.2952 587 LEU B N   
3173 C CA  . LEU B 146 ? 0.9037 0.9400 1.0779 -0.0072 -0.0367 -0.2730 587 LEU B CA  
3174 C C   . LEU B 146 ? 0.8605 0.8847 1.0110 0.0029  -0.0281 -0.2469 587 LEU B C   
3175 O O   . LEU B 146 ? 0.8827 0.8704 1.0470 0.0012  -0.0269 -0.2264 587 LEU B O   
3176 C CB  . LEU B 146 ? 0.9616 0.9694 1.1851 -0.0112 -0.0414 -0.3010 587 LEU B CB  
3177 C CG  . LEU B 146 ? 0.9931 0.9975 1.2299 0.0014  -0.0419 -0.3316 587 LEU B CG  
3178 C CD1 . LEU B 146 ? 1.0263 1.0073 1.3191 -0.0064 -0.0482 -0.3657 587 LEU B CD1 
3179 C CD2 . LEU B 146 ? 1.0294 1.0815 1.2280 0.0130  -0.0401 -0.3562 587 LEU B CD2 
3180 N N   . THR B 147 ? 0.8404 0.8942 0.9557 0.0129  -0.0224 -0.2456 588 THR B N   
3181 C CA  . THR B 147 ? 0.8266 0.8727 0.9276 0.0196  -0.0137 -0.2220 588 THR B CA  
3182 C C   . THR B 147 ? 0.7840 0.8486 0.8487 0.0195  -0.0058 -0.1970 588 THR B C   
3183 O O   . THR B 147 ? 0.7818 0.8761 0.8208 0.0236  -0.0025 -0.2029 588 THR B O   
3184 C CB  . THR B 147 ? 0.8206 0.8787 0.9274 0.0315  -0.0077 -0.2435 588 THR B CB  
3185 O OG1 . THR B 147 ? 0.8839 0.9342 1.0228 0.0335  -0.0139 -0.2774 588 THR B OG1 
3186 C CG2 . THR B 147 ? 0.7971 0.8381 0.9163 0.0367  -0.0055 -0.2252 588 THR B CG2 
3187 N N   . VAL B 148 ? 0.7464 0.7920 0.8077 0.0159  -0.0030 -0.1693 589 VAL B N   
3188 C CA  . VAL B 148 ? 0.7375 0.7950 0.7725 0.0158  0.0057  -0.1478 589 VAL B CA  
3189 C C   . VAL B 148 ? 0.7316 0.8050 0.7557 0.0235  0.0167  -0.1488 589 VAL B C   
3190 O O   . VAL B 148 ? 0.7274 0.7923 0.7684 0.0265  0.0174  -0.1517 589 VAL B O   
3191 C CB  . VAL B 148 ? 0.7446 0.7778 0.7786 0.0096  0.0064  -0.1240 589 VAL B CB  
3192 C CG1 . VAL B 148 ? 0.7437 0.7870 0.7582 0.0106  0.0168  -0.1077 589 VAL B CG1 
3193 C CG2 . VAL B 148 ? 0.7689 0.7891 0.8105 -0.0003 0.0034  -0.1180 589 VAL B CG2 
3194 N N   . LYS B 149 ? 0.7463 0.8427 0.7447 0.0269  0.0257  -0.1448 590 LYS B N   
3195 C CA  . LYS B 149 ? 0.7493 0.8582 0.7365 0.0312  0.0427  -0.1395 590 LYS B CA  
3196 C C   . LYS B 149 ? 0.7284 0.8342 0.7003 0.0289  0.0518  -0.1126 590 LYS B C   
3197 O O   . LYS B 149 ? 0.7415 0.8574 0.6902 0.0322  0.0522  -0.1025 590 LYS B O   
3198 C CB  . LYS B 149 ? 0.7746 0.9093 0.7391 0.0384  0.0505  -0.1559 590 LYS B CB  
3199 C CG  . LYS B 149 ? 0.7947 0.9339 0.7776 0.0417  0.0443  -0.1892 590 LYS B CG  
3200 C CD  . LYS B 149 ? 0.8117 0.9449 0.8289 0.0435  0.0522  -0.1985 590 LYS B CD  
3201 C CE  . LYS B 149 ? 0.8363 0.9758 0.8752 0.0497  0.0499  -0.2342 590 LYS B CE  
3202 N NZ  . LYS B 149 ? 0.8500 0.9949 0.9232 0.0548  0.0621  -0.2448 590 LYS B NZ  
3203 N N   . ILE B 150 ? 0.7180 0.8103 0.7062 0.0244  0.0569  -0.1030 591 ILE B N   
3204 C CA  . ILE B 150 ? 0.6998 0.7859 0.6821 0.0213  0.0678  -0.0823 591 ILE B CA  
3205 C C   . ILE B 150 ? 0.7228 0.8206 0.6960 0.0237  0.0895  -0.0745 591 ILE B C   
3206 O O   . ILE B 150 ? 0.7695 0.8781 0.7545 0.0240  0.0995  -0.0868 591 ILE B O   
3207 C CB  . ILE B 150 ? 0.6885 0.7584 0.6924 0.0149  0.0645  -0.0813 591 ILE B CB  
3208 C CG1 . ILE B 150 ? 0.6987 0.7524 0.7017 0.0119  0.0479  -0.0816 591 ILE B CG1 
3209 C CG2 . ILE B 150 ? 0.7078 0.7710 0.7123 0.0109  0.0776  -0.0666 591 ILE B CG2 
3210 C CD1 . ILE B 150 ? 0.7214 0.7611 0.7367 0.0090  0.0385  -0.0843 591 ILE B CD1 
3211 N N   . GLY B 151 ? 0.8319 1.5447 0.7249 0.1833  0.0897  -0.2354 592 GLY B N   
3212 C CA  . GLY B 151 ? 0.8744 1.6507 0.7484 0.1631  0.1379  -0.2057 592 GLY B CA  
3213 C C   . GLY B 151 ? 0.9040 1.6248 0.7406 0.1375  0.1585  -0.1407 592 GLY B C   
3214 O O   . GLY B 151 ? 0.8781 1.5200 0.7257 0.1260  0.1404  -0.1206 592 GLY B O   
3215 N N   . ASP B 152 ? 1.0016 1.7612 0.7902 0.1314  0.1986  -0.1061 593 ASP B N   
3216 C CA  . ASP B 152 ? 1.0867 1.7873 0.8191 0.1230  0.2120  -0.0435 593 ASP B CA  
3217 C C   . ASP B 152 ? 1.1740 1.9080 0.8215 0.1629  0.2048  -0.0388 593 ASP B C   
3218 O O   . ASP B 152 ? 1.2087 2.0128 0.8132 0.1720  0.2390  -0.0341 593 ASP B O   
3219 C CB  . ASP B 152 ? 1.1386 1.8267 0.8773 0.0799  0.2686  0.0085  593 ASP B CB  
3220 C CG  . ASP B 152 ? 1.2055 1.7983 0.9069 0.0704  0.2712  0.0695  593 ASP B CG  
3221 O OD1 . ASP B 152 ? 1.2403 1.7697 0.9926 0.0452  0.2622  0.0754  593 ASP B OD1 
3222 O OD2 . ASP B 152 ? 1.2469 1.8289 0.8652 0.0950  0.2771  0.1074  593 ASP B OD2 
3223 N N   . PHE B 153 ? 1.1823 1.8732 0.8091 0.1877  0.1601  -0.0449 594 PHE B N   
3224 C CA  . PHE B 153 ? 1.2514 1.9754 0.8050 0.2313  0.1396  -0.0516 594 PHE B CA  
3225 C C   . PHE B 153 ? 1.3500 2.0127 0.8519 0.2370  0.1377  0.0067  594 PHE B C   
3226 O O   . PHE B 153 ? 1.3571 1.9932 0.8623 0.2571  0.0945  -0.0083 594 PHE B O   
3227 C CB  . PHE B 153 ? 1.1846 1.9208 0.7711 0.2581  0.0844  -0.1213 594 PHE B CB  
3228 C CG  . PHE B 153 ? 1.1263 1.8985 0.7692 0.2571  0.0789  -0.1793 594 PHE B CG  
3229 C CD1 . PHE B 153 ? 1.0347 1.7525 0.7476 0.2438  0.0530  -0.2070 594 PHE B CD1 
3230 C CD2 . PHE B 153 ? 1.1577 2.0177 0.7788 0.2740  0.1006  -0.2054 594 PHE B CD2 
3231 C CE1 . PHE B 153 ? 0.9988 1.7402 0.7557 0.2513  0.0447  -0.2573 594 PHE B CE1 
3232 C CE2 . PHE B 153 ? 1.1131 2.0073 0.7883 0.2801  0.0920  -0.2622 594 PHE B CE2 
3233 C CZ  . PHE B 153 ? 1.0413 1.8718 0.7832 0.2708  0.0617  -0.2873 594 PHE B CZ  
3234 N N   . GLY B 154 ? 1.4465 2.0867 0.9059 0.2190  0.1868  0.0718  595 GLY B N   
3235 C CA  . GLY B 154 ? 1.4916 2.0595 0.8979 0.2257  0.1912  0.1357  595 GLY B CA  
3236 C C   . GLY B 154 ? 1.5368 2.1231 0.8671 0.2834  0.1513  0.1322  595 GLY B C   
3237 O O   . GLY B 154 ? 1.5746 2.1325 0.9332 0.2978  0.1051  0.1120  595 GLY B O   
3238 N N   . LEU B 155 ? 1.5743 2.2153 0.8089 0.3183  0.1693  0.1485  596 LEU B N   
3239 C CA  . LEU B 155 ? 1.6194 2.2910 0.7702 0.3824  0.1281  0.1414  596 LEU B CA  
3240 C C   . LEU B 155 ? 1.6043 2.3847 0.7172 0.4187  0.1161  0.0834  596 LEU B C   
3241 O O   . LEU B 155 ? 1.5739 2.4016 0.6695 0.4051  0.1616  0.0859  596 LEU B O   
3242 C CB  . LEU B 155 ? 1.7495 2.3668 0.7866 0.4075  0.1570  0.2301  596 LEU B CB  
3243 C CG  . LEU B 155 ? 1.7453 2.2613 0.7809 0.4114  0.1417  0.2797  596 LEU B CG  
3244 C CD1 . LEU B 155 ? 1.8233 2.3527 0.7574 0.4887  0.0983  0.2916  596 LEU B CD1 
3245 C CD2 . LEU B 155 ? 1.6014 2.0784 0.7637 0.3752  0.1095  0.2397  596 LEU B CD2 
3246 N N   . GLY B 173 ? 1.4927 1.3529 1.0520 0.1444  0.1810  0.3782  614 GLY B N   
3247 C CA  . GLY B 173 ? 1.3681 1.2954 0.9982 0.1102  0.1772  0.3213  614 GLY B CA  
3248 C C   . GLY B 173 ? 1.2769 1.2448 0.9447 0.1307  0.1302  0.2690  614 GLY B C   
3249 O O   . GLY B 173 ? 1.3177 1.2825 0.9630 0.1709  0.0999  0.2700  614 GLY B O   
3250 N N   . SER B 174 ? 1.1566 1.1620 0.8837 0.1038  0.1258  0.2230  615 SER B N   
3251 C CA  . SER B 174 ? 1.0620 1.1071 0.8197 0.1179  0.0909  0.1764  615 SER B CA  
3252 C C   . SER B 174 ? 1.0019 1.0168 0.8177 0.0984  0.0846  0.1505  615 SER B C   
3253 O O   . SER B 174 ? 0.9328 0.9585 0.7823 0.0734  0.0920  0.1270  615 SER B O   
3254 C CB  . SER B 174 ? 1.0355 1.1534 0.7908 0.1184  0.0864  0.1450  615 SER B CB  
3255 O OG  . SER B 174 ? 1.0718 1.2269 0.7709 0.1529  0.0756  0.1549  615 SER B OG  
3256 N N   . ILE B 175 ? 1.0050 0.9911 0.8280 0.1176  0.0675  0.1513  616 ILE B N   
3257 C CA  . ILE B 175 ? 0.9498 0.8905 0.8102 0.1072  0.0673  0.1415  616 ILE B CA  
3258 C C   . ILE B 175 ? 0.8617 0.8290 0.7571 0.1024  0.0549  0.1008  616 ILE B C   
3259 O O   . ILE B 175 ? 0.8619 0.8049 0.7822 0.0883  0.0595  0.0861  616 ILE B O   
3260 C CB  . ILE B 175 ? 1.0313 0.9334 0.8778 0.1378  0.0562  0.1627  616 ILE B CB  
3261 C CG1 . ILE B 175 ? 1.1368 0.9687 0.9600 0.1316  0.0777  0.2052  616 ILE B CG1 
3262 C CG2 . ILE B 175 ? 1.0178 0.9094 0.9043 0.1447  0.0440  0.1357  616 ILE B CG2 
3263 C CD1 . ILE B 175 ? 1.2211 1.0620 0.9938 0.1290  0.0972  0.2411  616 ILE B CD1 
3264 N N   . LEU B 176 ? 0.7934 0.8075 0.6883 0.1153  0.0400  0.0820  617 LEU B N   
3265 C CA  . LEU B 176 ? 0.7260 0.7524 0.6521 0.1104  0.0337  0.0500  617 LEU B CA  
3266 C C   . LEU B 176 ? 0.7129 0.7358 0.6440 0.0909  0.0419  0.0349  617 LEU B C   
3267 O O   . LEU B 176 ? 0.7268 0.7360 0.6717 0.0867  0.0432  0.0186  617 LEU B O   
3268 C CB  . LEU B 176 ? 0.6914 0.7651 0.6276 0.1241  0.0172  0.0285  617 LEU B CB  
3269 C CG  . LEU B 176 ? 0.7215 0.8157 0.6585 0.1520  0.0006  0.0324  617 LEU B CG  
3270 C CD1 . LEU B 176 ? 0.7228 0.8765 0.6819 0.1620  -0.0185 -0.0020 617 LEU B CD1 
3271 C CD2 . LEU B 176 ? 0.7168 0.7867 0.6815 0.1579  0.0026  0.0320  617 LEU B CD2 
3272 N N   . TRP B 177 ? 0.7265 0.7634 0.6439 0.0822  0.0487  0.0408  618 TRP B N   
3273 C CA  . TRP B 177 ? 0.7053 0.7502 0.6304 0.0710  0.0514  0.0213  618 TRP B CA  
3274 C C   . TRP B 177 ? 0.7256 0.7479 0.6639 0.0557  0.0614  0.0232  618 TRP B C   
3275 O O   . TRP B 177 ? 0.7180 0.7532 0.6663 0.0511  0.0593  0.0022  618 TRP B O   
3276 C CB  . TRP B 177 ? 0.7105 0.8028 0.6246 0.0730  0.0515  0.0136  618 TRP B CB  
3277 C CG  . TRP B 177 ? 0.6782 0.7944 0.5872 0.0883  0.0369  -0.0025 618 TRP B CG  
3278 C CD1 . TRP B 177 ? 0.6617 0.7781 0.5815 0.0925  0.0271  -0.0300 618 TRP B CD1 
3279 C CD2 . TRP B 177 ? 0.6954 0.8352 0.5904 0.1032  0.0284  0.0040  618 TRP B CD2 
3280 N NE1 . TRP B 177 ? 0.6792 0.8184 0.6032 0.1026  0.0148  -0.0454 618 TRP B NE1 
3281 C CE2 . TRP B 177 ? 0.6906 0.8523 0.5997 0.1115  0.0126  -0.0280 618 TRP B CE2 
3282 C CE3 . TRP B 177 ? 0.7383 0.8796 0.6074 0.1139  0.0311  0.0334  618 TRP B CE3 
3283 C CZ2 . TRP B 177 ? 0.7250 0.9242 0.6315 0.1291  -0.0039 -0.0404 618 TRP B CZ2 
3284 C CZ3 . TRP B 177 ? 0.7541 0.9298 0.6080 0.1384  0.0131  0.0271  618 TRP B CZ3 
3285 C CH2 . TRP B 177 ? 0.7435 0.9546 0.6200 0.1453  -0.0058 -0.0137 618 TRP B CH2 
3286 N N   . MET B 178 ? 0.7453 0.7343 0.6871 0.0505  0.0695  0.0435  619 MET B N   
3287 C CA  . MET B 178 ? 0.7515 0.7176 0.7165 0.0321  0.0789  0.0386  619 MET B CA  
3288 C C   . MET B 178 ? 0.7334 0.6761 0.7089 0.0382  0.0686  0.0147  619 MET B C   
3289 O O   . MET B 178 ? 0.7349 0.6539 0.7026 0.0525  0.0642  0.0182  619 MET B O   
3290 C CB  . MET B 178 ? 0.7882 0.7144 0.7529 0.0234  0.0940  0.0699  619 MET B CB  
3291 C CG  . MET B 178 ? 0.8410 0.7867 0.7824 0.0185  0.1104  0.0992  619 MET B CG  
3292 S SD  . MET B 178 ? 0.9497 0.8338 0.8854 0.0008  0.1403  0.1438  619 MET B SD  
3293 C CE  . MET B 178 ? 0.9992 0.8115 0.9566 0.0094  0.1273  0.1366  619 MET B CE  
3294 N N   . ALA B 179 ? 0.7185 0.6760 0.7114 0.0302  0.0649  -0.0125 620 ALA B N   
3295 C CA  . ALA B 179 ? 0.7154 0.6557 0.7102 0.0400  0.0540  -0.0386 620 ALA B CA  
3296 C C   . ALA B 179 ? 0.7535 0.6509 0.7659 0.0340  0.0591  -0.0357 620 ALA B C   
3297 O O   . ALA B 179 ? 0.7682 0.6448 0.7974 0.0174  0.0721  -0.0146 620 ALA B O   
3298 C CB  . ALA B 179 ? 0.7271 0.7016 0.7417 0.0363  0.0440  -0.0735 620 ALA B CB  
3299 N N   . PRO B 180 ? 0.7714 0.6504 0.7744 0.0507  0.0505  -0.0556 621 PRO B N   
3300 C CA  . PRO B 180 ? 0.7827 0.6208 0.8045 0.0504  0.0523  -0.0619 621 PRO B CA  
3301 C C   . PRO B 180 ? 0.8082 0.6336 0.8765 0.0240  0.0551  -0.0796 621 PRO B C   
3302 O O   . PRO B 180 ? 0.8589 0.6368 0.9473 0.0136  0.0651  -0.0647 621 PRO B O   
3303 C CB  . PRO B 180 ? 0.7991 0.6380 0.7965 0.0754  0.0426  -0.0894 621 PRO B CB  
3304 C CG  . PRO B 180 ? 0.7695 0.6292 0.7287 0.0888  0.0455  -0.0735 621 PRO B CG  
3305 C CD  . PRO B 180 ? 0.7545 0.6422 0.7197 0.0747  0.0437  -0.0647 621 PRO B CD  
3306 N N   . GLU B 181 ? 0.8053 0.6710 0.8951 0.0136  0.0467  -0.1127 622 GLU B N   
3307 C CA  . GLU B 181 ? 0.8264 0.6895 0.9787 -0.0185 0.0519  -0.1386 622 GLU B CA  
3308 C C   . GLU B 181 ? 0.8257 0.6756 1.0004 -0.0521 0.0806  -0.0993 622 GLU B C   
3309 O O   . GLU B 181 ? 0.8726 0.6847 1.0934 -0.0826 0.0974  -0.0999 622 GLU B O   
3310 C CB  . GLU B 181 ? 0.8219 0.7470 1.0015 -0.0181 0.0322  -0.1928 622 GLU B CB  
3311 C CG  . GLU B 181 ? 0.8203 0.8077 0.9986 -0.0209 0.0328  -0.1895 622 GLU B CG  
3312 C CD  . GLU B 181 ? 0.8101 0.8123 0.9201 0.0187  0.0176  -0.1781 622 GLU B CD  
3313 O OE1 . GLU B 181 ? 0.8292 0.7934 0.8913 0.0425  0.0145  -0.1625 622 GLU B OE1 
3314 O OE2 . GLU B 181 ? 0.8024 0.8537 0.9105 0.0251  0.0111  -0.1859 622 GLU B OE2 
3315 N N   . VAL B 182 ? 0.7950 0.6712 0.9335 -0.0456 0.0881  -0.0649 623 VAL B N   
3316 C CA  . VAL B 182 ? 0.8143 0.6825 0.9536 -0.0688 0.1168  -0.0225 623 VAL B CA  
3317 C C   . VAL B 182 ? 0.8562 0.6477 0.9709 -0.0617 0.1277  0.0209  623 VAL B C   
3318 O O   . VAL B 182 ? 0.9076 0.6531 1.0392 -0.0868 0.1535  0.0467  623 VAL B O   
3319 C CB  . VAL B 182 ? 0.7721 0.6947 0.8735 -0.0553 0.1165  -0.0054 623 VAL B CB  
3320 C CG1 . VAL B 182 ? 0.8129 0.7302 0.8989 -0.0712 0.1462  0.0397  623 VAL B CG1 
3321 C CG2 . VAL B 182 ? 0.7442 0.7381 0.8707 -0.0574 0.1050  -0.0478 623 VAL B CG2 
3322 N N   . ILE B 183 ? 0.8472 0.6240 0.9237 -0.0263 0.1096  0.0283  624 ILE B N   
3323 C CA  . ILE B 183 ? 0.9146 0.6288 0.9684 -0.0082 0.1124  0.0629  624 ILE B CA  
3324 C C   . ILE B 183 ? 0.9910 0.6329 1.0807 -0.0213 0.1192  0.0545  624 ILE B C   
3325 O O   . ILE B 183 ? 1.0930 0.6701 1.1767 -0.0274 0.1370  0.0924  624 ILE B O   
3326 C CB  . ILE B 183 ? 0.8904 0.6139 0.9187 0.0297  0.0912  0.0558  624 ILE B CB  
3327 C CG1 . ILE B 183 ? 0.8392 0.6237 0.8384 0.0417  0.0846  0.0620  624 ILE B CG1 
3328 C CG2 . ILE B 183 ? 0.9667 0.6303 0.9826 0.0528  0.0904  0.0829  624 ILE B CG2 
3329 C CD1 . ILE B 183 ? 0.8581 0.6468 0.8342 0.0731  0.0741  0.0774  624 ILE B CD1 
3330 N N   . ARG B 184 ? 0.9934 0.6414 1.1151 -0.0214 0.1041  0.0043  625 ARG B N   
3331 C CA  . ARG B 184 ? 1.0768 0.6613 1.2434 -0.0352 0.1067  -0.0191 625 ARG B CA  
3332 C C   . ARG B 184 ? 1.1913 0.7364 1.3992 -0.0820 0.1372  -0.0013 625 ARG B C   
3333 O O   . ARG B 184 ? 1.2692 0.7250 1.4898 -0.0901 0.1521  0.0202  625 ARG B O   
