data_4KZI
# 
_entry.id   4KZI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4KZI         
RCSB  RCSB079990   
WWPDB D_1000079990 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4KZJ . unspecified 
PDB 4KZM . unspecified 
PDB 4JGV . unspecified 
# 
_pdbx_database_status.entry_id                        4KZI 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2013-05-30 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, F.'    1  
'Zhang, Q.' 2  
'Li, A.'    3  
'Tian, X.'  4  
'Cai, Q.'   5  
'Wang, W.'  6  
'Wang, Y.'  7  
'Chen, H.'  8  
'Xing, Y.'  9  
'Wu, Q.'    10 
'Lin, T.'   11 
# 
_citation.id                        primary 
_citation.title                     
'Orphan nuclear receptor TR3 acts in autophagic cell death via mitochondrial signaling pathway.' 
_citation.journal_abbrev            Nat.Chem.Biol. 
_citation.journal_volume            10 
_citation.page_first                133 
_citation.page_last                 140 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1552-4469 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24316735 
_citation.pdbx_database_id_DOI      10.1038/nchembio.1406 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wang, W.J.'   1  ? 
primary 'Wang, Y.'     2  ? 
primary 'Chen, H.Z.'   3  ? 
primary 'Xing, Y.Z.'   4  ? 
primary 'Li, F.W.'     5  ? 
primary 'Zhang, Q.'    6  ? 
primary 'Zhou, B.'     7  ? 
primary 'Zhang, H.K.'  8  ? 
primary 'Zhang, J.'    9  ? 
primary 'Bian, X.L.'   10 ? 
primary 'Li, L.'       11 ? 
primary 'Liu, Y.'      12 ? 
primary 'Zhao, B.X.'   13 ? 
primary 'Chen, Y.'     14 ? 
primary 'Wu, R.'       15 ? 
primary 'Li, A.Z.'     16 ? 
primary 'Yao, L.M.'    17 ? 
primary 'Chen, P.'     18 ? 
primary 'Zhang, Y.'    19 ? 
primary 'Tian, X.Y.'   20 ? 
primary 'Beermann, F.' 21 ? 
primary 'Wu, M.'       22 ? 
primary 'Han, J.'      23 ? 
primary 'Huang, P.Q.'  24 ? 
primary 'Lin, T.'      25 ? 
primary 'Wu, Q.'       26 ? 
# 
_cell.length_a           74.723 
_cell.length_b           76.512 
_cell.length_c           128.918 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4KZI 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         4KZI 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Nuclear receptor subfamily 4 group A member 1' 28745.305 2  ? ? 'ligand binding domain, UNP residues 351-598' ? 
2 non-polymer syn GLYCEROL                                        92.094    3  ? ? ?                                             ? 
3 non-polymer syn '1-(3,5-dimethoxyphenyl)decan-1-one'            292.413   1  ? ? ?                                             ? 
4 water       nat water                                           18.015    92 ? ? ?                                             ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Early response protein NAK1, Nuclear hormone receptor NUR/77, Nur77, Orphan nuclear receptor HMR, Orphan nuclear receptor TR3, ST-59, Testicular receptor 3
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAE
LSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSAL
VLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIID
KIFMDTLPFLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAE
LSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSAL
VLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIID
KIFMDTLPFLEHHHHHH
;
_entity_poly.pdbx_strand_id                 B,A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   LYS n 
1 4   PRO n 
1 5   LYS n 
1 6   GLN n 
1 7   PRO n 
1 8   PRO n 
1 9   ASP n 
1 10  ALA n 
1 11  SER n 
1 12  PRO n 
1 13  ALA n 
1 14  ASN n 
1 15  LEU n 
1 16  LEU n 
1 17  THR n 
1 18  SER n 
1 19  LEU n 
1 20  VAL n 
1 21  ARG n 
1 22  ALA n 
1 23  HIS n 
1 24  LEU n 
1 25  ASP n 
1 26  SER n 
1 27  GLY n 
1 28  PRO n 
1 29  SER n 
1 30  THR n 
1 31  ALA n 
1 32  LYS n 
1 33  LEU n 
1 34  ASP n 
1 35  TYR n 
1 36  SER n 
1 37  LYS n 
1 38  PHE n 
1 39  GLN n 
1 40  GLU n 
1 41  LEU n 
1 42  VAL n 
1 43  LEU n 
1 44  PRO n 
1 45  HIS n 
1 46  PHE n 
1 47  GLY n 
1 48  LYS n 
1 49  GLU n 
1 50  ASP n 
1 51  ALA n 
1 52  GLY n 
1 53  ASP n 
1 54  VAL n 
1 55  GLN n 
1 56  GLN n 
1 57  PHE n 
1 58  TYR n 
1 59  ASP n 
1 60  LEU n 
1 61  LEU n 
1 62  SER n 
1 63  GLY n 
1 64  SER n 
1 65  LEU n 
1 66  GLU n 
1 67  VAL n 
1 68  ILE n 
1 69  ARG n 
1 70  LYS n 
1 71  TRP n 
1 72  ALA n 
1 73  GLU n 
1 74  LYS n 
1 75  ILE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  ALA n 
1 80  GLU n 
1 81  LEU n 
1 82  SER n 
1 83  PRO n 
1 84  ALA n 
1 85  ASP n 
1 86  GLN n 
1 87  ASP n 
1 88  LEU n 
1 89  LEU n 
1 90  LEU n 
1 91  GLU n 
1 92  SER n 
1 93  ALA n 
1 94  PHE n 
1 95  LEU n 
1 96  GLU n 
1 97  LEU n 
1 98  PHE n 
1 99  ILE n 
1 100 LEU n 
1 101 ARG n 
1 102 LEU n 
1 103 ALA n 
1 104 TYR n 
1 105 ARG n 
1 106 SER n 
1 107 LYS n 
1 108 PRO n 
1 109 GLY n 
1 110 GLU n 
1 111 GLY n 
1 112 LYS n 
1 113 LEU n 
1 114 ILE n 
1 115 PHE n 
1 116 CYS n 
1 117 SER n 
1 118 GLY n 
1 119 LEU n 
1 120 VAL n 
1 121 LEU n 
1 122 HIS n 
1 123 ARG n 
1 124 LEU n 
1 125 GLN n 
1 126 CYS n 
1 127 ALA n 
1 128 ARG n 
1 129 GLY n 
1 130 PHE n 
1 131 GLY n 
1 132 ASP n 
1 133 TRP n 
1 134 ILE n 
1 135 ASP n 
1 136 SER n 
1 137 ILE n 
1 138 LEU n 
1 139 ALA n 
1 140 PHE n 
1 141 SER n 
1 142 ARG n 
1 143 SER n 
1 144 LEU n 
1 145 HIS n 
1 146 SER n 
1 147 LEU n 
1 148 LEU n 
1 149 VAL n 
1 150 ASP n 
1 151 VAL n 
1 152 PRO n 
1 153 ALA n 
1 154 PHE n 
1 155 ALA n 
1 156 CYS n 
1 157 LEU n 
1 158 SER n 
1 159 ALA n 
1 160 LEU n 
1 161 VAL n 
1 162 LEU n 
1 163 ILE n 
1 164 THR n 
1 165 ASP n 
1 166 ARG n 
1 167 HIS n 
1 168 GLY n 
1 169 LEU n 
1 170 GLN n 
1 171 GLU n 
1 172 PRO n 
1 173 ARG n 
1 174 ARG n 
1 175 VAL n 
1 176 GLU n 
1 177 GLU n 
1 178 LEU n 
1 179 GLN n 
1 180 ASN n 
1 181 ARG n 
1 182 ILE n 
1 183 ALA n 
1 184 SER n 
1 185 CYS n 
1 186 LEU n 
1 187 LYS n 
1 188 GLU n 
1 189 HIS n 
1 190 VAL n 
1 191 ALA n 
1 192 ALA n 
1 193 VAL n 
1 194 ALA n 
1 195 GLY n 
1 196 GLU n 
1 197 PRO n 
1 198 GLN n 
1 199 PRO n 
1 200 ALA n 
1 201 SER n 
1 202 CYS n 
1 203 LEU n 
1 204 SER n 
1 205 ARG n 
1 206 LEU n 
1 207 LEU n 
1 208 GLY n 
1 209 LYS n 
1 210 LEU n 
1 211 PRO n 
1 212 GLU n 
1 213 LEU n 
1 214 ARG n 
1 215 THR n 
1 216 LEU n 
1 217 CYS n 
1 218 THR n 
1 219 GLN n 
1 220 GLY n 
1 221 LEU n 
1 222 GLN n 
1 223 ARG n 
1 224 ILE n 
1 225 PHE n 
1 226 TYR n 
1 227 LEU n 
1 228 LYS n 
1 229 LEU n 
1 230 GLU n 
1 231 ASP n 
1 232 LEU n 
1 233 VAL n 
1 234 PRO n 
1 235 PRO n 
1 236 PRO n 
1 237 PRO n 
1 238 ILE n 
1 239 ILE n 
1 240 ASP n 
1 241 LYS n 
1 242 ILE n 
1 243 PHE n 
1 244 MET n 
1 245 ASP n 
1 246 THR n 
1 247 LEU n 
1 248 PRO n 
1 249 PHE n 
1 250 LEU n 
1 251 GLU n 
1 252 HIS n 
1 253 HIS n 
1 254 HIS n 
1 255 HIS n 
1 256 HIS n 
1 257 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'GFRP1, HMR, NAK1, NR4A1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NR4A1_HUMAN 
_struct_ref.pdbx_db_accession          P22736 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAEL
SPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALV
LITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDK
IFMDTLPF
;
_struct_ref.pdbx_align_begin           351 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4KZI B 2 ? 249 ? P22736 351 ? 598 ? 351 598 
2 1 4KZI A 2 ? 249 ? P22736 351 ? 598 ? 351 598 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4KZI MET B 1   ? UNP P22736 ? ? 'expression tag' 350 1  
1 4KZI LEU B 250 ? UNP P22736 ? ? 'expression tag' 599 2  
1 4KZI GLU B 251 ? UNP P22736 ? ? 'expression tag' 600 3  
1 4KZI HIS B 252 ? UNP P22736 ? ? 'expression tag' 601 4  
1 4KZI HIS B 253 ? UNP P22736 ? ? 'expression tag' 602 5  
1 4KZI HIS B 254 ? UNP P22736 ? ? 'expression tag' 603 6  
1 4KZI HIS B 255 ? UNP P22736 ? ? 'expression tag' 604 7  
1 4KZI HIS B 256 ? UNP P22736 ? ? 'expression tag' 605 8  
1 4KZI HIS B 257 ? UNP P22736 ? ? 'expression tag' 606 9  
2 4KZI MET A 1   ? UNP P22736 ? ? 'expression tag' 350 10 
2 4KZI LEU A 250 ? UNP P22736 ? ? 'expression tag' 599 11 
2 4KZI GLU A 251 ? UNP P22736 ? ? 'expression tag' 600 12 
2 4KZI HIS A 252 ? UNP P22736 ? ? 'expression tag' 601 13 
2 4KZI HIS A 253 ? UNP P22736 ? ? 'expression tag' 602 14 
2 4KZI HIS A 254 ? UNP P22736 ? ? 'expression tag' 603 15 
2 4KZI HIS A 255 ? UNP P22736 ? ? 'expression tag' 604 16 
2 4KZI HIS A 256 ? UNP P22736 ? ? 'expression tag' 605 17 
2 4KZI HIS A 257 ? UNP P22736 ? ? 'expression tag' 606 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'    117.146 
ZJ0 non-polymer         . '1-(3,5-dimethoxyphenyl)decan-1-one' ?                               'C18 H28 O3'     292.413 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4KZI 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        0.391 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      3.21 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   61.62 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.pH              4.2 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    'PEG 4000, Sodium citrate, Glycerol, pH 4.2, vapor diffusion, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2013-04-27 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Ni FILTER' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.pdbx_wavelength_list        0.98 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SSRF 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
# 
_reflns.entry_id                     4KZI 
_reflns.d_resolution_high            2.400 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   29201 
_reflns.pdbx_Rmerge_I_obs            0.085 
_reflns.pdbx_netI_over_sigmaI        9.000 
_reflns.pdbx_chi_squared             1.238 
_reflns.pdbx_redundancy              4.700 
_reflns.percent_possible_obs         99.400 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.number_all                   29377 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.400 2.440  ? ? ? ? 0.455 ? ? 0.882 4.900 ? ? ? 1416 ? ? ? ? 100.000 ? ? 1  1 
2.440 2.490  ? ? ? ? 0.401 ? ? 0.882 4.900 ? ? ? 1469 ? ? ? ? 100.000 ? ? 2  1 
2.490 2.530  ? ? ? ? 0.344 ? ? 0.897 4.900 ? ? ? 1446 ? ? ? ? 100.000 ? ? 3  1 
2.530 2.590  ? ? ? ? 0.333 ? ? 0.898 4.900 ? ? ? 1422 ? ? ? ? 100.000 ? ? 4  1 
2.590 2.640  ? ? ? ? 0.270 ? ? 0.976 4.900 ? ? ? 1440 ? ? ? ? 100.000 ? ? 5  1 
2.640 2.700  ? ? ? ? 0.241 ? ? 0.999 4.900 ? ? ? 1454 ? ? ? ? 100.000 ? ? 6  1 
2.700 2.770  ? ? ? ? 0.214 ? ? 1.005 4.900 ? ? ? 1453 ? ? ? ? 100.000 ? ? 7  1 
2.770 2.850  ? ? ? ? 0.188 ? ? 1.114 4.900 ? ? ? 1460 ? ? ? ? 100.000 ? ? 8  1 
2.850 2.930  ? ? ? ? 0.158 ? ? 1.116 4.900 ? ? ? 1453 ? ? ? ? 100.000 ? ? 9  1 
2.930 3.020  ? ? ? ? 0.144 ? ? 1.177 4.800 ? ? ? 1437 ? ? ? ? 99.900  ? ? 10 1 
3.020 3.130  ? ? ? ? 0.128 ? ? 1.296 4.800 ? ? ? 1465 ? ? ? ? 99.900  ? ? 11 1 
3.130 3.260  ? ? ? ? 0.108 ? ? 1.375 4.800 ? ? ? 1450 ? ? ? ? 99.900  ? ? 12 1 
3.260 3.410  ? ? ? ? 0.094 ? ? 1.559 4.700 ? ? ? 1471 ? ? ? ? 100.000 ? ? 13 1 
3.410 3.580  ? ? ? ? 0.084 ? ? 1.596 4.600 ? ? ? 1461 ? ? ? ? 99.800  ? ? 14 1 
3.580 3.810  ? ? ? ? 0.077 ? ? 1.786 4.500 ? ? ? 1477 ? ? ? ? 99.900  ? ? 15 1 
3.810 4.100  ? ? ? ? 0.072 ? ? 1.610 4.400 ? ? ? 1477 ? ? ? ? 99.800  ? ? 16 1 
4.100 4.520  ? ? ? ? 0.067 ? ? 1.630 4.300 ? ? ? 1479 ? ? ? ? 99.700  ? ? 17 1 
4.520 5.170  ? ? ? ? 0.063 ? ? 1.496 4.300 ? ? ? 1492 ? ? ? ? 99.600  ? ? 18 1 
5.170 6.510  ? ? ? ? 0.063 ? ? 1.449 4.300 ? ? ? 1509 ? ? ? ? 99.300  ? ? 19 1 
6.510 50.000 ? ? ? ? 0.059 ? ? 1.262 3.800 ? ? ? 1470 ? ? ? ? 90.600  ? ? 20 1 
# 
_refine.entry_id                                 4KZI 
_refine.ls_d_res_high                            2.4100 
_refine.ls_d_res_low                             37.2800 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.1000 
_refine.ls_number_reflns_obs                     29148 
_refine.ls_number_reflns_all                     29377 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES: REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2083 
_refine.ls_R_factor_R_work                       0.2061 
_refine.ls_wR_factor_R_work                      0.2059 
_refine.ls_R_factor_R_free                       0.2486 
_refine.ls_wR_factor_R_free                      0.2470 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_number_reflns_R_free                  1486 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               60.6643 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.9800 
_refine.aniso_B[2][2]                            0.1500 
_refine.aniso_B[3][3]                            -1.1300 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9450 
_refine.correlation_coeff_Fo_to_Fc_free          0.9200 
_refine.overall_SU_R_Cruickshank_DPI             0.2771 
_refine.overall_SU_R_free                        0.2254 
_refine.pdbx_overall_ESU_R                       0.2770 
_refine.pdbx_overall_ESU_R_Free                  0.2250 
_refine.overall_SU_ML                            0.1680 
_refine.overall_SU_B                             7.2800 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8142 
_refine.B_iso_max                                190.670 
_refine.B_iso_min                                28.450 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3641 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         39 
_refine_hist.number_atoms_solvent             92 
_refine_hist.number_atoms_total               3772 
_refine_hist.d_res_high                       2.4100 
_refine_hist.d_res_low                        37.2800 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       3753 0.016  0.019  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         3720 0.006  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    5075 1.787  2.007  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      8562 1.219  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 461  5.986  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 154  38.433 23.182 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 646  18.983 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 28   18.035 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         587  0.096  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   4108 0.011  0.021  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     820  0.005  0.020  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.4050 
_refine_ls_shell.d_res_low                        2.4680 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               96.5900 
_refine_ls_shell.number_reflns_R_work             1948 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2830 
_refine_ls_shell.R_factor_R_free                  0.3360 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             117 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2065 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  4KZI 
_struct.title                     'Crystal Structure of TR3 LBD in complex with DPDO' 
_struct.pdbx_descriptor           'Nuclear receptor subfamily 4 group A member 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4KZI 
_struct_keywords.text            'ORPHAN NUCLEAR RECEPTOR, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 13  ? SER A 26  ? ALA B 362 SER B 375 1 ? 14 
HELX_P HELX_P2  2  ASP A 50  ? LYS A 74  ? ASP B 399 LYS B 423 1 ? 25 
HELX_P HELX_P3  3  GLY A 77  ? LEU A 81  ? GLY B 426 LEU B 430 5 ? 5  
HELX_P HELX_P4  4  SER A 82  ? SER A 106 ? SER B 431 SER B 455 1 ? 25 
HELX_P HELX_P5  5  LYS A 107 ? GLU A 110 ? LYS B 456 GLU B 459 5 ? 4  
HELX_P HELX_P6  6  ARG A 123 ? GLY A 131 ? ARG B 472 GLY B 480 1 ? 9  
HELX_P HELX_P7  7  ASP A 132 ? LEU A 147 ? ASP B 481 LEU B 496 1 ? 16 
HELX_P HELX_P8  8  ASP A 150 ? ILE A 163 ? ASP B 499 ILE B 512 1 ? 14 
HELX_P HELX_P9  9  GLU A 171 ? VAL A 193 ? GLU B 520 VAL B 542 1 ? 23 
HELX_P HELX_P10 10 SER A 201 ? GLY A 208 ? SER B 550 GLY B 557 1 ? 8  
HELX_P HELX_P11 11 GLY A 208 ? ASP A 231 ? GLY B 557 ASP B 580 1 ? 24 
HELX_P HELX_P12 12 PRO A 236 ? LEU A 247 ? PRO B 585 LEU B 596 1 ? 12 
HELX_P HELX_P13 13 ASN B 14  ? SER B 26  ? ASN A 363 SER A 375 1 ? 13 
HELX_P HELX_P14 14 ASP B 50  ? GLU B 73  ? ASP A 399 GLU A 422 1 ? 24 
HELX_P HELX_P15 15 GLY B 77  ? LEU B 81  ? GLY A 426 LEU A 430 5 ? 5  
HELX_P HELX_P16 16 SER B 82  ? SER B 106 ? SER A 431 SER A 455 1 ? 25 
HELX_P HELX_P17 17 LYS B 107 ? GLU B 110 ? LYS A 456 GLU A 459 5 ? 4  
HELX_P HELX_P18 18 ARG B 123 ? GLY B 131 ? ARG A 472 GLY A 480 1 ? 9  
HELX_P HELX_P19 19 ASP B 132 ? LEU B 147 ? ASP A 481 LEU A 496 1 ? 16 
HELX_P HELX_P20 20 ASP B 150 ? ILE B 163 ? ASP A 499 ILE A 512 1 ? 14 
HELX_P HELX_P21 21 GLU B 171 ? GLY B 195 ? GLU A 520 GLY A 544 1 ? 25 
HELX_P HELX_P22 22 CYS B 202 ? GLY B 208 ? CYS A 551 GLY A 557 1 ? 7  
HELX_P HELX_P23 23 LYS B 209 ? ASP B 231 ? LYS A 558 ASP A 580 1 ? 23 
HELX_P HELX_P24 24 PRO B 236 ? LEU B 247 ? PRO A 585 LEU A 596 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 12  A . ? PRO 361 B ALA 13  A ? ALA 362 B 1 -22.04 
2 GLU 196 A . ? GLU 545 B PRO 197 A ? PRO 546 B 1 12.86  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 112 ? ILE A 114 ? LYS B 461 ILE B 463 
A 2 VAL A 120 ? HIS A 122 ? VAL B 469 HIS B 471 
B 1 LYS B 112 ? ILE B 114 ? LYS A 461 ILE A 463 
B 2 VAL B 120 ? HIS B 122 ? VAL A 469 HIS A 471 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 113 ? N LEU B 462 O LEU A 121 ? O LEU B 470 
B 1 2 N LEU B 113 ? N LEU A 462 O LEU B 121 ? O LEU A 470 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL B 701' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL A 701' 
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 702' 
AC4 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ZJ0 A 703' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  HIS A 23  ? HIS B 372 . ? 1_555 ? 
2  AC1 7  SER A 26  ? SER B 375 . ? 1_555 ? 
3  AC1 7  GLY A 27  ? GLY B 376 . ? 1_555 ? 
4  AC1 7  ARG A 101 ? ARG B 450 . ? 1_555 ? 
5  AC1 7  ARG A 105 ? ARG B 454 . ? 1_555 ? 
6  AC1 7  HOH G .   ? HOH B 813 . ? 1_555 ? 
7  AC1 7  HOH G .   ? HOH B 826 . ? 1_555 ? 
8  AC2 4  LEU B 160 ? LEU A 509 . ? 1_555 ? 
9  AC2 4  VAL B 161 ? VAL A 510 . ? 1_555 ? 
10 AC2 4  THR B 164 ? THR A 513 . ? 1_555 ? 
11 AC2 4  ZJ0 F .   ? ZJ0 A 703 . ? 1_555 ? 
12 AC3 8  HIS B 23  ? HIS A 372 . ? 1_555 ? 
13 AC3 8  SER B 26  ? SER A 375 . ? 1_555 ? 
14 AC3 8  GLY B 27  ? GLY A 376 . ? 1_555 ? 
15 AC3 8  PRO B 28  ? PRO A 377 . ? 1_555 ? 
16 AC3 8  ARG B 101 ? ARG A 450 . ? 1_555 ? 
17 AC3 8  ARG B 105 ? ARG A 454 . ? 1_555 ? 
18 AC3 8  HOH H .   ? HOH A 806 . ? 1_555 ? 
19 AC3 8  HOH H .   ? HOH A 812 . ? 1_555 ? 
20 AC4 15 SER B 92  ? SER A 441 . ? 1_555 ? 
21 AC4 15 ALA B 93  ? ALA A 442 . ? 1_555 ? 
22 AC4 15 LEU B 95  ? LEU A 444 . ? 1_555 ? 
23 AC4 15 GLU B 96  ? GLU A 445 . ? 1_555 ? 
24 AC4 15 GLU B 110 ? GLU A 459 . ? 4_545 ? 
25 AC4 15 VAL B 161 ? VAL A 510 . ? 1_555 ? 
26 AC4 15 THR B 164 ? THR A 513 . ? 1_555 ? 
27 AC4 15 ASP B 165 ? ASP A 514 . ? 1_555 ? 
28 AC4 15 ARG B 166 ? ARG A 515 . ? 1_555 ? 
29 AC4 15 ARG B 214 ? ARG A 563 . ? 1_555 ? 
30 AC4 15 CYS B 217 ? CYS A 566 . ? 1_555 ? 
31 AC4 15 GOL D .   ? GOL A 701 . ? 1_555 ? 
32 AC4 15 HOH H .   ? HOH A 822 . ? 1_555 ? 
33 AC4 15 HOH H .   ? HOH A 826 . ? 1_555 ? 
34 AC4 15 HOH H .   ? HOH A 833 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4KZI 
_atom_sites.fract_transf_matrix[1][1]   0.013383 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013070 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007757 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 12  ? 0.866   -8.279  -61.324 1.00 127.21 ? 361 PRO B N   1 
ATOM   2    C CA  . PRO A 1 12  ? -0.065  -7.890  -60.266 1.00 132.25 ? 361 PRO B CA  1 
ATOM   3    C C   . PRO A 1 12  ? -1.206  -8.852  -59.718 1.00 136.07 ? 361 PRO B C   1 
ATOM   4    O O   . PRO A 1 12  ? -1.981  -8.369  -58.875 1.00 126.10 ? 361 PRO B O   1 
ATOM   5    C CB  . PRO A 1 12  ? -0.664  -6.587  -60.835 1.00 133.71 ? 361 PRO B CB  1 
ATOM   6    C CG  . PRO A 1 12  ? 0.437   -6.006  -61.696 1.00 135.34 ? 361 PRO B CG  1 
ATOM   7    C CD  . PRO A 1 12  ? 1.449   -7.097  -61.981 1.00 129.06 ? 361 PRO B CD  1 
ATOM   8    N N   . ALA A 1 13  ? -1.384  -10.128 -60.134 1.00 120.59 ? 362 ALA B N   1 
ATOM   9    C CA  . ALA A 1 13  ? -0.927  -10.734 -61.409 1.00 116.51 ? 362 ALA B CA  1 
ATOM   10   C C   . ALA A 1 13  ? 0.388   -11.534 -61.389 1.00 102.50 ? 362 ALA B C   1 
ATOM   11   O O   . ALA A 1 13  ? 0.461   -12.712 -60.981 1.00 86.04  ? 362 ALA B O   1 
ATOM   12   N N   . ASN A 1 14  ? 1.422   -10.881 -61.902 1.00 96.03  ? 363 ASN B N   1 
ATOM   13   C CA  . ASN A 1 14  ? 2.781   -11.309 -61.692 1.00 85.46  ? 363 ASN B CA  1 
ATOM   14   C C   . ASN A 1 14  ? 3.233   -11.137 -60.228 1.00 72.56  ? 363 ASN B C   1 
ATOM   15   O O   . ASN A 1 14  ? 4.090   -11.873 -59.773 1.00 73.86  ? 363 ASN B O   1 
ATOM   16   C CB  . ASN A 1 14  ? 3.694   -10.575 -62.652 1.00 87.85  ? 363 ASN B CB  1 
ATOM   17   C CG  . ASN A 1 14  ? 4.989   -11.324 -62.907 1.00 98.24  ? 363 ASN B CG  1 
ATOM   18   O OD1 . ASN A 1 14  ? 5.002   -12.465 -63.398 1.00 99.75  ? 363 ASN B OD1 1 
ATOM   19   N ND2 . ASN A 1 14  ? 6.089   -10.673 -62.603 1.00 98.32  ? 363 ASN B ND2 1 
ATOM   20   N N   . LEU A 1 15  ? 2.653   -10.189 -59.484 1.00 66.66  ? 364 LEU B N   1 
ATOM   21   C CA  . LEU A 1 15  ? 2.903   -10.071 -58.031 1.00 63.81  ? 364 LEU B CA  1 
ATOM   22   C C   . LEU A 1 15  ? 2.450   -11.375 -57.330 1.00 65.73  ? 364 LEU B C   1 
ATOM   23   O O   . LEU A 1 15  ? 3.238   -12.048 -56.661 1.00 59.93  ? 364 LEU B O   1 
ATOM   24   C CB  . LEU A 1 15  ? 2.143   -8.877  -57.432 1.00 62.69  ? 364 LEU B CB  1 
ATOM   25   C CG  . LEU A 1 15  ? 2.227   -8.712  -55.905 1.00 62.83  ? 364 LEU B CG  1 
ATOM   26   C CD1 . LEU A 1 15  ? 3.665   -8.778  -55.442 1.00 61.34  ? 364 LEU B CD1 1 
ATOM   27   C CD2 . LEU A 1 15  ? 1.617   -7.384  -55.470 1.00 63.52  ? 364 LEU B CD2 1 
ATOM   28   N N   . LEU A 1 16  ? 1.173   -11.708 -57.508 1.00 62.13  ? 365 LEU B N   1 
ATOM   29   C CA  . LEU A 1 16  ? 0.608   -12.929 -56.978 1.00 63.79  ? 365 LEU B CA  1 
ATOM   30   C C   . LEU A 1 16  ? 1.539   -14.135 -57.249 1.00 68.15  ? 365 LEU B C   1 
ATOM   31   O O   . LEU A 1 16  ? 1.932   -14.853 -56.323 1.00 67.45  ? 365 LEU B O   1 
ATOM   32   C CB  . LEU A 1 16  ? -0.768  -13.154 -57.577 1.00 61.05  ? 365 LEU B CB  1 
ATOM   33   C CG  . LEU A 1 16  ? -1.519  -14.346 -56.969 1.00 76.56  ? 365 LEU B CG  1 
ATOM   34   C CD1 . LEU A 1 16  ? -1.435  -14.288 -55.447 1.00 80.55  ? 365 LEU B CD1 1 
ATOM   35   C CD2 . LEU A 1 16  ? -2.977  -14.446 -57.431 1.00 62.37  ? 365 LEU B CD2 1 
ATOM   36   N N   . THR A 1 17  ? 1.963   -14.288 -58.496 1.00 62.72  ? 366 THR B N   1 
ATOM   37   C CA  . THR A 1 17  ? 2.887   -15.366 -58.900 1.00 60.31  ? 366 THR B CA  1 
ATOM   38   C C   . THR A 1 17  ? 4.227   -15.298 -58.179 1.00 56.41  ? 366 THR B C   1 
ATOM   39   O O   . THR A 1 17  ? 4.789   -16.321 -57.825 1.00 57.76  ? 366 THR B O   1 
ATOM   40   C CB  . THR A 1 17  ? 3.150   -15.328 -60.440 1.00 63.15  ? 366 THR B CB  1 
ATOM   41   O OG1 . THR A 1 17  ? 1.939   -15.644 -61.126 1.00 64.94  ? 366 THR B OG1 1 
ATOM   42   C CG2 . THR A 1 17  ? 4.234   -16.334 -60.896 1.00 58.02  ? 366 THR B CG2 1 
ATOM   43   N N   . SER A 1 18  ? 4.760   -14.097 -57.981 1.00 55.02  ? 367 SER B N   1 
ATOM   44   C CA  . SER A 1 18  ? 6.009   -13.971 -57.254 1.00 58.38  ? 367 SER B CA  1 
ATOM   45   C C   . SER A 1 18  ? 5.841   -14.374 -55.814 1.00 57.68  ? 367 SER B C   1 
ATOM   46   O O   . SER A 1 18  ? 6.718   -15.047 -55.252 1.00 54.54  ? 367 SER B O   1 
ATOM   47   C CB  . SER A 1 18  ? 6.546   -12.558 -57.311 1.00 57.41  ? 367 SER B CB  1 
ATOM   48   O OG  . SER A 1 18  ? 7.028   -12.319 -58.593 1.00 59.69  ? 367 SER B OG  1 
ATOM   49   N N   . LEU A 1 19  ? 4.721   -13.958 -55.227 1.00 54.43  ? 368 LEU B N   1 
ATOM   50   C CA  . LEU A 1 19  ? 4.433   -14.308 -53.834 1.00 56.10  ? 368 LEU B CA  1 
ATOM   51   C C   . LEU A 1 19  ? 4.276   -15.816 -53.696 1.00 51.91  ? 368 LEU B C   1 
ATOM   52   O O   . LEU A 1 19  ? 4.767   -16.396 -52.711 1.00 52.33  ? 368 LEU B O   1 
ATOM   53   C CB  . LEU A 1 19  ? 3.156   -13.588 -53.319 1.00 56.76  ? 368 LEU B CB  1 
ATOM   54   C CG  . LEU A 1 19  ? 3.246   -12.052 -53.186 1.00 49.37  ? 368 LEU B CG  1 
ATOM   55   C CD1 . LEU A 1 19  ? 1.934   -11.415 -52.800 1.00 54.29  ? 368 LEU B CD1 1 
ATOM   56   C CD2 . LEU A 1 19  ? 4.344   -11.632 -52.230 1.00 50.91  ? 368 LEU B CD2 1 
ATOM   57   N N   . VAL A 1 20  ? 3.607   -16.444 -54.668 1.00 52.01  ? 369 VAL B N   1 
ATOM   58   C CA  . VAL A 1 20  ? 3.395   -17.903 -54.651 1.00 52.33  ? 369 VAL B CA  1 
ATOM   59   C C   . VAL A 1 20  ? 4.716   -18.626 -54.782 1.00 54.28  ? 369 VAL B C   1 
ATOM   60   O O   . VAL A 1 20  ? 5.013   -19.540 -54.008 1.00 64.93  ? 369 VAL B O   1 
ATOM   61   C CB  . VAL A 1 20  ? 2.431   -18.372 -55.752 1.00 61.25  ? 369 VAL B CB  1 
ATOM   62   C CG1 . VAL A 1 20  ? 2.466   -19.895 -55.919 1.00 59.41  ? 369 VAL B CG1 1 
ATOM   63   C CG2 . VAL A 1 20  ? 1.014   -17.904 -55.444 1.00 57.61  ? 369 VAL B CG2 1 
ATOM   64   N N   . ARG A 1 21  ? 5.557   -18.182 -55.702 1.00 59.64  ? 370 ARG B N   1 
ATOM   65   C CA  . ARG A 1 21  ? 6.875   -18.830 -55.901 1.00 57.76  ? 370 ARG B CA  1 
ATOM   66   C C   . ARG A 1 21  ? 7.717   -18.693 -54.646 1.00 53.56  ? 370 ARG B C   1 
ATOM   67   O O   . ARG A 1 21  ? 8.417   -19.612 -54.249 1.00 54.70  ? 370 ARG B O   1 
ATOM   68   C CB  . ARG A 1 21  ? 7.563   -18.228 -57.149 1.00 71.44  ? 370 ARG B CB  1 
ATOM   69   C CG  . ARG A 1 21  ? 9.063   -18.510 -57.307 1.00 87.09  ? 370 ARG B CG  1 
ATOM   70   C CD  . ARG A 1 21  ? 9.420   -19.798 -58.024 1.00 98.86  ? 370 ARG B CD  1 
ATOM   71   N NE  . ARG A 1 21  ? 9.010   -21.014 -57.307 1.00 114.41 ? 370 ARG B NE  1 
ATOM   72   C CZ  . ARG A 1 21  ? 8.082   -21.891 -57.710 1.00 112.53 ? 370 ARG B CZ  1 
ATOM   73   N NH1 . ARG A 1 21  ? 7.814   -22.960 -56.964 1.00 105.82 ? 370 ARG B NH1 1 
ATOM   74   N NH2 . ARG A 1 21  ? 7.415   -21.716 -58.843 1.00 110.78 ? 370 ARG B NH2 1 
ATOM   75   N N   . ALA A 1 22  ? 7.640   -17.533 -53.992 1.00 55.54  ? 371 ALA B N   1 
ATOM   76   C CA  . ALA A 1 22  ? 8.436   -17.301 -52.783 1.00 54.68  ? 371 ALA B CA  1 
ATOM   77   C C   . ALA A 1 22  ? 7.959   -18.181 -51.621 1.00 46.31  ? 371 ALA B C   1 
ATOM   78   O O   . ALA A 1 22  ? 8.735   -18.803 -50.938 1.00 52.41  ? 371 ALA B O   1 
ATOM   79   C CB  . ALA A 1 22  ? 8.375   -15.838 -52.389 1.00 53.95  ? 371 ALA B CB  1 
ATOM   80   N N   . HIS A 1 23  ? 6.663   -18.265 -51.432 1.00 50.21  ? 372 HIS B N   1 
ATOM   81   C CA  . HIS A 1 23  ? 6.117   -19.211 -50.472 1.00 48.99  ? 372 HIS B CA  1 
ATOM   82   C C   . HIS A 1 23  ? 6.571   -20.672 -50.715 1.00 45.59  ? 372 HIS B C   1 
ATOM   83   O O   . HIS A 1 23  ? 7.195   -21.304 -49.863 1.00 47.61  ? 372 HIS B O   1 
ATOM   84   C CB  . HIS A 1 23  ? 4.583   -19.121 -50.495 1.00 50.54  ? 372 HIS B CB  1 
ATOM   85   C CG  . HIS A 1 23  ? 3.926   -20.159 -49.656 1.00 54.42  ? 372 HIS B CG  1 
ATOM   86   N ND1 . HIS A 1 23  ? 4.086   -20.216 -48.289 1.00 55.36  ? 372 HIS B ND1 1 
ATOM   87   C CD2 . HIS A 1 23  ? 3.152   -21.220 -49.993 1.00 53.94  ? 372 HIS B CD2 1 
ATOM   88   C CE1 . HIS A 1 23  ? 3.432   -21.264 -47.819 1.00 52.10  ? 372 HIS B CE1 1 
ATOM   89   N NE2 . HIS A 1 23  ? 2.842   -21.874 -48.831 1.00 57.20  ? 372 HIS B NE2 1 
ATOM   90   N N   . LEU A 1 24  ? 6.242   -21.206 -51.870 1.00 50.49  ? 373 LEU B N   1 
ATOM   91   C CA  . LEU A 1 24  ? 6.572   -22.601 -52.178 1.00 55.62  ? 373 LEU B CA  1 
ATOM   92   C C   . LEU A 1 24  ? 8.050   -22.911 -52.089 1.00 53.61  ? 373 LEU B C   1 
ATOM   93   O O   . LEU A 1 24  ? 8.408   -23.970 -51.626 1.00 60.00  ? 373 LEU B O   1 
ATOM   94   C CB  . LEU A 1 24  ? 6.052   -22.991 -53.550 1.00 58.95  ? 373 LEU B CB  1 
ATOM   95   C CG  . LEU A 1 24  ? 4.530   -23.059 -53.670 1.00 61.39  ? 373 LEU B CG  1 
ATOM   96   C CD1 . LEU A 1 24  ? 4.146   -23.378 -55.117 1.00 63.10  ? 373 LEU B CD1 1 
ATOM   97   C CD2 . LEU A 1 24  ? 3.889   -24.046 -52.695 1.00 57.83  ? 373 LEU B CD2 1 
ATOM   98   N N   . ASP A 1 25  ? 8.922   -21.988 -52.474 1.00 61.13  ? 374 ASP B N   1 
ATOM   99   C CA  . ASP A 1 25  ? 10.381  -22.260 -52.375 1.00 56.55  ? 374 ASP B CA  1 
ATOM   100  C C   . ASP A 1 25  ? 10.918  -22.204 -50.959 1.00 52.12  ? 374 ASP B C   1 
ATOM   101  O O   . ASP A 1 25  ? 12.065  -22.533 -50.732 1.00 50.45  ? 374 ASP B O   1 
ATOM   102  C CB  . ASP A 1 25  ? 11.193  -21.279 -53.252 1.00 60.44  ? 374 ASP B CB  1 
ATOM   103  C CG  . ASP A 1 25  ? 11.044  -21.549 -54.747 1.00 65.11  ? 374 ASP B CG  1 
ATOM   104  O OD1 . ASP A 1 25  ? 10.521  -22.616 -55.139 1.00 65.77  ? 374 ASP B OD1 1 
ATOM   105  O OD2 . ASP A 1 25  ? 11.435  -20.665 -55.542 1.00 75.30  ? 374 ASP B OD2 1 
ATOM   106  N N   . SER A 1 26  ? 10.124  -21.717 -50.003 1.00 59.41  ? 375 SER B N   1 
ATOM   107  C CA  . SER A 1 26  ? 10.613  -21.517 -48.619 1.00 61.41  ? 375 SER B CA  1 
ATOM   108  C C   . SER A 1 26  ? 10.271  -22.675 -47.659 1.00 57.19  ? 375 SER B C   1 
ATOM   109  O O   . SER A 1 26  ? 10.386  -22.527 -46.441 1.00 58.22  ? 375 SER B O   1 
ATOM   110  C CB  . SER A 1 26  ? 10.000  -20.217 -48.057 1.00 62.22  ? 375 SER B CB  1 
ATOM   111  O OG  . SER A 1 26  ? 8.627   -20.429 -47.794 1.00 54.43  ? 375 SER B OG  1 
ATOM   112  N N   . GLY A 1 27  ? 9.740   -23.767 -48.186 1.00 53.05  ? 376 GLY B N   1 
ATOM   113  C CA  . GLY A 1 27  ? 9.357   -24.884 -47.339 1.00 55.64  ? 376 GLY B CA  1 
ATOM   114  C C   . GLY A 1 27  ? 9.616   -26.188 -48.068 1.00 55.36  ? 376 GLY B C   1 
ATOM   115  O O   . GLY A 1 27  ? 9.850   -26.182 -49.262 1.00 56.56  ? 376 GLY B O   1 
ATOM   116  N N   . PRO A 1 28  ? 9.516   -27.313 -47.366 1.00 58.12  ? 377 PRO B N   1 
ATOM   117  C CA  . PRO A 1 28  ? 9.903   -28.591 -47.919 1.00 55.76  ? 377 PRO B CA  1 
ATOM   118  C C   . PRO A 1 28  ? 8.877   -29.085 -48.915 1.00 53.36  ? 377 PRO B C   1 
ATOM   119  O O   . PRO A 1 28  ? 7.682   -28.801 -48.788 1.00 57.96  ? 377 PRO B O   1 
ATOM   120  C CB  . PRO A 1 28  ? 9.977   -29.483 -46.681 1.00 63.97  ? 377 PRO B CB  1 
ATOM   121  C CG  . PRO A 1 28  ? 8.963   -28.923 -45.758 1.00 62.72  ? 377 PRO B CG  1 
ATOM   122  C CD  . PRO A 1 28  ? 8.870   -27.458 -46.052 1.00 59.13  ? 377 PRO B CD  1 
ATOM   123  N N   . SER A 1 29  ? 9.373   -29.753 -49.943 1.00 69.41  ? 378 SER B N   1 
ATOM   124  C CA  . SER A 1 29  ? 8.549   -30.559 -50.823 1.00 81.73  ? 378 SER B CA  1 
ATOM   125  C C   . SER A 1 29  ? 7.928   -31.711 -50.027 1.00 87.69  ? 378 SER B C   1 
ATOM   126  O O   . SER A 1 29  ? 8.578   -32.298 -49.144 1.00 80.54  ? 378 SER B O   1 
ATOM   127  C CB  . SER A 1 29  ? 9.433   -31.160 -51.909 1.00 80.04  ? 378 SER B CB  1 
ATOM   128  O OG  . SER A 1 29  ? 8.682   -32.065 -52.655 1.00 97.77  ? 378 SER B OG  1 
ATOM   129  N N   . THR A 1 30  ? 6.697   -32.070 -50.365 1.00 80.31  ? 379 THR B N   1 
ATOM   130  C CA  . THR A 1 30  ? 6.057   -33.203 -49.739 1.00 78.55  ? 379 THR B CA  1 
ATOM   131  C C   . THR A 1 30  ? 6.940   -34.470 -49.905 1.00 80.44  ? 379 THR B C   1 
ATOM   132  O O   . THR A 1 30  ? 6.830   -35.391 -49.100 1.00 74.27  ? 379 THR B O   1 
ATOM   133  C CB  . THR A 1 30  ? 4.605   -33.368 -50.250 1.00 78.48  ? 379 THR B CB  1 
ATOM   134  O OG1 . THR A 1 30  ? 3.709   -33.633 -49.150 1.00 76.36  ? 379 THR B OG1 1 
ATOM   135  C CG2 . THR A 1 30  ? 4.518   -34.451 -51.294 1.00 69.32  ? 379 THR B CG2 1 
ATOM   136  N N   . ALA A 1 31  ? 7.863   -34.489 -50.878 1.00 80.00  ? 380 ALA B N   1 
ATOM   137  C CA  . ALA A 1 31  ? 8.935   -35.519 -50.903 1.00 83.64  ? 380 ALA B CA  1 
ATOM   138  C C   . ALA A 1 31  ? 10.184  -35.292 -49.986 1.00 72.57  ? 380 ALA B C   1 
ATOM   139  O O   . ALA A 1 31  ? 11.052  -36.147 -49.927 1.00 82.58  ? 380 ALA B O   1 
ATOM   140  C CB  . ALA A 1 31  ? 9.375   -35.772 -52.351 1.00 80.48  ? 380 ALA B CB  1 
ATOM   141  N N   . LYS A 1 32  ? 10.291  -34.171 -49.281 1.00 73.99  ? 381 LYS B N   1 
ATOM   142  C CA  . LYS A 1 32  ? 11.476  -33.909 -48.421 1.00 71.50  ? 381 LYS B CA  1 
ATOM   143  C C   . LYS A 1 32  ? 11.089  -33.962 -46.937 1.00 67.45  ? 381 LYS B C   1 
ATOM   144  O O   . LYS A 1 32  ? 11.847  -33.559 -46.047 1.00 64.80  ? 381 LYS B O   1 
ATOM   145  C CB  . LYS A 1 32  ? 12.094  -32.549 -48.761 1.00 67.27  ? 381 LYS B CB  1 
ATOM   146  N N   . LEU A 1 33  ? 9.867   -34.406 -46.688 1.00 61.77  ? 382 LEU B N   1 
ATOM   147  C CA  . LEU A 1 33  ? 9.406   -34.634 -45.351 1.00 56.74  ? 382 LEU B CA  1 
ATOM   148  C C   . LEU A 1 33  ? 10.251  -35.744 -44.694 1.00 58.97  ? 382 LEU B C   1 
ATOM   149  O O   . LEU A 1 33  ? 10.400  -36.845 -45.243 1.00 57.54  ? 382 LEU B O   1 
ATOM   150  C CB  . LEU A 1 33  ? 7.925   -35.037 -45.373 1.00 56.79  ? 382 LEU B CB  1 
ATOM   151  C CG  . LEU A 1 33  ? 6.855   -33.965 -45.142 1.00 63.82  ? 382 LEU B CG  1 
ATOM   152  C CD1 . LEU A 1 33  ? 7.324   -32.533 -45.378 1.00 59.53  ? 382 LEU B CD1 1 
ATOM   153  C CD2 . LEU A 1 33  ? 5.615   -34.265 -45.952 1.00 56.90  ? 382 LEU B CD2 1 
ATOM   154  N N   . ASP A 1 34  ? 10.758  -35.435 -43.503 1.00 61.73  ? 383 ASP B N   1 
ATOM   155  C CA  . ASP A 1 34  ? 11.590  -36.315 -42.699 1.00 53.01  ? 383 ASP B CA  1 
ATOM   156  C C   . ASP A 1 34  ? 10.810  -36.797 -41.455 1.00 50.50  ? 383 ASP B C   1 
ATOM   157  O O   . ASP A 1 34  ? 10.616  -36.074 -40.479 1.00 54.45  ? 383 ASP B O   1 
ATOM   158  C CB  . ASP A 1 34  ? 12.874  -35.563 -42.302 1.00 50.42  ? 383 ASP B CB  1 
ATOM   159  C CG  . ASP A 1 34  ? 13.757  -36.332 -41.303 1.00 57.62  ? 383 ASP B CG  1 
ATOM   160  O OD1 . ASP A 1 34  ? 14.710  -35.695 -40.818 1.00 65.96  ? 383 ASP B OD1 1 
ATOM   161  O OD2 . ASP A 1 34  ? 13.508  -37.517 -40.957 1.00 57.38  ? 383 ASP B OD2 1 
ATOM   162  N N   . TYR A 1 35  ? 10.477  -38.062 -41.481 1.00 49.36  ? 384 TYR B N   1 
ATOM   163  C CA  . TYR A 1 35  ? 9.780   -38.736 -40.412 1.00 53.28  ? 384 TYR B CA  1 
ATOM   164  C C   . TYR A 1 35  ? 10.677  -39.579 -39.538 1.00 53.57  ? 384 TYR B C   1 
ATOM   165  O O   . TYR A 1 35  ? 10.159  -40.297 -38.693 1.00 62.45  ? 384 TYR B O   1 
ATOM   166  C CB  . TYR A 1 35  ? 8.720   -39.646 -40.997 1.00 47.84  ? 384 TYR B CB  1 
ATOM   167  C CG  . TYR A 1 35  ? 7.464   -38.905 -41.426 1.00 52.79  ? 384 TYR B CG  1 
ATOM   168  C CD1 . TYR A 1 35  ? 7.369   -38.349 -42.693 1.00 48.31  ? 384 TYR B CD1 1 
ATOM   169  C CD2 . TYR A 1 35  ? 6.365   -38.796 -40.576 1.00 49.51  ? 384 TYR B CD2 1 
ATOM   170  C CE1 . TYR A 1 35  ? 6.233   -37.703 -43.111 1.00 50.23  ? 384 TYR B CE1 1 
ATOM   171  C CE2 . TYR A 1 35  ? 5.227   -38.128 -40.999 1.00 56.48  ? 384 TYR B CE2 1 
ATOM   172  C CZ  . TYR A 1 35  ? 5.172   -37.580 -42.270 1.00 50.68  ? 384 TYR B CZ  1 
ATOM   173  O OH  . TYR A 1 35  ? 4.047   -36.940 -42.749 1.00 53.18  ? 384 TYR B OH  1 
ATOM   174  N N   . SER A 1 36  ? 11.999  -39.455 -39.686 1.00 51.95  ? 385 SER B N   1 
ATOM   175  C CA  . SER A 1 36  ? 12.946  -40.342 -38.933 1.00 55.51  ? 385 SER B CA  1 
ATOM   176  C C   . SER A 1 36  ? 12.926  -40.132 -37.413 1.00 57.27  ? 385 SER B C   1 
ATOM   177  O O   . SER A 1 36  ? 13.420  -40.972 -36.683 1.00 58.26  ? 385 SER B O   1 
ATOM   178  C CB  . SER A 1 36  ? 14.391  -40.166 -39.436 1.00 58.20  ? 385 SER B CB  1 
ATOM   179  O OG  . SER A 1 36  ? 14.874  -38.797 -39.386 1.00 55.91  ? 385 SER B OG  1 
ATOM   180  N N   . LYS A 1 37  ? 12.394  -39.003 -36.926 1.00 58.16  ? 386 LYS B N   1 
ATOM   181  C CA  . LYS A 1 37  ? 12.357  -38.755 -35.484 1.00 56.72  ? 386 LYS B CA  1 
ATOM   182  C C   . LYS A 1 37  ? 10.970  -38.807 -34.937 1.00 49.90  ? 386 LYS B C   1 
ATOM   183  O O   . LYS A 1 37  ? 10.789  -38.757 -33.737 1.00 57.01  ? 386 LYS B O   1 
ATOM   184  C CB  . LYS A 1 37  ? 12.927  -37.371 -35.144 1.00 63.31  ? 386 LYS B CB  1 
ATOM   185  C CG  . LYS A 1 37  ? 14.326  -37.132 -35.646 1.00 72.71  ? 386 LYS B CG  1 
ATOM   186  C CD  . LYS A 1 37  ? 15.315  -38.104 -35.012 1.00 81.38  ? 386 LYS B CD  1 
ATOM   187  C CE  . LYS A 1 37  ? 16.745  -37.689 -35.365 1.00 87.24  ? 386 LYS B CE  1 
ATOM   188  N NZ  . LYS A 1 37  ? 17.051  -37.943 -36.813 1.00 89.47  ? 386 LYS B NZ  1 
ATOM   189  N N   . PHE A 1 38  ? 9.984   -38.852 -35.809 1.00 55.26  ? 387 PHE B N   1 
ATOM   190  C CA  . PHE A 1 38  ? 8.590   -38.826 -35.409 1.00 54.52  ? 387 PHE B CA  1 
ATOM   191  C C   . PHE A 1 38  ? 8.261   -40.062 -34.569 1.00 59.92  ? 387 PHE B C   1 
ATOM   192  O O   . PHE A 1 38  ? 8.607   -41.179 -34.944 1.00 61.91  ? 387 PHE B O   1 
ATOM   193  C CB  . PHE A 1 38  ? 7.731   -38.804 -36.670 1.00 56.89  ? 387 PHE B CB  1 
ATOM   194  C CG  . PHE A 1 38  ? 6.256   -38.747 -36.410 1.00 56.74  ? 387 PHE B CG  1 
ATOM   195  C CD1 . PHE A 1 38  ? 5.622   -37.549 -36.138 1.00 54.74  ? 387 PHE B CD1 1 
ATOM   196  C CD2 . PHE A 1 38  ? 5.472   -39.906 -36.505 1.00 57.14  ? 387 PHE B CD2 1 
ATOM   197  C CE1 . PHE A 1 38  ? 4.231   -37.518 -35.904 1.00 64.25  ? 387 PHE B CE1 1 
ATOM   198  C CE2 . PHE A 1 38  ? 4.089   -39.872 -36.318 1.00 56.53  ? 387 PHE B CE2 1 
ATOM   199  C CZ  . PHE A 1 38  ? 3.460   -38.685 -36.002 1.00 55.93  ? 387 PHE B CZ  1 
ATOM   200  N N   . GLN A 1 39  ? 7.616   -39.834 -33.430 1.00 65.94  ? 388 GLN B N   1 
ATOM   201  C CA  . GLN A 1 39  ? 7.101   -40.885 -32.532 1.00 66.00  ? 388 GLN B CA  1 
ATOM   202  C C   . GLN A 1 39  ? 5.827   -40.336 -31.905 1.00 64.87  ? 388 GLN B C   1 
ATOM   203  O O   . GLN A 1 39  ? 5.891   -39.357 -31.169 1.00 66.00  ? 388 GLN B O   1 
ATOM   204  C CB  . GLN A 1 39  ? 8.073   -41.237 -31.390 1.00 64.18  ? 388 GLN B CB  1 
ATOM   205  C CG  . GLN A 1 39  ? 9.160   -42.244 -31.766 1.00 66.31  ? 388 GLN B CG  1 
ATOM   206  N N   . GLU A 1 40  ? 4.682   -40.954 -32.177 1.00 64.62  ? 389 GLU B N   1 
ATOM   207  C CA  . GLU A 1 40  ? 3.405   -40.508 -31.561 1.00 71.77  ? 389 GLU B CA  1 
ATOM   208  C C   . GLU A 1 40  ? 3.256   -40.860 -30.090 1.00 67.86  ? 389 GLU B C   1 
ATOM   209  O O   . GLU A 1 40  ? 2.395   -40.334 -29.430 1.00 83.21  ? 389 GLU B O   1 
ATOM   210  C CB  . GLU A 1 40  ? 2.183   -41.034 -32.307 1.00 77.10  ? 389 GLU B CB  1 
ATOM   211  C CG  . GLU A 1 40  ? 2.167   -42.527 -32.438 1.00 88.17  ? 389 GLU B CG  1 
ATOM   212  C CD  . GLU A 1 40  ? 0.850   -43.052 -32.945 1.00 95.40  ? 389 GLU B CD  1 
ATOM   213  O OE1 . GLU A 1 40  ? 0.076   -42.261 -33.567 1.00 83.67  ? 389 GLU B OE1 1 
ATOM   214  O OE2 . GLU A 1 40  ? 0.621   -44.265 -32.700 1.00 77.78  ? 389 GLU B OE2 1 
ATOM   215  N N   . LEU A 1 41  ? 4.113   -41.733 -29.586 1.00 74.32  ? 390 LEU B N   1 
ATOM   216  C CA  . LEU A 1 41  ? 4.044   -42.246 -28.231 1.00 81.29  ? 390 LEU B CA  1 
ATOM   217  C C   . LEU A 1 41  ? 5.269   -41.831 -27.456 1.00 80.86  ? 390 LEU B C   1 
ATOM   218  O O   . LEU A 1 41  ? 6.360   -41.887 -27.978 1.00 88.40  ? 390 LEU B O   1 
ATOM   219  C CB  . LEU A 1 41  ? 3.997   -43.765 -28.322 1.00 82.53  ? 390 LEU B CB  1 
ATOM   220  C CG  . LEU A 1 41  ? 3.207   -44.589 -27.297 1.00 77.68  ? 390 LEU B CG  1 
ATOM   221  C CD1 . LEU A 1 41  ? 1.903   -43.949 -26.844 1.00 70.25  ? 390 LEU B CD1 1 
ATOM   222  C CD2 . LEU A 1 41  ? 2.954   -45.953 -27.925 1.00 77.40  ? 390 LEU B CD2 1 
ATOM   223  N N   . VAL A 1 42  ? 5.107   -41.396 -26.215 1.00 92.71  ? 391 VAL B N   1 
ATOM   224  C CA  . VAL A 1 42  ? 6.268   -40.892 -25.483 1.00 113.69 ? 391 VAL B CA  1 
ATOM   225  C C   . VAL A 1 42  ? 6.216   -41.265 -23.994 1.00 120.20 ? 391 VAL B C   1 
ATOM   226  O O   . VAL A 1 42  ? 5.142   -41.455 -23.410 1.00 105.06 ? 391 VAL B O   1 
ATOM   227  C CB  . VAL A 1 42  ? 6.487   -39.365 -25.704 1.00 117.03 ? 391 VAL B CB  1 
ATOM   228  C CG1 . VAL A 1 42  ? 7.971   -38.980 -25.586 1.00 111.73 ? 391 VAL B CG1 1 
ATOM   229  C CG2 . VAL A 1 42  ? 5.955   -38.919 -27.061 1.00 107.88 ? 391 VAL B CG2 1 
ATOM   230  N N   . LEU A 1 43  ? 7.397   -41.346 -23.395 1.00 137.51 ? 392 LEU B N   1 
ATOM   231  C CA  . LEU A 1 43  ? 7.575   -42.122 -22.205 1.00 148.35 ? 392 LEU B CA  1 
ATOM   232  C C   . LEU A 1 43  ? 8.628   -41.561 -21.287 1.00 147.93 ? 392 LEU B C   1 
ATOM   233  O O   . LEU A 1 43  ? 9.820   -41.506 -21.597 1.00 118.20 ? 392 LEU B O   1 
ATOM   234  C CB  . LEU A 1 43  ? 8.012   -43.529 -22.555 1.00 148.25 ? 392 LEU B CB  1 
ATOM   235  C CG  . LEU A 1 43  ? 9.318   -43.517 -23.364 1.00 141.65 ? 392 LEU B CG  1 
ATOM   236  C CD1 . LEU A 1 43  ? 10.039  -44.852 -23.277 1.00 135.12 ? 392 LEU B CD1 1 
ATOM   237  C CD2 . LEU A 1 43  ? 9.113   -43.110 -24.829 1.00 139.11 ? 392 LEU B CD2 1 
ATOM   238  N N   . PRO A 1 44  ? 8.181   -41.139 -20.133 1.00 145.33 ? 393 PRO B N   1 
ATOM   239  C CA  . PRO A 1 44  ? 6.953   -40.434 -19.781 1.00 141.18 ? 393 PRO B CA  1 
ATOM   240  C C   . PRO A 1 44  ? 7.305   -39.251 -18.850 1.00 138.05 ? 393 PRO B C   1 
ATOM   241  O O   . PRO A 1 44  ? 8.075   -39.408 -17.895 1.00 137.57 ? 393 PRO B O   1 
ATOM   242  C CB  . PRO A 1 44  ? 6.039   -41.543 -19.198 1.00 138.70 ? 393 PRO B CB  1 
ATOM   243  C CG  . PRO A 1 44  ? 6.817   -42.831 -19.296 1.00 138.01 ? 393 PRO B CG  1 
ATOM   244  C CD  . PRO A 1 44  ? 8.258   -42.465 -19.504 1.00 141.93 ? 393 PRO B CD  1 
ATOM   245  N N   . HIS A 1 45  ? 6.812   -38.060 -19.192 1.00 132.39 ? 394 HIS B N   1 
ATOM   246  C CA  . HIS A 1 45  ? 7.264   -36.818 -18.564 1.00 134.55 ? 394 HIS B CA  1 
ATOM   247  C C   . HIS A 1 45  ? 8.805   -36.714 -18.562 1.00 116.74 ? 394 HIS B C   1 
ATOM   248  O O   . HIS A 1 45  ? 9.503   -37.255 -17.700 1.00 109.28 ? 394 HIS B O   1 
ATOM   249  C CB  . HIS A 1 45  ? 6.674   -36.691 -17.145 1.00 140.77 ? 394 HIS B CB  1 
ATOM   250  C CG  . HIS A 1 45  ? 5.937   -35.409 -16.913 1.00 146.08 ? 394 HIS B CG  1 
ATOM   251  N ND1 . HIS A 1 45  ? 4.879   -35.016 -17.704 1.00 146.25 ? 394 HIS B ND1 1 
ATOM   252  C CD2 . HIS A 1 45  ? 6.097   -34.437 -15.984 1.00 144.01 ? 394 HIS B CD2 1 
ATOM   253  C CE1 . HIS A 1 45  ? 4.422   -33.852 -17.277 1.00 141.16 ? 394 HIS B CE1 1 
ATOM   254  N NE2 . HIS A 1 45  ? 5.147   -33.477 -16.237 1.00 144.23 ? 394 HIS B NE2 1 
ATOM   255  N N   . LYS A 1 48  ? 8.972   -31.729 -15.328 1.00 90.73  ? 397 LYS B N   1 
ATOM   256  C CA  . LYS A 1 48  ? 9.267   -30.389 -15.865 1.00 100.80 ? 397 LYS B CA  1 
ATOM   257  C C   . LYS A 1 48  ? 10.229  -30.546 -17.035 1.00 96.53  ? 397 LYS B C   1 
ATOM   258  O O   . LYS A 1 48  ? 11.046  -31.451 -17.017 1.00 88.65  ? 397 LYS B O   1 
ATOM   259  C CB  . LYS A 1 48  ? 9.900   -29.451 -14.798 1.00 93.67  ? 397 LYS B CB  1 
ATOM   260  N N   . GLU A 1 49  ? 10.151  -29.659 -18.028 1.00 99.46  ? 398 GLU B N   1 
ATOM   261  C CA  . GLU A 1 49  ? 11.081  -29.702 -19.189 1.00 95.77  ? 398 GLU B CA  1 
ATOM   262  C C   . GLU A 1 49  ? 12.525  -29.908 -18.779 1.00 88.93  ? 398 GLU B C   1 
ATOM   263  O O   . GLU A 1 49  ? 12.915  -29.516 -17.685 1.00 77.59  ? 398 GLU B O   1 
ATOM   264  C CB  . GLU A 1 49  ? 11.027  -28.413 -20.036 1.00 92.25  ? 398 GLU B CB  1 
ATOM   265  C CG  . GLU A 1 49  ? 11.439  -27.120 -19.318 1.00 87.28  ? 398 GLU B CG  1 
ATOM   266  C CD  . GLU A 1 49  ? 10.356  -26.519 -18.448 1.00 85.81  ? 398 GLU B CD  1 
ATOM   267  O OE1 . GLU A 1 49  ? 10.696  -25.901 -17.417 1.00 82.43  ? 398 GLU B OE1 1 
ATOM   268  O OE2 . GLU A 1 49  ? 9.161   -26.649 -18.795 1.00 98.82  ? 398 GLU B OE2 1 
ATOM   269  N N   . ASP A 1 50  ? 13.322  -30.490 -19.671 1.00 89.05  ? 399 ASP B N   1 
ATOM   270  C CA  . ASP A 1 50  ? 14.772  -30.579 -19.463 1.00 88.73  ? 399 ASP B CA  1 
ATOM   271  C C   . ASP A 1 50  ? 15.546  -29.914 -20.608 1.00 91.97  ? 399 ASP B C   1 
ATOM   272  O O   . ASP A 1 50  ? 14.962  -29.384 -21.583 1.00 79.38  ? 399 ASP B O   1 
ATOM   273  C CB  . ASP A 1 50  ? 15.201  -32.032 -19.302 1.00 91.56  ? 399 ASP B CB  1 
ATOM   274  C CG  . ASP A 1 50  ? 15.217  -32.783 -20.600 1.00 93.86  ? 399 ASP B CG  1 
ATOM   275  O OD1 . ASP A 1 50  ? 16.048  -32.458 -21.476 1.00 94.71  ? 399 ASP B OD1 1 
ATOM   276  O OD2 . ASP A 1 50  ? 14.430  -33.727 -20.720 1.00 92.00  ? 399 ASP B OD2 1 
ATOM   277  N N   . ALA A 1 51  ? 16.874  -29.955 -20.482 1.00 92.58  ? 400 ALA B N   1 
ATOM   278  C CA  . ALA A 1 51  ? 17.767  -29.247 -21.397 1.00 93.41  ? 400 ALA B CA  1 
ATOM   279  C C   . ALA A 1 51  ? 17.568  -29.646 -22.857 1.00 83.62  ? 400 ALA B C   1 
ATOM   280  O O   . ALA A 1 51  ? 17.644  -28.797 -23.721 1.00 84.93  ? 400 ALA B O   1 
ATOM   281  C CB  . ALA A 1 51  ? 19.224  -29.432 -20.982 1.00 86.85  ? 400 ALA B CB  1 
ATOM   282  N N   . GLY A 1 52  ? 17.300  -30.924 -23.117 1.00 81.97  ? 401 GLY B N   1 
ATOM   283  C CA  . GLY A 1 52  ? 17.123  -31.422 -24.488 1.00 68.90  ? 401 GLY B CA  1 
ATOM   284  C C   . GLY A 1 52  ? 15.854  -30.904 -25.119 1.00 63.76  ? 401 GLY B C   1 
ATOM   285  O O   . GLY A 1 52  ? 15.819  -30.637 -26.306 1.00 64.08  ? 401 GLY B O   1 
ATOM   286  N N   . ASP A 1 53  ? 14.818  -30.736 -24.311 1.00 65.50  ? 402 ASP B N   1 
ATOM   287  C CA  . ASP A 1 53  ? 13.584  -30.076 -24.746 1.00 64.85  ? 402 ASP B CA  1 
ATOM   288  C C   . ASP A 1 53  ? 13.748  -28.570 -24.998 1.00 64.96  ? 402 ASP B C   1 
ATOM   289  O O   . ASP A 1 53  ? 13.260  -28.063 -26.001 1.00 67.49  ? 402 ASP B O   1 
ATOM   290  C CB  . ASP A 1 53  ? 12.476  -30.289 -23.738 1.00 74.40  ? 402 ASP B CB  1 
ATOM   291  C CG  . ASP A 1 53  ? 12.233  -31.755 -23.463 1.00 74.55  ? 402 ASP B CG  1 
ATOM   292  O OD1 . ASP A 1 53  ? 11.861  -32.494 -24.388 1.00 74.10  ? 402 ASP B OD1 1 
ATOM   293  O OD2 . ASP A 1 53  ? 12.442  -32.162 -22.318 1.00 84.29  ? 402 ASP B OD2 1 
ATOM   294  N N   . VAL A 1 54  ? 14.476  -27.863 -24.142 1.00 59.48  ? 403 VAL B N   1 
ATOM   295  C CA  . VAL A 1 54  ? 14.697  -26.454 -24.391 1.00 55.97  ? 403 VAL B CA  1 
ATOM   296  C C   . VAL A 1 54  ? 15.605  -26.205 -25.616 1.00 60.41  ? 403 VAL B C   1 
ATOM   297  O O   . VAL A 1 54  ? 15.317  -25.351 -26.462 1.00 56.31  ? 403 VAL B O   1 
ATOM   298  C CB  . VAL A 1 54  ? 15.237  -25.733 -23.179 1.00 58.96  ? 403 VAL B CB  1 
ATOM   299  C CG1 . VAL A 1 54  ? 15.372  -24.265 -23.504 1.00 63.18  ? 403 VAL B CG1 1 
ATOM   300  C CG2 . VAL A 1 54  ? 14.292  -25.918 -22.012 1.00 57.95  ? 403 VAL B CG2 1 