3334 C CB  . ARG B 184 ? 1.0285 0.6512 1.2244 -0.0322 0.0848  -0.0859 625 ARG B CB  
3335 C CG  . ARG B 184 ? 0.9853 0.6068 1.1512 0.0103  0.0644  -0.1063 625 ARG B CG  
3336 C CD  . ARG B 184 ? 0.9631 0.6311 1.1397 0.0177  0.0441  -0.1683 625 ARG B CD  
3337 N NE  . ARG B 184 ? 0.9210 0.6428 1.0424 0.0475  0.0348  -0.1664 625 ARG B NE  
3338 C CZ  . ARG B 184 ? 0.9128 0.6901 1.0187 0.0540  0.0216  -0.1941 625 ARG B CZ  
3339 N NH1 . ARG B 184 ? 0.9271 0.7317 1.0755 0.0344  0.0115  -0.2336 625 ARG B NH1 
3340 N NH2 . ARG B 184 ? 0.9043 0.7096 0.9536 0.0812  0.0193  -0.1823 625 ARG B NH2 
3341 N N   . MET B 185 ? 1.2349 0.8450 1.4651 -0.1121 0.1491  -0.0105 626 MET B N   
3342 C CA  . MET B 185 ? 1.3369 0.9274 1.6113 -0.1624 0.1866  0.0060  626 MET B CA  
3343 C C   . MET B 185 ? 1.4246 0.9547 1.7750 -0.1936 0.1921  -0.0329 626 MET B C   
3344 O O   . MET B 185 ? 1.5332 0.9658 1.8943 -0.2127 0.2192  0.0013  626 MET B O   
3345 C CB  . MET B 185 ? 1.4275 0.9618 1.6445 -0.1585 0.2164  0.0847  626 MET B CB  
3346 C CG  . MET B 185 ? 1.5366 1.0847 1.7744 -0.2058 0.2625  0.1126  626 MET B CG  
3347 S SD  . MET B 185 ? 1.5142 1.2030 1.7510 -0.2099 0.2599  0.0901  626 MET B SD  
3348 C CE  . MET B 185 ? 1.5906 1.2763 1.8531 -0.2673 0.3266  0.1305  626 MET B CE  
3349 N N   . GLN B 186 ? 1.4110 0.9964 1.8098 -0.1940 0.1638  -0.1068 627 GLN B N   
3350 C CA  . GLN B 186 ? 1.5026 1.0537 1.9863 -0.2234 0.1610  -0.1653 627 GLN B CA  
3351 C C   . GLN B 186 ? 1.5190 1.1140 2.0933 -0.2852 0.1886  -0.1927 627 GLN B C   
3352 O O   . GLN B 186 ? 1.5763 1.1199 2.2336 -0.3294 0.2066  -0.2210 627 GLN B O   
3353 C CB  . GLN B 186 ? 1.4952 1.0970 1.9824 -0.1873 0.1133  -0.2392 627 GLN B CB  
3354 C CG  . GLN B 186 ? 1.4562 1.1787 1.9550 -0.1817 0.0902  -0.2875 627 GLN B CG  
3355 C CD  . GLN B 186 ? 1.3948 1.1693 1.8159 -0.1538 0.0895  -0.2406 627 GLN B CD  
3356 O OE1 . GLN B 186 ? 1.3499 1.1827 1.7876 -0.1755 0.1045  -0.2316 627 GLN B OE1 
3357 N NE2 . GLN B 186 ? 1.3260 1.0812 1.6682 -0.1070 0.0740  -0.2146 627 GLN B NE2 
3358 N N   . ASP B 187 ? 1.4678 1.1605 2.0325 -0.2886 0.1925  -0.1889 628 ASP B N   
3359 C CA  . ASP B 187 ? 1.4889 1.2565 2.1460 -0.3405 0.2136  -0.2282 628 ASP B CA  
3360 C C   . ASP B 187 ? 1.5034 1.2635 2.1507 -0.3775 0.2707  -0.1600 628 ASP B C   
3361 O O   . ASP B 187 ? 1.4636 1.1989 2.0157 -0.3478 0.2797  -0.0905 628 ASP B O   
3362 C CB  . ASP B 187 ? 1.3993 1.2956 2.0584 -0.3101 0.1720  -0.2867 628 ASP B CB  
3363 C CG  . ASP B 187 ? 1.4183 1.4033 2.1979 -0.3516 0.1711  -0.3665 628 ASP B CG  
3364 O OD1 . ASP B 187 ? 1.4765 1.4249 2.3446 -0.3908 0.1782  -0.4101 628 ASP B OD1 
3365 O OD2 . ASP B 187 ? 1.3598 1.4540 2.1513 -0.3433 0.1612  -0.3912 628 ASP B OD2 
3366 N N   . LYS B 188 ? 1.5310 1.3168 2.2792 -0.4423 0.3106  -0.1836 629 LYS B N   
3367 C CA  . LYS B 188 ? 1.5698 1.3845 2.3190 -0.4803 0.3685  -0.1332 629 LYS B CA  
3368 C C   . LYS B 188 ? 1.4466 1.3647 2.1247 -0.4349 0.3470  -0.1233 629 LYS B C   
3369 O O   . LYS B 188 ? 1.5063 1.4107 2.1068 -0.4246 0.3756  -0.0538 629 LYS B O   
3370 C CB  . LYS B 188 ? 1.6357 1.5059 2.5293 -0.5568 0.4072  -0.1880 629 LYS B CB  
3371 C CG  . LYS B 188 ? 1.6715 1.6110 2.5900 -0.6012 0.4697  -0.1573 629 LYS B CG  
3372 C CD  . LYS B 188 ? 1.7964 1.6212 2.6475 -0.6262 0.5392  -0.0515 629 LYS B CD  
3373 C CE  . LYS B 188 ? 1.7714 1.5901 2.4710 -0.5622 0.5279  0.0222  629 LYS B CE  
3374 N NZ  . LYS B 188 ? 1.8994 1.6573 2.5341 -0.5847 0.5998  0.1163  629 LYS B NZ  
3375 N N   . ASN B 189 ? 1.2969 1.3104 1.9943 -0.4022 0.2943  -0.1928 630 ASN B N   
3376 C CA  . ASN B 189 ? 1.1622 1.2632 1.7976 -0.3562 0.2694  -0.1908 630 ASN B CA  
3377 C C   . ASN B 189 ? 1.0599 1.1744 1.6440 -0.2931 0.2041  -0.2254 630 ASN B C   
3378 O O   . ASN B 189 ? 1.0132 1.1906 1.6490 -0.2831 0.1684  -0.2979 630 ASN B O   
3379 C CB  . ASN B 189 ? 1.1375 1.3660 1.8561 -0.3853 0.2858  -0.2381 630 ASN B CB  
3380 C CG  . ASN B 189 ? 1.0476 1.3708 1.7228 -0.3307 0.2446  -0.2633 630 ASN B CG  
3381 O OD1 . ASN B 189 ? 0.9949 1.3020 1.5749 -0.2942 0.2414  -0.2135 630 ASN B OD1 
3382 N ND2 . ASN B 189 ? 1.0095 1.4310 1.7568 -0.3222 0.2106  -0.3445 630 ASN B ND2 
3383 N N   . PRO B 190 ? 1.0187 1.0764 1.5001 -0.2494 0.1901  -0.1740 631 PRO B N   
3384 C CA  . PRO B 190 ? 0.9451 1.0062 1.3681 -0.1930 0.1403  -0.1934 631 PRO B CA  
3385 C C   . PRO B 190 ? 0.8708 0.9985 1.2424 -0.1556 0.1218  -0.1910 631 PRO B C   
3386 O O   . PRO B 190 ? 0.8342 0.9540 1.1470 -0.1101 0.0884  -0.1952 631 PRO B O   
3387 C CB  . PRO B 190 ? 0.9777 0.9394 1.3336 -0.1753 0.1449  -0.1378 631 PRO B CB  
3388 C CG  . PRO B 190 ? 1.0127 0.9493 1.3468 -0.1977 0.1874  -0.0748 631 PRO B CG  
3389 C CD  . PRO B 190 ? 1.0568 1.0360 1.4736 -0.2519 0.2232  -0.0938 631 PRO B CD  
3390 N N   . TYR B 191 ? 0.8363 1.0252 1.2299 -0.1751 0.1467  -0.1842 632 TYR B N   
3391 C CA  . TYR B 191 ? 0.7690 1.0144 1.1171 -0.1407 0.1325  -0.1815 632 TYR B CA  
3392 C C   . TYR B 191 ? 0.7433 1.0737 1.1328 -0.1204 0.0989  -0.2493 632 TYR B C   
3393 O O   . TYR B 191 ? 0.7505 1.1328 1.2261 -0.1483 0.1018  -0.2984 632 TYR B O   
3394 C CB  . TYR B 191 ? 0.7770 1.0533 1.1224 -0.1639 0.1744  -0.1456 632 TYR B CB  
3395 C CG  . TYR B 191 ? 0.7928 0.9910 1.0706 -0.1643 0.1981  -0.0753 632 TYR B CG  
3396 C CD1 . TYR B 191 ? 0.8552 1.0035 1.1489 -0.2051 0.2425  -0.0362 632 TYR B CD1 
3397 C CD2 . TYR B 191 ? 0.7531 0.9258 0.9525 -0.1222 0.1755  -0.0493 632 TYR B CD2 
3398 C CE1 . TYR B 191 ? 0.8891 0.9656 1.1114 -0.1947 0.2588  0.0284  632 TYR B CE1 
3399 C CE2 . TYR B 191 ? 0.7826 0.8970 0.9244 -0.1160 0.1902  0.0066  632 TYR B CE2 
3400 C CZ  . TYR B 191 ? 0.8633 0.9306 1.0113 -0.1477 0.2292  0.0460  632 TYR B CZ  
3401 O OH  . TYR B 191 ? 0.9334 0.9428 1.0146 -0.1309 0.2384  0.1019  632 TYR B OH  
3402 N N   . SER B 192 ? 0.7313 1.0738 1.0612 -0.0702 0.0665  -0.2534 633 SER B N   
3403 C CA  . SER B 192 ? 0.7497 1.1590 1.0966 -0.0348 0.0274  -0.3119 633 SER B CA  
3404 C C   . SER B 192 ? 0.7538 1.1714 1.0360 0.0098  0.0110  -0.2981 633 SER B C   
3405 O O   . SER B 192 ? 0.7537 1.1265 0.9838 0.0101  0.0278  -0.2491 633 SER B O   
3406 C CB  . SER B 192 ? 0.7780 1.1499 1.1035 -0.0079 -0.0077 -0.3374 633 SER B CB  
3407 O OG  . SER B 192 ? 0.8103 1.0940 1.0528 0.0115  -0.0080 -0.2888 633 SER B OG  
3408 N N   . PHE B 193 ? 0.7722 0.8425 0.9623 -0.0090 0.0009  -0.2299 634 PHE B N   
3409 C CA  . PHE B 193 ? 0.7679 0.8248 0.9271 0.0079  -0.0157 -0.2147 634 PHE B CA  
3410 C C   . PHE B 193 ? 0.7687 0.7907 0.8693 0.0126  -0.0201 -0.1818 634 PHE B C   
3411 O O   . PHE B 193 ? 0.8079 0.8090 0.8816 0.0150  -0.0186 -0.1608 634 PHE B O   
3412 C CB  . PHE B 193 ? 0.7792 0.8558 0.9530 0.0328  -0.0481 -0.2367 634 PHE B CB  
3413 C CG  . PHE B 193 ? 0.7830 0.8999 1.0207 0.0321  -0.0481 -0.2737 634 PHE B CG  
3414 C CD1 . PHE B 193 ? 0.7990 0.9500 1.0709 0.0472  -0.0728 -0.3074 634 PHE B CD1 
3415 C CD2 . PHE B 193 ? 0.7770 0.9019 1.0414 0.0180  -0.0244 -0.2775 634 PHE B CD2 
3416 C CE1 . PHE B 193 ? 0.7792 0.9726 1.1177 0.0468  -0.0732 -0.3455 634 PHE B CE1 
3417 C CE2 . PHE B 193 ? 0.7650 0.9300 1.0917 0.0168  -0.0217 -0.3135 634 PHE B CE2 
3418 C CZ  . PHE B 193 ? 0.7703 0.9703 1.1376 0.0305  -0.0460 -0.3481 634 PHE B CZ  
3419 N N   . GLN B 194 ? 0.7743 0.7924 0.8594 0.0134  -0.0244 -0.1805 635 GLN B N   
3420 C CA  . GLN B 194 ? 0.8084 0.7979 0.8413 0.0178  -0.0270 -0.1525 635 GLN B CA  
3421 C C   . GLN B 194 ? 0.7916 0.7616 0.8088 0.0003  -0.0021 -0.1289 635 GLN B C   
3422 O O   . GLN B 194 ? 0.7984 0.7468 0.7783 0.0026  -0.0019 -0.1058 635 GLN B O   
3423 C CB  . GLN B 194 ? 0.8471 0.8428 0.8664 0.0274  -0.0412 -0.1625 635 GLN B CB  
3424 C CG  . GLN B 194 ? 0.8863 0.8935 0.8955 0.0535  -0.0723 -0.1752 635 GLN B CG  
3425 C CD  . GLN B 194 ? 0.8930 0.9403 0.9504 0.0585  -0.0863 -0.2163 635 GLN B CD  
3426 O OE1 . GLN B 194 ? 0.8750 0.9421 0.9850 0.0417  -0.0712 -0.2365 635 GLN B OE1 
3427 N NE2 . GLN B 194 ? 0.9514 1.0124 0.9910 0.0822  -0.1148 -0.2300 635 GLN B NE2 
3428 N N   . SER B 195 ? 0.7631 0.7404 0.8078 -0.0161 0.0193  -0.1341 636 SER B N   
3429 C CA  . SER B 195 ? 0.7618 0.7213 0.7874 -0.0275 0.0395  -0.1102 636 SER B CA  
3430 C C   . SER B 195 ? 0.7556 0.7113 0.7707 -0.0264 0.0409  -0.0998 636 SER B C   
3431 O O   . SER B 195 ? 0.7416 0.6827 0.7296 -0.0275 0.0444  -0.0799 636 SER B O   
3432 C CB  . SER B 195 ? 0.7673 0.7288 0.8178 -0.0427 0.0634  -0.1140 636 SER B CB  
3433 O OG  . SER B 195 ? 0.7925 0.7719 0.8798 -0.0497 0.0733  -0.1318 636 SER B OG  
3434 N N   . ASP B 196 ? 0.7394 0.7114 0.7802 -0.0238 0.0372  -0.1171 637 ASP B N   
3435 C CA  . ASP B 196 ? 0.7258 0.6956 0.7602 -0.0203 0.0352  -0.1132 637 ASP B CA  
3436 C C   . ASP B 196 ? 0.7239 0.6731 0.7298 -0.0081 0.0172  -0.0999 637 ASP B C   
3437 O O   . ASP B 196 ? 0.7452 0.6821 0.7348 -0.0101 0.0203  -0.0873 637 ASP B O   
3438 C CB  . ASP B 196 ? 0.7208 0.7140 0.7928 -0.0172 0.0332  -0.1384 637 ASP B CB  
3439 C CG  . ASP B 196 ? 0.7301 0.7395 0.8239 -0.0324 0.0598  -0.1457 637 ASP B CG  
3440 O OD1 . ASP B 196 ? 0.7944 0.7934 0.8710 -0.0433 0.0785  -0.1290 637 ASP B OD1 
3441 O OD2 . ASP B 196 ? 0.6966 0.7287 0.8244 -0.0323 0.0633  -0.1678 637 ASP B OD2 
3442 N N   . VAL B 197 ? 0.7166 0.6617 0.7156 0.0043  -0.0004 -0.1027 638 VAL B N   
3443 C CA  . VAL B 197 ? 0.7637 0.6832 0.7300 0.0152  -0.0124 -0.0851 638 VAL B CA  
3444 C C   . VAL B 197 ? 0.7848 0.6866 0.7228 0.0049  0.0002  -0.0623 638 VAL B C   
3445 O O   . VAL B 197 ? 0.8080 0.6924 0.7333 0.0038  0.0021  -0.0496 638 VAL B O   
3446 C CB  . VAL B 197 ? 0.7618 0.6802 0.7155 0.0328  -0.0325 -0.0896 638 VAL B CB  
3447 C CG1 . VAL B 197 ? 0.7777 0.6643 0.6892 0.0419  -0.0380 -0.0652 638 VAL B CG1 
3448 C CG2 . VAL B 197 ? 0.7629 0.6987 0.7452 0.0478  -0.0501 -0.1121 638 VAL B CG2 
3449 N N   . TYR B 198 ? 0.7573 0.6644 0.6906 -0.0022 0.0090  -0.0599 639 TYR B N   
3450 C CA  . TYR B 198 ? 0.7262 0.6228 0.6402 -0.0108 0.0211  -0.0422 639 TYR B CA  
3451 C C   . TYR B 198 ? 0.7208 0.6187 0.6397 -0.0196 0.0315  -0.0365 639 TYR B C   
3452 O O   . TYR B 198 ? 0.7308 0.6182 0.6370 -0.0220 0.0336  -0.0249 639 TYR B O   
3453 C CB  . TYR B 198 ? 0.7065 0.6107 0.6245 -0.0163 0.0300  -0.0450 639 TYR B CB  
3454 C CG  . TYR B 198 ? 0.6998 0.5958 0.6006 -0.0214 0.0400  -0.0292 639 TYR B CG  
3455 C CD1 . TYR B 198 ? 0.7101 0.5981 0.5895 -0.0170 0.0375  -0.0231 639 TYR B CD1 
3456 C CD2 . TYR B 198 ? 0.7208 0.6195 0.6259 -0.0288 0.0518  -0.0216 639 TYR B CD2 
3457 C CE1 . TYR B 198 ? 0.7265 0.6111 0.5959 -0.0215 0.0479  -0.0117 639 TYR B CE1 
3458 C CE2 . TYR B 198 ? 0.7331 0.6288 0.6275 -0.0310 0.0587  -0.0099 639 TYR B CE2 
3459 C CZ  . TYR B 198 ? 0.7315 0.6209 0.6116 -0.0282 0.0574  -0.0061 639 TYR B CZ  
3460 O OH  . TYR B 198 ? 0.7216 0.6121 0.5970 -0.0302 0.0654  0.0023  639 TYR B OH  
3461 N N   . ALA B 199 ? 0.7054 0.6182 0.6430 -0.0245 0.0389  -0.0462 640 ALA B N   
3462 C CA  . ALA B 199 ? 0.7247 0.6430 0.6620 -0.0297 0.0466  -0.0436 640 ALA B CA  
3463 C C   . ALA B 199 ? 0.7581 0.6683 0.6957 -0.0260 0.0374  -0.0460 640 ALA B C   
3464 O O   . ALA B 199 ? 0.7838 0.6908 0.7145 -0.0298 0.0395  -0.0401 640 ALA B O   
3465 C CB  . ALA B 199 ? 0.7288 0.6634 0.6817 -0.0336 0.0573  -0.0541 640 ALA B CB  
3466 N N   . PHE B 200 ? 0.7462 0.6531 0.6954 -0.0178 0.0267  -0.0563 641 PHE B N   
3467 C CA  . PHE B 200 ? 0.7723 0.6627 0.7225 -0.0123 0.0180  -0.0566 641 PHE B CA  
3468 C C   . PHE B 200 ? 0.7975 0.6644 0.7274 -0.0142 0.0186  -0.0384 641 PHE B C   
3469 O O   . PHE B 200 ? 0.7892 0.6443 0.7226 -0.0181 0.0206  -0.0367 641 PHE B O   
3470 C CB  . PHE B 200 ? 0.7942 0.6797 0.7551 0.0018  0.0036  -0.0662 641 PHE B CB  
3471 C CG  . PHE B 200 ? 0.8050 0.6659 0.7670 0.0098  -0.0045 -0.0638 641 PHE B CG  
3472 C CD1 . PHE B 200 ? 0.8100 0.6758 0.7934 0.0079  -0.0025 -0.0781 641 PHE B CD1 
3473 C CD2 . PHE B 200 ? 0.8169 0.6476 0.7572 0.0195  -0.0123 -0.0471 641 PHE B CD2 
3474 C CE1 . PHE B 200 ? 0.8415 0.6805 0.8311 0.0148  -0.0088 -0.0775 641 PHE B CE1 
3475 C CE2 . PHE B 200 ? 0.8704 0.6708 0.8120 0.0268  -0.0168 -0.0418 641 PHE B CE2 
3476 C CZ  . PHE B 200 ? 0.8860 0.6895 0.8555 0.0240  -0.0153 -0.0578 641 PHE B CZ  
3477 N N   . GLY B 201 ? 0.7991 0.6604 0.7107 -0.0123 0.0186  -0.0275 642 GLY B N   
3478 C CA  . GLY B 201 ? 0.7973 0.6393 0.6884 -0.0148 0.0233  -0.0103 642 GLY B CA  
3479 C C   . GLY B 201 ? 0.7673 0.6176 0.6635 -0.0278 0.0350  -0.0071 642 GLY B C   
3480 O O   . GLY B 201 ? 0.7956 0.6315 0.6907 -0.0332 0.0404  0.0001  642 GLY B O   
3481 N N   . ILE B 202 ? 0.7190 0.5922 0.6219 -0.0320 0.0396  -0.0128 643 ILE B N   
3482 C CA  . ILE B 202 ? 0.7280 0.6141 0.6355 -0.0398 0.0467  -0.0118 643 ILE B CA  
3483 C C   . ILE B 202 ? 0.7407 0.6313 0.6636 -0.0431 0.0444  -0.0230 643 ILE B C   
3484 O O   . ILE B 202 ? 0.7512 0.6467 0.6821 -0.0496 0.0474  -0.0247 643 ILE B O   
3485 C CB  . ILE B 202 ? 0.7244 0.6300 0.6302 -0.0395 0.0514  -0.0123 643 ILE B CB  
3486 C CG1 . ILE B 202 ? 0.7489 0.6496 0.6453 -0.0375 0.0550  -0.0043 643 ILE B CG1 
3487 C CG2 . ILE B 202 ? 0.7014 0.6240 0.6101 -0.0423 0.0539  -0.0132 643 ILE B CG2 
3488 C CD1 . ILE B 202 ? 0.7746 0.6700 0.6639 -0.0398 0.0589  0.0044  643 ILE B CD1 
3489 N N   . VAL B 203 ? 0.7678 0.6596 0.6992 -0.0388 0.0393  -0.0343 644 VAL B N   
3490 C CA  . VAL B 203 ? 0.7701 0.6666 0.7181 -0.0409 0.0368  -0.0494 644 VAL B CA  
3491 C C   . VAL B 203 ? 0.7993 0.6682 0.7563 -0.0438 0.0360  -0.0464 644 VAL B C   
3492 O O   . VAL B 203 ? 0.8158 0.6873 0.7896 -0.0510 0.0378  -0.0564 644 VAL B O   
3493 C CB  . VAL B 203 ? 0.7629 0.6684 0.7202 -0.0347 0.0333  -0.0641 644 VAL B CB  
3494 C CG1 . VAL B 203 ? 0.7685 0.6772 0.7448 -0.0355 0.0304  -0.0832 644 VAL B CG1 
3495 C CG2 . VAL B 203 ? 0.7505 0.6806 0.6992 -0.0348 0.0402  -0.0653 644 VAL B CG2 
3496 N N   . LEU B 204 ? 0.8398 0.6817 0.7853 -0.0377 0.0338  -0.0329 645 LEU B N   
3497 C CA  . LEU B 204 ? 0.8663 0.6741 0.8122 -0.0400 0.0375  -0.0223 645 LEU B CA  
3498 C C   . LEU B 204 ? 0.8511 0.6614 0.7995 -0.0536 0.0498  -0.0158 645 LEU B C   
3499 O O   . LEU B 204 ? 0.8833 0.6748 0.8475 -0.0623 0.0574  -0.0158 645 LEU B O   
3500 C CB  . LEU B 204 ? 0.8941 0.6745 0.8146 -0.0278 0.0331  -0.0045 645 LEU B CB  
3501 C CG  . LEU B 204 ? 0.9426 0.7078 0.8665 -0.0118 0.0198  -0.0096 645 LEU B CG  
3502 C CD1 . LEU B 204 ? 0.9910 0.7363 0.8834 0.0032  0.0127  0.0076  645 LEU B CD1 
3503 C CD2 . LEU B 204 ? 0.9853 0.7231 0.9301 -0.0129 0.0212  -0.0140 645 LEU B CD2 
3504 N N   . TYR B 205 ? 0.8028 0.6356 0.7399 -0.0555 0.0528  -0.0113 646 TYR B N   
3505 C CA  . TYR B 205 ? 0.8146 0.6578 0.7596 -0.0666 0.0633  -0.0091 646 TYR B CA  
3506 C C   . TYR B 205 ? 0.7998 0.6674 0.7744 -0.0744 0.0618  -0.0297 646 TYR B C   
3507 O O   . TYR B 205 ? 0.8435 0.7095 0.8406 -0.0860 0.0698  -0.0349 646 TYR B O   
3508 C CB  . TYR B 205 ? 0.8152 0.6781 0.7446 -0.0634 0.0648  -0.0024 646 TYR B CB  
3509 C CG  . TYR B 205 ? 0.8375 0.7143 0.7773 -0.0722 0.0749  -0.0013 646 TYR B CG  
3510 C CD1 . TYR B 205 ? 0.8668 0.7266 0.7963 -0.0765 0.0876  0.0123  646 TYR B CD1 
3511 C CD2 . TYR B 205 ? 0.8430 0.7528 0.8022 -0.0745 0.0718  -0.0150 646 TYR B CD2 
3512 C CE1 . TYR B 205 ? 0.8745 0.7514 0.8193 -0.0851 0.0989  0.0103  646 TYR B CE1 
3513 C CE2 . TYR B 205 ? 0.8551 0.7831 0.8299 -0.0806 0.0792  -0.0174 646 TYR B CE2 
3514 C CZ  . TYR B 205 ? 0.8656 0.7778 0.8365 -0.0870 0.0937  -0.0056 646 TYR B CZ  
3515 O OH  . TYR B 205 ? 0.8851 0.8195 0.8773 -0.0937 0.1029  -0.0110 646 TYR B OH  
3516 N N   . GLU B 206 ? 0.7873 0.6791 0.7627 -0.0683 0.0524  -0.0432 647 GLU B N   
3517 C CA  . GLU B 206 ? 0.7742 0.6942 0.7717 -0.0724 0.0481  -0.0655 647 GLU B CA  
3518 C C   . GLU B 206 ? 0.7669 0.6690 0.7930 -0.0803 0.0495  -0.0799 647 GLU B C   
3519 O O   . GLU B 206 ? 0.7716 0.6869 0.8259 -0.0903 0.0517  -0.0960 647 GLU B O   
3520 C CB  . GLU B 206 ? 0.7808 0.7258 0.7660 -0.0627 0.0402  -0.0755 647 GLU B CB  
3521 C CG  . GLU B 206 ? 0.7916 0.7468 0.7503 -0.0548 0.0415  -0.0603 647 GLU B CG  
3522 C CD  . GLU B 206 ? 0.8245 0.8010 0.7700 -0.0468 0.0389  -0.0680 647 GLU B CD  
3523 O OE1 . GLU B 206 ? 0.8321 0.8358 0.7795 -0.0446 0.0341  -0.0826 647 GLU B OE1 
3524 O OE2 . GLU B 206 ? 0.7757 0.7439 0.7094 -0.0428 0.0425  -0.0610 647 GLU B OE2 
3525 N N   . LEU B 207 ? 0.7682 0.6404 0.7908 -0.0750 0.0478  -0.0761 648 LEU B N   
3526 C CA  . LEU B 207 ? 0.7848 0.6342 0.8359 -0.0801 0.0490  -0.0898 648 LEU B CA  
3527 C C   . LEU B 207 ? 0.8029 0.6259 0.8715 -0.0940 0.0629  -0.0812 648 LEU B C   
3528 O O   . LEU B 207 ? 0.7920 0.6144 0.8973 -0.1059 0.0675  -0.1005 648 LEU B O   
3529 C CB  . LEU B 207 ? 0.7985 0.6165 0.8405 -0.0679 0.0439  -0.0829 648 LEU B CB  
3530 C CG  . LEU B 207 ? 0.7895 0.6326 0.8277 -0.0566 0.0335  -0.0985 648 LEU B CG  
3531 C CD1 . LEU B 207 ? 0.8209 0.6374 0.8513 -0.0427 0.0274  -0.0898 648 LEU B CD1 
3532 C CD2 . LEU B 207 ? 0.7927 0.6564 0.8592 -0.0602 0.0304  -0.1307 648 LEU B CD2 
3533 N N   . MET B 208 ? 0.8397 0.6430 0.8827 -0.0932 0.0712  -0.0539 649 MET B N   
3534 C CA  . MET B 208 ? 0.8952 0.6627 0.9443 -0.1044 0.0889  -0.0380 649 MET B CA  
3535 C C   . MET B 208 ? 0.8646 0.6604 0.9357 -0.1203 0.1005  -0.0453 649 MET B C   
3536 O O   . MET B 208 ? 0.9037 0.6768 0.9920 -0.1347 0.1196  -0.0386 649 MET B O   
3537 C CB  . MET B 208 ? 0.9763 0.7127 0.9807 -0.0927 0.0916  -0.0062 649 MET B CB  
3538 C CG  . MET B 208 ? 1.0831 0.7615 1.0769 -0.0880 0.0989  0.0132  649 MET B CG  
3539 S SD  . MET B 208 ? 1.2284 0.8791 1.2499 -0.0810 0.0890  -0.0023 649 MET B SD  
3540 C CE  . MET B 208 ? 1.1840 0.8821 1.2038 -0.0665 0.0646  -0.0257 649 MET B CE  
3541 N N   . THR B 209 ? 0.8142 0.6587 0.8858 -0.1169 0.0900  -0.0589 650 THR B N   
3542 C CA  . THR B 209 ? 0.8005 0.6798 0.8971 -0.1279 0.0964  -0.0700 650 THR B CA  
3543 C C   . THR B 209 ? 0.7832 0.7103 0.9109 -0.1286 0.0825  -0.1039 650 THR B C   
3544 O O   . THR B 209 ? 0.7718 0.7294 0.9339 -0.1386 0.0858  -0.1216 650 THR B O   
3545 C CB  . THR B 209 ? 0.7877 0.6851 0.8543 -0.1192 0.0957  -0.0539 650 THR B CB  
3546 O OG1 . THR B 209 ? 0.8033 0.7252 0.8489 -0.1037 0.0780  -0.0581 650 THR B OG1 
3547 C CG2 . THR B 209 ? 0.8134 0.6713 0.8442 -0.1157 0.1069  -0.0239 650 THR B CG2 
3548 N N   . GLY B 210 ? 0.8049 0.7424 0.9197 -0.1167 0.0668  -0.1145 651 GLY B N   
3549 C CA  . GLY B 210 ? 0.8047 0.7902 0.9348 -0.1123 0.0517  -0.1447 651 GLY B CA  
3550 C C   . GLY B 210 ? 0.8005 0.8239 0.9076 -0.1000 0.0429  -0.1391 651 GLY B C   
3551 O O   . GLY B 210 ? 0.8467 0.9128 0.9595 -0.0928 0.0294  -0.1608 651 GLY B O   
3552 N N   . GLN B 211 ? 0.7763 0.7837 0.8554 -0.0955 0.0498  -0.1106 652 GLN B N   
3553 C CA  . GLN B 211 ? 0.7624 0.7990 0.8263 -0.0847 0.0445  -0.1040 652 GLN B CA  
3554 C C   . GLN B 211 ? 0.7456 0.7668 0.7664 -0.0717 0.0436  -0.0802 652 GLN B C   
3555 O O   . GLN B 211 ? 0.7329 0.7208 0.7383 -0.0730 0.0491  -0.0666 652 GLN B O   
3556 C CB  . GLN B 211 ? 0.7787 0.8175 0.8636 -0.0944 0.0567  -0.0989 652 GLN B CB  
3557 C CG  . GLN B 211 ? 0.7984 0.8623 0.9355 -0.1084 0.0587  -0.1269 652 GLN B CG  
3558 C CD  . GLN B 211 ? 0.8020 0.8741 0.9640 -0.1185 0.0736  -0.1241 652 GLN B CD  
3559 O OE1 . GLN B 211 ? 0.7911 0.8849 0.9431 -0.1075 0.0700  -0.1174 652 GLN B OE1 
3560 N NE2 . GLN B 211 ? 0.8631 0.9167 1.0596 -0.1395 0.0924  -0.1294 652 GLN B NE2 
3561 N N   . LEU B 212 ? 0.7473 0.7935 0.7512 -0.0582 0.0362  -0.0767 653 LEU B N   
3562 C CA  . LEU B 212 ? 0.7774 0.8085 0.7482 -0.0481 0.0391  -0.0545 653 LEU B CA  
3563 C C   . LEU B 212 ? 0.7799 0.7986 0.7536 -0.0516 0.0488  -0.0406 653 LEU B C   
3564 O O   . LEU B 212 ? 0.7820 0.8188 0.7791 -0.0556 0.0506  -0.0481 653 LEU B O   
3565 C CB  . LEU B 212 ? 0.8012 0.8574 0.7518 -0.0313 0.0303  -0.0527 653 LEU B CB  
3566 C CG  . LEU B 212 ? 0.8437 0.9170 0.7802 -0.0239 0.0219  -0.0649 653 LEU B CG  
3567 C CD1 . LEU B 212 ? 0.8568 0.9572 0.7705 -0.0048 0.0128  -0.0617 653 LEU B CD1 
3568 C CD2 . LEU B 212 ? 0.8897 0.9372 0.8071 -0.0256 0.0298  -0.0556 653 LEU B CD2 
3569 N N   . PRO B 213 ? 0.7914 0.7834 0.7438 -0.0497 0.0553  -0.0236 654 PRO B N   
3570 C CA  . PRO B 213 ? 0.8013 0.7840 0.7521 -0.0510 0.0644  -0.0127 654 PRO B CA  
3571 C C   . PRO B 213 ? 0.7832 0.7874 0.7360 -0.0403 0.0624  -0.0109 654 PRO B C   
3572 O O   . PRO B 213 ? 0.7651 0.7842 0.7100 -0.0286 0.0536  -0.0116 654 PRO B O   
3573 C CB  . PRO B 213 ? 0.8034 0.7587 0.7310 -0.0486 0.0673  -0.0010 654 PRO B CB  
3574 C CG  . PRO B 213 ? 0.7996 0.7581 0.7178 -0.0424 0.0607  -0.0032 654 PRO B CG  
3575 C CD  . PRO B 213 ? 0.7971 0.7728 0.7285 -0.0451 0.0541  -0.0174 654 PRO B CD  
3576 N N   . TYR B 214 ? 0.7410 0.7460 0.7030 -0.0428 0.0711  -0.0082 655 TYR B N   
3577 C CA  . TYR B 214 ? 0.7236 0.7457 0.6913 -0.0311 0.0702  -0.0069 655 TYR B CA  
3578 C C   . TYR B 214 ? 0.7209 0.7802 0.7086 -0.0219 0.0583  -0.0193 655 TYR B C   
3579 O O   . TYR B 214 ? 0.7438 0.8146 0.7279 -0.0052 0.0519  -0.0153 655 TYR B O   
3580 C CB  . TYR B 214 ? 0.7085 0.7122 0.6520 -0.0194 0.0695  0.0061  655 TYR B CB  
3581 C CG  . TYR B 214 ? 0.7174 0.6915 0.6434 -0.0262 0.0758  0.0126  655 TYR B CG  
3582 C CD1 . TYR B 214 ? 0.7379 0.7002 0.6626 -0.0355 0.0841  0.0125  655 TYR B CD1 
3583 C CD2 . TYR B 214 ? 0.7293 0.6889 0.6397 -0.0224 0.0737  0.0181  655 TYR B CD2 
3584 C CE1 . TYR B 214 ? 0.7425 0.6818 0.6493 -0.0377 0.0856  0.0165  655 TYR B CE1 
3585 C CE2 . TYR B 214 ? 0.7420 0.6811 0.6429 -0.0274 0.0768  0.0193  655 TYR B CE2 
3586 C CZ  . TYR B 214 ? 0.7573 0.6874 0.6556 -0.0334 0.0805  0.0179  655 TYR B CZ  
3587 O OH  . TYR B 214 ? 0.7808 0.6945 0.6678 -0.0345 0.0796  0.0171  655 TYR B OH  
3588 N N   . SER B 215 ? 0.7189 0.7976 0.7297 -0.0314 0.0546  -0.0357 656 SER B N   
3589 C CA  . SER B 215 ? 0.7523 0.8727 0.7831 -0.0210 0.0393  -0.0528 656 SER B CA  
3590 C C   . SER B 215 ? 0.7172 0.8669 0.7752 -0.0123 0.0385  -0.0599 656 SER B C   
3591 O O   . SER B 215 ? 0.6936 0.8785 0.7617 0.0044  0.0218  -0.0709 656 SER B O   
3592 C CB  . SER B 215 ? 0.7884 0.9253 0.8463 -0.0351 0.0359  -0.0752 656 SER B CB  
3593 O OG  . SER B 215 ? 0.8284 0.9607 0.9191 -0.0556 0.0523  -0.0823 656 SER B OG  
3594 N N   . ASN B 216 ? 0.7188 0.8565 0.7872 -0.0213 0.0555  -0.0548 657 ASN B N   
3595 C CA  . ASN B 216 ? 0.7224 0.8882 0.8196 -0.0129 0.0575  -0.0631 657 ASN B CA  
3596 C C   . ASN B 216 ? 0.7314 0.8904 0.8086 0.0113  0.0509  -0.0490 657 ASN B C   
3597 O O   . ASN B 216 ? 0.7030 0.8827 0.8044 0.0210  0.0522  -0.0558 657 ASN B O   
3598 C CB  . ASN B 216 ? 0.7103 0.8697 0.8281 -0.0327 0.0818  -0.0658 657 ASN B CB  
3599 C CG  . ASN B 216 ? 0.7450 0.8579 0.8242 -0.0396 0.0966  -0.0449 657 ASN B CG  
3600 O OD1 . ASN B 216 ? 0.7906 0.8754 0.8356 -0.0360 0.0900  -0.0315 657 ASN B OD1 
3601 N ND2 . ASN B 216 ? 0.7714 0.8796 0.8569 -0.0494 0.1169  -0.0442 657 ASN B ND2 
3602 N N   . ILE B 217 ? 0.7462 0.8758 0.7834 0.0208  0.0455  -0.0306 658 ILE B N   
3603 C CA  . ILE B 217 ? 0.7689 0.8800 0.7865 0.0405  0.0442  -0.0144 658 ILE B CA  
3604 C C   . ILE B 217 ? 0.7802 0.8923 0.7713 0.0609  0.0281  -0.0043 658 ILE B C   
3605 O O   . ILE B 217 ? 0.8087 0.9048 0.7740 0.0551  0.0277  0.0025  658 ILE B O   
3606 C CB  . ILE B 217 ? 0.7870 0.8543 0.7811 0.0303  0.0596  0.0000  658 ILE B CB  
3607 C CG1 . ILE B 217 ? 0.7854 0.8522 0.7961 0.0136  0.0755  -0.0084 658 ILE B CG1 
3608 C CG2 . ILE B 217 ? 0.7879 0.8320 0.7679 0.0483  0.0606  0.0145  658 ILE B CG2 
3609 C CD1 . ILE B 217 ? 0.7951 0.8260 0.7821 0.0043  0.0873  0.0006  658 ILE B CD1 
3610 N N   . ASN B 218 ? 0.8008 0.9309 0.7962 0.0866  0.0155  -0.0027 659 ASN B N   
3611 C CA  . ASN B 218 ? 0.8219 0.9549 0.7856 0.1104  -0.0002 0.0088  659 ASN B CA  
3612 C C   . ASN B 218 ? 0.8591 0.9461 0.7862 0.1250  0.0077  0.0385  659 ASN B C   
3613 O O   . ASN B 218 ? 0.9402 1.0251 0.8368 0.1484  -0.0024 0.0531  659 ASN B O   
3614 C CB  . ASN B 218 ? 0.8333 1.0144 0.8187 0.1350  -0.0222 -0.0059 659 ASN B CB  
3615 C CG  . ASN B 218 ? 0.8633 1.0415 0.8665 0.1546  -0.0218 -0.0006 659 ASN B CG  
3616 O OD1 . ASN B 218 ? 0.9193 1.0533 0.9037 0.1591  -0.0090 0.0210  659 ASN B OD1 
3617 N ND2 . ASN B 218 ? 0.8694 1.0960 0.9142 0.1660  -0.0352 -0.0234 659 ASN B ND2 
3618 N N   . ASN B 219 ? 0.8334 0.8837 0.7632 0.1119  0.0265  0.0467  660 ASN B N   
3619 C CA  . ASN B 219 ? 0.8392 0.8449 0.7468 0.1231  0.0371  0.0707  660 ASN B CA  
3620 C C   . ASN B 219 ? 0.8265 0.7966 0.7176 0.1019  0.0542  0.0786  660 ASN B C   
3621 O O   . ASN B 219 ? 0.8142 0.7765 0.7214 0.0823  0.0642  0.0684  660 ASN B O   
3622 C CB  . ASN B 219 ? 0.8567 0.8528 0.7913 0.1307  0.0433  0.0682  660 ASN B CB  
3623 C CG  . ASN B 219 ? 0.9131 0.8616 0.8318 0.1452  0.0538  0.0914  660 ASN B CG  
3624 O OD1 . ASN B 219 ? 0.9482 0.8606 0.8584 0.1298  0.0706  0.0987  660 ASN B OD1 
3625 N ND2 . ASN B 219 ? 0.9551 0.9032 0.8730 0.1757  0.0441  0.1020  660 ASN B ND2 
3626 N N   . ARG B 220 ? 0.9071 0.8563 0.7654 0.1076  0.0582  0.0968  661 ARG B N   
3627 C CA  . ARG B 220 ? 0.9251 0.8481 0.7726 0.0871  0.0739  0.1006  661 ARG B CA  
3628 C C   . ARG B 220 ? 0.9327 0.8200 0.7968 0.0768  0.0914  0.1024  661 ARG B C   
3629 O O   . ARG B 220 ? 0.9183 0.7991 0.7914 0.0563  0.0991  0.0918  661 ARG B O   
3630 C CB  . ARG B 220 ? 0.9674 0.8772 0.7766 0.0969  0.0781  0.1201  661 ARG B CB  
3631 C CG  . ARG B 220 ? 0.9716 0.8811 0.7714 0.0770  0.0861  0.1143  661 ARG B CG  
3632 C CD  . ARG B 220 ? 1.0400 0.9350 0.8003 0.0870  0.0955  0.1347  661 ARG B CD  
3633 N NE  . ARG B 220 ? 1.0875 0.9384 0.8480 0.0796  0.1208  0.1510  661 ARG B NE  
3634 C CZ  . ARG B 220 ? 1.0763 0.9144 0.8367 0.0614  0.1385  0.1494  661 ARG B CZ  
3635 N NH1 . ARG B 220 ? 1.0547 0.9189 0.8111 0.0507  0.1334  0.1341  661 ARG B NH1 
3636 N NH2 . ARG B 220 ? 1.0856 0.8851 0.8550 0.0539  0.1624  0.1611  661 ARG B NH2 
3637 N N   . ASP B 221 ? 0.9628 0.8280 0.8323 0.0928  0.0962  0.1138  662 ASP B N   
3638 C CA  . ASP B 221 ? 0.9708 0.8017 0.8597 0.0842  0.1130  0.1123  662 ASP B CA  
3639 C C   . ASP B 221 ? 0.9235 0.7713 0.8402 0.0716  0.1107  0.0878  662 ASP B C   
3640 O O   . ASP B 221 ? 0.9021 0.7333 0.8325 0.0576  0.1214  0.0774  662 ASP B O   
3641 C CB  . ASP B 221 ? 1.0347 0.8343 0.9249 0.1065  0.1191  0.1301  662 ASP B CB  
3642 C CG  . ASP B 221 ? 1.1125 0.8793 0.9703 0.1169  0.1300  0.1597  662 ASP B CG  
3643 O OD1 . ASP B 221 ? 1.1086 0.8718 0.9502 0.1013  0.1392  0.1630  662 ASP B OD1 
3644 O OD2 . ASP B 221 ? 1.1528 0.8965 1.0007 0.1419  0.1306  0.1804  662 ASP B OD2 
3645 N N   . GLN B 222 ? 0.8910 0.7739 0.8162 0.0769  0.0976  0.0773  663 GLN B N   
3646 C CA  . GLN B 222 ? 0.8669 0.7673 0.8128 0.0653  0.0985  0.0565  663 GLN B CA  
3647 C C   . GLN B 222 ? 0.8306 0.7394 0.7687 0.0435  0.0989  0.0471  663 GLN B C   
3648 O O   . GLN B 222 ? 0.8263 0.7312 0.7705 0.0319  0.1049  0.0349  663 GLN B O   
3649 C CB  . GLN B 222 ? 0.8755 0.8112 0.8376 0.0764  0.0883  0.0480  663 GLN B CB  
3650 C CG  . GLN B 222 ? 0.9252 0.8542 0.9049 0.0984  0.0886  0.0501  663 GLN B CG  
3651 C CD  . GLN B 222 ? 0.9410 0.8608 0.9422 0.0927  0.1008  0.0346  663 GLN B CD  
3652 O OE1 . GLN B 222 ? 0.9468 0.8366 0.9561 0.1025  0.1081  0.0384  663 GLN B OE1 
3653 N NE2 . GLN B 222 ? 0.9439 0.8885 0.9536 0.0776  0.1042  0.0166  663 GLN B NE2 
3654 N N   . ILE B 223 ? 0.8009 0.7209 0.7241 0.0400  0.0918  0.0519  664 ILE B N   
3655 C CA  . ILE B 223 ? 0.7928 0.7153 0.7095 0.0221  0.0919  0.0444  664 ILE B CA  
3656 C C   . ILE B 223 ? 0.7821 0.6775 0.6959 0.0142  0.1013  0.0449  664 ILE B C   
3657 O O   . ILE B 223 ? 0.7360 0.6293 0.6525 0.0030  0.1028  0.0337  664 ILE B O   