ATOM   301  N N   . GLN A 1 55  ? 16.654  -26.995 -25.753 1.00 62.04  ? 404 GLN B N   1 
ATOM   302  C CA  . GLN A 1 55  ? 17.546  -26.854 -26.905 1.00 57.41  ? 404 GLN B CA  1 
ATOM   303  C C   . GLN A 1 55  ? 16.808  -27.086 -28.244 1.00 53.43  ? 404 GLN B C   1 
ATOM   304  O O   . GLN A 1 55  ? 16.993  -26.358 -29.207 1.00 55.03  ? 404 GLN B O   1 
ATOM   305  C CB  . GLN A 1 55  ? 18.751  -27.819 -26.766 1.00 56.59  ? 404 GLN B CB  1 
ATOM   306  C CG  . GLN A 1 55  ? 19.895  -27.585 -27.774 1.00 59.63  ? 404 GLN B CG  1 
ATOM   307  C CD  . GLN A 1 55  ? 20.545  -26.228 -27.597 1.00 60.18  ? 404 GLN B CD  1 
ATOM   308  O OE1 . GLN A 1 55  ? 21.107  -25.925 -26.534 1.00 72.90  ? 404 GLN B OE1 1 
ATOM   309  N NE2 . GLN A 1 55  ? 20.370  -25.359 -28.590 1.00 61.05  ? 404 GLN B NE2 1 
ATOM   310  N N   . GLN A 1 56  ? 15.972  -28.111 -28.300 1.00 53.52  ? 405 GLN B N   1 
ATOM   311  C CA  . GLN A 1 56  ? 15.179  -28.387 -29.505 1.00 55.93  ? 405 GLN B CA  1 
ATOM   312  C C   . GLN A 1 56  ? 14.208  -27.204 -29.820 1.00 56.75  ? 405 GLN B C   1 
ATOM   313  O O   . GLN A 1 56  ? 14.118  -26.748 -30.951 1.00 58.59  ? 405 GLN B O   1 
ATOM   314  C CB  . GLN A 1 56  ? 14.402  -29.693 -29.264 1.00 63.86  ? 405 GLN B CB  1 
ATOM   315  C CG  . GLN A 1 56  ? 13.459  -30.162 -30.376 1.00 73.14  ? 405 GLN B CG  1 
ATOM   316  C CD  . GLN A 1 56  ? 12.344  -31.119 -29.912 1.00 80.00  ? 405 GLN B CD  1 
ATOM   317  O OE1 . GLN A 1 56  ? 11.526  -30.786 -29.060 1.00 74.03  ? 405 GLN B OE1 1 
ATOM   318  N NE2 . GLN A 1 56  ? 12.297  -32.295 -30.508 1.00 84.32  ? 405 GLN B NE2 1 
ATOM   319  N N   . PHE A 1 57  ? 13.505  -26.695 -28.810 1.00 50.13  ? 406 PHE B N   1 
ATOM   320  C CA  . PHE A 1 57  ? 12.646  -25.521 -28.987 1.00 50.02  ? 406 PHE B CA  1 
ATOM   321  C C   . PHE A 1 57  ? 13.435  -24.387 -29.677 1.00 48.65  ? 406 PHE B C   1 
ATOM   322  O O   . PHE A 1 57  ? 13.031  -23.893 -30.703 1.00 47.65  ? 406 PHE B O   1 
ATOM   323  C CB  . PHE A 1 57  ? 12.163  -25.082 -27.617 1.00 47.81  ? 406 PHE B CB  1 
ATOM   324  C CG  . PHE A 1 57  ? 11.432  -23.785 -27.583 1.00 48.94  ? 406 PHE B CG  1 
ATOM   325  C CD1 . PHE A 1 57  ? 10.086  -23.721 -27.879 1.00 57.47  ? 406 PHE B CD1 1 
ATOM   326  C CD2 . PHE A 1 57  ? 12.077  -22.629 -27.185 1.00 53.54  ? 406 PHE B CD2 1 
ATOM   327  C CE1 . PHE A 1 57  ? 9.406   -22.518 -27.808 1.00 58.98  ? 406 PHE B CE1 1 
ATOM   328  C CE2 . PHE A 1 57  ? 11.408  -21.430 -27.124 1.00 49.98  ? 406 PHE B CE2 1 
ATOM   329  C CZ  . PHE A 1 57  ? 10.082  -21.372 -27.452 1.00 52.17  ? 406 PHE B CZ  1 
ATOM   330  N N   . TYR A 1 58  ? 14.573  -24.009 -29.119 1.00 49.61  ? 407 TYR B N   1 
ATOM   331  C CA  . TYR A 1 58  ? 15.391  -22.971 -29.709 1.00 49.66  ? 407 TYR B CA  1 
ATOM   332  C C   . TYR A 1 58  ? 15.881  -23.327 -31.093 1.00 52.13  ? 407 TYR B C   1 
ATOM   333  O O   . TYR A 1 58  ? 15.872  -22.476 -32.000 1.00 53.50  ? 407 TYR B O   1 
ATOM   334  C CB  . TYR A 1 58  ? 16.560  -22.637 -28.796 1.00 46.86  ? 407 TYR B CB  1 
ATOM   335  C CG  . TYR A 1 58  ? 16.156  -21.849 -27.571 1.00 50.97  ? 407 TYR B CG  1 
ATOM   336  C CD1 . TYR A 1 58  ? 15.328  -20.708 -27.680 1.00 52.12  ? 407 TYR B CD1 1 
ATOM   337  C CD2 . TYR A 1 58  ? 16.641  -22.190 -26.296 1.00 53.91  ? 407 TYR B CD2 1 
ATOM   338  C CE1 . TYR A 1 58  ? 14.973  -19.957 -26.566 1.00 49.26  ? 407 TYR B CE1 1 
ATOM   339  C CE2 . TYR A 1 58  ? 16.286  -21.444 -25.178 1.00 53.85  ? 407 TYR B CE2 1 
ATOM   340  C CZ  . TYR A 1 58  ? 15.440  -20.331 -25.328 1.00 52.58  ? 407 TYR B CZ  1 
ATOM   341  O OH  . TYR A 1 58  ? 15.072  -19.560 -24.251 1.00 50.29  ? 407 TYR B OH  1 
ATOM   342  N N   . ASP A 1 59  ? 16.288  -24.576 -31.273 1.00 53.30  ? 408 ASP B N   1 
ATOM   343  C CA  . ASP A 1 59  ? 16.791  -25.002 -32.577 1.00 57.17  ? 408 ASP B CA  1 
ATOM   344  C C   . ASP A 1 59  ? 15.718  -24.904 -33.650 1.00 61.28  ? 408 ASP B C   1 
ATOM   345  O O   . ASP A 1 59  ? 16.000  -24.508 -34.805 1.00 57.83  ? 408 ASP B O   1 
ATOM   346  C CB  . ASP A 1 59  ? 17.347  -26.432 -32.525 1.00 56.60  ? 408 ASP B CB  1 
ATOM   347  C CG  . ASP A 1 59  ? 18.675  -26.523 -31.764 1.00 65.38  ? 408 ASP B CG  1 
ATOM   348  O OD1 . ASP A 1 59  ? 19.233  -25.460 -31.334 1.00 58.81  ? 408 ASP B OD1 1 
ATOM   349  O OD2 . ASP A 1 59  ? 19.138  -27.675 -31.564 1.00 69.39  ? 408 ASP B OD2 1 
ATOM   350  N N   . LEU A 1 60  ? 14.492  -25.259 -33.281 1.00 52.19  ? 409 LEU B N   1 
ATOM   351  C CA  . LEU A 1 60  ? 13.377  -25.193 -34.234 1.00 57.53  ? 409 LEU B CA  1 
ATOM   352  C C   . LEU A 1 60  ? 13.096  -23.744 -34.640 1.00 56.75  ? 409 LEU B C   1 
ATOM   353  O O   . LEU A 1 60  ? 12.910  -23.409 -35.819 1.00 49.11  ? 409 LEU B O   1 
ATOM   354  C CB  . LEU A 1 60  ? 12.132  -25.788 -33.584 1.00 64.33  ? 409 LEU B CB  1 
ATOM   355  C CG  . LEU A 1 60  ? 11.729  -27.246 -33.852 1.00 66.01  ? 409 LEU B CG  1 
ATOM   356  C CD1 . LEU A 1 60  ? 12.662  -28.010 -34.756 1.00 67.86  ? 409 LEU B CD1 1 
ATOM   357  C CD2 . LEU A 1 60  ? 11.500  -27.973 -32.545 1.00 64.99  ? 409 LEU B CD2 1 
ATOM   358  N N   . LEU A 1 61  ? 13.068  -22.888 -33.627 1.00 53.29  ? 410 LEU B N   1 
ATOM   359  C CA  . LEU A 1 61  ? 12.928  -21.465 -33.811 1.00 53.98  ? 410 LEU B CA  1 
ATOM   360  C C   . LEU A 1 61  ? 14.019  -20.951 -34.765 1.00 56.32  ? 410 LEU B C   1 
ATOM   361  O O   . LEU A 1 61  ? 13.736  -20.295 -35.780 1.00 53.68  ? 410 LEU B O   1 
ATOM   362  C CB  . LEU A 1 61  ? 12.968  -20.795 -32.426 1.00 53.97  ? 410 LEU B CB  1 
ATOM   363  C CG  . LEU A 1 61  ? 11.732  -20.096 -31.865 1.00 58.00  ? 410 LEU B CG  1 
ATOM   364  C CD1 . LEU A 1 61  ? 10.434  -20.651 -32.379 1.00 57.68  ? 410 LEU B CD1 1 
ATOM   365  C CD2 . LEU A 1 61  ? 11.747  -20.092 -30.355 1.00 63.66  ? 410 LEU B CD2 1 
ATOM   366  N N   . SER A 1 62  ? 15.263  -21.283 -34.465 1.00 55.32  ? 411 SER B N   1 
ATOM   367  C CA  . SER A 1 62  ? 16.401  -20.795 -35.282 1.00 58.24  ? 411 SER B CA  1 
ATOM   368  C C   . SER A 1 62  ? 16.340  -21.247 -36.727 1.00 54.97  ? 411 SER B C   1 
ATOM   369  O O   . SER A 1 62  ? 16.619  -20.485 -37.644 1.00 68.30  ? 411 SER B O   1 
ATOM   370  C CB  . SER A 1 62  ? 17.708  -21.257 -34.669 1.00 56.02  ? 411 SER B CB  1 
ATOM   371  O OG  . SER A 1 62  ? 17.823  -20.583 -33.436 1.00 62.03  ? 411 SER B OG  1 
ATOM   372  N N   . GLY A 1 63  ? 15.971  -22.489 -36.959 1.00 57.81  ? 412 GLY B N   1 
ATOM   373  C CA  . GLY A 1 63  ? 15.933  -22.973 -38.344 1.00 52.99  ? 412 GLY B CA  1 
ATOM   374  C C   . GLY A 1 63  ? 14.987  -22.216 -39.277 1.00 59.17  ? 412 GLY B C   1 
ATOM   375  O O   . GLY A 1 63  ? 15.106  -22.325 -40.500 1.00 64.87  ? 412 GLY B O   1 
ATOM   376  N N   . SER A 1 64  ? 14.026  -21.477 -38.727 1.00 59.01  ? 413 SER B N   1 
ATOM   377  C CA  . SER A 1 64  ? 13.174  -20.627 -39.548 1.00 59.10  ? 413 SER B CA  1 
ATOM   378  C C   . SER A 1 64  ? 13.788  -19.270 -39.959 1.00 61.43  ? 413 SER B C   1 
ATOM   379  O O   . SER A 1 64  ? 13.274  -18.650 -40.886 1.00 56.83  ? 413 SER B O   1 
ATOM   380  C CB  . SER A 1 64  ? 11.884  -20.397 -38.778 1.00 61.98  ? 413 SER B CB  1 
ATOM   381  O OG  . SER A 1 64  ? 10.963  -21.403 -39.105 1.00 54.28  ? 413 SER B OG  1 
ATOM   382  N N   . LEU A 1 65  ? 14.821  -18.822 -39.226 1.00 60.92  ? 414 LEU B N   1 
ATOM   383  C CA  . LEU A 1 65  ? 15.447  -17.490 -39.368 1.00 67.04  ? 414 LEU B CA  1 
ATOM   384  C C   . LEU A 1 65  ? 15.896  -17.199 -40.748 1.00 53.58  ? 414 LEU B C   1 
ATOM   385  O O   . LEU A 1 65  ? 15.434  -16.241 -41.386 1.00 57.53  ? 414 LEU B O   1 
ATOM   386  C CB  . LEU A 1 65  ? 16.677  -17.442 -38.469 1.00 73.65  ? 414 LEU B CB  1 
ATOM   387  C CG  . LEU A 1 65  ? 16.622  -16.563 -37.221 1.00 83.55  ? 414 LEU B CG  1 
ATOM   388  C CD1 . LEU A 1 65  ? 15.224  -16.186 -36.741 1.00 73.85  ? 414 LEU B CD1 1 
ATOM   389  C CD2 . LEU A 1 65  ? 17.465  -17.272 -36.139 1.00 78.48  ? 414 LEU B CD2 1 
ATOM   390  N N   . GLU A 1 66  ? 16.759  -18.085 -41.221 1.00 57.85  ? 415 GLU B N   1 
ATOM   391  C CA  . GLU A 1 66  ? 17.393  -17.936 -42.504 1.00 59.05  ? 415 GLU B CA  1 
ATOM   392  C C   . GLU A 1 66  ? 16.316  -18.178 -43.544 1.00 56.53  ? 415 GLU B C   1 
ATOM   393  O O   . GLU A 1 66  ? 16.275  -17.462 -44.503 1.00 52.93  ? 415 GLU B O   1 
ATOM   394  C CB  . GLU A 1 66  ? 18.616  -18.861 -42.667 1.00 69.41  ? 415 GLU B CB  1 
ATOM   395  C CG  . GLU A 1 66  ? 19.822  -18.261 -43.404 1.00 88.32  ? 415 GLU B CG  1 
ATOM   396  C CD  . GLU A 1 66  ? 20.017  -16.735 -43.257 1.00 103.37 ? 415 GLU B CD  1 
ATOM   397  O OE1 . GLU A 1 66  ? 20.466  -16.275 -42.184 1.00 94.86  ? 415 GLU B OE1 1 
ATOM   398  O OE2 . GLU A 1 66  ? 19.759  -15.983 -44.239 1.00 120.36 ? 415 GLU B OE2 1 
ATOM   399  N N   . VAL A 1 67  ? 15.386  -19.112 -43.312 1.00 49.18  ? 416 VAL B N   1 
ATOM   400  C CA  . VAL A 1 67  ? 14.377  -19.401 -44.305 1.00 47.74  ? 416 VAL B CA  1 
ATOM   401  C C   . VAL A 1 67  ? 13.431  -18.223 -44.521 1.00 44.99  ? 416 VAL B C   1 
ATOM   402  O O   . VAL A 1 67  ? 13.075  -17.910 -45.652 1.00 47.01  ? 416 VAL B O   1 
ATOM   403  C CB  . VAL A 1 67  ? 13.541  -20.683 -43.934 1.00 52.14  ? 416 VAL B CB  1 
ATOM   404  C CG1 . VAL A 1 67  ? 12.320  -20.801 -44.800 1.00 50.69  ? 416 VAL B CG1 1 
ATOM   405  C CG2 . VAL A 1 67  ? 14.374  -21.935 -44.140 1.00 52.32  ? 416 VAL B CG2 1 
ATOM   406  N N   . ILE A 1 68  ? 13.032  -17.570 -43.447 1.00 39.58  ? 417 ILE B N   1 
ATOM   407  C CA  . ILE A 1 68  ? 12.110  -16.475 -43.550 1.00 43.17  ? 417 ILE B CA  1 
ATOM   408  C C   . ILE A 1 68  ? 12.791  -15.242 -44.113 1.00 41.61  ? 417 ILE B C   1 
ATOM   409  O O   . ILE A 1 68  ? 12.176  -14.509 -44.880 1.00 44.18  ? 417 ILE B O   1 
ATOM   410  C CB  . ILE A 1 68  ? 11.444  -16.169 -42.186 1.00 48.67  ? 417 ILE B CB  1 
ATOM   411  C CG1 . ILE A 1 68  ? 10.456  -17.300 -41.868 1.00 51.36  ? 417 ILE B CG1 1 
ATOM   412  C CG2 . ILE A 1 68  ? 10.699  -14.832 -42.231 1.00 50.96  ? 417 ILE B CG2 1 
ATOM   413  C CD1 . ILE A 1 68  ? 9.888   -17.256 -40.467 1.00 47.69  ? 417 ILE B CD1 1 
ATOM   414  N N   . ARG A 1 69  ? 14.044  -15.030 -43.761 1.00 42.19  ? 418 ARG B N   1 
ATOM   415  C CA  . ARG A 1 69  ? 14.834  -13.940 -44.385 1.00 53.38  ? 418 ARG B CA  1 
ATOM   416  C C   . ARG A 1 69  ? 14.966  -14.113 -45.911 1.00 53.20  ? 418 ARG B C   1 
ATOM   417  O O   . ARG A 1 69  ? 14.771  -13.150 -46.654 1.00 54.75  ? 418 ARG B O   1 
ATOM   418  C CB  . ARG A 1 69  ? 16.231  -13.872 -43.772 1.00 57.72  ? 418 ARG B CB  1 
ATOM   419  C CG  . ARG A 1 69  ? 16.969  -12.557 -44.026 1.00 76.70  ? 418 ARG B CG  1 
ATOM   420  C CD  . ARG A 1 69  ? 18.340  -12.452 -43.318 1.00 81.79  ? 418 ARG B CD  1 
ATOM   421  N NE  . ARG A 1 69  ? 18.367  -13.042 -41.956 1.00 98.32  ? 418 ARG B NE  1 
ATOM   422  C CZ  . ARG A 1 69  ? 17.977  -12.445 -40.820 1.00 94.24  ? 418 ARG B CZ  1 
ATOM   423  N NH1 . ARG A 1 69  ? 17.511  -11.187 -40.824 1.00 94.70  ? 418 ARG B NH1 1 
ATOM   424  N NH2 . ARG A 1 69  ? 18.074  -13.116 -39.667 1.00 87.03  ? 418 ARG B NH2 1 
ATOM   425  N N   . LYS A 1 70  ? 15.222  -15.336 -46.397 1.00 50.06  ? 419 LYS B N   1 
ATOM   426  C CA  . LYS A 1 70  ? 15.289  -15.553 -47.868 1.00 52.35  ? 419 LYS B CA  1 
ATOM   427  C C   . LYS A 1 70  ? 13.942  -15.454 -48.521 1.00 49.14  ? 419 LYS B C   1 
ATOM   428  O O   . LYS A 1 70  ? 13.846  -15.045 -49.684 1.00 47.97  ? 419 LYS B O   1 
ATOM   429  C CB  . LYS A 1 70  ? 15.880  -16.904 -48.245 1.00 59.16  ? 419 LYS B CB  1 
ATOM   430  C CG  . LYS A 1 70  ? 17.364  -16.991 -47.972 1.00 66.03  ? 419 LYS B CG  1 
ATOM   431  C CD  . LYS A 1 70  ? 17.866  -18.425 -48.112 1.00 77.87  ? 419 LYS B CD  1 
ATOM   432  C CE  . LYS A 1 70  ? 18.950  -18.687 -47.073 1.00 93.21  ? 419 LYS B CE  1 
ATOM   433  N NZ  . LYS A 1 70  ? 19.373  -20.119 -47.003 1.00 96.33  ? 419 LYS B NZ  1 
ATOM   434  N N   . TRP A 1 71  ? 12.882  -15.824 -47.787 1.00 46.93  ? 420 TRP B N   1 
ATOM   435  C CA  . TRP A 1 71  ? 11.533  -15.693 -48.343 1.00 49.11  ? 420 TRP B CA  1 
ATOM   436  C C   . TRP A 1 71  ? 11.195  -14.179 -48.538 1.00 46.46  ? 420 TRP B C   1 
ATOM   437  O O   . TRP A 1 71  ? 10.684  -13.762 -49.587 1.00 48.77  ? 420 TRP B O   1 
ATOM   438  C CB  . TRP A 1 71  ? 10.525  -16.478 -47.492 1.00 41.34  ? 420 TRP B CB  1 
ATOM   439  C CG  . TRP A 1 71  ? 9.121   -16.029 -47.629 1.00 41.83  ? 420 TRP B CG  1 
ATOM   440  C CD1 . TRP A 1 71  ? 8.235   -16.420 -48.559 1.00 40.67  ? 420 TRP B CD1 1 
ATOM   441  C CD2 . TRP A 1 71  ? 8.434   -15.102 -46.783 1.00 42.09  ? 420 TRP B CD2 1 
ATOM   442  N NE1 . TRP A 1 71  ? 7.022   -15.766 -48.384 1.00 44.63  ? 420 TRP B NE1 1 
ATOM   443  C CE2 . TRP A 1 71  ? 7.123   -14.974 -47.273 1.00 43.00  ? 420 TRP B CE2 1 
ATOM   444  C CE3 . TRP A 1 71  ? 8.802   -14.375 -45.670 1.00 45.72  ? 420 TRP B CE3 1 
ATOM   445  C CZ2 . TRP A 1 71  ? 6.181   -14.143 -46.686 1.00 44.71  ? 420 TRP B CZ2 1 
ATOM   446  C CZ3 . TRP A 1 71  ? 7.865   -13.552 -45.074 1.00 46.38  ? 420 TRP B CZ3 1 
ATOM   447  C CH2 . TRP A 1 71  ? 6.570   -13.451 -45.576 1.00 47.24  ? 420 TRP B CH2 1 
ATOM   448  N N   . ALA A 1 72  ? 11.552  -13.362 -47.560 1.00 47.38  ? 421 ALA B N   1 
ATOM   449  C CA  . ALA A 1 72  ? 11.194  -11.933 -47.618 1.00 48.62  ? 421 ALA B CA  1 
ATOM   450  C C   . ALA A 1 72  ? 11.878  -11.244 -48.785 1.00 47.26  ? 421 ALA B C   1 
ATOM   451  O O   . ALA A 1 72  ? 11.234  -10.456 -49.486 1.00 44.46  ? 421 ALA B O   1 
ATOM   452  C CB  . ALA A 1 72  ? 11.557  -11.240 -46.313 1.00 43.93  ? 421 ALA B CB  1 
ATOM   453  N N   . GLU A 1 73  ? 13.173  -11.556 -48.982 1.00 54.44  ? 422 GLU B N   1 
ATOM   454  C CA  . GLU A 1 73  ? 13.939  -10.971 -50.092 1.00 61.74  ? 422 GLU B CA  1 
ATOM   455  C C   . GLU A 1 73  ? 13.293  -11.249 -51.444 1.00 56.94  ? 422 GLU B C   1 
ATOM   456  O O   . GLU A 1 73  ? 13.522  -10.507 -52.357 1.00 51.71  ? 422 GLU B O   1 
ATOM   457  C CB  . GLU A 1 73  ? 15.469  -11.267 -50.118 1.00 64.66  ? 422 GLU B CB  1 
ATOM   458  C CG  . GLU A 1 73  ? 16.274  -10.577 -48.990 1.00 84.97  ? 422 GLU B CG  1 
ATOM   459  C CD  . GLU A 1 73  ? 16.263  -8.994  -48.959 1.00 90.91  ? 422 GLU B CD  1 
ATOM   460  O OE1 . GLU A 1 73  ? 17.101  -8.364  -49.661 1.00 93.77  ? 422 GLU B OE1 1 
ATOM   461  O OE2 . GLU A 1 73  ? 15.460  -8.346  -48.216 1.00 66.15  ? 422 GLU B OE2 1 
ATOM   462  N N   . LYS A 1 74  ? 12.445  -12.267 -51.558 1.00 58.98  ? 423 LYS B N   1 
ATOM   463  C CA  . LYS A 1 74  ? 11.780  -12.531 -52.837 1.00 55.58  ? 423 LYS B CA  1 
ATOM   464  C C   . LYS A 1 74  ? 10.400  -11.925 -52.906 1.00 51.75  ? 423 LYS B C   1 
ATOM   465  O O   . LYS A 1 74  ? 9.706   -12.096 -53.900 1.00 53.54  ? 423 LYS B O   1 
ATOM   466  C CB  . LYS A 1 74  ? 11.670  -14.037 -53.107 1.00 59.69  ? 423 LYS B CB  1 
ATOM   467  C CG  . LYS A 1 74  ? 13.010  -14.767 -53.271 1.00 65.61  ? 423 LYS B CG  1 
ATOM   468  C CD  . LYS A 1 74  ? 12.799  -16.240 -52.947 1.00 74.24  ? 423 LYS B CD  1 
ATOM   469  C CE  . LYS A 1 74  ? 14.038  -17.115 -53.082 1.00 83.69  ? 423 LYS B CE  1 
ATOM   470  N NZ  . LYS A 1 74  ? 13.617  -18.554 -53.025 1.00 84.85  ? 423 LYS B NZ  1 
ATOM   471  N N   . ILE A 1 75  ? 9.976   -11.200 -51.873 1.00 55.40  ? 424 ILE B N   1 
ATOM   472  C CA  . ILE A 1 75  ? 8.740   -10.410 -52.012 1.00 56.03  ? 424 ILE B CA  1 
ATOM   473  C C   . ILE A 1 75  ? 9.091   -9.140  -52.799 1.00 49.84  ? 424 ILE B C   1 
ATOM   474  O O   . ILE A 1 75  ? 9.966   -8.383  -52.382 1.00 50.95  ? 424 ILE B O   1 
ATOM   475  C CB  . ILE A 1 75  ? 8.109   -10.081 -50.656 1.00 51.89  ? 424 ILE B CB  1 
ATOM   476  C CG1 . ILE A 1 75  ? 7.807   -11.387 -49.902 1.00 52.99  ? 424 ILE B CG1 1 
ATOM   477  C CG2 . ILE A 1 75  ? 6.863   -9.246  -50.860 1.00 52.28  ? 424 ILE B CG2 1 
ATOM   478  C CD1 . ILE A 1 75  ? 7.547   -11.151 -48.435 1.00 50.79  ? 424 ILE B CD1 1 
ATOM   479  N N   . PRO A 1 76  ? 8.479   -8.956  -53.983 1.00 53.79  ? 425 PRO B N   1 
ATOM   480  C CA  . PRO A 1 76  ? 8.863   -7.794  -54.796 1.00 56.98  ? 425 PRO B CA  1 
ATOM   481  C C   . PRO A 1 76  ? 8.484   -6.564  -54.040 1.00 55.91  ? 425 PRO B C   1 
ATOM   482  O O   . PRO A 1 76  ? 7.383   -6.488  -53.475 1.00 53.19  ? 425 PRO B O   1 
ATOM   483  C CB  . PRO A 1 76  ? 8.005   -7.895  -56.048 1.00 58.20  ? 425 PRO B CB  1 
ATOM   484  C CG  . PRO A 1 76  ? 7.580   -9.305  -56.081 1.00 57.40  ? 425 PRO B CG  1 
ATOM   485  C CD  . PRO A 1 76  ? 7.482   -9.777  -54.664 1.00 56.97  ? 425 PRO B CD  1 
ATOM   486  N N   . GLY A 1 77  ? 9.416   -5.630  -53.996 1.00 46.10  ? 426 GLY B N   1 
ATOM   487  C CA  . GLY A 1 77  ? 9.243   -4.456  -53.212 1.00 43.91  ? 426 GLY B CA  1 
ATOM   488  C C   . GLY A 1 77  ? 10.000  -4.524  -51.909 1.00 44.01  ? 426 GLY B C   1 
ATOM   489  O O   . GLY A 1 77  ? 10.468  -3.503  -51.445 1.00 46.10  ? 426 GLY B O   1 
ATOM   490  N N   . PHE A 1 78  ? 10.133  -5.710  -51.317 1.00 45.65  ? 427 PHE B N   1 
ATOM   491  C CA  . PHE A 1 78  ? 10.708  -5.776  -49.981 1.00 47.92  ? 427 PHE B CA  1 
ATOM   492  C C   . PHE A 1 78  ? 12.142  -5.314  -49.947 1.00 48.29  ? 427 PHE B C   1 
ATOM   493  O O   . PHE A 1 78  ? 12.547  -4.618  -49.010 1.00 52.03  ? 427 PHE B O   1 
ATOM   494  C CB  . PHE A 1 78  ? 10.636  -7.178  -49.392 1.00 47.36  ? 427 PHE B CB  1 
ATOM   495  C CG  . PHE A 1 78  ? 11.113  -7.264  -47.942 1.00 46.46  ? 427 PHE B CG  1 
ATOM   496  C CD1 . PHE A 1 78  ? 10.311  -6.817  -46.900 1.00 45.87  ? 427 PHE B CD1 1 
ATOM   497  C CD2 . PHE A 1 78  ? 12.338  -7.774  -47.638 1.00 45.32  ? 427 PHE B CD2 1 
ATOM   498  C CE1 . PHE A 1 78  ? 10.738  -6.877  -45.579 1.00 47.73  ? 427 PHE B CE1 1 
ATOM   499  C CE2 . PHE A 1 78  ? 12.784  -7.865  -46.311 1.00 45.12  ? 427 PHE B CE2 1 
ATOM   500  C CZ  . PHE A 1 78  ? 11.973  -7.433  -45.291 1.00 44.32  ? 427 PHE B CZ  1 
ATOM   501  N N   . ALA A 1 79  ? 12.927  -5.716  -50.945 1.00 50.42  ? 428 ALA B N   1 
ATOM   502  C CA  . ALA A 1 79  ? 14.385  -5.414  -50.927 1.00 52.40  ? 428 ALA B CA  1 
ATOM   503  C C   . ALA A 1 79  ? 14.610  -3.934  -51.228 1.00 48.85  ? 428 ALA B C   1 
ATOM   504  O O   . ALA A 1 79  ? 15.684  -3.402  -50.988 1.00 55.72  ? 428 ALA B O   1 
ATOM   505  C CB  . ALA A 1 79  ? 15.144  -6.302  -51.911 1.00 46.44  ? 428 ALA B CB  1 
ATOM   506  N N   . GLU A 1 80  ? 13.558  -3.286  -51.708 1.00 51.95  ? 429 GLU B N   1 
ATOM   507  C CA  . GLU A 1 80  ? 13.560  -1.854  -51.986 1.00 59.21  ? 429 GLU B CA  1 
ATOM   508  C C   . GLU A 1 80  ? 13.075  -0.975  -50.844 1.00 54.98  ? 429 GLU B C   1 
ATOM   509  O O   . GLU A 1 80  ? 13.020  0.235   -51.009 1.00 46.11  ? 429 GLU B O   1 
ATOM   510  C CB  . GLU A 1 80  ? 12.796  -1.541  -53.275 1.00 60.07  ? 429 GLU B CB  1 
ATOM   511  C CG  . GLU A 1 80  ? 13.673  -1.664  -54.520 1.00 70.39  ? 429 GLU B CG  1 
ATOM   512  C CD  . GLU A 1 80  ? 13.357  -2.795  -55.473 1.00 83.27  ? 429 GLU B CD  1 
ATOM   513  O OE1 . GLU A 1 80  ? 12.666  -2.532  -56.501 1.00 87.63  ? 429 GLU B OE1 1 
ATOM   514  O OE2 . GLU A 1 80  ? 13.876  -3.904  -55.253 1.00 88.15  ? 429 GLU B OE2 1 
ATOM   515  N N   . LEU A 1 81  ? 12.767  -1.575  -49.684 1.00 55.46  ? 430 LEU B N   1 
ATOM   516  C CA  . LEU A 1 81  ? 12.667  -0.832  -48.425 1.00 51.08  ? 430 LEU B CA  1 
ATOM   517  C C   . LEU A 1 81  ? 14.042  -0.552  -47.836 1.00 54.51  ? 430 LEU B C   1 
ATOM   518  O O   . LEU A 1 81  ? 15.045  -1.232  -48.131 1.00 54.61  ? 430 LEU B O   1 
ATOM   519  C CB  . LEU A 1 81  ? 11.862  -1.603  -47.402 1.00 51.49  ? 430 LEU B CB  1 
ATOM   520  C CG  . LEU A 1 81  ? 10.486  -1.974  -47.965 1.00 56.62  ? 430 LEU B CG  1 
ATOM   521  C CD1 . LEU A 1 81  ? 9.816   -2.921  -47.003 1.00 58.93  ? 430 LEU B CD1 1 
ATOM   522  C CD2 . LEU A 1 81  ? 9.608   -0.739  -48.229 1.00 54.99  ? 430 LEU B CD2 1 
ATOM   523  N N   . SER A 1 82  ? 14.130  0.438   -46.970 1.00 48.72  ? 431 SER B N   1 
ATOM   524  C CA  . SER A 1 82  ? 15.435  0.712   -46.385 1.00 51.13  ? 431 SER B CA  1 
ATOM   525  C C   . SER A 1 82  ? 15.943  -0.541  -45.670 1.00 50.95  ? 431 SER B C   1 
ATOM   526  O O   . SER A 1 82  ? 15.150  -1.348  -45.185 1.00 48.52  ? 431 SER B O   1 
ATOM   527  C CB  . SER A 1 82  ? 15.408  1.924   -45.448 1.00 43.80  ? 431 SER B CB  1 
ATOM   528  O OG  . SER A 1 82  ? 14.798  1.614   -44.221 1.00 51.34  ? 431 SER B OG  1 
ATOM   529  N N   . PRO A 1 83  ? 17.264  -0.711  -45.595 1.00 54.97  ? 432 PRO B N   1 
ATOM   530  C CA  . PRO A 1 83  ? 17.786  -1.887  -44.842 1.00 52.19  ? 432 PRO B CA  1 
ATOM   531  C C   . PRO A 1 83  ? 17.331  -1.916  -43.385 1.00 52.79  ? 432 PRO B C   1 
ATOM   532  O O   . PRO A 1 83  ? 17.015  -2.992  -42.885 1.00 55.53  ? 432 PRO B O   1 
ATOM   533  C CB  . PRO A 1 83  ? 19.317  -1.708  -44.917 1.00 48.59  ? 432 PRO B CB  1 
ATOM   534  C CG  . PRO A 1 83  ? 19.517  -0.872  -46.149 1.00 53.05  ? 432 PRO B CG  1 
ATOM   535  C CD  . PRO A 1 83  ? 18.352  0.095   -46.166 1.00 49.08  ? 432 PRO B CD  1 
ATOM   536  N N   . ALA A 1 84  ? 17.321  -0.758  -42.698 1.00 48.75  ? 433 ALA B N   1 
ATOM   537  C CA  . ALA A 1 84  ? 16.827  -0.705  -41.313 1.00 50.10  ? 433 ALA B CA  1 
ATOM   538  C C   . ALA A 1 84  ? 15.349  -1.092  -41.161 1.00 49.72  ? 433 ALA B C   1 
ATOM   539  O O   . ALA A 1 84  ? 14.998  -1.771  -40.207 1.00 48.93  ? 433 ALA B O   1 
ATOM   540  C CB  . ALA A 1 84  ? 17.065  0.634   -40.665 1.00 44.74  ? 433 ALA B CB  1 
ATOM   541  N N   . ASP A 1 85  ? 14.532  -0.749  -42.148 1.00 47.07  ? 434 ASP B N   1 
ATOM   542  C CA  . ASP A 1 85  ? 13.130  -1.115  -42.118 1.00 51.65  ? 434 ASP B CA  1 
ATOM   543  C C   . ASP A 1 85  ? 12.935  -2.620  -42.428 1.00 49.44  ? 434 ASP B C   1 
ATOM   544  O O   . ASP A 1 85  ? 12.043  -3.267  -41.906 1.00 47.59  ? 434 ASP B O   1 
ATOM   545  C CB  . ASP A 1 85  ? 12.342  -0.237  -43.095 1.00 50.07  ? 434 ASP B CB  1 
ATOM   546  C CG  . ASP A 1 85  ? 12.116  1.185   -42.568 1.00 57.46  ? 434 ASP B CG  1 
ATOM   547  O OD1 . ASP A 1 85  ? 12.606  1.505   -41.460 1.00 59.07  ? 434 ASP B OD1 1 
ATOM   548  O OD2 . ASP A 1 85  ? 11.406  1.973   -43.246 1.00 58.66  ? 434 ASP B OD2 1 
ATOM   549  N N   . GLN A 1 86  ? 13.750  -3.147  -43.324 1.00 48.79  ? 435 GLN B N   1 
ATOM   550  C CA  . GLN A 1 86  ? 13.779  -4.557  -43.581 1.00 47.77  ? 435 GLN B CA  1 
ATOM   551  C C   . GLN A 1 86  ? 14.021  -5.330  -42.275 1.00 52.67  ? 435 GLN B C   1 
ATOM   552  O O   . GLN A 1 86  ? 13.255  -6.241  -41.905 1.00 41.56  ? 435 GLN B O   1 
ATOM   553  C CB  . GLN A 1 86  ? 14.829  -4.867  -44.636 1.00 47.31  ? 435 GLN B CB  1 
ATOM   554  C CG  . GLN A 1 86  ? 14.397  -4.590  -46.092 1.00 53.72  ? 435 GLN B CG  1 
ATOM   555  C CD  . GLN A 1 86  ? 15.550  -4.916  -47.084 1.00 53.40  ? 435 GLN B CD  1 
ATOM   556  O OE1 . GLN A 1 86  ? 16.069  -6.035  -47.114 1.00 57.16  ? 435 GLN B OE1 1 
ATOM   557  N NE2 . GLN A 1 86  ? 15.908  -3.965  -47.894 1.00 46.05  ? 435 GLN B NE2 1 
ATOM   558  N N   . ASP A 1 87  ? 15.085  -4.988  -41.576 1.00 44.68  ? 436 ASP B N   1 
ATOM   559  C CA  . ASP A 1 87  ? 15.405  -5.734  -40.360 1.00 49.56  ? 436 ASP B CA  1 
ATOM   560  C C   . ASP A 1 87  ? 14.351  -5.585  -39.255 1.00 50.96  ? 436 ASP B C   1 
ATOM   561  O O   . ASP A 1 87  ? 14.041  -6.534  -38.532 1.00 42.79  ? 436 ASP B O   1 
ATOM   562  C CB  . ASP A 1 87  ? 16.705  -5.249  -39.766 1.00 49.43  ? 436 ASP B CB  1 
ATOM   563  C CG  . ASP A 1 87  ? 17.904  -5.606  -40.594 1.00 56.20  ? 436 ASP B CG  1 
ATOM   564  O OD1 . ASP A 1 87  ? 17.829  -6.527  -41.440 1.00 61.82  ? 436 ASP B OD1 1 
ATOM   565  O OD2 . ASP A 1 87  ? 18.951  -4.925  -40.386 1.00 66.58  ? 436 ASP B OD2 1 
ATOM   566  N N   . LEU A 1 88  ? 13.825  -4.369  -39.123 1.00 56.16  ? 437 LEU B N   1 
ATOM   567  C CA  . LEU A 1 88  ? 12.815  -4.100  -38.133 1.00 49.42  ? 437 LEU B CA  1 
ATOM   568  C C   . LEU A 1 88  ? 11.548  -4.946  -38.475 1.00 50.61  ? 437 LEU B C   1 
ATOM   569  O O   . LEU A 1 88  ? 10.992  -5.558  -37.582 1.00 44.00  ? 437 LEU B O   1 
ATOM   570  C CB  . LEU A 1 88  ? 12.502  -2.591  -38.062 1.00 55.18  ? 437 LEU B CB  1 
ATOM   571  C CG  . LEU A 1 88  ? 11.343  -2.127  -37.150 1.00 56.18  ? 437 LEU B CG  1 
ATOM   572  C CD1 . LEU A 1 88  ? 11.678  -2.379  -35.694 1.00 55.07  ? 437 LEU B CD1 1 
ATOM   573  C CD2 . LEU A 1 88  ? 10.994  -0.664  -37.349 1.00 55.95  ? 437 LEU B CD2 1 
ATOM   574  N N   . LEU A 1 89  ? 11.151  -5.027  -39.751 1.00 43.53  ? 438 LEU B N   1 
ATOM   575  C CA  . LEU A 1 89  ? 10.001  -5.816  -40.140 1.00 42.70  ? 438 LEU B CA  1 
ATOM   576  C C   . LEU A 1 89  ? 10.220  -7.285  -39.868 1.00 45.52  ? 438 LEU B C   1 
ATOM   577  O O   . LEU A 1 89  ? 9.336   -7.954  -39.289 1.00 48.86  ? 438 LEU B O   1 
ATOM   578  C CB  . LEU A 1 89  ? 9.655   -5.586  -41.600 1.00 44.57  ? 438 LEU B CB  1 
ATOM   579  C CG  . LEU A 1 89  ? 9.133   -4.165  -41.906 1.00 49.89  ? 438 LEU B CG  1 
ATOM   580  C CD1 . LEU A 1 89  ? 8.914   -3.924  -43.381 1.00 47.97  ? 438 LEU B CD1 1 
ATOM   581  C CD2 . LEU A 1 89  ? 7.828   -3.862  -41.167 1.00 50.88  ? 438 LEU B CD2 1 
ATOM   582  N N   . LEU A 1 90  ? 11.393  -7.794  -40.257 1.00 47.19  ? 439 LEU B N   1 
ATOM   583  C CA  . LEU A 1 90  ? 11.705  -9.216  -40.129 1.00 48.31  ? 439 LEU B CA  1 
ATOM   584  C C   . LEU A 1 90  ? 11.654  -9.574  -38.662 1.00 49.60  ? 439 LEU B C   1 
ATOM   585  O O   . LEU A 1 90  ? 10.973  -10.508 -38.250 1.00 44.03  ? 439 LEU B O   1 
ATOM   586  C CB  . LEU A 1 90  ? 13.103  -9.578  -40.609 1.00 48.77  ? 439 LEU B CB  1 
ATOM   587  C CG  . LEU A 1 90  ? 13.343  -10.271 -41.949 1.00 53.90  ? 439 LEU B CG  1 
ATOM   588  C CD1 . LEU A 1 90  ? 12.090  -10.839 -42.610 1.00 54.27  ? 439 LEU B CD1 1 
ATOM   589  C CD2 . LEU A 1 90  ? 14.147  -9.397  -42.912 1.00 46.39  ? 439 LEU B CD2 1 
ATOM   590  N N   . GLU A 1 91  ? 12.402  -8.824  -37.888 1.00 42.01  ? 440 GLU B N   1 
ATOM   591  C CA  . GLU A 1 91  ? 12.513  -9.082  -36.453 1.00 52.84  ? 440 GLU B CA  1 
ATOM   592  C C   . GLU A 1 91  ? 11.150  -8.966  -35.754 1.00 50.96  ? 440 GLU B C   1 
ATOM   593  O O   . GLU A 1 91  ? 10.825  -9.746  -34.857 1.00 46.73  ? 440 GLU B O   1 
ATOM   594  C CB  . GLU A 1 91  ? 13.514  -8.062  -35.890 1.00 60.24  ? 440 GLU B CB  1 
ATOM   595  C CG  . GLU A 1 91  ? 13.963  -8.242  -34.454 1.00 79.52  ? 440 GLU B CG  1 
ATOM   596  C CD  . GLU A 1 91  ? 15.246  -7.464  -34.157 1.00 84.24  ? 440 GLU B CD  1 
ATOM   597  O OE1 . GLU A 1 91  ? 16.312  -7.842  -34.711 1.00 81.83  ? 440 GLU B OE1 1 
ATOM   598  O OE2 . GLU A 1 91  ? 15.177  -6.485  -33.379 1.00 73.56  ? 440 GLU B OE2 1 
ATOM   599  N N   . SER A 1 92  ? 10.322  -8.006  -36.165 1.00 43.19  ? 441 SER B N   1 
ATOM   600  C CA  . SER A 1 92  ? 9.122   -7.794  -35.419 1.00 42.39  ? 441 SER B CA  1 
ATOM   601  C C   . SER A 1 92  ? 8.078   -8.909  -35.774 1.00 47.29  ? 441 SER B C   1 
ATOM   602  O O   . SER A 1 92  ? 7.212   -9.142  -34.998 1.00 37.20  ? 441 SER B O   1 
ATOM   603  C CB  . SER A 1 92  ? 8.526   -6.408  -35.715 1.00 44.55  ? 441 SER B CB  1 
ATOM   604  O OG  . SER A 1 92  ? 9.383   -5.365  -35.290 1.00 54.09  ? 441 SER B OG  1 
ATOM   605  N N   . ALA A 1 93  ? 8.168   -9.500  -36.972 1.00 41.84  ? 442 ALA B N   1 
ATOM   606  C CA  . ALA A 1 93  ? 7.198   -10.432 -37.501 1.00 44.70  ? 442 ALA B CA  1 
ATOM   607  C C   . ALA A 1 93  ? 7.615   -11.885 -37.347 1.00 42.95  ? 442 ALA B C   1 
ATOM   608  O O   . ALA A 1 93  ? 6.806   -12.775 -37.533 1.00 47.60  ? 442 ALA B O   1 
ATOM   609  C CB  . ALA A 1 93  ? 6.949   -10.135 -38.970 1.00 43.08  ? 442 ALA B CB  1 
ATOM   610  N N   . PHE A 1 94  ? 8.854   -12.115 -36.950 1.00 40.08  ? 443 PHE B N   1 
ATOM   611  C CA  . PHE A 1 94  ? 9.422   -13.462 -36.887 1.00 42.87  ? 443 PHE B CA  1 
ATOM   612  C C   . PHE A 1 94  ? 8.528   -14.506 -36.212 1.00 43.86  ? 443 PHE B C   1 
ATOM   613  O O   . PHE A 1 94  ? 8.175   -15.535 -36.795 1.00 45.50  ? 443 PHE B O   1 
ATOM   614  C CB  . PHE A 1 94  ? 10.816  -13.485 -36.218 1.00 44.15  ? 443 PHE B CB  1 
ATOM   615  C CG  . PHE A 1 94  ? 11.314  -14.874 -36.003 1.00 55.22  ? 443 PHE B CG  1 
ATOM   616  C CD1 . PHE A 1 94  ? 11.630  -15.688 -37.098 1.00 52.58  ? 443 PHE B CD1 1 
ATOM   617  C CD2 . PHE A 1 94  ? 11.367  -15.416 -34.738 1.00 57.56  ? 443 PHE B CD2 1 
ATOM   618  C CE1 . PHE A 1 94  ? 11.999  -17.011 -36.909 1.00 58.09  ? 443 PHE B CE1 1 
ATOM   619  C CE2 . PHE A 1 94  ? 11.769  -16.734 -34.537 1.00 64.52  ? 443 PHE B CE2 1 
ATOM   620  C CZ  . PHE A 1 94  ? 12.086  -17.534 -35.630 1.00 57.30  ? 443 PHE B CZ  1 
ATOM   621  N N   . LEU A 1 95  ? 8.178   -14.235 -34.995 1.00 44.49  ? 444 LEU B N   1 
ATOM   622  C CA  . LEU A 1 95  ? 7.374   -15.151 -34.215 1.00 45.19  ? 444 LEU B CA  1 
ATOM   623  C C   . LEU A 1 95  ? 6.064   -15.399 -34.872 1.00 45.23  ? 444 LEU B C   1 
ATOM   624  O O   . LEU A 1 95  ? 5.683   -16.560 -35.061 1.00 43.45  ? 444 LEU B O   1 
ATOM   625  C CB  . LEU A 1 95  ? 7.170   -14.599 -32.826 1.00 54.35  ? 444 LEU B CB  1 
ATOM   626  C CG  . LEU A 1 95  ? 7.772   -15.261 -31.598 1.00 53.42  ? 444 LEU B CG  1 
ATOM   627  C CD1 . LEU A 1 95  ? 8.868   -16.295 -31.862 1.00 50.74  ? 444 LEU B CD1 1 
ATOM   628  C CD2 . LEU A 1 95  ? 8.222   -14.198 -30.616 1.00 53.59  ? 444 LEU B CD2 1 
ATOM   629  N N   . GLU A 1 96  ? 5.401   -14.335 -35.310 1.00 37.40  ? 445 GLU B N   1 
ATOM   630  C CA  . GLU A 1 96  ? 4.138   -14.530 -35.988 1.00 40.56  ? 445 GLU B CA  1 
ATOM   631  C C   . GLU A 1 96  ? 4.248   -15.305 -37.305 1.00 47.55  ? 445 GLU B C   1 
ATOM   632  O O   . GLU A 1 96  ? 3.318   -16.068 -37.723 1.00 47.54  ? 445 GLU B O   1 
ATOM   633  C CB  . GLU A 1 96  ? 3.485   -13.223 -36.341 1.00 41.36  ? 445 GLU B CB  1 
ATOM   634  C CG  . GLU A 1 96  ? 3.096   -12.316 -35.214 1.00 46.38  ? 445 GLU B CG  1 
ATOM   635  C CD  . GLU A 1 96  ? 2.861   -10.888 -35.749 1.00 57.32  ? 445 GLU B CD  1 
ATOM   636  O OE1 . GLU A 1 96  ? 3.765   -10.034 -35.555 1.00 46.09  ? 445 GLU B OE1 1 
ATOM   637  O OE2 . GLU A 1 96  ? 1.808   -10.676 -36.425 1.00 49.93  ? 445 GLU B OE2 1 
ATOM   638  N N   . LEU A 1 97  ? 5.339   -15.088 -38.015 1.00 45.63  ? 446 LEU B N   1 
ATOM   639  C CA  . LEU A 1 97  ? 5.502   -15.858 -39.274 1.00 52.42  ? 446 LEU B CA  1 
ATOM   640  C C   . LEU A 1 97  ? 5.815   -17.308 -39.026 1.00 49.28  ? 446 LEU B C   1 
ATOM   641  O O   . LEU A 1 97  ? 5.310   -18.194 -39.722 1.00 52.80  ? 446 LEU B O   1 
ATOM   642  C CB  . LEU A 1 97  ? 6.585   -15.263 -40.157 1.00 48.60  ? 446 LEU B CB  1 
ATOM   643  C CG  . LEU A 1 97  ? 6.229   -13.896 -40.761 1.00 41.47  ? 446 LEU B CG  1 
ATOM   644  C CD1 . LEU A 1 97  ? 7.441   -13.100 -41.194 1.00 42.11  ? 446 LEU B CD1 1 
ATOM   645  C CD2 . LEU A 1 97  ? 5.323   -14.134 -41.903 1.00 46.95  ? 446 LEU B CD2 1 
ATOM   646  N N   . PHE A 1 98  ? 6.662   -17.546 -38.041 1.00 47.26  ? 447 PHE B N   1 
ATOM   647  C CA  . PHE A 1 98  ? 6.946   -18.894 -37.610 1.00 50.86  ? 447 PHE B CA  1 
ATOM   648  C C   . PHE A 1 98  ? 5.637   -19.648 -37.241 1.00 50.47  ? 447 PHE B C   1 
ATOM   649  O O   . PHE A 1 98  ? 5.423   -20.750 -37.673 1.00 46.59  ? 447 PHE B O   1 
ATOM   650  C CB  . PHE A 1 98  ? 7.837   -18.858 -36.400 1.00 49.26  ? 447 PHE B CB  1 
ATOM   651  C CG  . PHE A 1 98  ? 8.022   -20.178 -35.780 1.00 50.09  ? 447 PHE B CG  1 
ATOM   652  C CD1 . PHE A 1 98  ? 8.867   -21.130 -36.361 1.00 51.05  ? 447 PHE B CD1 1 
ATOM   653  C CD2 . PHE A 1 98  ? 7.356   -20.489 -34.614 1.00 51.17  ? 447 PHE B CD2 1 
ATOM   654  C CE1 . PHE A 1 98  ? 9.042   -22.375 -35.756 1.00 52.78  ? 447 PHE B CE1 1 
ATOM   655  C CE2 . PHE A 1 98  ? 7.536   -21.719 -34.008 1.00 51.05  ? 447 PHE B CE2 1 
ATOM   656  C CZ  . PHE A 1 98  ? 8.378   -22.660 -34.570 1.00 48.52  ? 447 PHE B CZ  1 
ATOM   657  N N   . ILE A 1 99  ? 4.739   -18.987 -36.522 1.00 49.34  ? 448 ILE B N   1 
ATOM   658  C CA  . ILE A 1 99  ? 3.518   -19.607 -36.064 1.00 45.45  ? 448 ILE B CA  1 
ATOM   659  C C   . ILE A 1 99  ? 2.614   -19.817 -37.263 1.00 48.67  ? 448 ILE B C   1 
ATOM   660  O O   . ILE A 1 99  ? 1.987   -20.866 -37.412 1.00 48.05  ? 448 ILE B O   1 
ATOM   661  C CB  . ILE A 1 99  ? 2.812   -18.700 -35.072 1.00 44.01  ? 448 ILE B CB  1 
ATOM   662  C CG1 . ILE A 1 99  ? 3.603   -18.513 -33.777 1.00 47.66  ? 448 ILE B CG1 1 
ATOM   663  C CG2 . ILE A 1 99  ? 1.417   -19.158 -34.753 1.00 44.49  ? 448 ILE B CG2 1 
ATOM   664  C CD1 . ILE A 1 99  ? 3.200   -17.191 -33.052 1.00 49.35  ? 448 ILE B CD1 1 
ATOM   665  N N   . LEU A 1 100 ? 2.522   -18.825 -38.122 1.00 43.86  ? 449 LEU B N   1 
ATOM   666  C CA  . LEU A 1 100 ? 1.544   -18.925 -39.206 1.00 45.58  ? 449 LEU B CA  1 
ATOM   667  C C   . LEU A 1 100 ? 1.935   -20.023 -40.172 1.00 46.15  ? 449 LEU B C   1 
ATOM   668  O O   . LEU A 1 100 ? 1.111   -20.809 -40.600 1.00 45.39  ? 449 LEU B O   1 
ATOM   669  C CB  . LEU A 1 100 ? 1.425   -17.616 -39.970 1.00 41.30  ? 449 LEU B CB  1 
ATOM   670  C CG  . LEU A 1 100 ? 0.425   -17.550 -41.102 1.00 47.11  ? 449 LEU B CG  1 
ATOM   671  C CD1 . LEU A 1 100 ? -1.022  -17.651 -40.636 1.00 51.52  ? 449 LEU B CD1 1 
ATOM   672  C CD2 . LEU A 1 100 ? 0.610   -16.257 -41.835 1.00 44.13  ? 449 LEU B CD2 1 
ATOM   673  N N   . ARG A 1 101 ? 3.198   -20.058 -40.533 1.00 49.69  ? 450 ARG B N   1 
ATOM   674  C CA  . ARG A 1 101 ? 3.667   -21.035 -41.486 1.00 46.94  ? 450 ARG B CA  1 
ATOM   675  C C   . ARG A 1 101 ? 3.670   -22.423 -40.879 1.00 43.37  ? 450 ARG B C   1 
ATOM   676  O O   . ARG A 1 101 ? 3.398   -23.364 -41.561 1.00 49.32  ? 450 ARG B O   1 
ATOM   677  C CB  . ARG A 1 101 ? 5.055   -20.677 -41.990 1.00 40.50  ? 450 ARG B CB  1 
ATOM   678  C CG  . ARG A 1 101 ? 5.038   -19.492 -42.937 1.00 46.54  ? 450 ARG B CG  1 
ATOM   679  C CD  . ARG A 1 101 ? 6.345   -18.638 -42.859 1.00 46.70  ? 450 ARG B CD  1 
ATOM   680  N NE  . ARG A 1 101 ? 7.495   -19.448 -43.168 1.00 45.69  ? 450 ARG B NE  1 
ATOM   681  C CZ  . ARG A 1 101 ? 7.878   -19.736 -44.403 1.00 41.84  ? 450 ARG B CZ  1 
ATOM   682  N NH1 . ARG A 1 101 ? 7.238   -19.238 -45.450 1.00 42.10  ? 450 ARG B NH1 1 
ATOM   683  N NH2 . ARG A 1 101 ? 8.901   -20.548 -44.581 1.00 48.20  ? 450 ARG B NH2 1 
ATOM   684  N N   . LEU A 1 102 ? 3.947   -22.537 -39.611 1.00 45.17  ? 451 LEU B N   1 
ATOM   685  C CA  . LEU A 1 102 ? 3.895   -23.815 -38.974 1.00 48.58  ? 451 LEU B CA  1 
ATOM   686  C C   . LEU A 1 102 ? 2.428   -24.331 -38.974 1.00 49.65  ? 451 LEU B C   1 
ATOM   687  O O   . LEU A 1 102 ? 2.175   -25.487 -39.286 1.00 47.27  ? 451 LEU B O   1 
ATOM   688  C CB  . LEU A 1 102 ? 4.412   -23.697 -37.544 1.00 42.76  ? 451 LEU B CB  1 
ATOM   689  C CG  . LEU A 1 102 ? 4.455   -24.983 -36.725 1.00 44.32  ? 451 LEU B CG  1 
ATOM   690  C CD1 . LEU A 1 102 ? 5.347   -26.020 -37.401 1.00 48.51  ? 451 LEU B CD1 1 
ATOM   691  C CD2 . LEU A 1 102 ? 4.939   -24.687 -35.311 1.00 46.92  ? 451 LEU B CD2 1 
ATOM   692  N N   . ALA A 1 103 ? 1.493   -23.458 -38.598 1.00 53.11  ? 452 ALA B N   1 
ATOM   693  C CA  . ALA A 1 103 ? 0.083   -23.811 -38.464 1.00 51.77  ? 452 ALA B CA  1 
ATOM   694  C C   . ALA A 1 103 ? -0.484  -24.236 -39.792 1.00 51.37  ? 452 ALA B C   1 
ATOM   695  O O   . ALA A 1 103 ? -1.242  -25.186 -39.854 1.00 52.03  ? 452 ALA B O   1 
ATOM   696  C CB  . ALA A 1 103 ? -0.710  -22.637 -37.942 1.00 46.17  ? 452 ALA B CB  1 
ATOM   697  N N   . TYR A 1 104 ? -0.101  -23.538 -40.856 1.00 50.63  ? 453 TYR B N   1 
ATOM   698  C CA  . TYR A 1 104 ? -0.605  -23.850 -42.190 1.00 49.36  ? 453 TYR B CA  1 
ATOM   699  C C   . TYR A 1 104 ? -0.009  -25.166 -42.711 1.00 58.79  ? 453 TYR B C   1 
ATOM   700  O O   . TYR A 1 104 ? -0.685  -25.935 -43.367 1.00 60.54  ? 453 TYR B O   1 
ATOM   701  C CB  . TYR A 1 104 ? -0.238  -22.781 -43.186 1.00 46.39  ? 453 TYR B CB  1 
ATOM   702  C CG  . TYR A 1 104 ? -0.889  -22.864 -44.579 1.00 53.25  ? 453 TYR B CG  1 
ATOM   703  C CD1 . TYR A 1 104 ? -2.280  -22.817 -44.728 1.00 52.53  ? 453 TYR B CD1 1 
ATOM   704  C CD2 . TYR A 1 104 ? -0.101  -22.916 -45.763 1.00 54.07  ? 453 TYR B CD2 1 
ATOM   705  C CE1 . TYR A 1 104 ? -2.875  -22.833 -45.988 1.00 49.59  ? 453 TYR B CE1 1 
ATOM   706  C CE2 . TYR A 1 104 ? -0.685  -22.908 -47.033 1.00 51.21  ? 453 TYR B CE2 1 
ATOM   707  C CZ  . TYR A 1 104 ? -2.088  -22.851 -47.130 1.00 58.54  ? 453 TYR B CZ  1 
ATOM   708  O OH  . TYR A 1 104 ? -2.721  -22.830 -48.353 1.00 54.58  ? 453 TYR B OH  1 
ATOM   709  N N   . ARG A 1 105 ? 1.253   -25.407 -42.394 1.00 55.23  ? 454 ARG B N   1 
ATOM   710  C CA  . ARG A 1 105 ? 1.970   -26.565 -42.873 1.00 54.16  ? 454 ARG B CA  1 
ATOM   711  C C   . ARG A 1 105 ? 1.615   -27.850 -42.108 1.00 52.62  ? 454 ARG B C   1 
ATOM   712  O O   . ARG A 1 105 ? 1.763   -28.939 -42.601 1.00 58.52  ? 454 ARG B O   1 
ATOM   713  C CB  . ARG A 1 105 ? 3.438   -26.264 -42.651 1.00 51.91  ? 454 ARG B CB  1 
ATOM   714  C CG  . ARG A 1 105 ? 4.317   -27.138 -43.441 1.00 55.20  ? 454 ARG B CG  1 
ATOM   715  C CD  . ARG A 1 105 ? 5.801   -26.852 -43.274 1.00 59.27  ? 454 ARG B CD  1 
ATOM   716  N NE  . ARG A 1 105 ? 6.252   -25.463 -43.427 1.00 49.31  ? 454 ARG B NE  1 
ATOM   717  C CZ  . ARG A 1 105 ? 6.715   -24.663 -42.451 1.00 54.78  ? 454 ARG B CZ  1 
ATOM   718  N NH1 . ARG A 1 105 ? 6.707   -25.036 -41.166 1.00 48.21  ? 454 ARG B NH1 1 
ATOM   719  N NH2 . ARG A 1 105 ? 7.161   -23.432 -42.763 1.00 56.56  ? 454 ARG B NH2 1 
ATOM   720  N N   . SER A 1 106 ? 1.205   -27.697 -40.878 1.00 52.75  ? 455 SER B N   1 
ATOM   721  C CA  . SER A 1 106 ? 1.068   -28.820 -40.014 1.00 56.06  ? 455 SER B CA  1 
ATOM   722  C C   . SER A 1 106 ? -0.310  -29.484 -40.214 1.00 55.33  ? 455 SER B C   1 
ATOM   723  O O   . SER A 1 106 ? -1.168  -29.014 -41.000 1.00 52.01  ? 455 SER B O   1 
ATOM   724  C CB  . SER A 1 106 ? 1.214   -28.318 -38.589 1.00 54.89  ? 455 SER B CB  1 
ATOM   725  O OG  . SER A 1 106 ? 2.569   -28.139 -38.262 1.00 45.85  ? 455 SER B OG  1 
ATOM   726  N N   . LYS A 1 107 ? -0.518  -30.560 -39.473 1.00 53.36  ? 456 LYS B N   1 
ATOM   727  C CA  . LYS A 1 107 ? -1.725  -31.410 -39.616 1.00 53.47  ? 456 LYS B CA  1 
ATOM   728  C C   . LYS A 1 107 ? -2.274  -31.603 -38.239 1.00 50.02  ? 456 LYS B C   1 
ATOM   729  O O   . LYS A 1 107 ? -1.950  -32.569 -37.534 1.00 53.77  ? 456 LYS B O   1 
ATOM   730  C CB  . LYS A 1 107 ? -1.387  -32.773 -40.214 1.00 60.70  ? 456 LYS B CB  1 
ATOM   731  C CG  . LYS A 1 107 ? -0.705  -32.718 -41.576 1.00 67.89  ? 456 LYS B CG  1 
ATOM   732  C CD  . LYS A 1 107 ? -1.710  -32.675 -42.713 1.00 76.93  ? 456 LYS B CD  1 
ATOM   733  C CE  . LYS A 1 107 ? -1.022  -32.508 -44.064 1.00 91.25  ? 456 LYS B CE  1 
ATOM   734  N NZ  . LYS A 1 107 ? -0.628  -31.097 -44.390 1.00 92.84  ? 456 LYS B NZ  1 
ATOM   735  N N   . PRO A 1 108 ? -3.109  -30.676 -37.823 1.00 50.04  ? 457 PRO B N   1 
ATOM   736  C CA  . PRO A 1 108 ? -3.547  -30.678 -36.439 1.00 53.86  ? 457 PRO B CA  1 
ATOM   737  C C   . PRO A 1 108 ? -4.540  -31.808 -36.069 1.00 60.54  ? 457 PRO B C   1 
ATOM   738  O O   . PRO A 1 108 ? -4.628  -32.201 -34.862 1.00 49.18  ? 457 PRO B O   1 
ATOM   739  C CB  . PRO A 1 108 ? -4.192  -29.303 -36.293 1.00 61.55  ? 457 PRO B CB  1 
ATOM   740  C CG  . PRO A 1 108 ? -4.604  -28.901 -37.688 1.00 56.40  ? 457 PRO B CG  1 
ATOM   741  C CD  . PRO A 1 108 ? -3.582  -29.507 -38.583 1.00 51.91  ? 457 PRO B CD  1 
ATOM   742  N N   . GLY A 1 109 ? -5.264  -32.339 -37.070 1.00 62.06  ? 458 GLY B N   1 
ATOM   743  C CA  . GLY A 1 109 ? -6.187  -33.461 -36.810 1.00 63.23  ? 458 GLY B CA  1 
ATOM   744  C C   . GLY A 1 109 ? -5.393  -34.644 -36.287 1.00 64.21  ? 458 GLY B C   1 
ATOM   745  O O   . GLY A 1 109 ? -5.892  -35.464 -35.529 1.00 59.80  ? 458 GLY B O   1 
ATOM   746  N N   . GLU A 1 110 ? -4.122  -34.713 -36.669 1.00 65.42  ? 459 GLU B N   1 
ATOM   747  C CA  . GLU A 1 110 ? -3.303  -35.853 -36.283 1.00 66.23  ? 459 GLU B CA  1 
ATOM   748  C C   . GLU A 1 110 ? -2.257  -35.504 -35.246 1.00 58.46  ? 459 GLU B C   1 
ATOM   749  O O   . GLU A 1 110 ? -1.358  -36.276 -35.020 1.00 60.83  ? 459 GLU B O   1 
ATOM   750  C CB  . GLU A 1 110 ? -2.650  -36.427 -37.541 1.00 71.04  ? 459 GLU B CB  1 
ATOM   751  C CG  . GLU A 1 110 ? -3.710  -36.772 -38.621 1.00 78.32  ? 459 GLU B CG  1 
ATOM   752  C CD  . GLU A 1 110 ? -3.514  -36.038 -39.957 1.00 105.57 ? 459 GLU B CD  1 
ATOM   753  O OE1 . GLU A 1 110 ? -2.543  -36.380 -40.701 1.00 111.63 ? 459 GLU B OE1 1 
ATOM   754  O OE2 . GLU A 1 110 ? -4.342  -35.119 -40.262 1.00 87.62  ? 459 GLU B OE2 1 
ATOM   755  N N   . GLY A 1 111 ? -2.324  -34.325 -34.648 1.00 55.53  ? 460 GLY B N   1 
ATOM   756  C CA  . GLY A 1 111 ? -1.210  -33.872 -33.799 1.00 51.54  ? 460 GLY B CA  1 
ATOM   757  C C   . GLY A 1 111 ? 0.171   -33.762 -34.449 1.00 52.29  ? 460 GLY B C   1 
ATOM   758  O O   . GLY A 1 111 ? 1.173   -33.868 -33.768 1.00 55.20  ? 460 GLY B O   1 
ATOM   759  N N   . LYS A 1 112 ? 0.241   -33.562 -35.759 1.00 51.51  ? 461 LYS B N   1 
ATOM   760  C CA  . LYS A 1 112 ? 1.523   -33.504 -36.481 1.00 57.94  ? 461 LYS B CA  1 
ATOM   761  C C   . LYS A 1 112 ? 2.014   -32.106 -36.759 1.00 50.07  ? 461 LYS B C   1 
ATOM   762  O O   . LYS A 1 112 ? 1.334   -31.391 -37.497 1.00 44.44  ? 461 LYS B O   1 
ATOM   763  C CB  . LYS A 1 112 ? 1.388   -34.092 -37.877 1.00 63.25  ? 461 LYS B CB  1 
ATOM   764  C CG  . LYS A 1 112 ? 1.931   -35.470 -38.018 1.00 64.91  ? 461 LYS B CG  1 
ATOM   765  C CD  . LYS A 1 112 ? 1.796   -35.886 -39.469 1.00 67.51  ? 461 LYS B CD  1 
ATOM   766  C CE  . LYS A 1 112 ? 1.243   -37.291 -39.513 1.00 74.27  ? 461 LYS B CE  1 
ATOM   767  N NZ  . LYS A 1 112 ? 1.071   -37.728 -40.914 1.00 82.09  ? 461 LYS B NZ  1 
ATOM   768  N N   . LEU A 1 113 ? 3.184   -31.759 -36.204 1.00 47.61  ? 462 LEU B N   1 
ATOM   769  C CA  . LEU A 1 113 ? 3.903   -30.497 -36.533 1.00 49.24  ? 462 LEU B CA  1 
ATOM   770  C C   . LEU A 1 113 ? 4.947   -30.750 -37.639 1.00 45.87  ? 462 LEU B C   1 
ATOM   771  O O   . LEU A 1 113 ? 5.775   -31.663 -37.557 1.00 48.96  ? 462 LEU B O   1 
ATOM   772  C CB  . LEU A 1 113 ? 4.610   -29.926 -35.312 1.00 47.67  ? 462 LEU B CB  1 
ATOM   773  C CG  . LEU A 1 113 ? 3.805   -29.361 -34.159 1.00 46.04  ? 462 LEU B CG  1 
ATOM   774  C CD1 . LEU A 1 113 ? 2.847   -28.265 -34.617 1.00 53.95  ? 462 LEU B CD1 1 
ATOM   775  C CD2 . LEU A 1 113 ? 2.996   -30.448 -33.504 1.00 56.71  ? 462 LEU B CD2 1 
ATOM   776  N N   . ILE A 1 114 ? 4.874   -29.965 -38.682 1.00 38.88  ? 463 ILE B N   1 
ATOM   777  C CA  . ILE A 1 114 ? 5.797   -30.034 -39.751 1.00 44.71  ? 463 ILE B CA  1 
ATOM   778  C C   . ILE A 1 114 ? 6.595   -28.720 -39.835 1.00 45.57  ? 463 ILE B C   1 
ATOM   779  O O   . ILE A 1 114 ? 6.051   -27.687 -40.148 1.00 54.56  ? 463 ILE B O   1 
ATOM   780  C CB  . ILE A 1 114 ? 5.067   -30.322 -41.078 1.00 45.31  ? 463 ILE B CB  1 
ATOM   781  C CG1 . ILE A 1 114 ? 4.288   -31.655 -40.948 1.00 51.97  ? 463 ILE B CG1 1 
ATOM   782  C CG2 . ILE A 1 114 ? 6.076   -30.385 -42.206 1.00 45.28  ? 463 ILE B CG2 1 
ATOM   783  C CD1 . ILE A 1 114 ? 3.538   -32.118 -42.197 1.00 44.34  ? 463 ILE B CD1 1 
ATOM   784  N N   . PHE A 1 115 ? 7.880   -28.794 -39.540 1.00 48.15  ? 464 PHE B N   1 
ATOM   785  C CA  . PHE A 1 115 ? 8.763   -27.637 -39.567 1.00 49.32  ? 464 PHE B CA  1 
ATOM   786  C C   . PHE A 1 115 ? 9.392   -27.365 -40.948 1.00 53.73  ? 464 PHE B C   1 
ATOM   787  O O   . PHE A 1 115 ? 9.391   -28.239 -41.812 1.00 55.79  ? 464 PHE B O   1 
ATOM   788  C CB  . PHE A 1 115 ? 9.812   -27.806 -38.462 1.00 43.99  ? 464 PHE B CB  1 
ATOM   789  C CG  . PHE A 1 115 ? 9.192   -27.925 -37.100 1.00 49.70  ? 464 PHE B CG  1 
ATOM   790  C CD1 . PHE A 1 115 ? 8.880   -29.177 -36.558 1.00 53.32  ? 464 PHE B CD1 1 
ATOM   791  C CD2 . PHE A 1 115 ? 8.816   -26.794 -36.392 1.00 50.29  ? 464 PHE B CD2 1 
ATOM   792  C CE1 . PHE A 1 115 ? 8.292   -29.276 -35.299 1.00 47.66  ? 464 PHE B CE1 1 
ATOM   793  C CE2 . PHE A 1 115 ? 8.259   -26.889 -35.130 1.00 49.34  ? 464 PHE B CE2 1 
ATOM   794  C CZ  . PHE A 1 115 ? 7.973   -28.135 -34.597 1.00 50.15  ? 464 PHE B CZ  1 
ATOM   795  N N   . CYS A 1 116 ? 9.927   -26.152 -41.148 1.00 54.11  ? 465 CYS B N   1 
ATOM   796  C CA  . CYS A 1 116 ? 10.314  -25.705 -42.492 1.00 51.81  ? 465 CYS B CA  1 
ATOM   797  C C   . CYS A 1 116 ? 11.485  -26.510 -43.047 1.00 45.73  ? 465 CYS B C   1 
ATOM   798  O O   . CYS A 1 116 ? 11.659  -26.535 -44.241 1.00 48.76  ? 465 CYS B O   1 
ATOM   799  C CB  . CYS A 1 116 ? 10.639  -24.195 -42.546 1.00 60.88  ? 465 CYS B CB  1 
ATOM   800  S SG  . CYS A 1 116 ? 12.162  -23.846 -41.673 1.00 57.80  ? 465 CYS B SG  1 
ATOM   801  N N   . SER A 1 117 ? 12.315  -27.114 -42.205 1.00 50.23  ? 466 SER B N   1 
ATOM   802  C CA  . SER A 1 117 ? 13.316  -28.080 -42.695 1.00 53.67  ? 466 SER B CA  1 
ATOM   803  C C   . SER A 1 117 ? 12.671  -29.354 -43.306 1.00 55.89  ? 466 SER B C   1 
ATOM   804  O O   . SER A 1 117 ? 13.355  -30.108 -43.964 1.00 59.04  ? 466 SER B O   1 
ATOM   805  C CB  . SER A 1 117 ? 14.261  -28.555 -41.562 1.00 56.46  ? 466 SER B CB  1 
ATOM   806  O OG  . SER A 1 117 ? 13.611  -29.408 -40.592 1.00 51.35  ? 466 SER B OG  1 
ATOM   807  N N   . GLY A 1 118 ? 11.396  -29.623 -43.030 1.00 56.24  ? 467 GLY B N   1 
ATOM   808  C CA  . GLY A 1 118 ? 10.784  -30.917 -43.406 1.00 55.03  ? 467 GLY B CA  1 
ATOM   809  C C   . GLY A 1 118 ? 10.630  -31.904 -42.256 1.00 52.85  ? 467 GLY B C   1 
ATOM   810  O O   . GLY A 1 118 ? 9.941   -32.940 -42.379 1.00 59.42  ? 467 GLY B O   1 
ATOM   811  N N   . LEU A 1 119 ? 11.271  -31.580 -41.137 1.00 49.16  ? 468 LEU B N   1 
ATOM   812  C CA  . LEU A 1 119 ? 11.200  -32.370 -39.937 1.00 49.84  ? 468 LEU B CA  1 
ATOM   813  C C   . LEU A 1 119 ? 9.744   -32.444 -39.457 1.00 51.93  ? 468 LEU B C   1 
ATOM   814  O O   . LEU A 1 119 ? 9.063   -31.395 -39.307 1.00 45.08  ? 468 LEU B O   1 
ATOM   815  C CB  . LEU A 1 119 ? 12.080  -31.770 -38.845 1.00 50.12  ? 468 LEU B CB  1 
ATOM   816  C CG  . LEU A 1 119 ? 12.159  -32.571 -37.529 1.00 53.05  ? 468 LEU B CG  1 
ATOM   817  C CD1 . LEU A 1 119 ? 13.089  -33.777 -37.657 1.00 51.28  ? 468 LEU B CD1 1 
ATOM   818  C CD2 . LEU A 1 119 ? 12.648  -31.681 -36.408 1.00 51.07  ? 468 LEU B CD2 1 
ATOM   819  N N   . VAL A 1 120 ? 9.289   -33.680 -39.229 1.00 46.08  ? 469 VAL B N   1 
ATOM   820  C CA  . VAL A 1 120 ? 7.948   -33.948 -38.696 1.00 52.20  ? 469 VAL B CA  1 
ATOM   821  C C   . VAL A 1 120 ? 8.013   -34.454 -37.244 1.00 50.07  ? 469 VAL B C   1 
ATOM   822  O O   . VAL A 1 120 ? 8.781   -35.339 -36.903 1.00 47.05  ? 469 VAL B O   1 
ATOM   823  C CB  . VAL A 1 120 ? 7.206   -34.957 -39.584 1.00 48.12  ? 469 VAL B CB  1 
ATOM   824  C CG1 . VAL A 1 120 ? 5.791   -35.187 -39.083 1.00 48.48  ? 469 VAL B CG1 1 
ATOM   825  C CG2 . VAL A 1 120 ? 7.205   -34.444 -41.008 1.00 49.90  ? 469 VAL B CG2 1 
ATOM   826  N N   . LEU A 1 121 ? 7.220   -33.845 -36.376 1.00 54.60  ? 470 LEU B N   1 
ATOM   827  C CA  . LEU A 1 121 ? 7.210   -34.187 -34.948 1.00 47.04  ? 470 LEU B CA  1 
ATOM   828  C C   . LEU A 1 121 ? 5.762   -34.226 -34.437 1.00 50.74  ? 470 LEU B C   1 
ATOM   829  O O   . LEU A 1 121 ? 4.857   -33.517 -34.959 1.00 45.49  ? 470 LEU B O   1 
ATOM   830  C CB  . LEU A 1 121 ? 8.036   -33.171 -34.175 1.00 50.42  ? 470 LEU B CB  1 
ATOM   831  C CG  . LEU A 1 121 ? 9.400   -33.495 -33.535 1.00 56.99  ? 470 LEU B CG  1 
ATOM   832  C CD1 . LEU A 1 121 ? 10.220  -34.482 -34.309 1.00 58.34  ? 470 LEU B CD1 1 
ATOM   833  C CD2 . LEU A 1 121 ? 10.218  -32.227 -33.294 1.00 56.28  ? 470 LEU B CD2 1 
ATOM   834  N N   . HIS A 1 122 ? 5.528   -35.060 -33.433 1.00 55.52  ? 471 HIS B N   1 
ATOM   835  C CA  . HIS A 1 122 ? 4.230   -35.150 -32.829 1.00 54.67  ? 471 HIS B CA  1 
ATOM   836  C C   . HIS A 1 122 ? 4.093   -34.066 -31.768 1.00 53.34  ? 471 HIS B C   1 
ATOM   837  O O   . HIS A 1 122 ? 5.069   -33.687 -31.095 1.00 49.03  ? 471 HIS B O   1 
ATOM   838  C CB  . HIS A 1 122 ? 4.021   -36.523 -32.175 1.00 63.37  ? 471 HIS B CB  1 
ATOM   839  C CG  . HIS A 1 122 ? 2.610   -36.727 -31.737 1.00 60.31  ? 471 HIS B CG  1 
ATOM   840  N ND1 . HIS A 1 122 ? 1.612   -37.115 -32.600 1.00 59.73  ? 471 HIS B ND1 1 
ATOM   841  C CD2 . HIS A 1 122 ? 1.998   -36.453 -30.563 1.00 63.60  ? 471 HIS B CD2 1 
ATOM   842  C CE1 . HIS A 1 122 ? 0.458   -37.154 -31.952 1.00 62.83  ? 471 HIS B CE1 1 
ATOM   843  N NE2 . HIS A 1 122 ? 0.664   -36.733 -30.719 1.00 65.34  ? 471 HIS B NE2 1 
ATOM   844  N N   . ARG A 1 123 ? 2.870   -33.601 -31.569 1.00 55.63  ? 472 ARG B N   1 
ATOM   845  C CA  . ARG A 1 123 ? 2.635   -32.592 -30.542 1.00 64.40  ? 472 ARG B CA  1 
ATOM   846  C C   . ARG A 1 123 ? 3.260   -32.919 -29.181 1.00 56.72  ? 472 ARG B C   1 
ATOM   847  O O   . ARG A 1 123 ? 3.882   -32.074 -28.547 1.00 57.61  ? 472 ARG B O   1 
ATOM   848  C CB  . ARG A 1 123 ? 1.170   -32.117 -30.479 1.00 71.06  ? 472 ARG B CB  1 
ATOM   849  C CG  . ARG A 1 123 ? 0.098   -33.019 -29.922 1.00 83.96  ? 472 ARG B CG  1 
ATOM   850  C CD  . ARG A 1 123 ? -0.978  -32.109 -29.268 1.00 92.77  ? 472 ARG B CD  1 
ATOM   851  N NE  . ARG A 1 123 ? -0.583  -31.774 -27.879 1.00 82.49  ? 472 ARG B NE  1 
ATOM   852  C CZ  . ARG A 1 123 ? -0.931  -32.487 -26.808 1.00 91.21  ? 472 ARG B CZ  1 
ATOM   853  N NH1 . ARG A 1 123 ? -1.713  -33.559 -26.921 1.00 88.35  ? 472 ARG B NH1 1 
ATOM   854  N NH2 . ARG A 1 123 ? -0.505  -32.124 -25.606 1.00 91.82  ? 472 ARG B NH2 1 
ATOM   855  N N   . LEU A 1 124 ? 3.187   -34.172 -28.795 1.00 56.46  ? 473 LEU B N   1 
ATOM   856  C CA  . LEU A 1 124 ? 3.727   -34.613 -27.528 1.00 57.18  ? 473 LEU B CA  1 
ATOM   857  C C   . LEU A 1 124 ? 5.234   -34.626 -27.470 1.00 60.05  ? 473 LEU B C   1 
ATOM   858  O O   . LEU A 1 124 ? 5.800   -34.595 -26.397 1.00 63.81  ? 473 LEU B O   1 
ATOM   859  C CB  . LEU A 1 124 ? 3.239   -36.010 -27.206 1.00 58.22  ? 473 LEU B CB  1 
ATOM   860  C CG  . LEU A 1 124 ? 1.716   -36.111 -27.047 1.00 64.06  ? 473 LEU B CG  1 
ATOM   861  C CD1 . LEU A 1 124 ? 1.301   -37.582 -27.181 1.00 65.57  ? 473 LEU B CD1 1 
ATOM   862  C CD2 . LEU A 1 124 ? 1.243   -35.479 -25.739 1.00 62.31  ? 473 LEU B CD2 1 
ATOM   863  N N   . GLN A 1 125 ? 5.897   -34.704 -28.608 1.00 58.10  ? 474 GLN B N   1 
ATOM   864  C CA  . GLN A 1 125 ? 7.346   -34.591 -28.630 1.00 53.86  ? 474 GLN B CA  1 
ATOM   865  C C   . GLN A 1 125 ? 7.729   -33.104 -28.494 1.00 59.04  ? 474 GLN B C   1 
ATOM   866  O O   . GLN A 1 125 ? 8.884   -32.797 -28.258 1.00 55.34  ? 474 GLN B O   1 
ATOM   867  C CB  . GLN A 1 125 ? 7.889   -35.140 -29.934 1.00 56.02  ? 474 GLN B CB  1 
ATOM   868  C CG  . GLN A 1 125 ? 7.615   -36.598 -30.205 1.00 53.29  ? 474 GLN B CG  1 
ATOM   869  C CD  . GLN A 1 125 ? 8.149   -36.996 -31.567 1.00 54.67  ? 474 GLN B CD  1 
ATOM   870  O OE1 . GLN A 1 125 ? 7.480   -36.878 -32.604 1.00 49.59  ? 474 GLN B OE1 1 
ATOM   871  N NE2 . GLN A 1 125 ? 9.357   -37.502 -31.564 1.00 51.27  ? 474 GLN B NE2 1 
ATOM   872  N N   . CYS A 1 126 ? 6.775   -32.188 -28.678 1.00 57.83  ? 475 CYS B N   1 
ATOM   873  C CA  . CYS A 1 126 ? 7.032   -30.751 -28.543 1.00 63.73  ? 475 CYS B CA  1 
ATOM   874  C C   . CYS A 1 126 ? 6.555   -30.087 -27.272 1.00 64.33  ? 475 CYS B C   1 
ATOM   875  O O   . CYS A 1 126 ? 6.905   -28.947 -27.006 1.00 61.10  ? 475 CYS B O   1 
ATOM   876  C CB  . CYS A 1 126 ? 6.324   -29.988 -29.670 1.00 66.00  ? 475 CYS B CB  1 
ATOM   877  S SG  . CYS A 1 126 ? 6.869   -30.384 -31.301 1.00 61.05  ? 475 CYS B SG  1 
ATOM   878  N N   . ALA A 1 127 ? 5.688   -30.756 -26.533 1.00 68.70  ? 476 ALA B N   1 
ATOM   879  C CA  . ALA A 1 127 ? 4.978   -30.132 -25.413 1.00 67.35  ? 476 ALA B CA  1 
ATOM   880  C C   . ALA A 1 127 ? 5.909   -29.612 -24.332 1.00 59.07  ? 476 ALA B C   1 
ATOM   881  O O   . ALA A 1 127 ? 5.651   -28.598 -23.710 1.00 70.54  ? 476 ALA B O   1 
ATOM   882  C CB  . ALA A 1 127 ? 3.991   -31.128 -24.806 1.00 64.06  ? 476 ALA B CB  1 
ATOM   883  N N   . ARG A 1 128 ? 6.961   -30.343 -24.070 1.00 53.87  ? 477 ARG B N   1 
ATOM   884  C CA  . ARG A 1 128 ? 7.833   -30.017 -22.960 1.00 60.48  ? 477 ARG B CA  1 
ATOM   885  C C   . ARG A 1 128 ? 8.606   -28.734 -23.251 1.00 59.78  ? 477 ARG B C   1 
ATOM   886  O O   . ARG A 1 128 ? 8.703   -27.860 -22.392 1.00 66.55  ? 477 ARG B O   1 
ATOM   887  C CB  . ARG A 1 128 ? 8.737   -31.223 -22.620 1.00 70.81  ? 477 ARG B CB  1 
ATOM   888  C CG  . ARG A 1 128 ? 8.062   -32.116 -21.544 1.00 86.62  ? 477 ARG B CG  1 
ATOM   889  C CD  . ARG A 1 128 ? 8.066   -33.617 -21.765 1.00 99.59  ? 477 ARG B CD  1 
ATOM   890  N NE  . ARG A 1 128 ? 9.230   -34.321 -21.208 1.00 108.90 ? 477 ARG B NE  1 
ATOM   891  C CZ  . ARG A 1 128 ? 10.053  -35.097 -21.915 1.00 113.68 ? 477 ARG B CZ  1 
ATOM   892  N NH1 . ARG A 1 128 ? 9.900   -35.248 -23.229 1.00 107.91 ? 477 ARG B NH1 1 
ATOM   893  N NH2 . ARG A 1 128 ? 11.056  -35.720 -21.297 1.00 116.11 ? 477 ARG B NH2 1 
ATOM   894  N N   . GLY A 1 129 ? 9.088   -28.591 -24.481 1.00 56.97  ? 478 GLY B N   1 
ATOM   895  C CA  . GLY A 1 129 ? 9.797   -27.396 -24.899 1.00 56.52  ? 478 GLY B CA  1 
ATOM   896  C C   . GLY A 1 129 ? 8.922   -26.163 -25.033 1.00 56.23  ? 478 GLY B C   1 
ATOM   897  O O   . GLY A 1 129 ? 9.206   -25.094 -24.448 1.00 53.31  ? 478 GLY B O   1 
ATOM   898  N N   . PHE A 1 130 ? 7.834   -26.335 -25.757 1.00 52.54  ? 479 PHE B N   1 
ATOM   899  C CA  . PHE A 1 130 ? 6.953   -25.244 -26.078 1.00 51.89  ? 479 PHE B CA  1 
ATOM   900  C C   . PHE A 1 130 ? 5.963   -24.869 -24.987 1.00 55.27  ? 479 PHE B C   1 
ATOM   901  O O   . PHE A 1 130 ? 5.418   -23.751 -25.023 1.00 47.11  ? 479 PHE B O   1 
ATOM   902  C CB  . PHE A 1 130 ? 6.143   -25.596 -27.329 1.00 52.98  ? 479 PHE B CB  1 
ATOM   903  C CG  . PHE A 1 130 ? 6.923   -25.543 -28.581 1.00 57.90  ? 479 PHE B CG  1 
ATOM   904  C CD1 . PHE A 1 130 ? 7.827   -26.571 -28.896 1.00 59.26  ? 479 PHE B CD1 1 
ATOM   905  C CD2 . PHE A 1 130 ? 6.783   -24.477 -29.456 1.00 61.09  ? 479 PHE B CD2 1 
ATOM   906  C CE1 . PHE A 1 130 ? 8.565   -26.528 -30.057 1.00 56.55  ? 479 PHE B CE1 1 
ATOM   907  C CE2 . PHE A 1 130 ? 7.518   -24.446 -30.634 1.00 58.86  ? 479 PHE B CE2 1 
ATOM   908  C CZ  . PHE A 1 130 ? 8.405   -25.472 -30.931 1.00 57.44  ? 479 PHE B CZ  1 
ATOM   909  N N   . GLY A 1 131 ? 5.654   -25.818 -24.085 1.00 59.23  ? 480 GLY B N   1 
ATOM   910  C CA  . GLY A 1 131 ? 4.534   -25.678 -23.115 1.00 46.64  ? 480 GLY B CA  1 
ATOM   911  C C   . GLY A 1 131 ? 3.191   -25.571 -23.794 1.00 46.21  ? 480 GLY B C   1 
ATOM   912  O O   . GLY A 1 131 ? 3.036   -25.932 -24.938 1.00 49.80  ? 480 GLY B O   1 
ATOM   913  N N   . ASP A 1 132 ? 2.211   -25.047 -23.085 1.00 57.36  ? 481 ASP B N   1 
ATOM   914  C CA  . ASP A 1 132 ? 0.840   -24.785 -23.620 1.00 60.83  ? 481 ASP B CA  1 
ATOM   915  C C   . ASP A 1 132 ? 0.770   -24.143 -24.997 1.00 66.23  ? 481 ASP B C   1 
ATOM   916  O O   . ASP A 1 132 ? -0.221  -24.332 -25.769 1.00 70.83  ? 481 ASP B O   1 
ATOM   917  C CB  . ASP A 1 132 ? 0.114   -23.798 -22.681 1.00 69.62  ? 481 ASP B CB  1 
ATOM   918  C CG  . ASP A 1 132 ? -0.097  -24.349 -21.291 1.00 76.19  ? 481 ASP B CG  1 
ATOM   919  O OD1 . ASP A 1 132 ? -0.322  -23.545 -20.361 1.00 85.92  ? 481 ASP B OD1 1 
ATOM   920  O OD2 . ASP A 1 132 ? -0.043  -25.582 -21.136 1.00 86.58  ? 481 ASP B OD2 1 
ATOM   921  N N   . TRP A 1 133 ? 1.781   -23.328 -25.299 1.00 50.91  ? 482 TRP B N   1 
ATOM   922  C CA  . TRP A 1 133 ? 1.783   -22.566 -26.527 1.00 47.32  ? 482 TRP B CA  1 
ATOM   923  C C   . TRP A 1 133 ? 1.525   -23.463 -27.750 1.00 48.57  ? 482 TRP B C   1 
ATOM   924  O O   . TRP A 1 133 ? 0.799   -23.063 -28.657 1.00 50.69  ? 482 TRP B O   1 
ATOM   925  C CB  . TRP A 1 133 ? 3.109   -21.798 -26.638 1.00 47.01  ? 482 TRP B CB  1 
ATOM   926  C CG  . TRP A 1 133 ? 3.241   -20.870 -27.806 1.00 46.14  ? 482 TRP B CG  1 
ATOM   927  C CD1 . TRP A 1 133 ? 2.279   -20.073 -28.318 1.00 45.72  ? 482 TRP B CD1 1 
ATOM   928  C CD2 . TRP A 1 133 ? 4.430   -20.589 -28.549 1.00 40.96  ? 482 TRP B CD2 1 
ATOM   929  N NE1 . TRP A 1 133 ? 2.784   -19.335 -29.325 1.00 45.35  ? 482 TRP B NE1 1 
ATOM   930  C CE2 . TRP A 1 133 ? 4.109   -19.631 -29.477 1.00 44.45  ? 482 TRP B CE2 1 
ATOM   931  C CE3 . TRP A 1 133 ? 5.738   -21.040 -28.483 1.00 46.81  ? 482 TRP B CE3 1 
ATOM   932  C CZ2 . TRP A 1 133 ? 5.013   -19.155 -30.358 1.00 46.02  ? 482 TRP B CZ2 1 
ATOM   933  C CZ3 . TRP A 1 133 ? 6.620   -20.578 -29.341 1.00 48.93  ? 482 TRP B CZ3 1 
ATOM   934  C CH2 . TRP A 1 133 ? 6.264   -19.655 -30.290 1.00 51.60  ? 482 TRP B CH2 1 
ATOM   935  N N   . ILE A 1 134 ? 2.084   -24.684 -27.764 1.00 45.77  ? 483 ILE B N   1 
ATOM   936  C CA  . ILE A 1 134 ? 1.884   -25.595 -28.906 1.00 53.72  ? 483 ILE B CA  1 
ATOM   937  C C   . ILE A 1 134 ? 0.426   -26.027 -29.071 1.00 48.40  ? 483 ILE B C   1 
ATOM   938  O O   . ILE A 1 134 ? -0.068  -26.141 -30.183 1.00 52.91  ? 483 ILE B O   1 
ATOM   939  C CB  . ILE A 1 134 ? 2.823   -26.832 -28.875 1.00 59.22  ? 483 ILE B CB  1 
ATOM   940  C CG1 . ILE A 1 134 ? 3.055   -27.365 -30.297 1.00 58.74  ? 483 ILE B CG1 1 
ATOM   941  C CG2 . ILE A 1 134 ? 2.250   -27.918 -27.997 1.00 54.23  ? 483 ILE B CG2 1 
ATOM   942  C CD1 . ILE A 1 134 ? 3.947   -26.487 -31.166 1.00 57.64  ? 483 ILE B CD1 1 
ATOM   943  N N   . ASP A 1 135 ? -0.287  -26.165 -27.980 1.00 50.49  ? 484 ASP B N   1 
ATOM   944  C CA  . ASP A 1 135 ? -1.719  -26.460 -28.075 1.00 51.81  ? 484 ASP B CA  1 
ATOM   945  C C   . ASP A 1 135 ? -2.417  -25.324 -28.683 1.00 49.26  ? 484 ASP B C   1 
ATOM   946  O O   . ASP A 1 135 ? -3.275  -25.522 -29.525 1.00 60.00  ? 484 ASP B O   1 
ATOM   947  C CB  . ASP A 1 135 ? -2.345  -26.770 -26.696 1.00 60.74  ? 484 ASP B CB  1 
ATOM   948  C CG  . ASP A 1 135 ? -1.787  -28.046 -26.097 1.00 65.72  ? 484 ASP B CG  1 
ATOM   949  O OD1 . ASP A 1 135 ? -1.483  -28.952 -26.908 1.00 71.54  ? 484 ASP B OD1 1 
ATOM   950  O OD2 . ASP A 1 135 ? -1.594  -28.131 -24.861 1.00 70.53  ? 484 ASP B OD2 1 
ATOM   951  N N   . SER A 1 136 ? -2.060  -24.113 -28.267 1.00 53.29  ? 485 SER B N   1 
ATOM   952  C CA  . SER A 1 136 ? -2.726  -22.928 -28.838 1.00 46.37  ? 485 SER B CA  1 
ATOM   953  C C   . SER A 1 136 ? -2.382  -22.757 -30.284 1.00 44.17  ? 485 SER B C   1 
ATOM   954  O O   . SER A 1 136 ? -3.229  -22.336 -31.089 1.00 47.55  ? 485 SER B O   1 
ATOM   955  C CB  . SER A 1 136 ? -2.361  -21.659 -28.093 1.00 46.93  ? 485 SER B CB  1 
ATOM   956  O OG  . SER A 1 136 ? -2.627  -21.806 -26.726 1.00 53.24  ? 485 SER B OG  1 
ATOM   957  N N   . ILE A 1 137 ? -1.154  -23.121 -30.639 1.00 42.21  ? 486 ILE B N   1 
ATOM   958  C CA  . ILE A 1 137 ? -0.784  -23.068 -32.043 1.00 47.00  ? 486 ILE B CA  1 
ATOM   959  C C   . ILE A 1 137 ? -1.623  -24.099 -32.814 1.00 46.47  ? 486 ILE B C   1 
ATOM   960  O O   . ILE A 1 137 ? -2.087  -23.834 -33.931 1.00 43.44  ? 486 ILE B O   1 
ATOM   961  C CB  . ILE A 1 137 ? 0.714   -23.338 -32.238 1.00 50.28  ? 486 ILE B CB  1 
ATOM   962  C CG1 . ILE A 1 137 ? 1.514   -22.172 -31.703 1.00 48.86  ? 486 ILE B CG1 1 
ATOM   963  C CG2 . ILE A 1 137 ? 1.034   -23.568 -33.701 1.00 53.09  ? 486 ILE B CG2 1 
ATOM   964  C CD1 . ILE A 1 137 ? 2.997   -22.490 -31.522 1.00 50.02  ? 486 ILE B CD1 1 
ATOM   965  N N   . LEU A 1 138 ? -1.827  -25.283 -32.233 1.00 51.54  ? 487 LEU B N   1 
ATOM   966  C CA  . LEU A 1 138 ? -2.657  -26.306 -32.917 1.00 53.78  ? 487 LEU B CA  1 
ATOM   967  C C   . LEU A 1 138 ? -4.122  -25.905 -33.051 1.00 45.67  ? 487 LEU B C   1 
ATOM   968  O O   . LEU A 1 138 ? -4.714  -26.111 -34.082 1.00 46.94  ? 487 LEU B O   1 
ATOM   969  C CB  . LEU A 1 138 ? -2.503  -27.660 -32.251 1.00 51.96  ? 487 LEU B CB  1 
ATOM   970  C CG  . LEU A 1 138 ? -1.159  -28.274 -32.602 1.00 51.04  ? 487 LEU B CG  1 
ATOM   971  C CD1 . LEU A 1 138 ? -0.890  -29.418 -31.666 1.00 53.28  ? 487 LEU B CD1 1 
ATOM   972  C CD2 . LEU A 1 138 ? -1.098  -28.733 -34.046 1.00 52.12  ? 487 LEU B CD2 1 
ATOM   973  N N   . ALA A 1 139 ? -4.674  -25.284 -32.033 1.00 45.56  ? 488 ALA B N   1 
ATOM   974  C CA  . ALA A 1 139 ? -6.021  -24.733 -32.130 1.00 49.31  ? 488 ALA B CA  1 
ATOM   975  C C   . ALA A 1 139 ? -6.108  -23.799 -33.281 1.00 52.95  ? 488 ALA B C   1 
ATOM   976  O O   . ALA A 1 139 ? -7.060  -23.865 -34.060 1.00 56.96  ? 488 ALA B O   1 
ATOM   977  C CB  . ALA A 1 139 ? -6.406  -23.984 -30.835 1.00 47.86  ? 488 ALA B CB  1 
ATOM   978  N N   . PHE A 1 140 ? -5.103  -22.919 -33.401 1.00 54.22  ? 489 PHE B N   1 
ATOM   979  C CA  . PHE A 1 140 ? -5.070  -21.933 -34.491 1.00 48.01  ? 489 PHE B CA  1 
ATOM   980  C C   . PHE A 1 140 ? -4.947  -22.631 -35.828 1.00 43.27  ? 489 PHE B C   1 
ATOM   981  O O   . PHE A 1 140 ? -5.566  -22.237 -36.807 1.00 42.32  ? 489 PHE B O   1 
ATOM   982  C CB  . PHE A 1 140 ? -3.887  -20.990 -34.269 1.00 49.23  ? 489 PHE B CB  1 
ATOM   983  C CG  . PHE A 1 140 ? -3.729  -19.917 -35.301 1.00 49.27  ? 489 PHE B CG  1 
ATOM   984  C CD1 . PHE A 1 140 ? -4.484  -18.773 -35.250 1.00 53.81  ? 489 PHE B CD1 1 
ATOM   985  C CD2 . PHE A 1 140 ? -2.765  -20.028 -36.280 1.00 50.48  ? 489 PHE B CD2 1 
ATOM   986  C CE1 . PHE A 1 140 ? -4.291  -17.751 -36.166 1.00 52.93  ? 489 PHE B CE1 1 
ATOM   987  C CE2 . PHE A 1 140 ? -2.566  -19.024 -37.188 1.00 52.16  ? 489 PHE B CE2 1 
ATOM   988  C CZ  . PHE A 1 140 ? -3.338  -17.879 -37.139 1.00 54.75  ? 489 PHE B CZ  1 
ATOM   989  N N   . SER A 1 141 ? -4.132  -23.673 -35.865 1.00 42.13  ? 490 SER B N   1 
ATOM   990  C CA  . SER A 1 141 ? -3.965  -24.424 -37.093 1.00 49.15  ? 490 SER B CA  1 
ATOM   991  C C   . SER A 1 141 ? -5.274  -25.042 -37.555 1.00 47.67  ? 490 SER B C   1 
ATOM   992  O O   . SER A 1 141 ? -5.661  -24.936 -38.731 1.00 52.15  ? 490 SER B O   1 
ATOM   993  C CB  . SER A 1 141 ? -2.929  -25.526 -36.901 1.00 47.62  ? 490 SER B CB  1 
ATOM   994  O OG  . SER A 1 141 ? -2.736  -26.200 -38.108 1.00 48.13  ? 490 SER B OG  1 
ATOM   995  N N   . ARG A 1 142 ? -5.994  -25.635 -36.625 1.00 51.15  ? 491 ARG B N   1 
ATOM   996  C CA  . ARG A 1 142 ? -7.304  -26.244 -36.956 1.00 60.76  ? 491 ARG B CA  1 
ATOM   997  C C   . ARG A 1 142 ? -8.263  -25.174 -37.477 1.00 56.65  ? 491 ARG B C   1 
ATOM   998  O O   . ARG A 1 142 ? -8.959  -25.353 -38.476 1.00 61.58  ? 491 ARG B O   1 
ATOM   999  C CB  . ARG A 1 142 ? -7.866  -26.946 -35.726 1.00 70.52  ? 491 ARG B CB  1 
ATOM   1000 C CG  . ARG A 1 142 ? -9.371  -27.143 -35.707 1.00 87.11  ? 491 ARG B CG  1 
ATOM   1001 C CD  . ARG A 1 142 ? -9.801  -27.850 -34.437 1.00 104.61 ? 491 ARG B CD  1 
ATOM   1002 N NE  . ARG A 1 142 ? -11.255 -27.841 -34.307 1.00 119.60 ? 491 ARG B NE  1 
ATOM   1003 C CZ  . ARG A 1 142 ? -11.969 -28.745 -33.641 1.00 123.75 ? 491 ARG B CZ  1 
ATOM   1004 N NH1 . ARG A 1 142 ? -11.391 -29.785 -33.038 1.00 118.12 ? 491 ARG B NH1 1 
ATOM   1005 N NH2 . ARG A 1 142 ? -13.286 -28.613 -33.584 1.00 126.08 ? 491 ARG B NH2 1 
ATOM   1006 N N   . SER A 1 143 ? -8.256  -24.021 -36.833 1.00 52.67  ? 492 SER B N   1 
ATOM   1007 C CA  . SER A 1 143 ? -9.088  -22.927 -37.297 1.00 56.61  ? 492 SER B CA  1 
ATOM   1008 C C   . SER A 1 143 ? -8.641  -22.389 -38.673 1.00 60.82  ? 492 SER B C   1 
ATOM   1009 O O   . SER A 1 143 ? -9.465  -22.085 -39.533 1.00 63.63  ? 492 SER B O   1 
ATOM   1010 C CB  . SER A 1 143 ? -9.121  -21.851 -36.223 1.00 56.34  ? 492 SER B CB  1 
ATOM   1011 O OG  . SER A 1 143 ? -9.911  -20.793 -36.661 1.00 61.41  ? 492 SER B OG  1 
ATOM   1012 N N   . LEU A 1 144 ? -7.336  -22.268 -38.891 1.00 61.53  ? 493 LEU B N   1 
ATOM   1013 C CA  . LEU A 1 144 ? -6.841  -21.848 -40.204 1.00 56.10  ? 493 LEU B CA  1 
ATOM   1014 C C   . LEU A 1 144 ? -7.247  -22.888 -41.282 1.00 51.70  ? 493 LEU B C   1 
ATOM   1015 O O   . LEU A 1 144 ? -7.636  -22.540 -42.380 1.00 51.01  ? 493 LEU B O   1 
ATOM   1016 C CB  . LEU A 1 144 ? -5.323  -21.784 -40.182 1.00 59.55  ? 493 LEU B CB  1 
ATOM   1017 C CG  . LEU A 1 144 ? -4.560  -20.689 -40.863 1.00 63.42  ? 493 LEU B CG  1 
ATOM   1018 C CD1 . LEU A 1 144 ? -3.236  -21.295 -41.302 1.00 66.19  ? 493 LEU B CD1 1 
ATOM   1019 C CD2 . LEU A 1 144 ? -5.290  -19.989 -42.006 1.00 57.10  ? 493 LEU B CD2 1 
ATOM   1020 N N   . HIS A 1 145 ? -7.097  -24.168 -40.977 1.00 55.03  ? 494 HIS B N   1 
ATOM   1021 C CA  . HIS A 1 145 ? -7.550  -25.225 -41.904 1.00 59.94  ? 494 HIS B CA  1 
ATOM   1022 C C   . HIS A 1 145 ? -9.037  -25.180 -42.261 1.00 59.82  ? 494 HIS B C   1 
ATOM   1023 O O   . HIS A 1 145 ? -9.381  -25.437 -43.401 1.00 67.08  ? 494 HIS B O   1 
ATOM   1024 C CB  . HIS A 1 145 ? -7.118  -26.627 -41.436 1.00 56.13  ? 494 HIS B CB  1 
ATOM   1025 C CG  . HIS A 1 145 ? -5.661  -26.874 -41.650 1.00 65.20  ? 494 HIS B CG  1 
ATOM   1026 N ND1 . HIS A 1 145 ? -4.765  -26.931 -40.614 1.00 77.14  ? 494 HIS B ND1 1 
ATOM   1027 C CD2 . HIS A 1 145 ? -4.925  -26.966 -42.783 1.00 74.41  ? 494 HIS B CD2 1 
ATOM   1028 C CE1 . HIS A 1 145 ? -3.549  -27.114 -41.087 1.00 74.31  ? 494 HIS B CE1 1 
ATOM   1029 N NE2 . HIS A 1 145 ? -3.618  -27.144 -42.402 1.00 74.76  ? 494 HIS B NE2 1 
ATOM   1030 N N   . SER A 1 146 ? -9.898  -24.785 -41.333 1.00 67.58  ? 495 SER B N   1 
ATOM   1031 C CA  . SER A 1 146 ? -11.349 -24.699 -41.623 1.00 68.95  ? 495 SER B CA  1 
ATOM   1032 C C   . SER A 1 146 ? -11.648 -23.675 -42.688 1.00 70.45  ? 495 SER B C   1 
ATOM   1033 O O   . SER A 1 146 ? -12.668 -23.788 -43.365 1.00 76.74  ? 495 SER B O   1 
ATOM   1034 C CB  . SER A 1 146 ? -12.208 -24.283 -40.408 1.00 68.88  ? 495 SER B CB  1 
ATOM   1035 O OG  . SER A 1 146 ? -12.111 -25.211 -39.372 1.00 68.54  ? 495 SER B OG  1 
ATOM   1036 N N   . LEU A 1 147 ? -10.817 -22.641 -42.798 1.00 67.71  ? 496 LEU B N   1 
ATOM   1037 C CA  . LEU A 1 147 ? -11.003 -21.636 -43.851 1.00 72.69  ? 496 LEU B CA  1 
ATOM   1038 C C   . LEU A 1 147 ? -10.666 -22.148 -45.241 1.00 69.31  ? 496 LEU B C   1 
ATOM   1039 O O   . LEU A 1 147 ? -11.071 -21.544 -46.227 1.00 75.44  ? 496 LEU B O   1 
ATOM   1040 C CB  . LEU A 1 147 ? -10.183 -20.369 -43.566 1.00 71.04  ? 496 LEU B CB  1 
ATOM   1041 C CG  . LEU A 1 147 ? -10.934 -19.224 -42.873 1.00 82.40  ? 496 LEU B CG  1 
ATOM   1042 C CD1 . LEU A 1 147 ? -12.128 -19.675 -42.026 1.00 85.22  ? 496 LEU B CD1 1 
ATOM   1043 C CD2 . LEU A 1 147 ? -9.957  -18.449 -42.021 1.00 82.19  ? 496 LEU B CD2 1 
ATOM   1044 N N   . LEU A 1 148 ? -9.913  -23.240 -45.334 1.00 69.19  ? 497 LEU B N   1 
ATOM   1045 C CA  . LEU A 1 148 ? -9.521  -23.740 -46.624 1.00 70.87  ? 497 LEU B CA  1 
ATOM   1046 C C   . LEU A 1 148 ? -8.925  -22.555 -47.355 1.00 65.46  ? 497 LEU B C   1 
ATOM   1047 O O   . LEU A 1 148 ? -9.491  -22.032 -48.331 1.00 76.47  ? 497 LEU B O   1 
ATOM   1048 C CB  . LEU A 1 148 ? -10.732 -24.318 -47.371 1.00 81.26  ? 497 LEU B CB  1 
ATOM   1049 C CG  . LEU A 1 148 ? -11.572 -25.336 -46.580 1.00 84.67  ? 497 LEU B CG  1 
ATOM   1050 C CD1 . LEU A 1 148 ? -13.001 -25.374 -47.121 1.00 85.95  ? 497 LEU B CD1 1 
ATOM   1051 C CD2 . LEU A 1 148 ? -10.914 -26.720 -46.571 1.00 82.82  ? 497 LEU B CD2 1 
ATOM   1052 N N   . VAL A 1 149 ? -7.788  -22.110 -46.842 1.00 63.56  ? 498 VAL B N   1 
ATOM   1053 C CA  . VAL A 1 149 ? -7.081  -20.995 -47.420 1.00 58.13  ? 498 VAL B CA  1 
ATOM   1054 C C   . VAL A 1 149 ? -6.223  -21.618 -48.501 1.00 56.36  ? 498 VAL B C   1 
ATOM   1055 O O   . VAL A 1 149 ? -5.433  -22.496 -48.213 1.00 57.64  ? 498 VAL B O   1 
ATOM   1056 C CB  . VAL A 1 149 ? -6.218  -20.287 -46.372 1.00 63.19  ? 498 VAL B CB  1 
ATOM   1057 C CG1 . VAL A 1 149 ? -5.438  -19.140 -46.990 1.00 61.24  ? 498 VAL B CG1 1 
ATOM   1058 C CG2 . VAL A 1 149 ? -7.099  -19.800 -45.232 1.00 68.25  ? 498 VAL B CG2 1 
ATOM   1059 N N   . ASP A 1 150 ? -6.412  -21.207 -49.751 1.00 59.41  ? 499 ASP B N   1 
ATOM   1060 C CA  . ASP A 1 150 ? -5.593  -21.728 -50.835 1.00 58.26  ? 499 ASP B CA  1 
ATOM   1061 C C   . ASP A 1 150 ? -4.214  -21.032 -50.841 1.00 57.62  ? 499 ASP B C   1 
ATOM   1062 O O   . ASP A 1 150 ? -3.976  -20.070 -50.123 1.00 59.91  ? 499 ASP B O   1 
ATOM   1063 C CB  . ASP A 1 150 ? -6.287  -21.568 -52.198 1.00 57.15  ? 499 ASP B CB  1 
ATOM   1064 C CG  . ASP A 1 150 ? -6.407  -20.120 -52.613 1.00 66.88  ? 499 ASP B CG  1 
ATOM   1065 O OD1 . ASP A 1 150 ? -7.035  -19.840 -53.624 1.00 84.38  ? 499 ASP B OD1 1 
ATOM   1066 O OD2 . ASP A 1 150 ? -5.875  -19.226 -51.959 1.00 72.37  ? 499 ASP B OD2 1 
ATOM   1067 N N   . VAL A 1 151 ? -3.291  -21.598 -51.596 1.00 58.88  ? 500 VAL B N   1 
ATOM   1068 C CA  . VAL A 1 151 ? -1.903  -21.199 -51.554 1.00 61.33  ? 500 VAL B CA  1 
ATOM   1069 C C   . VAL A 1 151 ? -1.692  -19.731 -51.957 1.00 66.33  ? 500 VAL B C   1 
ATOM   1070 O O   . VAL A 1 151 ? -0.920  -19.033 -51.303 1.00 63.36  ? 500 VAL B O   1 
ATOM   1071 C CB  . VAL A 1 151 ? -1.037  -22.168 -52.393 1.00 59.81  ? 500 VAL B CB  1 
ATOM   1072 C CG1 . VAL A 1 151 ? 0.348   -21.600 -52.653 1.00 66.33  ? 500 VAL B CG1 1 
ATOM   1073 C CG2 . VAL A 1 151 ? -0.944  -23.517 -51.685 1.00 61.34  ? 500 VAL B CG2 1 
ATOM   1074 N N   . PRO A 1 152 ? -2.358  -19.262 -53.027 1.00 68.43  ? 501 PRO B N   1 
ATOM   1075 C CA  . PRO A 1 152 ? -2.149  -17.853 -53.361 1.00 63.04  ? 501 PRO B CA  1 
ATOM   1076 C C   . PRO A 1 152 ? -2.646  -16.880 -52.270 1.00 59.22  ? 501 PRO B C   1 
ATOM   1077 O O   . PRO A 1 152 ? -2.002  -15.849 -51.969 1.00 56.37  ? 501 PRO B O   1 
ATOM   1078 C CB  . PRO A 1 152 ? -2.915  -17.696 -54.676 1.00 64.35  ? 501 PRO B CB  1 
ATOM   1079 C CG  . PRO A 1 152 ? -2.894  -19.069 -55.270 1.00 69.64  ? 501 PRO B CG  1 
ATOM   1080 C CD  . PRO A 1 152 ? -3.105  -19.963 -54.090 1.00 69.42  ? 501 PRO B CD  1 
ATOM   1081 N N   . ALA A 1 153 ? -3.740  -17.235 -51.628 1.00 56.57  ? 502 ALA B N   1 
ATOM   1082 C CA  . ALA A 1 153 ? -4.255  -16.414 -50.551 1.00 56.71  ? 502 ALA B CA  1 
ATOM   1083 C C   . ALA A 1 153 ? -3.305  -16.468 -49.362 1.00 53.38  ? 502 ALA B C   1 
ATOM   1084 O O   . ALA A 1 153 ? -2.966  -15.449 -48.791 1.00 64.38  ? 502 ALA B O   1 
ATOM   1085 C CB  . ALA A 1 153 ? -5.641  -16.845 -50.165 1.00 56.18  ? 502 ALA B CB  1 
ATOM   1086 N N   . PHE A 1 154 ? -2.795  -17.644 -49.045 1.00 52.43  ? 503 PHE B N   1 
ATOM   1087 C CA  . PHE A 1 154 ? -1.815  -17.755 -47.977 1.00 46.45  ? 503 PHE B CA  1 
ATOM   1088 C C   . PHE A 1 154 ? -0.527  -17.004 -48.283 1.00 48.67  ? 503 PHE B C   1 
ATOM   1089 O O   . PHE A 1 154 ? 0.131   -16.450 -47.392 1.00 50.56  ? 503 PHE B O   1 
ATOM   1090 C CB  . PHE A 1 154 ? -1.492  -19.200 -47.677 1.00 49.33  ? 503 PHE B CB  1 
ATOM   1091 C CG  . PHE A 1 154 ? -0.648  -19.342 -46.470 1.00 47.24  ? 503 PHE B CG  1 
ATOM   1092 C CD1 . PHE A 1 154 ? -1.233  -19.297 -45.229 1.00 50.73  ? 503 PHE B CD1 1 
ATOM   1093 C CD2 . PHE A 1 154 ? 0.745   -19.425 -46.570 1.00 44.72  ? 503 PHE B CD2 1 
ATOM   1094 C CE1 . PHE A 1 154 ? -0.453  -19.382 -44.089 1.00 48.05  ? 503 PHE B CE1 1 
ATOM   1095 C CE2 . PHE A 1 154 ? 1.533   -19.516 -45.445 1.00 51.93  ? 503 PHE B CE2 1 
ATOM   1096 C CZ  . PHE A 1 154 ? 0.923   -19.493 -44.189 1.00 52.30  ? 503 PHE B CZ  1 
ATOM   1097 N N   . ALA A 1 155 ? -0.152  -17.008 -49.549 1.00 53.15  ? 504 ALA B N   1 
ATOM   1098 C CA  . ALA A 1 155 ? 1.073   -16.359 -49.972 1.00 50.21  ? 504 ALA B CA  1 
ATOM   1099 C C   . ALA A 1 155 ? 0.950   -14.864 -49.766 1.00 52.06  ? 504 ALA B C   1 
ATOM   1100 O O   . ALA A 1 155 ? 1.885   -14.247 -49.294 1.00 48.81  ? 504 ALA B O   1 
ATOM   1101 C CB  . ALA A 1 155 ? 1.372   -16.692 -51.406 1.00 48.33  ? 504 ALA B CB  1 
ATOM   1102 N N   . CYS A 1 156 ? -0.250  -14.320 -49.975 1.00 53.73  ? 505 CYS B N   1 
ATOM   1103 C CA  . CYS A 1 156 ? -0.508  -12.933 -49.623 1.00 52.12  ? 505 CYS B CA  1 
ATOM   1104 C C   . CYS A 1 156 ? -0.577  -12.677 -48.103 1.00 53.79  ? 505 CYS B C   1 
ATOM   1105 O O   . CYS A 1 156 ? -0.001  -11.688 -47.605 1.00 49.84  ? 505 CYS B O   1 
ATOM   1106 C CB  . CYS A 1 156 ? -1.791  -12.458 -50.278 1.00 53.95  ? 505 CYS B CB  1 
ATOM   1107 S SG  . CYS A 1 156 ? -1.718  -12.503 -52.077 1.00 57.68  ? 505 CYS B SG  1 
ATOM   1108 N N   . LEU A 1 157 ? -1.277  -13.539 -47.358 1.00 54.28  ? 506 LEU B N   1 
ATOM   1109 C CA  . LEU A 1 157 ? -1.474  -13.278 -45.935 1.00 51.11  ? 506 LEU B CA  1 
ATOM   1110 C C   . LEU A 1 157 ? -0.168  -13.196 -45.210 1.00 47.81  ? 506 LEU B C   1 
ATOM   1111 O O   . LEU A 1 157 ? -0.028  -12.370 -44.339 1.00 47.70  ? 506 LEU B O   1 
ATOM   1112 C CB  . LEU A 1 157 ? -2.214  -14.390 -45.228 1.00 54.59  ? 506 LEU B CB  1 
ATOM   1113 C CG  . LEU A 1 157 ? -3.589  -14.163 -44.618 1.00 62.86  ? 506 LEU B CG  1 
ATOM   1114 C CD1 . LEU A 1 157 ? -3.655  -15.152 -43.492 1.00 57.65  ? 506 LEU B CD1 1 
ATOM   1115 C CD2 . LEU A 1 157 ? -3.848  -12.750 -44.114 1.00 62.23  ? 506 LEU B CD2 1 
ATOM   1116 N N   . SER A 1 158 ? 0.742   -14.128 -45.502 1.00 37.27  ? 507 SER B N   1 
ATOM   1117 C CA  . SER A 1 158 ? 1.969   -14.204 -44.763 1.00 40.28  ? 507 SER B CA  1 
ATOM   1118 C C   . SER A 1 158 ? 2.788   -12.953 -45.059 1.00 45.18  ? 507 SER B C   1 
ATOM   1119 O O   . SER A 1 158 ? 3.431   -12.383 -44.182 1.00 45.72  ? 507 SER B O   1 
ATOM   1120 C CB  . SER A 1 158 ? 2.778   -15.476 -45.108 1.00 42.95  ? 507 SER B CB  1 
ATOM   1121 O OG  . SER A 1 158 ? 2.887   -15.745 -46.510 1.00 42.01  ? 507 SER B OG  1 
ATOM   1122 N N   . ALA A 1 159 ? 2.725   -12.511 -46.297 1.00 46.38  ? 508 ALA B N   1 
ATOM   1123 C CA  . ALA A 1 159 ? 3.441   -11.341 -46.655 1.00 48.60  ? 508 ALA B CA  1 
ATOM   1124 C C   . ALA A 1 159 ? 2.864   -10.123 -45.959 1.00 51.57  ? 508 ALA B C   1 
ATOM   1125 O O   . ALA A 1 159 ? 3.629   -9.233  -45.545 1.00 45.50  ? 508 ALA B O   1 
ATOM   1126 C CB  . ALA A 1 159 ? 3.407   -11.177 -48.140 1.00 52.32  ? 508 ALA B CB  1 
ATOM   1127 N N   . LEU A 1 160 ? 1.542   -10.117 -45.750 1.00 52.79  ? 509 LEU B N   1 
ATOM   1128 C CA  . LEU A 1 160 ? 0.898   -9.028  -45.012 1.00 51.63  ? 509 LEU B CA  1 
ATOM   1129 C C   . LEU A 1 160 ? 1.275   -9.045  -43.543 1.00 54.65  ? 509 LEU B C   1 
ATOM   1130 O O   . LEU A 1 160 ? 1.229   -8.019  -42.861 1.00 55.13  ? 509 LEU B O   1 
ATOM   1131 C CB  . LEU A 1 160 ? -0.615  -9.050  -45.141 1.00 52.01  ? 509 LEU B CB  1 
ATOM   1132 C CG  . LEU A 1 160 ? -1.105  -8.689  -46.547 1.00 59.23  ? 509 LEU B CG  1 
ATOM   1133 C CD1 . LEU A 1 160 ? -2.562  -9.102  -46.767 1.00 56.87  ? 509 LEU B CD1 1 
ATOM   1134 C CD2 . LEU A 1 160 ? -0.925  -7.213  -46.865 1.00 56.35  ? 509 LEU B CD2 1 
ATOM   1135 N N   . VAL A 1 161 ? 1.650   -10.203 -43.032 1.00 49.91  ? 510 VAL B N   1 
ATOM   1136 C CA  . VAL A 1 161 ? 2.124   -10.251 -41.642 1.00 48.30  ? 510 VAL B CA  1 
ATOM   1137 C C   . VAL A 1 161 ? 3.489   -9.532  -41.501 1.00 47.49  ? 510 VAL B C   1 
ATOM   1138 O O   . VAL A 1 161 ? 3.789   -8.904  -40.506 1.00 43.39  ? 510 VAL B O   1 
ATOM   1139 C CB  . VAL A 1 161 ? 2.205   -11.691 -41.148 1.00 46.04  ? 510 VAL B CB  1 
ATOM   1140 C CG1 . VAL A 1 161 ? 2.971   -11.773 -39.822 1.00 45.29  ? 510 VAL B CG1 1 
ATOM   1141 C CG2 . VAL A 1 161 ? 0.820   -12.309 -41.040 1.00 47.60  ? 510 VAL B CG2 1 
ATOM   1142 N N   . LEU A 1 162 ? 4.294   -9.629  -42.533 1.00 48.91  ? 511 LEU B N   1 
ATOM   1143 C CA  . LEU A 1 162 ? 5.635   -9.068  -42.516 1.00 49.01  ? 511 LEU B CA  1 
ATOM   1144 C C   . LEU A 1 162 ? 5.572   -7.579  -42.836 1.00 43.37  ? 511 LEU B C   1 
ATOM   1145 O O   . LEU A 1 162 ? 6.179   -6.783  -42.147 1.00 42.36  ? 511 LEU B O   1 
ATOM   1146 C CB  . LEU A 1 162 ? 6.480   -9.763  -43.581 1.00 45.74  ? 511 LEU B CB  1 
ATOM   1147 C CG  . LEU A 1 162 ? 7.838   -9.151  -43.832 1.00 44.27  ? 511 LEU B CG  1 
ATOM   1148 C CD1 . LEU A 1 162 ? 8.808   -9.459  -42.707 1.00 47.69  ? 511 LEU B CD1 1 
ATOM   1149 C CD2 . LEU A 1 162 ? 8.380   -9.686  -45.149 1.00 48.86  ? 511 LEU B CD2 1 
ATOM   1150 N N   . ILE A 1 163 ? 4.842   -7.236  -43.899 1.00 39.88  ? 512 ILE B N   1 
ATOM   1151 C CA  . ILE A 1 163 ? 4.798   -5.887  -44.420 1.00 43.42  ? 512 ILE B CA  1 
ATOM   1152 C C   . ILE A 1 163 ? 3.604   -5.196  -43.743 1.00 45.91  ? 512 ILE B C   1 
ATOM   1153 O O   . ILE A 1 163 ? 2.464   -5.178  -44.255 1.00 48.73  ? 512 ILE B O   1 
ATOM   1154 C CB  . ILE A 1 163 ? 4.619   -5.841  -45.961 1.00 45.37  ? 512 ILE B CB  1 
ATOM   1155 C CG1 . ILE A 1 163 ? 5.568   -6.790  -46.719 1.00 50.37  ? 512 ILE B CG1 1 
ATOM   1156 C CG2 . ILE A 1 163 ? 4.763   -4.434  -46.476 1.00 43.66  ? 512 ILE B CG2 1 
ATOM   1157 C CD1 . ILE A 1 163 ? 6.974   -6.414  -46.497 1.00 59.27  ? 512 ILE B CD1 1 
ATOM   1158 N N   . THR A 1 164 ? 3.883   -4.574  -42.612 1.00 46.20  ? 513 THR B N   1 
ATOM   1159 C CA  . THR A 1 164 ? 2.831   -3.954  -41.779 1.00 51.96  ? 513 THR B CA  1 
ATOM   1160 C C   . THR A 1 164 ? 3.482   -2.849  -40.961 1.00 48.41  ? 513 THR B C   1 
ATOM   1161 O O   . THR A 1 164 ? 4.697   -2.804  -40.831 1.00 55.14  ? 513 THR B O   1 
ATOM   1162 C CB  . THR A 1 164 ? 2.143   -5.008  -40.848 1.00 41.61  ? 513 THR B CB  1 
ATOM   1163 O OG1 . THR A 1 164 ? 1.015   -4.429  -40.212 1.00 49.49  ? 513 THR B OG1 1 
ATOM   1164 C CG2 . THR A 1 164 ? 3.085   -5.519  -39.800 1.00 40.06  ? 513 THR B CG2 1 
ATOM   1165 N N   . ASP A 1 165 ? 2.679   -1.914  -40.495 1.00 47.12  ? 514 ASP B N   1 
ATOM   1166 C CA  . ASP A 1 165 ? 3.196   -0.860  -39.667 1.00 47.83  ? 514 ASP B CA  1 
ATOM   1167 C C   . ASP A 1 165 ? 3.863   -1.357  -38.385 1.00 49.80  ? 514 ASP B C   1 
ATOM   1168 O O   . ASP A 1 165 ? 3.374   -2.301  -37.752 1.00 54.64  ? 514 ASP B O   1 
ATOM   1169 C CB  . ASP A 1 165 ? 2.128   0.179   -39.372 1.00 53.90  ? 514 ASP B CB  1 
ATOM   1170 C CG  . ASP A 1 165 ? 2.742   1.458   -38.876 1.00 59.27  ? 514 ASP B CG  1 
ATOM   1171 O OD1 . ASP A 1 165 ? 3.360   2.186   -39.714 1.00 61.33  ? 514 ASP B OD1 1 
ATOM   1172 O OD2 . ASP A 1 165 ? 2.688   1.662   -37.652 1.00 57.77  ? 514 ASP B OD2 1 
ATOM   1173 N N   . ARG A 1 166 ? 5.011   -0.755  -38.042 1.00 49.73  ? 515 ARG B N   1 
ATOM   1174 C CA  . ARG A 1 166 ? 5.720   -1.001  -36.801 1.00 46.24  ? 515 ARG B CA  1 
ATOM   1175 C C   . ARG A 1 166 ? 6.281   0.317   -36.293 1.00 52.66  ? 515 ARG B C   1 
ATOM   1176 O O   . ARG A 1 166 ? 6.695   1.156   -37.081 1.00 54.45  ? 515 ARG B O   1 
ATOM   1177 C CB  . ARG A 1 166 ? 6.914   -1.954  -37.010 1.00 50.32  ? 515 ARG B CB  1 
ATOM   1178 C CG  . ARG A 1 166 ? 6.520   -3.301  -37.588 1.00 54.05  ? 515 ARG B CG  1 
ATOM   1179 C CD  . ARG A 1 166 ? 5.831   -4.225  -36.558 1.00 48.68  ? 515 ARG B CD  1 
ATOM   1180 N NE  . ARG A 1 166 ? 5.545   -5.546  -37.138 1.00 55.81  ? 515 ARG B NE  1 
ATOM   1181 C CZ  . ARG A 1 166 ? 4.992   -6.588  -36.496 1.00 54.87  ? 515 ARG B CZ  1 
ATOM   1182 N NH1 . ARG A 1 166 ? 4.565   -6.467  -35.272 1.00 53.09  ? 515 ARG B NH1 1 
ATOM   1183 N NH2 . ARG A 1 166 ? 4.872   -7.749  -37.098 1.00 51.82  ? 515 ARG B NH2 1 
ATOM   1184 N N   . HIS A 1 167 ? 6.331   0.473   -34.971 1.00 56.13  ? 516 HIS B N   1 
ATOM   1185 C CA  . HIS A 1 167 ? 6.977   1.610   -34.351 1.00 55.36  ? 516 HIS B CA  1 
ATOM   1186 C C   . HIS A 1 167 ? 8.454   1.634   -34.763 1.00 55.95  ? 516 HIS B C   1 
ATOM   1187 O O   . HIS A 1 167 ? 9.125   0.613   -34.644 1.00 59.50  ? 516 HIS B O   1 
ATOM   1188 C CB  . HIS A 1 167 ? 6.871   1.525   -32.818 1.00 52.07  ? 516 HIS B CB  1 
ATOM   1189 C CG  . HIS A 1 167 ? 7.464   2.719   -32.127 1.00 62.14  ? 516 HIS B CG  1 
ATOM   1190 N ND1 . HIS A 1 167 ? 6.808   3.931   -32.043 1.00 66.08  ? 516 HIS B ND1 1 
ATOM   1191 C CD2 . HIS A 1 167 ? 8.670   2.907   -31.547 1.00 66.81  ? 516 HIS B CD2 1 
ATOM   1192 C CE1 . HIS A 1 167 ? 7.586   4.814   -31.446 1.00 69.42  ? 516 HIS B CE1 1 
ATOM   1193 N NE2 . HIS A 1 167 ? 8.725   4.221   -31.143 1.00 75.22  ? 516 HIS B NE2 1 
ATOM   1194 N N   . GLY A 1 168 ? 8.922   2.786   -35.270 1.00 57.44  ? 517 GLY B N   1 
ATOM   1195 C CA  . GLY A 1 168 ? 10.322  3.011   -35.654 1.00 52.49  ? 517 GLY B CA  1 
ATOM   1196 C C   . GLY A 1 168 ? 10.663  2.803   -37.126 1.00 51.96  ? 517 GLY B C   1 
ATOM   1197 O O   . GLY A 1 168 ? 11.839  2.817   -37.501 1.00 50.27  ? 517 GLY B O   1 
ATOM   1198 N N   . LEU A 1 169 ? 9.665   2.589   -37.972 1.00 49.57  ? 518 LEU B N   1 
ATOM   1199 C CA  . LEU A 1 169 ? 9.908   2.602   -39.420 1.00 55.28  ? 518 LEU B CA  1 
ATOM   1200 C C   . LEU A 1 169 ? 10.445  3.984   -39.875 1.00 61.88  ? 518 LEU B C   1 
ATOM   1201 O O   . LEU A 1 169 ? 9.998   4.999   -39.398 1.00 60.47  ? 518 LEU B O   1 
ATOM   1202 C CB  . LEU A 1 169 ? 8.628   2.256   -40.194 1.00 50.77  ? 518 LEU B CB  1 
ATOM   1203 C CG  . LEU A 1 169 ? 8.218   0.775   -40.115 1.00 50.45  ? 518 LEU B CG  1 
ATOM   1204 C CD1 . LEU A 1 169 ? 6.845   0.602   -40.723 1.00 50.10  ? 518 LEU B CD1 1 
ATOM   1205 C CD2 . LEU A 1 169 ? 9.252   -0.074  -40.846 1.00 50.81  ? 518 LEU B CD2 1 
ATOM   1206 N N   . GLN A 1 170 ? 11.418  3.981   -40.781 1.00 60.55  ? 519 GLN B N   1 
ATOM   1207 C CA  . GLN A 1 170 ? 11.954  5.193   -41.371 1.00 52.97  ? 519 GLN B CA  1 
ATOM   1208 C C   . GLN A 1 170 ? 11.007  5.686   -42.432 1.00 56.71  ? 519 GLN B C   1 
ATOM   1209 O O   . GLN A 1 170 ? 10.801  6.880   -42.571 1.00 64.47  ? 519 GLN B O   1 
ATOM   1210 C CB  . GLN A 1 170 ? 13.306  4.900   -42.009 1.00 53.17  ? 519 GLN B CB  1 
ATOM   1211 C CG  . GLN A 1 170 ? 14.385  4.552   -40.985 1.00 54.43  ? 519 GLN B CG  1 
ATOM   1212 C CD  . GLN A 1 170 ? 15.728  4.189   -41.612 1.00 60.86  ? 519 GLN B CD  1 
ATOM   1213 O OE1 . GLN A 1 170 ? 16.776  4.346   -40.989 1.00 59.38  ? 519 GLN B OE1 1 
ATOM   1214 N NE2 . GLN A 1 170 ? 15.701  3.671   -42.828 1.00 58.48  ? 519 GLN B NE2 1 
ATOM   1215 N N   . GLU A 1 171 ? 10.399  4.771   -43.173 1.00 54.26  ? 520 GLU B N   1 
ATOM   1216 C CA  . GLU A 1 171 ? 9.508   5.148   -44.236 1.00 55.51  ? 520 GLU B CA  1 
ATOM   1217 C C   . GLU A 1 171 ? 8.160   4.438   -44.125 1.00 50.34  ? 520 GLU B C   1 
ATOM   1218 O O   . GLU A 1 171 ? 7.731   3.701   -45.034 1.00 58.71  ? 520 GLU B O   1 
ATOM   1219 C CB  . GLU A 1 171 ? 10.156  4.876   -45.585 1.00 56.47  ? 520 GLU B CB  1 
ATOM   1220 C CG  . GLU A 1 171 ? 11.586  5.394   -45.710 1.00 62.21  ? 520 GLU B CG  1 
ATOM   1221 C CD  . GLU A 1 171 ? 12.085  5.258   -47.151 1.00 66.75  ? 520 GLU B CD  1 
ATOM   1222 O OE1 . GLU A 1 171 ? 12.330  4.118   -47.611 1.00 64.89  ? 520 GLU B OE1 1 
ATOM   1223 O OE2 . GLU A 1 171 ? 12.173  6.282   -47.848 1.00 64.29  ? 520 GLU B OE2 1 
ATOM   1224 N N   . PRO A 1 172 ? 7.440   4.724   -43.061 1.00 55.75  ? 521 PRO B N   1 
ATOM   1225 C CA  . PRO A 1 172 ? 6.130   4.061   -42.876 1.00 52.47  ? 521 PRO B CA  1 
ATOM   1226 C C   . PRO A 1 172 ? 5.173   4.147   -44.071 1.00 52.15  ? 521 PRO B C   1 
ATOM   1227 O O   . PRO A 1 172 ? 4.437   3.199   -44.316 1.00 60.84  ? 521 PRO B O   1 
ATOM   1228 C CB  . PRO A 1 172 ? 5.551   4.781   -41.652 1.00 55.53  ? 521 PRO B CB  1 
ATOM   1229 C CG  . PRO A 1 172 ? 6.332   6.070   -41.497 1.00 51.44  ? 521 PRO B CG  1 
ATOM   1230 C CD  . PRO A 1 172 ? 7.726   5.683   -41.974 1.00 59.32  ? 521 PRO B CD  1 
ATOM   1231 N N   . ARG A 1 173 ? 5.244   5.196   -44.879 1.00 59.56  ? 522 ARG B N   1 
ATOM   1232 C CA  . ARG A 1 173 ? 4.361   5.276   -46.041 1.00 60.98  ? 522 ARG B CA  1 
ATOM   1233 C C   . ARG A 1 173 ? 4.755   4.298   -47.155 1.00 57.57  ? 522 ARG B C   1 
ATOM   1234 O O   . ARG A 1 173 ? 3.890   3.758   -47.878 1.00 53.48  ? 522 ARG B O   1 
ATOM   1235 C CB  . ARG A 1 173 ? 4.330   6.706   -46.608 1.00 64.56  ? 522 ARG B CB  1 
ATOM   1236 C CG  . ARG A 1 173 ? 3.345   7.651   -45.956 1.00 80.68  ? 522 ARG B CG  1 
ATOM   1237 C CD  . ARG A 1 173 ? 3.678   9.079   -46.399 1.00 95.89  ? 522 ARG B CD  1 
ATOM   1238 N NE  . ARG A 1 173 ? 2.883   10.132  -45.732 1.00 109.17 ? 522 ARG B NE  1 
ATOM   1239 C CZ  . ARG A 1 173 ? 3.376   11.123  -44.975 1.00 103.72 ? 522 ARG B CZ  1 
ATOM   1240 N NH1 . ARG A 1 173 ? 2.542   12.013  -44.433 1.00 88.95  ? 522 ARG B NH1 1 
ATOM   1241 N NH2 . ARG A 1 173 ? 4.691   11.239  -44.755 1.00 102.35 ? 522 ARG B NH2 1 
ATOM   1242 N N   . ARG A 1 174 ? 6.048   4.054   -47.337 1.00 53.02  ? 523 ARG B N   1 
ATOM   1243 C CA  . ARG A 1 174 ? 6.435   3.045   -48.356 1.00 53.32  ? 523 ARG B CA  1 
ATOM   1244 C C   . ARG A 1 174 ? 6.035   1.631   -47.947 1.00 43.63  ? 523 ARG B C   1 
ATOM   1245 O O   . ARG A 1 174 ? 5.578   0.864   -48.784 1.00 42.00  ? 523 ARG B O   1 
ATOM   1246 C CB  . ARG A 1 174 ? 7.894   3.146   -48.687 1.00 52.15  ? 523 ARG B CB  1 
ATOM   1247 C CG  . ARG A 1 174 ? 8.160   4.533   -49.295 1.00 54.03  ? 523 ARG B CG  1 
ATOM   1248 C CD  . ARG A 1 174 ? 9.477   4.655   -50.074 1.00 49.65  ? 523 ARG B CD  1 
ATOM   1249 N NE  . ARG A 1 174 ? 9.559   3.651   -51.144 1.00 51.28  ? 523 ARG B NE  1 
ATOM   1250 C CZ  . ARG A 1 174 ? 10.389  2.626   -51.118 1.00 46.75  ? 523 ARG B CZ  1 
ATOM   1251 N NH1 . ARG A 1 174 ? 10.404  1.753   -52.113 1.00 48.74  ? 523 ARG B NH1 1 
ATOM   1252 N NH2 . ARG A 1 174 ? 11.229  2.510   -50.111 1.00 41.43  ? 523 ARG B NH2 1 
ATOM   1253 N N   . VAL A 1 175 ? 6.138   1.345   -46.653 1.00 43.85  ? 524 VAL B N   1 
ATOM   1254 C CA  . VAL A 1 175 ? 5.684   0.083   -46.121 1.00 50.70  ? 524 VAL B CA  1 
ATOM   1255 C C   . VAL A 1 175 ? 4.195   -0.037  -46.340 1.00 51.70  ? 524 VAL B C   1 
ATOM   1256 O O   . VAL A 1 175 ? 3.731   -1.055  -46.876 1.00 53.13  ? 524 VAL B O   1 
ATOM   1257 C CB  . VAL A 1 175 ? 6.006   -0.084  -44.628 1.00 51.75  ? 524 VAL B CB  1 
ATOM   1258 C CG1 . VAL A 1 175 ? 5.340   -1.346  -44.093 1.00 52.08  ? 524 VAL B CG1 1 
ATOM   1259 C CG2 . VAL A 1 175 ? 7.483   -0.200  -44.465 1.00 51.71  ? 524 VAL B CG2 1 
ATOM   1260 N N   . GLU A 1 176 ? 3.450   1.012   -45.995 1.00 48.66  ? 525 GLU B N   1 
ATOM   1261 C CA  . GLU A 1 176 ? 2.025   1.015   -46.286 1.00 50.38  ? 525 GLU B CA  1 
ATOM   1262 C C   . GLU A 1 176 ? 1.740   0.812   -47.755 1.00 52.22  ? 525 GLU B C   1 
ATOM   1263 O O   . GLU A 1 176 ? 0.827   0.054   -48.115 1.00 51.21  ? 525 GLU B O   1 
ATOM   1264 C CB  . GLU A 1 176 ? 1.369   2.290   -45.791 1.00 58.43  ? 525 GLU B CB  1 
ATOM   1265 C CG  . GLU A 1 176 ? -0.102  2.447   -46.145 1.00 72.33  ? 525 GLU B CG  1 
ATOM   1266 C CD  . GLU A 1 176 ? -0.694  3.778   -45.664 1.00 87.42  ? 525 GLU B CD  1 
ATOM   1267 O OE1 . GLU A 1 176 ? -0.007  4.826   -45.803 1.00 82.78  ? 525 GLU B OE1 1 
ATOM   1268 O OE2 . GLU A 1 176 ? -1.857  3.776   -45.183 1.00 92.64  ? 525 GLU B OE2 1 
ATOM   1269 N N   . GLU A 1 177 ? 2.501   1.471   -48.616 1.00 55.39  ? 526 GLU B N   1 
ATOM   1270 C CA  . GLU A 1 177 ? 2.250   1.349   -50.062 1.00 58.15  ? 526 GLU B CA  1 
ATOM   1271 C C   . GLU A 1 177 ? 2.401   -0.116  -50.486 1.00 55.51  ? 526 GLU B C   1 
ATOM   1272 O O   . GLU A 1 177 ? 1.596   -0.621  -51.274 1.00 55.16  ? 526 GLU B O   1 
ATOM   1273 C CB  . GLU A 1 177 ? 3.202   2.266   -50.892 1.00 67.24  ? 526 GLU B CB  1 
ATOM   1274 C CG  . GLU A 1 177 ? 2.796   3.748   -51.020 1.00 74.59  ? 526 GLU B CG  1 
ATOM   1275 C CD  . GLU A 1 177 ? 3.958   4.657   -51.474 1.00 74.29  ? 526 GLU B CD  1 
ATOM   1276 O OE1 . GLU A 1 177 ? 4.883   4.139   -52.147 1.00 60.33  ? 526 GLU B OE1 1 
ATOM   1277 O OE2 . GLU A 1 177 ? 3.967   5.871   -51.146 1.00 70.11  ? 526 GLU B OE2 1 
ATOM   1278 N N   . LEU A 1 178 ? 3.441   -0.785  -49.971 1.00 47.59  ? 527 LEU B N   1 
ATOM   1279 C CA  . LEU A 1 178 ? 3.681   -2.155  -50.324 1.00 47.16  ? 527 LEU B CA  1 
ATOM   1280 C C   . LEU A 1 178 ? 2.572   -3.038  -49.715 1.00 49.29  ? 527 LEU B C   1 
ATOM   1281 O O   . LEU A 1 178 ? 2.011   -3.905  -50.400 1.00 48.73  ? 527 LEU B O   1 
ATOM   1282 C CB  . LEU A 1 178 ? 5.065   -2.579  -49.862 1.00 45.01  ? 527 LEU B CB  1 
ATOM   1283 C CG  . LEU A 1 178 ? 5.435   -3.986  -50.276 1.00 49.00  ? 527 LEU B CG  1 
ATOM   1284 C CD1 . LEU A 1 178 ? 5.309   -4.179  -51.772 1.00 53.48  ? 527 LEU B CD1 1 
ATOM   1285 C CD2 . LEU A 1 178 ? 6.870   -4.251  -49.867 1.00 51.39  ? 527 LEU B CD2 1 
ATOM   1286 N N   . GLN A 1 179 ? 2.207   -2.779  -48.461 1.00 49.24  ? 528 GLN B N   1 
ATOM   1287 C CA  . GLN A 1 179 ? 1.063   -3.458  -47.871 1.00 51.48  ? 528 GLN B CA  1 
ATOM   1288 C C   . GLN A 1 179 ? -0.181  -3.334  -48.740 1.00 54.40  ? 528 GLN B C   1 
ATOM   1289 O O   . GLN A 1 179 ? -0.843  -4.314  -49.006 1.00 51.49  ? 528 GLN B O   1 
ATOM   1290 C CB  . GLN A 1 179 ? 0.753   -2.898  -46.485 1.00 65.75  ? 528 GLN B CB  1 
ATOM   1291 C CG  . GLN A 1 179 ? -0.359  -3.676  -45.788 1.00 66.30  ? 528 GLN B CG  1 
ATOM   1292 C CD  . GLN A 1 179 ? -0.457  -3.386  -44.314 1.00 63.66  ? 528 GLN B CD  1 
ATOM   1293 O OE1 . GLN A 1 179 ? -0.679  -2.265  -43.934 1.00 62.62  ? 528 GLN B OE1 1 
ATOM   1294 N NE2 . GLN A 1 179 ? -0.289  -4.417  -43.477 1.00 72.22  ? 528 GLN B NE2 1 
ATOM   1295 N N   . ASN A 1 180 ? -0.487  -2.125  -49.214 1.00 58.92  ? 529 ASN B N   1 
ATOM   1296 C CA  . ASN A 1 180 ? -1.683  -1.918  -50.056 1.00 56.16  ? 529 ASN B CA  1 
ATOM   1297 C C   . ASN A 1 180 ? -1.629  -2.736  -51.306 1.00 55.06  ? 529 ASN B C   1 
ATOM   1298 O O   . ASN A 1 180 ? -2.612  -3.373  -51.669 1.00 54.83  ? 529 ASN B O   1 
ATOM   1299 C CB  . ASN A 1 180 ? -1.897  -0.462  -50.423 1.00 60.09  ? 529 ASN B CB  1 
ATOM   1300 C CG  . ASN A 1 180 ? -2.362  0.352   -49.242 1.00 68.22  ? 529 ASN B CG  1 
ATOM   1301 O OD1 . ASN A 1 180 ? -2.692  -0.200  -48.176 1.00 62.58  ? 529 ASN B OD1 1 
ATOM   1302 N ND2 . ASN A 1 180 ? -2.376  1.676   -49.401 1.00 72.93  ? 529 ASN B ND2 1 
ATOM   1303 N N   . ARG A 1 181 ? -0.485  -2.757  -51.975 1.00 56.81  ? 530 ARG B N   1 
ATOM   1304 C CA  . ARG A 1 181 ? -0.377  -3.600  -53.194 1.00 57.87  ? 530 ARG B CA  1 
ATOM   1305 C C   . ARG A 1 181 ? -0.689  -5.069  -52.893 1.00 56.03  ? 530 ARG B C   1 
ATOM   1306 O O   . ARG A 1 181 ? -1.351  -5.742  -53.696 1.00 55.68  ? 530 ARG B O   1 
ATOM   1307 C CB  . ARG A 1 181 ? 1.003   -3.515  -53.806 1.00 59.67  ? 530 ARG B CB  1 
ATOM   1308 C CG  . ARG A 1 181 ? 1.328   -2.156  -54.351 1.00 68.91  ? 530 ARG B CG  1 
ATOM   1309 C CD  . ARG A 1 181 ? 2.786   -2.108  -54.820 1.00 82.09  ? 530 ARG B CD  1 
ATOM   1310 N NE  . ARG A 1 181 ? 3.330   -0.786  -54.452 1.00 84.81  ? 530 ARG B NE  1 
ATOM   1311 C CZ  . ARG A 1 181 ? 4.601   -0.554  -54.148 1.00 82.97  ? 530 ARG B CZ  1 
ATOM   1312 N NH1 . ARG A 1 181 ? 4.995   0.678   -53.772 1.00 98.50  ? 530 ARG B NH1 1 
ATOM   1313 N NH2 . ARG A 1 181 ? 5.490   -1.539  -54.230 1.00 68.37  ? 530 ARG B NH2 1 
ATOM   1314 N N   . ILE A 1 182 ? -0.187  -5.580  -51.761 1.00 51.51  ? 531 ILE B N   1 
ATOM   1315 C CA  . ILE A 1 182 ? -0.359  -6.989  -51.486 1.00 51.84  ? 531 ILE B CA  1 
ATOM   1316 C C   . ILE A 1 182 ? -1.809  -7.247  -51.084 1.00 57.06  ? 531 ILE B C   1 
ATOM   1317 O O   . ILE A 1 182 ? -2.415  -8.247  -51.492 1.00 57.74  ? 531 ILE B O   1 
ATOM   1318 C CB  . ILE A 1 182 ? 0.610   -7.456  -50.412 1.00 53.49  ? 531 ILE B CB  1 
ATOM   1319 C CG1 . ILE A 1 182 ? 2.031   -7.359  -50.943 1.00 51.89  ? 531 ILE B CG1 1 
ATOM   1320 C CG2 . ILE A 1 182 ? 0.321   -8.890  -50.025 1.00 55.78  ? 531 ILE B CG2 1 
ATOM   1321 C CD1 . ILE A 1 182 ? 3.045   -7.311  -49.831 1.00 48.86  ? 531 ILE B CD1 1 
ATOM   1322 N N   . ALA A 1 183 ? -2.380  -6.324  -50.322 1.00 59.42  ? 532 ALA B N   1 
ATOM   1323 C CA  . ALA A 1 183 ? -3.808  -6.377  -49.967 1.00 67.19  ? 532 ALA B CA  1 
ATOM   1324 C C   . ALA A 1 183 ? -4.712  -6.407  -51.215 1.00 68.83  ? 532 ALA B C   1 
ATOM   1325 O O   . ALA A 1 183 ? -5.626  -7.236  -51.319 1.00 62.58  ? 532 ALA B O   1 
ATOM   1326 C CB  . ALA A 1 183 ? -4.178  -5.210  -49.058 1.00 68.71  ? 532 ALA B CB  1 
ATOM   1327 N N   . SER A 1 184 ? -4.418  -5.551  -52.190 1.00 63.65  ? 533 SER B N   1 
ATOM   1328 C CA  . SER A 1 184 ? -5.194  -5.523  -53.430 1.00 64.45  ? 533 SER B CA  1 
ATOM   1329 C C   . SER A 1 184 ? -5.061  -6.834  -54.183 1.00 62.16  ? 533 SER B C   1 
ATOM   1330 O O   . SER A 1 184 ? -6.046  -7.368  -54.680 1.00 56.83  ? 533 SER B O   1 
ATOM   1331 C CB  . SER A 1 184 ? -4.766  -4.358  -54.328 1.00 70.65  ? 533 SER B CB  1 
ATOM   1332 O OG  . SER A 1 184 ? -5.081  -3.109  -53.702 1.00 72.43  ? 533 SER B OG  1 
ATOM   1333 N N   . CYS A 1 185 ? -3.834  -7.335  -54.264 1.00 59.35  ? 534 CYS B N   1 
ATOM   1334 C CA  . CYS A 1 185 ? -3.566  -8.608  -54.897 1.00 57.83  ? 534 CYS B CA  1 
ATOM   1335 C C   . CYS A 1 185 ? -4.405  -9.693  -54.233 1.00 60.96  ? 534 CYS B C   1 
ATOM   1336 O O   . CYS A 1 185 ? -5.054  -10.484 -54.902 1.00 53.91  ? 534 CYS B O   1 
ATOM   1337 C CB  . CYS A 1 185 ? -2.088  -8.910  -54.745 1.00 69.27  ? 534 CYS B CB  1 