3658 C CB  . ILE B 223 ? 0.8052 0.7426 0.7094 0.0208  0.0833  0.0471  664 ILE B CB  
3659 C CG1 . ILE B 223 ? 0.8058 0.7756 0.7215 0.0258  0.0730  0.0394  664 ILE B CG1 
3660 C CG2 . ILE B 223 ? 0.7931 0.7266 0.6928 0.0043  0.0841  0.0400  664 ILE B CG2 
3661 C CD1 . ILE B 223 ? 0.8299 0.8186 0.7352 0.0301  0.0620  0.0390  664 ILE B CD1 
3662 N N   . ILE B 224 ? 0.7764 0.6517 0.6849 0.0207  0.1081  0.0576  665 ILE B N   
3663 C CA  . ILE B 224 ? 0.7944 0.6454 0.7093 0.0115  0.1200  0.0553  665 ILE B CA  
3664 C C   . ILE B 224 ? 0.7933 0.6382 0.7276 0.0075  0.1235  0.0393  665 ILE B C   
3665 O O   . ILE B 224 ? 0.7705 0.6170 0.7103 -0.0036 0.1232  0.0244  665 ILE B O   
3666 C CB  . ILE B 224 ? 0.8038 0.6282 0.7127 0.0192  0.1325  0.0740  665 ILE B CB  
3667 C CG1 . ILE B 224 ? 0.8153 0.6483 0.6994 0.0204  0.1307  0.0858  665 ILE B CG1 
3668 C CG2 . ILE B 224 ? 0.7981 0.5962 0.7268 0.0077  0.1486  0.0673  665 ILE B CG2 
3669 C CD1 . ILE B 224 ? 0.8449 0.6524 0.7110 0.0304  0.1446  0.1093  665 ILE B CD1 
3670 N N   . PHE B 225 ? 0.8121 0.6534 0.7560 0.0189  0.1251  0.0402  666 PHE B N   
3671 C CA  . PHE B 225 ? 0.8098 0.6450 0.7725 0.0172  0.1301  0.0229  666 PHE B CA  
3672 C C   . PHE B 225 ? 0.7998 0.6573 0.7568 0.0085  0.1235  0.0059  666 PHE B C   
3673 O O   . PHE B 225 ? 0.8227 0.6772 0.7840 0.0009  0.1247  -0.0102 666 PHE B O   
3674 C CB  . PHE B 225 ? 0.7910 0.6226 0.7662 0.0333  0.1321  0.0256  666 PHE B CB  
3675 C CG  . PHE B 225 ? 0.7891 0.6163 0.7846 0.0327  0.1381  0.0046  666 PHE B CG  
3676 C CD1 . PHE B 225 ? 0.8341 0.6353 0.8475 0.0269  0.1481  -0.0054 666 PHE B CD1 
3677 C CD2 . PHE B 225 ? 0.7905 0.6416 0.7900 0.0373  0.1352  -0.0079 666 PHE B CD2 
3678 C CE1 . PHE B 225 ? 0.8499 0.6498 0.8836 0.0271  0.1525  -0.0298 666 PHE B CE1 
3679 C CE2 . PHE B 225 ? 0.7889 0.6388 0.8043 0.0380  0.1414  -0.0298 666 PHE B CE2 
3680 C CZ  . PHE B 225 ? 0.8350 0.6597 0.8669 0.0336  0.1486  -0.0418 666 PHE B CZ  
3681 N N   . MET B 226 ? 0.8081 0.6879 0.7549 0.0101  0.1169  0.0095  667 MET B N   
3682 C CA  . MET B 226 ? 0.8219 0.7184 0.7602 0.0037  0.1150  -0.0018 667 MET B CA  
3683 C C   . MET B 226 ? 0.7826 0.6789 0.7041 -0.0067 0.1094  -0.0038 667 MET B C   
3684 O O   . MET B 226 ? 0.7980 0.6973 0.7088 -0.0097 0.1087  -0.0143 667 MET B O   
3685 C CB  . MET B 226 ? 0.8477 0.7664 0.7872 0.0064  0.1136  0.0023  667 MET B CB  
3686 C CG  . MET B 226 ? 0.8797 0.8053 0.8391 0.0197  0.1164  0.0014  667 MET B CG  
3687 S SD  . MET B 226 ? 0.9324 0.8923 0.9012 0.0204  0.1127  0.0019  667 MET B SD  
3688 C CE  . MET B 226 ? 0.9356 0.9078 0.9041 0.0114  0.1257  -0.0127 667 MET B CE  
3689 N N   . VAL B 227 ? 0.7702 0.6638 0.6875 -0.0099 0.1049  0.0055  668 VAL B N   
3690 C CA  . VAL B 227 ? 0.7632 0.6555 0.6699 -0.0173 0.0989  0.0017  668 VAL B CA  
3691 C C   . VAL B 227 ? 0.7716 0.6544 0.6873 -0.0190 0.1000  -0.0121 668 VAL B C   
3692 O O   . VAL B 227 ? 0.7843 0.6710 0.6914 -0.0204 0.0936  -0.0233 668 VAL B O   
3693 C CB  . VAL B 227 ? 0.7568 0.6500 0.6610 -0.0199 0.0952  0.0109  668 VAL B CB  
3694 C CG1 . VAL B 227 ? 0.7713 0.6631 0.6703 -0.0254 0.0887  0.0042  668 VAL B CG1 
3695 C CG2 . VAL B 227 ? 0.7378 0.6448 0.6379 -0.0190 0.0918  0.0182  668 VAL B CG2 
3696 N N   . GLY B 228 ? 0.7874 0.6575 0.7213 -0.0179 0.1083  -0.0121 669 GLY B N   
3697 C CA  . GLY B 228 ? 0.8025 0.6641 0.7558 -0.0218 0.1121  -0.0297 669 GLY B CA  
3698 C C   . GLY B 228 ? 0.7879 0.6574 0.7404 -0.0190 0.1085  -0.0495 669 GLY B C   
3699 O O   . GLY B 228 ? 0.7821 0.6576 0.7401 -0.0214 0.1024  -0.0696 669 GLY B O   
3700 N N   . ARG B 229 ? 0.7884 0.6616 0.7336 -0.0126 0.1116  -0.0459 670 ARG B N   
3701 C CA  . ARG B 229 ? 0.8033 0.6852 0.7451 -0.0086 0.1117  -0.0645 670 ARG B CA  
3702 C C   . ARG B 229 ? 0.7732 0.6706 0.6812 -0.0075 0.1043  -0.0647 670 ARG B C   
3703 O O   . ARG B 229 ? 0.8042 0.7107 0.6996 -0.0033 0.1040  -0.0802 670 ARG B O   
3704 C CB  . ARG B 229 ? 0.8521 0.7316 0.8059 -0.0013 0.1214  -0.0616 670 ARG B CB  
3705 C CG  . ARG B 229 ? 0.9019 0.7600 0.8881 0.0011  0.1303  -0.0668 670 ARG B CG  
3706 C CD  . ARG B 229 ? 0.9730 0.8317 0.9749 0.0004  0.1319  -0.0978 670 ARG B CD  
3707 N NE  . ARG B 229 ? 1.0654 0.9004 1.1038 0.0028  0.1432  -0.1063 670 ARG B NE  
3708 C CZ  . ARG B 229 ? 1.0846 0.9155 1.1376 0.0127  0.1502  -0.1135 670 ARG B CZ  
3709 N NH1 . ARG B 229 ? 1.0721 0.9253 1.1077 0.0202  0.1484  -0.1142 670 ARG B NH1 
3710 N NH2 . ARG B 229 ? 1.1263 0.9289 1.2147 0.0148  0.1610  -0.1202 670 ARG B NH2 
3711 N N   . GLY B 230 ? 0.7543 0.6528 0.6461 -0.0106 0.0997  -0.0475 671 GLY B N   
3712 C CA  . GLY B 230 ? 0.7663 0.6715 0.6259 -0.0097 0.0967  -0.0420 671 GLY B CA  
3713 C C   . GLY B 230 ? 0.7870 0.6994 0.6406 -0.0101 0.1081  -0.0324 671 GLY B C   
3714 O O   . GLY B 230 ? 0.8695 0.7842 0.6971 -0.0111 0.1115  -0.0260 671 GLY B O   
3715 N N   . TYR B 231 ? 0.7498 0.6655 0.6281 -0.0089 0.1152  -0.0309 672 TYR B N   
3716 C CA  . TYR B 231 ? 0.7635 0.6925 0.6445 -0.0090 0.1256  -0.0265 672 TYR B CA  
3717 C C   . TYR B 231 ? 0.7466 0.6801 0.6283 -0.0157 0.1250  -0.0114 672 TYR B C   
3718 O O   . TYR B 231 ? 0.7569 0.7029 0.6409 -0.0195 0.1349  -0.0094 672 TYR B O   
3719 C CB  . TYR B 231 ? 0.7763 0.7104 0.6866 -0.0014 0.1308  -0.0328 672 TYR B CB  
3720 C CG  . TYR B 231 ? 0.7962 0.7244 0.7141 0.0046  0.1333  -0.0515 672 TYR B CG  
3721 C CD1 . TYR B 231 ? 0.7878 0.7069 0.7349 0.0123  0.1355  -0.0553 672 TYR B CD1 
3722 C CD2 . TYR B 231 ? 0.8279 0.7587 0.7233 0.0041  0.1332  -0.0662 672 TYR B CD2 
3723 C CE1 . TYR B 231 ? 0.8073 0.7185 0.7678 0.0167  0.1391  -0.0755 672 TYR B CE1 
3724 C CE2 . TYR B 231 ? 0.8352 0.7642 0.7414 0.0094  0.1344  -0.0891 672 TYR B CE2 
3725 C CZ  . TYR B 231 ? 0.8385 0.7569 0.7806 0.0143  0.1382  -0.0948 672 TYR B CZ  
3726 O OH  . TYR B 231 ? 0.8785 0.7929 0.8373 0.0183  0.1407  -0.1206 672 TYR B OH  
3727 N N   . LEU B 232 ? 0.7373 0.6623 0.6206 -0.0181 0.1151  -0.0037 673 LEU B N   
3728 C CA  . LEU B 232 ? 0.7458 0.6762 0.6347 -0.0239 0.1126  0.0059  673 LEU B CA  
3729 C C   . LEU B 232 ? 0.7727 0.6897 0.6444 -0.0287 0.1052  0.0107  673 LEU B C   
3730 O O   . LEU B 232 ? 0.8275 0.7350 0.6944 -0.0259 0.0978  0.0074  673 LEU B O   
3731 C CB  . LEU B 232 ? 0.7209 0.6565 0.6289 -0.0185 0.1065  0.0091  673 LEU B CB  
3732 C CG  . LEU B 232 ? 0.7258 0.6807 0.6498 -0.0188 0.1038  0.0116  673 LEU B CG  
3733 C CD1 . LEU B 232 ? 0.7097 0.6640 0.6343 -0.0133 0.0940  0.0172  673 LEU B CD1 
3734 C CD2 . LEU B 232 ? 0.7405 0.7007 0.6638 -0.0307 0.1073  0.0112  673 LEU B CD2 
3735 N N   . SER B 233 ? 0.8049 0.7209 0.6720 -0.0358 0.1080  0.0170  674 SER B N   
3736 C CA  . SER B 233 ? 0.8468 0.7485 0.7028 -0.0385 0.1001  0.0217  674 SER B CA  
3737 C C   . SER B 233 ? 0.8776 0.7805 0.7446 -0.0477 0.1045  0.0262  674 SER B C   
3738 O O   . SER B 233 ? 0.9167 0.8316 0.7967 -0.0533 0.1156  0.0254  674 SER B O   
3739 C CB  . SER B 233 ? 0.9018 0.7879 0.7278 -0.0343 0.0988  0.0237  674 SER B CB  
3740 O OG  . SER B 233 ? 0.9640 0.8448 0.7743 -0.0383 0.1122  0.0316  674 SER B OG  
3741 N N   . PRO B 234 ? 0.8592 0.7516 0.7264 -0.0499 0.0966  0.0277  675 PRO B N   
3742 C CA  . PRO B 234 ? 0.8441 0.7388 0.7301 -0.0593 0.0996  0.0267  675 PRO B CA  
3743 C C   . PRO B 234 ? 0.8741 0.7572 0.7571 -0.0684 0.1158  0.0338  675 PRO B C   
3744 O O   . PRO B 234 ? 0.9158 0.7778 0.7695 -0.0653 0.1211  0.0444  675 PRO B O   
3745 C CB  . PRO B 234 ? 0.8620 0.7418 0.7440 -0.0574 0.0888  0.0261  675 PRO B CB  
3746 C CG  . PRO B 234 ? 0.8719 0.7547 0.7446 -0.0478 0.0791  0.0230  675 PRO B CG  
3747 C CD  . PRO B 234 ? 0.8772 0.7591 0.7347 -0.0435 0.0843  0.0259  675 PRO B CD  
3748 N N   . ASP B 235 ? 0.8627 0.7611 0.7759 -0.0793 0.1241  0.0272  676 ASP B N   
3749 C CA  . ASP B 235 ? 0.8865 0.7749 0.8048 -0.0918 0.1450  0.0329  676 ASP B CA  
3750 C C   . ASP B 235 ? 0.9291 0.7864 0.8470 -0.0991 0.1480  0.0396  676 ASP B C   
3751 O O   . ASP B 235 ? 0.9276 0.7926 0.8777 -0.1066 0.1435  0.0274  676 ASP B O   
3752 C CB  . ASP B 235 ? 0.8674 0.7899 0.8285 -0.1013 0.1533  0.0182  676 ASP B CB  
3753 C CG  . ASP B 235 ? 0.9075 0.8226 0.8810 -0.1176 0.1804  0.0221  676 ASP B CG  
3754 O OD1 . ASP B 235 ? 0.9580 0.8362 0.9004 -0.1207 0.1939  0.0404  676 ASP B OD1 
3755 O OD2 . ASP B 235 ? 0.9029 0.8499 0.9177 -0.1266 0.1889  0.0068  676 ASP B OD2 
3756 N N   . LEU B 236 ? 0.9633 0.7849 0.8445 -0.0956 0.1555  0.0582  677 LEU B N   
3757 C CA  . LEU B 236 ? 0.9646 0.7491 0.8416 -0.0981 0.1568  0.0677  677 LEU B CA  
3758 C C   . LEU B 236 ? 0.9479 0.7173 0.8516 -0.1176 0.1813  0.0705  677 LEU B C   
3759 O O   . LEU B 236 ? 0.9821 0.7190 0.8920 -0.1215 0.1839  0.0759  677 LEU B O   
3760 C CB  . LEU B 236 ? 1.0003 0.7504 0.8253 -0.0825 0.1526  0.0879  677 LEU B CB  
3761 C CG  . LEU B 236 ? 0.9864 0.7525 0.7928 -0.0649 0.1287  0.0806  677 LEU B CG  
3762 C CD1 . LEU B 236 ? 1.0352 0.7722 0.7944 -0.0477 0.1214  0.0962  677 LEU B CD1 
3763 C CD2 . LEU B 236 ? 0.9390 0.7212 0.7750 -0.0635 0.1101  0.0637  677 LEU B CD2 
3764 N N   . SER B 237 ? 0.9232 0.7160 0.8485 -0.1303 0.2003  0.0647  678 SER B N   
3765 C CA  . SER B 237 ? 0.9351 0.7168 0.8954 -0.1525 0.2276  0.0639  678 SER B CA  
3766 C C   . SER B 237 ? 0.9106 0.7137 0.9304 -0.1642 0.2189  0.0373  678 SER B C   
3767 O O   . SER B 237 ? 0.9535 0.7440 1.0103 -0.1836 0.2387  0.0321  678 SER B O   
3768 C CB  . SER B 237 ? 0.9302 0.7362 0.9015 -0.1631 0.2522  0.0619  678 SER B CB  
3769 O OG  . SER B 237 ? 0.8890 0.7483 0.8886 -0.1584 0.2371  0.0388  678 SER B OG  
3770 N N   . LYS B 238 ? 0.8888 0.7232 0.9169 -0.1526 0.1906  0.0197  679 LYS B N   
3771 C CA  . LYS B 238 ? 0.8753 0.7360 0.9526 -0.1597 0.1787  -0.0081 679 LYS B CA  
3772 C C   . LYS B 238 ? 0.8999 0.7273 0.9779 -0.1589 0.1705  -0.0088 679 LYS B C   
3773 O O   . LYS B 238 ? 0.9090 0.7569 1.0242 -0.1632 0.1592  -0.0344 679 LYS B O   
3774 C CB  . LYS B 238 ? 0.8375 0.7456 0.9164 -0.1452 0.1536  -0.0244 679 LYS B CB  
3775 C CG  . LYS B 238 ? 0.8381 0.7809 0.9231 -0.1431 0.1588  -0.0272 679 LYS B CG  
3776 C CD  . LYS B 238 ? 0.8144 0.7943 0.8951 -0.1255 0.1345  -0.0378 679 LYS B CD  
3777 C CE  . LYS B 238 ? 0.8404 0.8598 0.9636 -0.1274 0.1207  -0.0664 679 LYS B CE  
3778 N NZ  . LYS B 238 ? 0.8656 0.9121 0.9712 -0.1067 0.0971  -0.0703 679 LYS B NZ  
3779 N N   . VAL B 239 ? 0.9297 0.7084 0.9668 -0.1508 0.1741  0.0169  680 VAL B N   
3780 C CA  . VAL B 239 ? 0.9562 0.7010 0.9969 -0.1477 0.1664  0.0161  680 VAL B CA  
3781 C C   . VAL B 239 ? 1.0144 0.7361 1.1008 -0.1697 0.1884  0.0086  680 VAL B C   
3782 O O   . VAL B 239 ? 1.0371 0.7497 1.1343 -0.1856 0.2154  0.0175  680 VAL B O   
3783 C CB  . VAL B 239 ? 0.9875 0.6865 0.9744 -0.1300 0.1625  0.0450  680 VAL B CB  
3784 C CG1 . VAL B 239 ? 0.9539 0.6785 0.9043 -0.1110 0.1424  0.0478  680 VAL B CG1 
3785 C CG2 . VAL B 239 ? 1.0460 0.7019 1.0072 -0.1358 0.1898  0.0744  680 VAL B CG2 
3786 N N   . ARG B 240 ? 1.0426 0.7551 1.1587 -0.1714 0.1787  -0.0098 681 ARG B N   
3787 C CA  . ARG B 240 ? 1.0933 0.7867 1.2643 -0.1937 0.1979  -0.0248 681 ARG B CA  
3788 C C   . ARG B 240 ? 1.1552 0.7776 1.3049 -0.1989 0.2259  0.0104  681 ARG B C   
3789 O O   . ARG B 240 ? 1.1809 0.7665 1.2736 -0.1793 0.2208  0.0413  681 ARG B O   
3790 C CB  . ARG B 240 ? 1.1154 0.8155 1.3216 -0.1919 0.1793  -0.0559 681 ARG B CB  
3791 C CG  . ARG B 240 ? 1.0781 0.8428 1.2856 -0.1800 0.1499  -0.0839 681 ARG B CG  
3792 C CD  . ARG B 240 ? 1.0866 0.8916 1.3544 -0.1920 0.1424  -0.1294 681 ARG B CD  
3793 N NE  . ARG B 240 ? 1.0925 0.8993 1.3632 -0.1806 0.1226  -0.1497 681 ARG B NE  
3794 C CZ  . ARG B 240 ? 1.1137 0.8766 1.4061 -0.1840 0.1278  -0.1554 681 ARG B CZ  
3795 N NH1 . ARG B 240 ? 1.1869 0.8934 1.4971 -0.1986 0.1533  -0.1382 681 ARG B NH1 
3796 N NH2 . ARG B 240 ? 1.0702 0.8437 1.3657 -0.1721 0.1091  -0.1778 681 ARG B NH2 
3797 N N   . SER B 241 ? 1.1813 0.7854 1.3770 -0.2247 0.2560  0.0054  682 SER B N   
3798 C CA  . SER B 241 ? 1.2526 0.7890 1.4262 -0.2328 0.2910  0.0430  682 SER B CA  
3799 C C   . SER B 241 ? 1.3075 0.7715 1.4508 -0.2169 0.2881  0.0684  682 SER B C   
3800 O O   . SER B 241 ? 1.3684 0.7737 1.4636 -0.2103 0.3080  0.1098  682 SER B O   
3801 C CB  . SER B 241 ? 1.2742 0.8077 1.5159 -0.2677 0.3271  0.0273  682 SER B CB  
3802 O OG  . SER B 241 ? 1.2666 0.8008 1.5757 -0.2806 0.3217  -0.0083 682 SER B OG  
3803 N N   . ASN B 242 ? 1.2852 0.7541 1.4543 -0.2085 0.2630  0.0434  683 ASN B N   
3804 C CA  . ASN B 242 ? 1.3445 0.7493 1.4939 -0.1911 0.2573  0.0619  683 ASN B CA  
3805 C C   . ASN B 242 ? 1.3024 0.7194 1.3981 -0.1572 0.2216  0.0700  683 ASN B C   
3806 O O   . ASN B 242 ? 1.2942 0.6737 1.3824 -0.1390 0.2084  0.0750  683 ASN B O   
3807 C CB  . ASN B 242 ? 1.3572 0.7507 1.5783 -0.2052 0.2579  0.0270  683 ASN B CB  
3808 C CG  . ASN B 242 ? 1.3079 0.7765 1.5666 -0.2051 0.2282  -0.0225 683 ASN B CG  
3809 O OD1 . ASN B 242 ? 1.2471 0.7802 1.5044 -0.2086 0.2192  -0.0372 683 ASN B OD1 
3810 N ND2 . ASN B 242 ? 1.3294 0.7891 1.6201 -0.1994 0.2133  -0.0485 683 ASN B ND2 
3811 N N   . CYS B 243 ? 1.2561 0.7254 1.3195 -0.1488 0.2071  0.0696  684 CYS B N   
3812 C CA  . CYS B 243 ? 1.2621 0.7431 1.2764 -0.1193 0.1778  0.0782  684 CYS B CA  
3813 C C   . CYS B 243 ? 1.3210 0.7492 1.2720 -0.1012 0.1852  0.1218  684 CYS B C   
3814 O O   . CYS B 243 ? 1.3567 0.7873 1.2741 -0.1051 0.2012  0.1421  684 CYS B O   
3815 C CB  . CYS B 243 ? 1.2248 0.7728 1.2269 -0.1171 0.1630  0.0646  684 CYS B CB  
3816 S SG  . CYS B 243 ? 1.2796 0.8371 1.2222 -0.0846 0.1345  0.0782  684 CYS B SG  
3817 N N   . PRO B 244 ? 1.3527 0.7358 1.2851 -0.0786 0.1723  0.1351  685 PRO B N   
3818 C CA  . PRO B 244 ? 1.4305 0.7563 1.3003 -0.0583 0.1794  0.1786  685 PRO B CA  
3819 C C   . PRO B 244 ? 1.4004 0.7561 1.2098 -0.0422 0.1685  0.1930  685 PRO B C   
3820 O O   . PRO B 244 ? 1.3019 0.7139 1.1148 -0.0358 0.1445  0.1699  685 PRO B O   
3821 C CB  . PRO B 244 ? 1.4649 0.7565 1.3331 -0.0312 0.1559  0.1795  685 PRO B CB  
3822 C CG  . PRO B 244 ? 1.4132 0.7302 1.3519 -0.0452 0.1481  0.1382  685 PRO B CG  
3823 C CD  . PRO B 244 ? 1.3300 0.7198 1.2921 -0.0658 0.1470  0.1097  685 PRO B CD  
3824 N N   . LYS B 245 ? 1.5747 1.0327 1.4823 -0.2212 0.1981  0.2218  686 LYS B N   
3825 C CA  . LYS B 245 ? 1.5485 1.0393 1.3638 -0.1974 0.2077  0.2471  686 LYS B CA  
3826 C C   . LYS B 245 ? 1.4792 0.9758 1.2198 -0.1545 0.1633  0.2344  686 LYS B C   
3827 O O   . LYS B 245 ? 1.4239 0.9764 1.1248 -0.1402 0.1543  0.2180  686 LYS B O   
3828 C CB  . LYS B 245 ? 1.6908 1.1284 1.4531 -0.1987 0.2551  0.3158  686 LYS B CB  
3829 C CG  . LYS B 245 ? 1.7280 1.2029 1.5362 -0.2338 0.3090  0.3311  686 LYS B CG  
3830 C CD  . LYS B 245 ? 1.6863 1.2013 1.6288 -0.2781 0.3115  0.2879  686 LYS B CD  
3831 C CE  . LYS B 245 ? 1.7544 1.1924 1.7735 -0.3062 0.3200  0.2973  686 LYS B CE  
3832 N NZ  . LYS B 245 ? 1.8579 1.2522 1.8972 -0.3329 0.3836  0.3595  686 LYS B NZ  
3833 N N   . ALA B 246 ? 1.4899 0.9302 1.2215 -0.1345 0.1366  0.2398  687 ALA B N   
3834 C CA  . ALA B 246 ? 1.4409 0.8957 1.1234 -0.0963 0.0921  0.2231  687 ALA B CA  
3835 C C   . ALA B 246 ? 1.3374 0.8728 1.0531 -0.0965 0.0677  0.1672  687 ALA B C   
3836 O O   . ALA B 246 ? 1.3070 0.8782 0.9769 -0.0745 0.0480  0.1580  687 ALA B O   
3837 C CB  . ALA B 246 ? 1.4807 0.8723 1.1786 -0.0772 0.0687  0.2288  687 ALA B CB  
3838 N N   . MET B 247 ? 1.3099 0.8746 1.1064 -0.1212 0.0697  0.1308  688 MET B N   
3839 C CA  . MET B 247 ? 1.2200 0.8607 1.0495 -0.1173 0.0478  0.0828  688 MET B CA  
3840 C C   . MET B 247 ? 1.1638 0.8687 0.9793 -0.1219 0.0643  0.0814  688 MET B C   
3841 O O   . MET B 247 ? 1.0721 0.8226 0.8731 -0.1036 0.0474  0.0634  688 MET B O   
3842 C CB  . MET B 247 ? 1.2286 0.8852 1.1419 -0.1398 0.0434  0.0436  688 MET B CB  
3843 C CG  . MET B 247 ? 1.1794 0.9157 1.1213 -0.1304 0.0202  -0.0027 688 MET B CG  
3844 S SD  . MET B 247 ? 1.2247 0.9668 1.1364 -0.0889 -0.0153 -0.0192 688 MET B SD  
3845 C CE  . MET B 247 ? 1.2971 0.9513 1.2269 -0.0841 -0.0255 -0.0213 688 MET B CE  
3846 N N   . LYS B 248 ? 1.1961 0.9038 1.0239 -0.1461 0.1006  0.1012  689 LYS B N   
3847 C CA  . LYS B 248 ? 1.1705 0.9305 0.9811 -0.1464 0.1230  0.1050  689 LYS B CA  
3848 C C   . LYS B 248 ? 1.1945 0.9406 0.9186 -0.1188 0.1170  0.1191  689 LYS B C   
3849 O O   . LYS B 248 ? 1.1276 0.9176 0.8419 -0.1065 0.1126  0.1015  689 LYS B O   
3850 C CB  . LYS B 248 ? 1.2344 0.9896 1.0633 -0.1728 0.1684  0.1327  689 LYS B CB  
3851 C CG  . LYS B 248 ? 1.2318 1.0390 1.1603 -0.2037 0.1784  0.1092  689 LYS B CG  
3852 C CD  . LYS B 248 ? 1.3084 1.1293 1.2603 -0.2277 0.2284  0.1376  689 LYS B CD  
3853 C CE  . LYS B 248 ? 1.2690 1.1544 1.2022 -0.2132 0.2471  0.1359  689 LYS B CE  
3854 N NZ  . LYS B 248 ? 1.3056 1.2286 1.2944 -0.2391 0.2948  0.1531  689 LYS B NZ  
3855 N N   . ARG B 249 ? 1.2931 0.9774 0.9566 -0.1087 0.1174  0.1513  690 ARG B N   
3856 C CA  . ARG B 249 ? 1.3266 0.9982 0.9033 -0.0812 0.1038  0.1610  690 ARG B CA  
3857 C C   . ARG B 249 ? 1.2251 0.9220 0.8105 -0.0620 0.0610  0.1278  690 ARG B C   
3858 O O   . ARG B 249 ? 1.2134 0.9354 0.7667 -0.0492 0.0524  0.1130  690 ARG B O   
3859 C CB  . ARG B 249 ? 1.4751 1.0801 0.9925 -0.0695 0.1049  0.2042  690 ARG B CB  
3860 C CG  . ARG B 249 ? 1.5946 1.1908 1.0099 -0.0407 0.0928  0.2186  690 ARG B CG  
3861 C CD  . ARG B 249 ? 1.7554 1.2875 1.1166 -0.0254 0.0949  0.2699  690 ARG B CD  
3862 N NE  . ARG B 249 ? 1.9045 1.4340 1.1568 0.0060  0.0806  0.2866  690 ARG B NE  
3863 C CZ  . ARG B 249 ? 2.0698 1.5706 1.2380 0.0175  0.1097  0.3347  690 ARG B CZ  
3864 N NH1 . ARG B 249 ? 2.1300 1.5962 1.3169 -0.0025 0.1607  0.3778  690 ARG B NH1 
3865 N NH2 . ARG B 249 ? 2.1496 1.6596 1.2136 0.0501  0.0878  0.3400  690 ARG B NH2 
3866 N N   . LEU B 250 ? 1.1793 0.8695 0.8131 -0.0604 0.0372  0.1143  691 LEU B N   
3867 C CA  . LEU B 250 ? 1.1369 0.8554 0.7861 -0.0417 0.0021  0.0866  691 LEU B CA  
3868 C C   . LEU B 250 ? 1.0749 0.8569 0.7605 -0.0461 0.0077  0.0589  691 LEU B C   
3869 O O   . LEU B 250 ? 1.0636 0.8695 0.7389 -0.0329 -0.0058 0.0458  691 LEU B O   
3870 C CB  . LEU B 250 ? 1.1172 0.8183 0.8125 -0.0370 -0.0177 0.0758  691 LEU B CB  
3871 C CG  . LEU B 250 ? 1.0686 0.8105 0.7908 -0.0181 -0.0462 0.0472  691 LEU B CG  
3872 C CD1 . LEU B 250 ? 1.1031 0.8406 0.7820 0.0044  -0.0706 0.0552  691 LEU B CD1 
3873 C CD2 . LEU B 250 ? 1.0598 0.7915 0.8293 -0.0125 -0.0593 0.0298  691 LEU B CD2 
3874 N N   . MET B 251 ? 1.0472 0.8571 0.7816 -0.0642 0.0272  0.0511  692 MET B N   
3875 C CA  . MET B 251 ? 0.9717 0.8433 0.7402 -0.0652 0.0373  0.0340  692 MET B CA  
3876 C C   . MET B 251 ? 0.9755 0.8523 0.7043 -0.0588 0.0533  0.0398  692 MET B C   
3877 O O   . MET B 251 ? 0.9245 0.8316 0.6650 -0.0474 0.0496  0.0265  692 MET B O   
3878 C CB  . MET B 251 ? 0.9866 0.8866 0.8043 -0.0868 0.0587  0.0316  692 MET B CB  
3879 C CG  . MET B 251 ? 0.9562 0.9156 0.8316 -0.0848 0.0459  0.0054  692 MET B CG  
3880 S SD  . MET B 251 ? 1.0042 1.0152 0.9426 -0.1101 0.0667  -0.0013 692 MET B SD  
3881 C CE  . MET B 251 ? 1.0672 1.0133 1.0221 -0.1390 0.0700  0.0031  692 MET B CE  
3882 N N   . ALA B 252 ? 1.0260 0.8708 0.7086 -0.0654 0.0745  0.0597  693 ALA B N   
3883 C CA  . ALA B 252 ? 1.0489 0.8968 0.6885 -0.0588 0.0939  0.0597  693 ALA B CA  
3884 C C   . ALA B 252 ? 1.0627 0.9012 0.6668 -0.0414 0.0668  0.0431  693 ALA B C   
3885 O O   . ALA B 252 ? 1.0327 0.8892 0.6401 -0.0355 0.0746  0.0259  693 ALA B O   
3886 C CB  . ALA B 252 ? 1.1121 0.9273 0.6977 -0.0654 0.1222  0.0863  693 ALA B CB  
3887 N N   . GLU B 253 ? 1.1185 0.9300 0.6986 -0.0332 0.0352  0.0472  694 GLU B N   
3888 C CA  . GLU B 253 ? 1.1592 0.9702 0.7168 -0.0186 0.0036  0.0293  694 GLU B CA  
3889 C C   . GLU B 253 ? 1.0624 0.9106 0.6872 -0.0165 -0.0081 0.0071  694 GLU B C   
3890 O O   . GLU B 253 ? 1.0375 0.8967 0.6667 -0.0128 -0.0147 -0.0130 694 GLU B O   
3891 C CB  . GLU B 253 ? 1.2404 1.0222 0.7653 -0.0064 -0.0285 0.0432  694 GLU B CB  
3892 C CG  . GLU B 253 ? 1.3750 1.1148 0.8276 -0.0031 -0.0167 0.0760  694 GLU B CG  
3893 C CD  . GLU B 253 ? 1.4823 1.2192 0.8575 0.0023  -0.0034 0.0730  694 GLU B CD  
3894 O OE1 . GLU B 253 ? 1.6002 1.3120 0.9220 0.0014  0.0251  0.1031  694 GLU B OE1 
3895 O OE2 . GLU B 253 ? 1.4935 1.2522 0.8621 0.0075  -0.0190 0.0397  694 GLU B OE2 
3896 N N   . CYS B 254 ? 1.0069 0.8741 0.6848 -0.0186 -0.0093 0.0102  695 CYS B N   
3897 C CA  . CYS B 254 ? 0.9572 0.8651 0.6942 -0.0134 -0.0130 -0.0031 695 CYS B CA  
3898 C C   . CYS B 254 ? 0.9377 0.8707 0.6969 -0.0154 0.0149  -0.0072 695 CYS B C   
3899 O O   . CYS B 254 ? 0.9156 0.8714 0.7127 -0.0090 0.0154  -0.0145 695 CYS B O   
3900 C CB  . CYS B 254 ? 0.9402 0.8683 0.7175 -0.0123 -0.0168 -0.0017 695 CYS B CB  
3901 S SG  . CYS B 254 ? 1.0352 0.9311 0.8036 -0.0035 -0.0475 0.0000  695 CYS B SG  
3902 N N   . LEU B 255 ? 0.9468 0.8758 0.6885 -0.0229 0.0413  0.0005  696 LEU B N   
3903 C CA  . LEU B 255 ? 0.8971 0.8521 0.6661 -0.0199 0.0701  -0.0004 696 LEU B CA  
3904 C C   . LEU B 255 ? 0.9541 0.8831 0.6893 -0.0176 0.0840  -0.0125 696 LEU B C   
3905 O O   . LEU B 255 ? 0.9686 0.9108 0.7277 -0.0118 0.1108  -0.0144 696 LEU B O   
3906 C CB  . LEU B 255 ? 0.8875 0.8679 0.6745 -0.0272 0.0925  0.0119  696 LEU B CB  
3907 C CG  . LEU B 255 ? 0.8523 0.8710 0.6842 -0.0292 0.0805  0.0134  696 LEU B CG  
3908 C CD1 . LEU B 255 ? 0.8489 0.8939 0.7035 -0.0421 0.0998  0.0198  696 LEU B CD1 
3909 C CD2 . LEU B 255 ? 0.8235 0.8872 0.6978 -0.0119 0.0777  0.0117  696 LEU B CD2 
3910 N N   . LYS B 256 ? 0.9939 0.8882 0.6739 -0.0189 0.0651  -0.0230 697 LYS B N   
3911 C CA  . LYS B 256 ? 1.0422 0.9136 0.6822 -0.0160 0.0743  -0.0445 697 LYS B CA  
3912 C C   . LYS B 256 ? 0.9951 0.8745 0.6906 -0.0124 0.0812  -0.0629 697 LYS B C   
3913 O O   . LYS B 256 ? 0.9893 0.8872 0.7389 -0.0119 0.0678  -0.0594 697 LYS B O   
3914 C CB  . LYS B 256 ? 1.1195 0.9651 0.6961 -0.0143 0.0415  -0.0582 697 LYS B CB  
3915 C CG  . LYS B 256 ? 1.1827 1.0098 0.6938 -0.0134 0.0394  -0.0331 697 LYS B CG  
3916 C CD  . LYS B 256 ? 1.2894 1.0932 0.7081 -0.0049 0.0338  -0.0447 697 LYS B CD  
3917 C CE  . LYS B 256 ? 1.3535 1.1483 0.7239 -0.0042 0.0786  -0.0302 697 LYS B CE  
3918 N NZ  . LYS B 256 ? 1.3923 1.1757 0.7437 -0.0085 0.0899  0.0137  697 LYS B NZ  
3919 N N   . LYS B 257 ? 1.0397 0.9024 0.7228 -0.0087 0.1056  -0.0818 698 LYS B N   
3920 C CA  . LYS B 257 ? 1.0197 0.8807 0.7645 -0.0041 0.1231  -0.0942 698 LYS B CA  
3921 C C   . LYS B 257 ? 1.0512 0.8902 0.8087 -0.0117 0.0977  -0.1291 698 LYS B C   
3922 O O   . LYS B 257 ? 1.0412 0.8791 0.8686 -0.0127 0.1059  -0.1328 698 LYS B O   
3923 C CB  . LYS B 257 ? 1.0458 0.8958 0.7818 0.0059  0.1650  -0.1004 698 LYS B CB  
3924 C CG  . LYS B 257 ? 1.0018 0.8873 0.7506 0.0125  0.1915  -0.0665 698 LYS B CG  
3925 C CD  . LYS B 257 ? 1.0610 0.9382 0.7805 0.0221  0.2301  -0.0744 698 LYS B CD  
3926 C CE  . LYS B 257 ? 1.0398 0.9617 0.7792 0.0244  0.2537  -0.0423 698 LYS B CE  
3927 N NZ  . LYS B 257 ? 1.1008 1.0206 0.8142 0.0347  0.2954  -0.0486 698 LYS B NZ  
3928 N N   . LYS B 258 ? 1.1320 0.9568 0.8255 -0.0167 0.0671  -0.1527 699 LYS B N   
3929 C CA  . LYS B 258 ? 1.1648 0.9822 0.8735 -0.0259 0.0327  -0.1899 699 LYS B CA  
3930 C C   . LYS B 258 ? 1.1090 0.9555 0.8487 -0.0293 -0.0025 -0.1713 699 LYS B C   
3931 O O   . LYS B 258 ? 1.0929 0.9472 0.7833 -0.0238 -0.0210 -0.1512 699 LYS B O   
3932 C CB  . LYS B 258 ? 1.2796 1.0778 0.8967 -0.0239 0.0133  -0.2273 699 LYS B CB  
3933 C CG  . LYS B 258 ? 1.3950 1.1741 1.0307 -0.0328 0.0010  -0.2872 699 LYS B CG  
3934 C CD  . LYS B 258 ? 1.4551 1.2532 1.0803 -0.0404 -0.0567 -0.3181 699 LYS B CD  
3935 C CE  . LYS B 258 ? 1.5143 1.2995 1.1880 -0.0565 -0.0716 -0.3831 699 LYS B CE  
3936 N NZ  . LYS B 258 ? 1.6035 1.3513 1.2253 -0.0516 -0.0473 -0.4284 699 LYS B NZ  
3937 N N   . ARG B 259 ? 1.0714 0.9319 0.8977 -0.0369 -0.0064 -0.1754 700 ARG B N   
3938 C CA  . ARG B 259 ? 1.0215 0.9147 0.8904 -0.0387 -0.0364 -0.1639 700 ARG B CA  
3939 C C   . ARG B 259 ? 1.0778 0.9789 0.8910 -0.0356 -0.0829 -0.1757 700 ARG B C   
3940 O O   . ARG B 259 ? 1.0529 0.9715 0.8586 -0.0265 -0.0990 -0.1500 700 ARG B O   
3941 C CB  . ARG B 259 ? 1.0229 0.9246 0.9836 -0.0527 -0.0396 -0.1856 700 ARG B CB  
3942 C CG  . ARG B 259 ? 0.9938 0.9072 1.0376 -0.0509 -0.0018 -0.1543 700 ARG B CG  
3943 C CD  . ARG B 259 ? 0.9920 0.9231 1.1322 -0.0660 -0.0091 -0.1667 700 ARG B CD  
3944 N NE  . ARG B 259 ? 1.0739 0.9838 1.2237 -0.0855 -0.0323 -0.2214 700 ARG B NE  
3945 C CZ  . ARG B 259 ? 1.1316 1.0544 1.3716 -0.1061 -0.0439 -0.2464 700 ARG B CZ  
3946 N NH1 . ARG B 259 ? 1.0982 1.0541 1.4268 -0.1083 -0.0281 -0.2147 700 ARG B NH1 
3947 N NH2 . ARG B 259 ? 1.2135 1.1196 1.4572 -0.1248 -0.0702 -0.3056 700 ARG B NH2 
3948 N N   . ASP B 260 ? 1.1720 1.0610 0.9487 -0.0408 -0.1057 -0.2170 701 ASP B N   
3949 C CA  . ASP B 260 ? 1.2324 1.1398 0.9683 -0.0355 -0.1576 -0.2339 701 ASP B CA  
3950 C C   . ASP B 260 ? 1.2508 1.1458 0.8858 -0.0169 -0.1633 -0.2029 701 ASP B C   
3951 O O   . ASP B 260 ? 1.2805 1.1915 0.8850 -0.0044 -0.2021 -0.1949 701 ASP B O   
3952 C CB  . ASP B 260 ? 1.3361 1.2395 1.0562 -0.0452 -0.1817 -0.2932 701 ASP B CB  
3953 C CG  . ASP B 260 ? 1.3741 1.2690 1.1949 -0.0673 -0.1604 -0.3243 701 ASP B CG  
3954 O OD1 . ASP B 260 ? 1.3555 1.2231 1.2015 -0.0685 -0.1109 -0.3057 701 ASP B OD1 
3955 O OD2 . ASP B 260 ? 1.4305 1.3469 1.3105 -0.0830 -0.1925 -0.3659 701 ASP B OD2 
3956 N N   . GLU B 261 ? 1.2286 1.0964 0.8200 -0.0144 -0.1224 -0.1824 702 GLU B N   
3957 C CA  . GLU B 261 ? 1.2541 1.1055 0.7633 -0.0014 -0.1160 -0.1469 702 GLU B CA  
3958 C C   . GLU B 261 ? 1.1446 1.0006 0.6903 0.0009  -0.1073 -0.1044 702 GLU B C   
3959 O O   . GLU B 261 ? 1.1529 0.9920 0.6467 0.0095  -0.1065 -0.0740 702 GLU B O   
3960 C CB  . GLU B 261 ? 1.3194 1.1458 0.7715 -0.0012 -0.0740 -0.1466 702 GLU B CB  
3961 C CG  . GLU B 261 ? 1.4382 1.2553 0.8107 0.0051  -0.0872 -0.1860 702 GLU B CG  
3962 C CD  . GLU B 261 ? 1.5040 1.2996 0.8240 0.0084  -0.0401 -0.1896 702 GLU B CD  
3963 O OE1 . GLU B 261 ? 1.4414 1.2319 0.7705 0.0075  -0.0007 -0.1509 702 GLU B OE1 
3964 O OE2 . GLU B 261 ? 1.5782 1.3658 0.8513 0.0122  -0.0431 -0.2352 702 GLU B OE2 
3965 N N   . ARG B 262 ? 1.0580 0.9354 0.6916 -0.0056 -0.0995 -0.1025 703 ARG B N   
3966 C CA  . ARG B 262 ? 0.9877 0.8742 0.6539 -0.0014 -0.0945 -0.0720 703 ARG B CA  
3967 C C   . ARG B 262 ? 1.0166 0.9140 0.6885 0.0102  -0.1351 -0.0692 703 ARG B C   
3968 O O   . ARG B 262 ? 1.0498 0.9689 0.7477 0.0107  -0.1635 -0.0926 703 ARG B O   
3969 C CB  . ARG B 262 ? 0.8896 0.8022 0.6361 -0.0064 -0.0707 -0.0690 703 ARG B CB  
3970 C CG  . ARG B 262 ? 0.9045 0.8112 0.6582 -0.0130 -0.0334 -0.0734 703 ARG B CG  
3971 C CD  . ARG B 262 ? 0.8610 0.7933 0.6675 -0.0104 -0.0050 -0.0535 703 ARG B CD  
3972 N NE  . ARG B 262 ? 0.8419 0.7934 0.7166 -0.0097 0.0069  -0.0572 703 ARG B NE  
3973 C CZ  . ARG B 262 ? 0.8644 0.8046 0.7614 -0.0118 0.0329  -0.0646 703 ARG B CZ  
3974 N NH1 . ARG B 262 ? 0.9055 0.8195 0.7595 -0.0132 0.0491  -0.0745 703 ARG B NH1 
3975 N NH2 . ARG B 262 ? 0.8512 0.8042 0.8172 -0.0109 0.0463  -0.0605 703 ARG B NH2 
3976 N N   . PRO B 263 ? 1.0291 0.9116 0.6833 0.0197  -0.1380 -0.0422 704 PRO B N   
3977 C CA  . PRO B 263 ? 1.0456 0.9359 0.7113 0.0365  -0.1733 -0.0360 704 PRO B CA  
3978 C C   . PRO B 263 ? 0.9845 0.9136 0.7375 0.0386  -0.1755 -0.0441 704 PRO B C   
3979 O O   . PRO B 263 ? 0.9204 0.8643 0.7145 0.0291  -0.1467 -0.0455 704 PRO B O   
3980 C CB  . PRO B 263 ? 1.0825 0.9330 0.7096 0.0437  -0.1639 -0.0043 704 PRO B CB  