ATOM   1338 S SG  . CYS A 1 185 ? -1.538  -10.350 -55.621 1.00 73.58  ? 534 CYS B SG  1 
ATOM   1339 N N   . LEU A 1 186 ? -4.431  -9.710  -52.904 1.00 64.08  ? 535 LEU B N   1 
ATOM   1340 C CA  . LEU A 1 186 ? -5.239  -10.703 -52.195 1.00 63.52  ? 535 LEU B CA  1 
ATOM   1341 C C   . LEU A 1 186 ? -6.752  -10.534 -52.496 1.00 67.80  ? 535 LEU B C   1 
ATOM   1342 O O   . LEU A 1 186 ? -7.395  -11.490 -52.901 1.00 69.15  ? 535 LEU B O   1 
ATOM   1343 C CB  . LEU A 1 186 ? -4.965  -10.654 -50.691 1.00 57.56  ? 535 LEU B CB  1 
ATOM   1344 C CG  . LEU A 1 186 ? -5.827  -11.554 -49.802 1.00 60.02  ? 535 LEU B CG  1 
ATOM   1345 C CD1 . LEU A 1 186 ? -5.571  -13.008 -50.115 1.00 60.50  ? 535 LEU B CD1 1 
ATOM   1346 C CD2 . LEU A 1 186 ? -5.635  -11.292 -48.306 1.00 65.26  ? 535 LEU B CD2 1 
ATOM   1347 N N   . LYS A 1 187 ? -7.290  -9.327  -52.286 1.00 70.66  ? 536 LYS B N   1 
ATOM   1348 C CA  . LYS A 1 187 ? -8.706  -8.991  -52.526 1.00 71.45  ? 536 LYS B CA  1 
ATOM   1349 C C   . LYS A 1 187 ? -9.166  -9.498  -53.885 1.00 75.72  ? 536 LYS B C   1 
ATOM   1350 O O   . LYS A 1 187 ? -10.165 -10.218 -53.985 1.00 63.80  ? 536 LYS B O   1 
ATOM   1351 C CB  . LYS A 1 187 ? -8.908  -7.471  -52.487 1.00 82.70  ? 536 LYS B CB  1 
ATOM   1352 C CG  . LYS A 1 187 ? -10.369 -6.991  -52.566 1.00 96.62  ? 536 LYS B CG  1 
ATOM   1353 C CD  . LYS A 1 187 ? -10.438 -5.496  -52.965 1.00 97.55  ? 536 LYS B CD  1 
ATOM   1354 C CE  . LYS A 1 187 ? -10.729 -4.553  -51.812 1.00 101.58 ? 536 LYS B CE  1 
ATOM   1355 N NZ  . LYS A 1 187 ? -12.154 -4.134  -51.771 1.00 98.52  ? 536 LYS B NZ  1 
ATOM   1356 N N   . GLU A 1 188 ? -8.404  -9.132  -54.918 1.00 77.17  ? 537 GLU B N   1 
ATOM   1357 C CA  . GLU A 1 188 ? -8.663  -9.553  -56.288 1.00 85.07  ? 537 GLU B CA  1 
ATOM   1358 C C   . GLU A 1 188 ? -8.668  -11.077 -56.415 1.00 83.57  ? 537 GLU B C   1 
ATOM   1359 O O   . GLU A 1 188 ? -9.589  -11.623 -57.005 1.00 87.61  ? 537 GLU B O   1 
ATOM   1360 C CB  . GLU A 1 188 ? -7.636  -8.947  -57.260 1.00 93.38  ? 537 GLU B CB  1 
ATOM   1361 C CG  . GLU A 1 188 ? -7.840  -9.366  -58.722 1.00 113.72 ? 537 GLU B CG  1 
ATOM   1362 C CD  . GLU A 1 188 ? -6.978  -8.587  -59.711 1.00 122.41 ? 537 GLU B CD  1 
ATOM   1363 O OE1 . GLU A 1 188 ? -6.293  -9.221  -60.544 1.00 116.04 ? 537 GLU B OE1 1 
ATOM   1364 O OE2 . GLU A 1 188 ? -6.974  -7.338  -59.657 1.00 125.31 ? 537 GLU B OE2 1 
ATOM   1365 N N   . HIS A 1 189 ? -7.641  -11.754 -55.901 1.00 82.39  ? 538 HIS B N   1 
ATOM   1366 C CA  . HIS A 1 189 ? -7.612  -13.223 -55.924 1.00 75.82  ? 538 HIS B CA  1 
ATOM   1367 C C   . HIS A 1 189 ? -8.812  -13.865 -55.157 1.00 82.74  ? 538 HIS B C   1 
ATOM   1368 O O   . HIS A 1 189 ? -9.390  -14.860 -55.584 1.00 78.27  ? 538 HIS B O   1 
ATOM   1369 C CB  . HIS A 1 189 ? -6.292  -13.766 -55.393 1.00 69.42  ? 538 HIS B CB  1 
ATOM   1370 C CG  . HIS A 1 189 ? -6.309  -15.247 -55.222 1.00 67.79  ? 538 HIS B CG  1 
ATOM   1371 N ND1 . HIS A 1 189 ? -6.094  -16.122 -56.264 1.00 72.22  ? 538 HIS B ND1 1 
ATOM   1372 C CD2 . HIS A 1 189 ? -6.591  -16.009 -54.142 1.00 69.64  ? 538 HIS B CD2 1 
ATOM   1373 C CE1 . HIS A 1 189 ? -6.219  -17.364 -55.825 1.00 80.09  ? 538 HIS B CE1 1 
ATOM   1374 N NE2 . HIS A 1 189 ? -6.515  -17.321 -54.539 1.00 79.31  ? 538 HIS B NE2 1 
ATOM   1375 N N   . VAL A 1 190 ? -9.208  -13.291 -54.038 1.00 91.21  ? 539 VAL B N   1 
ATOM   1376 C CA  . VAL A 1 190 ? -10.311 -13.860 -53.282 1.00 92.85  ? 539 VAL B CA  1 
ATOM   1377 C C   . VAL A 1 190 ? -11.662 -13.630 -53.981 1.00 97.32  ? 539 VAL B C   1 
ATOM   1378 O O   . VAL A 1 190 ? -12.628 -14.333 -53.699 1.00 95.06  ? 539 VAL B O   1 
ATOM   1379 C CB  . VAL A 1 190 ? -10.255 -13.353 -51.827 1.00 94.35  ? 539 VAL B CB  1 
ATOM   1380 C CG1 . VAL A 1 190 ? -11.586 -13.512 -51.093 1.00 107.87 ? 539 VAL B CG1 1 
ATOM   1381 C CG2 . VAL A 1 190 ? -9.138  -14.086 -51.103 1.00 93.02  ? 539 VAL B CG2 1 
ATOM   1382 N N   . ALA A 1 191 ? -11.722 -12.681 -54.910 1.00 100.28 ? 540 ALA B N   1 
ATOM   1383 C CA  . ALA A 1 191 ? -12.870 -12.561 -55.816 1.00 105.30 ? 540 ALA B CA  1 
ATOM   1384 C C   . ALA A 1 191 ? -12.780 -13.507 -57.039 1.00 107.98 ? 540 ALA B C   1 
ATOM   1385 O O   . ALA A 1 191 ? -13.683 -14.311 -57.255 1.00 124.32 ? 540 ALA B O   1 
ATOM   1386 C CB  . ALA A 1 191 ? -13.041 -11.120 -56.278 1.00 102.73 ? 540 ALA B CB  1 
ATOM   1387 N N   . ALA A 1 192 ? -11.693 -13.427 -57.811 1.00 105.59 ? 541 ALA B N   1 
ATOM   1388 C CA  . ALA A 1 192 ? -11.569 -14.149 -59.092 1.00 101.16 ? 541 ALA B CA  1 
ATOM   1389 C C   . ALA A 1 192 ? -11.734 -15.656 -58.952 1.00 112.00 ? 541 ALA B C   1 
ATOM   1390 O O   . ALA A 1 192 ? -11.818 -16.342 -59.969 1.00 102.70 ? 541 ALA B O   1 
ATOM   1391 C CB  . ALA A 1 192 ? -10.232 -13.845 -59.772 1.00 95.18  ? 541 ALA B CB  1 
ATOM   1392 N N   . VAL A 1 193 ? -11.719 -16.169 -57.717 1.00 121.77 ? 542 VAL B N   1 
ATOM   1393 C CA  . VAL A 1 193 ? -11.944 -17.591 -57.456 1.00 132.91 ? 542 VAL B CA  1 
ATOM   1394 C C   . VAL A 1 193 ? -13.244 -17.948 -56.702 1.00 133.88 ? 542 VAL B C   1 
ATOM   1395 O O   . VAL A 1 193 ? -13.715 -19.082 -56.794 1.00 119.98 ? 542 VAL B O   1 
ATOM   1396 C CB  . VAL A 1 193 ? -10.698 -18.182 -56.753 1.00 128.48 ? 542 VAL B CB  1 
ATOM   1397 C CG1 . VAL A 1 193 ? -10.866 -19.674 -56.479 1.00 123.81 ? 542 VAL B CG1 1 
ATOM   1398 C CG2 . VAL A 1 193 ? -9.465  -17.927 -57.620 1.00 124.70 ? 542 VAL B CG2 1 
ATOM   1399 N N   . ALA A 1 194 ? -13.815 -17.000 -55.965 1.00 142.36 ? 543 ALA B N   1 
ATOM   1400 C CA  . ALA A 1 194 ? -15.153 -17.175 -55.365 1.00 146.05 ? 543 ALA B CA  1 
ATOM   1401 C C   . ALA A 1 194 ? -16.301 -16.735 -56.316 1.00 152.14 ? 543 ALA B C   1 
ATOM   1402 O O   . ALA A 1 194 ? -17.475 -16.993 -56.033 1.00 145.67 ? 543 ALA B O   1 
ATOM   1403 C CB  . ALA A 1 194 ? -15.227 -16.432 -54.020 1.00 133.73 ? 543 ALA B CB  1 
ATOM   1404 N N   . GLY A 1 195 ? -15.974 -16.116 -57.453 1.00 157.21 ? 544 GLY B N   1 
ATOM   1405 C CA  . GLY A 1 195 ? -17.009 -15.468 -58.268 1.00 154.64 ? 544 GLY B CA  1 
ATOM   1406 C C   . GLY A 1 195 ? -17.414 -14.210 -57.526 1.00 160.36 ? 544 GLY B C   1 
ATOM   1407 O O   . GLY A 1 195 ? -18.087 -14.289 -56.502 1.00 141.33 ? 544 GLY B O   1 
ATOM   1408 N N   . GLU A 1 196 ? -16.965 -13.057 -58.028 1.00 168.26 ? 545 GLU B N   1 
ATOM   1409 C CA  . GLU A 1 196 ? -17.241 -11.734 -57.423 1.00 172.93 ? 545 GLU B CA  1 
ATOM   1410 C C   . GLU A 1 196 ? -18.765 -11.502 -57.225 1.00 185.99 ? 545 GLU B C   1 
ATOM   1411 O O   . GLU A 1 196 ? -19.563 -12.389 -57.552 1.00 190.67 ? 545 GLU B O   1 
ATOM   1412 C CB  . GLU A 1 196 ? -16.595 -10.632 -58.281 1.00 156.01 ? 545 GLU B CB  1 
ATOM   1413 N N   . PRO A 1 197 ? -19.186 -10.315 -56.715 1.00 181.30 ? 546 PRO B N   1 
ATOM   1414 C CA  . PRO A 1 197 ? -18.435 -9.063  -56.533 1.00 171.15 ? 546 PRO B CA  1 
ATOM   1415 C C   . PRO A 1 197 ? -17.150 -9.250  -55.728 1.00 162.10 ? 546 PRO B C   1 
ATOM   1416 O O   . PRO A 1 197 ? -16.858 -8.475  -54.824 1.00 148.26 ? 546 PRO B O   1 
ATOM   1417 C CB  . PRO A 1 197 ? -19.437 -8.158  -55.794 1.00 169.21 ? 546 PRO B CB  1 
ATOM   1418 C CG  . PRO A 1 197 ? -20.362 -9.098  -55.100 1.00 164.93 ? 546 PRO B CG  1 
ATOM   1419 C CD  . PRO A 1 197 ? -20.513 -10.237 -56.064 1.00 166.71 ? 546 PRO B CD  1 
ATOM   1420 N N   . ALA A 1 200 ? -15.619 -10.219 -49.271 1.00 113.57 ? 549 ALA B N   1 
ATOM   1421 C CA  . ALA A 1 200 ? -15.980 -9.412  -48.111 1.00 125.58 ? 549 ALA B CA  1 
ATOM   1422 C C   . ALA A 1 200 ? -16.103 -10.304 -46.882 1.00 130.27 ? 549 ALA B C   1 
ATOM   1423 O O   . ALA A 1 200 ? -15.625 -9.963  -45.803 1.00 122.47 ? 549 ALA B O   1 
ATOM   1424 C CB  . ALA A 1 200 ? -17.291 -8.678  -48.362 1.00 123.67 ? 549 ALA B CB  1 
ATOM   1425 N N   . SER A 1 201 ? -16.765 -11.441 -47.061 1.00 129.61 ? 550 SER B N   1 
ATOM   1426 C CA  . SER A 1 201 ? -16.925 -12.415 -46.004 1.00 120.64 ? 550 SER B CA  1 
ATOM   1427 C C   . SER A 1 201 ? -15.643 -13.226 -45.889 1.00 108.64 ? 550 SER B C   1 
ATOM   1428 O O   . SER A 1 201 ? -14.974 -13.169 -44.858 1.00 119.76 ? 550 SER B O   1 
ATOM   1429 C CB  . SER A 1 201 ? -18.110 -13.326 -46.311 1.00 121.09 ? 550 SER B CB  1 
ATOM   1430 O OG  . SER A 1 201 ? -18.052 -14.503 -45.529 1.00 119.70 ? 550 SER B OG  1 
ATOM   1431 N N   . CYS A 1 202 ? -15.294 -13.977 -46.938 1.00 94.75  ? 551 CYS B N   1 
ATOM   1432 C CA  . CYS A 1 202 ? -14.056 -14.780 -46.918 1.00 94.36  ? 551 CYS B CA  1 
ATOM   1433 C C   . CYS A 1 202 ? -12.893 -13.892 -46.497 1.00 92.20  ? 551 CYS B C   1 
ATOM   1434 O O   . CYS A 1 202 ? -12.110 -14.246 -45.604 1.00 88.85  ? 551 CYS B O   1 
ATOM   1435 C CB  . CYS A 1 202 ? -13.760 -15.421 -48.291 1.00 98.25  ? 551 CYS B CB  1 
ATOM   1436 S SG  . CYS A 1 202 ? -12.137 -16.231 -48.450 1.00 101.79 ? 551 CYS B SG  1 
ATOM   1437 N N   . LEU A 1 203 ? -12.820 -12.716 -47.123 1.00 82.96  ? 552 LEU B N   1 
ATOM   1438 C CA  . LEU A 1 203 ? -11.700 -11.821 -46.935 1.00 80.29  ? 552 LEU B CA  1 
ATOM   1439 C C   . LEU A 1 203 ? -11.600 -11.330 -45.493 1.00 85.28  ? 552 LEU B C   1 
ATOM   1440 O O   . LEU A 1 203 ? -10.535 -11.413 -44.876 1.00 79.70  ? 552 LEU B O   1 
ATOM   1441 C CB  . LEU A 1 203 ? -11.796 -10.639 -47.894 1.00 82.21  ? 552 LEU B CB  1 
ATOM   1442 C CG  . LEU A 1 203 ? -10.599 -9.685  -47.849 1.00 88.91  ? 552 LEU B CG  1 
ATOM   1443 C CD1 . LEU A 1 203 ? -9.289  -10.361 -48.243 1.00 94.15  ? 552 LEU B CD1 1 
ATOM   1444 C CD2 . LEU A 1 203 ? -10.853 -8.466  -48.721 1.00 95.88  ? 552 LEU B CD2 1 
ATOM   1445 N N   . SER A 1 204 ? -12.705 -10.829 -44.951 1.00 89.72  ? 553 SER B N   1 
ATOM   1446 C CA  . SER A 1 204 ? -12.713 -10.368 -43.565 1.00 86.11  ? 553 SER B CA  1 
ATOM   1447 C C   . SER A 1 204 ? -12.531 -11.553 -42.587 1.00 76.49  ? 553 SER B C   1 
ATOM   1448 O O   . SER A 1 204 ? -12.004 -11.361 -41.500 1.00 76.85  ? 553 SER B O   1 
ATOM   1449 C CB  . SER A 1 204 ? -13.962 -9.521  -43.253 1.00 79.69  ? 553 SER B CB  1 
ATOM   1450 O OG  . SER A 1 204 ? -15.127 -10.115 -43.783 1.00 99.71  ? 553 SER B OG  1 
ATOM   1451 N N   . ARG A 1 205 ? -12.900 -12.773 -42.981 1.00 75.38  ? 554 ARG B N   1 
ATOM   1452 C CA  . ARG A 1 205 ? -12.622 -13.962 -42.142 1.00 78.60  ? 554 ARG B CA  1 
ATOM   1453 C C   . ARG A 1 205 ? -11.128 -14.294 -42.179 1.00 74.17  ? 554 ARG B C   1 
ATOM   1454 O O   . ARG A 1 205 ? -10.545 -14.622 -41.171 1.00 74.51  ? 554 ARG B O   1 
ATOM   1455 C CB  . ARG A 1 205 ? -13.466 -15.186 -42.543 1.00 86.93  ? 554 ARG B CB  1 
ATOM   1456 C CG  . ARG A 1 205 ? -14.740 -15.346 -41.707 1.00 100.25 ? 554 ARG B CG  1 
ATOM   1457 C CD  . ARG A 1 205 ? -15.517 -16.638 -41.975 1.00 105.55 ? 554 ARG B CD  1 
ATOM   1458 N NE  . ARG A 1 205 ? -16.297 -16.583 -43.217 1.00 122.74 ? 554 ARG B NE  1 
ATOM   1459 C CZ  . ARG A 1 205 ? -16.164 -17.421 -44.255 1.00 127.32 ? 554 ARG B CZ  1 
ATOM   1460 N NH1 . ARG A 1 205 ? -15.295 -18.435 -44.219 1.00 119.21 ? 554 ARG B NH1 1 
ATOM   1461 N NH2 . ARG A 1 205 ? -16.924 -17.256 -45.345 1.00 120.09 ? 554 ARG B NH2 1 
ATOM   1462 N N   . LEU A 1 206 ? -10.517 -14.167 -43.347 1.00 73.20  ? 555 LEU B N   1 
ATOM   1463 C CA  . LEU A 1 206 ? -9.077  -14.299 -43.491 1.00 75.50  ? 555 LEU B CA  1 
ATOM   1464 C C   . LEU A 1 206 ? -8.256  -13.258 -42.724 1.00 71.75  ? 555 LEU B C   1 
ATOM   1465 O O   . LEU A 1 206 ? -7.347  -13.586 -41.974 1.00 64.33  ? 555 LEU B O   1 
ATOM   1466 C CB  . LEU A 1 206 ? -8.720  -14.183 -44.971 1.00 82.25  ? 555 LEU B CB  1 
ATOM   1467 C CG  . LEU A 1 206 ? -8.213  -15.473 -45.587 1.00 87.13  ? 555 LEU B CG  1 
ATOM   1468 C CD1 . LEU A 1 206 ? -8.182  -15.298 -47.095 1.00 88.35  ? 555 LEU B CD1 1 
ATOM   1469 C CD2 . LEU A 1 206 ? -6.848  -15.840 -44.998 1.00 84.51  ? 555 LEU B CD2 1 
ATOM   1470 N N   . LEU A 1 207 ? -8.577  -11.994 -42.928 1.00 67.26  ? 556 LEU B N   1 
ATOM   1471 C CA  . LEU A 1 207 ? -7.907  -10.922 -42.215 1.00 62.84  ? 556 LEU B CA  1 
ATOM   1472 C C   . LEU A 1 207 ? -8.137  -11.011 -40.732 1.00 60.53  ? 556 LEU B C   1 
ATOM   1473 O O   . LEU A 1 207 ? -7.294  -10.578 -39.965 1.00 64.02  ? 556 LEU B O   1 
ATOM   1474 C CB  . LEU A 1 207 ? -8.389  -9.566  -42.700 1.00 70.68  ? 556 LEU B CB  1 
ATOM   1475 C CG  . LEU A 1 207 ? -7.687  -9.000  -43.932 1.00 73.32  ? 556 LEU B CG  1 
ATOM   1476 C CD1 . LEU A 1 207 ? -7.023  -10.050 -44.793 1.00 68.79  ? 556 LEU B CD1 1 
ATOM   1477 C CD2 . LEU A 1 207 ? -8.671  -8.176  -44.749 1.00 76.22  ? 556 LEU B CD2 1 
ATOM   1478 N N   . GLY A 1 208 ? -9.257  -11.593 -40.313 1.00 62.14  ? 557 GLY B N   1 
ATOM   1479 C CA  . GLY A 1 208 ? -9.501  -11.851 -38.892 1.00 63.26  ? 557 GLY B CA  1 
ATOM   1480 C C   . GLY A 1 208 ? -8.482  -12.786 -38.238 1.00 67.50  ? 557 GLY B C   1 
ATOM   1481 O O   . GLY A 1 208 ? -8.438  -12.883 -36.989 1.00 66.41  ? 557 GLY B O   1 
ATOM   1482 N N   . LYS A 1 209 ? -7.696  -13.493 -39.054 1.00 54.37  ? 558 LYS B N   1 
ATOM   1483 C CA  . LYS A 1 209 ? -6.627  -14.315 -38.503 1.00 68.22  ? 558 LYS B CA  1 
ATOM   1484 C C   . LYS A 1 209 ? -5.416  -13.531 -38.052 1.00 65.13  ? 558 LYS B C   1 
ATOM   1485 O O   . LYS A 1 209 ? -4.616  -14.053 -37.296 1.00 63.47  ? 558 LYS B O   1 
ATOM   1486 C CB  . LYS A 1 209 ? -6.200  -15.404 -39.492 1.00 66.41  ? 558 LYS B CB  1 
ATOM   1487 C CG  . LYS A 1 209 ? -7.315  -16.378 -39.799 1.00 70.30  ? 558 LYS B CG  1 
ATOM   1488 C CD  . LYS A 1 209 ? -7.370  -17.485 -38.755 1.00 75.48  ? 558 LYS B CD  1 
ATOM   1489 C CE  . LYS A 1 209 ? -8.763  -17.850 -38.303 1.00 82.24  ? 558 LYS B CE  1 
ATOM   1490 N NZ  . LYS A 1 209 ? -8.681  -19.085 -37.492 1.00 87.72  ? 558 LYS B NZ  1 
ATOM   1491 N N   . LEU A 1 210 ? -5.234  -12.312 -38.528 1.00 59.01  ? 559 LEU B N   1 
ATOM   1492 C CA  . LEU A 1 210 ? -4.043  -11.567 -38.105 1.00 58.21  ? 559 LEU B CA  1 
ATOM   1493 C C   . LEU A 1 210 ? -4.008  -11.138 -36.616 1.00 63.81  ? 559 LEU B C   1 
ATOM   1494 O O   . LEU A 1 210 ? -2.978  -11.348 -35.957 1.00 67.04  ? 559 LEU B O   1 
ATOM   1495 C CB  . LEU A 1 210 ? -3.745  -10.436 -39.051 1.00 52.99  ? 559 LEU B CB  1 
ATOM   1496 C CG  . LEU A 1 210 ? -3.591  -10.853 -40.528 1.00 57.92  ? 559 LEU B CG  1 
ATOM   1497 C CD1 . LEU A 1 210 ? -3.486  -9.695  -41.523 1.00 64.83  ? 559 LEU B CD1 1 
ATOM   1498 C CD2 . LEU A 1 210 ? -2.347  -11.719 -40.657 1.00 61.84  ? 559 LEU B CD2 1 
ATOM   1499 N N   . PRO A 1 211 ? -5.131  -10.595 -36.071 1.00 65.54  ? 560 PRO B N   1 
ATOM   1500 C CA  . PRO A 1 211 ? -5.106  -10.259 -34.636 1.00 58.99  ? 560 PRO B CA  1 
ATOM   1501 C C   . PRO A 1 211 ? -4.942  -11.471 -33.801 1.00 53.03  ? 560 PRO B C   1 
ATOM   1502 O O   . PRO A 1 211 ? -4.280  -11.398 -32.770 1.00 59.20  ? 560 PRO B O   1 
ATOM   1503 C CB  . PRO A 1 211 ? -6.475  -9.581  -34.360 1.00 61.05  ? 560 PRO B CB  1 
ATOM   1504 C CG  . PRO A 1 211 ? -7.157  -9.412  -35.703 1.00 60.56  ? 560 PRO B CG  1 
ATOM   1505 C CD  . PRO A 1 211 ? -6.310  -10.030 -36.779 1.00 63.31  ? 560 PRO B CD  1 
ATOM   1506 N N   . GLU A 1 212 ? -5.534  -12.599 -34.198 1.00 60.97  ? 561 GLU B N   1 
ATOM   1507 C CA  . GLU A 1 212 ? -5.352  -13.838 -33.375 1.00 67.05  ? 561 GLU B CA  1 
ATOM   1508 C C   . GLU A 1 212 ? -3.864  -14.241 -33.359 1.00 57.32  ? 561 GLU B C   1 
ATOM   1509 O O   . GLU A 1 212 ? -3.332  -14.684 -32.343 1.00 56.00  ? 561 GLU B O   1 
ATOM   1510 C CB  . GLU A 1 212 ? -6.225  -15.027 -33.805 1.00 68.33  ? 561 GLU B CB  1 
ATOM   1511 C CG  . GLU A 1 212 ? -7.640  -14.710 -34.268 1.00 79.73  ? 561 GLU B CG  1 
ATOM   1512 C CD  . GLU A 1 212 ? -8.461  -15.977 -34.557 1.00 87.76  ? 561 GLU B CD  1 
ATOM   1513 O OE1 . GLU A 1 212 ? -9.716  -15.938 -34.390 1.00 82.73  ? 561 GLU B OE1 1 
ATOM   1514 O OE2 . GLU A 1 212 ? -7.839  -17.004 -34.946 1.00 74.53  ? 561 GLU B OE2 1 
ATOM   1515 N N   . LEU A 1 213 ? -3.193  -14.049 -34.491 1.00 56.63  ? 562 LEU B N   1 
ATOM   1516 C CA  . LEU A 1 213 ? -1.777  -14.381 -34.626 1.00 50.57  ? 562 LEU B CA  1 
ATOM   1517 C C   . LEU A 1 213 ? -0.894  -13.526 -33.696 1.00 52.55  ? 562 LEU B C   1 
ATOM   1518 O O   . LEU A 1 213 ? 0.024   -14.040 -33.039 1.00 42.40  ? 562 LEU B O   1 
ATOM   1519 C CB  . LEU A 1 213 ? -1.388  -14.185 -36.071 1.00 51.08  ? 562 LEU B CB  1 
ATOM   1520 C CG  . LEU A 1 213 ? -0.077  -14.812 -36.523 1.00 54.60  ? 562 LEU B CG  1 
ATOM   1521 C CD1 . LEU A 1 213 ? 0.046   -16.313 -36.238 1.00 58.12  ? 562 LEU B CD1 1 
ATOM   1522 C CD2 . LEU A 1 213 ? -0.019  -14.538 -37.997 1.00 58.44  ? 562 LEU B CD2 1 
ATOM   1523 N N   . ARG A 1 214 ? -1.230  -12.242 -33.570 1.00 51.66  ? 563 ARG B N   1 
ATOM   1524 C CA  . ARG A 1 214 ? -0.561  -11.381 -32.573 1.00 59.05  ? 563 ARG B CA  1 
ATOM   1525 C C   . ARG A 1 214 ? -0.723  -11.913 -31.162 1.00 54.01  ? 563 ARG B C   1 
ATOM   1526 O O   . ARG A 1 214 ? 0.237   -11.983 -30.397 1.00 51.48  ? 563 ARG B O   1 
ATOM   1527 C CB  . ARG A 1 214 ? -1.115  -9.962  -32.586 1.00 57.59  ? 563 ARG B CB  1 
ATOM   1528 C CG  . ARG A 1 214 ? -0.587  -9.052  -33.684 1.00 59.56  ? 563 ARG B CG  1 
ATOM   1529 C CD  . ARG A 1 214 ? 0.823   -8.527  -33.534 1.00 54.87  ? 563 ARG B CD  1 
ATOM   1530 N NE  . ARG A 1 214 ? 1.182   -7.982  -34.860 1.00 57.65  ? 563 ARG B NE  1 
ATOM   1531 C CZ  . ARG A 1 214 ? 1.023   -6.720  -35.280 1.00 55.86  ? 563 ARG B CZ  1 
ATOM   1532 N NH1 . ARG A 1 214 ? 0.496   -5.767  -34.511 1.00 54.84  ? 563 ARG B NH1 1 
ATOM   1533 N NH2 . ARG A 1 214 ? 1.371   -6.412  -36.519 1.00 53.65  ? 563 ARG B NH2 1 
ATOM   1534 N N   . THR A 1 215 ? -1.946  -12.262 -30.802 1.00 56.00  ? 564 THR B N   1 
ATOM   1535 C CA  . THR A 1 215 ? -2.171  -12.841 -29.499 1.00 52.00  ? 564 THR B CA  1 
ATOM   1536 C C   . THR A 1 215 ? -1.282  -14.070 -29.324 1.00 52.39  ? 564 THR B C   1 
ATOM   1537 O O   . THR A 1 215 ? -0.643  -14.205 -28.291 1.00 52.95  ? 564 THR B O   1 
ATOM   1538 C CB  . THR A 1 215 ? -3.654  -13.211 -29.263 1.00 61.75  ? 564 THR B CB  1 
ATOM   1539 O OG1 . THR A 1 215 ? -4.440  -12.020 -29.092 1.00 56.75  ? 564 THR B OG1 1 
ATOM   1540 C CG2 . THR A 1 215 ? -3.799  -14.095 -28.001 1.00 58.90  ? 564 THR B CG2 1 
ATOM   1541 N N   . LEU A 1 216 ? -1.193  -14.962 -30.314 1.00 56.13  ? 565 LEU B N   1 
ATOM   1542 C CA  . LEU A 1 216 ? -0.238  -16.116 -30.191 1.00 56.33  ? 565 LEU B CA  1 
ATOM   1543 C C   . LEU A 1 216 ? 1.234   -15.708 -30.105 1.00 47.62  ? 565 LEU B C   1 
ATOM   1544 O O   . LEU A 1 216 ? 2.023   -16.390 -29.447 1.00 51.22  ? 565 LEU B O   1 
ATOM   1545 C CB  . LEU A 1 216 ? -0.425  -17.086 -31.351 1.00 56.01  ? 565 LEU B CB  1 
ATOM   1546 C CG  . LEU A 1 216 ? -1.665  -17.980 -31.212 1.00 56.23  ? 565 LEU B CG  1 
ATOM   1547 C CD1 . LEU A 1 216 ? -2.053  -18.498 -32.574 1.00 60.78  ? 565 LEU B CD1 1 
ATOM   1548 C CD2 . LEU A 1 216 ? -1.382  -19.177 -30.323 1.00 55.89  ? 565 LEU B CD2 1 
ATOM   1549 N N   . CYS A 1 217 ? 1.618   -14.636 -30.806 1.00 49.54  ? 566 CYS B N   1 
ATOM   1550 C CA  . CYS A 1 217 ? 3.027   -14.116 -30.735 1.00 56.80  ? 566 CYS B CA  1 
ATOM   1551 C C   . CYS A 1 217 ? 3.339   -13.873 -29.259 1.00 50.94  ? 566 CYS B C   1 
ATOM   1552 O O   . CYS A 1 217 ? 4.382   -14.278 -28.747 1.00 63.80  ? 566 CYS B O   1 
ATOM   1553 C CB  . CYS A 1 217 ? 3.278   -12.804 -31.609 1.00 56.28  ? 566 CYS B CB  1 
ATOM   1554 S SG  . CYS A 1 217 ? 4.908   -11.895 -31.392 1.00 55.43  ? 566 CYS B SG  1 
ATOM   1555 N N   . THR A 1 218 ? 2.404   -13.239 -28.565 1.00 46.82  ? 567 THR B N   1 
ATOM   1556 C CA  . THR A 1 218 ? 2.550   -12.961 -27.129 1.00 48.52  ? 567 THR B CA  1 
ATOM   1557 C C   . THR A 1 218 ? 2.746   -14.145 -26.277 1.00 45.47  ? 567 THR B C   1 
ATOM   1558 O O   . THR A 1 218 ? 3.620   -14.123 -25.396 1.00 47.47  ? 567 THR B O   1 
ATOM   1559 C CB  . THR A 1 218 ? 1.319   -12.196 -26.595 1.00 53.64  ? 567 THR B CB  1 
ATOM   1560 O OG1 . THR A 1 218 ? 1.159   -10.996 -27.361 1.00 49.15  ? 567 THR B OG1 1 
ATOM   1561 C CG2 . THR A 1 218 ? 1.472   -11.848 -25.145 1.00 56.33  ? 567 THR B CG2 1 
ATOM   1562 N N   . GLN A 1 219 ? 1.937   -15.188 -26.476 1.00 49.02  ? 568 GLN B N   1 
ATOM   1563 C CA  . GLN A 1 219 ? 2.177   -16.471 -25.725 1.00 51.86  ? 568 GLN B CA  1 
ATOM   1564 C C   . GLN A 1 219 ? 3.593   -17.042 -25.948 1.00 51.33  ? 568 GLN B C   1 
ATOM   1565 O O   . GLN A 1 219 ? 4.178   -17.659 -25.052 1.00 53.72  ? 568 GLN B O   1 
ATOM   1566 C CB  . GLN A 1 219 ? 1.224   -17.570 -26.113 1.00 56.75  ? 568 GLN B CB  1 
ATOM   1567 C CG  . GLN A 1 219 ? -0.152  -17.433 -25.568 1.00 64.98  ? 568 GLN B CG  1 
ATOM   1568 C CD  . GLN A 1 219 ? -1.040  -18.605 -25.965 1.00 73.98  ? 568 GLN B CD  1 
ATOM   1569 O OE1 . GLN A 1 219 ? -0.791  -19.779 -25.591 1.00 68.20  ? 568 GLN B OE1 1 
ATOM   1570 N NE2 . GLN A 1 219 ? -2.098  -18.288 -26.707 1.00 68.18  ? 568 GLN B NE2 1 
ATOM   1571 N N   . GLY A 1 220 ? 4.130   -16.839 -27.146 1.00 50.17  ? 569 GLY B N   1 
ATOM   1572 C CA  . GLY A 1 220 ? 5.509   -17.222 -27.446 1.00 48.26  ? 569 GLY B CA  1 
ATOM   1573 C C   . GLY A 1 220 ? 6.511   -16.401 -26.690 1.00 43.04  ? 569 GLY B C   1 
ATOM   1574 O O   . GLY A 1 220 ? 7.494   -16.905 -26.171 1.00 45.51  ? 569 GLY B O   1 
ATOM   1575 N N   . LEU A 1 221 ? 6.284   -15.103 -26.637 1.00 47.88  ? 570 LEU B N   1 
ATOM   1576 C CA  . LEU A 1 221 ? 7.157   -14.250 -25.827 1.00 49.01  ? 570 LEU B CA  1 
ATOM   1577 C C   . LEU A 1 221 ? 7.108   -14.700 -24.358 1.00 51.69  ? 570 LEU B C   1 
ATOM   1578 O O   . LEU A 1 221 ? 8.141   -14.737 -23.676 1.00 43.48  ? 570 LEU B O   1 
ATOM   1579 C CB  . LEU A 1 221 ? 6.758   -12.772 -25.975 1.00 48.40  ? 570 LEU B CB  1 
ATOM   1580 C CG  . LEU A 1 221 ? 7.047   -12.116 -27.347 1.00 49.38  ? 570 LEU B CG  1 
ATOM   1581 C CD1 . LEU A 1 221 ? 6.474   -10.716 -27.449 1.00 51.24  ? 570 LEU B CD1 1 
ATOM   1582 C CD2 . LEU A 1 221 ? 8.528   -12.016 -27.597 1.00 43.66  ? 570 LEU B CD2 1 
ATOM   1583 N N   . GLN A 1 222 ? 5.917   -15.095 -23.874 1.00 48.77  ? 571 GLN B N   1 
ATOM   1584 C CA  . GLN A 1 222 ? 5.818   -15.587 -22.481 1.00 46.50  ? 571 GLN B CA  1 
ATOM   1585 C C   . GLN A 1 222 ? 6.630   -16.847 -22.275 1.00 45.62  ? 571 GLN B C   1 
ATOM   1586 O O   . GLN A 1 222 ? 7.276   -17.016 -21.248 1.00 44.03  ? 571 GLN B O   1 
ATOM   1587 C CB  . GLN A 1 222 ? 4.364   -15.797 -22.083 1.00 43.37  ? 571 GLN B CB  1 
ATOM   1588 C CG  . GLN A 1 222 ? 3.553   -14.486 -22.031 1.00 46.72  ? 571 GLN B CG  1 
ATOM   1589 C CD  . GLN A 1 222 ? 2.115   -14.783 -21.700 1.00 49.77  ? 571 GLN B CD  1 
ATOM   1590 O OE1 . GLN A 1 222 ? 1.260   -14.869 -22.576 1.00 54.64  ? 571 GLN B OE1 1 
ATOM   1591 N NE2 . GLN A 1 222 ? 1.859   -15.021 -20.438 1.00 51.77  ? 571 GLN B NE2 1 
ATOM   1592 N N   . ARG A 1 223 ? 6.638   -17.732 -23.266 1.00 46.10  ? 572 ARG B N   1 
ATOM   1593 C CA  . ARG A 1 223 ? 7.347   -18.967 -23.092 1.00 46.89  ? 572 ARG B CA  1 
ATOM   1594 C C   . ARG A 1 223 ? 8.875   -18.666 -23.083 1.00 51.49  ? 572 ARG B C   1 
ATOM   1595 O O   . ARG A 1 223 ? 9.618   -19.196 -22.291 1.00 49.78  ? 572 ARG B O   1 
ATOM   1596 C CB  . ARG A 1 223 ? 6.989   -19.936 -24.196 1.00 47.00  ? 572 ARG B CB  1 
ATOM   1597 C CG  . ARG A 1 223 ? 7.775   -21.230 -24.100 1.00 52.81  ? 572 ARG B CG  1 
ATOM   1598 C CD  . ARG A 1 223 ? 7.327   -21.972 -22.868 1.00 53.54  ? 572 ARG B CD  1 
ATOM   1599 N NE  . ARG A 1 223 ? 7.960   -23.250 -22.746 1.00 59.75  ? 572 ARG B NE  1 
ATOM   1600 C CZ  . ARG A 1 223 ? 7.913   -23.990 -21.650 1.00 62.06  ? 572 ARG B CZ  1 
ATOM   1601 N NH1 . ARG A 1 223 ? 7.241   -23.563 -20.589 1.00 61.36  ? 572 ARG B NH1 1 
ATOM   1602 N NH2 . ARG A 1 223 ? 8.551   -25.155 -21.609 1.00 59.44  ? 572 ARG B NH2 1 
ATOM   1603 N N   . ILE A 1 224 ? 9.332   -17.797 -23.970 1.00 49.67  ? 573 ILE B N   1 
ATOM   1604 C CA  . ILE A 1 224 ? 10.726  -17.467 -23.999 1.00 44.35  ? 573 ILE B CA  1 
ATOM   1605 C C   . ILE A 1 224 ? 11.085  -16.794 -22.690 1.00 51.53  ? 573 ILE B C   1 
ATOM   1606 O O   . ILE A 1 224 ? 12.124  -17.126 -22.083 1.00 49.53  ? 573 ILE B O   1 
ATOM   1607 C CB  . ILE A 1 224 ? 11.086  -16.573 -25.186 1.00 46.81  ? 573 ILE B CB  1 
ATOM   1608 C CG1 . ILE A 1 224 ? 10.883  -17.373 -26.478 1.00 47.88  ? 573 ILE B CG1 1 
ATOM   1609 C CG2 . ILE A 1 224 ? 12.536  -16.119 -25.100 1.00 47.85  ? 573 ILE B CG2 1 
ATOM   1610 C CD1 . ILE A 1 224 ? 10.924  -16.543 -27.727 1.00 48.34  ? 573 ILE B CD1 1 
ATOM   1611 N N   . PHE A 1 225 ? 10.249  -15.870 -22.215 1.00 48.36  ? 574 PHE B N   1 
ATOM   1612 C CA  . PHE A 1 225 ? 10.537  -15.283 -20.893 1.00 50.39  ? 574 PHE B CA  1 
ATOM   1613 C C   . PHE A 1 225 ? 10.741  -16.370 -19.855 1.00 47.02  ? 574 PHE B C   1 
ATOM   1614 O O   . PHE A 1 225 ? 11.643  -16.324 -19.065 1.00 53.59  ? 574 PHE B O   1 
ATOM   1615 C CB  . PHE A 1 225 ? 9.375   -14.418 -20.410 1.00 49.99  ? 574 PHE B CB  1 
ATOM   1616 C CG  . PHE A 1 225 ? 9.552   -13.876 -19.019 1.00 45.16  ? 574 PHE B CG  1 
ATOM   1617 C CD1 . PHE A 1 225 ? 10.470  -12.887 -18.787 1.00 42.96  ? 574 PHE B CD1 1 
ATOM   1618 C CD2 . PHE A 1 225 ? 8.782   -14.341 -17.958 1.00 42.71  ? 574 PHE B CD2 1 
ATOM   1619 C CE1 . PHE A 1 225 ? 10.646  -12.361 -17.530 1.00 43.37  ? 574 PHE B CE1 1 
ATOM   1620 C CE2 . PHE A 1 225 ? 8.910   -13.779 -16.703 1.00 46.83  ? 574 PHE B CE2 1 
ATOM   1621 C CZ  . PHE A 1 225 ? 9.836   -12.766 -16.492 1.00 47.07  ? 574 PHE B CZ  1 
ATOM   1622 N N   . TYR A 1 226 ? 9.798   -17.284 -19.792 1.00 50.82  ? 575 TYR B N   1 
ATOM   1623 C CA  . TYR A 1 226 ? 9.812   -18.277 -18.761 1.00 49.29  ? 575 TYR B CA  1 
ATOM   1624 C C   . TYR A 1 226 ? 11.084  -19.093 -18.879 1.00 50.70  ? 575 TYR B C   1 
ATOM   1625 O O   . TYR A 1 226 ? 11.681  -19.422 -17.881 1.00 51.12  ? 575 TYR B O   1 
ATOM   1626 C CB  . TYR A 1 226 ? 8.565   -19.174 -18.894 1.00 47.66  ? 575 TYR B CB  1 
ATOM   1627 C CG  . TYR A 1 226 ? 8.675   -20.427 -18.134 1.00 54.44  ? 575 TYR B CG  1 
ATOM   1628 C CD1 . TYR A 1 226 ? 8.372   -20.458 -16.766 1.00 64.52  ? 575 TYR B CD1 1 
ATOM   1629 C CD2 . TYR A 1 226 ? 9.148   -21.563 -18.729 1.00 61.25  ? 575 TYR B CD2 1 
ATOM   1630 C CE1 . TYR A 1 226 ? 8.508   -21.609 -16.031 1.00 64.31  ? 575 TYR B CE1 1 
ATOM   1631 C CE2 . TYR A 1 226 ? 9.286   -22.738 -18.019 1.00 67.50  ? 575 TYR B CE2 1 
ATOM   1632 C CZ  . TYR A 1 226 ? 8.968   -22.754 -16.668 1.00 73.50  ? 575 TYR B CZ  1 
ATOM   1633 O OH  . TYR A 1 226 ? 9.096   -23.924 -15.978 1.00 64.19  ? 575 TYR B OH  1 
ATOM   1634 N N   . LEU A 1 227 ? 11.456  -19.469 -20.105 1.00 48.53  ? 576 LEU B N   1 
ATOM   1635 C CA  . LEU A 1 227 ? 12.617  -20.316 -20.291 1.00 57.60  ? 576 LEU B CA  1 
ATOM   1636 C C   . LEU A 1 227 ? 13.882  -19.537 -19.905 1.00 57.81  ? 576 LEU B C   1 
ATOM   1637 O O   . LEU A 1 227 ? 14.808  -20.096 -19.349 1.00 62.70  ? 576 LEU B O   1 
ATOM   1638 C CB  . LEU A 1 227 ? 12.669  -20.869 -21.730 1.00 56.73  ? 576 LEU B CB  1 
ATOM   1639 C CG  . LEU A 1 227 ? 11.546  -21.861 -22.143 1.00 62.55  ? 576 LEU B CG  1 
ATOM   1640 C CD1 . LEU A 1 227 ? 11.485  -22.155 -23.634 1.00 60.56  ? 576 LEU B CD1 1 
ATOM   1641 C CD2 . LEU A 1 227 ? 11.696  -23.164 -21.383 1.00 58.45  ? 576 LEU B CD2 1 
ATOM   1642 N N   . LYS A 1 228 ? 13.907  -18.239 -20.189 1.00 56.05  ? 577 LYS B N   1 
ATOM   1643 C CA  . LYS A 1 228 ? 15.049  -17.420 -19.808 1.00 58.70  ? 577 LYS B CA  1 
ATOM   1644 C C   . LYS A 1 228 ? 15.136  -17.296 -18.281 1.00 61.85  ? 577 LYS B C   1 
ATOM   1645 O O   . LYS A 1 228 ? 16.217  -17.273 -17.709 1.00 65.62  ? 577 LYS B O   1 
ATOM   1646 C CB  . LYS A 1 228 ? 14.958  -16.049 -20.428 1.00 57.47  ? 577 LYS B CB  1 
ATOM   1647 C CG  . LYS A 1 228 ? 15.236  -16.009 -21.913 1.00 62.55  ? 577 LYS B CG  1 
ATOM   1648 C CD  . LYS A 1 228 ? 14.854  -14.654 -22.528 1.00 64.46  ? 577 LYS B CD  1 
ATOM   1649 C CE  . LYS A 1 228 ? 15.675  -13.471 -21.995 1.00 64.25  ? 577 LYS B CE  1 
ATOM   1650 N NZ  . LYS A 1 228 ? 17.152  -13.648 -22.187 1.00 65.65  ? 577 LYS B NZ  1 
ATOM   1651 N N   . LEU A 1 229 ? 13.985  -17.236 -17.624 1.00 64.74  ? 578 LEU B N   1 
ATOM   1652 C CA  . LEU A 1 229 ? 13.943  -17.279 -16.170 1.00 65.16  ? 578 LEU B CA  1 
ATOM   1653 C C   . LEU A 1 229 ? 14.575  -18.532 -15.658 1.00 63.94  ? 578 LEU B C   1 
ATOM   1654 O O   . LEU A 1 229 ? 15.400  -18.480 -14.778 1.00 61.72  ? 578 LEU B O   1 
ATOM   1655 C CB  . LEU A 1 229 ? 12.519  -17.266 -15.645 1.00 63.87  ? 578 LEU B CB  1 
ATOM   1656 C CG  . LEU A 1 229 ? 12.023  -15.951 -15.102 1.00 64.34  ? 578 LEU B CG  1 
ATOM   1657 C CD1 . LEU A 1 229 ? 10.618  -16.179 -14.563 1.00 64.51  ? 578 LEU B CD1 1 
ATOM   1658 C CD2 . LEU A 1 229 ? 12.945  -15.450 -14.001 1.00 70.10  ? 578 LEU B CD2 1 
ATOM   1659 N N   . GLU A 1 230 ? 14.160  -19.657 -16.213 1.00 68.30  ? 579 GLU B N   1 
ATOM   1660 C CA  . GLU A 1 230 ? 14.596  -20.929 -15.685 1.00 76.86  ? 579 GLU B CA  1 
ATOM   1661 C C   . GLU A 1 230 ? 16.042  -21.175 -16.052 1.00 81.49  ? 579 GLU B C   1 
ATOM   1662 O O   . GLU A 1 230 ? 16.750  -21.817 -15.312 1.00 76.66  ? 579 GLU B O   1 
ATOM   1663 C CB  . GLU A 1 230 ? 13.701  -22.062 -16.160 1.00 79.82  ? 579 GLU B CB  1 
ATOM   1664 C CG  . GLU A 1 230 ? 12.257  -21.948 -15.642 1.00 93.47  ? 579 GLU B CG  1 
ATOM   1665 C CD  . GLU A 1 230 ? 12.117  -22.064 -14.106 1.00 96.48  ? 579 GLU B CD  1 
ATOM   1666 O OE1 . GLU A 1 230 ? 12.567  -21.171 -13.341 1.00 83.12  ? 579 GLU B OE1 1 
ATOM   1667 O OE2 . GLU A 1 230 ? 11.535  -23.062 -13.639 1.00 99.56  ? 579 GLU B OE2 1 
ATOM   1668 N N   . ASP A 1 231 ? 16.461  -20.686 -17.217 1.00 84.17  ? 580 ASP B N   1 
ATOM   1669 C CA  . ASP A 1 231 ? 17.866  -20.666 -17.593 1.00 78.77  ? 580 ASP B CA  1 
ATOM   1670 C C   . ASP A 1 231 ? 18.539  -22.034 -17.702 1.00 76.78  ? 580 ASP B C   1 
ATOM   1671 O O   . ASP A 1 231 ? 19.703  -22.149 -17.391 1.00 72.83  ? 580 ASP B O   1 
ATOM   1672 C CB  . ASP A 1 231 ? 18.638  -19.785 -16.617 1.00 81.16  ? 580 ASP B CB  1 
ATOM   1673 C CG  . ASP A 1 231 ? 19.996  -19.372 -17.150 1.00 90.86  ? 580 ASP B CG  1 
ATOM   1674 O OD1 . ASP A 1 231 ? 20.295  -19.613 -18.357 1.00 92.05  ? 580 ASP B OD1 1 
ATOM   1675 O OD2 . ASP A 1 231 ? 20.764  -18.792 -16.355 1.00 90.90  ? 580 ASP B OD2 1 
ATOM   1676 N N   . LEU A 1 232 ? 17.820  -23.049 -18.193 1.00 81.16  ? 581 LEU B N   1 
ATOM   1677 C CA  . LEU A 1 232 ? 18.412  -24.355 -18.501 1.00 77.94  ? 581 LEU B CA  1 
ATOM   1678 C C   . LEU A 1 232 ? 19.426  -24.260 -19.606 1.00 76.13  ? 581 LEU B C   1 
ATOM   1679 O O   . LEU A 1 232 ? 20.530  -24.745 -19.454 1.00 79.66  ? 581 LEU B O   1 
ATOM   1680 C CB  . LEU A 1 232 ? 17.373  -25.414 -18.892 1.00 82.59  ? 581 LEU B CB  1 
ATOM   1681 C CG  . LEU A 1 232 ? 16.324  -25.797 -17.842 1.00 92.90  ? 581 LEU B CG  1 
ATOM   1682 C CD1 . LEU A 1 232 ? 15.751  -27.169 -18.190 1.00 95.48  ? 581 LEU B CD1 1 
ATOM   1683 C CD2 . LEU A 1 232 ? 16.849  -25.809 -16.405 1.00 90.69  ? 581 LEU B CD2 1 
ATOM   1684 N N   . VAL A 1 233 ? 19.046  -23.685 -20.737 1.00 80.46  ? 582 VAL B N   1 
ATOM   1685 C CA  . VAL A 1 233 ? 20.007  -23.376 -21.776 1.00 85.49  ? 582 VAL B CA  1 
ATOM   1686 C C   . VAL A 1 233 ? 19.747  -21.960 -22.235 1.00 80.47  ? 582 VAL B C   1 
ATOM   1687 O O   . VAL A 1 233 ? 18.608  -21.502 -22.282 1.00 71.95  ? 582 VAL B O   1 
ATOM   1688 C CB  . VAL A 1 233 ? 19.984  -24.366 -22.974 1.00 85.14  ? 582 VAL B CB  1 
ATOM   1689 C CG1 . VAL A 1 233 ? 19.977  -25.814 -22.485 1.00 88.17  ? 582 VAL B CG1 1 
ATOM   1690 C CG2 . VAL A 1 233 ? 18.812  -24.102 -23.882 1.00 84.15  ? 582 VAL B CG2 1 
ATOM   1691 N N   . PRO A 1 234 ? 20.817  -21.245 -22.541 1.00 80.49  ? 583 PRO B N   1 
ATOM   1692 C CA  . PRO A 1 234 ? 20.604  -19.899 -23.014 1.00 80.82  ? 583 PRO B CA  1 
ATOM   1693 C C   . PRO A 1 234 ? 19.936  -19.904 -24.387 1.00 80.68  ? 583 PRO B C   1 
ATOM   1694 O O   . PRO A 1 234 ? 20.173  -20.809 -25.197 1.00 78.42  ? 583 PRO B O   1 
ATOM   1695 C CB  . PRO A 1 234 ? 22.028  -19.331 -23.118 1.00 80.84  ? 583 PRO B CB  1 
ATOM   1696 C CG  . PRO A 1 234 ? 22.921  -20.525 -23.260 1.00 82.26  ? 583 PRO B CG  1 
ATOM   1697 C CD  . PRO A 1 234 ? 22.240  -21.639 -22.526 1.00 80.76  ? 583 PRO B CD  1 
ATOM   1698 N N   . PRO A 1 235 ? 19.134  -18.883 -24.670 1.00 76.28  ? 584 PRO B N   1 
ATOM   1699 C CA  . PRO A 1 235 ? 18.657  -18.766 -26.025 1.00 77.70  ? 584 PRO B CA  1 
ATOM   1700 C C   . PRO A 1 235 ? 19.796  -18.411 -26.995 1.00 67.82  ? 584 PRO B C   1 
ATOM   1701 O O   . PRO A 1 235 ? 20.752  -17.770 -26.615 1.00 65.34  ? 584 PRO B O   1 
ATOM   1702 C CB  . PRO A 1 235 ? 17.654  -17.612 -25.952 1.00 77.42  ? 584 PRO B CB  1 
ATOM   1703 C CG  . PRO A 1 235 ? 17.739  -17.051 -24.574 1.00 74.59  ? 584 PRO B CG  1 
ATOM   1704 C CD  . PRO A 1 235 ? 18.906  -17.659 -23.899 1.00 77.88  ? 584 PRO B CD  1 
ATOM   1705 N N   . PRO A 1 236 ? 19.688  -18.840 -28.241 1.00 65.43  ? 585 PRO B N   1 
ATOM   1706 C CA  . PRO A 1 236 ? 20.642  -18.380 -29.214 1.00 72.66  ? 585 PRO B CA  1 
ATOM   1707 C C   . PRO A 1 236 ? 20.559  -16.847 -29.351 1.00 67.70  ? 585 PRO B C   1 
ATOM   1708 O O   . PRO A 1 236 ? 19.473  -16.258 -29.189 1.00 59.88  ? 585 PRO B O   1 
ATOM   1709 C CB  . PRO A 1 236 ? 20.219  -19.080 -30.510 1.00 78.00  ? 585 PRO B CB  1 
ATOM   1710 C CG  . PRO A 1 236 ? 18.882  -19.681 -30.283 1.00 74.25  ? 585 PRO B CG  1 
ATOM   1711 C CD  . PRO A 1 236 ? 18.541  -19.545 -28.832 1.00 75.46  ? 585 PRO B CD  1 
ATOM   1712 N N   . PRO A 1 237 ? 21.701  -16.206 -29.605 1.00 66.52  ? 586 PRO B N   1 
ATOM   1713 C CA  . PRO A 1 237 ? 21.802  -14.722 -29.519 1.00 69.27  ? 586 PRO B CA  1 
ATOM   1714 C C   . PRO A 1 237 ? 20.804  -13.946 -30.401 1.00 60.36  ? 586 PRO B C   1 
ATOM   1715 O O   . PRO A 1 237 ? 20.248  -12.934 -29.981 1.00 60.72  ? 586 PRO B O   1 
ATOM   1716 C CB  . PRO A 1 237 ? 23.258  -14.445 -29.965 1.00 65.43  ? 586 PRO B CB  1 
ATOM   1717 C CG  . PRO A 1 237 ? 24.005  -15.706 -29.608 1.00 63.86  ? 586 PRO B CG  1 
ATOM   1718 C CD  . PRO A 1 237 ? 23.018  -16.832 -29.865 1.00 69.02  ? 586 PRO B CD  1 
ATOM   1719 N N   . ILE A 1 238 ? 20.549  -14.448 -31.595 1.00 63.62  ? 587 ILE B N   1 
ATOM   1720 C CA  . ILE A 1 238 ? 19.599  -13.777 -32.499 1.00 73.39  ? 587 ILE B CA  1 
ATOM   1721 C C   . ILE A 1 238 ? 18.132  -13.871 -31.998 1.00 68.74  ? 587 ILE B C   1 
ATOM   1722 O O   . ILE A 1 238 ? 17.342  -12.898 -32.112 1.00 64.20  ? 587 ILE B O   1 
ATOM   1723 C CB  . ILE A 1 238 ? 19.693  -14.338 -33.944 1.00 70.20  ? 587 ILE B CB  1 
ATOM   1724 C CG1 . ILE A 1 238 ? 21.123  -14.186 -34.501 1.00 80.32  ? 587 ILE B CG1 1 
ATOM   1725 C CG2 . ILE A 1 238 ? 18.674  -13.670 -34.877 1.00 68.40  ? 587 ILE B CG2 1 
ATOM   1726 C CD1 . ILE A 1 238 ? 21.314  -14.850 -35.858 1.00 78.09  ? 587 ILE B CD1 1 
ATOM   1727 N N   . ILE A 1 239 ? 17.764  -15.016 -31.441 1.00 55.12  ? 588 ILE B N   1 
ATOM   1728 C CA  . ILE A 1 239 ? 16.420  -15.144 -30.851 1.00 61.39  ? 588 ILE B CA  1 
ATOM   1729 C C   . ILE A 1 239 ? 16.338  -14.207 -29.674 1.00 55.39  ? 588 ILE B C   1 
ATOM   1730 O O   . ILE A 1 239 ? 15.362  -13.461 -29.519 1.00 56.08  ? 588 ILE B O   1 
ATOM   1731 C CB  . ILE A 1 239 ? 16.107  -16.580 -30.364 1.00 55.88  ? 588 ILE B CB  1 
ATOM   1732 C CG1 . ILE A 1 239 ? 16.167  -17.567 -31.544 1.00 55.97  ? 588 ILE B CG1 1 
ATOM   1733 C CG2 . ILE A 1 239 ? 14.769  -16.625 -29.641 1.00 54.14  ? 588 ILE B CG2 1 
ATOM   1734 C CD1 . ILE A 1 239 ? 15.313  -17.190 -32.726 1.00 60.92  ? 588 ILE B CD1 1 
ATOM   1735 N N   . ASP A 1 240 ? 17.373  -14.258 -28.843 1.00 55.33  ? 589 ASP B N   1 
ATOM   1736 C CA  . ASP A 1 240 ? 17.440  -13.393 -27.664 1.00 54.37  ? 589 ASP B CA  1 
ATOM   1737 C C   . ASP A 1 240 ? 17.293  -11.937 -28.062 1.00 56.69  ? 589 ASP B C   1 
ATOM   1738 O O   . ASP A 1 240 ? 16.579  -11.176 -27.398 1.00 54.34  ? 589 ASP B O   1 
ATOM   1739 C CB  . ASP A 1 240 ? 18.739  -13.600 -26.907 1.00 56.56  ? 589 ASP B CB  1 
ATOM   1740 C CG  . ASP A 1 240 ? 18.619  -13.257 -25.438 1.00 60.38  ? 589 ASP B CG  1 
ATOM   1741 O OD1 . ASP A 1 240 ? 17.623  -13.580 -24.786 1.00 68.99  ? 589 ASP B OD1 1 
ATOM   1742 O OD2 . ASP A 1 240 ? 19.551  -12.685 -24.890 1.00 75.12  ? 589 ASP B OD2 1 
ATOM   1743 N N   . LYS A 1 241 ? 17.923  -11.545 -29.170 1.00 49.72  ? 590 LYS B N   1 
ATOM   1744 C CA  . LYS A 1 241 ? 17.831  -10.163 -29.584 1.00 57.50  ? 590 LYS B CA  1 
ATOM   1745 C C   . LYS A 1 241 ? 16.416  -9.816  -30.008 1.00 52.06  ? 590 LYS B C   1 
ATOM   1746 O O   . LYS A 1 241 ? 15.886  -8.749  -29.638 1.00 55.01  ? 590 LYS B O   1 
ATOM   1747 C CB  . LYS A 1 241 ? 18.822  -9.848  -30.717 1.00 71.41  ? 590 LYS B CB  1 
ATOM   1748 C CG  . LYS A 1 241 ? 18.744  -8.414  -31.256 1.00 73.14  ? 590 LYS B CG  1 
ATOM   1749 C CD  . LYS A 1 241 ? 20.035  -8.057  -32.016 1.00 82.93  ? 590 LYS B CD  1 
ATOM   1750 C CE  . LYS A 1 241 ? 19.836  -7.149  -33.235 1.00 84.67  ? 590 LYS B CE  1 
ATOM   1751 N NZ  . LYS A 1 241 ? 19.031  -5.923  -32.967 1.00 88.44  ? 590 LYS B NZ  1 
ATOM   1752 N N   . ILE A 1 242 ? 15.802  -10.703 -30.785 1.00 56.56  ? 591 ILE B N   1 
ATOM   1753 C CA  . ILE A 1 242 ? 14.413  -10.497 -31.199 1.00 58.13  ? 591 ILE B CA  1 
ATOM   1754 C C   . ILE A 1 242 ? 13.500  -10.343 -29.971 1.00 53.18  ? 591 ILE B C   1 
ATOM   1755 O O   . ILE A 1 242 ? 12.717  -9.395  -29.881 1.00 51.01  ? 591 ILE B O   1 
ATOM   1756 C CB  . ILE A 1 242 ? 13.916  -11.652 -32.068 1.00 59.89  ? 591 ILE B CB  1 
ATOM   1757 C CG1 . ILE A 1 242 ? 14.590  -11.616 -33.452 1.00 62.11  ? 591 ILE B CG1 1 
ATOM   1758 C CG2 . ILE A 1 242 ? 12.408  -11.585 -32.212 1.00 55.47  ? 591 ILE B CG2 1 
ATOM   1759 C CD1 . ILE A 1 242 ? 14.592  -12.950 -34.212 1.00 55.28  ? 591 ILE B CD1 1 
ATOM   1760 N N   . PHE A 1 243 ? 13.665  -11.238 -29.014 1.00 50.20  ? 592 PHE B N   1 
ATOM   1761 C CA  . PHE A 1 243 ? 12.901  -11.168 -27.761 1.00 53.94  ? 592 PHE B CA  1 
ATOM   1762 C C   . PHE A 1 243 ? 13.167  -9.807  -27.131 1.00 50.00  ? 592 PHE B C   1 
ATOM   1763 O O   . PHE A 1 243 ? 12.252  -9.009  -26.958 1.00 54.55  ? 592 PHE B O   1 
ATOM   1764 C CB  . PHE A 1 243 ? 13.288  -12.341 -26.827 1.00 49.83  ? 592 PHE B CB  1 
ATOM   1765 C CG  . PHE A 1 243 ? 12.682  -12.275 -25.456 1.00 52.51  ? 592 PHE B CG  1 
ATOM   1766 C CD1 . PHE A 1 243 ? 11.436  -12.834 -25.194 1.00 53.25  ? 592 PHE B CD1 1 
ATOM   1767 C CD2 . PHE A 1 243 ? 13.358  -11.693 -24.418 1.00 52.22  ? 592 PHE B CD2 1 
ATOM   1768 C CE1 . PHE A 1 243 ? 10.887  -12.772 -23.931 1.00 52.06  ? 592 PHE B CE1 1 
ATOM   1769 C CE2 . PHE A 1 243 ? 12.808  -11.633 -23.148 1.00 49.25  ? 592 PHE B CE2 1 
ATOM   1770 C CZ  . PHE A 1 243 ? 11.571  -12.172 -22.900 1.00 51.90  ? 592 PHE B CZ  1 
ATOM   1771 N N   . MET A 1 244 ? 14.424  -9.500  -26.868 1.00 53.20  ? 593 MET B N   1 
ATOM   1772 C CA  . MET A 1 244 ? 14.747  -8.202  -26.226 1.00 56.01  ? 593 MET B CA  1 
ATOM   1773 C C   . MET A 1 244 ? 14.270  -6.996  -27.034 1.00 52.34  ? 593 MET B C   1 
ATOM   1774 O O   . MET A 1 244 ? 13.693  -6.096  -26.448 1.00 51.14  ? 593 MET B O   1 
ATOM   1775 C CB  . MET A 1 244 ? 16.235  -8.086  -25.903 1.00 63.19  ? 593 MET B CB  1 
ATOM   1776 C CG  . MET A 1 244 ? 16.793  -9.124  -24.919 1.00 61.87  ? 593 MET B CG  1 
ATOM   1777 S SD  . MET A 1 244 ? 16.009  -9.155  -23.286 1.00 70.87  ? 593 MET B SD  1 
ATOM   1778 C CE  . MET A 1 244 ? 17.201  -10.207 -22.497 1.00 83.33  ? 593 MET B CE  1 
ATOM   1779 N N   . ASP A 1 245 ? 14.388  -7.008  -28.373 1.00 62.27  ? 594 ASP B N   1 
ATOM   1780 C CA  . ASP A 1 245 ? 13.995  -5.817  -29.191 1.00 64.17  ? 594 ASP B CA  1 
ATOM   1781 C C   . ASP A 1 245 ? 12.517  -5.637  -29.342 1.00 66.60  ? 594 ASP B C   1 
ATOM   1782 O O   . ASP A 1 245 ? 12.037  -4.523  -29.514 1.00 74.62  ? 594 ASP B O   1 
ATOM   1783 C CB  . ASP A 1 245 ? 14.586  -5.852  -30.587 1.00 68.08  ? 594 ASP B CB  1 
ATOM   1784 C CG  . ASP A 1 245 ? 16.095  -5.624  -30.590 1.00 72.93  ? 594 ASP B CG  1 
ATOM   1785 O OD1 . ASP A 1 245 ? 16.664  -5.350  -29.522 1.00 70.25  ? 594 ASP B OD1 1 
ATOM   1786 O OD2 . ASP A 1 245 ? 16.724  -5.724  -31.668 1.00 72.81  ? 594 ASP B OD2 1 
ATOM   1787 N N   . THR A 1 246 ? 11.780  -6.732  -29.276 1.00 71.44  ? 595 THR B N   1 
ATOM   1788 C CA  . THR A 1 246 ? 10.330  -6.661  -29.404 1.00 70.12  ? 595 THR B CA  1 
ATOM   1789 C C   . THR A 1 246 ? 9.665   -6.408  -28.058 1.00 67.56  ? 595 THR B C   1 
ATOM   1790 O O   . THR A 1 246 ? 8.467   -6.281  -28.008 1.00 74.21  ? 595 THR B O   1 
ATOM   1791 C CB  . THR A 1 246 ? 9.748   -7.892  -30.153 1.00 66.44  ? 595 THR B CB  1 
ATOM   1792 O OG1 . THR A 1 246 ? 10.243  -9.114  -29.589 1.00 64.20  ? 595 THR B OG1 1 
ATOM   1793 C CG2 . THR A 1 246 ? 10.149  -7.796  -31.663 1.00 59.77  ? 595 THR B CG2 1 
ATOM   1794 N N   . LEU A 1 247 ? 10.425  -6.287  -26.975 1.00 71.80  ? 596 LEU B N   1 
ATOM   1795 C CA  . LEU A 1 247 ? 9.817   -5.896  -25.724 1.00 74.82  ? 596 LEU B CA  1 
ATOM   1796 C C   . LEU A 1 247 ? 9.656   -4.384  -25.685 1.00 90.17  ? 596 LEU B C   1 
ATOM   1797 O O   . LEU A 1 247 ? 10.641  -3.630  -25.682 1.00 86.46  ? 596 LEU B O   1 
ATOM   1798 C CB  . LEU A 1 247 ? 10.632  -6.354  -24.541 1.00 78.90  ? 596 LEU B CB  1 
ATOM   1799 C CG  . LEU A 1 247 ? 10.659  -7.891  -24.438 1.00 80.81  ? 596 LEU B CG  1 
ATOM   1800 C CD1 . LEU A 1 247 ? 11.187  -8.323  -23.060 1.00 82.95  ? 596 LEU B CD1 1 
ATOM   1801 C CD2 . LEU A 1 247 ? 9.336   -8.575  -24.791 1.00 64.62  ? 596 LEU B CD2 1 
ATOM   1802 N N   . PRO A 1 248 ? 8.403   -3.927  -25.643 1.00 98.68  ? 597 PRO B N   1 
ATOM   1803 C CA  . PRO A 1 248 ? 8.096   -2.501  -25.503 1.00 111.65 ? 597 PRO B CA  1 
ATOM   1804 C C   . PRO A 1 248 ? 8.488   -1.823  -24.149 1.00 106.97 ? 597 PRO B C   1 
ATOM   1805 O O   . PRO A 1 248 ? 7.761   -0.929  -23.690 1.00 112.71 ? 597 PRO B O   1 
ATOM   1806 C CB  . PRO A 1 248 ? 6.573   -2.441  -25.718 1.00 118.55 ? 597 PRO B CB  1 
ATOM   1807 C CG  . PRO A 1 248 ? 6.176   -3.776  -26.283 1.00 114.24 ? 597 PRO B CG  1 
ATOM   1808 C CD  . PRO A 1 248 ? 7.198   -4.755  -25.817 1.00 102.01 ? 597 PRO B CD  1 
ATOM   1809 N N   . PHE A 1 249 ? 9.614   -2.228  -23.544 1.00 91.11  ? 598 PHE B N   1 
ATOM   1810 C CA  . PHE A 1 249 ? 10.083  -1.658  -22.271 1.00 88.61  ? 598 PHE B CA  1 
ATOM   1811 C C   . PHE A 1 249 ? 11.552  -2.021  -21.967 1.00 91.71  ? 598 PHE B C   1 
ATOM   1812 O O   . PHE A 1 249 ? 12.310  -2.466  -22.842 1.00 83.52  ? 598 PHE B O   1 
ATOM   1813 C CB  . PHE A 1 249 ? 9.148   -2.074  -21.098 1.00 90.91  ? 598 PHE B CB  1 
ATOM   1814 C CG  . PHE A 1 249 ? 8.938   -3.575  -20.968 1.00 86.70  ? 598 PHE B CG  1 
ATOM   1815 C CD1 . PHE A 1 249 ? 9.875   -4.380  -20.314 1.00 84.76  ? 598 PHE B CD1 1 
ATOM   1816 C CD2 . PHE A 1 249 ? 7.823   -4.177  -21.513 1.00 81.75  ? 598 PHE B CD2 1 
ATOM   1817 C CE1 . PHE A 1 249 ? 9.681   -5.751  -20.206 1.00 85.54  ? 598 PHE B CE1 1 
ATOM   1818 C CE2 . PHE A 1 249 ? 7.623   -5.552  -21.405 1.00 85.04  ? 598 PHE B CE2 1 
ATOM   1819 C CZ  . PHE A 1 249 ? 8.546   -6.342  -20.750 1.00 77.18  ? 598 PHE B CZ  1 
ATOM   1820 N N   . ALA B 1 13  ? 10.832  -15.784 24.601  1.00 100.56 ? 362 ALA A N   1 
ATOM   1821 C CA  . ALA B 1 13  ? 11.917  -14.795 24.304  1.00 108.54 ? 362 ALA A CA  1 
ATOM   1822 C C   . ALA B 1 13  ? 11.354  -13.378 24.094  1.00 100.56 ? 362 ALA A C   1 
ATOM   1823 O O   . ALA B 1 13  ? 10.197  -13.189 23.695  1.00 86.46  ? 362 ALA A O   1 
ATOM   1824 C CB  . ALA B 1 13  ? 12.744  -15.244 23.084  1.00 104.28 ? 362 ALA A CB  1 
ATOM   1825 N N   . ASN B 1 14  ? 12.171  -12.380 24.409  1.00 98.83  ? 363 ASN A N   1 
ATOM   1826 C CA  . ASN B 1 14  ? 11.855  -11.003 24.027  1.00 96.35  ? 363 ASN A CA  1 
ATOM   1827 C C   . ASN B 1 14  ? 11.938  -10.730 22.509  1.00 79.95  ? 363 ASN A C   1 
ATOM   1828 O O   . ASN B 1 14  ? 11.195  -9.903  21.953  1.00 67.38  ? 363 ASN A O   1 
ATOM   1829 C CB  . ASN B 1 14  ? 12.788  -10.046 24.730  1.00 93.18  ? 363 ASN A CB  1 
ATOM   1830 C CG  . ASN B 1 14  ? 12.423  -8.618  24.445  1.00 97.84  ? 363 ASN A CG  1 
ATOM   1831 O OD1 . ASN B 1 14  ? 11.270  -8.220  24.630  1.00 95.07  ? 363 ASN A OD1 1 
ATOM   1832 N ND2 . ASN B 1 14  ? 13.378  -7.851  23.940  1.00 90.24  ? 363 ASN A ND2 1 
ATOM   1833 N N   . LEU B 1 15  ? 12.863  -11.410 21.846  1.00 65.76  ? 364 LEU A N   1 
ATOM   1834 C CA  . LEU B 1 15  ? 12.924  -11.357 20.392  1.00 60.18  ? 364 LEU A CA  1 
ATOM   1835 C C   . LEU B 1 15  ? 11.631  -11.946 19.786  1.00 55.71  ? 364 LEU A C   1 
ATOM   1836 O O   . LEU B 1 15  ? 10.925  -11.269 19.037  1.00 54.88  ? 364 LEU A O   1 
ATOM   1837 C CB  . LEU B 1 15  ? 14.134  -12.123 19.925  1.00 60.50  ? 364 LEU A CB  1 
ATOM   1838 C CG  . LEU B 1 15  ? 14.286  -12.249 18.407  1.00 63.21  ? 364 LEU A CG  1 
ATOM   1839 C CD1 . LEU B 1 15  ? 14.154  -10.911 17.719  1.00 60.79  ? 364 LEU A CD1 1 
ATOM   1840 C CD2 . LEU B 1 15  ? 15.638  -12.844 18.089  1.00 58.30  ? 364 LEU A CD2 1 
ATOM   1841 N N   . LEU B 1 16  ? 11.304  -13.172 20.201  1.00 51.71  ? 365 LEU A N   1 
ATOM   1842 C CA  . LEU B 1 16  ? 10.087  -13.850 19.816  1.00 54.58  ? 365 LEU A CA  1 
ATOM   1843 C C   . LEU B 1 16  ? 8.904   -12.900 19.950  1.00 61.13  ? 365 LEU A C   1 
ATOM   1844 O O   . LEU B 1 16  ? 8.137   -12.725 19.006  1.00 61.36  ? 365 LEU A O   1 
ATOM   1845 C CB  . LEU B 1 16  ? 9.859   -15.101 20.656  1.00 58.52  ? 365 LEU A CB  1 
ATOM   1846 C CG  . LEU B 1 16  ? 8.632   -15.942 20.234  1.00 65.83  ? 365 LEU A CG  1 
ATOM   1847 C CD1 . LEU B 1 16  ? 8.694   -16.202 18.732  1.00 65.10  ? 365 LEU A CD1 1 
ATOM   1848 C CD2 . LEU B 1 16  ? 8.481   -17.249 21.016  1.00 55.99  ? 365 LEU A CD2 1 
ATOM   1849 N N   . THR B 1 17  ? 8.798   -12.253 21.099  1.00 64.14  ? 366 THR A N   1 
ATOM   1850 C CA  . THR B 1 17  ? 7.693   -11.335 21.379  1.00 65.76  ? 366 THR A CA  1 
ATOM   1851 C C   . THR B 1 17  ? 7.687   -10.172 20.397  1.00 61.95  ? 366 THR A C   1 
ATOM   1852 O O   . THR B 1 17  ? 6.630   -9.725  19.978  1.00 67.14  ? 366 THR A O   1 
ATOM   1853 C CB  . THR B 1 17  ? 7.767   -10.780 22.849  1.00 62.17  ? 366 THR A CB  1 
ATOM   1854 O OG1 . THR B 1 17  ? 7.538   -11.835 23.769  1.00 60.25  ? 366 THR A OG1 1 
ATOM   1855 C CG2 . THR B 1 17  ? 6.692   -9.700  23.121  1.00 68.68  ? 366 THR A CG2 1 