3981 C CG  . PRO B 263 ? 1.0357 0.8809 0.6781 0.0262  -0.1233 0.0000  704 PRO B CG  
3982 C CD  . PRO B 263 ? 1.0306 0.8879 0.6623 0.0146  -0.1075 -0.0179 704 PRO B CD  
3983 N N   . LEU B 264 ? 1.0082 0.9582 0.7876 0.0546  -0.2083 -0.0467 705 LEU B N   
3984 C CA  . LEU B 264 ? 0.9277 0.9179 0.7879 0.0615  -0.2077 -0.0512 705 LEU B CA  
3985 C C   . LEU B 264 ? 0.9105 0.8809 0.7679 0.0770  -0.2015 -0.0339 705 LEU B C   
3986 O O   . LEU B 264 ? 0.9412 0.8645 0.7440 0.0778  -0.1968 -0.0178 705 LEU B O   
3987 C CB  . LEU B 264 ? 0.9312 0.9632 0.8348 0.0709  -0.2447 -0.0664 705 LEU B CB  
3988 C CG  . LEU B 264 ? 0.9230 0.9769 0.8473 0.0505  -0.2517 -0.0939 705 LEU B CG  
3989 C CD1 . LEU B 264 ? 0.9434 1.0430 0.9084 0.0581  -0.2970 -0.1133 705 LEU B CD1 
3990 C CD2 . LEU B 264 ? 0.8644 0.9365 0.8552 0.0323  -0.2133 -0.0987 705 LEU B CD2 
3991 N N   . PHE B 265 ? 0.8662 0.8710 0.7848 0.0890  -0.1984 -0.0386 706 PHE B N   
3992 C CA  . PHE B 265 ? 0.8576 0.8441 0.7778 0.1017  -0.1876 -0.0329 706 PHE B CA  
3993 C C   . PHE B 265 ? 0.8982 0.8486 0.8002 0.1252  -0.2115 -0.0222 706 PHE B C   
3994 O O   . PHE B 265 ? 0.9169 0.8202 0.7944 0.1263  -0.2016 -0.0145 706 PHE B O   
3995 C CB  . PHE B 265 ? 0.8108 0.8474 0.7912 0.1092  -0.1691 -0.0436 706 PHE B CB  
3996 C CG  . PHE B 265 ? 0.7795 0.8255 0.7551 0.0942  -0.1373 -0.0444 706 PHE B CG  
3997 C CD1 . PHE B 265 ? 0.8084 0.8312 0.7611 0.0934  -0.1264 -0.0474 706 PHE B CD1 
3998 C CD2 . PHE B 265 ? 0.7589 0.8359 0.7566 0.0809  -0.1194 -0.0425 706 PHE B CD2 
3999 C CE1 . PHE B 265 ? 0.8039 0.8464 0.7541 0.0822  -0.1022 -0.0490 706 PHE B CE1 
4000 C CE2 . PHE B 265 ? 0.7525 0.8412 0.7452 0.0731  -0.0913 -0.0382 706 PHE B CE2 
4001 C CZ  . PHE B 265 ? 0.7688 0.8460 0.7363 0.0748  -0.0848 -0.0415 706 PHE B CZ  
4002 N N   . PRO B 266 ? 0.9356 0.9079 0.8555 0.1444  -0.2430 -0.0213 707 PRO B N   
4003 C CA  . PRO B 266 ? 1.0225 0.9540 0.9186 0.1718  -0.2650 -0.0033 707 PRO B CA  
4004 C C   . PRO B 266 ? 1.1141 0.9747 0.9311 0.1637  -0.2595 0.0216  707 PRO B C   
4005 O O   . PRO B 266 ? 1.1564 0.9617 0.9600 0.1764  -0.2542 0.0385  707 PRO B O   
4006 C CB  . PRO B 266 ? 1.0335 1.0109 0.9517 0.1905  -0.3043 -0.0048 707 PRO B CB  
4007 C CG  . PRO B 266 ? 0.9610 1.0094 0.9502 0.1760  -0.2966 -0.0295 707 PRO B CG  
4008 C CD  . PRO B 266 ? 0.9169 0.9533 0.8900 0.1443  -0.2596 -0.0356 707 PRO B CD  
4009 N N   . GLN B 267 ? 1.1468 1.0075 0.9167 0.1426  -0.2563 0.0232  708 GLN B N   
4010 C CA  . GLN B 267 ? 1.2307 1.0333 0.9246 0.1337  -0.2433 0.0487  708 GLN B CA  
4011 C C   . GLN B 267 ? 1.2035 0.9697 0.9058 0.1133  -0.2052 0.0512  708 GLN B C   
4012 O O   . GLN B 267 ? 1.2599 0.9674 0.9315 0.1131  -0.1928 0.0765  708 GLN B O   
4013 C CB  . GLN B 267 ? 1.2745 1.0938 0.9202 0.1165  -0.2432 0.0411  708 GLN B CB  
4014 C CG  . GLN B 267 ? 1.3916 1.2320 0.9983 0.1360  -0.2843 0.0418  708 GLN B CG  
4015 C CD  . GLN B 267 ? 1.4034 1.3054 1.0817 0.1500  -0.3189 0.0186  708 GLN B CD  
4016 O OE1 . GLN B 267 ? 1.4687 1.3800 1.1467 0.1809  -0.3535 0.0316  708 GLN B OE1 
4017 N NE2 . GLN B 267 ? 1.3065 1.2532 1.0513 0.1291  -0.3077 -0.0121 708 GLN B NE2 
4018 N N   . ILE B 268 ? 1.1089 0.9132 0.8566 0.0963  -0.1867 0.0259  709 ILE B N   
4019 C CA  . ILE B 268 ? 1.0725 0.8603 0.8352 0.0777  -0.1570 0.0208  709 ILE B CA  
4020 C C   . ILE B 268 ? 1.0933 0.8486 0.8854 0.0922  -0.1601 0.0182  709 ILE B C   
4021 O O   . ILE B 268 ? 1.1338 0.8386 0.9191 0.0807  -0.1448 0.0270  709 ILE B O   
4022 C CB  . ILE B 268 ? 0.9845 0.8306 0.7866 0.0648  -0.1407 -0.0030 709 ILE B CB  
4023 C CG1 . ILE B 268 ? 0.9770 0.8381 0.7521 0.0483  -0.1302 -0.0005 709 ILE B CG1 
4024 C CG2 . ILE B 268 ? 0.9608 0.8064 0.7855 0.0522  -0.1194 -0.0144 709 ILE B CG2 
4025 C CD1 . ILE B 268 ? 0.9283 0.8441 0.7454 0.0432  -0.1179 -0.0164 709 ILE B CD1 
4026 N N   . LEU B 269 ? 1.0709 0.8547 0.9019 0.1171  -0.1779 0.0042  710 LEU B N   
4027 C CA  . LEU B 269 ? 1.0885 0.8421 0.9505 0.1370  -0.1809 -0.0045 710 LEU B CA  
4028 C C   . LEU B 269 ? 1.1803 0.8546 1.0101 0.1476  -0.1872 0.0281  710 LEU B C   
4029 O O   . LEU B 269 ? 1.2070 0.8233 1.0476 0.1424  -0.1733 0.0278  710 LEU B O   
4030 C CB  . LEU B 269 ? 1.0492 0.8537 0.9568 0.1673  -0.1976 -0.0203 710 LEU B CB  
4031 C CG  . LEU B 269 ? 1.0700 0.8744 1.0212 0.1869  -0.1911 -0.0479 710 LEU B CG  
4032 C CD1 . LEU B 269 ? 1.0419 0.8615 0.9993 0.1644  -0.1674 -0.0760 710 LEU B CD1 
4033 C CD2 . LEU B 269 ? 1.0557 0.9263 1.0534 0.2160  -0.2013 -0.0598 710 LEU B CD2 
4034 N N   . ALA B 270 ? 1.2093 0.8820 0.9993 0.1618  -0.2076 0.0565  711 ALA B N   
4035 C CA  . ALA B 270 ? 1.3028 0.9061 1.0499 0.1781  -0.2134 0.0984  711 ALA B CA  
4036 C C   . ALA B 270 ? 1.3518 0.8963 1.0640 0.1480  -0.1812 0.1202  711 ALA B C   
4037 O O   . ALA B 270 ? 1.4426 0.9132 1.1534 0.1534  -0.1695 0.1461  711 ALA B O   
4038 C CB  . ALA B 270 ? 1.3294 0.9607 1.0300 0.1990  -0.2444 0.1204  711 ALA B CB  
4039 N N   . SER B 271 ? 1.3256 0.9018 1.0171 0.1168  -0.1640 0.1113  712 SER B N   
4040 C CA  . SER B 271 ? 1.3623 0.8954 1.0289 0.0872  -0.1300 0.1320  712 SER B CA  
4041 C C   . SER B 271 ? 1.3502 0.8539 1.0768 0.0657  -0.1083 0.1119  712 SER B C   
4042 O O   . SER B 271 ? 1.4127 0.8522 1.1398 0.0515  -0.0854 0.1367  712 SER B O   
4043 C CB  . SER B 271 ? 1.3111 0.8922 0.9500 0.0631  -0.1158 0.1228  712 SER B CB  
4044 O OG  . SER B 271 ? 1.3760 0.9592 0.9430 0.0770  -0.1271 0.1474  712 SER B OG  
4045 N N   . ILE B 272 ? 1.2815 0.8344 1.0594 0.0634  -0.1150 0.0663  713 ILE B N   
4046 C CA  . ILE B 272 ? 1.2890 0.8279 1.1225 0.0454  -0.1016 0.0343  713 ILE B CA  
4047 C C   . ILE B 272 ? 1.3757 0.8412 1.2366 0.0648  -0.1070 0.0367  713 ILE B C   
4048 O O   . ILE B 272 ? 1.4374 0.8447 1.3283 0.0438  -0.0885 0.0346  713 ILE B O   
4049 C CB  . ILE B 272 ? 1.2146 0.8329 1.0830 0.0463  -0.1089 -0.0130 713 ILE B CB  
4050 C CG1 . ILE B 272 ? 1.1637 0.8433 1.0147 0.0259  -0.0974 -0.0126 713 ILE B CG1 
4051 C CG2 . ILE B 272 ? 1.2223 0.8310 1.1421 0.0347  -0.1028 -0.0544 713 ILE B CG2 
4052 C CD1 . ILE B 272 ? 1.0940 0.8540 0.9656 0.0357  -0.1039 -0.0415 713 ILE B CD1 
4053 N N   . GLU B 273 ? 1.3839 0.8521 1.2426 0.1045  -0.1310 0.0403  714 GLU B N   
4054 C CA  . GLU B 273 ? 1.4606 0.8561 1.3453 0.1317  -0.1360 0.0468  714 GLU B CA  
4055 C C   . GLU B 273 ? 1.5414 0.8424 1.4006 0.1279  -0.1197 0.1020  714 GLU B C   
4056 O O   . GLU B 273 ? 1.6210 0.8420 1.5167 0.1320  -0.1087 0.1043  714 GLU B O   
4057 C CB  . GLU B 273 ? 1.4818 0.9088 1.3679 0.1793  -0.1654 0.0494  714 GLU B CB  
4058 C CG  . GLU B 273 ? 1.4276 0.9324 1.3553 0.1898  -0.1737 -0.0031 714 GLU B CG  
4059 C CD  . GLU B 273 ? 1.4268 0.9843 1.3632 0.2308  -0.1999 0.0023  714 GLU B CD  
4060 O OE1 . GLU B 273 ? 1.3612 0.9813 1.3355 0.2436  -0.2017 -0.0340 714 GLU B OE1 
4061 O OE2 . GLU B 273 ? 1.4813 1.0249 1.3886 0.2515  -0.2186 0.0432  714 GLU B OE2 
4062 N N   . LEU B 274 ? 1.5349 0.8434 1.3314 0.1210  -0.1151 0.1460  715 LEU B N   
4063 C CA  . LEU B 274 ? 1.6331 0.8605 1.3926 0.1193  -0.0938 0.2076  715 LEU B CA  
4064 C C   . LEU B 274 ? 1.6697 0.8448 1.4712 0.0734  -0.0543 0.2045  715 LEU B C   
4065 O O   . LEU B 274 ? 1.7605 0.8436 1.5904 0.0738  -0.0358 0.2301  715 LEU B O   
4066 C CB  . LEU B 274 ? 1.6277 0.8916 1.3025 0.1223  -0.0965 0.2459  715 LEU B CB  
4067 C CG  . LEU B 274 ? 1.7368 0.9325 1.3493 0.1303  -0.0750 0.3182  715 LEU B CG  
4068 C CD1 . LEU B 274 ? 1.8293 0.9943 1.4071 0.1859  -0.1038 0.3598  715 LEU B CD1 
4069 C CD2 . LEU B 274 ? 1.7133 0.9555 1.2520 0.1147  -0.0635 0.3343  715 LEU B CD2 
4070 N N   . LEU B 275 ? 1.5998 0.8339 1.4121 0.0342  -0.0410 0.1745  716 LEU B N   
4071 C CA  . LEU B 275 ? 1.6273 0.8311 1.4891 -0.0130 -0.0059 0.1678  716 LEU B CA  
4072 C C   . LEU B 275 ? 1.6385 0.8253 1.5865 -0.0268 -0.0104 0.1080  716 LEU B C   
4073 O O   . LEU B 275 ? 1.7018 0.8331 1.7072 -0.0604 0.0145  0.1036  716 LEU B O   
4074 C CB  . LEU B 275 ? 1.5447 0.8250 1.3930 -0.0453 0.0085  0.1569  716 LEU B CB  
4075 C CG  . LEU B 275 ? 1.4378 0.8114 1.3170 -0.0534 -0.0102 0.0937  716 LEU B CG  
4076 C CD1 . LEU B 275 ? 1.4333 0.8116 1.3953 -0.0873 -0.0021 0.0446  716 LEU B CD1 
4077 C CD2 . LEU B 275 ? 1.3739 0.8194 1.2124 -0.0634 -0.0022 0.1007  716 LEU B CD2 
4078 N N   . ALA B 276 ? 1.5831 0.8201 1.5425 -0.0018 -0.0409 0.0598  717 ALA B N   
4079 C CA  . ALA B 276 ? 1.5991 0.8214 1.6271 -0.0047 -0.0482 -0.0014 717 ALA B CA  
4080 C C   . ALA B 276 ? 1.7417 0.8434 1.8075 0.0010  -0.0344 0.0176  717 ALA B C   
4081 O O   . ALA B 276 ? 1.7901 0.8438 1.9197 -0.0350 -0.0157 -0.0076 717 ALA B O   
4082 C CB  . ALA B 276 ? 1.5318 0.8168 1.5530 0.0341  -0.0782 -0.0400 717 ALA B CB  
4083 N N   . ARG B 277 ? 1.8194 0.8726 1.8507 0.0463  -0.0435 0.0637  718 ARG B N   
4084 C CA  . ARG B 277 ? 1.9592 0.8937 2.0278 0.0638  -0.0318 0.0849  718 ARG B CA  
4085 C C   . ARG B 277 ? 2.0546 0.9001 2.1442 0.0257  0.0085  0.1326  718 ARG B C   
4086 O O   . ARG B 277 ? 2.1307 0.8785 2.2868 0.0158  0.0268  0.1248  718 ARG B O   
4087 C CB  . ARG B 277 ? 2.0182 0.9309 2.0419 0.1263  -0.0520 0.1336  718 ARG B CB  
4088 C CG  . ARG B 277 ? 2.1089 0.9789 2.0660 0.1400  -0.0399 0.2256  718 ARG B CG  
4089 C CD  . ARG B 277 ? 2.1587 1.0324 2.0719 0.2056  -0.0703 0.2651  718 ARG B CD  
4090 N NE  . ARG B 277 ? 2.0737 1.0680 1.9448 0.2197  -0.1047 0.2423  718 ARG B NE  
4091 C CZ  . ARG B 277 ? 2.0030 1.0657 1.9073 0.2375  -0.1301 0.1853  718 ARG B CZ  
4092 N NH1 . ARG B 277 ? 2.0266 1.0546 1.9989 0.2484  -0.1278 0.1390  718 ARG B NH1 
4093 N NH2 . ARG B 277 ? 1.9036 1.0700 1.7745 0.2447  -0.1555 0.1732  718 ARG B NH2 
4094 N N   . SER B 278 ? 2.0417 0.9199 2.0795 0.0042  0.0254  0.1802  719 SER B N   
4095 C CA  . SER B 278 ? 2.1298 0.9340 2.1832 -0.0311 0.0707  0.2349  719 SER B CA  
4096 C C   . SER B 278 ? 2.1001 0.9228 2.2374 -0.0957 0.0918  0.1823  719 SER B C   
4097 O O   . SER B 278 ? 1.9818 0.9032 2.1308 -0.1136 0.0723  0.1202  719 SER B O   
4098 C CB  . SER B 278 ? 2.1219 0.9589 2.0798 -0.0230 0.0832  0.3064  719 SER B CB  
4099 O OG  . SER B 278 ? 1.9840 0.9375 1.9100 -0.0367 0.0673  0.2699  719 SER B OG  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   442 ?   ?   ?   A . n 
A 1 2   SER 2   443 ?   ?   ?   A . n 
A 1 3   ASP 3   444 ?   ?   ?   A . n 
A 1 4   SER 4   445 ?   ?   ?   A . n 
A 1 5   SER 5   446 ?   ?   ?   A . n 
A 1 6   ASP 6   447 447 ASP ASP A . n 
A 1 7   ASP 7   448 448 ASP ASP A . n 
A 1 8   TRP 8   449 449 TRP TRP A . n 
A 1 9   GLU 9   450 450 GLU GLU A . n 
A 1 10  ILE 10  451 451 ILE ILE A . n 
A 1 11  PRO 11  452 452 PRO PRO A . n 
A 1 12  ASP 12  453 453 ASP ASP A . n 
A 1 13  GLY 13  454 454 GLY GLY A . n 
A 1 14  GLN 14  455 455 GLN GLN A . n 
A 1 15  ILE 15  456 456 ILE ILE A . n 
A 1 16  THR 16  457 457 THR THR A . n 
A 1 17  VAL 17  458 458 VAL VAL A . n 
A 1 18  GLY 18  459 459 GLY GLY A . n 
A 1 19  GLN 19  460 460 GLN GLN A . n 
A 1 20  ARG 20  461 461 ARG ARG A . n 
A 1 21  ILE 21  462 462 ILE ILE A . n 
A 1 22  GLY 22  463 463 GLY GLY A . n 
A 1 23  SER 23  464 464 SER SER A . n 
A 1 24  GLY 24  465 465 GLY GLY A . n 
A 1 25  SER 25  466 466 SER SER A . n 
A 1 26  PHE 26  467 467 PHE PHE A . n 
A 1 27  GLY 27  468 468 GLY GLY A . n 
A 1 28  THR 28  469 469 THR THR A . n 
A 1 29  VAL 29  470 470 VAL VAL A . n 
A 1 30  TYR 30  471 471 TYR TYR A . n 
A 1 31  LYS 31  472 472 LYS LYS A . n 
A 1 32  GLY 32  473 473 GLY GLY A . n 
A 1 33  LYS 33  474 474 LYS LYS A . n 
A 1 34  TRP 34  475 475 TRP TRP A . n 
A 1 35  HIS 35  476 476 HIS HIS A . n 
A 1 36  GLY 36  477 477 GLY GLY A . n 
A 1 37  ASP 37  478 478 ASP ASP A . n 
A 1 38  VAL 38  479 479 VAL VAL A . n 
A 1 39  ALA 39  480 480 ALA ALA A . n 
A 1 40  VAL 40  481 481 VAL VAL A . n 
A 1 41  LYS 41  482 482 LYS LYS A . n 
A 1 42  MET 42  483 483 MET MET A . n 
A 1 43  LEU 43  484 484 LEU LEU A . n 
A 1 44  ASN 44  485 485 ASN ASN A . n 
A 1 45  VAL 45  486 486 VAL VAL A . n 
A 1 46  THR 46  487 487 THR THR A . n 
A 1 47  ALA 47  488 488 ALA ALA A . n 
A 1 48  PRO 48  489 489 PRO PRO A . n 
A 1 49  THR 49  490 490 THR THR A . n 
A 1 50  PRO 50  491 491 PRO PRO A . n 
A 1 51  GLN 51  492 492 GLN GLN A . n 
A 1 52  GLN 52  493 493 GLN GLN A . n 
A 1 53  LEU 53  494 494 LEU LEU A . n 
A 1 54  GLN 54  495 495 GLN GLN A . n 
A 1 55  ALA 55  496 496 ALA ALA A . n 
A 1 56  PHE 56  497 497 PHE PHE A . n 
A 1 57  LYS 57  498 498 LYS LYS A . n 
A 1 58  ASN 58  499 499 ASN ASN A . n 
A 1 59  GLU 59  500 500 GLU GLU A . n 
A 1 60  VAL 60  501 501 VAL VAL A . n 
A 1 61  GLY 61  502 502 GLY GLY A . n 
A 1 62  VAL 62  503 503 VAL VAL A . n 
A 1 63  LEU 63  504 504 LEU LEU A . n 
A 1 64  ARG 64  505 505 ARG ARG A . n 
A 1 65  LYS 65  506 506 LYS LYS A . n 
A 1 66  THR 66  507 507 THR THR A . n 
A 1 67  ARG 67  508 508 ARG ARG A . n 
A 1 68  HIS 68  509 509 HIS HIS A . n 
A 1 69  VAL 69  510 510 VAL VAL A . n 
A 1 70  ASN 70  511 511 ASN ASN A . n 
A 1 71  ILE 71  512 512 ILE ILE A . n 
A 1 72  LEU 72  513 513 LEU LEU A . n 
A 1 73  LEU 73  514 514 LEU LEU A . n 
A 1 74  PHE 74  515 515 PHE PHE A . n 
A 1 75  MET 75  516 516 MET MET A . n 
A 1 76  GLY 76  517 517 GLY GLY A . n 
A 1 77  TYR 77  518 518 TYR TYR A . n 
A 1 78  SER 78  519 519 SER SER A . n 
A 1 79  THR 79  520 520 THR THR A . n 
A 1 80  LYS 80  521 521 LYS LYS A . n 
A 1 81  PRO 81  522 522 PRO PRO A . n 
A 1 82  GLN 82  523 523 GLN GLN A . n 
A 1 83  LEU 83  524 524 LEU LEU A . n 
A 1 84  ALA 84  525 525 ALA ALA A . n 
A 1 85  ILE 85  526 526 ILE ILE A . n 
A 1 86  VAL 86  527 527 VAL VAL A . n 
A 1 87  THR 87  528 528 THR THR A . n 
A 1 88  GLN 88  529 529 GLN GLN A . n 
A 1 89  TRP 89  530 530 TRP TRP A . n 
A 1 90  CYS 90  531 531 CYS CYS A . n 
A 1 91  GLU 91  532 532 GLU GLU A . n 
A 1 92  GLY 92  533 533 GLY GLY A . n 
A 1 93  SER 93  534 534 SER SER A . n 