ATOM   1856 N N   . SER B 1 18  ? 8.855   -9.644  20.082  1.00 54.39  ? 367 SER A N   1 
ATOM   1857 C CA  . SER B 1 18  ? 8.915   -8.530  19.157  1.00 55.12  ? 367 SER A CA  1 
ATOM   1858 C C   . SER B 1 18  ? 8.515   -8.976  17.786  1.00 56.97  ? 367 SER A C   1 
ATOM   1859 O O   . SER B 1 18  ? 7.814   -8.255  17.085  1.00 72.63  ? 367 SER A O   1 
ATOM   1860 C CB  . SER B 1 18  ? 10.306  -7.929  19.101  1.00 58.73  ? 367 SER A CB  1 
ATOM   1861 O OG  . SER B 1 18  ? 10.564  -7.221  20.271  1.00 61.10  ? 367 SER A OG  1 
ATOM   1862 N N   . LEU B 1 19  ? 8.940   -10.178 17.413  1.00 59.65  ? 368 LEU A N   1 
ATOM   1863 C CA  . LEU B 1 19  ? 8.546   -10.764 16.100  1.00 62.02  ? 368 LEU A CA  1 
ATOM   1864 C C   . LEU B 1 19  ? 7.033   -11.020 16.025  1.00 60.68  ? 368 LEU A C   1 
ATOM   1865 O O   . LEU B 1 19  ? 6.422   -10.721 15.011  1.00 50.66  ? 368 LEU A O   1 
ATOM   1866 C CB  . LEU B 1 19  ? 9.307   -12.064 15.810  1.00 53.11  ? 368 LEU A CB  1 
ATOM   1867 C CG  . LEU B 1 19  ? 10.819  -11.910 15.650  1.00 52.04  ? 368 LEU A CG  1 
ATOM   1868 C CD1 . LEU B 1 19  ? 11.525  -13.252 15.491  1.00 50.59  ? 368 LEU A CD1 1 
ATOM   1869 C CD2 . LEU B 1 19  ? 11.191  -10.990 14.509  1.00 54.00  ? 368 LEU A CD2 1 
ATOM   1870 N N   . VAL B 1 20  ? 6.444   -11.526 17.123  1.00 61.88  ? 369 VAL A N   1 
ATOM   1871 C CA  . VAL B 1 20  ? 5.015   -11.760 17.180  1.00 56.12  ? 369 VAL A CA  1 
ATOM   1872 C C   . VAL B 1 20  ? 4.273   -10.438 17.069  1.00 54.20  ? 369 VAL A C   1 
ATOM   1873 O O   . VAL B 1 20  ? 3.326   -10.327 16.294  1.00 54.37  ? 369 VAL A O   1 
ATOM   1874 C CB  . VAL B 1 20  ? 4.595   -12.506 18.448  1.00 57.09  ? 369 VAL A CB  1 
ATOM   1875 C CG1 . VAL B 1 20  ? 3.078   -12.497 18.631  1.00 60.32  ? 369 VAL A CG1 1 
ATOM   1876 C CG2 . VAL B 1 20  ? 5.079   -13.935 18.368  1.00 60.75  ? 369 VAL A CG2 1 
ATOM   1877 N N   . ARG B 1 21  ? 4.723   -9.436  17.811  1.00 56.01  ? 370 ARG A N   1 
ATOM   1878 C CA  . ARG B 1 21  ? 4.035   -8.139  17.816  1.00 66.95  ? 370 ARG A CA  1 
ATOM   1879 C C   . ARG B 1 21  ? 4.114   -7.536  16.412  1.00 65.40  ? 370 ARG A C   1 
ATOM   1880 O O   . ARG B 1 21  ? 3.155   -6.954  15.910  1.00 64.99  ? 370 ARG A O   1 
ATOM   1881 C CB  . ARG B 1 21  ? 4.627   -7.198  18.893  1.00 70.46  ? 370 ARG A CB  1 
ATOM   1882 C CG  . ARG B 1 21  ? 4.299   -5.698  18.793  1.00 84.81  ? 370 ARG A CG  1 
ATOM   1883 C CD  . ARG B 1 21  ? 3.145   -5.210  19.695  1.00 98.49  ? 370 ARG A CD  1 
ATOM   1884 N NE  . ARG B 1 21  ? 2.071   -6.197  19.943  1.00 112.03 ? 370 ARG A NE  1 
ATOM   1885 C CZ  . ARG B 1 21  ? 0.965   -6.383  19.207  1.00 106.18 ? 370 ARG A CZ  1 
ATOM   1886 N NH1 . ARG B 1 21  ? 0.089   -7.319  19.568  1.00 92.35  ? 370 ARG A NH1 1 
ATOM   1887 N NH2 . ARG B 1 21  ? 0.722   -5.670  18.121  1.00 107.37 ? 370 ARG A NH2 1 
ATOM   1888 N N   . ALA B 1 22  ? 5.256   -7.688  15.771  1.00 61.66  ? 371 ALA A N   1 
ATOM   1889 C CA  . ALA B 1 22  ? 5.423   -7.119  14.447  1.00 61.44  ? 371 ALA A CA  1 
ATOM   1890 C C   . ALA B 1 22  ? 4.500   -7.854  13.427  1.00 56.41  ? 371 ALA A C   1 
ATOM   1891 O O   . ALA B 1 22  ? 3.870   -7.233  12.602  1.00 49.80  ? 371 ALA A O   1 
ATOM   1892 C CB  . ALA B 1 22  ? 6.885   -7.214  14.024  1.00 58.20  ? 371 ALA A CB  1 
ATOM   1893 N N   . HIS B 1 23  ? 4.469   -9.175  13.472  1.00 50.55  ? 372 HIS A N   1 
ATOM   1894 C CA  . HIS B 1 23  ? 3.558   -9.935  12.614  1.00 54.71  ? 372 HIS A CA  1 
ATOM   1895 C C   . HIS B 1 23  ? 2.103   -9.509  12.804  1.00 46.42  ? 372 HIS A C   1 
ATOM   1896 O O   . HIS B 1 23  ? 1.464   -9.043  11.861  1.00 57.21  ? 372 HIS A O   1 
ATOM   1897 C CB  . HIS B 1 23  ? 3.706   -11.422 12.872  1.00 52.45  ? 372 HIS A CB  1 
ATOM   1898 C CG  . HIS B 1 23  ? 2.673   -12.243 12.178  1.00 58.66  ? 372 HIS A CG  1 
ATOM   1899 N ND1 . HIS B 1 23  ? 2.629   -12.369 10.807  1.00 60.48  ? 372 HIS A ND1 1 
ATOM   1900 C CD2 . HIS B 1 23  ? 1.633   -12.962 12.660  1.00 52.62  ? 372 HIS A CD2 1 
ATOM   1901 C CE1 . HIS B 1 23  ? 1.612   -13.139 10.474  1.00 52.10  ? 372 HIS A CE1 1 
ATOM   1902 N NE2 . HIS B 1 23  ? 0.992   -13.507 11.579  1.00 56.01  ? 372 HIS A NE2 1 
ATOM   1903 N N   . LEU B 1 24  ? 1.603   -9.622  14.027  1.00 48.44  ? 373 LEU A N   1 
ATOM   1904 C CA  . LEU B 1 24  ? 0.219   -9.236  14.319  1.00 59.84  ? 373 LEU A CA  1 
ATOM   1905 C C   . LEU B 1 24  ? -0.139  -7.814  13.948  1.00 55.73  ? 373 LEU A C   1 
ATOM   1906 O O   . LEU B 1 24  ? -1.205  -7.598  13.440  1.00 61.03  ? 373 LEU A O   1 
ATOM   1907 C CB  . LEU B 1 24  ? -0.135  -9.495  15.777  1.00 62.72  ? 373 LEU A CB  1 
ATOM   1908 C CG  . LEU B 1 24  ? -0.169  -10.991 16.142  1.00 64.83  ? 373 LEU A CG  1 
ATOM   1909 C CD1 . LEU B 1 24  ? -0.447  -11.147 17.622  1.00 61.61  ? 373 LEU A CD1 1 
ATOM   1910 C CD2 . LEU B 1 24  ? -1.168  -11.804 15.297  1.00 60.63  ? 373 LEU A CD2 1 
ATOM   1911 N N   . ASP B 1 25  ? 0.761   -6.853  14.129  1.00 61.28  ? 374 ASP A N   1 
ATOM   1912 C CA  . ASP B 1 25  ? 0.438   -5.475  13.765  1.00 62.63  ? 374 ASP A CA  1 
ATOM   1913 C C   . ASP B 1 25  ? 0.478   -5.205  12.270  1.00 65.25  ? 374 ASP A C   1 
ATOM   1914 O O   . ASP B 1 25  ? 0.072   -4.122  11.837  1.00 64.15  ? 374 ASP A O   1 
ATOM   1915 C CB  . ASP B 1 25  ? 1.376   -4.468  14.456  1.00 68.65  ? 374 ASP A CB  1 
ATOM   1916 C CG  . ASP B 1 25  ? 1.079   -4.299  15.921  1.00 75.87  ? 374 ASP A CG  1 
ATOM   1917 O OD1 . ASP B 1 25  ? -0.004  -4.744  16.370  1.00 70.60  ? 374 ASP A OD1 1 
ATOM   1918 O OD2 . ASP B 1 25  ? 1.955   -3.759  16.644  1.00 82.28  ? 374 ASP A OD2 1 
ATOM   1919 N N   . SER B 1 26  ? 0.980   -6.147  11.471  1.00 63.61  ? 375 SER A N   1 
ATOM   1920 C CA  . SER B 1 26  ? 1.144   -5.890  10.030  1.00 55.93  ? 375 SER A CA  1 
ATOM   1921 C C   . SER B 1 26  ? -0.001  -6.473  9.221   1.00 60.08  ? 375 SER A C   1 
ATOM   1922 O O   . SER B 1 26  ? 0.051   -6.529  8.001   1.00 51.83  ? 375 SER A O   1 
ATOM   1923 C CB  . SER B 1 26  ? 2.418   -6.566  9.564   1.00 51.10  ? 375 SER A CB  1 
ATOM   1924 O OG  . SER B 1 26  ? 2.255   -7.956  9.561   1.00 46.97  ? 375 SER A OG  1 
ATOM   1925 N N   . GLY B 1 27  ? -0.987  -7.013  9.904   1.00 65.27  ? 376 GLY A N   1 
ATOM   1926 C CA  . GLY B 1 27  ? -2.086  -7.619  9.241   1.00 68.17  ? 376 GLY A CA  1 
ATOM   1927 C C   . GLY B 1 27  ? -3.322  -7.205  9.968   1.00 64.73  ? 376 GLY A C   1 
ATOM   1928 O O   . GLY B 1 27  ? -3.270  -6.456  10.950  1.00 65.41  ? 376 GLY A O   1 
ATOM   1929 N N   . PRO B 1 28  ? -4.451  -7.678  9.487   1.00 64.88  ? 377 PRO A N   1 
ATOM   1930 C CA  . PRO B 1 28  ? -5.677  -7.281  10.102  1.00 72.95  ? 377 PRO A CA  1 
ATOM   1931 C C   . PRO B 1 28  ? -6.213  -8.312  11.104  1.00 73.16  ? 377 PRO A C   1 
ATOM   1932 O O   . PRO B 1 28  ? -6.016  -9.518  10.917  1.00 70.03  ? 377 PRO A O   1 
ATOM   1933 C CB  . PRO B 1 28  ? -6.599  -7.150  8.904   1.00 79.31  ? 377 PRO A CB  1 
ATOM   1934 C CG  . PRO B 1 28  ? -6.140  -8.243  7.995   1.00 77.30  ? 377 PRO A CG  1 
ATOM   1935 C CD  . PRO B 1 28  ? -4.670  -8.375  8.210   1.00 73.92  ? 377 PRO A CD  1 
ATOM   1936 N N   . SER B 1 29  ? -6.825  -7.812  12.178  1.00 79.02  ? 378 SER A N   1 
ATOM   1937 C CA  . SER B 1 29  ? -7.658  -8.605  13.097  1.00 87.21  ? 378 SER A CA  1 
ATOM   1938 C C   . SER B 1 29  ? -9.000  -8.986  12.453  1.00 87.68  ? 378 SER A C   1 
ATOM   1939 O O   . SER B 1 29  ? -9.460  -8.344  11.508  1.00 78.60  ? 378 SER A O   1 
ATOM   1940 C CB  . SER B 1 29  ? -7.918  -7.820  14.379  1.00 88.24  ? 378 SER A CB  1 
ATOM   1941 O OG  . SER B 1 29  ? -8.232  -6.471  14.099  1.00 89.37  ? 378 SER A OG  1 
ATOM   1942 N N   . THR B 1 30  ? -9.619  -10.035 12.969  1.00 91.92  ? 379 THR A N   1 
ATOM   1943 C CA  . THR B 1 30  ? -10.906 -10.450 12.445  1.00 105.58 ? 379 THR A CA  1 
ATOM   1944 C C   . THR B 1 30  ? -11.869 -9.250  12.331  1.00 102.71 ? 379 THR A C   1 
ATOM   1945 O O   . THR B 1 30  ? -12.034 -8.656  11.258  1.00 106.25 ? 379 THR A O   1 
ATOM   1946 C CB  . THR B 1 30  ? -11.474 -11.620 13.275  1.00 111.50 ? 379 THR A CB  1 
ATOM   1947 O OG1 . THR B 1 30  ? -10.663 -12.770 13.014  1.00 117.22 ? 379 THR A OG1 1 
ATOM   1948 C CG2 . THR B 1 30  ? -12.931 -11.946 12.931  1.00 114.29 ? 379 THR A CG2 1 
ATOM   1949 N N   . ALA B 1 31  ? -12.494 -8.876  13.428  1.00 104.63 ? 380 ALA A N   1 
ATOM   1950 C CA  . ALA B 1 31  ? -13.238 -7.612  13.434  1.00 112.54 ? 380 ALA A CA  1 
ATOM   1951 C C   . ALA B 1 31  ? -12.313 -6.487  12.936  1.00 107.38 ? 380 ALA A C   1 
ATOM   1952 O O   . ALA B 1 31  ? -11.482 -6.015  13.693  1.00 114.99 ? 380 ALA A O   1 
ATOM   1953 C CB  . ALA B 1 31  ? -13.755 -7.294  14.831  1.00 109.91 ? 380 ALA A CB  1 
ATOM   1954 N N   . LYS B 1 32  ? -12.511 -6.074  11.679  1.00 103.57 ? 381 LYS A N   1 
ATOM   1955 C CA  . LYS B 1 32  ? -11.734 -5.044  10.885  1.00 104.59 ? 381 LYS A CA  1 
ATOM   1956 C C   . LYS B 1 32  ? -11.238 -5.597  9.494   1.00 97.16  ? 381 LYS A C   1 
ATOM   1957 O O   . LYS B 1 32  ? -10.575 -4.908  8.689   1.00 84.12  ? 381 LYS A O   1 
ATOM   1958 C CB  . LYS B 1 32  ? -10.702 -4.220  11.707  1.00 103.87 ? 381 LYS A CB  1 
ATOM   1959 C CG  . LYS B 1 32  ? -9.319  -3.940  11.114  1.00 114.28 ? 381 LYS A CG  1 
ATOM   1960 C CD  . LYS B 1 32  ? -8.339  -5.071  11.412  1.00 119.24 ? 381 LYS A CD  1 
ATOM   1961 C CE  . LYS B 1 32  ? -7.006  -4.530  11.926  1.00 127.45 ? 381 LYS A CE  1 
ATOM   1962 N NZ  . LYS B 1 32  ? -6.920  -4.412  13.408  1.00 130.93 ? 381 LYS A NZ  1 
ATOM   1963 N N   . LEU B 1 33  ? -11.631 -6.845  9.219   1.00 91.81  ? 382 LEU A N   1 
ATOM   1964 C CA  . LEU B 1 33  ? -11.847 -7.365  7.851   1.00 82.89  ? 382 LEU A CA  1 
ATOM   1965 C C   . LEU B 1 33  ? -12.855 -6.488  7.109   1.00 78.23  ? 382 LEU A C   1 
ATOM   1966 O O   . LEU B 1 33  ? -13.955 -6.211  7.616   1.00 73.52  ? 382 LEU A O   1 
ATOM   1967 C CB  . LEU B 1 33  ? -12.367 -8.803  7.920   1.00 72.53  ? 382 LEU A CB  1 
ATOM   1968 C CG  . LEU B 1 33  ? -11.373 -9.968  7.755   1.00 78.72  ? 382 LEU A CG  1 
ATOM   1969 C CD1 . LEU B 1 33  ? -9.909  -9.587  7.962   1.00 73.81  ? 382 LEU A CD1 1 
ATOM   1970 C CD2 . LEU B 1 33  ? -11.772 -11.132 8.643   1.00 79.48  ? 382 LEU A CD2 1 
ATOM   1971 N N   . ASP B 1 34  ? -12.450 -6.043  5.922   1.00 66.72  ? 383 ASP A N   1 
ATOM   1972 C CA  . ASP B 1 34  ? -13.218 -5.129  5.120   1.00 61.35  ? 383 ASP A CA  1 
ATOM   1973 C C   . ASP B 1 34  ? -13.884 -5.901  3.981   1.00 58.88  ? 383 ASP A C   1 
ATOM   1974 O O   . ASP B 1 34  ? -13.226 -6.336  2.999   1.00 52.14  ? 383 ASP A O   1 
ATOM   1975 C CB  . ASP B 1 34  ? -12.304 -4.017  4.602   1.00 60.16  ? 383 ASP A CB  1 
ATOM   1976 C CG  . ASP B 1 34  ? -12.981 -3.124  3.583   1.00 65.69  ? 383 ASP A CG  1 
ATOM   1977 O OD1 . ASP B 1 34  ? -12.231 -2.318  2.991   1.00 59.43  ? 383 ASP A OD1 1 
ATOM   1978 O OD2 . ASP B 1 34  ? -14.229 -3.243  3.353   1.00 65.57  ? 383 ASP A OD2 1 
ATOM   1979 N N   . TYR B 1 35  ? -15.198 -6.042  4.118   1.00 55.68  ? 384 TYR A N   1 
ATOM   1980 C CA  . TYR B 1 35  ? -16.013 -6.754  3.173   1.00 59.25  ? 384 TYR A CA  1 
ATOM   1981 C C   . TYR B 1 35  ? -16.738 -5.851  2.179   1.00 61.88  ? 384 TYR A C   1 
ATOM   1982 O O   . TYR B 1 35  ? -17.662 -6.316  1.461   1.00 55.63  ? 384 TYR A O   1 
ATOM   1983 C CB  . TYR B 1 35  ? -17.036 -7.574  3.923   1.00 59.89  ? 384 TYR A CB  1 
ATOM   1984 C CG  . TYR B 1 35  ? -16.500 -8.878  4.458   1.00 68.73  ? 384 TYR A CG  1 
ATOM   1985 C CD1 . TYR B 1 35  ? -16.017 -8.980  5.754   1.00 64.73  ? 384 TYR A CD1 1 
ATOM   1986 C CD2 . TYR B 1 35  ? -16.509 -10.034 3.672   1.00 67.46  ? 384 TYR A CD2 1 
ATOM   1987 C CE1 . TYR B 1 35  ? -15.559 -10.198 6.251   1.00 63.23  ? 384 TYR A CE1 1 
ATOM   1988 C CE2 . TYR B 1 35  ? -16.040 -11.238 4.164   1.00 74.86  ? 384 TYR A CE2 1 
ATOM   1989 C CZ  . TYR B 1 35  ? -15.571 -11.310 5.454   1.00 66.58  ? 384 TYR A CZ  1 
ATOM   1990 O OH  . TYR B 1 35  ? -15.110 -12.521 5.914   1.00 80.38  ? 384 TYR A OH  1 
ATOM   1991 N N   . SER B 1 36  ? -16.333 -4.576  2.123   1.00 59.35  ? 385 SER A N   1 
ATOM   1992 C CA  . SER B 1 36  ? -17.079 -3.575  1.323   1.00 58.66  ? 385 SER A CA  1 
ATOM   1993 C C   . SER B 1 36  ? -16.978 -3.814  -0.188  1.00 67.31  ? 385 SER A C   1 
ATOM   1994 O O   . SER B 1 36  ? -17.738 -3.227  -0.960  1.00 62.96  ? 385 SER A O   1 
ATOM   1995 C CB  . SER B 1 36  ? -16.621 -2.136  1.644   1.00 57.51  ? 385 SER A CB  1 
ATOM   1996 O OG  . SER B 1 36  ? -15.214 -1.947  1.504   1.00 55.45  ? 385 SER A OG  1 
ATOM   1997 N N   . LYS B 1 37  ? -16.033 -4.640  -0.633  1.00 61.58  ? 386 LYS A N   1 
ATOM   1998 C CA  . LYS B 1 37  ? -15.956 -4.948  -2.061  1.00 56.36  ? 386 LYS A CA  1 
ATOM   1999 C C   . LYS B 1 37  ? -16.245 -6.402  -2.395  1.00 50.90  ? 386 LYS A C   1 
ATOM   2000 O O   . LYS B 1 37  ? -16.308 -6.758  -3.555  1.00 47.78  ? 386 LYS A O   1 
ATOM   2001 C CB  . LYS B 1 37  ? -14.591 -4.582  -2.584  1.00 65.31  ? 386 LYS A CB  1 
ATOM   2002 C CG  . LYS B 1 37  ? -14.235 -3.115  -2.354  1.00 72.83  ? 386 LYS A CG  1 
ATOM   2003 C CD  . LYS B 1 37  ? -13.243 -2.590  -3.394  1.00 90.57  ? 386 LYS A CD  1 
ATOM   2004 C CE  . LYS B 1 37  ? -12.400 -1.418  -2.887  1.00 92.85  ? 386 LYS A CE  1 
ATOM   2005 N NZ  . LYS B 1 37  ? -11.268 -1.103  -3.809  1.00 85.49  ? 386 LYS A NZ  1 
ATOM   2006 N N   . PHE B 1 38  ? -16.386 -7.226  -1.371  1.00 46.06  ? 387 PHE A N   1 
ATOM   2007 C CA  . PHE B 1 38  ? -16.521 -8.652  -1.537  1.00 49.39  ? 387 PHE A CA  1 
ATOM   2008 C C   . PHE B 1 38  ? -17.817 -9.003  -2.225  1.00 50.62  ? 387 PHE A C   1 
ATOM   2009 O O   . PHE B 1 38  ? -18.858 -8.459  -1.889  1.00 53.55  ? 387 PHE A O   1 
ATOM   2010 C CB  . PHE B 1 38  ? -16.490 -9.302  -0.163  1.00 49.61  ? 387 PHE A CB  1 
ATOM   2011 C CG  . PHE B 1 38  ? -16.636 -10.787 -0.187  1.00 50.00  ? 387 PHE A CG  1 
ATOM   2012 C CD1 . PHE B 1 38  ? -15.547 -11.615 -0.549  1.00 48.78  ? 387 PHE A CD1 1 
ATOM   2013 C CD2 . PHE B 1 38  ? -17.843 -11.384 0.170   1.00 48.71  ? 387 PHE A CD2 1 
ATOM   2014 C CE1 . PHE B 1 38  ? -15.690 -12.995 -0.607  1.00 39.80  ? 387 PHE A CE1 1 
ATOM   2015 C CE2 . PHE B 1 38  ? -17.976 -12.771 0.145   1.00 49.43  ? 387 PHE A CE2 1 
ATOM   2016 C CZ  . PHE B 1 38  ? -16.900 -13.569 -0.238  1.00 47.88  ? 387 PHE A CZ  1 
ATOM   2017 N N   . GLN B 1 39  ? -17.740 -9.895  -3.201  1.00 52.54  ? 388 GLN A N   1 
ATOM   2018 C CA  . GLN B 1 39  ? -18.912 -10.434 -3.861  1.00 56.46  ? 388 GLN A CA  1 
ATOM   2019 C C   . GLN B 1 39  ? -18.740 -11.905 -3.984  1.00 54.34  ? 388 GLN A C   1 
ATOM   2020 O O   . GLN B 1 39  ? -17.754 -12.342 -4.557  1.00 52.53  ? 388 GLN A O   1 
ATOM   2021 C CB  . GLN B 1 39  ? -19.041 -9.822  -5.238  1.00 56.61  ? 388 GLN A CB  1 
ATOM   2022 C CG  . GLN B 1 39  ? -19.398 -8.347  -5.149  1.00 72.59  ? 388 GLN A CG  1 
ATOM   2023 C CD  . GLN B 1 39  ? -20.486 -7.960  -6.101  1.00 85.75  ? 388 GLN A CD  1 
ATOM   2024 O OE1 . GLN B 1 39  ? -21.695 -8.076  -5.790  1.00 89.96  ? 388 GLN A OE1 1 
ATOM   2025 N NE2 . GLN B 1 39  ? -20.076 -7.512  -7.286  1.00 81.69  ? 388 GLN A NE2 1 
ATOM   2026 N N   . GLU B 1 40  ? -19.702 -12.662 -3.468  1.00 54.72  ? 389 GLU A N   1 
ATOM   2027 C CA  . GLU B 1 40  ? -19.583 -14.092 -3.414  1.00 52.25  ? 389 GLU A CA  1 
ATOM   2028 C C   . GLU B 1 40  ? -19.753 -14.751 -4.755  1.00 53.29  ? 389 GLU A C   1 
ATOM   2029 O O   . GLU B 1 40  ? -19.350 -15.891 -4.943  1.00 61.80  ? 389 GLU A O   1 
ATOM   2030 C CB  . GLU B 1 40  ? -20.464 -14.709 -2.310  1.00 59.90  ? 389 GLU A CB  1 
ATOM   2031 C CG  . GLU B 1 40  ? -21.741 -13.998 -1.994  1.00 66.22  ? 389 GLU A CG  1 
ATOM   2032 C CD  . GLU B 1 40  ? -21.626 -12.839 -0.984  1.00 72.84  ? 389 GLU A CD  1 
ATOM   2033 O OE1 . GLU B 1 40  ? -21.335 -13.099 0.201   1.00 80.99  ? 389 GLU A OE1 1 
ATOM   2034 O OE2 . GLU B 1 40  ? -21.889 -11.666 -1.343  1.00 71.61  ? 389 GLU A OE2 1 
ATOM   2035 N N   . LEU B 1 41  ? -20.253 -14.013 -5.723  1.00 54.54  ? 390 LEU A N   1 
ATOM   2036 C CA  . LEU B 1 41  ? -20.306 -14.535 -7.072  1.00 54.04  ? 390 LEU A CA  1 
ATOM   2037 C C   . LEU B 1 41  ? -20.162 -13.354 -7.977  1.00 52.14  ? 390 LEU A C   1 
ATOM   2038 O O   . LEU B 1 41  ? -20.824 -12.346 -7.835  1.00 64.98  ? 390 LEU A O   1 
ATOM   2039 C CB  . LEU B 1 41  ? -21.640 -15.208 -7.352  1.00 54.86  ? 390 LEU A CB  1 
ATOM   2040 C CG  . LEU B 1 41  ? -21.791 -16.343 -8.352  1.00 62.51  ? 390 LEU A CG  1 
ATOM   2041 C CD1 . LEU B 1 41  ? -23.171 -16.191 -8.965  1.00 61.51  ? 390 LEU A CD1 1 
ATOM   2042 C CD2 . LEU B 1 41  ? -20.738 -16.393 -9.437  1.00 61.96  ? 390 LEU A CD2 1 
ATOM   2043 N N   . VAL B 1 42  ? -19.290 -13.469 -8.927  1.00 48.93  ? 391 VAL A N   1 
ATOM   2044 C CA  . VAL B 1 42  ? -19.211 -12.464 -9.909  1.00 54.33  ? 391 VAL A CA  1 
ATOM   2045 C C   . VAL B 1 42  ? -19.021 -13.319 -11.178 1.00 55.11  ? 391 VAL A C   1 
ATOM   2046 O O   . VAL B 1 42  ? -18.597 -14.488 -11.083 1.00 50.14  ? 391 VAL A O   1 
ATOM   2047 C CB  . VAL B 1 42  ? -18.047 -11.527 -9.502  1.00 64.25  ? 391 VAL A CB  1 
ATOM   2048 C CG1 . VAL B 1 42  ? -16.707 -12.063 -10.038 1.00 67.19  ? 391 VAL A CG1 1 
ATOM   2049 C CG2 . VAL B 1 42  ? -18.287 -10.106 -9.960  1.00 65.92  ? 391 VAL A CG2 1 
ATOM   2050 N N   . LEU B 1 43  ? -19.386 -12.781 -12.334 1.00 62.41  ? 392 LEU A N   1 
ATOM   2051 C CA  . LEU B 1 43  ? -19.355 -13.531 -13.575 1.00 66.97  ? 392 LEU A CA  1 
ATOM   2052 C C   . LEU B 1 43  ? -18.326 -12.859 -14.481 1.00 73.31  ? 392 LEU A C   1 
ATOM   2053 O O   . LEU B 1 43  ? -18.602 -11.795 -15.022 1.00 82.45  ? 392 LEU A O   1 
ATOM   2054 C CB  . LEU B 1 43  ? -20.735 -13.567 -14.246 1.00 68.25  ? 392 LEU A CB  1 
ATOM   2055 C CG  . LEU B 1 43  ? -21.976 -13.879 -13.365 1.00 68.65  ? 392 LEU A CG  1 
ATOM   2056 C CD1 . LEU B 1 43  ? -23.284 -13.559 -14.095 1.00 67.99  ? 392 LEU A CD1 1 
ATOM   2057 C CD2 . LEU B 1 43  ? -21.978 -15.305 -12.835 1.00 60.73  ? 392 LEU A CD2 1 
ATOM   2058 N N   . PRO B 1 44  ? -17.113 -13.441 -14.591 1.00 94.74  ? 393 PRO A N   1 
ATOM   2059 C CA  . PRO B 1 44  ? -16.139 -12.787 -15.471 1.00 106.40 ? 393 PRO A CA  1 
ATOM   2060 C C   . PRO B 1 44  ? -16.029 -13.382 -16.870 1.00 102.04 ? 393 PRO A C   1 
ATOM   2061 O O   . PRO B 1 44  ? -16.437 -14.526 -17.120 1.00 92.50  ? 393 PRO A O   1 
ATOM   2062 C CB  . PRO B 1 44  ? -14.783 -13.000 -14.756 1.00 104.82 ? 393 PRO A CB  1 
ATOM   2063 C CG  . PRO B 1 44  ? -15.066 -13.834 -13.539 1.00 107.26 ? 393 PRO A CG  1 
ATOM   2064 C CD  . PRO B 1 44  ? -16.447 -14.418 -13.702 1.00 101.58 ? 393 PRO A CD  1 
ATOM   2065 N N   . HIS B 1 45  ? -15.443 -12.571 -17.748 1.00 93.95  ? 394 HIS A N   1 
ATOM   2066 C CA  . HIS B 1 45  ? -14.866 -13.009 -19.006 1.00 87.57  ? 394 HIS A CA  1 
ATOM   2067 C C   . HIS B 1 45  ? -13.438 -13.480 -18.663 1.00 85.50  ? 394 HIS A C   1 
ATOM   2068 O O   . HIS B 1 45  ? -12.567 -12.663 -18.359 1.00 88.54  ? 394 HIS A O   1 
ATOM   2069 C CB  . HIS B 1 45  ? -14.837 -11.813 -19.957 1.00 84.44  ? 394 HIS A CB  1 
ATOM   2070 C CG  . HIS B 1 45  ? -14.940 -12.162 -21.403 1.00 98.89  ? 394 HIS A CG  1 
ATOM   2071 N ND1 . HIS B 1 45  ? -14.375 -13.298 -21.944 1.00 109.35 ? 394 HIS A ND1 1 
ATOM   2072 C CD2 . HIS B 1 45  ? -15.498 -11.485 -22.437 1.00 107.31 ? 394 HIS A CD2 1 
ATOM   2073 C CE1 . HIS B 1 45  ? -14.619 -13.328 -23.243 1.00 113.34 ? 394 HIS A CE1 1 
ATOM   2074 N NE2 . HIS B 1 45  ? -15.296 -12.238 -23.568 1.00 115.46 ? 394 HIS A NE2 1 
ATOM   2075 N N   . PHE B 1 46  ? -13.210 -14.794 -18.666 1.00 87.15  ? 395 PHE A N   1 
ATOM   2076 C CA  . PHE B 1 46  ? -11.890 -15.377 -18.317 1.00 89.27  ? 395 PHE A CA  1 
ATOM   2077 C C   . PHE B 1 46  ? -10.850 -15.191 -19.440 1.00 76.06  ? 395 PHE A C   1 
ATOM   2078 O O   . PHE B 1 46  ? -11.225 -15.106 -20.613 1.00 79.81  ? 395 PHE A O   1 
ATOM   2079 C CB  . PHE B 1 46  ? -12.004 -16.888 -17.991 1.00 92.85  ? 395 PHE A CB  1 
ATOM   2080 C CG  . PHE B 1 46  ? -12.749 -17.193 -16.713 1.00 90.92  ? 395 PHE A CG  1 
ATOM   2081 C CD1 . PHE B 1 46  ? -12.143 -16.979 -15.469 1.00 86.21  ? 395 PHE A CD1 1 
ATOM   2082 C CD2 . PHE B 1 46  ? -14.061 -17.707 -16.754 1.00 88.21  ? 395 PHE A CD2 1 
ATOM   2083 C CE1 . PHE B 1 46  ? -12.830 -17.251 -14.299 1.00 88.53  ? 395 PHE A CE1 1 
ATOM   2084 C CE2 . PHE B 1 46  ? -14.758 -17.977 -15.586 1.00 82.42  ? 395 PHE A CE2 1 
ATOM   2085 C CZ  . PHE B 1 46  ? -14.139 -17.760 -14.359 1.00 92.59  ? 395 PHE A CZ  1 
ATOM   2086 N N   . GLY B 1 47  ? -9.562  -15.145 -19.054 0.50 65.61  ? 396 GLY A N   1 
ATOM   2087 C CA  . GLY B 1 47  ? -8.407  -15.007 -19.973 0.50 60.10  ? 396 GLY A CA  1 
ATOM   2088 C C   . GLY B 1 47  ? -8.210  -13.593 -20.515 0.50 54.72  ? 396 GLY A C   1 
ATOM   2089 O O   . GLY B 1 47  ? -7.523  -13.375 -21.502 0.50 46.76  ? 396 GLY A O   1 
ATOM   2090 N N   . LYS B 1 48  ? -8.839  -12.636 -19.859 1.00 59.99  ? 397 LYS A N   1 
ATOM   2091 C CA  . LYS B 1 48  ? -8.778  -11.232 -20.234 1.00 69.26  ? 397 LYS A CA  1 
ATOM   2092 C C   . LYS B 1 48  ? -8.950  -10.394 -18.959 1.00 64.85  ? 397 LYS A C   1 
ATOM   2093 O O   . LYS B 1 48  ? -9.268  -10.916 -17.869 1.00 66.73  ? 397 LYS A O   1 
ATOM   2094 C CB  . LYS B 1 48  ? -9.861  -10.933 -21.278 1.00 68.85  ? 397 LYS A CB  1 
ATOM   2095 C CG  . LYS B 1 48  ? -11.242 -10.807 -20.692 1.00 70.45  ? 397 LYS A CG  1 
ATOM   2096 C CD  . LYS B 1 48  ? -11.754 -9.360  -20.751 1.00 86.68  ? 397 LYS A CD  1 
ATOM   2097 C CE  . LYS B 1 48  ? -12.880 -9.127  -21.769 1.00 82.39  ? 397 LYS A CE  1 
ATOM   2098 N NZ  . LYS B 1 48  ? -14.057 -8.389  -21.210 1.00 83.55  ? 397 LYS A NZ  1 
ATOM   2099 N N   . GLU B 1 49  ? -8.709  -9.107  -19.103 1.00 54.93  ? 398 GLU A N   1 
ATOM   2100 C CA  . GLU B 1 49  ? -8.702  -8.202  -17.992 1.00 58.29  ? 398 GLU A CA  1 
ATOM   2101 C C   . GLU B 1 49  ? -8.858  -6.803  -18.530 1.00 55.01  ? 398 GLU A C   1 
ATOM   2102 O O   . GLU B 1 49  ? -8.565  -6.572  -19.664 1.00 55.44  ? 398 GLU A O   1 
ATOM   2103 C CB  . GLU B 1 49  ? -7.366  -8.302  -17.250 1.00 55.62  ? 398 GLU A CB  1 
ATOM   2104 C CG  . GLU B 1 49  ? -6.132  -8.136  -18.101 1.00 48.47  ? 398 GLU A CG  1 
ATOM   2105 C CD  . GLU B 1 49  ? -5.707  -9.396  -18.824 1.00 51.04  ? 398 GLU A CD  1 
ATOM   2106 O OE1 . GLU B 1 49  ? -5.197  -9.305  -19.966 1.00 56.42  ? 398 GLU A OE1 1 
ATOM   2107 O OE2 . GLU B 1 49  ? -5.876  -10.507 -18.298 1.00 55.83  ? 398 GLU A OE2 1 
ATOM   2108 N N   . ASP B 1 50  ? -9.307  -5.887  -17.688 1.00 57.41  ? 399 ASP A N   1 
ATOM   2109 C CA  . ASP B 1 50  ? -9.317  -4.476  -18.020 1.00 55.85  ? 399 ASP A CA  1 
ATOM   2110 C C   . ASP B 1 50  ? -8.485  -3.638  -17.011 1.00 54.74  ? 399 ASP A C   1 
ATOM   2111 O O   . ASP B 1 50  ? -7.919  -4.153  -16.023 1.00 50.63  ? 399 ASP A O   1 
ATOM   2112 C CB  . ASP B 1 50  ? -10.762 -3.984  -18.081 1.00 53.39  ? 399 ASP A CB  1 
ATOM   2113 C CG  . ASP B 1 50  ? -11.449 -4.070  -16.759 1.00 55.98  ? 399 ASP A CG  1 
ATOM   2114 O OD1 . ASP B 1 50  ? -10.839 -3.714  -15.701 1.00 57.63  ? 399 ASP A OD1 1 
ATOM   2115 O OD2 . ASP B 1 50  ? -12.595 -4.592  -16.766 1.00 66.61  ? 399 ASP A OD2 1 
ATOM   2116 N N   . ALA B 1 51  ? -8.428  -2.340  -17.283 1.00 53.34  ? 400 ALA A N   1 
ATOM   2117 C CA  . ALA B 1 51  ? -7.570  -1.423  -16.547 1.00 46.10  ? 400 ALA A CA  1 
ATOM   2118 C C   . ALA B 1 51  ? -7.865  -1.444  -15.060 1.00 42.88  ? 400 ALA A C   1 
ATOM   2119 O O   . ALA B 1 51  ? -6.959  -1.337  -14.276 1.00 48.52  ? 400 ALA A O   1 
ATOM   2120 C CB  . ALA B 1 51  ? -7.703  -0.015  -17.094 1.00 49.21  ? 400 ALA A CB  1 
ATOM   2121 N N   . GLY B 1 52  ? -9.125  -1.563  -14.662 1.00 42.81  ? 401 GLY A N   1 
ATOM   2122 C CA  . GLY B 1 52  ? -9.472  -1.576  -13.229 1.00 38.53  ? 401 GLY A CA  1 
ATOM   2123 C C   . GLY B 1 52  ? -8.885  -2.830  -12.566 1.00 47.47  ? 401 GLY A C   1 
ATOM   2124 O O   . GLY B 1 52  ? -8.382  -2.772  -11.449 1.00 48.96  ? 401 GLY A O   1 
ATOM   2125 N N   . ASP B 1 53  ? -8.978  -3.969  -13.250 1.00 42.96  ? 402 ASP A N   1 
ATOM   2126 C CA  . ASP B 1 53  ? -8.427  -5.189  -12.713 1.00 46.14  ? 402 ASP A CA  1 
ATOM   2127 C C   . ASP B 1 53  ? -6.925  -5.054  -12.584 1.00 44.18  ? 402 ASP A C   1 
ATOM   2128 O O   . ASP B 1 53  ? -6.367  -5.482  -11.573 1.00 43.00  ? 402 ASP A O   1 
ATOM   2129 C CB  . ASP B 1 53  ? -8.736  -6.391  -13.597 1.00 50.19  ? 402 ASP A CB  1 
ATOM   2130 C CG  . ASP B 1 53  ? -10.235 -6.548  -13.906 1.00 55.79  ? 402 ASP A CG  1 
ATOM   2131 O OD1 . ASP B 1 53  ? -11.078 -6.326  -13.010 1.00 54.49  ? 402 ASP A OD1 1 
ATOM   2132 O OD2 . ASP B 1 53  ? -10.540 -6.924  -15.056 1.00 54.11  ? 402 ASP A OD2 1 
ATOM   2133 N N   . VAL B 1 54  ? -6.249  -4.482  -13.585 1.00 41.98  ? 403 VAL A N   1 
ATOM   2134 C CA  . VAL B 1 54  ? -4.803  -4.379  -13.496 1.00 42.51  ? 403 VAL A CA  1 
ATOM   2135 C C   . VAL B 1 54  ? -4.394  -3.398  -12.414 1.00 44.07  ? 403 VAL A C   1 
ATOM   2136 O O   . VAL B 1 54  ? -3.465  -3.656  -11.634 1.00 40.59  ? 403 VAL A O   1 
ATOM   2137 C CB  . VAL B 1 54  ? -4.159  -4.024  -14.829 1.00 44.42  ? 403 VAL A CB  1 
ATOM   2138 C CG1 . VAL B 1 54  ? -2.655  -4.001  -14.648 1.00 47.72  ? 403 VAL A CG1 1 
ATOM   2139 C CG2 . VAL B 1 54  ? -4.507  -5.077  -15.870 1.00 47.59  ? 403 VAL A CG2 1 
ATOM   2140 N N   . GLN B 1 55  ? -5.101  -2.273  -12.325 1.00 46.43  ? 404 GLN A N   1 
ATOM   2141 C CA  . GLN B 1 55  ? -4.750  -1.290  -11.311 1.00 43.68  ? 404 GLN A CA  1 
ATOM   2142 C C   . GLN B 1 55  ? -4.894  -1.885  -9.903  1.00 38.75  ? 404 GLN A C   1 
ATOM   2143 O O   . GLN B 1 55  ? -4.065  -1.674  -9.014  1.00 46.28  ? 404 GLN A O   1 
ATOM   2144 C CB  . GLN B 1 55  ? -5.583  -0.008  -11.469 1.00 44.20  ? 404 GLN A CB  1 
ATOM   2145 C CG  . GLN B 1 55  ? -5.078  1.165   -10.643 1.00 43.36  ? 404 GLN A CG  1 
ATOM   2146 C CD  . GLN B 1 55  ? -3.603  1.500   -10.993 1.00 49.38  ? 404 GLN A CD  1 
ATOM   2147 O OE1 . GLN B 1 55  ? -3.265  1.811   -12.128 1.00 55.24  ? 404 GLN A OE1 1 
ATOM   2148 N NE2 . GLN B 1 55  ? -2.727  1.387   -10.014 1.00 53.07  ? 404 GLN A NE2 1 
ATOM   2149 N N   . GLN B 1 56  ? -5.985  -2.581  -9.659  1.00 42.28  ? 405 GLN A N   1 
ATOM   2150 C CA  . GLN B 1 56  ? -6.187  -3.209  -8.352  1.00 45.12  ? 405 GLN A CA  1 
ATOM   2151 C C   . GLN B 1 56  ? -5.044  -4.276  -8.035  1.00 42.30  ? 405 GLN A C   1 
ATOM   2152 O O   . GLN B 1 56  ? -4.470  -4.293  -6.970  1.00 42.61  ? 405 GLN A O   1 
ATOM   2153 C CB  . GLN B 1 56  ? -7.563  -3.848  -8.350  1.00 42.16  ? 405 GLN A CB  1 
ATOM   2154 C CG  . GLN B 1 56  ? -7.889  -4.479  -7.015  1.00 46.15  ? 405 GLN A CG  1 
ATOM   2155 C CD  . GLN B 1 56  ? -9.204  -5.222  -7.035  1.00 46.02  ? 405 GLN A CD  1 
ATOM   2156 O OE1 . GLN B 1 56  ? -9.394  -6.157  -7.807  1.00 58.14  ? 405 GLN A OE1 1 
ATOM   2157 N NE2 . GLN B 1 56  ? -10.100 -4.835  -6.180  1.00 50.81  ? 405 GLN A NE2 1 
ATOM   2158 N N   . PHE B 1 57  ? -4.687  -5.097  -9.003  1.00 39.09  ? 406 PHE A N   1 
ATOM   2159 C CA  . PHE B 1 57  ? -3.539  -6.040  -8.846  1.00 41.18  ? 406 PHE A CA  1 
ATOM   2160 C C   . PHE B 1 57  ? -2.286  -5.287  -8.365  1.00 39.97  ? 406 PHE A C   1 
ATOM   2161 O O   . PHE B 1 57  ? -1.716  -5.601  -7.353  1.00 40.61  ? 406 PHE A O   1 
ATOM   2162 C CB  . PHE B 1 57  ? -3.280  -6.704  -10.190 1.00 34.88  ? 406 PHE A CB  1 
ATOM   2163 C CG  . PHE B 1 57  ? -2.029  -7.522  -10.262 1.00 39.27  ? 406 PHE A CG  1 
ATOM   2164 C CD1 . PHE B 1 57  ? -2.034  -8.838  -9.870  1.00 43.25  ? 406 PHE A CD1 1 
ATOM   2165 C CD2 . PHE B 1 57  ? -0.879  -7.017  -10.794 1.00 43.76  ? 406 PHE A CD2 1 
ATOM   2166 C CE1 . PHE B 1 57  ? -0.908  -9.638  -9.979  1.00 43.91  ? 406 PHE A CE1 1 
ATOM   2167 C CE2 . PHE B 1 57  ? 0.272   -7.806  -10.909 1.00 42.55  ? 406 PHE A CE2 1 
ATOM   2168 C CZ  . PHE B 1 57  ? 0.247   -9.125  -10.497 1.00 43.14  ? 406 PHE A CZ  1 
ATOM   2169 N N   . TYR B 1 58  ? -1.899  -4.251  -9.087  1.00 39.34  ? 407 TYR A N   1 
ATOM   2170 C CA  . TYR B 1 58  ? -0.744  -3.448  -8.687  1.00 42.03  ? 407 TYR A CA  1 
ATOM   2171 C C   . TYR B 1 58  ? -0.914  -2.768  -7.360  1.00 43.14  ? 407 TYR A C   1 
ATOM   2172 O O   . TYR B 1 58  ? 0.019   -2.789  -6.504  1.00 46.78  ? 407 TYR A O   1 
ATOM   2173 C CB  . TYR B 1 58  ? -0.417  -2.417  -9.749  1.00 40.85  ? 407 TYR A CB  1 
ATOM   2174 C CG  . TYR B 1 58  ? 0.188   -2.979  -10.996 1.00 37.75  ? 407 TYR A CG  1 
ATOM   2175 C CD1 . TYR B 1 58  ? 1.227   -3.894  -10.931 1.00 41.65  ? 407 TYR A CD1 1 
ATOM   2176 C CD2 . TYR B 1 58  ? -0.228  -2.560  -12.249 1.00 43.32  ? 407 TYR A CD2 1 
ATOM   2177 C CE1 . TYR B 1 58  ? 1.816   -4.410  -12.074 1.00 36.82  ? 407 TYR A CE1 1 
ATOM   2178 C CE2 . TYR B 1 58  ? 0.394   -3.044  -13.398 1.00 41.75  ? 407 TYR A CE2 1 
ATOM   2179 C CZ  . TYR B 1 58  ? 1.397   -3.987  -13.283 1.00 42.32  ? 407 TYR A CZ  1 
ATOM   2180 O OH  . TYR B 1 58  ? 2.038   -4.473  -14.400 1.00 48.54  ? 407 TYR A OH  1 
ATOM   2181 N N   . ASP B 1 59  ? -2.102  -2.224  -7.126  1.00 39.57  ? 408 ASP A N   1 
ATOM   2182 C CA  . ASP B 1 59  ? -2.355  -1.581  -5.833  1.00 39.13  ? 408 ASP A CA  1 
ATOM   2183 C C   . ASP B 1 59  ? -2.195  -2.547  -4.679  1.00 40.99  ? 408 ASP A C   1 
ATOM   2184 O O   . ASP B 1 59  ? -1.693  -2.183  -3.605  1.00 48.35  ? 408 ASP A O   1 
ATOM   2185 C CB  . ASP B 1 59  ? -3.768  -0.943  -5.769  1.00 44.84  ? 408 ASP A CB  1 
ATOM   2186 C CG  . ASP B 1 59  ? -3.912  0.298   -6.641  1.00 47.24  ? 408 ASP A CG  1 
ATOM   2187 O OD1 . ASP B 1 59  ? -2.874  0.785   -7.188  1.00 44.43  ? 408 ASP A OD1 1 
ATOM   2188 O OD2 . ASP B 1 59  ? -5.084  0.756   -6.795  1.00 51.72  ? 408 ASP A OD2 1 
ATOM   2189 N N   . LEU B 1 60  ? -2.664  -3.771  -4.854  1.00 47.38  ? 409 LEU A N   1 
ATOM   2190 C CA  . LEU B 1 60  ? -2.573  -4.794  -3.790  1.00 49.25  ? 409 LEU A CA  1 
ATOM   2191 C C   . LEU B 1 60  ? -1.101  -5.154  -3.504  1.00 42.63  ? 409 LEU A C   1 
ATOM   2192 O O   . LEU B 1 60  ? -0.641  -5.207  -2.392  1.00 43.52  ? 409 LEU A O   1 
ATOM   2193 C CB  . LEU B 1 60  ? -3.327  -6.034  -4.254  1.00 51.52  ? 409 LEU A CB  1 
ATOM   2194 C CG  . LEU B 1 60  ? -4.769  -6.272  -3.799  1.00 49.53  ? 409 LEU A CG  1 
ATOM   2195 C CD1 . LEU B 1 60  ? -5.332  -5.199  -2.911  1.00 46.87  ? 409 LEU A CD1 1 
ATOM   2196 C CD2 . LEU B 1 60  ? -5.655  -6.610  -4.953  1.00 48.35  ? 409 LEU A CD2 1 
ATOM   2197 N N   . LEU B 1 61  ? -0.369  -5.354  -4.562  1.00 39.92  ? 410 LEU A N   1 
ATOM   2198 C CA  . LEU B 1 61  ? 1.052   -5.581  -4.491  1.00 42.98  ? 410 LEU A CA  1 
ATOM   2199 C C   . LEU B 1 61  ? 1.770   -4.379  -3.776  1.00 44.04  ? 410 LEU A C   1 
ATOM   2200 O O   . LEU B 1 61  ? 2.518   -4.552  -2.787  1.00 43.61  ? 410 LEU A O   1 
ATOM   2201 C CB  . LEU B 1 61  ? 1.533   -5.772  -5.925  1.00 43.87  ? 410 LEU A CB  1 
ATOM   2202 C CG  . LEU B 1 61  ? 2.031   -7.126  -6.420  1.00 43.24  ? 410 LEU A CG  1 
ATOM   2203 C CD1 . LEU B 1 61  ? 1.474   -8.306  -5.716  1.00 43.67  ? 410 LEU A CD1 1 
ATOM   2204 C CD2 . LEU B 1 61  ? 1.892   -7.264  -7.918  1.00 41.83  ? 410 LEU A CD2 1 
ATOM   2205 N N   . SER B 1 62  ? 1.458   -3.166  -4.192  1.00 47.11  ? 411 SER A N   1 
ATOM   2206 C CA  . SER B 1 62  ? 2.046   -1.946  -3.550  1.00 49.86  ? 411 SER A CA  1 
ATOM   2207 C C   . SER B 1 62  ? 1.746   -1.762  -2.080  1.00 42.74  ? 411 SER A C   1 
ATOM   2208 O O   . SER B 1 62  ? 2.629   -1.472  -1.278  1.00 45.03  ? 411 SER A O   1 
ATOM   2209 C CB  . SER B 1 62  ? 1.554   -0.670  -4.231  1.00 47.85  ? 411 SER A CB  1 
ATOM   2210 O OG  . SER B 1 62  ? 2.166   -0.530  -5.437  1.00 50.00  ? 411 SER A OG  1 
ATOM   2211 N N   . GLY B 1 63  ? 0.500   -1.941  -1.707  1.00 42.86  ? 412 GLY A N   1 
ATOM   2212 C CA  . GLY B 1 63  ? 0.146   -1.728  -0.331  1.00 45.95  ? 412 GLY A CA  1 
ATOM   2213 C C   . GLY B 1 63  ? 0.774   -2.765  0.546   1.00 44.93  ? 412 GLY A C   1 
ATOM   2214 O O   . GLY B 1 63  ? 1.065   -2.527  1.715   1.00 52.17  ? 412 GLY A O   1 
ATOM   2215 N N   . SER B 1 64  ? 0.895   -3.960  -0.010  1.00 44.56  ? 413 SER A N   1 
ATOM   2216 C CA  . SER B 1 64  ? 1.510   -5.056  0.722   1.00 44.45  ? 413 SER A CA  1 
ATOM   2217 C C   . SER B 1 64  ? 3.001   -4.821  0.900   1.00 44.29  ? 413 SER A C   1 
ATOM   2218 O O   . SER B 1 64  ? 3.533   -5.037  1.985   1.00 42.21  ? 413 SER A O   1 
ATOM   2219 C CB  . SER B 1 64  ? 1.217   -6.387  0.052   1.00 52.24  ? 413 SER A CB  1 
ATOM   2220 O OG  . SER B 1 64  ? 2.307   -7.287  0.141   1.00 57.06  ? 413 SER A OG  1 
ATOM   2221 N N   . LEU B 1 65  ? 3.667   -4.297  -0.131  1.00 42.65  ? 414 LEU A N   1 
ATOM   2222 C CA  . LEU B 1 65  ? 5.032   -3.874  0.061   1.00 44.41  ? 414 LEU A CA  1 
ATOM   2223 C C   . LEU B 1 65  ? 5.193   -2.781  1.151   1.00 47.47  ? 414 LEU A C   1 
ATOM   2224 O O   . LEU B 1 65  ? 6.060   -2.893  1.992   1.00 46.34  ? 414 LEU A O   1 
ATOM   2225 C CB  . LEU B 1 65  ? 5.639   -3.378  -1.200  1.00 47.26  ? 414 LEU A CB  1 
ATOM   2226 C CG  . LEU B 1 65  ? 7.107   -2.974  -1.101  1.00 54.06  ? 414 LEU A CG  1 
ATOM   2227 C CD1 . LEU B 1 65  ? 7.938   -4.163  -0.647  1.00 54.50  ? 414 LEU A CD1 1 
ATOM   2228 C CD2 . LEU B 1 65  ? 7.562   -2.426  -2.454  1.00 57.02  ? 414 LEU A CD2 1 
ATOM   2229 N N   . GLU B 1 66  ? 4.365   -1.746  1.155   1.00 51.53  ? 415 GLU A N   1 
ATOM   2230 C CA  . GLU B 1 66  ? 4.366   -0.742  2.265   1.00 47.70  ? 415 GLU A CA  1 
ATOM   2231 C C   . GLU B 1 66  ? 4.172   -1.388  3.593   1.00 46.05  ? 415 GLU A C   1 
ATOM   2232 O O   . GLU B 1 66  ? 4.831   -1.032  4.570   1.00 55.81  ? 415 GLU A O   1 
ATOM   2233 C CB  . GLU B 1 66  ? 3.179   0.250   2.111   1.00 52.30  ? 415 GLU A CB  1 
ATOM   2234 C CG  . GLU B 1 66  ? 3.321   1.318   1.020   1.00 67.94  ? 415 GLU A CG  1 
ATOM   2235 C CD  . GLU B 1 66  ? 2.079   2.227   0.909   1.00 89.34  ? 415 GLU A CD  1 
ATOM   2236 O OE1 . GLU B 1 66  ? 1.900   3.077   1.818   1.00 100.24 ? 415 GLU A OE1 1 
ATOM   2237 O OE2 . GLU B 1 66  ? 1.279   2.102   -0.066  1.00 83.71  ? 415 GLU A OE2 1 
ATOM   2238 N N   . VAL B 1 67  ? 3.192   -2.286  3.693   1.00 40.50  ? 416 VAL A N   1 
ATOM   2239 C CA  . VAL B 1 67  ? 2.993   -2.969  4.957   1.00 40.71  ? 416 VAL A CA  1 
ATOM   2240 C C   . VAL B 1 67  ? 4.221   -3.825  5.342   1.00 41.55  ? 416 VAL A C   1 
ATOM   2241 O O   . VAL B 1 67  ? 4.609   -3.919  6.521   1.00 43.10  ? 416 VAL A O   1 
ATOM   2242 C CB  . VAL B 1 67  ? 1.728   -3.840  4.909   1.00 47.03  ? 416 VAL A CB  1 
ATOM   2243 C CG1 . VAL B 1 67  ? 1.703   -4.869  6.019   1.00 41.28  ? 416 VAL A CG1 1 
ATOM   2244 C CG2 . VAL B 1 67  ? 0.482   -2.963  5.033   1.00 50.24  ? 416 VAL A CG2 1 
ATOM   2245 N N   . ILE B 1 68  ? 4.800   -4.488  4.360   1.00 40.54  ? 417 ILE A N   1 
ATOM   2246 C CA  . ILE B 1 68  ? 5.896   -5.382  4.668   1.00 45.45  ? 417 ILE A CA  1 
ATOM   2247 C C   . ILE B 1 68  ? 7.105   -4.572  5.128   1.00 45.87  ? 417 ILE A C   1 
ATOM   2248 O O   . ILE B 1 68  ? 7.805   -4.986  6.010   1.00 41.56  ? 417 ILE A O   1 
ATOM   2249 C CB  . ILE B 1 68  ? 6.209   -6.277  3.478   1.00 40.44  ? 417 ILE A CB  1 
ATOM   2250 C CG1 . ILE B 1 68  ? 5.109   -7.326  3.398   1.00 41.58  ? 417 ILE A CG1 1 
ATOM   2251 C CG2 . ILE B 1 68  ? 7.520   -7.007  3.686   1.00 44.10  ? 417 ILE A CG2 1 
ATOM   2252 C CD1 . ILE B 1 68  ? 5.172   -8.166  2.143   1.00 39.45  ? 417 ILE A CD1 1 
ATOM   2253 N N   . ARG B 1 69  ? 7.285   -3.400  4.554   1.00 46.72  ? 418 ARG A N   1 
ATOM   2254 C CA  . ARG B 1 69  ? 8.321   -2.449  4.972   1.00 48.93  ? 418 ARG A CA  1 
ATOM   2255 C C   . ARG B 1 69  ? 8.162   -2.022  6.422   1.00 49.37  ? 418 ARG A C   1 
ATOM   2256 O O   . ARG B 1 69  ? 9.143   -1.983  7.146   1.00 55.05  ? 418 ARG A O   1 
ATOM   2257 C CB  . ARG B 1 69  ? 8.315   -1.236  4.047   1.00 52.23  ? 418 ARG A CB  1 
ATOM   2258 C CG  . ARG B 1 69  ? 9.541   -0.380  4.068   1.00 60.79  ? 418 ARG A CG  1 
ATOM   2259 C CD  . ARG B 1 69  ? 9.385   0.774   3.071   1.00 66.59  ? 418 ARG A CD  1 
ATOM   2260 N NE  . ARG B 1 69  ? 9.277   0.443   1.631   1.00 58.24  ? 418 ARG A NE  1 
ATOM   2261 C CZ  . ARG B 1 69  ? 10.330  0.217   0.832   1.00 66.70  ? 418 ARG A CZ  1 
ATOM   2262 N NH1 . ARG B 1 69  ? 11.586  0.166   1.327   1.00 72.28  ? 418 ARG A NH1 1 
ATOM   2263 N NH2 . ARG B 1 69  ? 10.142  0.004   -0.464  1.00 61.22  ? 418 ARG A NH2 1 
ATOM   2264 N N   . LYS B 1 70  ? 6.945   -1.755  6.873   1.00 46.50  ? 419 LYS A N   1 
ATOM   2265 C CA  . LYS B 1 70  ? 6.736   -1.376  8.294   1.00 47.83  ? 419 LYS A CA  1 
ATOM   2266 C C   . LYS B 1 70  ? 6.909   -2.532  9.218   1.00 47.65  ? 419 LYS A C   1 
ATOM   2267 O O   . LYS B 1 70  ? 7.292   -2.369  10.361  1.00 54.99  ? 419 LYS A O   1 
ATOM   2268 C CB  . LYS B 1 70  ? 5.359   -0.721  8.539   1.00 50.08  ? 419 LYS A CB  1 
ATOM   2269 C CG  . LYS B 1 70  ? 5.317   0.663   7.893   1.00 63.74  ? 419 LYS A CG  1 
ATOM   2270 C CD  . LYS B 1 70  ? 3.917   1.271   7.798   1.00 75.32  ? 419 LYS A CD  1 
ATOM   2271 C CE  . LYS B 1 70  ? 3.789   2.126   6.538   1.00 79.18  ? 419 LYS A CE  1 
ATOM   2272 N NZ  . LYS B 1 70  ? 2.406   2.630   6.288   1.00 81.18  ? 419 LYS A NZ  1 
ATOM   2273 N N   . TRP B 1 71  ? 6.619   -3.723  8.741   1.00 49.90  ? 420 TRP A N   1 
ATOM   2274 C CA  . TRP B 1 71  ? 6.815   -4.916  9.569   1.00 46.56  ? 420 TRP A CA  1 
ATOM   2275 C C   . TRP B 1 71  ? 8.327   -5.156  9.747   1.00 47.47  ? 420 TRP A C   1 
ATOM   2276 O O   . TRP B 1 71  ? 8.801   -5.459  10.839  1.00 49.81  ? 420 TRP A O   1 
ATOM   2277 C CB  . TRP B 1 71  ? 6.079   -6.106  8.928   1.00 44.49  ? 420 TRP A CB  1 
ATOM   2278 C CG  . TRP B 1 71  ? 6.587   -7.447  9.287   1.00 43.49  ? 420 TRP A CG  1 
ATOM   2279 C CD1 . TRP B 1 71  ? 6.241   -8.169  10.362  1.00 46.69  ? 420 TRP A CD1 1 
ATOM   2280 C CD2 . TRP B 1 71  ? 7.482   -8.274  8.517   1.00 39.97  ? 420 TRP A CD2 1 
ATOM   2281 N NE1 . TRP B 1 71  ? 6.887   -9.400  10.354  1.00 46.52  ? 420 TRP A NE1 1 
ATOM   2282 C CE2 . TRP B 1 71  ? 7.674   -9.471  9.240   1.00 41.93  ? 420 TRP A CE2 1 
ATOM   2283 C CE3 . TRP B 1 71  ? 8.170   -8.095  7.329   1.00 42.64  ? 420 TRP A CE3 1 
ATOM   2284 C CZ2 . TRP B 1 71  ? 8.497   -10.490 8.802   1.00 41.90  ? 420 TRP A CZ2 1 
ATOM   2285 C CZ3 . TRP B 1 71  ? 9.006   -9.115  6.892   1.00 44.55  ? 420 TRP A CZ3 1 
ATOM   2286 C CH2 . TRP B 1 71  ? 9.153   -10.297 7.631   1.00 46.16  ? 420 TRP A CH2 1 
ATOM   2287 N N   . ALA B 1 72  ? 9.088   -4.992  8.678   1.00 49.57  ? 421 ALA A N   1 
ATOM   2288 C CA  . ALA B 1 72  ? 10.531  -5.274  8.727   1.00 53.03  ? 421 ALA A CA  1 
ATOM   2289 C C   . ALA B 1 72  ? 11.207  -4.298  9.678   1.00 51.02  ? 421 ALA A C   1 
ATOM   2290 O O   . ALA B 1 72  ? 12.060  -4.706  10.474  1.00 46.09  ? 421 ALA A O   1 
ATOM   2291 C CB  . ALA B 1 72  ? 11.160  -5.171  7.346   1.00 52.94  ? 421 ALA A CB  1 
ATOM   2292 N N   . GLU B 1 73  ? 10.783  -3.039  9.605   1.00 49.51  ? 422 GLU A N   1 
ATOM   2293 C CA  . GLU B 1 73  ? 11.318  -1.991  10.459  1.00 58.75  ? 422 GLU A CA  1 
ATOM   2294 C C   . GLU B 1 73  ? 11.144  -2.332  11.937  1.00 52.63  ? 422 GLU A C   1 
ATOM   2295 O O   . GLU B 1 73  ? 11.875  -1.819  12.740  1.00 48.96  ? 422 GLU A O   1 
ATOM   2296 C CB  . GLU B 1 73  ? 10.753  -0.589  10.080  1.00 64.50  ? 422 GLU A CB  1 
ATOM   2297 C CG  . GLU B 1 73  ? 10.199  0.276   11.260  1.00 84.65  ? 422 GLU A CG  1 
ATOM   2298 C CD  . GLU B 1 73  ? 8.844   0.992   10.932  1.00 101.23 ? 422 GLU A CD  1 
ATOM   2299 O OE1 . GLU B 1 73  ? 8.916   2.011   10.182  1.00 98.68  ? 422 GLU A OE1 1 
ATOM   2300 O OE2 . GLU B 1 73  ? 7.704   0.569   11.406  1.00 71.46  ? 422 GLU A OE2 1 
ATOM   2301 N N   . LYS B 1 74  ? 10.250  -3.250  12.291  1.00 48.22  ? 423 LYS A N   1 
ATOM   2302 C CA  . LYS B 1 74  ? 10.083  -3.634  13.682  1.00 48.22  ? 423 LYS A CA  1 
ATOM   2303 C C   . LYS B 1 74  ? 10.790  -4.935  14.037  1.00 50.02  ? 423 LYS A C   1 
ATOM   2304 O O   . LYS B 1 74  ? 10.663  -5.420  15.158  1.00 54.95  ? 423 LYS A O   1 
ATOM   2305 C CB  . LYS B 1 74  ? 8.594   -3.769  14.042  1.00 53.16  ? 423 LYS A CB  1 
ATOM   2306 C CG  . LYS B 1 74  ? 7.793   -2.465  13.982  1.00 57.11  ? 423 LYS A CG  1 
ATOM   2307 C CD  . LYS B 1 74  ? 6.322   -2.786  13.749  1.00 63.51  ? 423 LYS A CD  1 
ATOM   2308 C CE  . LYS B 1 74  ? 5.395   -1.580  13.659  1.00 69.92  ? 423 LYS A CE  1 
ATOM   2309 N NZ  . LYS B 1 74  ? 3.977   -2.061  13.697  1.00 73.02  ? 423 LYS A NZ  1 
ATOM   2310 N N   . ILE B 1 75  ? 11.468  -5.553  13.094  1.00 49.21  ? 424 ILE A N   1 
ATOM   2311 C CA  . ILE B 1 75  ? 12.284  -6.701  13.454  1.00 52.69  ? 424 ILE A CA  1 
ATOM   2312 C C   . ILE B 1 75  ? 13.585  -6.145  14.074  1.00 48.71  ? 424 ILE A C   1 
ATOM   2313 O O   . ILE B 1 75  ? 14.275  -5.342  13.446  1.00 45.78  ? 424 ILE A O   1 
ATOM   2314 C CB  . ILE B 1 75  ? 12.613  -7.569  12.250  1.00 53.46  ? 424 ILE A CB  1 
ATOM   2315 C CG1 . ILE B 1 75  ? 11.331  -8.058  11.606  1.00 54.88  ? 424 ILE A CG1 1 
ATOM   2316 C CG2 . ILE B 1 75  ? 13.497  -8.733  12.693  1.00 50.47  ? 424 ILE A CG2 1 
ATOM   2317 C CD1 . ILE B 1 75  ? 11.539  -8.609  10.216  1.00 54.52  ? 424 ILE A CD1 1 
ATOM   2318 N N   . PRO B 1 76  ? 13.878  -6.515  15.318  1.00 45.44  ? 425 PRO A N   1 
ATOM   2319 C CA  . PRO B 1 76  ? 15.002  -5.858  16.018  1.00 50.55  ? 425 PRO A CA  1 
ATOM   2320 C C   . PRO B 1 76  ? 16.315  -6.109  15.309  1.00 52.09  ? 425 PRO A C   1 
ATOM   2321 O O   . PRO B 1 76  ? 16.606  -7.241  14.920  1.00 48.23  ? 425 PRO A O   1 
ATOM   2322 C CB  . PRO B 1 76  ? 14.983  -6.485  17.409  1.00 50.12  ? 425 PRO A CB  1 
ATOM   2323 C CG  . PRO B 1 76  ? 13.581  -6.962  17.611  1.00 56.97  ? 425 PRO A CG  1 
ATOM   2324 C CD  . PRO B 1 76  ? 13.073  -7.354  16.228  1.00 56.02  ? 425 PRO A CD  1 
ATOM   2325 N N   . GLY B 1 77  ? 17.060  -5.046  15.048  1.00 45.75  ? 426 GLY A N   1 
ATOM   2326 C CA  . GLY B 1 77  ? 18.261  -5.171  14.220  1.00 45.81  ? 426 GLY A CA  1 
ATOM   2327 C C   . GLY B 1 77  ? 18.065  -4.728  12.804  1.00 43.41  ? 426 GLY A C   1 
ATOM   2328 O O   . GLY B 1 77  ? 18.995  -4.222  12.166  1.00 51.73  ? 426 GLY A O   1 
ATOM   2329 N N   . PHE B 1 78  ? 16.868  -4.883  12.272  1.00 41.05  ? 427 PHE A N   1 
ATOM   2330 C CA  . PHE B 1 78  ? 16.703  -4.632  10.836  1.00 41.07  ? 427 PHE A CA  1 
ATOM   2331 C C   . PHE B 1 78  ? 16.935  -3.158  10.440  1.00 43.43  ? 427 PHE A C   1 
ATOM   2332 O O   . PHE B 1 78  ? 17.532  -2.855  9.400   1.00 44.67  ? 427 PHE A O   1 
ATOM   2333 C CB  . PHE B 1 78  ? 15.312  -5.064  10.370  1.00 49.04  ? 427 PHE A CB  1 
ATOM   2334 C CG  . PHE B 1 78  ? 15.134  -4.955  8.905   1.00 42.52  ? 427 PHE A CG  1 
ATOM   2335 C CD1 . PHE B 1 78  ? 15.590  -5.976  8.058   1.00 49.13  ? 427 PHE A CD1 1 
ATOM   2336 C CD2 . PHE B 1 78  ? 14.581  -3.848  8.362   1.00 39.30  ? 427 PHE A CD2 1 
ATOM   2337 C CE1 . PHE B 1 78  ? 15.466  -5.859  6.681   1.00 44.48  ? 427 PHE A CE1 1 
ATOM   2338 C CE2 . PHE B 1 78  ? 14.407  -3.732  6.978   1.00 41.23  ? 427 PHE A CE2 1 
ATOM   2339 C CZ  . PHE B 1 78  ? 14.855  -4.732  6.149   1.00 45.02  ? 427 PHE A CZ  1 
ATOM   2340 N N   . ALA B 1 79  ? 16.463  -2.243  11.279  1.00 46.63  ? 428 ALA A N   1 
ATOM   2341 C CA  . ALA B 1 79  ? 16.452  -0.813  10.938  1.00 50.61  ? 428 ALA A CA  1 
ATOM   2342 C C   . ALA B 1 79  ? 17.850  -0.283  11.000  1.00 54.25  ? 428 ALA A C   1 
ATOM   2343 O O   . ALA B 1 79  ? 18.129  0.787   10.453  1.00 47.73  ? 428 ALA A O   1 
ATOM   2344 C CB  . ALA B 1 79  ? 15.510  -0.007  11.859  1.00 42.27  ? 428 ALA A CB  1 
ATOM   2345 N N   . GLU B 1 80  ? 18.741  -1.058  11.628  1.00 50.91  ? 429 GLU A N   1 
ATOM   2346 C CA  . GLU B 1 80  ? 20.117  -0.624  11.716  1.00 51.44  ? 429 GLU A CA  1 
ATOM   2347 C C   . GLU B 1 80  ? 21.004  -1.146  10.643  1.00 51.26  ? 429 GLU A C   1 
ATOM   2348 O O   . GLU B 1 80  ? 22.182  -0.781  10.583  1.00 49.86  ? 429 GLU A O   1 
ATOM   2349 C CB  . GLU B 1 80  ? 20.667  -0.931  13.098  1.00 54.09  ? 429 GLU A CB  1 
ATOM   2350 C CG  . GLU B 1 80  ? 20.098  0.028   14.102  1.00 49.90  ? 429 GLU A CG  1 
ATOM   2351 C CD  . GLU B 1 80  ? 18.646  -0.244  14.462  1.00 55.12  ? 429 GLU A CD  1 
ATOM   2352 O OE1 . GLU B 1 80  ? 18.322  -1.411  14.799  1.00 53.04  ? 429 GLU A OE1 1 
ATOM   2353 O OE2 . GLU B 1 80  ? 17.824  0.719   14.443  1.00 65.16  ? 429 GLU A OE2 1 
ATOM   2354 N N   . LEU B 1 81  ? 20.482  -2.004  9.787   1.00 46.25  ? 430 LEU A N   1 
ATOM   2355 C CA  . LEU B 1 81  ? 21.263  -2.403  8.607   1.00 44.86  ? 430 LEU A CA  1 
ATOM   2356 C C   . LEU B 1 81  ? 21.434  -1.191  7.686   1.00 50.22  ? 430 LEU A C   1 
ATOM   2357 O O   . LEU B 1 81  ? 20.676  -0.231  7.740   1.00 44.59  ? 430 LEU A O   1 
ATOM   2358 C CB  . LEU B 1 81  ? 20.588  -3.548  7.867   1.00 46.33  ? 430 LEU A CB  1 
ATOM   2359 C CG  . LEU B 1 81  ? 20.375  -4.806  8.746   1.00 46.08  ? 430 LEU A CG  1 
ATOM   2360 C CD1 . LEU B 1 81  ? 19.478  -5.805  8.051   1.00 46.32  ? 430 LEU A CD1 1 
ATOM   2361 C CD2 . LEU B 1 81  ? 21.711  -5.458  9.128   1.00 46.38  ? 430 LEU A CD2 1 
ATOM   2362 N N   . SER B 1 82  ? 22.435  -1.225  6.820   1.00 49.11  ? 431 SER A N   1 
ATOM   2363 C CA  . SER B 1 82  ? 22.562  -0.127  5.921   1.00 49.52  ? 431 SER A CA  1 
ATOM   2364 C C   . SER B 1 82  ? 21.239  0.033   5.131   1.00 51.89  ? 431 SER A C   1 
ATOM   2365 O O   . SER B 1 82  ? 20.501  -0.910  4.921   1.00 51.57  ? 431 SER A O   1 
ATOM   2366 C CB  . SER B 1 82  ? 23.719  -0.320  4.976   1.00 44.95  ? 431 SER A CB  1 
ATOM   2367 O OG  . SER B 1 82  ? 23.425  -1.275  3.985   1.00 48.26  ? 431 SER A OG  1 
ATOM   2368 N N   . PRO B 1 83  ? 20.957  1.245   4.687   1.00 61.14  ? 432 PRO A N   1 
ATOM   2369 C CA  . PRO B 1 83  ? 19.727  1.453   3.924   1.00 57.20  ? 432 PRO A CA  1 
ATOM   2370 C C   . PRO B 1 83  ? 19.714  0.637   2.661   1.00 54.38  ? 432 PRO A C   1 
ATOM   2371 O O   . PRO B 1 83  ? 18.670  0.080   2.350   1.00 49.01  ? 432 PRO A O   1 
ATOM   2372 C CB  . PRO B 1 83  ? 19.771  2.956   3.579   1.00 58.46  ? 432 PRO A CB  1 
ATOM   2373 C CG  . PRO B 1 83  ? 20.603  3.551   4.687   1.00 64.57  ? 432 PRO A CG  1 
ATOM   2374 C CD  . PRO B 1 83  ? 21.673  2.515   4.938   1.00 61.29  ? 432 PRO A CD  1 
ATOM   2375 N N   . ALA B 1 84  ? 20.839  0.577   1.933   1.00 44.45  ? 433 ALA A N   1 
ATOM   2376 C CA  . ALA B 1 84  ? 20.897  -0.266  0.759   1.00 43.56  ? 433 ALA A CA  1 
ATOM   2377 C C   . ALA B 1 84  ? 20.573  -1.749  1.069   1.00 43.67  ? 433 ALA A C   1 
ATOM   2378 O O   . ALA B 1 84  ? 19.971  -2.403  0.236   1.00 39.62  ? 433 ALA A O   1 
ATOM   2379 C CB  . ALA B 1 84  ? 22.215  -0.131  -0.002  1.00 38.86  ? 433 ALA A CB  1 
ATOM   2380 N N   . ASP B 1 85  ? 21.003  -2.257  2.219   1.00 44.08  ? 434 ASP A N   1 
ATOM   2381 C CA  . ASP B 1 85  ? 20.810  -3.673  2.549   1.00 50.15  ? 434 ASP A CA  1 
ATOM   2382 C C   . ASP B 1 85  ? 19.366  -3.928  2.963   1.00 43.88  ? 434 ASP A C   1 
ATOM   2383 O O   . ASP B 1 85  ? 18.784  -4.981  2.699   1.00 41.95  ? 434 ASP A O   1 
ATOM   2384 C CB  . ASP B 1 85  ? 21.781  -4.147  3.644   1.00 44.86  ? 434 ASP A CB  1 
ATOM   2385 C CG  . ASP B 1 85  ? 23.195  -4.382  3.125   1.00 47.82  ? 434 ASP A CG  1 
ATOM   2386 O OD1 . ASP B 1 85  ? 23.468  -4.148  1.930   1.00 49.24  ? 434 ASP A OD1 1 
ATOM   2387 O OD2 . ASP B 1 85  ? 24.049  -4.822  3.927   1.00 47.93  ? 434 ASP A OD2 1 
ATOM   2388 N N   . GLN B 1 86  ? 18.810  -2.961  3.634   1.00 41.36  ? 435 GLN A N   1 
ATOM   2389 C CA  . GLN B 1 86  ? 17.399  -2.991  3.953   1.00 43.31  ? 435 GLN A CA  1 
ATOM   2390 C C   . GLN B 1 86  ? 16.530  -3.121  2.657   1.00 44.11  ? 435 GLN A C   1 
ATOM   2391 O O   . GLN B 1 86  ? 15.771  -4.079  2.485   1.00 40.29  ? 435 GLN A O   1 
ATOM   2392 C CB  . GLN B 1 86  ? 17.056  -1.736  4.707   1.00 40.50  ? 435 GLN A CB  1 
ATOM   2393 C CG  . GLN B 1 86  ? 17.337  -1.768  6.191   1.00 43.84  ? 435 GLN A CG  1 
ATOM   2394 C CD  . GLN B 1 86  ? 16.869  -0.487  6.903   1.00 52.59  ? 435 GLN A CD  1 
ATOM   2395 O OE1 . GLN B 1 86  ? 15.694  -0.132  6.852   1.00 54.06  ? 435 GLN A OE1 1 
ATOM   2396 N NE2 . GLN B 1 86  ? 17.803  0.235   7.513   1.00 47.21  ? 435 GLN A NE2 1 
ATOM   2397 N N   . ASP B 1 87  ? 16.772  -2.243  1.708   1.00 37.64  ? 436 ASP A N   1 
ATOM   2398 C CA  . ASP B 1 87  ? 16.061  -2.298  0.470   1.00 46.22  ? 436 ASP A CA  1 
ATOM   2399 C C   . ASP B 1 87  ? 16.269  -3.582  -0.322  1.00 49.47  ? 436 ASP A C   1 
ATOM   2400 O O   . ASP B 1 87  ? 15.312  -4.117  -0.958  1.00 46.68  ? 436 ASP A O   1 
ATOM   2401 C CB  . ASP B 1 87  ? 16.430  -1.133  -0.452  1.00 42.37  ? 436 ASP A CB  1 
ATOM   2402 C CG  . ASP B 1 87  ? 15.937  0.221   0.073   1.00 45.01  ? 436 ASP A CG  1 
ATOM   2403 O OD1 . ASP B 1 87  ? 15.021  0.268   0.924   1.00 42.26  ? 436 ASP A OD1 1 
ATOM   2404 O OD2 . ASP B 1 87  ? 16.515  1.239   -0.352  1.00 54.41  ? 436 ASP A OD2 1 
ATOM   2405 N N   . LEU B 1 88  ? 17.518  -4.030  -0.354  1.00 41.56  ? 437 LEU A N   1 
ATOM   2406 C CA  . LEU B 1 88  ? 17.856  -5.199  -1.129  1.00 39.29  ? 437 LEU A CA  1 
ATOM   2407 C C   . LEU B 1 88  ? 17.103  -6.397  -0.511  1.00 39.12  ? 437 LEU A C   1 
ATOM   2408 O O   . LEU B 1 88  ? 16.554  -7.200  -1.240  1.00 36.44  ? 437 LEU A O   1 
ATOM   2409 C CB  . LEU B 1 88  ? 19.370  -5.396  -1.185  1.00 42.67  ? 437 LEU A CB  1 
ATOM   2410 C CG  . LEU B 1 88  ? 19.870  -6.701  -1.800  1.00 42.20  ? 437 LEU A CG  1 
ATOM   2411 C CD1 . LEU B 1 88  ? 19.589  -6.750  -3.273  1.00 38.23  ? 437 LEU A CD1 1 
ATOM   2412 C CD2 . LEU B 1 88  ? 21.363  -6.851  -1.555  1.00 47.97  ? 437 LEU A CD2 1 
ATOM   2413 N N   . LEU B 1 89  ? 17.046  -6.481  0.806   1.00 36.61  ? 438 LEU A N   1 
ATOM   2414 C CA  . LEU B 1 89  ? 16.383  -7.613  1.464   1.00 37.45  ? 438 LEU A CA  1 
ATOM   2415 C C   . LEU B 1 89  ? 14.899  -7.597  1.187   1.00 41.12  ? 438 LEU A C   1 
ATOM   2416 O O   . LEU B 1 89  ? 14.335  -8.639  0.845   1.00 41.61  ? 438 LEU A O   1 
ATOM   2417 C CB  . LEU B 1 89  ? 16.666  -7.621  2.992   1.00 36.93  ? 438 LEU A CB  1 
ATOM   2418 C CG  . LEU B 1 89  ? 18.140  -7.939  3.378   1.00 39.17  ? 438 LEU A CG  1 
ATOM   2419 C CD1 . LEU B 1 89  ? 18.399  -7.794  4.872   1.00 39.80  ? 438 LEU A CD1 1 
ATOM   2420 C CD2 . LEU B 1 89  ? 18.521  -9.350  2.941   1.00 44.08  ? 438 LEU A CD2 1 
ATOM   2421 N N   . LEU B 1 90  ? 14.302  -6.399  1.312   1.00 42.91  ? 439 LEU A N   1 
ATOM   2422 C CA  . LEU B 1 90  ? 12.899  -6.220  1.189   1.00 40.23  ? 439 LEU A CA  1 
ATOM   2423 C C   . LEU B 1 90  ? 12.522  -6.596  -0.202  1.00 40.14  ? 439 LEU A C   1 
ATOM   2424 O O   . LEU B 1 90  ? 11.654  -7.428  -0.413  1.00 36.90  ? 439 LEU A O   1 
ATOM   2425 C CB  . LEU B 1 90  ? 12.471  -4.777  1.375   1.00 42.03  ? 439 LEU A CB  1 
ATOM   2426 C CG  . LEU B 1 90  ? 11.844  -4.317  2.689   1.00 47.84  ? 439 LEU A CG  1 
ATOM   2427 C CD1 . LEU B 1 90  ? 11.397  -5.416  3.624   1.00 41.29  ? 439 LEU A CD1 1 
ATOM   2428 C CD2 . LEU B 1 90  ? 12.687  -3.259  3.411   1.00 43.53  ? 439 LEU A CD2 1 
ATOM   2429 N N   . GLU B 1 91  ? 13.229  -6.024  -1.146  1.00 35.79  ? 440 GLU A N   1 
ATOM   2430 C CA  . GLU B 1 91  ? 12.946  -6.279  -2.542  1.00 37.94  ? 440 GLU A CA  1 
ATOM   2431 C C   . GLU B 1 91  ? 13.170  -7.699  -2.973  1.00 42.60  ? 440 GLU A C   1 
ATOM   2432 O O   . GLU B 1 91  ? 12.473  -8.188  -3.846  1.00 42.88  ? 440 GLU A O   1 
ATOM   2433 C CB  . GLU B 1 91  ? 13.771  -5.345  -3.421  1.00 43.34  ? 440 GLU A CB  1 
ATOM   2434 C CG  . GLU B 1 91  ? 13.248  -3.903  -3.224  1.00 55.59  ? 440 GLU A CG  1 
ATOM   2435 C CD  . GLU B 1 91  ? 14.206  -2.797  -3.697  1.00 58.30  ? 440 GLU A CD  1 
ATOM   2436 O OE1 . GLU B 1 91  ? 14.240  -1.680  -3.120  1.00 62.26  ? 440 GLU A OE1 1 
ATOM   2437 O OE2 . GLU B 1 91  ? 14.917  -3.059  -4.664  1.00 58.59  ? 440 GLU A OE2 1 
ATOM   2438 N N   . SER B 1 92  ? 14.187  -8.367  -2.418  1.00 41.43  ? 441 SER A N   1 
ATOM   2439 C CA  . SER B 1 92  ? 14.519  -9.646  -2.926  1.00 38.82  ? 441 SER A CA  1 
ATOM   2440 C C   . SER B 1 92  ? 13.480  -10.627 -2.319  1.00 42.60  ? 441 SER A C   1 
ATOM   2441 O O   . SER B 1 92  ? 13.258  -11.617 -2.890  1.00 38.42  ? 441 SER A O   1 
ATOM   2442 C CB  . SER B 1 92  ? 15.918  -10.093 -2.504  1.00 41.09  ? 441 SER A CB  1 
ATOM   2443 O OG  . SER B 1 92  ? 16.882  -9.240  -2.996  1.00 46.52  ? 441 SER A OG  1 
ATOM   2444 N N   . ALA B 1 93  ? 12.910  -10.330 -1.158  1.00 36.21  ? 442 ALA A N   1 
ATOM   2445 C CA  . ALA B 1 93  ? 11.998  -11.197 -0.487  1.00 34.02  ? 442 ALA A CA  1 
ATOM   2446 C C   . ALA B 1 93  ? 10.500  -10.837 -0.701  1.00 39.93  ? 442 ALA A C   1 
ATOM   2447 O O   . ALA B 1 93  ? 9.617   -11.640 -0.365  1.00 39.78  ? 442 ALA A O   1 
ATOM   2448 C CB  . ALA B 1 93  ? 12.288  -11.145 0.988   1.00 36.83  ? 442 ALA A CB  1 
ATOM   2449 N N   . PHE B 1 94  ? 10.218  -9.693  -1.306  1.00 35.75  ? 443 PHE A N   1 
ATOM   2450 C CA  . PHE B 1 94  ? 8.821   -9.215  -1.381  1.00 42.15  ? 443 PHE A CA  1 
ATOM   2451 C C   . PHE B 1 94  ? 7.779   -10.255 -1.903  1.00 39.86  ? 443 PHE A C   1 
ATOM   2452 O O   . PHE B 1 94  ? 6.789   -10.532 -1.259  1.00 40.87  ? 443 PHE A O   1 
ATOM   2453 C CB  . PHE B 1 94  ? 8.715   -7.986  -2.251  1.00 37.63  ? 443 PHE A CB  1 
ATOM   2454 C CG  . PHE B 1 94  ? 7.293   -7.599  -2.555  1.00 43.44  ? 443 PHE A CG  1 
ATOM   2455 C CD1 . PHE B 1 94  ? 6.440   -7.235  -1.543  1.00 41.50  ? 443 PHE A CD1 1 
ATOM   2456 C CD2 . PHE B 1 94  ? 6.808   -7.632  -3.855  1.00 43.85  ? 443 PHE A CD2 1 
ATOM   2457 C CE1 . PHE B 1 94  ? 5.135   -6.916  -1.780  1.00 41.07  ? 443 PHE A CE1 1 
ATOM   2458 C CE2 . PHE B 1 94  ? 5.491   -7.326  -4.102  1.00 46.63  ? 443 PHE A CE2 1 
ATOM   2459 C CZ  . PHE B 1 94  ? 4.643   -6.964  -3.057  1.00 42.09  ? 443 PHE A CZ  1 
ATOM   2460 N N   . LEU B 1 95  ? 8.014   -10.767 -3.086  1.00 39.40  ? 444 LEU A N   1 
ATOM   2461 C CA  . LEU B 1 95  ? 7.084   -11.695 -3.737  1.00 45.07  ? 444 LEU A CA  1 
ATOM   2462 C C   . LEU B 1 95  ? 6.843   -12.909 -2.887  1.00 41.60  ? 444 LEU A C   1 
ATOM   2463 O O   . LEU B 1 95  ? 5.696   -13.237 -2.615  1.00 42.66  ? 444 LEU A O   1 
ATOM   2464 C CB  . LEU B 1 95  ? 7.560   -12.116 -5.123  1.00 44.92  ? 444 LEU A CB  1 
ATOM   2465 C CG  . LEU B 1 95  ? 6.782   -11.722 -6.387  1.00 56.11  ? 444 LEU A CG  1 
ATOM   2466 C CD1 . LEU B 1 95  ? 5.794   -10.570 -6.268  1.00 54.69  ? 444 LEU A CD1 1 
ATOM   2467 C CD2 . LEU B 1 95  ? 7.789   -11.465 -7.486  1.00 57.07  ? 444 LEU A CD2 1 
ATOM   2468 N N   . GLU B 1 96  ? 7.914   -13.464 -2.356  1.00 39.95  ? 445 GLU A N   1 
ATOM   2469 C CA  . GLU B 1 96  ? 7.810   -14.569 -1.496  1.00 40.09  ? 445 GLU A CA  1 
ATOM   2470 C C   . GLU B 1 96  ? 7.052   -14.279 -0.252  1.00 39.96  ? 445 GLU A C   1 
ATOM   2471 O O   . GLU B 1 96  ? 6.203   -15.104 0.159   1.00 41.01  ? 445 GLU A O   1 
ATOM   2472 C CB  . GLU B 1 96  ? 9.165   -15.136 -1.171  1.00 41.02  ? 445 GLU A CB  1 
ATOM   2473 C CG  . GLU B 1 96  ? 9.039   -16.473 -0.529  1.00 51.71  ? 445 GLU A CG  1 
ATOM   2474 C CD  . GLU B 1 96  ? 10.353  -17.193 -0.355  1.00 62.38  ? 445 GLU A CD  1 
ATOM   2475 O OE1 . GLU B 1 96  ? 11.346  -16.713 -0.906  1.00 52.63  ? 445 GLU A OE1 1 
ATOM   2476 O OE2 . GLU B 1 96  ? 10.365  -18.286 0.267   1.00 60.68  ? 445 GLU A OE2 1 
ATOM   2477 N N   . LEU B 1 97  ? 7.300   -13.123 0.348   1.00 43.16  ? 446 LEU A N   1 
ATOM   2478 C CA  . LEU B 1 97  ? 6.572   -12.744 1.559   1.00 41.83  ? 446 LEU A CA  1 
ATOM   2479 C C   . LEU B 1 97  ? 5.094   -12.461 1.261   1.00 43.27  ? 446 LEU A C   1 
ATOM   2480 O O   . LEU B 1 97  ? 4.236   -12.747 2.076   1.00 40.29  ? 446 LEU A O   1 
ATOM   2481 C CB  . LEU B 1 97  ? 7.192   -11.520 2.258   1.00 42.59  ? 446 LEU A CB  1 
ATOM   2482 C CG  . LEU B 1 97  ? 8.553   -11.728 2.914   1.00 40.16  ? 446 LEU A CG  1 
ATOM   2483 C CD1 . LEU B 1 97  ? 9.324   -10.410 3.156   1.00 40.07  ? 446 LEU A CD1 1 
ATOM   2484 C CD2 . LEU B 1 97  ? 8.348   -12.407 4.227   1.00 39.98  ? 446 LEU A CD2 1 
ATOM   2485 N N   . PHE B 1 98  ? 4.829   -11.754 0.174   1.00 42.71  ? 447 PHE A N   1 
ATOM   2486 C CA  . PHE B 1 98  ? 3.464   -11.430 -0.228  1.00 41.03  ? 447 PHE A CA  1 
ATOM   2487 C C   . PHE B 1 98  ? 2.660   -12.727 -0.327  1.00 45.75  ? 447 PHE A C   1 
ATOM   2488 O O   . PHE B 1 98  ? 1.555   -12.815 0.189   1.00 38.13  ? 447 PHE A O   1 
ATOM   2489 C CB  . PHE B 1 98  ? 3.471   -10.728 -1.578  1.00 37.41  ? 447 PHE A CB  1 
ATOM   2490 C CG  . PHE B 1 98  ? 2.112   -10.552 -2.200  1.00 40.99  ? 447 PHE A CG  1 
ATOM   2491 C CD1 . PHE B 1 98  ? 1.232   -9.609  -1.693  1.00 41.87  ? 447 PHE A CD1 1 
ATOM   2492 C CD2 . PHE B 1 98  ? 1.703   -11.320 -3.285  1.00 39.43  ? 447 PHE A CD2 1 
ATOM   2493 C CE1 . PHE B 1 98  ? -0.008  -9.401  -2.269  1.00 44.62  ? 447 PHE A CE1 1 
ATOM   2494 C CE2 . PHE B 1 98  ? 0.450   -11.123 -3.864  1.00 41.51  ? 447 PHE A CE2 1 
ATOM   2495 C CZ  . PHE B 1 98  ? -0.403  -10.164 -3.355  1.00 43.01  ? 447 PHE A CZ  1 
ATOM   2496 N N   . ILE B 1 99  ? 3.239   -13.725 -0.985  1.00 43.13  ? 448 ILE A N   1 
ATOM   2497 C CA  . ILE B 1 99  ? 2.526   -14.941 -1.232  1.00 44.05  ? 448 ILE A CA  1 
ATOM   2498 C C   . ILE B 1 99  ? 2.361   -15.674 0.110   1.00 46.49  ? 448 ILE A C   1 
ATOM   2499 O O   . ILE B 1 99  ? 1.311   -16.215 0.413   1.00 44.44  ? 448 ILE A O   1 
ATOM   2500 C CB  . ILE B 1 99  ? 3.308   -15.821 -2.186  1.00 41.92  ? 448 ILE A CB  1 
ATOM   2501 C CG1 . ILE B 1 99  ? 3.367   -15.192 -3.560  1.00 39.83  ? 448 ILE A CG1 1 
ATOM   2502 C CG2 . ILE B 1 99  ? 2.698   -17.215 -2.270  1.00 44.48  ? 448 ILE A CG2 1 
ATOM   2503 C CD1 . ILE B 1 99  ? 4.540   -15.759 -4.383  1.00 45.77  ? 448 ILE A CD1 1 
ATOM   2504 N N   . LEU B 1 100 ? 3.406   -15.676 0.918   1.00 45.38  ? 449 LEU A N   1 
ATOM   2505 C CA  . LEU B 1 100 ? 3.382   -16.493 2.114   1.00 45.38  ? 449 LEU A CA  1 
ATOM   2506 C C   . LEU B 1 100 ? 2.390   -15.943 3.090   1.00 41.80  ? 449 LEU A C   1 
ATOM   2507 O O   . LEU B 1 100 ? 1.614   -16.655 3.632   1.00 41.81  ? 449 LEU A O   1 
ATOM   2508 C CB  . LEU B 1 100 ? 4.758   -16.558 2.759   1.00 44.51  ? 449 LEU A CB  1 
ATOM   2509 C CG  . LEU B 1 100 ? 4.942   -17.444 3.974   1.00 45.40  ? 449 LEU A CG  1 
ATOM   2510 C CD1 . LEU B 1 100 ? 4.815   -18.922 3.637   1.00 48.51  ? 449 LEU A CD1 1 
ATOM   2511 C CD2 . LEU B 1 100 ? 6.313   -17.233 4.541   1.00 51.05  ? 449 LEU A CD2 1 
ATOM   2512 N N   . ARG B 1 101 ? 2.410   -14.657 3.284   1.00 38.22  ? 450 ARG A N   1 
ATOM   2513 C CA  . ARG B 1 101 ? 1.461   -14.031 4.153   1.00 40.09  ? 450 ARG A CA  1 
ATOM   2514 C C   . ARG B 1 101 ? 0.037   -14.106 3.636   1.00 39.12  ? 450 ARG A C   1 
ATOM   2515 O O   . ARG B 1 101 ? -0.850  -14.183 4.401   1.00 41.49  ? 450 ARG A O   1 
ATOM   2516 C CB  . ARG B 1 101 ? 1.842   -12.576 4.408   1.00 36.25  ? 450 ARG A CB  1 
ATOM   2517 C CG  . ARG B 1 101 ? 3.081   -12.460 5.281   1.00 40.96  ? 450 ARG A CG  1 
ATOM   2518 C CD  . ARG B 1 101 ? 3.881   -11.188 5.022   1.00 39.57  ? 450 ARG A CD  1 
ATOM   2519 N NE  . ARG B 1 101 ? 3.060   -10.000 5.199   1.00 40.63  ? 450 ARG A NE  1 
ATOM   2520 C CZ  . ARG B 1 101 ? 2.816   -9.402  6.359   1.00 44.71  ? 450 ARG A CZ  1 
ATOM   2521 N NH1 . ARG B 1 101 ? 3.334   -9.850  7.486   1.00 47.92  ? 450 ARG A NH1 1 
ATOM   2522 N NH2 . ARG B 1 101 ? 2.023   -8.342  6.385   1.00 51.52  ? 450 ARG A NH2 1 
ATOM   2523 N N   . LEU B 1 102 ? -0.166  -13.974 2.332   1.00 44.95  ? 451 LEU A N   1 
ATOM   2524 C CA  . LEU B 1 102 ? -1.514  -14.026 1.761   1.00 44.97  ? 451 LEU A CA  1 
ATOM   2525 C C   . LEU B 1 102 ? -2.083  -15.422 1.973   1.00 44.73  ? 451 LEU A C   1 
ATOM   2526 O O   . LEU B 1 102 ? -3.191  -15.570 2.415   1.00 42.17  ? 451 LEU A O   1 
ATOM   2527 C CB  . LEU B 1 102 ? -1.455  -13.708 0.276   1.00 44.57  ? 451 LEU A CB  1 
ATOM   2528 C CG  . LEU B 1 102 ? -2.765  -13.704 -0.490  1.00 45.74  ? 451 LEU A CG  1 
ATOM   2529 C CD1 . LEU B 1 102 ? -3.748  -12.712 0.090   1.00 49.03  ? 451 LEU A CD1 1 
ATOM   2530 C CD2 . LEU B 1 102 ? -2.517  -13.407 -1.960  1.00 46.30  ? 451 LEU A CD2 1 
ATOM   2531 N N   . ALA B 1 103 ? -1.272  -16.427 1.711   1.00 38.30  ? 452 ALA A N   1 
ATOM   2532 C CA  . ALA B 1 103 ? -1.656  -17.776 1.904   1.00 42.34  ? 452 ALA A CA  1 
ATOM   2533 C C   . ALA B 1 103 ? -1.978  -18.084 3.365   1.00 48.90  ? 452 ALA A C   1 
ATOM   2534 O O   . ALA B 1 103 ? -2.906  -18.865 3.647   1.00 47.79  ? 452 ALA A O   1 
ATOM   2535 C CB  . ALA B 1 103 ? -0.540  -18.699 1.434   1.00 42.78  ? 452 ALA A CB  1 
ATOM   2536 N N   . TYR B 1 104 ? -1.168  -17.557 4.283   1.00 50.34  ? 453 TYR A N   1 
ATOM   2537 C CA  . TYR B 1 104 ? -1.295  -17.926 5.683   1.00 48.87  ? 453 TYR A CA  1 
ATOM   2538 C C   . TYR B 1 104 ? -2.562  -17.283 6.154   1.00 47.17  ? 453 TYR A C   1 
ATOM   2539 O O   . TYR B 1 104 ? -3.289  -17.874 6.947   1.00 49.26  ? 453 TYR A O   1 
ATOM   2540 C CB  . TYR B 1 104 ? -0.137  -17.461 6.514   1.00 47.44  ? 453 TYR A CB  1 
ATOM   2541 C CG  . TYR B 1 104 ? -0.131  -17.891 7.984   1.00 51.92  ? 453 TYR A CG  1 
ATOM   2542 C CD1 . TYR B 1 104 ? -0.054  -19.252 8.344   1.00 51.11  ? 453 TYR A CD1 1 
ATOM   2543 C CD2 . TYR B 1 104 ? -0.074  -16.939 9.006   1.00 45.54  ? 453 TYR A CD2 1 
ATOM   2544 C CE1 . TYR B 1 104 ? 0.018   -19.637 9.659   1.00 47.07  ? 453 TYR A CE1 1 
ATOM   2545 C CE2 . TYR B 1 104 ? 0.006   -17.311 10.328  1.00 49.49  ? 453 TYR A CE2 1 
ATOM   2546 C CZ  . TYR B 1 104 ? 0.048   -18.656 10.655  1.00 54.24  ? 453 TYR A CZ  1 
ATOM   2547 O OH  . TYR B 1 104 ? 0.134   -19.027 11.974  1.00 56.85  ? 453 TYR A OH  1 
ATOM   2548 N N   . ARG B 1 105 ? -2.877  -16.101 5.657   1.00 45.87  ? 454 ARG A N   1 
ATOM   2549 C CA  . ARG B 1 105 ? -4.073  -15.452 6.187   1.00 47.73  ? 454 ARG A CA  1 
ATOM   2550 C C   . ARG B 1 105 ? -5.414  -15.717 5.472   1.00 44.93  ? 454 ARG A C   1 
ATOM   2551 O O   . ARG B 1 105 ? -6.460  -15.351 5.990   1.00 46.17  ? 454 ARG A O   1 
ATOM   2552 C CB  . ARG B 1 105 ? -3.813  -13.951 6.377   1.00 47.84  ? 454 ARG A CB  1 
ATOM   2553 C CG  . ARG B 1 105 ? -4.393  -13.052 5.407   1.00 52.26  ? 454 ARG A CG  1 
ATOM   2554 C CD  . ARG B 1 105 ? -4.236  -11.614 5.829   1.00 62.49  ? 454 ARG A CD  1 
ATOM   2555 N NE  . ARG B 1 105 ? -2.857  -11.123 5.925   1.00 60.45  ? 454 ARG A NE  1 
ATOM   2556 C CZ  . ARG B 1 105 ? -2.094  -10.808 4.879   1.00 61.37  ? 454 ARG A CZ  1 
ATOM   2557 N NH1 . ARG B 1 105 ? -2.539  -10.975 3.637   1.00 53.95  ? 454 ARG A NH1 1 
ATOM   2558 N NH2 . ARG B 1 105 ? -0.865  -10.316 5.070   1.00 60.72  ? 454 ARG A NH2 1 
ATOM   2559 N N   . SER B 1 106 ? -5.370  -16.306 4.279   1.00 41.46  ? 455 SER A N   1 
ATOM   2560 C CA  . SER B 1 106 ? -6.541  -16.470 3.446   1.00 41.81  ? 455 SER A CA  1 
ATOM   2561 C C   . SER B 1 106 ? -7.409  -17.665 3.896   1.00 43.39  ? 455 SER A C   1 
ATOM   2562 O O   . SER B 1 106 ? -7.031  -18.387 4.843   1.00 42.13  ? 455 SER A O   1 
ATOM   2563 C CB  . SER B 1 106 ? -6.121  -16.566 1.986   1.00 36.66  ? 455 SER A CB  1 
ATOM   2564 O OG  . SER B 1 106 ? -5.875  -15.287 1.452   1.00 39.91  ? 455 SER A OG  1 
ATOM   2565 N N   . LYS B 1 107 ? -8.586  -17.809 3.273   1.00 44.48  ? 456 LYS A N   1 
ATOM   2566 C CA  . LYS B 1 107 ? -9.604  -18.813 3.695   1.00 46.28  ? 456 LYS A CA  1 
ATOM   2567 C C   . LYS B 1 107 ? -9.996  -19.573 2.482   1.00 38.99  ? 456 LYS A C   1 
ATOM   2568 O O   . LYS B 1 107 ? -10.971 -19.272 1.832   1.00 39.13  ? 456 LYS A O   1 
ATOM   2569 C CB  . LYS B 1 107 ? -10.858 -18.200 4.317   1.00 53.27  ? 456 LYS A CB  1 
ATOM   2570 C CG  . LYS B 1 107 ? -10.614 -17.321 5.525   1.00 65.78  ? 456 LYS A CG  1 
ATOM   2571 C CD  . LYS B 1 107 ? -10.606 -18.099 6.829   1.00 81.81  ? 456 LYS A CD  1 
ATOM   2572 C CE  . LYS B 1 107 ? -10.232 -17.214 8.041   1.00 93.38  ? 456 LYS A CE  1 
ATOM   2573 N NZ  . LYS B 1 107 ? -11.302 -16.273 8.521   1.00 86.58  ? 456 LYS A NZ  1 
ATOM   2574 N N   . PRO B 1 108 ? -9.186  -20.547 2.133   1.00 36.71  ? 457 PRO A N   1 
ATOM   2575 C CA  . PRO B 1 108 ? -9.356  -21.227 0.909   1.00 41.47  ? 457 PRO A CA  1 
ATOM   2576 C C   . PRO B 1 108 ? -10.637 -22.136 0.831   1.00 42.89  ? 457 PRO A C   1 
ATOM   2577 O O   . PRO B 1 108 ? -11.120 -22.436 -0.263  1.00 45.89  ? 457 PRO A O   1 
ATOM   2578 C CB  . PRO B 1 108 ? -8.028  -22.006 0.788   1.00 42.57  ? 457 PRO A CB  1 
ATOM   2579 C CG  . PRO B 1 108 ? -7.534  -22.203 2.167   1.00 33.43  ? 457 PRO A CG  1 
ATOM   2580 C CD  . PRO B 1 108 ? -8.006  -21.005 2.885   1.00 36.70  ? 457 PRO A CD  1 
ATOM   2581 N N   . GLY B 1 109 ? -11.138 -22.580 1.967   1.00 42.20  ? 458 GLY A N   1 
ATOM   2582 C CA  . GLY B 1 109 ? -12.411 -23.379 2.073   1.00 42.12  ? 458 GLY A CA  1 
ATOM   2583 C C   . GLY B 1 109 ? -13.615 -22.506 1.743   1.00 48.45  ? 458 GLY A C   1 
ATOM   2584 O O   . GLY B 1 109 ? -14.654 -23.012 1.354   1.00 43.01  ? 458 GLY A O   1 
ATOM   2585 N N   . GLU B 1 110 ? -13.438 -21.191 1.745   1.00 42.22  ? 459 GLU A N   1 
ATOM   2586 C CA  . GLU B 1 110 ? -14.488 -20.306 1.211   1.00 48.19  ? 459 GLU A CA  1 
ATOM   2587 C C   . GLU B 1 110 ? -14.103 -19.540 -0.078  1.00 40.75  ? 459 GLU A C   1 
ATOM   2588 O O   . GLU B 1 110 ? -14.780 -18.637 -0.469  1.00 38.05  ? 459 GLU A O   1 
ATOM   2589 C CB  . GLU B 1 110 ? -14.879 -19.311 2.261   1.00 46.40  ? 459 GLU A CB  1 
ATOM   2590 C CG  . GLU B 1 110 ? -15.304 -19.869 3.609   1.00 54.74  ? 459 GLU A CG  1 
ATOM   2591 C CD  . GLU B 1 110 ? -15.519 -18.714 4.583   1.00 55.72  ? 459 GLU A CD  1 
ATOM   2592 O OE1 . GLU B 1 110 ? -16.298 -17.810 4.231   1.00 59.78  ? 459 GLU A OE1 1 
ATOM   2593 O OE2 . GLU B 1 110 ? -14.908 -18.676 5.655   1.00 56.01  ? 459 GLU A OE2 1 
ATOM   2594 N N   . GLY B 1 111 ? -13.034 -19.910 -0.762  1.00 43.51  ? 460 GLY A N   1 
ATOM   2595 C CA  . GLY B 1 111 ? -12.561 -19.052 -1.875  1.00 41.65  ? 460 GLY A CA  1 
ATOM   2596 C C   . GLY B 1 111 ? -12.220 -17.597 -1.558  1.00 36.55  ? 460 GLY A C   1 
ATOM   2597 O O   . GLY B 1 111 ? -12.221 -16.736 -2.453  1.00 40.23  ? 460 GLY A O   1 
ATOM   2598 N N   . LYS B 1 112 ? -11.866 -17.331 -0.320  1.00 38.64  ? 461 LYS A N   1 
ATOM   2599 C CA  . LYS B 1 112 ? -11.574 -15.971 0.164   1.00 43.88  ? 461 LYS A CA  1 
ATOM   2600 C C   . LYS B 1 112 ? -10.084 -15.642 0.275   1.00 43.43  ? 461 LYS A C   1 
ATOM   2601 O O   . LYS B 1 112 ? -9.328  -16.313 1.025   1.00 43.55  ? 461 LYS A O   1 
ATOM   2602 C CB  . LYS B 1 112 ? -12.200 -15.805 1.550   1.00 47.72  ? 461 LYS A CB  1 
ATOM   2603 C CG  . LYS B 1 112 ? -13.607 -15.267 1.466   1.00 49.85  ? 461 LYS A CG  1 
ATOM   2604 C CD  . LYS B 1 112 ? -14.259 -15.157 2.829   1.00 55.46  ? 461 LYS A CD  1 
ATOM   2605 C CE  . LYS B 1 112 ? -15.769 -15.373 2.689   1.00 59.80  ? 461 LYS A CE  1 
ATOM   2606 N NZ  . LYS B 1 112 ? -16.406 -15.308 4.025   1.00 63.49  ? 461 LYS A NZ  1 
ATOM   2607 N N   . LEU B 1 113 ? -9.679  -14.617 -0.471  1.00 45.89  ? 462 LEU A N   1 
ATOM   2608 C CA  . LEU B 1 113 ? -8.353  -13.996 -0.333  1.00 41.68  ? 462 LEU A CA  1 
ATOM   2609 C C   . LEU B 1 113 ? -8.504  -12.841 0.596   1.00 39.89  ? 462 LEU A C   1 
ATOM   2610 O O   . LEU B 1 113 ? -9.420  -11.990 0.455   1.00 40.75  ? 462 LEU A O   1 
ATOM   2611 C CB  . LEU B 1 113 ? -7.828  -13.465 -1.671  1.00 43.00  ? 462 LEU A CB  1 
ATOM   2612 C CG  . LEU B 1 113 ? -7.380  -14.470 -2.720  1.00 40.63  ? 462 LEU A CG  1 
ATOM   2613 C CD1 . LEU B 1 113 ? -6.315  -15.403 -2.190  1.00 39.86  ? 462 LEU A CD1 1 
ATOM   2614 C CD2 . LEU B 1 113 ? -8.601  -15.290 -3.181  1.00 42.10  ? 462 LEU A CD2 1 
ATOM   2615 N N   . ILE B 1 114 ? -7.638  -12.818 1.580   1.00 38.57  ? 463 ILE A N   1 
ATOM   2616 C CA  . ILE B 1 114 ? -7.641  -11.767 2.539   1.00 40.73  ? 463 ILE A CA  1 
ATOM   2617 C C   . ILE B 1 114 ? -6.297  -11.050 2.490   1.00 44.41  ? 463 ILE A C   1 
ATOM   2618 O O   . ILE B 1 114 ? -5.248  -11.618 2.833   1.00 43.78  ? 463 ILE A O   1 
ATOM   2619 C CB  . ILE B 1 114 ? -7.884  -12.343 3.926   1.00 41.83  ? 463 ILE A CB  1 
ATOM   2620 C CG1 . ILE B 1 114 ? -9.216  -13.077 3.933   1.00 44.18  ? 463 ILE A CG1 1 
ATOM   2621 C CG2 . ILE B 1 114 ? -7.850  -11.215 4.951   1.00 45.90  ? 463 ILE A CG2 1 
ATOM   2622 C CD1 . ILE B 1 114 ? -9.619  -13.675 5.263   1.00 46.36  ? 463 ILE A CD1 1 
ATOM   2623 N N   . PHE B 1 115 ? -6.326  -9.826  2.021   1.00 45.27  ? 464 PHE A N   1 
ATOM   2624 C CA  . PHE B 1 115 ? -5.129  -9.037  1.853   1.00 48.34  ? 464 PHE A CA  1 
ATOM   2625 C C   . PHE B 1 115 ? -4.795  -8.219  3.108   1.00 48.85  ? 464 PHE A C   1 
ATOM   2626 O O   . PHE B 1 115 ? -5.608  -8.099  4.010   1.00 52.69  ? 464 PHE A O   1 
ATOM   2627 C CB  . PHE B 1 115 ? -5.271  -8.144  0.636   1.00 43.96  ? 464 PHE A CB  1 
ATOM   2628 C CG  . PHE B 1 115 ? -5.447  -8.893  -0.605  1.00 41.51  ? 464 PHE A CG  1 
ATOM   2629 C CD1 . PHE B 1 115 ? -6.732  -9.179  -1.058  1.00 49.90  ? 464 PHE A CD1 1 
ATOM   2630 C CD2 . PHE B 1 115 ? -4.388  -9.321  -1.323  1.00 42.25  ? 464 PHE A CD2 1 
ATOM   2631 C CE1 . PHE B 1 115 ? -6.950  -9.879  -2.218  1.00 44.45  ? 464 PHE A CE1 1 
ATOM   2632 C CE2 . PHE B 1 115 ? -4.587  -10.037 -2.479  1.00 50.93  ? 464 PHE A CE2 1 
ATOM   2633 C CZ  . PHE B 1 115 ? -5.888  -10.313 -2.937  1.00 49.84  ? 464 PHE A CZ  1 
ATOM   2634 N N   . CYS B 1 116 ? -3.592  -7.655  3.156   1.00 52.08  ? 465 CYS A N   1 
ATOM   2635 C CA  . CYS B 1 116 ? -3.077  -7.078  4.430   1.00 55.20  ? 465 CYS A CA  1 
ATOM   2636 C C   . CYS B 1 116 ? -3.808  -5.813  4.883   1.00 56.81  ? 465 CYS A C   1 
ATOM   2637 O O   . CYS B 1 116 ? -3.852  -5.532  6.057   1.00 66.47  ? 465 CYS A O   1 
ATOM   2638 C CB  . CYS B 1 116 ? -1.607  -6.794  4.312   1.00 59.84  ? 465 CYS A CB  1 
ATOM   2639 S SG  . CYS B 1 116 ? -1.261  -5.399  3.180   1.00 69.19  ? 465 CYS A SG  1 
ATOM   2640 N N   . SER B 1 117 ? -4.440  -5.093  3.975   1.00 57.62  ? 466 SER A N   1 
ATOM   2641 C CA  . SER B 1 117 ? -5.343  -4.004  4.366   1.00 61.41  ? 466 SER A CA  1 
ATOM   2642 C C   . SER B 1 117 ? -6.605  -4.532  5.034   1.00 62.26  ? 466 SER A C   1 
ATOM   2643 O O   . SER B 1 117 ? -7.396  -3.765  5.520   1.00 58.74  ? 466 SER A O   1 
ATOM   2644 C CB  . SER B 1 117 ? -5.764  -3.201  3.121   1.00 66.50  ? 466 SER A CB  1 
ATOM   2645 O OG  . SER B 1 117 ? -6.508  -4.029  2.218   1.00 57.89  ? 466 SER A OG  1 
ATOM   2646 N N   . GLY B 1 118 ? -6.844  -5.841  5.044   1.00 64.84  ? 467 GLY A N   1 
ATOM   2647 C CA  . GLY B 1 118 ? -8.103  -6.369  5.626   1.00 57.99  ? 467 GLY A CA  1 
ATOM   2648 C C   . GLY B 1 118 ? -9.141  -6.580  4.544   1.00 53.17  ? 467 GLY A C   1 
ATOM   2649 O O   . GLY B 1 118 ? -10.186 -7.193  4.791   1.00 57.87  ? 467 GLY A O   1 
ATOM   2650 N N   . LEU B 1 119 ? -8.815  -6.107  3.341   1.00 50.89  ? 468 LEU A N   1 
ATOM   2651 C CA  . LEU B 1 119 ? -9.633  -6.274  2.175   1.00 50.37  ? 468 LEU A CA  1 
ATOM   2652 C C   . LEU B 1 119 ? -9.826  -7.768  1.850   1.00 50.46  ? 468 LEU A C   1 
ATOM   2653 O O   . LEU B 1 119 ? -8.859  -8.536  1.729   1.00 47.87  ? 468 LEU A O   1 
ATOM   2654 C CB  . LEU B 1 119 ? -9.009  -5.550  0.980   1.00 46.82  ? 468 LEU A CB  1 
ATOM   2655 C CG  . LEU B 1 119 ? -9.857  -5.522  -0.289  1.00 53.67  ? 468 LEU A CG  1 
ATOM   2656 C CD1 . LEU B 1 119 ? -10.948 -4.454  -0.216  1.00 56.79  ? 468 LEU A CD1 1 
ATOM   2657 C CD2 . LEU B 1 119 ? -9.022  -5.255  -1.524  1.00 53.82  ? 468 LEU A CD2 1 
ATOM   2658 N N   . VAL B 1 120 ? -11.086 -8.153  1.745   1.00 48.08  ? 469 VAL A N   1 
ATOM   2659 C CA  . VAL B 1 120 ? -11.486 -9.513  1.414   1.00 44.06  ? 469 VAL A CA  1 
ATOM   2660 C C   . VAL B 1 120 ? -12.062 -9.553  0.016   1.00 44.18  ? 469 VAL A C   1 
ATOM   2661 O O   . VAL B 1 120 ? -12.892 -8.742  -0.364  1.00 46.69  ? 469 VAL A O   1 
ATOM   2662 C CB  . VAL B 1 120 ? -12.506 -10.018 2.418   1.00 46.52  ? 469 VAL A CB  1 
ATOM   2663 C CG1 . VAL B 1 120 ? -12.901 -11.443 2.103   1.00 49.87  ? 469 VAL A CG1 1 
ATOM   2664 C CG2 . VAL B 1 120 ? -11.927 -9.922  3.814   1.00 53.84  ? 469 VAL A CG2 1 
ATOM   2665 N N   . LEU B 1 121 ? -11.586 -10.504 -0.776  1.00 47.74  ? 470 LEU A N   1 
ATOM   2666 C CA  . LEU B 1 121 ? -12.012 -10.618 -2.143  1.00 41.75  ? 470 LEU A CA  1 
ATOM   2667 C C   . LEU B 1 121 ? -12.205 -12.094 -2.444  1.00 40.64  ? 470 LEU A C   1 
ATOM   2668 O O   . LEU B 1 121 ? -11.502 -12.963 -1.910  1.00 47.13  ? 470 LEU A O   1 
ATOM   2669 C CB  . LEU B 1 121 ? -10.959 -9.984  -3.052  1.00 43.55  ? 470 LEU A CB  1 
ATOM   2670 C CG  . LEU B 1 121 ? -11.215 -8.687  -3.839  1.00 53.96  ? 470 LEU A CG  1 
ATOM   2671 C CD1 . LEU B 1 121 ? -12.088 -7.675  -3.140  1.00 52.32  ? 470 LEU A CD1 1 
ATOM   2672 C CD2 . LEU B 1 121 ? -9.909  -8.027  -4.253  1.00 57.59  ? 470 LEU A CD2 1 
ATOM   2673 N N   . HIS B 1 122 ? -13.147 -12.387 -3.315  1.00 40.32  ? 471 HIS A N   1 
ATOM   2674 C CA  . HIS B 1 122 ? -13.406 -13.764 -3.687  1.00 40.27  ? 471 HIS A CA  1 
ATOM   2675 C C   . HIS B 1 122 ? -12.414 -14.174 -4.747  1.00 43.94  ? 471 HIS A C   1 
ATOM   2676 O O   . HIS B 1 122 ? -11.981 -13.351 -5.548  1.00 39.24  ? 471 HIS A O   1 
ATOM   2677 C CB  . HIS B 1 122 ? -14.836 -13.912 -4.249  1.00 41.15  ? 471 HIS A CB  1 
ATOM   2678 C CG  . HIS B 1 122 ? -15.224 -15.332 -4.479  1.00 38.99  ? 471 HIS A CG  1 
ATOM   2679 N ND1 . HIS B 1 122 ? -15.636 -16.167 -3.460  1.00 42.90  ? 471 HIS A ND1 1 
ATOM   2680 C CD2 . HIS B 1 122 ? -15.132 -16.102 -5.568  1.00 36.17  ? 471 HIS A CD2 1 
ATOM   2681 C CE1 . HIS B 1 122 ? -15.772 -17.392 -3.918  1.00 34.98  ? 471 HIS A CE1 1 
ATOM   2682 N NE2 . HIS B 1 122 ? -15.507 -17.365 -5.204  1.00 34.87  ? 471 HIS A NE2 1 
ATOM   2683 N N   . ARG B 1 123 ? -12.111 -15.455 -4.821  1.00 44.05  ? 472 ARG A N   1 
ATOM   2684 C CA  . ARG B 1 123 ? -11.253 -15.937 -5.898  1.00 45.78  ? 472 ARG A CA  1 
ATOM   2685 C C   . ARG B 1 123 ? -11.607 -15.426 -7.301  1.00 47.68  ? 472 ARG A C   1 
ATOM   2686 O O   . ARG B 1 123 ? -10.728 -14.943 -8.079  1.00 48.01  ? 472 ARG A O   1 
ATOM   2687 C CB  . ARG B 1 123 ? -11.304 -17.446 -5.839  1.00 44.94  ? 472 ARG A CB  1 
ATOM   2688 C CG  . ARG B 1 123 ? -10.504 -18.215 -6.863  1.00 44.01  ? 472 ARG A CG  1 
ATOM   2689 C CD  . ARG B 1 123 ? -10.987 -19.694 -6.981  1.00 47.92  ? 472 ARG A CD  1 
ATOM   2690 N NE  . ARG B 1 123 ? -11.387 -20.046 -8.360  1.00 48.83  ? 472 ARG A NE  1 
ATOM   2691 C CZ  . ARG B 1 123 ? -12.619 -20.324 -8.694  1.00 65.17  ? 472 ARG A CZ  1 
ATOM   2692 N NH1 . ARG B 1 123 ? -12.908 -20.595 -9.938  1.00 79.48  ? 472 ARG A NH1 1 
ATOM   2693 N NH2 . ARG B 1 123 ? -13.567 -20.381 -7.768  1.00 87.19  ? 472 ARG A NH2 1 
ATOM   2694 N N   . LEU B 1 124 ? -12.902 -15.458 -7.605  1.00 44.22  ? 473 LEU A N   1 
ATOM   2695 C CA  . LEU B 1 124 ? -13.410 -15.012 -8.911  1.00 41.17  ? 473 LEU A CA  1 
ATOM   2696 C C   . LEU B 1 124 ? -13.209 -13.544 -9.179  1.00 37.81  ? 473 LEU A C   1 
ATOM   2697 O O   . LEU B 1 124 ? -13.164 -13.163 -10.315 1.00 43.24  ? 473 LEU A O   1 
ATOM   2698 C CB  . LEU B 1 124 ? -14.904 -15.312 -9.051  1.00 36.82  ? 473 LEU A CB  1 
ATOM   2699 C CG  . LEU B 1 124 ? -15.230 -16.778 -9.042  1.00 44.71  ? 473 LEU A CG  1 
ATOM   2700 C CD1 . LEU B 1 124 ? -16.685 -17.015 -8.723  1.00 49.69  ? 473 LEU A CD1 1 
ATOM   2701 C CD2 . LEU B 1 124 ? -14.826 -17.413 -10.379 1.00 45.46  ? 473 LEU A CD2 1 
ATOM   2702 N N   . GLN B 1 125 ? -13.201 -12.725 -8.139  1.00 38.12  ? 474 GLN A N   1 
ATOM   2703 C CA  . GLN B 1 125 ? -12.930 -11.320 -8.279  1.00 43.09  ? 474 GLN A CA  1 
ATOM   2704 C C   . GLN B 1 125 ? -11.441 -11.073 -8.493  1.00 48.37  ? 474 GLN A C   1 
ATOM   2705 O O   . GLN B 1 125 ? -11.073 -10.025 -8.970  1.00 46.62  ? 474 GLN A O   1 
ATOM   2706 C CB  . GLN B 1 125 ? -13.325 -10.578 -7.018  1.00 44.54  ? 474 GLN A CB  1 
ATOM   2707 C CG  . GLN B 1 125 ? -14.798 -10.642 -6.669  1.00 44.95  ? 474 GLN A CG  1 
ATOM   2708 C CD  . GLN B 1 125 ? -15.101 -9.904  -5.398  1.00 43.47  ? 474 GLN A CD  1 
ATOM   2709 O OE1 . GLN B 1 125 ? -14.931 -10.411 -4.271  1.00 41.10  ? 474 GLN A OE1 1 
ATOM   2710 N NE2 . GLN B 1 125 ? -15.456 -8.667  -5.558  1.00 52.21  ? 474 GLN A NE2 1 
ATOM   2711 N N   . CYS B 1 126 ? -10.577 -12.047 -8.157  1.00 46.75  ? 475 CYS A N   1 
ATOM   2712 C CA  . CYS B 1 126 ? -9.151  -11.853 -8.353  1.00 42.89  ? 475 CYS A CA  1 
ATOM   2713 C C   . CYS B 1 126 ? -8.665  -12.396 -9.698  1.00 42.09  ? 475 CYS A C   1 
ATOM   2714 O O   . CYS B 1 126 ? -7.586  -12.094 -10.131 1.00 46.18  ? 475 CYS A O   1 
ATOM   2715 C CB  . CYS B 1 126 ? -8.393  -12.545 -7.259  1.00 43.43  ? 475 CYS A CB  1 
ATOM   2716 S SG  . CYS B 1 126 ? -8.739  -11.862 -5.644  1.00 45.63  ? 475 CYS A SG  1 
ATOM   2717 N N   . ALA B 1 127 ? -9.486  -13.175 -10.346 1.00 42.58  ? 476 ALA A N   1 
ATOM   2718 C CA  . ALA B 1 127 ? -9.107  -13.944 -11.510 1.00 46.74  ? 476 ALA A CA  1 
ATOM   2719 C C   . ALA B 1 127 ? -8.664  -13.111 -12.689 1.00 44.41  ? 476 ALA A C   1 
ATOM   2720 O O   . ALA B 1 127 ? -7.806  -13.506 -13.434 1.00 45.20  ? 476 ALA A O   1 
ATOM   2721 C CB  . ALA B 1 127 ? -10.292 -14.827 -11.952 1.00 47.01  ? 476 ALA A CB  1 
ATOM   2722 N N   . ARG B 1 128 ? -9.285  -11.977 -12.872 1.00 43.51  ? 477 ARG A N   1 
ATOM   2723 C CA  . ARG B 1 128 ? -8.987  -11.121 -13.996 1.00 49.33  ? 477 ARG A CA  1 
ATOM   2724 C C   . ARG B 1 128 ? -7.616  -10.434 -13.842 1.00 48.63  ? 477 ARG A C   1 
ATOM   2725 O O   . ARG B 1 128 ? -6.825  -10.480 -14.748 1.00 49.76  ? 477 ARG A O   1 
ATOM   2726 C CB  . ARG B 1 128 ? -10.142 -10.106 -14.224 1.00 58.04  ? 477 ARG A CB  1 
ATOM   2727 C CG  . ARG B 1 128 ? -11.248 -10.679 -15.151 1.00 61.00  ? 477 ARG A CG  1 
ATOM   2728 C CD  . ARG B 1 128 ? -12.507 -9.820  -15.267 1.00 61.54  ? 477 ARG A CD  1 
ATOM   2729 N NE  . ARG B 1 128 ? -12.356 -8.643  -16.135 1.00 64.96  ? 477 ARG A NE  1 
ATOM   2730 C CZ  . ARG B 1 128 ? -12.352 -8.661  -17.471 1.00 65.65  ? 477 ARG A CZ  1 
ATOM   2731 N NH1 . ARG B 1 128 ? -12.555 -9.788  -18.136 1.00 66.26  ? 477 ARG A NH1 1 
ATOM   2732 N NH2 . ARG B 1 128 ? -12.163 -7.533  -18.130 1.00 65.28  ? 477 ARG A NH2 1 
ATOM   2733 N N   . GLY B 1 129 ? -7.315  -9.883  -12.667 1.00 44.07  ? 478 GLY A N   1 
ATOM   2734 C CA  . GLY B 1 129 ? -6.026  -9.209  -12.424 1.00 43.32  ? 478 GLY A CA  1 
ATOM   2735 C C   . GLY B 1 129 ? -4.864  -10.200 -12.300 1.00 45.38  ? 478 GLY A C   1 
ATOM   2736 O O   . GLY B 1 129 ? -3.857  -10.098 -12.990 1.00 43.50  ? 478 GLY A O   1 
ATOM   2737 N N   . PHE B 1 130 ? -5.045  -11.182 -11.447 1.00 43.41  ? 479 PHE A N   1 
ATOM   2738 C CA  . PHE B 1 130 ? -4.000  -12.130 -11.084 1.00 41.73  ? 479 PHE A CA  1 
ATOM   2739 C C   . PHE B 1 130 ? -3.828  -13.311 -12.020 1.00 38.54  ? 479 PHE A C   1 
ATOM   2740 O O   . PHE B 1 130 ? -2.760  -13.914 -12.019 1.00 41.02  ? 479 PHE A O   1 
ATOM   2741 C CB  . PHE B 1 130 ? -4.260  -12.691 -9.698  1.00 40.53  ? 479 PHE A CB  1 
ATOM   2742 C CG  . PHE B 1 130 ? -4.044  -11.723 -8.602  1.00 38.53  ? 479 PHE A CG  1 
ATOM   2743 C CD1 . PHE B 1 130 ? -4.973  -10.721 -8.345  1.00 44.55  ? 479 PHE A CD1 1 
ATOM   2744 C CD2 . PHE B 1 130 ? -2.920  -11.810 -7.817  1.00 45.28  ? 479 PHE A CD2 1 
ATOM   2745 C CE1 . PHE B 1 130 ? -4.765  -9.820  -7.327  1.00 46.57  ? 479 PHE A CE1 1 
ATOM   2746 C CE2 . PHE B 1 130 ? -2.726  -10.923 -6.768  1.00 45.54  ? 479 PHE A CE2 1 
ATOM   2747 C CZ  . PHE B 1 130 ? -3.636  -9.942  -6.530  1.00 45.41  ? 479 PHE A CZ  1 
ATOM   2748 N N   . GLY B 1 131 ? -4.851  -13.623 -12.814 1.00 42.49  ? 480 GLY A N   1 
ATOM   2749 C CA  . GLY B 1 131 ? -4.871  -14.870 -13.628 1.00 37.64  ? 480 GLY A CA  1 
ATOM   2750 C C   . GLY B 1 131 ? -4.857  -16.126 -12.739 1.00 40.84  ? 480 GLY A C   1 
ATOM   2751 O O   . GLY B 1 131 ? -5.148  -16.084 -11.539 1.00 50.10  ? 480 GLY A O   1 
ATOM   2752 N N   . ASP B 1 132 ? -4.431  -17.227 -13.314 1.00 42.27  ? 481 ASP A N   1 
ATOM   2753 C CA  . ASP B 1 132 ? -4.220  -18.513 -12.618 1.00 48.06  ? 481 ASP A CA  1 
ATOM   2754 C C   . ASP B 1 132 ? -3.496  -18.443 -11.280 1.00 43.85  ? 481 ASP A C   1 
ATOM   2755 O O   . ASP B 1 132 ? -3.675  -19.295 -10.399 1.00 44.51  ? 481 ASP A O   1 
ATOM   2756 C CB  . ASP B 1 132 ? -3.355  -19.442 -13.523 1.00 50.41  ? 481 ASP A CB  1 
ATOM   2757 C CG  . ASP B 1 132 ? -4.050  -19.825 -14.786 1.00 68.08  ? 481 ASP A CG  1 
ATOM   2758 O OD1 . ASP B 1 132 ? -3.360  -20.276 -15.736 1.00 82.05  ? 481 ASP A OD1 1 
ATOM   2759 O OD2 . ASP B 1 132 ? -5.297  -19.681 -14.841 1.00 70.37  ? 481 ASP A OD2 1 
ATOM   2760 N N   . TRP B 1 133 ? -2.591  -17.496 -11.187 1.00 37.82  ? 482 TRP A N   1 
ATOM   2761 C CA  . TRP B 1 133 ? -1.682  -17.398 -10.060 1.00 41.29  ? 482 TRP A CA  1 
ATOM   2762 C C   . TRP B 1 133 ? -2.463  -17.416 -8.724  1.00 40.50  ? 482 TRP A C   1 
ATOM   2763 O O   . TRP B 1 133 ? -2.072  -18.093 -7.757  1.00 38.99  ? 482 TRP A O   1 
ATOM   2764 C CB  . TRP B 1 133 ? -0.812  -16.115 -10.214 1.00 39.81  ? 482 TRP A CB  1 
ATOM   2765 C CG  . TRP B 1 133 ? 0.199   -15.913 -9.185  1.00 40.82  ? 482 TRP A CG  1 
ATOM   2766 C CD1 . TRP B 1 133 ? 0.970   -16.864 -8.640  1.00 42.66  ? 482 TRP A CD1 1 
ATOM   2767 C CD2 . TRP B 1 133 ? 0.680   -14.660 -8.650  1.00 39.97  ? 482 TRP A CD2 1 
ATOM   2768 N NE1 . TRP B 1 133 ? 1.824   -16.322 -7.747  1.00 38.63  ? 482 TRP A NE1 1 
ATOM   2769 C CE2 . TRP B 1 133 ? 1.687   -14.966 -7.746  1.00 39.54  ? 482 TRP A CE2 1 
ATOM   2770 C CE3 . TRP B 1 133 ? 0.333   -13.325 -8.836  1.00 40.87  ? 482 TRP A CE3 1 
ATOM   2771 C CZ2 . TRP B 1 133 ? 2.329   -13.998 -6.974  1.00 42.25  ? 482 TRP A CZ2 1 
ATOM   2772 C CZ3 . TRP B 1 133 ? 0.977   -12.373 -8.105  1.00 49.40  ? 482 TRP A CZ3 1 
ATOM   2773 C CH2 . TRP B 1 133 ? 1.982   -12.711 -7.179  1.00 40.62  ? 482 TRP A CH2 1 
ATOM   2774 N N   . ILE B 1 134 ? -3.596  -16.740 -8.689  1.00 38.10  ? 483 ILE A N   1 
ATOM   2775 C CA  . ILE B 1 134 ? -4.357  -16.711 -7.460  1.00 40.35  ? 483 ILE A CA  1 
ATOM   2776 C C   . ILE B 1 134 ? -4.941  -18.078 -7.094  1.00 39.64  ? 483 ILE A C   1 
ATOM   2777 O O   . ILE B 1 134 ? -5.026  -18.427 -5.903  1.00 37.76  ? 483 ILE A O   1 
ATOM   2778 C CB  . ILE B 1 134 ? -5.469  -15.643 -7.496  1.00 44.94  ? 483 ILE A CB  1 
ATOM   2779 C CG1 . ILE B 1 134 ? -5.791  -15.177 -6.077  1.00 47.09  ? 483 ILE A CG1 1 
ATOM   2780 C CG2 . ILE B 1 134 ? -6.722  -16.197 -8.172  1.00 48.55  ? 483 ILE A CG2 1 
ATOM   2781 C CD1 . ILE B 1 134 ? -4.720  -14.296 -5.447  1.00 48.23  ? 483 ILE A CD1 1 
ATOM   2782 N N   . ASP B 1 135 ? -5.292  -18.876 -8.087  1.00 35.54  ? 484 ASP A N   1 
ATOM   2783 C CA  . ASP B 1 135 ? -5.739  -20.251 -7.787  1.00 42.11  ? 484 ASP A CA  1 
ATOM   2784 C C   . ASP B 1 135 ? -4.625  -21.018 -7.202  1.00 40.20  ? 484 ASP A C   1 
ATOM   2785 O O   . ASP B 1 135 ? -4.821  -21.743 -6.219  1.00 39.38  ? 484 ASP A O   1 
ATOM   2786 C CB  . ASP B 1 135 ? -6.261  -20.943 -9.047  1.00 41.65  ? 484 ASP A CB  1 
ATOM   2787 C CG  . ASP B 1 135 ? -7.490  -20.220 -9.593  1.00 48.66  ? 484 ASP A CG  1 
ATOM   2788 O OD1 . ASP B 1 135 ? -8.206  -19.632 -8.744  1.00 46.19  ? 484 ASP A OD1 1 
ATOM   2789 O OD2 . ASP B 1 135 ? -7.723  -20.186 -10.817 1.00 46.61  ? 484 ASP A OD2 1 
ATOM   2790 N N   . SER B 1 136 ? -3.431  -20.871 -7.782  1.00 41.83  ? 485 SER A N   1 
ATOM   2791 C CA  . SER B 1 136 ? -2.249  -21.590 -7.220  1.00 38.84  ? 485 SER A CA  1 
ATOM   2792 C C   . SER B 1 136 ? -1.893  -21.068 -5.823  1.00 38.19  ? 485 SER A C   1 
ATOM   2793 O O   . SER B 1 136 ? -1.425  -21.834 -4.977  1.00 41.94  ? 485 SER A O   1 
ATOM   2794 C CB  . SER B 1 136 ? -1.078  -21.465 -8.107  1.00 35.25  ? 485 SER A CB  1 
ATOM   2795 O OG  . SER B 1 136 ? -1.508  -21.860 -9.410  1.00 41.43  ? 485 SER A OG  1 
ATOM   2796 N N   . ILE B 1 137 ? -2.114  -19.783 -5.569  1.00 36.59  ? 486 ILE A N   1 
ATOM   2797 C CA  . ILE B 1 137 ? -1.848  -19.258 -4.222  1.00 40.01  ? 486 ILE A CA  1 
ATOM   2798 C C   . ILE B 1 137 ? -2.840  -19.873 -3.228  1.00 41.27  ? 486 ILE A C   1 
ATOM   2799 O O   . ILE B 1 137 ? -2.475  -20.250 -2.124  1.00 44.28  ? 486 ILE A O   1 
ATOM   2800 C CB  . ILE B 1 137 ? -1.930  -17.730 -4.196  1.00 41.85  ? 486 ILE A CB  1 
ATOM   2801 C CG1 . ILE B 1 137 ? -0.747  -17.133 -4.929  1.00 44.33  ? 486 ILE A CG1 1 
ATOM   2802 C CG2 . ILE B 1 137 ? -1.926  -17.227 -2.777  1.00 44.75  ? 486 ILE A CG2 1 
ATOM   2803 C CD1 . ILE B 1 137 ? -0.896  -15.669 -5.275  1.00 46.46  ? 486 ILE A CD1 1 
ATOM   2804 N N   . LEU B 1 138 ? -4.096  -20.022 -3.621  1.00 45.54  ? 487 LEU A N   1 
ATOM   2805 C CA  . LEU B 1 138 ? -5.053  -20.746 -2.749  1.00 42.80  ? 487 LEU A CA  1 
ATOM   2806 C C   . LEU B 1 138 ? -4.715  -22.213 -2.464  1.00 39.63  ? 487 LEU A C   1 
ATOM   2807 O O   . LEU B 1 138 ? -4.884  -22.717 -1.358  1.00 42.93  ? 487 LEU A O   1 
ATOM   2808 C CB  . LEU B 1 138 ? -6.444  -20.704 -3.325  1.00 42.63  ? 487 LEU A CB  1 
ATOM   2809 C CG  . LEU B 1 138 ? -7.095  -19.374 -3.038  1.00 44.92  ? 487 LEU A CG  1 
ATOM   2810 C CD1 . LEU B 1 138 ? -8.348  -19.333 -3.861  1.00 48.06  ? 487 LEU A CD1 1 
ATOM   2811 C CD2 . LEU B 1 138 ? -7.437  -19.143 -1.599  1.00 46.69  ? 487 LEU A CD2 1 
ATOM   2812 N N   . ALA B 1 139 ? -4.265  -22.909 -3.471  1.00 37.20  ? 488 ALA A N   1 
ATOM   2813 C CA  . ALA B 1 139 ? -3.783  -24.278 -3.282  1.00 37.52  ? 488 ALA A CA  1 
ATOM   2814 C C   . ALA B 1 139 ? -2.704  -24.292 -2.259  1.00 39.99  ? 488 ALA A C   1 
ATOM   2815 O O   . ALA B 1 139 ? -2.732  -25.077 -1.348  1.00 40.28  ? 488 ALA A O   1 
ATOM   2816 C CB  . ALA B 1 139 ? -3.249  -24.838 -4.599  1.00 35.94  ? 488 ALA A CB  1 
ATOM   2817 N N   . PHE B 1 140 ? -1.786  -23.324 -2.359  1.00 43.06  ? 489 PHE A N   1 
ATOM   2818 C CA  . PHE B 1 140 ? -0.709  -23.245 -1.422  1.00 40.59  ? 489 PHE A CA  1 
ATOM   2819 C C   . PHE B 1 140 ? -1.192  -22.916 -0.031  1.00 41.19  ? 489 PHE A C   1 
ATOM   2820 O O   . PHE B 1 140 ? -0.630  -23.355 0.959   1.00 41.40  ? 489 PHE A O   1 
ATOM   2821 C CB  . PHE B 1 140 ? 0.307   -22.191 -1.873  1.00 45.60  ? 489 PHE A CB  1 
ATOM   2822 C CG  . PHE B 1 140 ? 1.482   -22.067 -0.946  1.00 40.28  ? 489 PHE A CG  1 
ATOM   2823 C CD1 . PHE B 1 140 ? 2.332   -23.150 -0.766  1.00 46.53  ? 489 PHE A CD1 1 
ATOM   2824 C CD2 . PHE B 1 140 ? 1.682   -20.951 -0.214  1.00 41.24  ? 489 PHE A CD2 1 
ATOM   2825 C CE1 . PHE B 1 140 ? 3.425   -23.071 0.091   1.00 47.47  ? 489 PHE A CE1 1 
ATOM   2826 C CE2 . PHE B 1 140 ? 2.774   -20.839 0.661   1.00 48.35  ? 489 PHE A CE2 1 
ATOM   2827 C CZ  . PHE B 1 140 ? 3.645   -21.916 0.808   1.00 48.42  ? 489 PHE A CZ  1 
ATOM   2828 N N   . SER B 1 141 ? -2.227  -22.099 0.045   1.00 44.12  ? 490 SER A N   1 
ATOM   2829 C CA  . SER B 1 141 ? -2.858  -21.832 1.318   1.00 41.02  ? 490 SER A CA  1 
ATOM   2830 C C   . SER B 1 141 ? -3.334  -23.116 1.992   1.00 43.07  ? 490 SER A C   1 
ATOM   2831 O O   . SER B 1 141 ? -3.101  -23.331 3.186   1.00 43.26  ? 490 SER A O   1 
ATOM   2832 C CB  . SER B 1 141 ? -4.017  -20.872 1.118   1.00 39.15  ? 490 SER A CB  1 
ATOM   2833 O OG  . SER B 1 141 ? -4.554  -20.479 2.359   1.00 40.75  ? 490 SER A OG  1 
ATOM   2834 N N   . ARG B 1 142 ? -3.995  -23.973 1.238   1.00 42.26  ? 491 ARG A N   1 
ATOM   2835 C CA  . ARG B 1 142 ? -4.485  -25.275 1.821   1.00 44.84  ? 491 ARG A CA  1 
ATOM   2836 C C   . ARG B 1 142 ? -3.309  -26.105 2.321   1.00 44.86  ? 491 ARG A C   1 
ATOM   2837 O O   . ARG B 1 142 ? -3.297  -26.688 3.411   1.00 44.09  ? 491 ARG A O   1 
ATOM   2838 C CB  . ARG B 1 142 ? -5.280  -26.134 0.792   1.00 41.91  ? 491 ARG A CB  1 
ATOM   2839 C CG  . ARG B 1 142 ? -6.541  -25.446 0.269   1.00 39.17  ? 491 ARG A CG  1 
ATOM   2840 C CD  . ARG B 1 142 ? -7.247  -26.180 -0.862  1.00 43.26  ? 491 ARG A CD  1 
ATOM   2841 N NE  . ARG B 1 142 ? -8.383  -25.375 -1.331  1.00 49.85  ? 491 ARG A NE  1 
ATOM   2842 C CZ  . ARG B 1 142 ? -8.409  -24.646 -2.458  1.00 49.09  ? 491 ARG A CZ  1 
ATOM   2843 N NH1 . ARG B 1 142 ? -7.381  -24.583 -3.294  1.00 49.01  ? 491 ARG A NH1 1 
ATOM   2844 N NH2 . ARG B 1 142 ? -9.493  -23.951 -2.737  1.00 55.88  ? 491 ARG A NH2 1 
ATOM   2845 N N   . SER B 1 143 ? -2.286  -26.101 1.521   1.00 45.19  ? 492 SER A N   1 
ATOM   2846 C CA  . SER B 1 143 ? -1.094  -26.875 1.831   1.00 52.14  ? 492 SER A CA  1 
ATOM   2847 C C   . SER B 1 143 ? -0.367  -26.318 3.052   1.00 52.26  ? 492 SER A C   1 
ATOM   2848 O O   . SER B 1 143 ? 0.010   -27.062 3.956   1.00 61.37  ? 492 SER A O   1 
ATOM   2849 C CB  . SER B 1 143 ? -0.257  -26.928 0.563   1.00 52.47  ? 492 SER A CB  1 
ATOM   2850 O OG  . SER B 1 143 ? 0.922   -27.601 0.769   1.00 65.13  ? 492 SER A OG  1 
ATOM   2851 N N   . LEU B 1 144 ? -0.263  -25.006 3.161   1.00 46.49  ? 493 LEU A N   1 
ATOM   2852 C CA  . LEU B 1 144 ? 0.292   -24.411 4.394   1.00 48.82  ? 493 LEU A CA  1 
ATOM   2853 C C   . LEU B 1 144 ? -0.613  -24.662 5.610   1.00 51.39  ? 493 LEU A C   1 
ATOM   2854 O O   . LEU B 1 144 ? -0.124  -24.965 6.694   1.00 49.06  ? 493 LEU A O   1 
ATOM   2855 C CB  . LEU B 1 144 ? 0.412   -22.915 4.221   1.00 46.22  ? 493 LEU A CB  1 
ATOM   2856 C CG  . LEU B 1 144 ? 1.603   -22.133 4.691   1.00 54.55  ? 493 LEU A CG  1 
ATOM   2857 C CD1 . LEU B 1 144 ? 1.124   -20.731 4.987   1.00 53.17  ? 493 LEU A CD1 1 
ATOM   2858 C CD2 . LEU B 1 144 ? 2.389   -22.735 5.834   1.00 57.70  ? 493 LEU A CD2 1 
ATOM   2859 N N   . HIS B 1 145 ? -1.927  -24.467 5.459   1.00 47.23  ? 494 HIS A N   1 
ATOM   2860 C CA  . HIS B 1 145 ? -2.853  -24.683 6.611   1.00 50.01  ? 494 HIS A CA  1 
ATOM   2861 C C   . HIS B 1 145 ? -2.801  -26.102 7.199   1.00 44.73  ? 494 HIS A C   1 
ATOM   2862 O O   . HIS B 1 145 ? -2.954  -26.269 8.402   1.00 48.94  ? 494 HIS A O   1 
ATOM   2863 C CB  . HIS B 1 145 ? -4.311  -24.277 6.272   1.00 45.48  ? 494 HIS A CB  1 
ATOM   2864 C CG  . HIS B 1 145 ? -4.506  -22.787 6.136   1.00 48.90  ? 494 HIS A CG  1 
ATOM   2865 N ND1 . HIS B 1 145 ? -3.516  -21.860 6.398   1.00 57.67  ? 494 HIS A ND1 1 
ATOM   2866 C CD2 . HIS B 1 145 ? -5.576  -22.069 5.743   1.00 55.83  ? 494 HIS A CD2 1 
ATOM   2867 C CE1 . HIS B 1 145 ? -3.981  -20.641 6.188   1.00 56.14  ? 494 HIS A CE1 1 
ATOM   2868 N NE2 . HIS B 1 145 ? -5.223  -20.740 5.774   1.00 51.12  ? 494 HIS A NE2 1 
ATOM   2869 N N   . SER B 1 146 ? -2.506  -27.099 6.374   1.00 44.10  ? 495 SER A N   1 
ATOM   2870 C CA  . SER B 1 146 ? -2.497  -28.485 6.819   1.00 53.22  ? 495 SER A CA  1 
ATOM   2871 C C   . SER B 1 146 ? -1.365  -28.749 7.826   1.00 62.34  ? 495 SER A C   1 
ATOM   2872 O O   . SER B 1 146 ? -1.473  -29.617 8.690   1.00 67.45  ? 495 SER A O   1 
ATOM   2873 C CB  . SER B 1 146 ? -2.401  -29.406 5.609   1.00 58.66  ? 495 SER A CB  1 
ATOM   2874 O OG  . SER B 1 146 ? -1.066  -29.513 5.117   1.00 67.21  ? 495 SER A OG  1 
ATOM   2875 N N   . LEU B 1 147 ? -0.306  -27.959 7.733   1.00 64.09  ? 496 LEU A N   1 
ATOM   2876 C CA  . LEU B 1 147 ? 0.793   -28.045 8.686   1.00 65.40  ? 496 LEU A CA  1 
ATOM   2877 C C   . LEU B 1 147 ? 0.486   -27.458 10.049  1.00 65.85  ? 496 LEU A C   1 
ATOM   2878 O O   . LEU B 1 147 ? 1.185   -27.743 10.998  1.00 56.58  ? 496 LEU A O   1 
ATOM   2879 C CB  . LEU B 1 147 ? 2.031   -27.362 8.125   1.00 64.67  ? 496 LEU A CB  1 
ATOM   2880 C CG  . LEU B 1 147 ? 3.031   -28.268 7.402   1.00 64.98  ? 496 LEU A CG  1 
ATOM   2881 C CD1 . LEU B 1 147 ? 2.438   -29.535 6.803   1.00 62.07  ? 496 LEU A CD1 1 
ATOM   2882 C CD2 . LEU B 1 147 ? 3.746   -27.454 6.338   1.00 71.21  ? 496 LEU A CD2 1 
ATOM   2883 N N   . LEU B 1 148 ? -0.532  -26.615 10.149  1.00 62.27  ? 497 LEU A N   1 
ATOM   2884 C CA  . LEU B 1 148 ? -0.824  -25.983 11.414  1.00 63.59  ? 497 LEU A CA  1 
ATOM   2885 C C   . LEU B 1 148 ? 0.421   -25.284 12.021  1.00 66.18  ? 497 LEU A C   1 
ATOM   2886 O O   . LEU B 1 148 ? 0.927   -25.646 13.089  1.00 63.06  ? 497 LEU A O   1 
ATOM   2887 C CB  . LEU B 1 148 ? -1.383  -27.032 12.382  1.00 72.17  ? 497 LEU A CB  1 
ATOM   2888 C CG  . LEU B 1 148 ? -2.521  -27.927 11.855  1.00 78.07  ? 497 LEU A CG  1 
ATOM   2889 C CD1 . LEU B 1 148 ? -2.548  -29.241 12.626  1.00 75.17  ? 497 LEU A CD1 1 
ATOM   2890 C CD2 . LEU B 1 148 ? -3.875  -27.207 11.895  1.00 69.94  ? 497 LEU A CD2 1 
ATOM   2891 N N   . VAL B 1 149 ? 0.911   -24.272 11.322  1.00 63.76  ? 498 VAL A N   1 
ATOM   2892 C CA  . VAL B 1 149 ? 2.033   -23.479 11.805  1.00 55.85  ? 498 VAL A CA  1 