A 1 94  SER 94  535 535 SER SER A . n 
A 1 95  LEU 95  536 536 LEU LEU A . n 
A 1 96  TYR 96  537 537 TYR TYR A . n 
A 1 97  HIS 97  538 538 HIS HIS A . n 
A 1 98  HIS 98  539 539 HIS HIS A . n 
A 1 99  LEU 99  540 540 LEU LEU A . n 
A 1 100 HIS 100 541 541 HIS HIS A . n 
A 1 101 ILE 101 542 542 ILE ILE A . n 
A 1 102 ILE 102 543 543 ILE ILE A . n 
A 1 103 GLU 103 544 544 GLU GLU A . n 
A 1 104 THR 104 545 545 THR THR A . n 
A 1 105 LYS 105 546 546 LYS LYS A . n 
A 1 106 PHE 106 547 547 PHE PHE A . n 
A 1 107 GLU 107 548 548 GLU GLU A . n 
A 1 108 MET 108 549 549 MET MET A . n 
A 1 109 ILE 109 550 550 ILE ILE A . n 
A 1 110 LYS 110 551 551 LYS LYS A . n 
A 1 111 LEU 111 552 552 LEU LEU A . n 
A 1 112 ILE 112 553 553 ILE ILE A . n 
A 1 113 ASP 113 554 554 ASP ASP A . n 
A 1 114 ILE 114 555 555 ILE ILE A . n 
A 1 115 ALA 115 556 556 ALA ALA A . n 
A 1 116 ARG 116 557 557 ARG ARG A . n 
A 1 117 GLN 117 558 558 GLN GLN A . n 
A 1 118 THR 118 559 559 THR THR A . n 
A 1 119 ALA 119 560 560 ALA ALA A . n 
A 1 120 GLN 120 561 561 GLN GLN A . n 
A 1 121 GLY 121 562 562 GLY GLY A . n 
A 1 122 MET 122 563 563 MET MET A . n 
A 1 123 ASP 123 564 564 ASP ASP A . n 
A 1 124 TYR 124 565 565 TYR TYR A . n 
A 1 125 LEU 125 566 566 LEU LEU A . n 
A 1 126 HIS 126 567 567 HIS HIS A . n 
A 1 127 ALA 127 568 568 ALA ALA A . n 
A 1 128 LYS 128 569 569 LYS LYS A . n 
A 1 129 SER 129 570 570 SER SER A . n 
A 1 130 ILE 130 571 571 ILE ILE A . n 
A 1 131 ILE 131 572 572 ILE ILE A . n 
A 1 132 HIS 132 573 573 HIS HIS A . n 
A 1 133 ARG 133 574 574 ARG ARG A . n 
A 1 134 ASP 134 575 575 ASP ASP A . n 
A 1 135 LEU 135 576 576 LEU LEU A . n 
A 1 136 LYS 136 577 577 LYS LYS A . n 
A 1 137 SER 137 578 578 SER SER A . n 
A 1 138 ASN 138 579 579 ASN ASN A . n 
A 1 139 ASN 139 580 580 ASN ASN A . n 
A 1 140 ILE 140 581 581 ILE ILE A . n 
A 1 141 PHE 141 582 582 PHE PHE A . n 
A 1 142 LEU 142 583 583 LEU LEU A . n 
A 1 143 HIS 143 584 584 HIS HIS A . n 
A 1 144 GLU 144 585 585 GLU GLU A . n 
A 1 145 ASP 145 586 586 ASP ASP A . n 
A 1 146 LEU 146 587 587 LEU LEU A . n 
A 1 147 THR 147 588 588 THR THR A . n 
A 1 148 VAL 148 589 589 VAL VAL A . n 
A 1 149 LYS 149 590 590 LYS LYS A . n 
A 1 150 ILE 150 591 591 ILE ILE A . n 
A 1 151 GLY 151 592 592 GLY GLY A . n 
A 1 152 ASP 152 593 593 ASP ASP A . n 
A 1 153 PHE 153 594 594 PHE PHE A . n 
A 1 154 GLY 154 595 595 GLY GLY A . n 
A 1 155 LEU 155 596 ?   ?   ?   A . n 
A 1 156 ALA 156 597 ?   ?   ?   A . n 
A 1 157 THR 157 598 ?   ?   ?   A . n 
A 1 158 VAL 158 599 ?   ?   ?   A . n 
A 1 159 LYS 159 600 ?   ?   ?   A . n 
A 1 160 SER 160 601 ?   ?   ?   A . n 
A 1 161 ARG 161 602 ?   ?   ?   A . n 
A 1 162 TRP 162 603 ?   ?   ?   A . n 
A 1 163 SER 163 604 ?   ?   ?   A . n 
A 1 164 GLY 164 605 ?   ?   ?   A . n 
A 1 165 SER 165 606 ?   ?   ?   A . n 
A 1 166 HIS 166 607 ?   ?   ?   A . n 
A 1 167 GLN 167 608 ?   ?   ?   A . n 
A 1 168 PHE 168 609 ?   ?   ?   A . n 
A 1 169 GLU 169 610 ?   ?   ?   A . n 
A 1 170 GLN 170 611 ?   ?   ?   A . n 
A 1 171 LEU 171 612 ?   ?   ?   A . n 
A 1 172 SER 172 613 ?   ?   ?   A . n 
A 1 173 GLY 173 614 614 GLY GLY A . n 
A 1 174 SER 174 615 615 SER SER A . n 
A 1 175 ILE 175 616 616 ILE ILE A . n 
A 1 176 LEU 176 617 617 LEU LEU A . n 
A 1 177 TRP 177 618 618 TRP TRP A . n 
A 1 178 MET 178 619 619 MET MET A . n 
A 1 179 ALA 179 620 620 ALA ALA A . n 
A 1 180 PRO 180 621 621 PRO PRO A . n 
A 1 181 GLU 181 622 622 GLU GLU A . n 
A 1 182 VAL 182 623 623 VAL VAL A . n 
A 1 183 ILE 183 624 624 ILE ILE A . n 
A 1 184 ARG 184 625 625 ARG ARG A . n 
A 1 185 MET 185 626 626 MET MET A . n 
A 1 186 GLN 186 627 627 GLN GLN A . n 
A 1 187 ASP 187 628 628 ASP ASP A . n 
A 1 188 LYS 188 629 629 LYS LYS A . n 
A 1 189 ASN 189 630 630 ASN ASN A . n 
A 1 190 PRO 190 631 631 PRO PRO A . n 
A 1 191 TYR 191 632 632 TYR TYR A . n 
A 1 192 SER 192 633 633 SER SER A . n 
A 1 193 PHE 193 634 634 PHE PHE A . n 
A 1 194 GLN 194 635 635 GLN GLN A . n 
A 1 195 SER 195 636 636 SER SER A . n 
A 1 196 ASP 196 637 637 ASP ASP A . n 
A 1 197 VAL 197 638 638 VAL VAL A . n 
A 1 198 TYR 198 639 639 TYR TYR A . n 
A 1 199 ALA 199 640 640 ALA ALA A . n 
A 1 200 PHE 200 641 641 PHE PHE A . n 
A 1 201 GLY 201 642 642 GLY GLY A . n 
A 1 202 ILE 202 643 643 ILE ILE A . n 
A 1 203 VAL 203 644 644 VAL VAL A . n 
A 1 204 LEU 204 645 645 LEU LEU A . n 
A 1 205 TYR 205 646 646 TYR TYR A . n 
A 1 206 GLU 206 647 647 GLU GLU A . n 
A 1 207 LEU 207 648 648 LEU LEU A . n 
A 1 208 MET 208 649 649 MET MET A . n 
A 1 209 THR 209 650 650 THR THR A . n 
A 1 210 GLY 210 651 651 GLY GLY A . n 
A 1 211 GLN 211 652 652 GLN GLN A . n 
A 1 212 LEU 212 653 653 LEU LEU A . n 
A 1 213 PRO 213 654 654 PRO PRO A . n 
A 1 214 TYR 214 655 655 TYR TYR A . n 
A 1 215 SER 215 656 656 SER SER A . n 
A 1 216 ASN 216 657 657 ASN ASN A . n 
A 1 217 ILE 217 658 658 ILE ILE A . n 
A 1 218 ASN 218 659 659 ASN ASN A . n 
A 1 219 ASN 219 660 660 ASN ASN A . n 
A 1 220 ARG 220 661 661 ARG ARG A . n 
A 1 221 ASP 221 662 662 ASP ASP A . n 
A 1 222 GLN 222 663 663 GLN GLN A . n 
A 1 223 ILE 223 664 664 ILE ILE A . n 
A 1 224 ILE 224 665 665 ILE ILE A . n 
A 1 225 PHE 225 666 666 PHE PHE A . n 
A 1 226 MET 226 667 667 MET MET A . n 
A 1 227 VAL 227 668 668 VAL VAL A . n 
A 1 228 GLY 228 669 669 GLY GLY A . n 
A 1 229 ARG 229 670 670 ARG ARG A . n 
A 1 230 GLY 230 671 671 GLY GLY A . n 
A 1 231 TYR 231 672 672 TYR TYR A . n 
A 1 232 LEU 232 673 673 LEU LEU A . n 
A 1 233 SER 233 674 674 SER SER A . n 
A 1 234 PRO 234 675 675 PRO PRO A . n 
A 1 235 ASP 235 676 676 ASP ASP A . n 
A 1 236 LEU 236 677 677 LEU LEU A . n 
A 1 237 SER 237 678 678 SER SER A . n 
A 1 238 LYS 238 679 679 LYS LYS A . n 
A 1 239 VAL 239 680 680 VAL VAL A . n 
A 1 240 ARG 240 681 681 ARG ARG A . n 
A 1 241 SER 241 682 682 SER SER A . n 
A 1 242 ASN 242 683 683 ASN ASN A . n 
A 1 243 CYS 243 684 684 CYS CYS A . n 
A 1 244 PRO 244 685 685 PRO PRO A . n 
A 1 245 LYS 245 686 686 LYS LYS A . n 
A 1 246 ALA 246 687 687 ALA ALA A . n 
A 1 247 MET 247 688 688 MET MET A . n 
A 1 248 LYS 248 689 689 LYS LYS A . n 
A 1 249 ARG 249 690 690 ARG ARG A . n 
A 1 250 LEU 250 691 691 LEU LEU A . n 
A 1 251 MET 251 692 692 MET MET A . n 
A 1 252 ALA 252 693 693 ALA ALA A . n 
A 1 253 GLU 253 694 694 GLU GLU A . n 
A 1 254 CYS 254 695 695 CYS CYS A . n 
A 1 255 LEU 255 696 696 LEU LEU A . n 
A 1 256 LYS 256 697 697 LYS LYS A . n 
A 1 257 LYS 257 698 698 LYS LYS A . n 
A 1 258 LYS 258 699 699 LYS LYS A . n 
A 1 259 ARG 259 700 700 ARG ARG A . n 
A 1 260 ASP 260 701 701 ASP ASP A . n 
A 1 261 GLU 261 702 702 GLU GLU A . n 
A 1 262 ARG 262 703 703 ARG ARG A . n 
A 1 263 PRO 263 704 704 PRO PRO A . n 
A 1 264 LEU 264 705 705 LEU LEU A . n 
A 1 265 PHE 265 706 706 PHE PHE A . n 
A 1 266 PRO 266 707 707 PRO PRO A . n 
A 1 267 GLN 267 708 708 GLN GLN A . n 
A 1 268 ILE 268 709 709 ILE ILE A . n 
A 1 269 LEU 269 710 710 LEU LEU A . n 
A 1 270 ALA 270 711 711 ALA ALA A . n 
A 1 271 SER 271 712 712 SER SER A . n 
A 1 272 ILE 272 713 713 ILE ILE A . n 
A 1 273 GLU 273 714 714 GLU GLU A . n 
A 1 274 LEU 274 715 715 LEU LEU A . n 
A 1 275 LEU 275 716 716 LEU LEU A . n 
A 1 276 ALA 276 717 717 ALA ALA A . n 
A 1 277 ARG 277 718 718 ARG ARG A . n 
A 1 278 SER 278 719 719 SER SER A . n 
A 1 279 LEU 279 720 720 LEU LEU A . n 
A 1 280 PRO 280 721 721 PRO PRO A . n 
A 1 281 LYS 281 722 ?   ?   ?   A . n 
A 1 282 ILE 282 723 ?   ?   ?   A . n 
A 1 283 HIS 283 724 ?   ?   ?   A . n 
A 1 284 ARG 284 725 ?   ?   ?   A . n 
B 1 1   GLY 1   442 ?   ?   ?   B . n 
B 1 2   SER 2   443 ?   ?   ?   B . n 
B 1 3   ASP 3   444 ?   ?   ?   B . n 
B 1 4   SER 4   445 ?   ?   ?   B . n 
B 1 5   SER 5   446 ?   ?   ?   B . n 
B 1 6   ASP 6   447 447 ASP ASP B . n 
B 1 7   ASP 7   448 448 ASP ASP B . n 
B 1 8   TRP 8   449 449 TRP TRP B . n 
B 1 9   GLU 9   450 450 GLU GLU B . n 
B 1 10  ILE 10  451 451 ILE ILE B . n 
B 1 11  PRO 11  452 452 PRO PRO B . n 
B 1 12  ASP 12  453 453 ASP ASP B . n 
B 1 13  GLY 13  454 454 GLY GLY B . n 
B 1 14  GLN 14  455 455 GLN GLN B . n 
B 1 15  ILE 15  456 456 ILE ILE B . n 
B 1 16  THR 16  457 457 THR THR B . n 
B 1 17  VAL 17  458 458 VAL VAL B . n 
B 1 18  GLY 18  459 459 GLY GLY B . n 
B 1 19  GLN 19  460 460 GLN GLN B . n 
B 1 20  ARG 20  461 461 ARG ARG B . n 
B 1 21  ILE 21  462 462 ILE ILE B . n 
B 1 22  GLY 22  463 463 GLY GLY B . n 
B 1 23  SER 23  464 464 SER SER B . n 
B 1 24  GLY 24  465 465 GLY GLY B . n 
B 1 25  SER 25  466 466 SER SER B . n 
B 1 26  PHE 26  467 467 PHE PHE B . n 
B 1 27  GLY 27  468 468 GLY GLY B . n 
B 1 28  THR 28  469 469 THR THR B . n 
B 1 29  VAL 29  470 470 VAL VAL B . n 
B 1 30  TYR 30  471 471 TYR TYR B . n 
B 1 31  LYS 31  472 472 LYS LYS B . n 
B 1 32  GLY 32  473 473 GLY GLY B . n 
B 1 33  LYS 33  474 474 LYS LYS B . n 
B 1 34  TRP 34  475 475 TRP TRP B . n 
B 1 35  HIS 35  476 476 HIS HIS B . n 
B 1 36  GLY 36  477 477 GLY GLY B . n 
B 1 37  ASP 37  478 478 ASP ASP B . n 
B 1 38  VAL 38  479 479 VAL VAL B . n 
B 1 39  ALA 39  480 480 ALA ALA B . n 
B 1 40  VAL 40  481 481 VAL VAL B . n 
B 1 41  LYS 41  482 482 LYS LYS B . n 
B 1 42  MET 42  483 483 MET MET B . n 
B 1 43  LEU 43  484 484 LEU LEU B . n 
B 1 44  ASN 44  485 485 ASN ASN B . n 
B 1 45  VAL 45  486 486 VAL VAL B . n 
B 1 46  THR 46  487 487 THR THR B . n 
B 1 47  ALA 47  488 488 ALA ALA B . n 
B 1 48  PRO 48  489 489 PRO PRO B . n 
B 1 49  THR 49  490 490 THR THR B . n 
B 1 50  PRO 50  491 491 PRO PRO B . n 
B 1 51  GLN 51  492 492 GLN GLN B . n 
B 1 52  GLN 52  493 493 GLN GLN B . n 
B 1 53  LEU 53  494 494 LEU LEU B . n 
B 1 54  GLN 54  495 495 GLN GLN B . n 
B 1 55  ALA 55  496 496 ALA ALA B . n 
B 1 56  PHE 56  497 497 PHE PHE B . n 
B 1 57  LYS 57  498 498 LYS LYS B . n 
B 1 58  ASN 58  499 499 ASN ASN B . n 
B 1 59  GLU 59  500 500 GLU GLU B . n 
B 1 60  VAL 60  501 501 VAL VAL B . n 
B 1 61  GLY 61  502 502 GLY GLY B . n 
B 1 62  VAL 62  503 503 VAL VAL B . n 
B 1 63  LEU 63  504 504 LEU LEU B . n 
B 1 64  ARG 64  505 505 ARG ARG B . n 
B 1 65  LYS 65  506 506 LYS LYS B . n 
B 1 66  THR 66  507 507 THR THR B . n 
B 1 67  ARG 67  508 508 ARG ARG B . n 
B 1 68  HIS 68  509 509 HIS HIS B . n 
B 1 69  VAL 69  510 510 VAL VAL B . n 
B 1 70  ASN 70  511 511 ASN ASN B . n 
B 1 71  ILE 71  512 512 ILE ILE B . n 
B 1 72  LEU 72  513 513 LEU LEU B . n 
B 1 73  LEU 73  514 514 LEU LEU B . n 
B 1 74  PHE 74  515 515 PHE PHE B . n 
B 1 75  MET 75  516 516 MET MET B . n 
B 1 76  GLY 76  517 517 GLY GLY B . n 
B 1 77  TYR 77  518 518 TYR TYR B . n 
B 1 78  SER 78  519 519 SER SER B . n 
B 1 79  THR 79  520 520 THR THR B . n 
B 1 80  LYS 80  521 521 LYS LYS B . n 
B 1 81  PRO 81  522 522 PRO PRO B . n 
B 1 82  GLN 82  523 523 GLN GLN B . n 
B 1 83  LEU 83  524 524 LEU LEU B . n 
B 1 84  ALA 84  525 525 ALA ALA B . n 
B 1 85  ILE 85  526 526 ILE ILE B . n 
B 1 86  VAL 86  527 527 VAL VAL B . n 
B 1 87  THR 87  528 528 THR THR B . n 
B 1 88  GLN 88  529 529 GLN GLN B . n 
B 1 89  TRP 89  530 530 TRP TRP B . n 
B 1 90  CYS 90  531 531 CYS CYS B . n 
B 1 91  GLU 91  532 532 GLU GLU B . n 
B 1 92  GLY 92  533 533 GLY GLY B . n 
B 1 93  SER 93  534 534 SER SER B . n 
B 1 94  SER 94  535 535 SER SER B . n 
B 1 95  LEU 95  536 536 LEU LEU B . n 
B 1 96  TYR 96  537 537 TYR TYR B . n 
B 1 97  HIS 97  538 538 HIS HIS B . n 
B 1 98  HIS 98  539 539 HIS HIS B . n 
B 1 99  LEU 99  540 540 LEU LEU B . n 
B 1 100 HIS 100 541 541 HIS HIS B . n 
B 1 101 ILE 101 542 542 ILE ILE B . n 
B 1 102 ILE 102 543 543 ILE ILE B . n 
B 1 103 GLU 103 544 544 GLU GLU B . n 
B 1 104 THR 104 545 545 THR THR B . n 
B 1 105 LYS 105 546 546 LYS LYS B . n 
B 1 106 PHE 106 547 547 PHE PHE B . n 
B 1 107 GLU 107 548 548 GLU GLU B . n 
B 1 108 MET 108 549 549 MET MET B . n 
B 1 109 ILE 109 550 550 ILE ILE B . n 
B 1 110 LYS 110 551 551 LYS LYS B . n 
B 1 111 LEU 111 552 552 LEU LEU B . n 
B 1 112 ILE 112 553 553 ILE ILE B . n 
B 1 113 ASP 113 554 554 ASP ASP B . n 
B 1 114 ILE 114 555 555 ILE ILE B . n 
B 1 115 ALA 115 556 556 ALA ALA B . n 
B 1 116 ARG 116 557 557 ARG ARG B . n 
B 1 117 GLN 117 558 558 GLN GLN B . n 
B 1 118 THR 118 559 559 THR THR B . n 
B 1 119 ALA 119 560 560 ALA ALA B . n 
B 1 120 GLN 120 561 561 GLN GLN B . n 
B 1 121 GLY 121 562 562 GLY GLY B . n 
B 1 122 MET 122 563 563 MET MET B . n 
B 1 123 ASP 123 564 564 ASP ASP B . n 
B 1 124 TYR 124 565 565 TYR TYR B . n 
B 1 125 LEU 125 566 566 LEU LEU B . n 
B 1 126 HIS 126 567 567 HIS HIS B . n 
B 1 127 ALA 127 568 568 ALA ALA B . n 
B 1 128 LYS 128 569 569 LYS LYS B . n 
B 1 129 SER 129 570 570 SER SER B . n 
B 1 130 ILE 130 571 571 ILE ILE B . n 
B 1 131 ILE 131 572 572 ILE ILE B . n 
B 1 132 HIS 132 573 573 HIS HIS B . n 
B 1 133 ARG 133 574 574 ARG ARG B . n 
B 1 134 ASP 134 575 575 ASP ASP B . n 
B 1 135 LEU 135 576 576 LEU LEU B . n 
B 1 136 LYS 136 577 577 LYS LYS B . n 
B 1 137 SER 137 578 578 SER SER B . n 
B 1 138 ASN 138 579 579 ASN ASN B . n 
B 1 139 ASN 139 580 580 ASN ASN B . n 
B 1 140 ILE 140 581 581 ILE ILE B . n 
B 1 141 PHE 141 582 582 PHE PHE B . n 
B 1 142 LEU 142 583 583 LEU LEU B . n 
B 1 143 HIS 143 584 584 HIS HIS B . n 
B 1 144 GLU 144 585 585 GLU GLU B . n 
B 1 145 ASP 145 586 586 ASP ASP B . n 
B 1 146 LEU 146 587 587 LEU LEU B . n 
B 1 147 THR 147 588 588 THR THR B . n 
B 1 148 VAL 148 589 589 VAL VAL B . n 
B 1 149 LYS 149 590 590 LYS LYS B . n 
B 1 150 ILE 150 591 591 ILE ILE B . n 
B 1 151 GLY 151 592 592 GLY GLY B . n 
B 1 152 ASP 152 593 593 ASP ASP B . n 
B 1 153 PHE 153 594 594 PHE PHE B . n 
B 1 154 GLY 154 595 595 GLY GLY B . n 
B 1 155 LEU 155 596 596 LEU LEU B . n 
B 1 156 ALA 156 597 ?   ?   ?   B . n 
B 1 157 THR 157 598 ?   ?   ?   B . n 
B 1 158 VAL 158 599 ?   ?   ?   B . n 
B 1 159 LYS 159 600 ?   ?   ?   B . n 
B 1 160 SER 160 601 ?   ?   ?   B . n 
B 1 161 ARG 161 602 ?   ?   ?   B . n 