ATOM   2893 C C   . VAL B 1 149 ? 1.439   -22.428 12.700  1.00 58.65  ? 498 VAL A C   1 
ATOM   2894 O O   . VAL B 1 149 ? 0.586   -21.675 12.248  1.00 56.14  ? 498 VAL A O   1 
ATOM   2895 C CB  . VAL B 1 149 ? 2.776   -22.838 10.641  1.00 61.19  ? 498 VAL A CB  1 
ATOM   2896 C CG1 . VAL B 1 149 ? 3.900   -21.939 11.133  1.00 65.31  ? 498 VAL A CG1 1 
ATOM   2897 C CG2 . VAL B 1 149 ? 3.314   -23.934 9.712   1.00 62.64  ? 498 VAL A CG2 1 
ATOM   2898 N N   . ASP B 1 150 ? 1.822   -22.406 13.989  1.00 57.81  ? 499 ASP A N   1 
ATOM   2899 C CA  . ASP B 1 150 ? 1.278   -21.398 14.898  1.00 56.48  ? 499 ASP A CA  1 
ATOM   2900 C C   . ASP B 1 150 ? 1.903   -20.014 14.616  1.00 53.60  ? 499 ASP A C   1 
ATOM   2901 O O   . ASP B 1 150 ? 2.922   -19.897 13.939  1.00 55.76  ? 499 ASP A O   1 
ATOM   2902 C CB  . ASP B 1 150 ? 1.484   -21.816 16.363  1.00 59.79  ? 499 ASP A CB  1 
ATOM   2903 C CG  . ASP B 1 150 ? 2.953   -22.027 16.725  1.00 70.68  ? 499 ASP A CG  1 
ATOM   2904 O OD1 . ASP B 1 150 ? 3.223   -23.031 17.419  1.00 73.53  ? 499 ASP A OD1 1 
ATOM   2905 O OD2 . ASP B 1 150 ? 3.843   -21.230 16.313  1.00 66.70  ? 499 ASP A OD2 1 
ATOM   2906 N N   . VAL B 1 151 ? 1.330   -18.995 15.213  1.00 50.95  ? 500 VAL A N   1 
ATOM   2907 C CA  . VAL B 1 151 ? 1.757   -17.635 14.981  1.00 56.35  ? 500 VAL A CA  1 
ATOM   2908 C C   . VAL B 1 151 ? 3.230   -17.323 15.327  1.00 57.97  ? 500 VAL A C   1 
ATOM   2909 O O   . VAL B 1 151 ? 3.913   -16.655 14.560  1.00 54.79  ? 500 VAL A O   1 
ATOM   2910 C CB  . VAL B 1 151 ? 0.808   -16.668 15.694  1.00 51.24  ? 500 VAL A CB  1 
ATOM   2911 C CG1 . VAL B 1 151 ? 1.358   -15.245 15.731  1.00 51.41  ? 500 VAL A CG1 1 
ATOM   2912 C CG2 . VAL B 1 151 ? -0.569  -16.725 15.002  1.00 50.79  ? 500 VAL A CG2 1 
ATOM   2913 N N   . PRO B 1 152 ? 3.709   -17.769 16.495  1.00 65.45  ? 501 PRO A N   1 
ATOM   2914 C CA  . PRO B 1 152 ? 5.106   -17.416 16.785  1.00 63.35  ? 501 PRO A CA  1 
ATOM   2915 C C   . PRO B 1 152 ? 6.092   -18.068 15.792  1.00 59.49  ? 501 PRO A C   1 
ATOM   2916 O O   . PRO B 1 152 ? 7.119   -17.458 15.408  1.00 60.34  ? 501 PRO A O   1 
ATOM   2917 C CB  . PRO B 1 152 ? 5.291   -17.914 18.237  1.00 63.46  ? 501 PRO A CB  1 
ATOM   2918 C CG  . PRO B 1 152 ? 3.907   -17.824 18.820  1.00 58.86  ? 501 PRO A CG  1 
ATOM   2919 C CD  . PRO B 1 152 ? 3.037   -18.318 17.696  1.00 66.37  ? 501 PRO A CD  1 
ATOM   2920 N N   . ALA B 1 153 ? 5.774   -19.283 15.366  1.00 48.57  ? 502 ALA A N   1 
ATOM   2921 C CA  . ALA B 1 153 ? 6.618   -19.971 14.425  1.00 50.86  ? 502 ALA A CA  1 
ATOM   2922 C C   . ALA B 1 153 ? 6.543   -19.259 13.090  1.00 48.32  ? 502 ALA A C   1 
ATOM   2923 O O   . ALA B 1 153 ? 7.557   -19.007 12.490  1.00 51.36  ? 502 ALA A O   1 
ATOM   2924 C CB  . ALA B 1 153 ? 6.208   -21.427 14.283  1.00 48.94  ? 502 ALA A CB  1 
ATOM   2925 N N   . PHE B 1 154 ? 5.342   -18.893 12.667  1.00 51.14  ? 503 PHE A N   1 
ATOM   2926 C CA  . PHE B 1 154 ? 5.188   -18.146 11.440  1.00 49.81  ? 503 PHE A CA  1 
ATOM   2927 C C   . PHE B 1 154 ? 5.879   -16.788 11.533  1.00 49.04  ? 503 PHE A C   1 
ATOM   2928 O O   . PHE B 1 154 ? 6.450   -16.320 10.553  1.00 46.72  ? 503 PHE A O   1 
ATOM   2929 C CB  . PHE B 1 154 ? 3.709   -17.959 11.064  1.00 48.68  ? 503 PHE A CB  1 
ATOM   2930 C CG  . PHE B 1 154 ? 3.515   -17.385 9.685   1.00 42.24  ? 503 PHE A CG  1 
ATOM   2931 C CD1 . PHE B 1 154 ? 3.480   -18.197 8.565   1.00 39.25  ? 503 PHE A CD1 1 
ATOM   2932 C CD2 . PHE B 1 154 ? 3.454   -16.023 9.520   1.00 44.93  ? 503 PHE A CD2 1 
ATOM   2933 C CE1 . PHE B 1 154 ? 3.365   -17.653 7.295   1.00 38.74  ? 503 PHE A CE1 1 
ATOM   2934 C CE2 . PHE B 1 154 ? 3.316   -15.472 8.271   1.00 46.08  ? 503 PHE A CE2 1 
ATOM   2935 C CZ  . PHE B 1 154 ? 3.259   -16.287 7.163   1.00 42.25  ? 503 PHE A CZ  1 
ATOM   2936 N N   . ALA B 1 155 ? 5.858   -16.177 12.710  1.00 49.46  ? 504 ALA A N   1 
ATOM   2937 C CA  . ALA B 1 155 ? 6.503   -14.897 12.891  1.00 52.84  ? 504 ALA A CA  1 
ATOM   2938 C C   . ALA B 1 155 ? 8.014   -15.027 12.654  1.00 53.00  ? 504 ALA A C   1 
ATOM   2939 O O   . ALA B 1 155 ? 8.614   -14.138 12.083  1.00 48.23  ? 504 ALA A O   1 
ATOM   2940 C CB  . ALA B 1 155 ? 6.196   -14.321 14.252  1.00 57.30  ? 504 ALA A CB  1 
ATOM   2941 N N   . CYS B 1 156 ? 8.611   -16.142 13.072  1.00 48.46  ? 505 CYS A N   1 
ATOM   2942 C CA  . CYS B 1 156 ? 10.020  -16.375 12.838  1.00 47.86  ? 505 CYS A CA  1 
ATOM   2943 C C   . CYS B 1 156 ? 10.316  -16.749 11.405  1.00 51.44  ? 505 CYS A C   1 
ATOM   2944 O O   . CYS B 1 156 ? 11.275  -16.229 10.799  1.00 51.76  ? 505 CYS A O   1 
ATOM   2945 C CB  . CYS B 1 156 ? 10.537  -17.483 13.744  1.00 57.78  ? 505 CYS A CB  1 
ATOM   2946 S SG  . CYS B 1 156 ? 10.501  -16.974 15.484  1.00 54.79  ? 505 CYS A SG  1 
ATOM   2947 N N   . LEU B 1 157 ? 9.491   -17.624 10.849  1.00 47.74  ? 506 LEU A N   1 
ATOM   2948 C CA  . LEU B 1 157 ? 9.745   -18.156 9.538   1.00 44.63  ? 506 LEU A CA  1 
ATOM   2949 C C   . LEU B 1 157 ? 9.701   -17.066 8.498   1.00 44.18  ? 506 LEU A C   1 
ATOM   2950 O O   . LEU B 1 157 ? 10.546  -17.032 7.614   1.00 42.03  ? 506 LEU A O   1 
ATOM   2951 C CB  . LEU B 1 157 ? 8.744   -19.253 9.221   1.00 52.43  ? 506 LEU A CB  1 
ATOM   2952 C CG  . LEU B 1 157 ? 9.111   -20.597 9.857   1.00 53.47  ? 506 LEU A CG  1 
ATOM   2953 C CD1 . LEU B 1 157 ? 7.965   -21.592 9.921   1.00 59.92  ? 506 LEU A CD1 1 
ATOM   2954 C CD2 . LEU B 1 157 ? 10.320  -21.268 9.181   1.00 64.28  ? 506 LEU A CD2 1 
ATOM   2955 N N   . SER B 1 158 ? 8.751   -16.153 8.620   1.00 40.69  ? 507 SER A N   1 
ATOM   2956 C CA  . SER B 1 158 ? 8.605   -15.113 7.656   1.00 42.09  ? 507 SER A CA  1 
ATOM   2957 C C   . SER B 1 158 ? 9.812   -14.178 7.771   1.00 41.03  ? 507 SER A C   1 
ATOM   2958 O O   . SER B 1 158 ? 10.343  -13.694 6.763   1.00 49.89  ? 507 SER A O   1 
ATOM   2959 C CB  . SER B 1 158 ? 7.281   -14.348 7.836   1.00 41.28  ? 507 SER A CB  1 
ATOM   2960 O OG  . SER B 1 158 ? 7.075   -13.911 9.149   1.00 47.02  ? 507 SER A OG  1 
ATOM   2961 N N   . ALA B 1 159 ? 10.261  -13.930 8.981   1.00 40.99  ? 508 ALA A N   1 
ATOM   2962 C CA  . ALA B 1 159 ? 11.412  -13.050 9.184   1.00 42.82  ? 508 ALA A CA  1 
ATOM   2963 C C   . ALA B 1 159 ? 12.655  -13.687 8.609   1.00 38.94  ? 508 ALA A C   1 
ATOM   2964 O O   . ALA B 1 159 ? 13.486  -12.981 8.073   1.00 40.71  ? 508 ALA A O   1 
ATOM   2965 C CB  . ALA B 1 159 ? 11.603  -12.762 10.657  1.00 52.46  ? 508 ALA A CB  1 
ATOM   2966 N N   . LEU B 1 160 ? 12.740  -15.024 8.671   1.00 38.37  ? 509 LEU A N   1 
ATOM   2967 C CA  . LEU B 1 160 ? 13.852  -15.772 8.056   1.00 41.96  ? 509 LEU A CA  1 
ATOM   2968 C C   . LEU B 1 160 ? 13.793  -15.738 6.544   1.00 38.89  ? 509 LEU A C   1 
ATOM   2969 O O   . LEU B 1 160 ? 14.807  -15.815 5.891   1.00 50.22  ? 509 LEU A O   1 
ATOM   2970 C CB  . LEU B 1 160 ? 13.917  -17.247 8.521   1.00 44.40  ? 509 LEU A CB  1 
ATOM   2971 C CG  . LEU B 1 160 ? 14.297  -17.387 10.010  1.00 49.22  ? 509 LEU A CG  1 
ATOM   2972 C CD1 . LEU B 1 160 ? 13.952  -18.739 10.560  1.00 49.60  ? 509 LEU A CD1 1 
ATOM   2973 C CD2 . LEU B 1 160 ? 15.779  -17.094 10.236  1.00 51.72  ? 509 LEU A CD2 1 
ATOM   2974 N N   . VAL B 1 161 ? 12.617  -15.576 5.977   1.00 39.69  ? 510 VAL A N   1 
ATOM   2975 C CA  . VAL B 1 161 ? 12.522  -15.380 4.524   1.00 38.11  ? 510 VAL A CA  1 
ATOM   2976 C C   . VAL B 1 161 ? 13.161  -14.028 4.143   1.00 37.50  ? 510 VAL A C   1 
ATOM   2977 O O   . VAL B 1 161 ? 13.746  -13.905 3.100   1.00 39.07  ? 510 VAL A O   1 
ATOM   2978 C CB  . VAL B 1 161 ? 11.066  -15.473 4.043   1.00 39.19  ? 510 VAL A CB  1 
ATOM   2979 C CG1 . VAL B 1 161 ? 10.921  -14.978 2.620   1.00 41.41  ? 510 VAL A CG1 1 
ATOM   2980 C CG2 . VAL B 1 161 ? 10.534  -16.917 4.202   1.00 41.01  ? 510 VAL A CG2 1 
ATOM   2981 N N   . LEU B 1 162 ? 13.050  -13.037 5.006   1.00 40.15  ? 511 LEU A N   1 
ATOM   2982 C CA  . LEU B 1 162 ? 13.539  -11.684 4.737   1.00 44.22  ? 511 LEU A CA  1 
ATOM   2983 C C   . LEU B 1 162 ? 15.031  -11.602 5.028   1.00 44.80  ? 511 LEU A C   1 
ATOM   2984 O O   . LEU B 1 162 ? 15.784  -11.138 4.195   1.00 41.94  ? 511 LEU A O   1 
ATOM   2985 C CB  . LEU B 1 162 ? 12.794  -10.665 5.641   1.00 42.48  ? 511 LEU A CB  1 
ATOM   2986 C CG  . LEU B 1 162 ? 13.326  -9.249  5.603   1.00 41.68  ? 511 LEU A CG  1 
ATOM   2987 C CD1 . LEU B 1 162 ? 12.957  -8.530  4.326   1.00 38.33  ? 511 LEU A CD1 1 
ATOM   2988 C CD2 . LEU B 1 162 ? 12.804  -8.482  6.804   1.00 44.55  ? 511 LEU A CD2 1 
ATOM   2989 N N   . ILE B 1 163 ? 15.420  -12.036 6.233   1.00 42.13  ? 512 ILE A N   1 
ATOM   2990 C CA  . ILE B 1 163 ? 16.771  -11.892 6.723   1.00 42.26  ? 512 ILE A CA  1 
ATOM   2991 C C   . ILE B 1 163 ? 17.583  -13.144 6.301   1.00 41.72  ? 512 ILE A C   1 
ATOM   2992 O O   . ILE B 1 163 ? 17.654  -14.165 6.989   1.00 39.28  ? 512 ILE A O   1 
ATOM   2993 C CB  . ILE B 1 163 ? 16.822  -11.780 8.270   1.00 48.89  ? 512 ILE A CB  1 
ATOM   2994 C CG1 . ILE B 1 163 ? 15.826  -10.761 8.823   1.00 42.44  ? 512 ILE A CG1 1 
ATOM   2995 C CG2 . ILE B 1 163 ? 18.250  -11.462 8.731   1.00 46.22  ? 512 ILE A CG2 1 
ATOM   2996 C CD1 . ILE B 1 163 ? 16.143  -9.401  8.333   1.00 51.10  ? 512 ILE A CD1 1 
ATOM   2997 N N   . THR B 1 164 ? 18.194  -13.028 5.154   1.00 39.69  ? 513 THR A N   1 
ATOM   2998 C CA  . THR B 1 164 ? 18.860  -14.123 4.567   1.00 42.09  ? 513 THR A CA  1 
ATOM   2999 C C   . THR B 1 164 ? 19.909  -13.563 3.614   1.00 42.46  ? 513 THR A C   1 
ATOM   3000 O O   . THR B 1 164 ? 19.861  -12.377 3.259   1.00 42.25  ? 513 THR A O   1 
ATOM   3001 C CB  . THR B 1 164 ? 17.832  -15.017 3.835   1.00 47.78  ? 513 THR A CB  1 
ATOM   3002 O OG1 . THR B 1 164 ? 18.466  -16.214 3.412   1.00 40.00  ? 513 THR A OG1 1 
ATOM   3003 C CG2 . THR B 1 164 ? 17.212  -14.339 2.604   1.00 38.31  ? 513 THR A CG2 1 
ATOM   3004 N N   . ASP B 1 165 ? 20.867  -14.401 3.228   1.00 40.38  ? 514 ASP A N   1 
ATOM   3005 C CA  . ASP B 1 165 ? 21.890  -14.005 2.302   1.00 40.68  ? 514 ASP A CA  1 
ATOM   3006 C C   . ASP B 1 165 ? 21.283  -13.569 0.978   1.00 42.15  ? 514 ASP A C   1 
ATOM   3007 O O   . ASP B 1 165 ? 20.379  -14.221 0.483   1.00 41.90  ? 514 ASP A O   1 
ATOM   3008 C CB  . ASP B 1 165 ? 22.831  -15.184 1.978   1.00 41.83  ? 514 ASP A CB  1 
ATOM   3009 C CG  . ASP B 1 165 ? 23.847  -15.488 3.082   1.00 45.61  ? 514 ASP A CG  1 
ATOM   3010 O OD1 . ASP B 1 165 ? 23.791  -16.586 3.661   1.00 48.20  ? 514 ASP A OD1 1 
ATOM   3011 O OD2 . ASP B 1 165 ? 24.753  -14.646 3.339   1.00 44.74  ? 514 ASP A OD2 1 
ATOM   3012 N N   . ARG B 1 166 ? 21.844  -12.512 0.382   1.00 37.30  ? 515 ARG A N   1 
ATOM   3013 C CA  . ARG B 1 166 ? 21.544  -12.126 -0.984  1.00 36.71  ? 515 ARG A CA  1 
ATOM   3014 C C   . ARG B 1 166 ? 22.818  -11.568 -1.641  1.00 41.01  ? 515 ARG A C   1 
ATOM   3015 O O   . ARG B 1 166 ? 23.615  -10.898 -0.983  1.00 49.66  ? 515 ARG A O   1 
ATOM   3016 C CB  . ARG B 1 166 ? 20.492  -10.982 -0.989  1.00 35.54  ? 515 ARG A CB  1 
ATOM   3017 C CG  . ARG B 1 166 ? 19.232  -11.320 -0.300  1.00 40.95  ? 515 ARG A CG  1 
ATOM   3018 C CD  . ARG B 1 166 ? 18.366  -12.280 -1.143  1.00 39.36  ? 515 ARG A CD  1 
ATOM   3019 N NE  . ARG B 1 166 ? 17.073  -12.504 -0.448  1.00 47.03  ? 515 ARG A NE  1 
ATOM   3020 C CZ  . ARG B 1 166 ? 16.103  -13.286 -0.908  1.00 49.85  ? 515 ARG A CZ  1 
ATOM   3021 N NH1 . ARG B 1 166 ? 16.284  -13.991 -2.005  1.00 47.06  ? 515 ARG A NH1 1 
ATOM   3022 N NH2 . ARG B 1 166 ? 14.962  -13.364 -0.277  1.00 47.65  ? 515 ARG A NH2 1 
ATOM   3023 N N   . HIS B 1 167 ? 22.979  -11.828 -2.912  1.00 37.27  ? 516 HIS A N   1 
ATOM   3024 C CA  . HIS B 1 167 ? 24.027  -11.239 -3.674  1.00 42.76  ? 516 HIS A CA  1 
ATOM   3025 C C   . HIS B 1 167 ? 23.868  -9.723  -3.609  1.00 47.86  ? 516 HIS A C   1 
ATOM   3026 O O   . HIS B 1 167 ? 22.790  -9.198  -3.865  1.00 45.76  ? 516 HIS A O   1 
ATOM   3027 C CB  . HIS B 1 167 ? 23.920  -11.712 -5.129  1.00 45.67  ? 516 HIS A CB  1 
ATOM   3028 C CG  . HIS B 1 167 ? 24.993  -11.167 -6.014  1.00 61.62  ? 516 HIS A CG  1 
ATOM   3029 N ND1 . HIS B 1 167 ? 26.276  -11.682 -6.025  1.00 65.41  ? 516 HIS A ND1 1 
ATOM   3030 C CD2 . HIS B 1 167 ? 24.987  -10.141 -6.899  1.00 57.53  ? 516 HIS A CD2 1 
ATOM   3031 C CE1 . HIS B 1 167 ? 27.003  -11.009 -6.899  1.00 60.34  ? 516 HIS A CE1 1 
ATOM   3032 N NE2 . HIS B 1 167 ? 26.247  -10.063 -7.431  1.00 58.35  ? 516 HIS A NE2 1 
ATOM   3033 N N   . GLY B 1 168 ? 24.942  -9.037  -3.235  1.00 51.65  ? 517 GLY A N   1 
ATOM   3034 C CA  . GLY B 1 168 ? 24.984  -7.565  -3.204  1.00 40.23  ? 517 GLY A CA  1 
ATOM   3035 C C   . GLY B 1 168 ? 24.801  -6.936  -1.835  1.00 42.20  ? 517 GLY A C   1 
ATOM   3036 O O   . GLY B 1 168 ? 24.775  -5.723  -1.725  1.00 45.94  ? 517 GLY A O   1 
ATOM   3037 N N   . LEU B 1 169 ? 24.660  -7.732  -0.781  1.00 39.38  ? 518 LEU A N   1 
ATOM   3038 C CA  . LEU B 1 169 ? 24.688  -7.168  0.559   1.00 43.63  ? 518 LEU A CA  1 
ATOM   3039 C C   . LEU B 1 169 ? 26.040  -6.462  0.795   1.00 46.28  ? 518 LEU A C   1 
ATOM   3040 O O   . LEU B 1 169 ? 27.097  -6.965  0.406   1.00 44.66  ? 518 LEU A O   1 
ATOM   3041 C CB  . LEU B 1 169 ? 24.472  -8.250  1.626   1.00 45.67  ? 518 LEU A CB  1 
ATOM   3042 C CG  . LEU B 1 169 ? 23.046  -8.788  1.697   1.00 45.21  ? 518 LEU A CG  1 
ATOM   3043 C CD1 . LEU B 1 169 ? 22.997  -9.991  2.599   1.00 41.15  ? 518 LEU A CD1 1 
ATOM   3044 C CD2 . LEU B 1 169 ? 22.155  -7.678  2.211   1.00 48.27  ? 518 LEU A CD2 1 
ATOM   3045 N N   . GLN B 1 170 ? 25.988  -5.322  1.457   1.00 46.40  ? 519 GLN A N   1 
ATOM   3046 C CA  . GLN B 1 170 ? 27.178  -4.590  1.841   1.00 47.73  ? 519 GLN A CA  1 
ATOM   3047 C C   . GLN B 1 170 ? 27.760  -5.267  3.108   1.00 51.05  ? 519 GLN A C   1 
ATOM   3048 O O   . GLN B 1 170 ? 28.955  -5.336  3.266   1.00 49.78  ? 519 GLN A O   1 
ATOM   3049 C CB  . GLN B 1 170 ? 26.796  -3.139  2.156   1.00 48.18  ? 519 GLN A CB  1 
ATOM   3050 C CG  . GLN B 1 170 ? 26.358  -2.360  0.925   1.00 52.43  ? 519 GLN A CG  1 
ATOM   3051 C CD  . GLN B 1 170 ? 25.887  -0.904  1.204   1.00 53.99  ? 519 GLN A CD  1 
ATOM   3052 O OE1 . GLN B 1 170 ? 25.982  -0.061  0.344   1.00 59.67  ? 519 GLN A OE1 1 
ATOM   3053 N NE2 . GLN B 1 170 ? 25.377  -0.639  2.377   1.00 50.79  ? 519 GLN A NE2 1 
ATOM   3054 N N   . GLU B 1 171 ? 26.894  -5.748  4.005   1.00 48.74  ? 520 GLU A N   1 
ATOM   3055 C CA  . GLU B 1 171 ? 27.305  -6.335  5.272   1.00 44.23  ? 520 GLU A CA  1 
ATOM   3056 C C   . GLU B 1 171 ? 26.669  -7.727  5.455   1.00 43.37  ? 520 GLU A C   1 
ATOM   3057 O O   . GLU B 1 171 ? 25.997  -7.996  6.468   1.00 43.97  ? 520 GLU A O   1 
ATOM   3058 C CB  . GLU B 1 171 ? 26.980  -5.396  6.439   1.00 45.92  ? 520 GLU A CB  1 
ATOM   3059 C CG  . GLU B 1 171 ? 27.425  -3.954  6.141   1.00 50.22  ? 520 GLU A CG  1 
ATOM   3060 C CD  . GLU B 1 171 ? 27.329  -3.043  7.326   1.00 55.83  ? 520 GLU A CD  1 
ATOM   3061 O OE1 . GLU B 1 171 ? 26.197  -2.634  7.738   1.00 56.84  ? 520 GLU A OE1 1 
ATOM   3062 O OE2 . GLU B 1 171 ? 28.423  -2.748  7.852   1.00 58.72  ? 520 GLU A OE2 1 
ATOM   3063 N N   . PRO B 1 172 ? 27.009  -8.656  4.551   1.00 40.54  ? 521 PRO A N   1 
ATOM   3064 C CA  . PRO B 1 172 ? 26.460  -9.980  4.666   1.00 41.31  ? 521 PRO A CA  1 
ATOM   3065 C C   . PRO B 1 172 ? 26.614  -10.597 6.055   1.00 43.79  ? 521 PRO A C   1 
ATOM   3066 O O   . PRO B 1 172 ? 25.759  -11.396 6.456   1.00 41.19  ? 521 PRO A O   1 
ATOM   3067 C CB  . PRO B 1 172 ? 27.186  -10.766 3.552   1.00 46.33  ? 521 PRO A CB  1 
ATOM   3068 C CG  . PRO B 1 172 ? 28.431  -9.943  3.211   1.00 38.72  ? 521 PRO A CG  1 
ATOM   3069 C CD  . PRO B 1 172 ? 27.972  -8.537  3.424   1.00 44.05  ? 521 PRO A CD  1 
ATOM   3070 N N   . ARG B 1 173 ? 27.665  -10.287 6.817   1.00 48.57  ? 522 ARG A N   1 
ATOM   3071 C CA  . ARG B 1 173 ? 27.833  -10.999 8.127   1.00 50.22  ? 522 ARG A CA  1 
ATOM   3072 C C   . ARG B 1 173 ? 26.871  -10.446 9.176   1.00 50.53  ? 522 ARG A C   1 
ATOM   3073 O O   . ARG B 1 173 ? 26.464  -11.180 10.066  1.00 48.85  ? 522 ARG A O   1 
ATOM   3074 C CB  . ARG B 1 173 ? 29.264  -10.941 8.713   1.00 56.29  ? 522 ARG A CB  1 
ATOM   3075 C CG  . ARG B 1 173 ? 30.443  -11.139 7.747   1.00 52.70  ? 522 ARG A CG  1 
ATOM   3076 C CD  . ARG B 1 173 ? 30.792  -12.570 7.474   1.00 50.63  ? 522 ARG A CD  1 
ATOM   3077 N NE  . ARG B 1 173 ? 31.049  -13.371 8.662   1.00 58.25  ? 522 ARG A NE  1 
ATOM   3078 C CZ  . ARG B 1 173 ? 32.267  -13.628 9.136   1.00 55.83  ? 522 ARG A CZ  1 
ATOM   3079 N NH1 . ARG B 1 173 ? 32.420  -14.429 10.175  1.00 46.40  ? 522 ARG A NH1 1 
ATOM   3080 N NH2 . ARG B 1 173 ? 33.342  -13.101 8.534   1.00 64.73  ? 522 ARG A NH2 1 
ATOM   3081 N N   . ARG B 1 174 ? 26.511  -9.147  9.102   1.00 50.37  ? 523 ARG A N   1 
ATOM   3082 C CA  . ARG B 1 174 ? 25.499  -8.646  10.047  1.00 44.45  ? 523 ARG A CA  1 
ATOM   3083 C C   . ARG B 1 174 ? 24.156  -9.329  9.767   1.00 40.18  ? 523 ARG A C   1 
ATOM   3084 O O   . ARG B 1 174 ? 23.408  -9.634  10.666  1.00 38.98  ? 523 ARG A O   1 
ATOM   3085 C CB  . ARG B 1 174 ? 25.363  -7.134  10.017  1.00 44.21  ? 523 ARG A CB  1 
ATOM   3086 C CG  . ARG B 1 174 ? 26.634  -6.367  10.433  1.00 46.81  ? 523 ARG A CG  1 
ATOM   3087 C CD  . ARG B 1 174 ? 26.359  -4.899  10.232  1.00 43.35  ? 523 ARG A CD  1 
ATOM   3088 N NE  . ARG B 1 174 ? 25.267  -4.492  11.129  1.00 44.53  ? 523 ARG A NE  1 
ATOM   3089 C CZ  . ARG B 1 174 ? 24.582  -3.345  11.025  1.00 41.41  ? 523 ARG A CZ  1 
ATOM   3090 N NH1 . ARG B 1 174 ? 23.668  -3.062  11.933  1.00 41.66  ? 523 ARG A NH1 1 
ATOM   3091 N NH2 . ARG B 1 174 ? 24.795  -2.484  10.006  1.00 44.01  ? 523 ARG A NH2 1 
ATOM   3092 N N   . VAL B 1 175 ? 23.890  -9.598  8.504   1.00 39.65  ? 524 VAL A N   1 
ATOM   3093 C CA  . VAL B 1 175 ? 22.639  -10.244 8.121   1.00 44.31  ? 524 VAL A CA  1 
ATOM   3094 C C   . VAL B 1 175 ? 22.664  -11.681 8.594   1.00 41.62  ? 524 VAL A C   1 
ATOM   3095 O O   . VAL B 1 175 ? 21.719  -12.108 9.236   1.00 38.66  ? 524 VAL A O   1 
ATOM   3096 C CB  . VAL B 1 175 ? 22.414  -10.160 6.609   1.00 43.25  ? 524 VAL A CB  1 
ATOM   3097 C CG1 . VAL B 1 175 ? 21.229  -10.995 6.249   1.00 48.56  ? 524 VAL A CG1 1 
ATOM   3098 C CG2 . VAL B 1 175 ? 22.170  -8.730  6.174   1.00 42.94  ? 524 VAL A CG2 1 
ATOM   3099 N N   . GLU B 1 176 ? 23.787  -12.389 8.345   1.00 40.20  ? 525 GLU A N   1 
ATOM   3100 C CA  . GLU B 1 176 ? 23.971  -13.755 8.875   1.00 39.38  ? 525 GLU A CA  1 
ATOM   3101 C C   . GLU B 1 176 ? 23.804  -13.754 10.378  1.00 41.21  ? 525 GLU A C   1 
ATOM   3102 O O   . GLU B 1 176 ? 23.110  -14.620 10.942  1.00 46.84  ? 525 GLU A O   1 
ATOM   3103 C CB  . GLU B 1 176 ? 25.301  -14.424 8.382   1.00 38.68  ? 525 GLU A CB  1 
ATOM   3104 C CG  . GLU B 1 176 ? 25.270  -14.661 6.882   1.00 39.11  ? 525 GLU A CG  1 
ATOM   3105 C CD  . GLU B 1 176 ? 26.598  -14.983 6.205   1.00 43.76  ? 525 GLU A CD  1 
ATOM   3106 O OE1 . GLU B 1 176 ? 26.630  -15.207 4.931   1.00 40.44  ? 525 GLU A OE1 1 
ATOM   3107 O OE2 . GLU B 1 176 ? 27.603  -15.131 6.939   1.00 54.55  ? 525 GLU A OE2 1 
ATOM   3108 N N   . GLU B 1 177 ? 24.363  -12.752 11.067  1.00 48.57  ? 526 GLU A N   1 
ATOM   3109 C CA  . GLU B 1 177 ? 24.248  -12.752 12.548  1.00 47.45  ? 526 GLU A CA  1 
ATOM   3110 C C   . GLU B 1 177 ? 22.802  -12.652 12.982  1.00 45.76  ? 526 GLU A C   1 
ATOM   3111 O O   . GLU B 1 177 ? 22.391  -13.302 13.923  1.00 48.01  ? 526 GLU A O   1 
ATOM   3112 C CB  . GLU B 1 177 ? 25.063  -11.620 13.137  1.00 52.50  ? 526 GLU A CB  1 
ATOM   3113 C CG  . GLU B 1 177 ? 24.875  -11.315 14.636  1.00 53.71  ? 526 GLU A CG  1 
ATOM   3114 C CD  . GLU B 1 177 ? 25.036  -12.495 15.581  1.00 64.59  ? 526 GLU A CD  1 
ATOM   3115 O OE1 . GLU B 1 177 ? 24.495  -12.379 16.715  1.00 71.86  ? 526 GLU A OE1 1 
ATOM   3116 O OE2 . GLU B 1 177 ? 25.683  -13.540 15.234  1.00 70.05  ? 526 GLU A OE2 1 
ATOM   3117 N N   . LEU B 1 178 ? 22.033  -11.809 12.295  1.00 44.73  ? 527 LEU A N   1 
ATOM   3118 C CA  . LEU B 1 178 ? 20.651  -11.631 12.652  1.00 46.50  ? 527 LEU A CA  1 
ATOM   3119 C C   . LEU B 1 178 ? 19.886  -12.894 12.281  1.00 46.44  ? 527 LEU A C   1 
ATOM   3120 O O   . LEU B 1 178 ? 19.029  -13.349 13.041  1.00 48.07  ? 527 LEU A O   1 
ATOM   3121 C CB  . LEU B 1 178 ? 20.106  -10.387 11.955  1.00 49.53  ? 527 LEU A CB  1 
ATOM   3122 C CG  . LEU B 1 178 ? 18.700  -10.009 12.303  1.00 52.59  ? 527 LEU A CG  1 
ATOM   3123 C CD1 . LEU B 1 178 ? 18.540  -9.845  13.787  1.00 57.73  ? 527 LEU A CD1 1 
ATOM   3124 C CD2 . LEU B 1 178 ? 18.366  -8.690  11.619  1.00 62.28  ? 527 LEU A CD2 1 
ATOM   3125 N N   . GLN B 1 179 ? 20.185  -13.464 11.115  1.00 45.15  ? 528 GLN A N   1 
ATOM   3126 C CA  . GLN B 1 179 ? 19.584  -14.764 10.738  1.00 51.11  ? 528 GLN A CA  1 
ATOM   3127 C C   . GLN B 1 179 ? 19.798  -15.790 11.845  1.00 53.56  ? 528 GLN A C   1 
ATOM   3128 O O   . GLN B 1 179 ? 18.846  -16.516 12.204  1.00 53.09  ? 528 GLN A O   1 
ATOM   3129 C CB  . GLN B 1 179 ? 20.200  -15.289 9.419   1.00 46.37  ? 528 GLN A CB  1 
ATOM   3130 C CG  . GLN B 1 179 ? 19.687  -16.623 8.859   1.00 44.39  ? 528 GLN A CG  1 
ATOM   3131 C CD  . GLN B 1 179 ? 20.387  -17.021 7.552   1.00 48.56  ? 528 GLN A CD  1 
ATOM   3132 O OE1 . GLN B 1 179 ? 21.592  -17.220 7.520   1.00 51.11  ? 528 GLN A OE1 1 
ATOM   3133 N NE2 . GLN B 1 179 ? 19.640  -17.095 6.460   1.00 51.75  ? 528 GLN A NE2 1 
ATOM   3134 N N   . ASN B 1 180 ? 21.022  -15.860 12.378  1.00 48.89  ? 529 ASN A N   1 
ATOM   3135 C CA  . ASN B 1 180 ? 21.327  -16.853 13.441  1.00 54.39  ? 529 ASN A CA  1 
ATOM   3136 C C   . ASN B 1 180 ? 20.433  -16.634 14.652  1.00 56.15  ? 529 ASN A C   1 
ATOM   3137 O O   . ASN B 1 180 ? 19.847  -17.568 15.190  1.00 56.80  ? 529 ASN A O   1 
ATOM   3138 C CB  . ASN B 1 180 ? 22.814  -16.811 13.898  1.00 49.54  ? 529 ASN A CB  1 
ATOM   3139 C CG  . ASN B 1 180 ? 23.798  -17.438 12.887  1.00 46.08  ? 529 ASN A CG  1 
ATOM   3140 O OD1 . ASN B 1 180 ? 23.411  -17.984 11.870  1.00 48.46  ? 529 ASN A OD1 1 
ATOM   3141 N ND2 . ASN B 1 180 ? 25.051  -17.307 13.152  1.00 43.94  ? 529 ASN A ND2 1 
ATOM   3142 N N   . ARG B 1 181 ? 20.307  -15.386 15.075  1.00 59.08  ? 530 ARG A N   1 
ATOM   3143 C CA  . ARG B 1 181 ? 19.467  -15.088 16.227  1.00 57.26  ? 530 ARG A CA  1 
ATOM   3144 C C   . ARG B 1 181 ? 18.010  -15.509 16.031  1.00 63.43  ? 530 ARG A C   1 
ATOM   3145 O O   . ARG B 1 181 ? 17.357  -16.016 16.960  1.00 61.22  ? 530 ARG A O   1 
ATOM   3146 C CB  . ARG B 1 181 ? 19.498  -13.598 16.539  1.00 66.30  ? 530 ARG A CB  1 
ATOM   3147 C CG  . ARG B 1 181 ? 20.845  -13.065 16.989  1.00 68.35  ? 530 ARG A CG  1 
ATOM   3148 C CD  . ARG B 1 181 ? 20.774  -11.566 17.234  1.00 72.53  ? 530 ARG A CD  1 
ATOM   3149 N NE  . ARG B 1 181 ? 22.055  -10.878 17.049  1.00 78.93  ? 530 ARG A NE  1 
ATOM   3150 C CZ  . ARG B 1 181 ? 22.183  -9.558  16.901  1.00 88.76  ? 530 ARG A CZ  1 
ATOM   3151 N NH1 . ARG B 1 181 ? 23.393  -8.988  16.760  1.00 83.31  ? 530 ARG A NH1 1 
ATOM   3152 N NH2 . ARG B 1 181 ? 21.093  -8.797  16.902  1.00 77.17  ? 530 ARG A NH2 1 
ATOM   3153 N N   . ILE B 1 182 ? 17.473  -15.291 14.835  1.00 63.16  ? 531 ILE A N   1 
ATOM   3154 C CA  . ILE B 1 182 ? 16.064  -15.591 14.624  1.00 57.53  ? 531 ILE A CA  1 
ATOM   3155 C C   . ILE B 1 182 ? 15.871  -17.096 14.563  1.00 48.76  ? 531 ILE A C   1 
ATOM   3156 O O   . ILE B 1 182 ? 14.900  -17.650 15.091  1.00 42.43  ? 531 ILE A O   1 
ATOM   3157 C CB  . ILE B 1 182 ? 15.516  -14.884 13.386  1.00 57.53  ? 531 ILE A CB  1 
ATOM   3158 C CG1 . ILE B 1 182 ? 15.543  -13.398 13.625  1.00 53.53  ? 531 ILE A CG1 1 
ATOM   3159 C CG2 . ILE B 1 182 ? 14.070  -15.312 13.111  1.00 58.50  ? 531 ILE A CG2 1 
ATOM   3160 C CD1 . ILE B 1 182 ? 15.511  -12.623 12.341  1.00 54.77  ? 531 ILE A CD1 1 
ATOM   3161 N N   . ALA B 1 183 ? 16.794  -17.759 13.910  1.00 55.10  ? 532 ALA A N   1 
ATOM   3162 C CA  . ALA B 1 183 ? 16.774  -19.229 13.912  1.00 59.65  ? 532 ALA A CA  1 
ATOM   3163 C C   . ALA B 1 183 ? 16.771  -19.829 15.356  1.00 58.82  ? 532 ALA A C   1 
ATOM   3164 O O   . ALA B 1 183 ? 15.996  -20.746 15.666  1.00 57.47  ? 532 ALA A O   1 
ATOM   3165 C CB  . ALA B 1 183 ? 17.949  -19.762 13.092  1.00 56.67  ? 532 ALA A CB  1 
ATOM   3166 N N   . SER B 1 184 ? 17.626  -19.306 16.230  1.00 57.73  ? 533 SER A N   1 
ATOM   3167 C CA  . SER B 1 184 ? 17.676  -19.781 17.626  1.00 62.89  ? 533 SER A CA  1 
ATOM   3168 C C   . SER B 1 184 ? 16.369  -19.518 18.344  1.00 64.76  ? 533 SER A C   1 
ATOM   3169 O O   . SER B 1 184 ? 15.848  -20.372 19.036  1.00 67.47  ? 533 SER A O   1 
ATOM   3170 C CB  . SER B 1 184 ? 18.813  -19.121 18.387  1.00 58.25  ? 533 SER A CB  1 
ATOM   3171 O OG  . SER B 1 184 ? 20.056  -19.528 17.851  1.00 59.19  ? 533 SER A OG  1 
ATOM   3172 N N   . CYS B 1 185 ? 15.811  -18.348 18.111  1.00 65.90  ? 534 CYS A N   1 
ATOM   3173 C CA  . CYS B 1 185 ? 14.509  -17.996 18.645  1.00 63.45  ? 534 CYS A CA  1 
ATOM   3174 C C   . CYS B 1 185 ? 13.434  -18.988 18.177  1.00 66.22  ? 534 CYS A C   1 
ATOM   3175 O O   . CYS B 1 185 ? 12.617  -19.462 18.969  1.00 66.71  ? 534 CYS A O   1 
ATOM   3176 C CB  . CYS B 1 185 ? 14.175  -16.597 18.165  1.00 70.85  ? 534 CYS A CB  1 
ATOM   3177 S SG  . CYS B 1 185 ? 12.710  -15.873 18.926  1.00 69.76  ? 534 CYS A SG  1 
ATOM   3178 N N   . LEU B 1 186 ? 13.443  -19.325 16.896  1.00 61.50  ? 535 LEU A N   1 
ATOM   3179 C CA  . LEU B 1 186 ? 12.492  -20.313 16.403  1.00 65.18  ? 535 LEU A CA  1 
ATOM   3180 C C   . LEU B 1 186 ? 12.710  -21.684 17.045  1.00 60.88  ? 535 LEU A C   1 
ATOM   3181 O O   . LEU B 1 186 ? 11.780  -22.260 17.589  1.00 60.37  ? 535 LEU A O   1 
ATOM   3182 C CB  . LEU B 1 186 ? 12.547  -20.400 14.877  1.00 64.65  ? 535 LEU A CB  1 
ATOM   3183 C CG  . LEU B 1 186 ? 11.674  -21.474 14.195  1.00 61.58  ? 535 LEU A CG  1 
ATOM   3184 C CD1 . LEU B 1 186 ? 10.188  -21.212 14.438  1.00 59.22  ? 535 LEU A CD1 1 
ATOM   3185 C CD2 . LEU B 1 186 ? 11.950  -21.590 12.696  1.00 59.12  ? 535 LEU A CD2 1 
ATOM   3186 N N   . LYS B 1 187 ? 13.933  -22.192 16.992  1.00 70.63  ? 536 LYS A N   1 
ATOM   3187 C CA  . LYS B 1 187 ? 14.293  -23.498 17.622  1.00 81.56  ? 536 LYS A CA  1 
ATOM   3188 C C   . LYS B 1 187 ? 13.774  -23.622 19.058  1.00 79.94  ? 536 LYS A C   1 
ATOM   3189 O O   . LYS B 1 187 ? 13.095  -24.592 19.418  1.00 73.33  ? 536 LYS A O   1 
ATOM   3190 C CB  . LYS B 1 187 ? 15.820  -23.678 17.632  1.00 89.01  ? 536 LYS A CB  1 
ATOM   3191 C CG  . LYS B 1 187 ? 16.306  -25.078 18.031  1.00 102.08 ? 536 LYS A CG  1 
ATOM   3192 C CD  . LYS B 1 187 ? 17.809  -25.177 18.292  1.00 106.70 ? 536 LYS A CD  1 
ATOM   3193 C CE  . LYS B 1 187 ? 18.269  -26.596 18.687  1.00 111.31 ? 536 LYS A CE  1 
ATOM   3194 N NZ  . LYS B 1 187 ? 18.659  -27.534 17.584  1.00 105.63 ? 536 LYS A NZ  1 
ATOM   3195 N N   . GLU B 1 188 ? 14.101  -22.613 19.853  1.00 72.28  ? 537 GLU A N   1 
ATOM   3196 C CA  . GLU B 1 188 ? 13.684  -22.528 21.248  1.00 79.60  ? 537 GLU A CA  1 
ATOM   3197 C C   . GLU B 1 188 ? 12.174  -22.564 21.401  1.00 76.49  ? 537 GLU A C   1 
ATOM   3198 O O   . GLU B 1 188 ? 11.666  -23.324 22.224  1.00 81.32  ? 537 GLU A O   1 
ATOM   3199 C CB  . GLU B 1 188 ? 14.258  -21.262 21.893  1.00 83.34  ? 537 GLU A CB  1 
ATOM   3200 C CG  . GLU B 1 188 ? 13.860  -21.026 23.347  1.00 97.23  ? 537 GLU A CG  1 
ATOM   3201 C CD  . GLU B 1 188 ? 14.663  -19.895 23.996  1.00 101.56 ? 537 GLU A CD  1 
ATOM   3202 O OE1 . GLU B 1 188 ? 14.061  -18.945 24.545  1.00 95.97  ? 537 GLU A OE1 1 
ATOM   3203 O OE2 . GLU B 1 188 ? 15.907  -19.943 23.949  1.00 107.93 ? 537 GLU A OE2 1 
ATOM   3204 N N   . HIS B 1 189 ? 11.454  -21.774 20.602  1.00 75.84  ? 538 HIS A N   1 
ATOM   3205 C CA  . HIS B 1 189 ? 9.976   -21.855 20.591  1.00 76.72  ? 538 HIS A CA  1 
ATOM   3206 C C   . HIS B 1 189 ? 9.396   -23.234 20.218  1.00 68.96  ? 538 HIS A C   1 
ATOM   3207 O O   . HIS B 1 189 ? 8.416   -23.652 20.820  1.00 67.52  ? 538 HIS A O   1 
ATOM   3208 C CB  . HIS B 1 189 ? 9.340   -20.801 19.670  1.00 75.26  ? 538 HIS A CB  1 
ATOM   3209 C CG  . HIS B 1 189 ? 7.852   -20.974 19.475  1.00 81.42  ? 538 HIS A CG  1 
ATOM   3210 N ND1 . HIS B 1 189 ? 6.932   -20.611 20.443  1.00 82.21  ? 538 HIS A ND1 1 
ATOM   3211 C CD2 . HIS B 1 189 ? 7.127   -21.480 18.436  1.00 79.15  ? 538 HIS A CD2 1 
ATOM   3212 C CE1 . HIS B 1 189 ? 5.709   -20.866 20.000  1.00 81.12  ? 538 HIS A CE1 1 
ATOM   3213 N NE2 . HIS B 1 189 ? 5.799   -21.412 18.796  1.00 77.41  ? 538 HIS A NE2 1 
ATOM   3214 N N   . VAL B 1 190 ? 9.958   -23.925 19.222  1.00 77.11  ? 539 VAL A N   1 
ATOM   3215 C CA  . VAL B 1 190 ? 9.395   -25.239 18.853  1.00 88.85  ? 539 VAL A CA  1 
ATOM   3216 C C   . VAL B 1 190 ? 9.717   -26.314 19.913  1.00 91.93  ? 539 VAL A C   1 
ATOM   3217 O O   . VAL B 1 190 ? 9.025   -27.311 19.984  1.00 97.53  ? 539 VAL A O   1 
ATOM   3218 C CB  . VAL B 1 190 ? 9.732   -25.737 17.418  1.00 87.51  ? 539 VAL A CB  1 
ATOM   3219 C CG1 . VAL B 1 190 ? 9.286   -24.704 16.389  1.00 85.08  ? 539 VAL A CG1 1 
ATOM   3220 C CG2 . VAL B 1 190 ? 11.204  -26.098 17.276  1.00 97.34  ? 539 VAL A CG2 1 
ATOM   3221 N N   . ALA B 1 191 ? 10.729  -26.087 20.755  1.00 100.26 ? 540 ALA A N   1 
ATOM   3222 C CA  . ALA B 1 191 ? 10.981  -26.964 21.918  1.00 88.41  ? 540 ALA A CA  1 
ATOM   3223 C C   . ALA B 1 191 ? 9.991   -26.653 23.057  1.00 86.37  ? 540 ALA A C   1 
ATOM   3224 O O   . ALA B 1 191 ? 9.384   -27.565 23.624  1.00 100.89 ? 540 ALA A O   1 
ATOM   3225 C CB  . ALA B 1 191 ? 12.422  -26.825 22.391  1.00 82.91  ? 540 ALA A CB  1 
ATOM   3226 N N   . ALA B 1 192 ? 9.830   -25.369 23.382  1.00 78.26  ? 541 ALA A N   1 
ATOM   3227 C CA  . ALA B 1 192 ? 8.870   -24.933 24.414  1.00 89.04  ? 541 ALA A CA  1 
ATOM   3228 C C   . ALA B 1 192 ? 7.471   -25.516 24.157  1.00 97.38  ? 541 ALA A C   1 
ATOM   3229 O O   . ALA B 1 192 ? 6.884   -26.243 24.983  1.00 97.96  ? 541 ALA A O   1 
ATOM   3230 C CB  . ALA B 1 192 ? 8.808   -23.404 24.485  1.00 81.31  ? 541 ALA A CB  1 
ATOM   3231 N N   . VAL B 1 193 ? 6.974   -25.257 22.962  1.00 104.16 ? 542 VAL A N   1 
ATOM   3232 C CA  . VAL B 1 193 ? 5.616   -25.657 22.619  1.00 109.97 ? 542 VAL A CA  1 
ATOM   3233 C C   . VAL B 1 193 ? 5.562   -27.160 22.308  1.00 107.95 ? 542 VAL A C   1 
ATOM   3234 O O   . VAL B 1 193 ? 4.506   -27.779 22.415  1.00 110.94 ? 542 VAL A O   1 
ATOM   3235 C CB  . VAL B 1 193 ? 5.037   -24.823 21.465  1.00 116.62 ? 542 VAL A CB  1 
ATOM   3236 C CG1 . VAL B 1 193 ? 3.649   -25.341 21.086  1.00 117.18 ? 542 VAL A CG1 1 
ATOM   3237 C CG2 . VAL B 1 193 ? 4.971   -23.344 21.857  1.00 119.95 ? 542 VAL A CG2 1 
ATOM   3238 N N   . ALA B 1 194 ? 6.698   -27.757 21.972  1.00 104.58 ? 543 ALA A N   1 
ATOM   3239 C CA  . ALA B 1 194 ? 6.764   -29.223 21.887  1.00 118.51 ? 543 ALA A CA  1 
ATOM   3240 C C   . ALA B 1 194 ? 6.394   -29.820 23.234  1.00 129.74 ? 543 ALA A C   1 
ATOM   3241 O O   . ALA B 1 194 ? 5.641   -30.781 23.289  1.00 133.32 ? 543 ALA A O   1 
ATOM   3242 C CB  . ALA B 1 194 ? 8.151   -29.715 21.487  1.00 116.84 ? 543 ALA A CB  1 
ATOM   3243 N N   . GLY B 1 195 ? 6.922   -29.216 24.302  1.00 134.04 ? 544 GLY A N   1 
ATOM   3244 C CA  . GLY B 1 195 ? 6.841   -29.722 25.664  1.00 125.23 ? 544 GLY A CA  1 
ATOM   3245 C C   . GLY B 1 195 ? 8.228   -29.750 26.289  1.00 130.38 ? 544 GLY A C   1 
ATOM   3246 O O   . GLY B 1 195 ? 9.243   -29.723 25.578  1.00 130.02 ? 544 GLY A O   1 
ATOM   3247 N N   . SER B 1 201 ? 10.479  -32.194 13.011  1.00 98.11  ? 550 SER A N   1 
ATOM   3248 C CA  . SER B 1 201 ? 9.934   -32.705 11.752  1.00 104.20 ? 550 SER A CA  1 
ATOM   3249 C C   . SER B 1 201 ? 9.051   -31.660 11.019  1.00 107.20 ? 550 SER A C   1 
ATOM   3250 O O   . SER B 1 201 ? 9.082   -31.594 9.770   1.00 113.70 ? 550 SER A O   1 
ATOM   3251 C CB  . SER B 1 201 ? 9.163   -34.032 11.981  1.00 98.99  ? 550 SER A CB  1 
ATOM   3252 O OG  . SER B 1 201 ? 9.307   -34.938 10.891  1.00 78.50  ? 550 SER A OG  1 
ATOM   3253 N N   . CYS B 1 202 ? 8.275   -30.865 11.783  1.00 100.36 ? 551 CYS A N   1 
ATOM   3254 C CA  . CYS B 1 202 ? 7.476   -29.755 11.218  1.00 97.08  ? 551 CYS A CA  1 
ATOM   3255 C C   . CYS B 1 202 ? 8.361   -28.989 10.224  1.00 91.80  ? 551 CYS A C   1 
ATOM   3256 O O   . CYS B 1 202 ? 7.943   -28.708 9.100   1.00 68.98  ? 551 CYS A O   1 
ATOM   3257 C CB  . CYS B 1 202 ? 6.934   -28.789 12.305  1.00 96.83  ? 551 CYS A CB  1 
ATOM   3258 S SG  . CYS B 1 202 ? 6.034   -27.313 11.680  1.00 105.63 ? 551 CYS A SG  1 
ATOM   3259 N N   . LEU B 1 203 ? 9.599   -28.711 10.647  1.00 89.56  ? 552 LEU A N   1 
ATOM   3260 C CA  . LEU B 1 203 ? 10.524  -27.939 9.860   1.00 89.89  ? 552 LEU A CA  1 
ATOM   3261 C C   . LEU B 1 203 ? 10.818  -28.598 8.513   1.00 86.50  ? 552 LEU A C   1 
ATOM   3262 O O   . LEU B 1 203 ? 10.712  -27.959 7.454   1.00 82.13  ? 552 LEU A O   1 
ATOM   3263 C CB  . LEU B 1 203 ? 11.827  -27.693 10.623  1.00 87.42  ? 552 LEU A CB  1 
ATOM   3264 C CG  . LEU B 1 203 ? 12.825  -26.779 9.880   1.00 93.40  ? 552 LEU A CG  1 
ATOM   3265 C CD1 . LEU B 1 203 ? 12.297  -25.362 9.630   1.00 74.26  ? 552 LEU A CD1 1 
ATOM   3266 C CD2 . LEU B 1 203 ? 14.153  -26.738 10.628  1.00 100.57 ? 552 LEU A CD2 1 
ATOM   3267 N N   . SER B 1 204 ? 11.191  -29.866 8.531   1.00 79.45  ? 553 SER A N   1 
ATOM   3268 C CA  . SER B 1 204 ? 11.442  -30.552 7.252   1.00 85.15  ? 553 SER A CA  1 
ATOM   3269 C C   . SER B 1 204 ? 10.178  -30.674 6.381   1.00 75.33  ? 553 SER A C   1 
ATOM   3270 O O   . SER B 1 204 ? 10.275  -30.754 5.137   1.00 58.07  ? 553 SER A O   1 
ATOM   3271 C CB  . SER B 1 204 ? 12.030  -31.942 7.481   1.00 85.89  ? 553 SER A CB  1 
ATOM   3272 O OG  . SER B 1 204 ? 11.127  -32.701 8.255   1.00 82.92  ? 553 SER A OG  1 
ATOM   3273 N N   . ARG B 1 205 ? 9.010   -30.731 7.028   1.00 65.69  ? 554 ARG A N   1 
ATOM   3274 C CA  . ARG B 1 205 ? 7.740   -30.802 6.287   1.00 66.54  ? 554 ARG A CA  1 
ATOM   3275 C C   . ARG B 1 205 ? 7.461   -29.426 5.647   1.00 64.37  ? 554 ARG A C   1 
ATOM   3276 O O   . ARG B 1 205 ? 7.021   -29.362 4.517   1.00 62.62  ? 554 ARG A O   1 
ATOM   3277 C CB  . ARG B 1 205 ? 6.583   -31.244 7.198   1.00 78.49  ? 554 ARG A CB  1 
ATOM   3278 C CG  . ARG B 1 205 ? 6.323   -32.752 7.247   1.00 87.18  ? 554 ARG A CG  1 
ATOM   3279 C CD  . ARG B 1 205 ? 5.194   -33.127 8.217   1.00 99.14  ? 554 ARG A CD  1 
ATOM   3280 N NE  . ARG B 1 205 ? 5.609   -33.037 9.650   1.00 115.19 ? 554 ARG A NE  1 
ATOM   3281 C CZ  . ARG B 1 205 ? 5.696   -34.067 10.523  1.00 111.95 ? 554 ARG A CZ  1 
ATOM   3282 N NH1 . ARG B 1 205 ? 5.383   -35.318 10.168  1.00 104.76 ? 554 ARG A NH1 1 
ATOM   3283 N NH2 . ARG B 1 205 ? 6.089   -33.850 11.787  1.00 96.71  ? 554 ARG A NH2 1 
ATOM   3284 N N   . LEU B 1 206 ? 7.736   -28.347 6.384   1.00 61.85  ? 555 LEU A N   1 
ATOM   3285 C CA  . LEU B 1 206 ? 7.695   -26.989 5.873   1.00 63.35  ? 555 LEU A CA  1 
ATOM   3286 C C   . LEU B 1 206 ? 8.638   -26.767 4.691   1.00 61.19  ? 555 LEU A C   1 
ATOM   3287 O O   . LEU B 1 206 ? 8.241   -26.232 3.642   1.00 68.58  ? 555 LEU A O   1 
ATOM   3288 C CB  . LEU B 1 206 ? 8.069   -26.005 6.967   1.00 69.24  ? 555 LEU A CB  1 
ATOM   3289 C CG  . LEU B 1 206 ? 6.913   -25.143 7.391   1.00 78.44  ? 555 LEU A CG  1 
ATOM   3290 C CD1 . LEU B 1 206 ? 7.266   -24.463 8.704   1.00 76.51  ? 555 LEU A CD1 1 
ATOM   3291 C CD2 . LEU B 1 206 ? 6.554   -24.149 6.276   1.00 77.76  ? 555 LEU A CD2 1 
ATOM   3292 N N   . LEU B 1 207 ? 9.888   -27.148 4.866   1.00 50.33  ? 556 LEU A N   1 
ATOM   3293 C CA  . LEU B 1 207 ? 10.876  -27.035 3.779   1.00 60.32  ? 556 LEU A CA  1 
ATOM   3294 C C   . LEU B 1 207 ? 10.491  -27.839 2.550   1.00 53.51  ? 556 LEU A C   1 
ATOM   3295 O O   . LEU B 1 207 ? 10.794  -27.449 1.432   1.00 56.22  ? 556 LEU A O   1 
ATOM   3296 C CB  . LEU B 1 207 ? 12.296  -27.387 4.279   1.00 62.32  ? 556 LEU A CB  1 
ATOM   3297 C CG  . LEU B 1 207 ? 13.077  -26.249 4.956   1.00 66.17  ? 556 LEU A CG  1 
ATOM   3298 C CD1 . LEU B 1 207 ? 12.212  -25.121 5.514   1.00 69.89  ? 556 LEU A CD1 1 
ATOM   3299 C CD2 . LEU B 1 207 ? 13.970  -26.798 6.041   1.00 67.82  ? 556 LEU A CD2 1 
ATOM   3300 N N   . GLY B 1 208 ? 9.776   -28.932 2.758   1.00 56.45  ? 557 GLY A N   1 
ATOM   3301 C CA  . GLY B 1 208 ? 9.200   -29.684 1.645   1.00 57.04  ? 557 GLY A CA  1 
ATOM   3302 C C   . GLY B 1 208 ? 8.182   -28.920 0.781   1.00 58.81  ? 557 GLY A C   1 
ATOM   3303 O O   . GLY B 1 208 ? 7.915   -29.332 -0.353  1.00 61.21  ? 557 GLY A O   1 
ATOM   3304 N N   . LYS B 1 209 ? 7.623   -27.822 1.304   1.00 60.15  ? 558 LYS A N   1 
ATOM   3305 C CA  . LYS B 1 209 ? 6.710   -26.906 0.561   1.00 65.77  ? 558 LYS A CA  1 
ATOM   3306 C C   . LYS B 1 209 ? 7.444   -25.735 -0.124  1.00 66.01  ? 558 LYS A C   1 
ATOM   3307 O O   . LYS B 1 209 ? 6.850   -24.960 -0.881  1.00 66.87  ? 558 LYS A O   1 
ATOM   3308 C CB  . LYS B 1 209 ? 5.745   -26.228 1.525   1.00 74.10  ? 558 LYS A CB  1 
ATOM   3309 C CG  . LYS B 1 209 ? 4.994   -27.167 2.425   1.00 78.47  ? 558 LYS A CG  1 
ATOM   3310 C CD  . LYS B 1 209 ? 3.791   -27.757 1.723   1.00 77.40  ? 558 LYS A CD  1 
ATOM   3311 C CE  . LYS B 1 209 ? 3.691   -29.224 2.043   1.00 75.21  ? 558 LYS A CE  1 
ATOM   3312 N NZ  . LYS B 1 209 ? 2.322   -29.750 2.054   1.00 77.51  ? 558 LYS A NZ  1 
ATOM   3313 N N   . LEU B 1 210 ? 8.730   -25.573 0.177   1.00 65.94  ? 559 LEU A N   1 
ATOM   3314 C CA  . LEU B 1 210 ? 9.516   -24.518 -0.469  1.00 69.51  ? 559 LEU A CA  1 
ATOM   3315 C C   . LEU B 1 210 ? 9.486   -24.480 -1.993  1.00 64.14  ? 559 LEU A C   1 
ATOM   3316 O O   . LEU B 1 210 ? 9.410   -23.398 -2.547  1.00 61.82  ? 559 LEU A O   1 
ATOM   3317 C CB  . LEU B 1 210 ? 10.969  -24.625 -0.084  1.00 66.77  ? 559 LEU A CB  1 
ATOM   3318 C CG  . LEU B 1 210 ? 11.490  -23.371 0.578   1.00 78.81  ? 559 LEU A CG  1 
ATOM   3319 C CD1 . LEU B 1 210 ? 10.423  -22.639 1.386   1.00 79.73  ? 559 LEU A CD1 1 
ATOM   3320 C CD2 . LEU B 1 210 ? 12.620  -23.794 1.488   1.00 74.11  ? 559 LEU A CD2 1 
ATOM   3321 N N   . PRO B 1 211 ? 9.601   -25.653 -2.662  1.00 63.70  ? 560 PRO A N   1 
ATOM   3322 C CA  . PRO B 1 211 ? 9.523   -25.662 -4.142  1.00 68.52  ? 560 PRO A CA  1 
ATOM   3323 C C   . PRO B 1 211 ? 8.200   -25.154 -4.675  1.00 64.20  ? 560 PRO A C   1 
ATOM   3324 O O   . PRO B 1 211 ? 8.176   -24.532 -5.748  1.00 61.20  ? 560 PRO A O   1 
ATOM   3325 C CB  . PRO B 1 211 ? 9.703   -27.153 -4.551  1.00 64.13  ? 560 PRO A CB  1 
ATOM   3326 C CG  . PRO B 1 211 ? 10.050  -27.900 -3.306  1.00 66.25  ? 560 PRO A CG  1 
ATOM   3327 C CD  . PRO B 1 211 ? 10.002  -26.972 -2.106  1.00 62.82  ? 560 PRO A CD  1 
ATOM   3328 N N   . GLU B 1 212 ? 7.121   -25.414 -3.942  1.00 54.52  ? 561 GLU A N   1 
ATOM   3329 C CA  . GLU B 1 212 ? 5.824   -24.865 -4.312  1.00 60.82  ? 561 GLU A CA  1 
ATOM   3330 C C   . GLU B 1 212 ? 5.859   -23.295 -4.203  1.00 54.65  ? 561 GLU A C   1 
ATOM   3331 O O   . GLU B 1 212 ? 5.429   -22.616 -5.111  1.00 54.05  ? 561 GLU A O   1 
ATOM   3332 C CB  . GLU B 1 212 ? 4.752   -25.497 -3.423  1.00 64.72  ? 561 GLU A CB  1 
ATOM   3333 C CG  . GLU B 1 212 ? 3.335   -25.552 -3.969  1.00 76.13  ? 561 GLU A CG  1 
ATOM   3334 C CD  . GLU B 1 212 ? 2.359   -26.182 -2.951  1.00 87.47  ? 561 GLU A CD  1 
ATOM   3335 O OE1 . GLU B 1 212 ? 1.124   -25.790 -2.964  1.00 66.63  ? 561 GLU A OE1 1 
ATOM   3336 O OE2 . GLU B 1 212 ? 2.856   -27.067 -2.149  1.00 64.96  ? 561 GLU A OE2 1 
ATOM   3337 N N   . LEU B 1 213 ? 6.426   -22.756 -3.124  1.00 44.90  ? 562 LEU A N   1 
ATOM   3338 C CA  . LEU B 1 213 ? 6.576   -21.291 -2.961  1.00 53.15  ? 562 LEU A CA  1 
ATOM   3339 C C   . LEU B 1 213 ? 7.444   -20.646 -4.055  1.00 55.19  ? 562 LEU A C   1 
ATOM   3340 O O   . LEU B 1 213 ? 7.110   -19.580 -4.602  1.00 57.22  ? 562 LEU A O   1 
ATOM   3341 C CB  . LEU B 1 213 ? 7.154   -20.982 -1.597  1.00 45.74  ? 562 LEU A CB  1 
ATOM   3342 C CG  . LEU B 1 213 ? 7.061   -19.564 -1.108  1.00 47.53  ? 562 LEU A CG  1 
ATOM   3343 C CD1 . LEU B 1 213 ? 5.687   -18.910 -1.140  1.00 45.56  ? 562 LEU A CD1 1 
ATOM   3344 C CD2 . LEU B 1 213 ? 7.536   -19.611 0.338   1.00 49.93  ? 562 LEU A CD2 1 
ATOM   3345 N N   . ARG B 1 214 ? 8.549   -21.306 -4.380  1.00 53.69  ? 563 ARG A N   1 
ATOM   3346 C CA  . ARG B 1 214 ? 9.432   -20.850 -5.463  1.00 56.18  ? 563 ARG A CA  1 
ATOM   3347 C C   . ARG B 1 214 ? 8.686   -20.799 -6.751  1.00 44.65  ? 563 ARG A C   1 
ATOM   3348 O O   . ARG B 1 214 ? 8.788   -19.855 -7.478  1.00 43.57  ? 563 ARG A O   1 
ATOM   3349 C CB  . ARG B 1 214 ? 10.644  -21.792 -5.671  1.00 63.31  ? 563 ARG A CB  1 
ATOM   3350 C CG  . ARG B 1 214 ? 11.995  -21.407 -5.008  1.00 80.62  ? 563 ARG A CG  1 
ATOM   3351 C CD  . ARG B 1 214 ? 11.968  -20.993 -3.530  1.00 89.92  ? 563 ARG A CD  1 
ATOM   3352 N NE  . ARG B 1 214 ? 13.230  -21.334 -2.838  1.00 101.19 ? 563 ARG A NE  1 
ATOM   3353 C CZ  . ARG B 1 214 ? 13.604  -20.855 -1.646  1.00 98.34  ? 563 ARG A CZ  1 
ATOM   3354 N NH1 . ARG B 1 214 ? 12.853  -19.982 -0.984  1.00 101.88 ? 563 ARG A NH1 1 
ATOM   3355 N NH2 . ARG B 1 214 ? 14.740  -21.254 -1.109  1.00 84.89  ? 563 ARG A NH2 1 
ATOM   3356 N N   . THR B 1 215 ? 7.962   -21.860 -7.066  1.00 46.21  ? 564 THR A N   1 
ATOM   3357 C CA  . THR B 1 215 ? 7.208   -21.900 -8.299  1.00 43.79  ? 564 THR A CA  1 
ATOM   3358 C C   . THR B 1 215 ? 6.213   -20.743 -8.275  1.00 41.83  ? 564 THR A C   1 
ATOM   3359 O O   . THR B 1 215 ? 5.957   -20.134 -9.292  1.00 51.35  ? 564 THR A O   1 
ATOM   3360 C CB  . THR B 1 215 ? 6.460   -23.268 -8.462  1.00 49.13  ? 564 THR A CB  1 
ATOM   3361 O OG1 . THR B 1 215 ? 7.402   -24.287 -8.754  1.00 51.25  ? 564 THR A OG1 1 
ATOM   3362 C CG2 . THR B 1 215 ? 5.438   -23.253 -9.597  1.00 48.44  ? 564 THR A CG2 1 
ATOM   3363 N N   . LEU B 1 216 ? 5.628   -20.465 -7.116  1.00 42.69  ? 565 LEU A N   1 
ATOM   3364 C CA  . LEU B 1 216 ? 4.644   -19.371 -7.035  1.00 41.49  ? 565 LEU A CA  1 
ATOM   3365 C C   . LEU B 1 216 ? 5.265   -17.999 -7.257  1.00 40.90  ? 565 LEU A C   1 
ATOM   3366 O O   . LEU B 1 216 ? 4.672   -17.118 -7.904  1.00 36.19  ? 565 LEU A O   1 
ATOM   3367 C CB  . LEU B 1 216 ? 3.947   -19.431 -5.740  1.00 40.36  ? 565 LEU A CB  1 
ATOM   3368 C CG  . LEU B 1 216 ? 2.995   -20.635 -5.613  1.00 45.23  ? 565 LEU A CG  1 
ATOM   3369 C CD1 . LEU B 1 216 ? 2.673   -20.867 -4.161  1.00 42.46  ? 565 LEU A CD1 1 
ATOM   3370 C CD2 . LEU B 1 216 ? 1.706   -20.385 -6.362  1.00 43.14  ? 565 LEU A CD2 1 
ATOM   3371 N N   . CYS B 1 217 ? 6.490   -17.833 -6.794  1.00 38.28  ? 566 CYS A N   1 
ATOM   3372 C CA  . CYS B 1 217 ? 7.206   -16.555 -7.039  1.00 41.67  ? 566 CYS A CA  1 
ATOM   3373 C C   . CYS B 1 217 ? 7.415   -16.351 -8.520  1.00 43.23  ? 566 CYS A C   1 
ATOM   3374 O O   . CYS B 1 217 ? 7.059   -15.307 -9.097  1.00 41.99  ? 566 CYS A O   1 
ATOM   3375 C CB  . CYS B 1 217 ? 8.532   -16.608 -6.348  1.00 37.92  ? 566 CYS A CB  1 
ATOM   3376 S SG  . CYS B 1 217 ? 8.322   -16.533 -4.593  1.00 45.75  ? 566 CYS A SG  1 
ATOM   3377 N N   . THR B 1 218 ? 7.880   -17.421 -9.153  1.00 39.52  ? 567 THR A N   1 
ATOM   3378 C CA  . THR B 1 218 ? 7.993   -17.427 -10.576 1.00 38.55  ? 567 THR A CA  1 
ATOM   3379 C C   . THR B 1 218 ? 6.684   -17.135 -11.300 1.00 41.65  ? 567 THR A C   1 
ATOM   3380 O O   . THR B 1 218 ? 6.705   -16.398 -12.286 1.00 46.48  ? 567 THR A O   1 
ATOM   3381 C CB  . THR B 1 218 ? 8.507   -18.786 -11.052 1.00 41.13  ? 567 THR A CB  1 
ATOM   3382 O OG1 . THR B 1 218 ? 9.744   -19.062 -10.410 1.00 48.16  ? 567 THR A OG1 1 
ATOM   3383 C CG2 . THR B 1 218 ? 8.732   -18.801 -12.552 1.00 38.72  ? 567 THR A CG2 1 
ATOM   3384 N N   . GLN B 1 219 ? 5.581   -17.796 -10.921 1.00 42.27  ? 568 GLN A N   1 
ATOM   3385 C CA  . GLN B 1 219 ? 4.294   -17.511 -11.564 1.00 44.78  ? 568 GLN A CA  1 
ATOM   3386 C C   . GLN B 1 219 ? 3.937   -16.029 -11.444 1.00 41.90  ? 568 GLN A C   1 
ATOM   3387 O O   . GLN B 1 219 ? 3.252   -15.481 -12.330 1.00 45.32  ? 568 GLN A O   1 
ATOM   3388 C CB  . GLN B 1 219 ? 3.124   -18.296 -10.961 1.00 48.36  ? 568 GLN A CB  1 
ATOM   3389 C CG  . GLN B 1 219 ? 3.028   -19.719 -11.388 1.00 61.21  ? 568 GLN A CG  1 
ATOM   3390 C CD  . GLN B 1 219 ? 1.822   -20.429 -10.749 1.00 67.17  ? 568 GLN A CD  1 
ATOM   3391 O OE1 . GLN B 1 219 ? 0.646   -20.087 -10.999 1.00 60.40  ? 568 GLN A OE1 1 
ATOM   3392 N NE2 . GLN B 1 219 ? 2.118   -21.459 -9.958  1.00 64.54  ? 568 GLN A NE2 1 
ATOM   3393 N N   . GLY B 1 220 ? 4.297   -15.429 -10.311 1.00 39.41  ? 569 GLY A N   1 
ATOM   3394 C CA  . GLY B 1 220 ? 4.066   -13.991 -10.068 1.00 35.66  ? 569 GLY A CA  1 
ATOM   3395 C C   . GLY B 1 220 ? 4.879   -13.184 -11.033 1.00 40.21  ? 569 GLY A C   1 
ATOM   3396 O O   . GLY B 1 220 ? 4.373   -12.228 -11.632 1.00 42.57  ? 569 GLY A O   1 
ATOM   3397 N N   . LEU B 1 221 ? 6.141   -13.569 -11.228 1.00 41.17  ? 570 LEU A N   1 
ATOM   3398 C CA  . LEU B 1 221 ? 6.968   -12.849 -12.201 1.00 42.06  ? 570 LEU A CA  1 
ATOM   3399 C C   . LEU B 1 221 ? 6.362   -12.974 -13.618 1.00 45.03  ? 570 LEU A C   1 
ATOM   3400 O O   . LEU B 1 221 ? 6.333   -12.005 -14.394 1.00 43.82  ? 570 LEU A O   1 
ATOM   3401 C CB  . LEU B 1 221 ? 8.405   -13.369 -12.175 1.00 41.50  ? 570 LEU A CB  1 
ATOM   3402 C CG  . LEU B 1 221 ? 9.248   -13.043 -10.937 1.00 43.63  ? 570 LEU A CG  1 
ATOM   3403 C CD1 . LEU B 1 221 ? 10.589  -13.717 -10.995 1.00 39.96  ? 570 LEU A CD1 1 
ATOM   3404 C CD2 . LEU B 1 221 ? 9.477   -11.560 -10.815 1.00 44.95  ? 570 LEU A CD2 1 
ATOM   3405 N N   . GLN B 1 222 ? 5.833   -14.150 -13.964 1.00 42.51  ? 571 GLN A N   1 
ATOM   3406 C CA  . GLN B 1 222 ? 5.203   -14.329 -15.308 1.00 35.53  ? 571 GLN A CA  1 
ATOM   3407 C C   . GLN B 1 222 ? 3.960   -13.464 -15.465 1.00 37.86  ? 571 GLN A C   1 
ATOM   3408 O O   . GLN B 1 222 ? 3.733   -12.897 -16.514 1.00 37.61  ? 571 GLN A O   1 
ATOM   3409 C CB  . GLN B 1 222 ? 4.836   -15.772 -15.507 1.00 42.32  ? 571 GLN A CB  1 
ATOM   3410 C CG  . GLN B 1 222 ? 6.038   -16.713 -15.554 1.00 44.30  ? 571 GLN A CG  1 
ATOM   3411 C CD  . GLN B 1 222 ? 5.556   -18.135 -15.733 1.00 52.50  ? 571 GLN A CD  1 