B 1 162 TRP 162 603 ?   ?   ?   B . n 
B 1 163 SER 163 604 ?   ?   ?   B . n 
B 1 164 GLY 164 605 ?   ?   ?   B . n 
B 1 165 SER 165 606 ?   ?   ?   B . n 
B 1 166 HIS 166 607 ?   ?   ?   B . n 
B 1 167 GLN 167 608 ?   ?   ?   B . n 
B 1 168 PHE 168 609 ?   ?   ?   B . n 
B 1 169 GLU 169 610 ?   ?   ?   B . n 
B 1 170 GLN 170 611 ?   ?   ?   B . n 
B 1 171 LEU 171 612 ?   ?   ?   B . n 
B 1 172 SER 172 613 ?   ?   ?   B . n 
B 1 173 GLY 173 614 614 GLY GLY B . n 
B 1 174 SER 174 615 615 SER SER B . n 
B 1 175 ILE 175 616 616 ILE ILE B . n 
B 1 176 LEU 176 617 617 LEU LEU B . n 
B 1 177 TRP 177 618 618 TRP TRP B . n 
B 1 178 MET 178 619 619 MET MET B . n 
B 1 179 ALA 179 620 620 ALA ALA B . n 
B 1 180 PRO 180 621 621 PRO PRO B . n 
B 1 181 GLU 181 622 622 GLU GLU B . n 
B 1 182 VAL 182 623 623 VAL VAL B . n 
B 1 183 ILE 183 624 624 ILE ILE B . n 
B 1 184 ARG 184 625 625 ARG ARG B . n 
B 1 185 MET 185 626 626 MET MET B . n 
B 1 186 GLN 186 627 627 GLN GLN B . n 
B 1 187 ASP 187 628 628 ASP ASP B . n 
B 1 188 LYS 188 629 629 LYS LYS B . n 
B 1 189 ASN 189 630 630 ASN ASN B . n 
B 1 190 PRO 190 631 631 PRO PRO B . n 
B 1 191 TYR 191 632 632 TYR TYR B . n 
B 1 192 SER 192 633 633 SER SER B . n 
B 1 193 PHE 193 634 634 PHE PHE B . n 
B 1 194 GLN 194 635 635 GLN GLN B . n 
B 1 195 SER 195 636 636 SER SER B . n 
B 1 196 ASP 196 637 637 ASP ASP B . n 
B 1 197 VAL 197 638 638 VAL VAL B . n 
B 1 198 TYR 198 639 639 TYR TYR B . n 
B 1 199 ALA 199 640 640 ALA ALA B . n 
B 1 200 PHE 200 641 641 PHE PHE B . n 
B 1 201 GLY 201 642 642 GLY GLY B . n 
B 1 202 ILE 202 643 643 ILE ILE B . n 
B 1 203 VAL 203 644 644 VAL VAL B . n 
B 1 204 LEU 204 645 645 LEU LEU B . n 
B 1 205 TYR 205 646 646 TYR TYR B . n 
B 1 206 GLU 206 647 647 GLU GLU B . n 
B 1 207 LEU 207 648 648 LEU LEU B . n 
B 1 208 MET 208 649 649 MET MET B . n 
B 1 209 THR 209 650 650 THR THR B . n 
B 1 210 GLY 210 651 651 GLY GLY B . n 
B 1 211 GLN 211 652 652 GLN GLN B . n 
B 1 212 LEU 212 653 653 LEU LEU B . n 
B 1 213 PRO 213 654 654 PRO PRO B . n 
B 1 214 TYR 214 655 655 TYR TYR B . n 
B 1 215 SER 215 656 656 SER SER B . n 
B 1 216 ASN 216 657 657 ASN ASN B . n 
B 1 217 ILE 217 658 658 ILE ILE B . n 
B 1 218 ASN 218 659 659 ASN ASN B . n 
B 1 219 ASN 219 660 660 ASN ASN B . n 
B 1 220 ARG 220 661 661 ARG ARG B . n 
B 1 221 ASP 221 662 662 ASP ASP B . n 
B 1 222 GLN 222 663 663 GLN GLN B . n 
B 1 223 ILE 223 664 664 ILE ILE B . n 
B 1 224 ILE 224 665 665 ILE ILE B . n 
B 1 225 PHE 225 666 666 PHE PHE B . n 
B 1 226 MET 226 667 667 MET MET B . n 
B 1 227 VAL 227 668 668 VAL VAL B . n 
B 1 228 GLY 228 669 669 GLY GLY B . n 
B 1 229 ARG 229 670 670 ARG ARG B . n 
B 1 230 GLY 230 671 671 GLY GLY B . n 
B 1 231 TYR 231 672 672 TYR TYR B . n 
B 1 232 LEU 232 673 673 LEU LEU B . n 
B 1 233 SER 233 674 674 SER SER B . n 
B 1 234 PRO 234 675 675 PRO PRO B . n 
B 1 235 ASP 235 676 676 ASP ASP B . n 
B 1 236 LEU 236 677 677 LEU LEU B . n 
B 1 237 SER 237 678 678 SER SER B . n 
B 1 238 LYS 238 679 679 LYS LYS B . n 
B 1 239 VAL 239 680 680 VAL VAL B . n 
B 1 240 ARG 240 681 681 ARG ARG B . n 
B 1 241 SER 241 682 682 SER SER B . n 
B 1 242 ASN 242 683 683 ASN ASN B . n 
B 1 243 CYS 243 684 684 CYS CYS B . n 
B 1 244 PRO 244 685 685 PRO PRO B . n 
B 1 245 LYS 245 686 686 LYS LYS B . n 
B 1 246 ALA 246 687 687 ALA ALA B . n 
B 1 247 MET 247 688 688 MET MET B . n 
B 1 248 LYS 248 689 689 LYS LYS B . n 
B 1 249 ARG 249 690 690 ARG ARG B . n 
B 1 250 LEU 250 691 691 LEU LEU B . n 
B 1 251 MET 251 692 692 MET MET B . n 
B 1 252 ALA 252 693 693 ALA ALA B . n 
B 1 253 GLU 253 694 694 GLU GLU B . n 
B 1 254 CYS 254 695 695 CYS CYS B . n 
B 1 255 LEU 255 696 696 LEU LEU B . n 
B 1 256 LYS 256 697 697 LYS LYS B . n 
B 1 257 LYS 257 698 698 LYS LYS B . n 
B 1 258 LYS 258 699 699 LYS LYS B . n 
B 1 259 ARG 259 700 700 ARG ARG B . n 
B 1 260 ASP 260 701 701 ASP ASP B . n 
B 1 261 GLU 261 702 702 GLU GLU B . n 
B 1 262 ARG 262 703 703 ARG ARG B . n 
B 1 263 PRO 263 704 704 PRO PRO B . n 
B 1 264 LEU 264 705 705 LEU LEU B . n 
B 1 265 PHE 265 706 706 PHE PHE B . n 
B 1 266 PRO 266 707 707 PRO PRO B . n 
B 1 267 GLN 267 708 708 GLN GLN B . n 
B 1 268 ILE 268 709 709 ILE ILE B . n 
B 1 269 LEU 269 710 710 LEU LEU B . n 
B 1 270 ALA 270 711 711 ALA ALA B . n 
B 1 271 SER 271 712 712 SER SER B . n 
B 1 272 ILE 272 713 713 ILE ILE B . n 
B 1 273 GLU 273 714 714 GLU GLU B . n 
B 1 274 LEU 274 715 715 LEU LEU B . n 
B 1 275 LEU 275 716 716 LEU LEU B . n 
B 1 276 ALA 276 717 717 ALA ALA B . n 
B 1 277 ARG 277 718 718 ARG ARG B . n 
B 1 278 SER 278 719 719 SER SER B . n 
B 1 279 LEU 279 720 ?   ?   ?   B . n 
B 1 280 PRO 280 721 ?   ?   ?   B . n 
B 1 281 LYS 281 722 ?   ?   ?   B . n 
B 1 282 ILE 282 723 ?   ?   ?   B . n 
B 1 283 HIS 283 724 ?   ?   ?   B . n 
B 1 284 ARG 284 725 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 1SU 1  901  901 1SU LIG A . 
D 2 1SU 1  901  901 1SU LIG B . 
E 3 HOH 1  1001 2   HOH HOH A . 
E 3 HOH 2  1002 13  HOH HOH A . 
E 3 HOH 3  1003 17  HOH HOH A . 
E 3 HOH 4  1004 24  HOH HOH A . 
E 3 HOH 5  1005 25  HOH HOH A . 
E 3 HOH 6  1006 31  HOH HOH A . 
E 3 HOH 7  1007 40  HOH HOH A . 
E 3 HOH 8  1008 43  HOH HOH A . 
E 3 HOH 9  1009 44  HOH HOH A . 
E 3 HOH 10 1010 54  HOH HOH A . 
E 3 HOH 11 1011 61  HOH HOH A . 
E 3 HOH 12 1012 68  HOH HOH A . 
E 3 HOH 13 1013 89  HOH HOH A . 
E 3 HOH 14 1014 90  HOH HOH A . 
E 3 HOH 15 1015 94  HOH HOH A . 
F 3 HOH 1  1001 1   HOH HOH B . 
F 3 HOH 2  1002 4   HOH HOH B . 
F 3 HOH 3  1003 6   HOH HOH B . 
F 3 HOH 4  1004 9   HOH HOH B . 
F 3 HOH 5  1005 12  HOH HOH B . 
F 3 HOH 6  1006 15  HOH HOH B . 
F 3 HOH 7  1007 18  HOH HOH B . 
F 3 HOH 8  1008 20  HOH HOH B . 
F 3 HOH 9  1009 22  HOH HOH B . 
F 3 HOH 10 1010 32  HOH HOH B . 
F 3 HOH 11 1011 33  HOH HOH B . 
F 3 HOH 12 1012 36  HOH HOH B . 
F 3 HOH 13 1013 42  HOH HOH B . 
F 3 HOH 14 1014 49  HOH HOH B . 
F 3 HOH 15 1015 50  HOH HOH B . 
F 3 HOH 16 1016 51  HOH HOH B . 
F 3 HOH 17 1017 59  HOH HOH B . 
F 3 HOH 18 1018 60  HOH HOH B . 
F 3 HOH 19 1019 67  HOH HOH B . 
F 3 HOH 20 1020 77  HOH HOH B . 
F 3 HOH 21 1021 87  HOH HOH B . 
F 3 HOH 22 1022 91  HOH HOH B . 
F 3 HOH 23 1023 95  HOH HOH B . 
F 3 HOH 24 1024 96  HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly              ?    dimeric   2 
2 author_and_software_defined_assembly PISA monomeric 1 
3 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F 
2 1 A,C,E       
3 1 B,D,F       
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-07-24 
2 'Structure model' 1 1 2013-09-04 
3 'Structure model' 1 2 2017-11-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1  ? refined 46.6073 -33.6626 17.7393  0.3584 0.3159 0.3828 0.0583  0.0248  0.0503  8.6934 11.6401 9.3452 
-0.2572 3.3912  -3.2237 0.1778  -0.2353 0.0575  -0.9883 -0.5725 -1.2551 0.1873  0.8406  0.1077  
'X-RAY DIFFRACTION' 2  ? refined 44.3592 -34.9543 5.1776   0.1158 0.1361 0.2612 0.0433  0.0974  0.0698  1.4605 6.4747  3.2736 
0.5720  -0.1012 2.0883  0.0450  -0.1161 0.0712  -0.2468 -0.0291 -0.5593 0.2438  -0.0226 0.2295  
'X-RAY DIFFRACTION' 3  ? refined 44.3852 -37.2362 -1.1347  0.3157 0.1597 0.0275 -0.0535 0.0665  -0.0373 5.5404 8.4751  3.0152 
-1.7735 1.5348  1.8649  0.1903  0.0289  -0.2192 -0.4071 0.0235  -0.1364 0.1227  -0.3212 0.3082  
'X-RAY DIFFRACTION' 4  ? refined 49.2665 -42.7441 -7.9571  0.2042 0.1256 0.1002 -0.0221 0.0306  -0.0226 5.9221 7.3528  3.9252 
-2.0268 -2.4078 2.4095  0.0587  0.1795  -0.2382 -0.1944 0.2538  -0.6627 0.1801  -0.2990 0.6059  
'X-RAY DIFFRACTION' 5  ? refined 47.2332 -55.6821 -11.8917 0.1332 0.1144 0.0697 -0.0011 0.0114  -0.0608 3.7362 4.6629  2.6714 
-0.8302 -1.4913 1.0227  0.0346  -0.1245 0.0899  0.3230  -0.3296 0.1580  -0.2863 -0.0442 -0.1741 
'X-RAY DIFFRACTION' 6  ? refined 40.2625 -39.8680 -19.0557 0.5579 0.5155 0.1540 0.1858  -0.0021 0.0279  3.5880 6.9011  4.9758 
-0.1433 1.9962  -0.0540 0.4666  -0.2956 -0.1710 0.8520  0.0935  0.8491  -0.8448 -0.4632 -0.4810 
'X-RAY DIFFRACTION' 7  ? refined 34.1333 -12.5130 -7.4140  0.6041 0.2478 0.4885 0.1797  -0.0807 0.0548  5.3556 8.8544  5.6361 
0.0956  0.1619  -0.4546 -0.1987 0.0600  0.1387  0.1152  1.0791  0.5302  -0.8954 -0.8953 -0.4767 
'X-RAY DIFFRACTION' 8  ? refined 31.1752 -15.5986 3.3498   0.3220 0.0989 0.3103 0.0791  -0.0736 -0.0307 5.0930 1.6126  3.2904 
-0.7997 -1.3398 0.2259  -0.0498 -0.0225 0.0724  0.4372  0.6337  -0.1162 -0.3927 -0.2656 -0.1775 
'X-RAY DIFFRACTION' 9  ? refined 27.2736 -21.4643 13.3768  0.1232 0.1472 0.1256 0.0056  0.0242  -0.0827 6.1643 5.6339  2.8889 
-0.4992 -0.6549 1.5317  0.2181  0.0126  -0.2307 0.3554  -0.3890 -0.1538 0.0753  0.1889  0.0156  
'X-RAY DIFFRACTION' 10 ? refined 23.8859 -4.0228  16.8797  0.3497 0.3169 0.3671 -0.0492 0.1542  0.0804  8.4977 6.7421  7.5828 
-3.3049 -0.5728 3.9471  0.2771  0.2859  -0.5629 0.9519  1.5559  -0.8588 -0.7253 -1.2390 0.8558  
'X-RAY DIFFRACTION' 11 ? refined 13.9834 -11.8771 21.0743  0.1698 0.0830 0.0684 -0.0472 0.0712  0.0115  4.8271 3.9190  2.9579 
-1.2378 -0.8851 2.1088  0.0327  -0.0102 -0.0225 0.1038  -0.2643 0.2096  0.2253  0.1585  -0.2519 
'X-RAY DIFFRACTION' 12 ? refined 23.9988 -20.1304 28.2847  0.5365 0.3019 0.1826 0.0057  -0.0708 0.0502  9.4412 6.1666  5.3668 
-2.4898 -1.6833 0.2377  -0.0108 0.1534  -0.1426 -0.7260 -0.8567 -0.0200 1.3755  0.8652  0.1228  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1  A 447 A 474 ? . . . . ? 
'X-RAY DIFFRACTION' 2  2  A 475 A 568 ? . . . . ? 
'X-RAY DIFFRACTION' 3  3  A 569 A 586 ? . . . . ? 
'X-RAY DIFFRACTION' 4  4  A 587 A 650 ? . . . . ? 
'X-RAY DIFFRACTION' 5  5  A 651 A 685 ? . . . . ? 
'X-RAY DIFFRACTION' 6  6  A 686 A 721 ? . . . . ? 
'X-RAY DIFFRACTION' 7  7  B 447 B 490 ? . . . . ? 
'X-RAY DIFFRACTION' 8  8  B 491 B 548 ? . . . . ? 
'X-RAY DIFFRACTION' 9  9  B 549 B 591 ? . . . . ? 
'X-RAY DIFFRACTION' 10 10 B 592 B 633 ? . . . . ? 
'X-RAY DIFFRACTION' 11 11 B 634 B 685 ? . . . . ? 
'X-RAY DIFFRACTION' 12 12 B 686 B 719 ? . . . . ? 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALEPACK   .        ?                program 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
2 REFMAC      5.7.0029 ?                program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
3 PDB_EXTRACT 3.11     'April 22, 2011' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
4 HKL-2000    .        ?                ?       ?                    ?                        'data collection' ? ?          ? 
5 DENZO       .        ?                ?       ?                    ?                        'data reduction'  ? ?          ? 
6 MOLREP      .        ?                ?       ?                    ?                        phasing           ? ?          ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 466 ? ? -49.31  -18.67  
2  1 THR A 487 ? ? -72.47  -72.80  
3  1 ARG A 574 ? ? 72.24   -17.17  
4  1 ASP A 575 ? ? -143.78 41.96   
5  1 LEU A 583 ? ? -109.51 75.99   
6  1 ASP A 586 ? ? 56.29   19.55   
7  1 LEU A 587 ? ? -134.54 -56.23  
8  1 MET A 626 ? ? 54.41   -100.04 
9  1 GLN A 627 ? ? 57.67   -64.40  
10 1 ASN B 485 ? ? -103.41 60.60   
11 1 PRO B 491 ? ? -36.50  -39.17  
12 1 LYS B 521 ? ? -60.10  -73.32  
13 1 ILE B 542 ? ? -109.29 -75.32  
14 1 ARG B 574 ? ? 81.78   -18.05  
15 1 ASP B 575 ? ? -146.58 50.26   
16 1 ASP B 586 ? ? 58.47   17.15   
17 1 LEU B 587 ? ? -148.37 -1.00   
18 1 PHE B 594 ? ? -113.95 66.59   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 521 ? CG ? A LYS 80 CG 
2 1 Y 1 A LYS 521 ? CD ? A LYS 80 CD 
3 1 Y 1 A LYS 521 ? CE ? A LYS 80 CE 
4 1 Y 1 A LYS 521 ? NZ ? A LYS 80 NZ 
5 1 Y 1 B LYS 521 ? CG ? B LYS 80 CG 
6 1 Y 1 B LYS 521 ? CD ? B LYS 80 CD 
7 1 Y 1 B LYS 521 ? CE ? B LYS 80 CE 
8 1 Y 1 B LYS 521 ? NZ ? B LYS 80 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 442 ? A GLY 1   
2  1 Y 1 A SER 443 ? A SER 2   
3  1 Y 1 A ASP 444 ? A ASP 3   
4  1 Y 1 A SER 445 ? A SER 4   
5  1 Y 1 A SER 446 ? A SER 5   
6  1 Y 1 A LEU 596 ? A LEU 155 
7  1 Y 1 A ALA 597 ? A ALA 156 
8  1 Y 1 A THR 598 ? A THR 157 
9  1 Y 1 A VAL 599 ? A VAL 158 
10 1 Y 1 A LYS 600 ? A LYS 159 
11 1 Y 1 A SER 601 ? A SER 160 
12 1 Y 1 A ARG 602 ? A ARG 161 
13 1 Y 1 A TRP 603 ? A TRP 162 
14 1 Y 1 A SER 604 ? A SER 163 
15 1 Y 1 A GLY 605 ? A GLY 164 
16 1 Y 1 A SER 606 ? A SER 165 
17 1 Y 1 A HIS 607 ? A HIS 166 
18 1 Y 1 A GLN 608 ? A GLN 167 
19 1 Y 1 A PHE 609 ? A PHE 168 
20 1 Y 1 A GLU 610 ? A GLU 169 
21 1 Y 1 A GLN 611 ? A GLN 170 
22 1 Y 1 A LEU 612 ? A LEU 171 
23 1 Y 1 A SER 613 ? A SER 172 
24 1 Y 1 A LYS 722 ? A LYS 281 
25 1 Y 1 A ILE 723 ? A ILE 282 
26 1 Y 1 A HIS 724 ? A HIS 283 
27 1 Y 1 A ARG 725 ? A ARG 284 
28 1 Y 1 B GLY 442 ? B GLY 1   
29 1 Y 1 B SER 443 ? B SER 2   
30 1 Y 1 B ASP 444 ? B ASP 3   
31 1 Y 1 B SER 445 ? B SER 4   
32 1 Y 1 B SER 446 ? B SER 5   
33 1 Y 1 B ALA 597 ? B ALA 156 
34 1 Y 1 B THR 598 ? B THR 157 
35 1 Y 1 B VAL 599 ? B VAL 158 
36 1 Y 1 B LYS 600 ? B LYS 159 
37 1 Y 1 B SER 601 ? B SER 160 
38 1 Y 1 B ARG 602 ? B ARG 161 
39 1 Y 1 B TRP 603 ? B TRP 162 
40 1 Y 1 B SER 604 ? B SER 163 
41 1 Y 1 B GLY 605 ? B GLY 164 
42 1 Y 1 B SER 606 ? B SER 165 
43 1 Y 1 B HIS 607 ? B HIS 166 
44 1 Y 1 B GLN 608 ? B GLN 167 
45 1 Y 1 B PHE 609 ? B PHE 168 
46 1 Y 1 B GLU 610 ? B GLU 169 
47 1 Y 1 B GLN 611 ? B GLN 170 
48 1 Y 1 B LEU 612 ? B LEU 171 
49 1 Y 1 B SER 613 ? B SER 172 
50 1 Y 1 B LEU 720 ? B LEU 279 
51 1 Y 1 B PRO 721 ? B PRO 280 
52 1 Y 1 B LYS 722 ? B LYS 281 
53 1 Y 1 B ILE 723 ? B ILE 282 
54 1 Y 1 B HIS 724 ? B HIS 283 
55 1 Y 1 B ARG 725 ? B ARG 284 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'N-{7-cyano-6-[4-fluoro-3-({[3-(trifluoromethyl)phenyl]acetyl}amino)phenoxy]-1,3-benzothiazol-2-yl}cyclopropanecarboxamide' 1SU 
3 water                                                                                                                       HOH 
#