ATOM   3412 O OE1 . GLN B 1 222 ? 5.466   -18.920 -14.778 1.00 47.58  ? 571 GLN A OE1 1 
ATOM   3413 N NE2 . GLN B 1 222 ? 5.210   -18.473 -16.987 1.00 53.38  ? 571 GLN A NE2 1 
ATOM   3414 N N   . ARG B 1 223 ? 3.185   -13.292 -14.395 1.00 37.84  ? 572 ARG A N   1 
ATOM   3415 C CA  . ARG B 1 223 ? 1.999   -12.505 -14.508 1.00 42.12  ? 572 ARG A CA  1 
ATOM   3416 C C   . ARG B 1 223 ? 2.399   -11.028 -14.672 1.00 40.01  ? 572 ARG A C   1 
ATOM   3417 O O   . ARG B 1 223 ? 1.834   -10.298 -15.504 1.00 43.13  ? 572 ARG A O   1 
ATOM   3418 C CB  . ARG B 1 223 ? 1.096   -12.679 -13.287 1.00 37.41  ? 572 ARG A CB  1 
ATOM   3419 C CG  . ARG B 1 223 ? -0.135  -11.821 -13.388 1.00 46.20  ? 572 ARG A CG  1 
ATOM   3420 C CD  . ARG B 1 223 ? -1.023  -12.387 -14.495 1.00 46.57  ? 572 ARG A CD  1 
ATOM   3421 N NE  . ARG B 1 223 ? -2.303  -11.696 -14.575 1.00 42.84  ? 572 ARG A NE  1 
ATOM   3422 C CZ  . ARG B 1 223 ? -3.125  -11.780 -15.619 1.00 44.03  ? 572 ARG A CZ  1 
ATOM   3423 N NH1 . ARG B 1 223 ? -2.794  -12.547 -16.647 1.00 44.71  ? 572 ARG A NH1 1 
ATOM   3424 N NH2 . ARG B 1 223 ? -4.241  -11.055 -15.659 1.00 37.90  ? 572 ARG A NH2 1 
ATOM   3425 N N   . ILE B 1 224 ? 3.415   -10.594 -13.946 1.00 40.09  ? 573 ILE A N   1 
ATOM   3426 C CA  . ILE B 1 224 ? 3.857   -9.201  -14.112 1.00 39.52  ? 573 ILE A CA  1 
ATOM   3427 C C   . ILE B 1 224 ? 4.407   -8.999  -15.526 1.00 39.94  ? 573 ILE A C   1 
ATOM   3428 O O   . ILE B 1 224 ? 4.049   -8.038  -16.188 1.00 36.41  ? 573 ILE A O   1 
ATOM   3429 C CB  . ILE B 1 224 ? 4.874   -8.804  -13.068 1.00 40.23  ? 573 ILE A CB  1 
ATOM   3430 C CG1 . ILE B 1 224 ? 4.228   -8.828  -11.708 1.00 39.58  ? 573 ILE A CG1 1 
ATOM   3431 C CG2 . ILE B 1 224 ? 5.388   -7.392  -13.356 1.00 43.54  ? 573 ILE A CG2 1 
ATOM   3432 C CD1 . ILE B 1 224 ? 5.192   -8.739  -10.552 1.00 40.41  ? 573 ILE A CD1 1 
ATOM   3433 N N   . PHE B 1 225 ? 5.181   -9.966  -16.024 1.00 40.14  ? 574 PHE A N   1 
ATOM   3434 C CA  . PHE B 1 225 ? 5.651   -9.893  -17.413 1.00 42.54  ? 574 PHE A CA  1 
ATOM   3435 C C   . PHE B 1 225 ? 4.527   -9.725  -18.370 1.00 46.92  ? 574 PHE A C   1 
ATOM   3436 O O   . PHE B 1 225 ? 4.524   -8.859  -19.214 1.00 49.63  ? 574 PHE A O   1 
ATOM   3437 C CB  . PHE B 1 225 ? 6.399   -11.166 -17.811 1.00 47.71  ? 574 PHE A CB  1 
ATOM   3438 C CG  . PHE B 1 225 ? 6.883   -11.148 -19.216 1.00 47.23  ? 574 PHE A CG  1 
ATOM   3439 C CD1 . PHE B 1 225 ? 7.901   -10.277 -19.593 1.00 46.88  ? 574 PHE A CD1 1 
ATOM   3440 C CD2 . PHE B 1 225 ? 6.311   -11.963 -20.171 1.00 44.78  ? 574 PHE A CD2 1 
ATOM   3441 C CE1 . PHE B 1 225 ? 8.333   -10.212 -20.917 1.00 46.06  ? 574 PHE A CE1 1 
ATOM   3442 C CE2 . PHE B 1 225 ? 6.724   -11.886 -21.482 1.00 44.11  ? 574 PHE A CE2 1 
ATOM   3443 C CZ  . PHE B 1 225 ? 7.740   -11.012 -21.859 1.00 40.08  ? 574 PHE A CZ  1 
ATOM   3444 N N   . TYR B 1 226 ? 3.544   -10.585 -18.238 1.00 50.27  ? 575 TYR A N   1 
ATOM   3445 C CA  . TYR B 1 226 ? 2.427   -10.563 -19.142 1.00 48.35  ? 575 TYR A CA  1 
ATOM   3446 C C   . TYR B 1 226 ? 1.663   -9.236  -19.059 1.00 44.41  ? 575 TYR A C   1 
ATOM   3447 O O   . TYR B 1 226 ? 1.312   -8.683  -20.076 1.00 43.35  ? 575 TYR A O   1 
ATOM   3448 C CB  . TYR B 1 226 ? 1.480   -11.705 -18.811 1.00 52.34  ? 575 TYR A CB  1 
ATOM   3449 C CG  . TYR B 1 226 ? 0.173   -11.533 -19.488 1.00 54.35  ? 575 TYR A CG  1 
ATOM   3450 C CD1 . TYR B 1 226 ? 0.001   -11.934 -20.801 1.00 54.07  ? 575 TYR A CD1 1 
ATOM   3451 C CD2 . TYR B 1 226 ? -0.881  -10.918 -18.825 1.00 54.09  ? 575 TYR A CD2 1 
ATOM   3452 C CE1 . TYR B 1 226 ? -1.209  -11.770 -21.437 1.00 59.30  ? 575 TYR A CE1 1 
ATOM   3453 C CE2 . TYR B 1 226 ? -2.092  -10.754 -19.430 1.00 60.22  ? 575 TYR A CE2 1 
ATOM   3454 C CZ  . TYR B 1 226 ? -2.257  -11.172 -20.737 1.00 68.48  ? 575 TYR A CZ  1 
ATOM   3455 O OH  . TYR B 1 226 ? -3.467  -10.978 -21.334 1.00 64.56  ? 575 TYR A OH  1 
ATOM   3456 N N   . LEU B 1 227 ? 1.437   -8.725  -17.859 1.00 40.62  ? 576 LEU A N   1 
ATOM   3457 C CA  . LEU B 1 227 ? 0.710   -7.472  -17.718 1.00 44.89  ? 576 LEU A CA  1 
ATOM   3458 C C   . LEU B 1 227 ? 1.540   -6.281  -18.246 1.00 44.58  ? 576 LEU A C   1 
ATOM   3459 O O   . LEU B 1 227 ? 1.000   -5.331  -18.830 1.00 42.11  ? 576 LEU A O   1 
ATOM   3460 C CB  . LEU B 1 227 ? 0.310   -7.233  -16.249 1.00 47.29  ? 576 LEU A CB  1 
ATOM   3461 C CG  . LEU B 1 227 ? -0.716  -8.206  -15.668 1.00 43.34  ? 576 LEU A CG  1 
ATOM   3462 C CD1 . LEU B 1 227 ? -0.905  -8.066  -14.184 1.00 44.92  ? 576 LEU A CD1 1 
ATOM   3463 C CD2 . LEU B 1 227 ? -2.033  -8.008  -16.329 1.00 47.00  ? 576 LEU A CD2 1 
ATOM   3464 N N   . LYS B 1 228 ? 2.850   -6.369  -18.126 1.00 44.35  ? 577 LYS A N   1 
ATOM   3465 C CA  . LYS B 1 228 ? 3.706   -5.321  -18.690 1.00 47.14  ? 577 LYS A CA  1 
ATOM   3466 C C   . LYS B 1 228 ? 3.670   -5.364  -20.206 1.00 53.80  ? 577 LYS A C   1 
ATOM   3467 O O   . LYS B 1 228 ? 3.708   -4.342  -20.864 1.00 55.79  ? 577 LYS A O   1 
ATOM   3468 C CB  . LYS B 1 228 ? 5.128   -5.491  -18.220 1.00 46.56  ? 577 LYS A CB  1 
ATOM   3469 C CG  . LYS B 1 228 ? 5.343   -5.057  -16.783 1.00 45.70  ? 577 LYS A CG  1 
ATOM   3470 C CD  . LYS B 1 228 ? 6.728   -5.487  -16.302 1.00 53.65  ? 577 LYS A CD  1 
ATOM   3471 C CE  . LYS B 1 228 ? 7.908   -4.837  -17.050 1.00 49.97  ? 577 LYS A CE  1 
ATOM   3472 N NZ  . LYS B 1 228 ? 7.894   -3.357  -17.009 1.00 52.32  ? 577 LYS A NZ  1 
ATOM   3473 N N   . LEU B 1 229 ? 3.612   -6.562  -20.756 1.00 54.68  ? 578 LEU A N   1 
ATOM   3474 C CA  . LEU B 1 229 ? 3.437   -6.693  -22.176 1.00 57.17  ? 578 LEU A CA  1 
ATOM   3475 C C   . LEU B 1 229 ? 2.175   -6.021  -22.600 1.00 55.61  ? 578 LEU A C   1 
ATOM   3476 O O   . LEU B 1 229 ? 2.140   -5.313  -23.573 1.00 61.87  ? 578 LEU A O   1 
ATOM   3477 C CB  . LEU B 1 229 ? 3.316   -8.148  -22.571 1.00 62.58  ? 578 LEU A CB  1 
ATOM   3478 C CG  . LEU B 1 229 ? 4.543   -8.751  -23.182 1.00 68.44  ? 578 LEU A CG  1 
ATOM   3479 C CD1 . LEU B 1 229 ? 4.204   -10.181 -23.576 1.00 68.52  ? 578 LEU A CD1 1 
ATOM   3480 C CD2 . LEU B 1 229 ? 4.986   -7.944  -24.399 1.00 76.89  ? 578 LEU A CD2 1 
ATOM   3481 N N   . GLU B 1 230 ? 1.118   -6.305  -21.878 1.00 56.58  ? 579 GLU A N   1 
ATOM   3482 C CA  . GLU B 1 230 ? -0.189  -5.839  -22.234 1.00 62.92  ? 579 GLU A CA  1 
ATOM   3483 C C   . GLU B 1 230 ? -0.267  -4.314  -22.024 1.00 56.40  ? 579 GLU A C   1 
ATOM   3484 O O   . GLU B 1 230 ? -0.908  -3.618  -22.781 1.00 58.47  ? 579 GLU A O   1 
ATOM   3485 C CB  . GLU B 1 230 ? -1.239  -6.585  -21.369 1.00 58.99  ? 579 GLU A CB  1 
ATOM   3486 C CG  . GLU B 1 230 ? -2.645  -6.401  -21.856 1.00 65.87  ? 579 GLU A CG  1 
ATOM   3487 C CD  . GLU B 1 230 ? -3.658  -6.989  -20.915 1.00 67.69  ? 579 GLU A CD  1 
ATOM   3488 O OE1 . GLU B 1 230 ? -3.397  -7.037  -19.696 1.00 63.20  ? 579 GLU A OE1 1 
ATOM   3489 O OE2 . GLU B 1 230 ? -4.738  -7.347  -21.415 1.00 68.36  ? 579 GLU A OE2 1 
ATOM   3490 N N   . ASP B 1 231 ? 0.359   -3.827  -20.961 1.00 52.29  ? 580 ASP A N   1 
ATOM   3491 C CA  . ASP B 1 231 ? 0.542   -2.399  -20.730 1.00 50.71  ? 580 ASP A CA  1 
ATOM   3492 C C   . ASP B 1 231 ? -0.743  -1.598  -20.581 1.00 53.58  ? 580 ASP A C   1 
ATOM   3493 O O   . ASP B 1 231 ? -0.770  -0.440  -20.910 1.00 59.42  ? 580 ASP A O   1 
ATOM   3494 C CB  . ASP B 1 231 ? 1.394   -1.796  -21.857 1.00 57.44  ? 580 ASP A CB  1 
ATOM   3495 C CG  . ASP B 1 231 ? 1.974   -0.404  -21.508 1.00 62.83  ? 580 ASP A CG  1 
ATOM   3496 O OD1 . ASP B 1 231 ? 2.031   -0.002  -20.314 1.00 58.30  ? 580 ASP A OD1 1 
ATOM   3497 O OD2 . ASP B 1 231 ? 2.378   0.294   -22.461 1.00 71.27  ? 580 ASP A OD2 1 
ATOM   3498 N N   . LEU B 1 232 ? -1.804  -2.202  -20.077 1.00 52.35  ? 581 LEU A N   1 
ATOM   3499 C CA  . LEU B 1 232 ? -3.026  -1.470  -19.834 1.00 44.75  ? 581 LEU A CA  1 
ATOM   3500 C C   . LEU B 1 232 ? -2.777  -0.310  -18.903 1.00 45.31  ? 581 LEU A C   1 
ATOM   3501 O O   . LEU B 1 232 ? -3.231  0.782   -19.152 1.00 51.29  ? 581 LEU A O   1 
ATOM   3502 C CB  . LEU B 1 232 ? -4.102  -2.372  -19.276 1.00 45.69  ? 581 LEU A CB  1 
ATOM   3503 C CG  . LEU B 1 232 ? -4.635  -3.516  -20.173 1.00 51.59  ? 581 LEU A CG  1 
ATOM   3504 C CD1 . LEU B 1 232 ? -5.985  -3.947  -19.666 1.00 49.37  ? 581 LEU A CD1 1 
ATOM   3505 C CD2 . LEU B 1 232 ? -4.744  -3.149  -21.665 1.00 53.99  ? 581 LEU A CD2 1 
ATOM   3506 N N   . VAL B 1 233 ? -2.090  -0.547  -17.814 1.00 54.82  ? 582 VAL A N   1 
ATOM   3507 C CA  . VAL B 1 233 ? -1.630  0.516   -16.919 1.00 48.63  ? 582 VAL A CA  1 
ATOM   3508 C C   . VAL B 1 233 ? -0.188  0.217   -16.532 1.00 56.87  ? 582 VAL A C   1 
ATOM   3509 O O   . VAL B 1 233 ? 0.228   -0.949  -16.474 1.00 56.61  ? 582 VAL A O   1 
ATOM   3510 C CB  . VAL B 1 233 ? -2.486  0.634   -15.653 1.00 52.59  ? 582 VAL A CB  1 
ATOM   3511 C CG1 . VAL B 1 233 ? -3.972  0.672   -16.009 1.00 57.93  ? 582 VAL A CG1 1 
ATOM   3512 C CG2 . VAL B 1 233 ? -2.209  -0.482  -14.677 1.00 56.68  ? 582 VAL A CG2 1 
ATOM   3513 N N   . PRO B 1 234 ? 0.601   1.263   -16.298 1.00 60.96  ? 583 PRO A N   1 
ATOM   3514 C CA  . PRO B 1 234 ? 1.990   0.988   -15.966 1.00 61.12  ? 583 PRO A CA  1 
ATOM   3515 C C   . PRO B 1 234 ? 2.101   0.435   -14.558 1.00 60.79  ? 583 PRO A C   1 
ATOM   3516 O O   . PRO B 1 234 ? 1.255   0.754   -13.715 1.00 54.68  ? 583 PRO A O   1 
ATOM   3517 C CB  . PRO B 1 234 ? 2.646   2.361   -16.025 1.00 62.91  ? 583 PRO A CB  1 
ATOM   3518 C CG  . PRO B 1 234 ? 1.526   3.343   -15.854 1.00 64.58  ? 583 PRO A CG  1 
ATOM   3519 C CD  . PRO B 1 234 ? 0.309   2.702   -16.431 1.00 60.82  ? 583 PRO A CD  1 
ATOM   3520 N N   . PRO B 1 235 ? 3.125   -0.406  -14.301 1.00 56.50  ? 584 PRO A N   1 
ATOM   3521 C CA  . PRO B 1 235 ? 3.307   -0.847  -12.947 1.00 54.12  ? 584 PRO A CA  1 
ATOM   3522 C C   . PRO B 1 235 ? 3.828   0.302   -12.103 1.00 49.05  ? 584 PRO A C   1 
ATOM   3523 O O   . PRO B 1 235 ? 4.459   1.174   -12.608 1.00 57.93  ? 584 PRO A O   1 
ATOM   3524 C CB  . PRO B 1 235 ? 4.368   -1.953  -13.058 1.00 59.83  ? 584 PRO A CB  1 
ATOM   3525 C CG  . PRO B 1 235 ? 4.792   -2.019  -14.484 1.00 57.87  ? 584 PRO A CG  1 
ATOM   3526 C CD  . PRO B 1 235 ? 4.218   -0.844  -15.183 1.00 58.38  ? 584 PRO A CD  1 
ATOM   3527 N N   . PRO B 1 236 ? 3.568   0.286   -10.817 1.00 51.70  ? 585 PRO A N   1 
ATOM   3528 C CA  . PRO B 1 236 ? 4.209   1.250   -9.964  1.00 53.99  ? 585 PRO A CA  1 
ATOM   3529 C C   . PRO B 1 236 ? 5.726   1.026   -9.989  1.00 56.11  ? 585 PRO A C   1 
ATOM   3530 O O   . PRO B 1 236 ? 6.187   -0.105  -10.169 1.00 50.76  ? 585 PRO A O   1 
ATOM   3531 C CB  . PRO B 1 236 ? 3.636   0.968   -8.578  1.00 50.21  ? 585 PRO A CB  1 
ATOM   3532 C CG  . PRO B 1 236 ? 2.882   -0.312  -8.676  1.00 50.86  ? 585 PRO A CG  1 
ATOM   3533 C CD  . PRO B 1 236 ? 2.834   -0.762  -10.090 1.00 50.95  ? 585 PRO A CD  1 
ATOM   3534 N N   . PRO B 1 237 ? 6.491   2.106   -9.826  1.00 55.58  ? 586 PRO A N   1 
ATOM   3535 C CA  . PRO B 1 237 ? 7.933   2.051   -10.142 1.00 54.46  ? 586 PRO A CA  1 
ATOM   3536 C C   . PRO B 1 237 ? 8.705   1.052   -9.323  1.00 48.65  ? 586 PRO A C   1 
ATOM   3537 O O   . PRO B 1 237 ? 9.596   0.349   -9.833  1.00 46.78  ? 586 PRO A O   1 
ATOM   3538 C CB  . PRO B 1 237 ? 8.408   3.501   -9.826  1.00 60.80  ? 586 PRO A CB  1 
ATOM   3539 C CG  . PRO B 1 237 ? 7.186   4.353   -10.083 1.00 55.86  ? 586 PRO A CG  1 
ATOM   3540 C CD  . PRO B 1 237 ? 6.018   3.495   -9.614  1.00 55.72  ? 586 PRO A CD  1 
ATOM   3541 N N   . ILE B 1 238 ? 8.383   0.996   -8.039  1.00 49.59  ? 587 ILE A N   1 
ATOM   3542 C CA  . ILE B 1 238 ? 9.079   0.096   -7.147  1.00 49.54  ? 587 ILE A CA  1 
ATOM   3543 C C   . ILE B 1 238 ? 8.775   -1.396  -7.457  1.00 57.95  ? 587 ILE A C   1 
ATOM   3544 O O   . ILE B 1 238 ? 9.652   -2.259  -7.353  1.00 53.03  ? 587 ILE A O   1 
ATOM   3545 C CB  . ILE B 1 238 ? 8.699   0.448   -5.735  1.00 62.57  ? 587 ILE A CB  1 
ATOM   3546 C CG1 . ILE B 1 238 ? 9.531   -0.363  -4.753  1.00 67.64  ? 587 ILE A CG1 1 
ATOM   3547 C CG2 . ILE B 1 238 ? 7.206   0.196   -5.509  1.00 75.19  ? 587 ILE A CG2 1 
ATOM   3548 C CD1 . ILE B 1 238 ? 11.015  -0.089  -4.846  1.00 75.68  ? 587 ILE A CD1 1 
ATOM   3549 N N   . ILE B 1 239 ? 7.540   -1.715  -7.867  1.00 52.93  ? 588 ILE A N   1 
ATOM   3550 C CA  . ILE B 1 239 ? 7.241   -3.095  -8.282  1.00 50.34  ? 588 ILE A CA  1 
ATOM   3551 C C   . ILE B 1 239 ? 8.024   -3.376  -9.522  1.00 47.55  ? 588 ILE A C   1 
ATOM   3552 O O   . ILE B 1 239 ? 8.647   -4.450  -9.666  1.00 44.24  ? 588 ILE A O   1 
ATOM   3553 C CB  . ILE B 1 239 ? 5.741   -3.317  -8.581  1.00 46.85  ? 588 ILE A CB  1 
ATOM   3554 C CG1 . ILE B 1 239 ? 4.907   -3.064  -7.320  1.00 44.27  ? 588 ILE A CG1 1 
ATOM   3555 C CG2 . ILE B 1 239 ? 5.490   -4.688  -9.191  1.00 44.99  ? 588 ILE A CG2 1 
ATOM   3556 C CD1 . ILE B 1 239 ? 5.367   -3.855  -6.106  1.00 46.52  ? 588 ILE A CD1 1 
ATOM   3557 N N   . ASP B 1 240 ? 7.976   -2.417  -10.433 1.00 45.30  ? 589 ASP A N   1 
ATOM   3558 C CA  . ASP B 1 240 ? 8.721   -2.552  -11.694 1.00 49.92  ? 589 ASP A CA  1 
ATOM   3559 C C   . ASP B 1 240 ? 10.211  -2.801  -11.432 1.00 51.21  ? 589 ASP A C   1 
ATOM   3560 O O   . ASP B 1 240 ? 10.839  -3.590  -12.115 1.00 56.56  ? 589 ASP A O   1 
ATOM   3561 C CB  . ASP B 1 240 ? 8.534   -1.308  -12.568 1.00 53.11  ? 589 ASP A CB  1 
ATOM   3562 C CG  . ASP B 1 240 ? 8.731   -1.589  -14.035 1.00 58.44  ? 589 ASP A CG  1 
ATOM   3563 O OD1 . ASP B 1 240 ? 8.269   -2.628  -14.531 1.00 59.73  ? 589 ASP A OD1 1 
ATOM   3564 O OD2 . ASP B 1 240 ? 9.352   -0.761  -14.728 1.00 66.52  ? 589 ASP A OD2 1 
ATOM   3565 N N   . LYS B 1 241 ? 10.774  -2.145  -10.420 1.00 51.41  ? 590 LYS A N   1 
ATOM   3566 C CA  . LYS B 1 241 ? 12.179  -2.299  -10.152 1.00 51.53  ? 590 LYS A CA  1 
ATOM   3567 C C   . LYS B 1 241 ? 12.457  -3.690  -9.642  1.00 51.73  ? 590 LYS A C   1 
ATOM   3568 O O   . LYS B 1 241 ? 13.423  -4.359  -10.075 1.00 43.28  ? 590 LYS A O   1 
ATOM   3569 C CB  . LYS B 1 241 ? 12.654  -1.253  -9.156  1.00 57.60  ? 590 LYS A CB  1 
ATOM   3570 C CG  . LYS B 1 241 ? 14.081  -1.449  -8.686  1.00 57.80  ? 590 LYS A CG  1 
ATOM   3571 C CD  . LYS B 1 241 ? 14.596  -0.181  -8.009  1.00 66.23  ? 590 LYS A CD  1 
ATOM   3572 C CE  . LYS B 1 241 ? 15.496  -0.425  -6.791  1.00 66.35  ? 590 LYS A CE  1 
ATOM   3573 N NZ  . LYS B 1 241 ? 16.617  -1.386  -7.023  1.00 62.97  ? 590 LYS A NZ  1 
ATOM   3574 N N   . ILE B 1 242 ? 11.611  -4.143  -8.729  1.00 49.97  ? 591 ILE A N   1 
ATOM   3575 C CA  . ILE B 1 242 ? 11.771  -5.491  -8.175  1.00 47.35  ? 591 ILE A CA  1 
ATOM   3576 C C   . ILE B 1 242 ? 11.734  -6.513  -9.294  1.00 47.97  ? 591 ILE A C   1 
ATOM   3577 O O   . ILE B 1 242 ? 12.560  -7.442  -9.372  1.00 54.87  ? 591 ILE A O   1 
ATOM   3578 C CB  . ILE B 1 242 ? 10.681  -5.779  -7.145  1.00 49.02  ? 591 ILE A CB  1 
ATOM   3579 C CG1 . ILE B 1 242 ? 10.920  -4.965  -5.873  1.00 47.96  ? 591 ILE A CG1 1 
ATOM   3580 C CG2 . ILE B 1 242 ? 10.638  -7.246  -6.817  1.00 48.77  ? 591 ILE A CG2 1 
ATOM   3581 C CD1 . ILE B 1 242 ? 9.684   -4.786  -4.984  1.00 51.00  ? 591 ILE A CD1 1 
ATOM   3582 N N   . PHE B 1 243 ? 10.778  -6.345  -10.179 1.00 46.02  ? 592 PHE A N   1 
ATOM   3583 C CA  . PHE B 1 243 ? 10.640  -7.258  -11.307 1.00 49.94  ? 592 PHE A CA  1 
ATOM   3584 C C   . PHE B 1 243 ? 11.956  -7.197  -12.091 1.00 52.05  ? 592 PHE A C   1 
ATOM   3585 O O   . PHE B 1 243 ? 12.639  -8.208  -12.258 1.00 58.35  ? 592 PHE A O   1 
ATOM   3586 C CB  . PHE B 1 243 ? 9.405   -6.842  -12.154 1.00 49.48  ? 592 PHE A CB  1 
ATOM   3587 C CG  . PHE B 1 243 ? 9.264   -7.580  -13.450 1.00 50.01  ? 592 PHE A CG  1 
ATOM   3588 C CD1 . PHE B 1 243 ? 8.615   -8.795  -13.506 1.00 45.51  ? 592 PHE A CD1 1 
ATOM   3589 C CD2 . PHE B 1 243 ? 9.764   -7.038  -14.635 1.00 50.15  ? 592 PHE A CD2 1 
ATOM   3590 C CE1 . PHE B 1 243 ? 8.495   -9.479  -14.713 1.00 44.50  ? 592 PHE A CE1 1 
ATOM   3591 C CE2 . PHE B 1 243 ? 9.655   -7.718  -15.837 1.00 45.66  ? 592 PHE A CE2 1 
ATOM   3592 C CZ  . PHE B 1 243 ? 9.003   -8.942  -15.876 1.00 47.69  ? 592 PHE A CZ  1 
ATOM   3593 N N   . MET B 1 244 ? 12.338  -6.005  -12.541 1.00 54.67  ? 593 MET A N   1 
ATOM   3594 C CA  . MET B 1 244 ? 13.591  -5.865  -13.321 1.00 54.62  ? 593 MET A CA  1 
ATOM   3595 C C   . MET B 1 244 ? 14.821  -6.398  -12.549 1.00 50.46  ? 593 MET A C   1 
ATOM   3596 O O   . MET B 1 244 ? 15.624  -7.065  -13.137 1.00 47.31  ? 593 MET A O   1 
ATOM   3597 C CB  . MET B 1 244 ? 13.782  -4.418  -13.794 1.00 57.64  ? 593 MET A CB  1 
ATOM   3598 C CG  . MET B 1 244 ? 12.712  -3.867  -14.747 1.00 57.38  ? 593 MET A CG  1 
ATOM   3599 S SD  . MET B 1 244 ? 12.537  -4.742  -16.334 1.00 66.04  ? 593 MET A SD  1 
ATOM   3600 C CE  . MET B 1 244 ? 11.368  -3.584  -17.079 1.00 78.77  ? 593 MET A CE  1 
ATOM   3601 N N   . ASP B 1 245 ? 14.933  -6.171  -11.226 1.00 52.09  ? 594 ASP A N   1 
ATOM   3602 C CA  . ASP B 1 245 ? 16.146  -6.579  -10.481 1.00 57.15  ? 594 ASP A CA  1 
ATOM   3603 C C   . ASP B 1 245 ? 16.234  -8.059  -10.253 1.00 60.49  ? 594 ASP A C   1 
ATOM   3604 O O   . ASP B 1 245 ? 17.317  -8.595  -10.095 1.00 62.29  ? 594 ASP A O   1 
ATOM   3605 C CB  . ASP B 1 245 ? 16.264  -5.893  -9.117  1.00 57.21  ? 594 ASP A CB  1 
ATOM   3606 C CG  . ASP B 1 245 ? 16.601  -4.422  -9.220  1.00 61.11  ? 594 ASP A CG  1 
ATOM   3607 O OD1 . ASP B 1 245 ? 16.861  -3.942  -10.357 1.00 62.60  ? 594 ASP A OD1 1 
ATOM   3608 O OD2 . ASP B 1 245 ? 16.564  -3.739  -8.159  1.00 59.30  ? 594 ASP A OD2 1 
ATOM   3609 N N   . THR B 1 246 ? 15.093  -8.721  -10.196 1.00 63.67  ? 595 THR A N   1 
ATOM   3610 C CA  . THR B 1 246 ? 15.081  -10.182 -10.062 1.00 64.03  ? 595 THR A CA  1 
ATOM   3611 C C   . THR B 1 246 ? 15.514  -10.934 -11.342 1.00 71.80  ? 595 THR A C   1 
ATOM   3612 O O   . THR B 1 246 ? 15.814  -12.157 -11.324 1.00 70.08  ? 595 THR A O   1 
ATOM   3613 C CB  . THR B 1 246 ? 13.649  -10.680 -9.714  1.00 67.05  ? 595 THR A CB  1 
ATOM   3614 O OG1 . THR B 1 246 ? 13.059  -9.876  -8.677  1.00 57.82  ? 595 THR A OG1 1 
ATOM   3615 C CG2 . THR B 1 246 ? 13.656  -12.193 -9.307  1.00 68.93  ? 595 THR A CG2 1 
ATOM   3616 N N   . LEU B 1 247 ? 15.494  -10.243 -12.471 1.00 74.61  ? 596 LEU A N   1 
ATOM   3617 C CA  . LEU B 1 247 ? 15.810  -10.938 -13.723 1.00 80.68  ? 596 LEU A CA  1 
ATOM   3618 C C   . LEU B 1 247 ? 17.319  -11.171 -13.974 1.00 83.88  ? 596 LEU A C   1 
ATOM   3619 O O   . LEU B 1 247 ? 18.080  -10.183 -14.059 1.00 75.74  ? 596 LEU A O   1 
ATOM   3620 C CB  . LEU B 1 247 ? 15.199  -10.202 -14.915 1.00 73.98  ? 596 LEU A CB  1 
ATOM   3621 C CG  . LEU B 1 247 ? 13.747  -10.388 -15.306 1.00 71.08  ? 596 LEU A CG  1 
ATOM   3622 C CD1 . LEU B 1 247 ? 12.931  -10.937 -14.166 1.00 68.09  ? 596 LEU A CD1 1 
ATOM   3623 C CD2 . LEU B 1 247 ? 13.181  -9.098  -15.895 1.00 79.38  ? 596 LEU A CD2 1 
ATOM   3624 N N   . PRO B 1 248 ? 17.747  -12.453 -14.162 1.00 88.24  ? 597 PRO A N   1 
ATOM   3625 C CA  . PRO B 1 248 ? 19.161  -12.713 -14.549 1.00 99.28  ? 597 PRO A CA  1 
ATOM   3626 C C   . PRO B 1 248 ? 19.548  -12.288 -16.000 1.00 99.77  ? 597 PRO A C   1 
ATOM   3627 O O   . PRO B 1 248 ? 20.358  -12.969 -16.628 1.00 93.57  ? 597 PRO A O   1 
ATOM   3628 C CB  . PRO B 1 248 ? 19.288  -14.244 -14.388 1.00 93.44  ? 597 PRO A CB  1 
ATOM   3629 C CG  . PRO B 1 248 ? 17.913  -14.770 -14.629 1.00 95.93  ? 597 PRO A CG  1 
ATOM   3630 C CD  . PRO B 1 248 ? 16.961  -13.710 -14.125 1.00 92.29  ? 597 PRO A CD  1 
ATOM   3631 N N   . PHE B 1 249 ? 19.006  -11.163 -16.500 1.00 99.53  ? 598 PHE A N   1 
ATOM   3632 C CA  . PHE B 1 249 ? 19.286  -10.669 -17.862 1.00 105.60 ? 598 PHE A CA  1 
ATOM   3633 C C   . PHE B 1 249 ? 18.827  -9.202  -18.097 1.00 105.00 ? 598 PHE A C   1 
ATOM   3634 O O   . PHE B 1 249 ? 18.579  -8.426  -17.172 1.00 87.21  ? 598 PHE A O   1 
ATOM   3635 C CB  . PHE B 1 249 ? 18.666  -11.618 -18.933 1.00 102.41 ? 598 PHE A CB  1 
ATOM   3636 C CG  . PHE B 1 249 ? 17.180  -11.870 -18.760 1.00 89.38  ? 598 PHE A CG  1 
ATOM   3637 C CD1 . PHE B 1 249 ? 16.235  -10.958 -19.237 1.00 86.59  ? 598 PHE A CD1 1 
ATOM   3638 C CD2 . PHE B 1 249 ? 16.727  -13.021 -18.116 1.00 86.18  ? 598 PHE A CD2 1 
ATOM   3639 C CE1 . PHE B 1 249 ? 14.868  -11.190 -19.062 1.00 90.65  ? 598 PHE A CE1 1 
ATOM   3640 C CE2 . PHE B 1 249 ? 15.364  -13.263 -17.943 1.00 78.03  ? 598 PHE A CE2 1 
ATOM   3641 C CZ  . PHE B 1 249 ? 14.434  -12.349 -18.421 1.00 81.80  ? 598 PHE A CZ  1 
HETATM 3642 C C1  . GOL C 2 .   ? 5.902   -24.051 -48.550 1.00 61.25  ? 701 GOL B C1  1 
HETATM 3643 O O1  . GOL C 2 .   ? 5.269   -25.231 -49.048 1.00 60.46  ? 701 GOL B O1  1 
HETATM 3644 C C2  . GOL C 2 .   ? 5.590   -23.861 -47.076 1.00 55.89  ? 701 GOL B C2  1 
HETATM 3645 O O2  . GOL C 2 .   ? 6.048   -25.010 -46.377 1.00 45.30  ? 701 GOL B O2  1 
HETATM 3646 C C3  . GOL C 2 .   ? 6.287   -22.586 -46.595 1.00 63.30  ? 701 GOL B C3  1 
HETATM 3647 O O3  . GOL C 2 .   ? 6.169   -22.379 -45.182 1.00 58.16  ? 701 GOL B O3  1 
HETATM 3648 C C1  . GOL D 2 .   ? 14.772  -18.886 4.187   1.00 64.52  ? 701 GOL A C1  1 
HETATM 3649 O O1  . GOL D 2 .   ? 16.182  -18.857 4.504   1.00 70.76  ? 701 GOL A O1  1 
HETATM 3650 C C2  . GOL D 2 .   ? 14.031  -20.032 4.878   1.00 65.98  ? 701 GOL A C2  1 
HETATM 3651 O O2  . GOL D 2 .   ? 14.344  -21.115 4.030   1.00 72.67  ? 701 GOL A O2  1 
HETATM 3652 C C3  . GOL D 2 .   ? 12.491  -19.804 4.964   1.00 77.97  ? 701 GOL A C3  1 
HETATM 3653 O O3  . GOL D 2 .   ? 11.574  -20.913 5.264   1.00 75.38  ? 701 GOL A O3  1 
HETATM 3654 C C1  . GOL E 2 .   ? 0.141   -10.453 8.801   1.00 69.63  ? 702 GOL A C1  1 
HETATM 3655 O O1  . GOL E 2 .   ? 0.271   -10.812 7.399   1.00 62.50  ? 702 GOL A O1  1 
HETATM 3656 C C2  . GOL E 2 .   ? -1.101  -11.077 9.451   1.00 61.19  ? 702 GOL A C2  1 
HETATM 3657 O O2  . GOL E 2 .   ? -2.297  -10.607 8.822   1.00 63.13  ? 702 GOL A O2  1 
HETATM 3658 C C3  . GOL E 2 .   ? -1.268  -10.653 10.893  1.00 66.69  ? 702 GOL A C3  1 
HETATM 3659 O O3  . GOL E 2 .   ? -2.373  -11.370 11.476  1.00 65.26  ? 702 GOL A O3  1 
HETATM 3660 O O8  . ZJ0 F 3 .   ? 14.647  -16.423 1.587   1.00 70.63  ? 703 ZJ0 A O8  1 
HETATM 3661 C C1  . ZJ0 F 3 .   ? 14.738  -16.800 0.388   1.00 105.49 ? 703 ZJ0 A C1  1 
HETATM 3662 C C2  . ZJ0 F 3 .   ? 16.003  -17.201 -0.417  1.00 106.66 ? 703 ZJ0 A C2  1 
HETATM 3663 C C7  . ZJ0 F 3 .   ? 17.246  -17.268 0.219   1.00 100.46 ? 703 ZJ0 A C7  1 
HETATM 3664 C C6  . ZJ0 F 3 .   ? 18.401  -17.606 -0.505  1.00 106.68 ? 703 ZJ0 A C6  1 
HETATM 3665 O O19 . ZJ0 F 3 .   ? 19.646  -17.716 0.058   1.00 101.31 ? 703 ZJ0 A O19 1 
HETATM 3666 C C21 . ZJ0 F 3 .   ? 20.149  -16.841 1.041   1.00 81.18  ? 703 ZJ0 A C21 1 
HETATM 3667 C C5  . ZJ0 F 3 .   ? 18.353  -17.913 -1.850  1.00 109.56 ? 703 ZJ0 A C5  1 
HETATM 3668 C C4  . ZJ0 F 3 .   ? 17.155  -17.860 -2.532  1.00 121.16 ? 703 ZJ0 A C4  1 
HETATM 3669 O O18 . ZJ0 F 3 .   ? 17.187  -18.168 -3.888  1.00 121.42 ? 703 ZJ0 A O18 1 
HETATM 3670 C C20 . ZJ0 F 3 .   ? 17.910  -17.394 -4.865  1.00 111.97 ? 703 ZJ0 A C20 1 
HETATM 3671 C C3  . ZJ0 F 3 .   ? 15.981  -17.508 -1.812  1.00 115.06 ? 703 ZJ0 A C3  1 
HETATM 3672 C C9  . ZJ0 F 3 .   ? 13.405  -16.834 -0.297  1.00 97.71  ? 703 ZJ0 A C9  1 
HETATM 3673 C C10 . ZJ0 F 3 .   ? 13.318  -15.835 -1.453  1.00 80.86  ? 703 ZJ0 A C10 1 
HETATM 3674 C C11 . ZJ0 F 3 .   ? 12.401  -14.623 -1.265  1.00 52.79  ? 703 ZJ0 A C11 1 
HETATM 3675 C C12 . ZJ0 F 3 .   ? 12.166  -14.139 -2.691  1.00 60.29  ? 703 ZJ0 A C12 1 
HETATM 3676 C C13 . ZJ0 F 3 .   ? 11.053  -13.081 -3.049  1.00 51.99  ? 703 ZJ0 A C13 1 
HETATM 3677 C C14 . ZJ0 F 3 .   ? 10.610  -13.246 -4.489  1.00 67.01  ? 703 ZJ0 A C14 1 
HETATM 3678 C C15 . ZJ0 F 3 .   ? 11.709  -13.459 -5.567  1.00 86.27  ? 703 ZJ0 A C15 1 
HETATM 3679 C C16 . ZJ0 F 3 .   ? 11.356  -14.461 -6.668  1.00 79.98  ? 703 ZJ0 A C16 1 
HETATM 3680 C C17 . ZJ0 F 3 .   ? 11.964  -15.838 -6.363  1.00 87.46  ? 703 ZJ0 A C17 1 
HETATM 3681 O O   . HOH G 4 .   ? 4.671   -17.909 -46.436 1.00 50.16  ? 801 HOH B O   1 
HETATM 3682 O O   . HOH G 4 .   ? 9.134   -21.109 -41.367 1.00 28.57  ? 802 HOH B O   1 
HETATM 3683 O O   . HOH G 4 .   ? 5.911   -11.475 -34.478 1.00 39.07  ? 803 HOH B O   1 
HETATM 3684 O O   . HOH G 4 .   ? 6.720   -6.883  -39.513 1.00 40.76  ? 804 HOH B O   1 
HETATM 3685 O O   . HOH G 4 .   ? 10.841  -36.887 -38.044 1.00 53.89  ? 805 HOH B O   1 
HETATM 3686 O O   . HOH G 4 .   ? 12.410  -8.070  -52.401 1.00 49.75  ? 806 HOH B O   1 
HETATM 3687 O O   . HOH G 4 .   ? 4.355   -15.503 -50.001 1.00 60.54  ? 807 HOH B O   1 
HETATM 3688 O O   . HOH G 4 .   ? -5.104  -32.168 -40.083 1.00 49.95  ? 808 HOH B O   1 
HETATM 3689 O O   . HOH G 4 .   ? 7.216   0.389   -50.987 1.00 57.32  ? 809 HOH B O   1 
HETATM 3690 O O   . HOH G 4 .   ? 1.562   5.644   -43.163 1.00 58.86  ? 810 HOH B O   1 
HETATM 3691 O O   . HOH G 4 .   ? 11.399  -18.781 -51.470 1.00 59.47  ? 811 HOH B O   1 
HETATM 3692 O O   . HOH G 4 .   ? 13.128  -33.498 -50.613 1.00 69.63  ? 812 HOH B O   1 
HETATM 3693 O O   . HOH G 4 .   ? 5.430   -27.538 -47.039 1.00 53.99  ? 813 HOH B O   1 
HETATM 3694 O O   . HOH G 4 .   ? 8.528   1.863   -53.980 1.00 56.68  ? 814 HOH B O   1 
HETATM 3695 O O   . HOH G 4 .   ? -8.839  -18.711 -50.465 1.00 62.62  ? 815 HOH B O   1 
HETATM 3696 O O   . HOH G 4 .   ? 15.456  -10.440 -46.394 1.00 61.75  ? 816 HOH B O   1 
HETATM 3697 O O   . HOH G 4 .   ? 21.755  -16.878 -32.902 1.00 66.00  ? 817 HOH B O   1 
HETATM 3698 O O   . HOH G 4 .   ? 12.944  -19.375 -48.032 1.00 52.11  ? 818 HOH B O   1 
HETATM 3699 O O   . HOH G 4 .   ? -0.839  -6.478  -40.751 1.00 63.96  ? 819 HOH B O   1 
HETATM 3700 O O   . HOH G 4 .   ? 7.519   4.767   -52.869 1.00 57.16  ? 820 HOH B O   1 
HETATM 3701 O O   . HOH G 4 .   ? 18.108  2.456   -42.966 1.00 52.66  ? 821 HOH B O   1 
HETATM 3702 O O   . HOH G 4 .   ? -0.341  -1.694  -40.937 1.00 52.03  ? 822 HOH B O   1 
HETATM 3703 O O   . HOH G 4 .   ? 17.655  -30.434 -29.620 1.00 60.54  ? 823 HOH B O   1 
HETATM 3704 O O   . HOH G 4 .   ? -3.823  -29.356 -28.324 1.00 60.67  ? 824 HOH B O   1 
HETATM 3705 O O   . HOH G 4 .   ? 4.563   -43.305 -34.466 1.00 64.40  ? 825 HOH B O   1 
HETATM 3706 O O   . HOH G 4 .   ? 6.938   -26.324 -50.739 1.00 54.63  ? 826 HOH B O   1 
HETATM 3707 O O   . HOH G 4 .   ? 1.793   -8.685  -38.371 1.00 52.92  ? 827 HOH B O   1 
HETATM 3708 O O   . HOH G 4 .   ? 2.015   -29.516 -45.333 1.00 52.71  ? 828 HOH B O   1 
HETATM 3709 O O   . HOH G 4 .   ? 18.586  -15.726 -20.633 1.00 62.87  ? 829 HOH B O   1 
HETATM 3710 O O   . HOH G 4 .   ? -5.290  -27.532 -29.564 1.00 59.36  ? 830 HOH B O   1 
HETATM 3711 O O   . HOH G 4 .   ? 16.556  -20.042 -22.195 1.00 56.97  ? 831 HOH B O   1 
HETATM 3712 O O   . HOH G 4 .   ? 10.893  -34.427 -28.183 1.00 61.58  ? 832 HOH B O   1 
HETATM 3713 O O   . HOH G 4 .   ? 12.023  -6.513  -54.686 1.00 49.86  ? 833 HOH B O   1 
HETATM 3714 O O   . HOH G 4 .   ? 13.072  -4.879  -22.581 1.00 71.43  ? 834 HOH B O   1 
HETATM 3715 O O   . HOH G 4 .   ? 13.526  1.473   -39.250 1.00 54.45  ? 835 HOH B O   1 
HETATM 3716 O O   . HOH G 4 .   ? 16.297  -1.926  -37.971 1.00 55.60  ? 836 HOH B O   1 
HETATM 3717 O O   . HOH G 4 .   ? 10.955  -38.283 -21.320 1.00 73.46  ? 837 HOH B O   1 
HETATM 3718 O O   . HOH G 4 .   ? 17.968  -6.999  -36.560 1.00 70.47  ? 838 HOH B O   1 
HETATM 3719 O O   . HOH H 4 .   ? 1.247   -8.495  3.089   1.00 28.45  ? 801 HOH A O   1 
HETATM 3720 O O   . HOH H 4 .   ? 23.911  -3.487  6.545   1.00 51.75  ? 802 HOH A O   1 
HETATM 3721 O O   . HOH H 4 .   ? 4.760   -11.923 8.554   1.00 42.84  ? 803 HOH A O   1 
HETATM 3722 O O   . HOH H 4 .   ? 7.459   -11.454 12.480  1.00 48.86  ? 804 HOH A O   1 
HETATM 3723 O O   . HOH H 4 .   ? -13.903 -6.444  0.786   1.00 57.89  ? 805 HOH A O   1 
HETATM 3724 O O   . HOH H 4 .   ? -0.435  -13.703 7.070   1.00 48.67  ? 806 HOH A O   1 
HETATM 3725 O O   . HOH H 4 .   ? -0.973  -14.309 -17.086 1.00 50.02  ? 807 HOH A O   1 
HETATM 3726 O O   . HOH H 4 .   ? 4.550   -31.492 0.646   1.00 57.47  ? 808 HOH A O   1 
HETATM 3727 O O   . HOH H 4 .   ? -16.808 -13.786 -6.722  1.00 64.56  ? 809 HOH A O   1 
HETATM 3728 O O   . HOH H 4 .   ? -7.402  -23.025 -5.610  1.00 47.21  ? 810 HOH A O   1 
HETATM 3729 O O   . HOH H 4 .   ? 3.157   -3.583  9.042   1.00 53.52  ? 811 HOH A O   1 
HETATM 3730 O O   . HOH H 4 .   ? -4.856  -11.611 9.526   1.00 55.62  ? 812 HOH A O   1 
HETATM 3731 O O   . HOH H 4 .   ? 29.618  -7.780  7.215   1.00 47.67  ? 813 HOH A O   1 
HETATM 3732 O O   . HOH H 4 .   ? -18.328 -15.877 -15.390 1.00 75.99  ? 814 HOH A O   1 
HETATM 3733 O O   . HOH H 4 .   ? 24.938  -12.541 1.614   1.00 50.34  ? 815 HOH A O   1 
HETATM 3734 O O   . HOH H 4 .   ? 6.007   -16.442 -18.682 1.00 57.11  ? 816 HOH A O   1 
HETATM 3735 O O   . HOH H 4 .   ? -1.837  -8.536  0.968   1.00 49.49  ? 817 HOH A O   1 
HETATM 3736 O O   . HOH H 4 .   ? -0.231  -23.176 8.925   1.00 52.79  ? 818 HOH A O   1 
HETATM 3737 O O   . HOH H 4 .   ? 14.547  -2.845  13.190  1.00 48.09  ? 819 HOH A O   1 
HETATM 3738 O O   . HOH H 4 .   ? 13.777  1.566   3.324   1.00 63.62  ? 820 HOH A O   1 
HETATM 3739 O O   . HOH H 4 .   ? 18.986  3.517   11.141  1.00 59.11  ? 821 HOH A O   1 
HETATM 3740 O O   . HOH H 4 .   ? 14.624  -15.683 -3.950  1.00 65.03  ? 822 HOH A O   1 
HETATM 3741 O O   . HOH H 4 .   ? -5.032  -12.740 -18.677 1.00 54.07  ? 823 HOH A O   1 
HETATM 3742 O O   . HOH H 4 .   ? 1.984   -2.993  -16.545 1.00 51.98  ? 824 HOH A O   1 
HETATM 3743 O O   . HOH H 4 .   ? -11.997 -11.270 -11.909 1.00 52.56  ? 825 HOH A O   1 
HETATM 3744 O O   . HOH H 4 .   ? 11.439  -11.290 -6.950  1.00 48.28  ? 826 HOH A O   1 
HETATM 3745 O O   . HOH H 4 .   ? -13.493 -5.821  -14.268 1.00 50.55  ? 827 HOH A O   1 
HETATM 3746 O O   . HOH H 4 .   ? -4.057  -31.371 8.429   1.00 60.97  ? 828 HOH A O   1 
HETATM 3747 O O   . HOH H 4 .   ? 3.948   -24.480 14.532  1.00 54.95  ? 829 HOH A O   1 
HETATM 3748 O O   . HOH H 4 .   ? -9.751  -19.331 -12.731 1.00 61.47  ? 830 HOH A O   1 
HETATM 3749 O O   . HOH H 4 .   ? 28.384  -8.661  -8.799  1.00 66.82  ? 831 HOH A O   1 
HETATM 3750 O O   . HOH H 4 .   ? -1.537  -4.699  -18.522 1.00 56.08  ? 832 HOH A O   1 
HETATM 3751 O O   . HOH H 4 .   ? 10.607  -10.257 -4.559  1.00 46.64  ? 833 HOH A O   1 
HETATM 3752 O O   . HOH H 4 .   ? 9.783   -1.128  -17.873 1.00 75.83  ? 834 HOH A O   1 
HETATM 3753 O O   . HOH H 4 .   ? 23.578  2.276   2.132   1.00 57.34  ? 835 HOH A O   1 
HETATM 3754 O O   . HOH H 4 .   ? -1.024  -1.767  13.053  1.00 65.76  ? 836 HOH A O   1 
HETATM 3755 O O   . HOH H 4 .   ? -0.022  -10.966 1.526   1.00 55.33  ? 837 HOH A O   1 
HETATM 3756 O O   . HOH H 4 .   ? 16.069  -2.461  15.654  1.00 45.22  ? 838 HOH A O   1 
HETATM 3757 O O   . HOH H 4 .   ? 19.845  -9.482  -20.308 1.00 95.28  ? 839 HOH A O   1 
HETATM 3758 O O   . HOH H 4 .   ? 0.222   -30.913 11.274  1.00 81.10  ? 840 HOH A O   1 
HETATM 3759 O O   . HOH H 4 .   ? 27.676  -9.460  -0.767  1.00 46.91  ? 841 HOH A O   1 
HETATM 3760 O O   . HOH H 4 .   ? 15.751  -10.995 1.372   1.00 33.67  ? 842 HOH A O   1 
HETATM 3761 O O   . HOH H 4 .   ? 13.595  -24.003 -3.042  1.00 69.93  ? 843 HOH A O   1 
HETATM 3762 O O   . HOH H 4 .   ? -16.556 -8.681  -19.650 1.00 82.41  ? 844 HOH A O   1 
HETATM 3763 O O   . HOH H 4 .   ? -3.716  -18.751 9.719   1.00 64.95  ? 845 HOH A O   1 
HETATM 3764 O O   . HOH H 4 .   ? -16.416 -16.387 -19.224 1.00 68.78  ? 846 HOH A O   1 
HETATM 3765 O O   . HOH H 4 .   ? 10.134  -25.010 -7.869  1.00 62.74  ? 847 HOH A O   1 
HETATM 3766 O O   . HOH H 4 .   ? 0.320   -23.754 -5.145  1.00 53.92  ? 848 HOH A O   1 
HETATM 3767 O O   . HOH H 4 .   ? -15.554 -9.395  -16.979 1.00 65.99  ? 849 HOH A O   1 
HETATM 3768 O O   . HOH H 4 .   ? -15.595 -7.369  -8.050  1.00 54.22  ? 850 HOH A O   1 
HETATM 3769 O O   . HOH H 4 .   ? -7.037  -12.764 -16.786 1.00 53.01  ? 851 HOH A O   1 
HETATM 3770 O O   . HOH H 4 .   ? 11.326  1.354   -11.605 1.00 55.99  ? 852 HOH A O   1 
HETATM 3771 O O   . HOH H 4 .   ? -2.270  -6.051  -0.447  1.00 51.30  ? 853 HOH A O   1 
HETATM 3772 O O   . HOH H 4 .   ? 4.547   0.095   -2.174  1.00 53.12  ? 854 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   350 ?   ?   ?   B . n 
A 1 2   SER 2   351 ?   ?   ?   B . n 
A 1 3   LYS 3   352 ?   ?   ?   B . n 
A 1 4   PRO 4   353 ?   ?   ?   B . n 
A 1 5   LYS 5   354 ?   ?   ?   B . n 
A 1 6   GLN 6   355 ?   ?   ?   B . n 
A 1 7   PRO 7   356 ?   ?   ?   B . n 
A 1 8   PRO 8   357 ?   ?   ?   B . n 
A 1 9   ASP 9   358 ?   ?   ?   B . n 
A 1 10  ALA 10  359 ?   ?   ?   B . n 
A 1 11  SER 11  360 ?   ?   ?   B . n 
A 1 12  PRO 12  361 361 PRO PRO B . n 
A 1 13  ALA 13  362 362 ALA ALA B . n 
A 1 14  ASN 14  363 363 ASN ASN B . n 
A 1 15  LEU 15  364 364 LEU LEU B . n 
A 1 16  LEU 16  365 365 LEU LEU B . n 
A 1 17  THR 17  366 366 THR THR B . n 
A 1 18  SER 18  367 367 SER SER B . n 
A 1 19  LEU 19  368 368 LEU LEU B . n 
A 1 20  VAL 20  369 369 VAL VAL B . n 
A 1 21  ARG 21  370 370 ARG ARG B . n 
A 1 22  ALA 22  371 371 ALA ALA B . n 
A 1 23  HIS 23  372 372 HIS HIS B . n 
A 1 24  LEU 24  373 373 LEU LEU B . n 
A 1 25  ASP 25  374 374 ASP ASP B . n 
A 1 26  SER 26  375 375 SER SER B . n 
A 1 27  GLY 27  376 376 GLY GLY B . n 
A 1 28  PRO 28  377 377 PRO PRO B . n 
A 1 29  SER 29  378 378 SER SER B . n 
A 1 30  THR 30  379 379 THR THR B . n 
A 1 31  ALA 31  380 380 ALA ALA B . n 
A 1 32  LYS 32  381 381 LYS LYS B . n 
A 1 33  LEU 33  382 382 LEU LEU B . n 
A 1 34  ASP 34  383 383 ASP ASP B . n 
A 1 35  TYR 35  384 384 TYR TYR B . n 
A 1 36  SER 36  385 385 SER SER B . n 
A 1 37  LYS 37  386 386 LYS LYS B . n 
A 1 38  PHE 38  387 387 PHE PHE B . n 
A 1 39  GLN 39  388 388 GLN GLN B . n 
A 1 40  GLU 40  389 389 GLU GLU B . n 
A 1 41  LEU 41  390 390 LEU LEU B . n 
A 1 42  VAL 42  391 391 VAL VAL B . n 
A 1 43  LEU 43  392 392 LEU LEU B . n 
A 1 44  PRO 44  393 393 PRO PRO B . n 
A 1 45  HIS 45  394 394 HIS HIS B . n 
A 1 46  PHE 46  395 ?   ?   ?   B . n 
A 1 47  GLY 47  396 ?   ?   ?   B . n 
A 1 48  LYS 48  397 397 LYS LYS B . n 
A 1 49  GLU 49  398 398 GLU GLU B . n 
A 1 50  ASP 50  399 399 ASP ASP B . n 
A 1 51  ALA 51  400 400 ALA ALA B . n 
A 1 52  GLY 52  401 401 GLY GLY B . n 
A 1 53  ASP 53  402 402 ASP ASP B . n 
A 1 54  VAL 54  403 403 VAL VAL B . n 
A 1 55  GLN 55  404 404 GLN GLN B . n 
A 1 56  GLN 56  405 405 GLN GLN B . n 
A 1 57  PHE 57  406 406 PHE PHE B . n 
A 1 58  TYR 58  407 407 TYR TYR B . n 
A 1 59  ASP 59  408 408 ASP ASP B . n 
A 1 60  LEU 60  409 409 LEU LEU B . n 
A 1 61  LEU 61  410 410 LEU LEU B . n 
A 1 62  SER 62  411 411 SER SER B . n 
A 1 63  GLY 63  412 412 GLY GLY B . n 
A 1 64  SER 64  413 413 SER SER B . n 
A 1 65  LEU 65  414 414 LEU LEU B . n 
A 1 66  GLU 66  415 415 GLU GLU B . n 
A 1 67  VAL 67  416 416 VAL VAL B . n 
A 1 68  ILE 68  417 417 ILE ILE B . n 
A 1 69  ARG 69  418 418 ARG ARG B . n 
A 1 70  LYS 70  419 419 LYS LYS B . n 
A 1 71  TRP 71  420 420 TRP TRP B . n 
A 1 72  ALA 72  421 421 ALA ALA B . n 
A 1 73  GLU 73  422 422 GLU GLU B . n 
A 1 74  LYS 74  423 423 LYS LYS B . n 
A 1 75  ILE 75  424 424 ILE ILE B . n 
A 1 76  PRO 76  425 425 PRO PRO B . n 
A 1 77  GLY 77  426 426 GLY GLY B . n 
A 1 78  PHE 78  427 427 PHE PHE B . n 
A 1 79  ALA 79  428 428 ALA ALA B . n 
A 1 80  GLU 80  429 429 GLU GLU B . n 
A 1 81  LEU 81  430 430 LEU LEU B . n 
A 1 82  SER 82  431 431 SER SER B . n 
A 1 83  PRO 83  432 432 PRO PRO B . n 
A 1 84  ALA 84  433 433 ALA ALA B . n 
A 1 85  ASP 85  434 434 ASP ASP B . n 
A 1 86  GLN 86  435 435 GLN GLN B . n 
A 1 87  ASP 87  436 436 ASP ASP B . n 
A 1 88  LEU 88  437 437 LEU LEU B . n 
A 1 89  LEU 89  438 438 LEU LEU B . n 
A 1 90  LEU 90  439 439 LEU LEU B . n 
A 1 91  GLU 91  440 440 GLU GLU B . n 
A 1 92  SER 92  441 441 SER SER B . n 
A 1 93  ALA 93  442 442 ALA ALA B . n 
A 1 94  PHE 94  443 443 PHE PHE B . n 
A 1 95  LEU 95  444 444 LEU LEU B . n 
A 1 96  GLU 96  445 445 GLU GLU B . n 
A 1 97  LEU 97  446 446 LEU LEU B . n 
A 1 98  PHE 98  447 447 PHE PHE B . n 
A 1 99  ILE 99  448 448 ILE ILE B . n 
A 1 100 LEU 100 449 449 LEU LEU B . n 
A 1 101 ARG 101 450 450 ARG ARG B . n 
A 1 102 LEU 102 451 451 LEU LEU B . n 
A 1 103 ALA 103 452 452 ALA ALA B . n 
A 1 104 TYR 104 453 453 TYR TYR B . n 
A 1 105 ARG 105 454 454 ARG ARG B . n 
A 1 106 SER 106 455 455 SER SER B . n 
A 1 107 LYS 107 456 456 LYS LYS B . n 
A 1 108 PRO 108 457 457 PRO PRO B . n 
A 1 109 GLY 109 458 458 GLY GLY B . n 
A 1 110 GLU 110 459 459 GLU GLU B . n 
A 1 111 GLY 111 460 460 GLY GLY B . n 
A 1 112 LYS 112 461 461 LYS LYS B . n 
A 1 113 LEU 113 462 462 LEU LEU B . n 
A 1 114 ILE 114 463 463 ILE ILE B . n 
A 1 115 PHE 115 464 464 PHE PHE B . n 
A 1 116 CYS 116 465 465 CYS CYS B . n 
A 1 117 SER 117 466 466 SER SER B . n 
A 1 118 GLY 118 467 467 GLY GLY B . n 
A 1 119 LEU 119 468 468 LEU LEU B . n 
A 1 120 VAL 120 469 469 VAL VAL B . n 
A 1 121 LEU 121 470 470 LEU LEU B . n 
A 1 122 HIS 122 471 471 HIS HIS B . n 
A 1 123 ARG 123 472 472 ARG ARG B . n 
A 1 124 LEU 124 473 473 LEU LEU B . n 
A 1 125 GLN 125 474 474 GLN GLN B . n 
A 1 126 CYS 126 475 475 CYS CYS B . n 
A 1 127 ALA 127 476 476 ALA ALA B . n 
A 1 128 ARG 128 477 477 ARG ARG B . n 
A 1 129 GLY 129 478 478 GLY GLY B . n 
A 1 130 PHE 130 479 479 PHE PHE B . n 
A 1 131 GLY 131 480 480 GLY GLY B . n 
A 1 132 ASP 132 481 481 ASP ASP B . n 
A 1 133 TRP 133 482 482 TRP TRP B . n 
A 1 134 ILE 134 483 483 ILE ILE B . n 
A 1 135 ASP 135 484 484 ASP ASP B . n 
A 1 136 SER 136 485 485 SER SER B . n 
A 1 137 ILE 137 486 486 ILE ILE B . n 
A 1 138 LEU 138 487 487 LEU LEU B . n 
A 1 139 ALA 139 488 488 ALA ALA B . n 
A 1 140 PHE 140 489 489 PHE PHE B . n 
A 1 141 SER 141 490 490 SER SER B . n 
A 1 142 ARG 142 491 491 ARG ARG B . n 
A 1 143 SER 143 492 492 SER SER B . n 
A 1 144 LEU 144 493 493 LEU LEU B . n 
A 1 145 HIS 145 494 494 HIS HIS B . n 
A 1 146 SER 146 495 495 SER SER B . n 
A 1 147 LEU 147 496 496 LEU LEU B . n 
A 1 148 LEU 148 497 497 LEU LEU B . n 
A 1 149 VAL 149 498 498 VAL VAL B . n 
A 1 150 ASP 150 499 499 ASP ASP B . n 
A 1 151 VAL 151 500 500 VAL VAL B . n 
A 1 152 PRO 152 501 501 PRO PRO B . n 
A 1 153 ALA 153 502 502 ALA ALA B . n 
A 1 154 PHE 154 503 503 PHE PHE B . n 
A 1 155 ALA 155 504 504 ALA ALA B . n 
A 1 156 CYS 156 505 505 CYS CYS B . n 
A 1 157 LEU 157 506 506 LEU LEU B . n 
A 1 158 SER 158 507 507 SER SER B . n 
A 1 159 ALA 159 508 508 ALA ALA B . n 
A 1 160 LEU 160 509 509 LEU LEU B . n 
A 1 161 VAL 161 510 510 VAL VAL B . n 
A 1 162 LEU 162 511 511 LEU LEU B . n 
A 1 163 ILE 163 512 512 ILE ILE B . n 
A 1 164 THR 164 513 513 THR THR B . n 
A 1 165 ASP 165 514 514 ASP ASP B . n 
A 1 166 ARG 166 515 515 ARG ARG B . n 
A 1 167 HIS 167 516 516 HIS HIS B . n 
A 1 168 GLY 168 517 517 GLY GLY B . n 
A 1 169 LEU 169 518 518 LEU LEU B . n 
A 1 170 GLN 170 519 519 GLN GLN B . n 
A 1 171 GLU 171 520 520 GLU GLU B . n 
A 1 172 PRO 172 521 521 PRO PRO B . n 
A 1 173 ARG 173 522 522 ARG ARG B . n 
A 1 174 ARG 174 523 523 ARG ARG B . n 
A 1 175 VAL 175 524 524 VAL VAL B . n 
A 1 176 GLU 176 525 525 GLU GLU B . n 
A 1 177 GLU 177 526 526 GLU GLU B . n 
A 1 178 LEU 178 527 527 LEU LEU B . n 
A 1 179 GLN 179 528 528 GLN GLN B . n 
A 1 180 ASN 180 529 529 ASN ASN B . n 
A 1 181 ARG 181 530 530 ARG ARG B . n 
A 1 182 ILE 182 531 531 ILE ILE B . n 
A 1 183 ALA 183 532 532 ALA ALA B . n 
A 1 184 SER 184 533 533 SER SER B . n 
A 1 185 CYS 185 534 534 CYS CYS B . n 
A 1 186 LEU 186 535 535 LEU LEU B . n 
A 1 187 LYS 187 536 536 LYS LYS B . n 
A 1 188 GLU 188 537 537 GLU GLU B . n 
A 1 189 HIS 189 538 538 HIS HIS B . n 
A 1 190 VAL 190 539 539 VAL VAL B . n 
A 1 191 ALA 191 540 540 ALA ALA B . n 
A 1 192 ALA 192 541 541 ALA ALA B . n 
A 1 193 VAL 193 542 542 VAL VAL B . n 
A 1 194 ALA 194 543 543 ALA ALA B . n 
A 1 195 GLY 195 544 544 GLY GLY B . n 
A 1 196 GLU 196 545 545 GLU GLU B . n 
A 1 197 PRO 197 546 546 PRO PRO B . n 
A 1 198 GLN 198 547 ?   ?   ?   B . n 
A 1 199 PRO 199 548 ?   ?   ?   B . n 
A 1 200 ALA 200 549 549 ALA ALA B . n 
A 1 201 SER 201 550 550 SER SER B . n 
A 1 202 CYS 202 551 551 CYS CYS B . n 
A 1 203 LEU 203 552 552 LEU LEU B . n 
A 1 204 SER 204 553 553 SER SER B . n 
A 1 205 ARG 205 554 554 ARG ARG B . n 
A 1 206 LEU 206 555 555 LEU LEU B . n 
A 1 207 LEU 207 556 556 LEU LEU B . n 
A 1 208 GLY 208 557 557 GLY GLY B . n 
A 1 209 LYS 209 558 558 LYS LYS B . n 
A 1 210 LEU 210 559 559 LEU LEU B . n 
A 1 211 PRO 211 560 560 PRO PRO B . n 
A 1 212 GLU 212 561 561 GLU GLU B . n 
A 1 213 LEU 213 562 562 LEU LEU B . n 
A 1 214 ARG 214 563 563 ARG ARG B . n 
A 1 215 THR 215 564 564 THR THR B . n 
A 1 216 LEU 216 565 565 LEU LEU B . n 
A 1 217 CYS 217 566 566 CYS CYS B . n 
A 1 218 THR 218 567 567 THR THR B . n 
A 1 219 GLN 219 568 568 GLN GLN B . n 
A 1 220 GLY 220 569 569 GLY GLY B . n 
A 1 221 LEU 221 570 570 LEU LEU B . n 
A 1 222 GLN 222 571 571 GLN GLN B . n 
A 1 223 ARG 223 572 572 ARG ARG B . n 
A 1 224 ILE 224 573 573 ILE ILE B . n 
A 1 225 PHE 225 574 574 PHE PHE B . n 
A 1 226 TYR 226 575 575 TYR TYR B . n 
A 1 227 LEU 227 576 576 LEU LEU B . n 
A 1 228 LYS 228 577 577 LYS LYS B . n 
A 1 229 LEU 229 578 578 LEU LEU B . n 
A 1 230 GLU 230 579 579 GLU GLU B . n 
A 1 231 ASP 231 580 580 ASP ASP B . n 
A 1 232 LEU 232 581 581 LEU LEU B . n 
A 1 233 VAL 233 582 582 VAL VAL B . n 
A 1 234 PRO 234 583 583 PRO PRO B . n 
A 1 235 PRO 235 584 584 PRO PRO B . n 
A 1 236 PRO 236 585 585 PRO PRO B . n 
A 1 237 PRO 237 586 586 PRO PRO B . n 
A 1 238 ILE 238 587 587 ILE ILE B . n 
A 1 239 ILE 239 588 588 ILE ILE B . n 
A 1 240 ASP 240 589 589 ASP ASP B . n 
A 1 241 LYS 241 590 590 LYS LYS B . n 
A 1 242 ILE 242 591 591 ILE ILE B . n 
A 1 243 PHE 243 592 592 PHE PHE B . n 
A 1 244 MET 244 593 593 MET MET B . n 
A 1 245 ASP 245 594 594 ASP ASP B . n 
A 1 246 THR 246 595 595 THR THR B . n 
A 1 247 LEU 247 596 596 LEU LEU B . n 
A 1 248 PRO 248 597 597 PRO PRO B . n 
A 1 249 PHE 249 598 598 PHE PHE B . n 
A 1 250 LEU 250 599 ?   ?   ?   B . n 
A 1 251 GLU 251 600 ?   ?   ?   B . n 
A 1 252 HIS 252 601 ?   ?   ?   B . n 
A 1 253 HIS 253 602 ?   ?   ?   B . n 
A 1 254 HIS 254 603 ?   ?   ?   B . n 
A 1 255 HIS 255 604 ?   ?   ?   B . n 
A 1 256 HIS 256 605 ?   ?   ?   B . n 
A 1 257 HIS 257 606 ?   ?   ?   B . n 
B 1 1   MET 1   350 ?   ?   ?   A . n 
B 1 2   SER 2   351 ?   ?   ?   A . n 
B 1 3   LYS 3   352 ?   ?   ?   A . n 
B 1 4   PRO 4   353 ?   ?   ?   A . n 
B 1 5   LYS 5   354 ?   ?   ?   A . n 
B 1 6   GLN 6   355 ?   ?   ?   A . n 
B 1 7   PRO 7   356 ?   ?   ?   A . n 
B 1 8   PRO 8   357 ?   ?   ?   A . n 
B 1 9   ASP 9   358 ?   ?   ?   A . n 
B 1 10  ALA 10  359 ?   ?   ?   A . n 
B 1 11  SER 11  360 ?   ?   ?   A . n 
B 1 12  PRO 12  361 ?   ?   ?   A . n 
B 1 13  ALA 13  362 362 ALA ALA A . n 
B 1 14  ASN 14  363 363 ASN ASN A . n 
B 1 15  LEU 15  364 364 LEU LEU A . n 
B 1 16  LEU 16  365 365 LEU LEU A . n 
B 1 17  THR 17  366 366 THR THR A . n 
B 1 18  SER 18  367 367 SER SER A . n 
B 1 19  LEU 19  368 368 LEU LEU A . n 
B 1 20  VAL 20  369 369 VAL VAL A . n 
B 1 21  ARG 21  370 370 ARG ARG A . n 
B 1 22  ALA 22  371 371 ALA ALA A . n 
B 1 23  HIS 23  372 372 HIS HIS A . n 
B 1 24  LEU 24  373 373 LEU LEU A . n 
B 1 25  ASP 25  374 374 ASP ASP A . n 
B 1 26  SER 26  375 375 SER SER A . n 
B 1 27  GLY 27  376 376 GLY GLY A . n 
B 1 28  PRO 28  377 377 PRO PRO A . n 
B 1 29  SER 29  378 378 SER SER A . n 
B 1 30  THR 30  379 379 THR THR A . n 
B 1 31  ALA 31  380 380 ALA ALA A . n 
B 1 32  LYS 32  381 381 LYS LYS A . n 
B 1 33  LEU 33  382 382 LEU LEU A . n 
B 1 34  ASP 34  383 383 ASP ASP A . n 
B 1 35  TYR 35  384 384 TYR TYR A . n 
B 1 36  SER 36  385 385 SER SER A . n 
B 1 37  LYS 37  386 386 LYS LYS A . n 
B 1 38  PHE 38  387 387 PHE PHE A . n 
B 1 39  GLN 39  388 388 GLN GLN A . n 
B 1 40  GLU 40  389 389 GLU GLU A . n 
B 1 41  LEU 41  390 390 LEU LEU A . n 
B 1 42  VAL 42  391 391 VAL VAL A . n 
B 1 43  LEU 43  392 392 LEU LEU A . n 
B 1 44  PRO 44  393 393 PRO PRO A . n 
B 1 45  HIS 45  394 394 HIS HIS A . n 
B 1 46  PHE 46  395 395 PHE PHE A . n 
B 1 47  GLY 47  396 396 GLY GLY A . n 
B 1 48  LYS 48  397 397 LYS LYS A . n 
B 1 49  GLU 49  398 398 GLU GLU A . n 
B 1 50  ASP 50  399 399 ASP ASP A . n 
B 1 51  ALA 51  400 400 ALA ALA A . n 
B 1 52  GLY 52  401 401 GLY GLY A . n 
B 1 53  ASP 53  402 402 ASP ASP A . n 
B 1 54  VAL 54  403 403 VAL VAL A . n 
B 1 55  GLN 55  404 404 GLN GLN A . n 
B 1 56  GLN 56  405 405 GLN GLN A . n 
B 1 57  PHE 57  406 406 PHE PHE A . n 
B 1 58  TYR 58  407 407 TYR TYR A . n 
B 1 59  ASP 59  408 408 ASP ASP A . n 
B 1 60  LEU 60  409 409 LEU LEU A . n 
B 1 61  LEU 61  410 410 LEU LEU A . n 
B 1 62  SER 62  411 411 SER SER A . n 
B 1 63  GLY 63  412 412 GLY GLY A . n 
B 1 64  SER 64  413 413 SER SER A . n 
B 1 65  LEU 65  414 414 LEU LEU A . n 
B 1 66  GLU 66  415 415 GLU GLU A . n 
B 1 67  VAL 67  416 416 VAL VAL A . n 
B 1 68  ILE 68  417 417 ILE ILE A . n 
B 1 69  ARG 69  418 418 ARG ARG A . n 
B 1 70  LYS 70  419 419 LYS LYS A . n 
B 1 71  TRP 71  420 420 TRP TRP A . n 
B 1 72  ALA 72  421 421 ALA ALA A . n 
B 1 73  GLU 73  422 422 GLU GLU A . n 
B 1 74  LYS 74  423 423 LYS LYS A . n 
B 1 75  ILE 75  424 424 ILE ILE A . n 
B 1 76  PRO 76  425 425 PRO PRO A . n 
B 1 77  GLY 77  426 426 GLY GLY A . n 
B 1 78  PHE 78  427 427 PHE PHE A . n 
B 1 79  ALA 79  428 428 ALA ALA A . n 
B 1 80  GLU 80  429 429 GLU GLU A . n 
B 1 81  LEU 81  430 430 LEU LEU A . n 
B 1 82  SER 82  431 431 SER SER A . n 
B 1 83  PRO 83  432 432 PRO PRO A . n 
B 1 84  ALA 84  433 433 ALA ALA A . n 
B 1 85  ASP 85  434 434 ASP ASP A . n 
B 1 86  GLN 86  435 435 GLN GLN A . n 
B 1 87  ASP 87  436 436 ASP ASP A . n 
B 1 88  LEU 88  437 437 LEU LEU A . n 
B 1 89  LEU 89  438 438 LEU LEU A . n 
B 1 90  LEU 90  439 439 LEU LEU A . n 
B 1 91  GLU 91  440 440 GLU GLU A . n 
B 1 92  SER 92  441 441 SER SER A . n 
B 1 93  ALA 93  442 442 ALA ALA A . n 
B 1 94  PHE 94  443 443 PHE PHE A . n 
B 1 95  LEU 95  444 444 LEU LEU A . n 
B 1 96  GLU 96  445 445 GLU GLU A . n 
B 1 97  LEU 97  446 446 LEU LEU A . n 
B 1 98  PHE 98  447 447 PHE PHE A . n 
B 1 99  ILE 99  448 448 ILE ILE A . n 
B 1 100 LEU 100 449 449 LEU LEU A . n 
B 1 101 ARG 101 450 450 ARG ARG A . n 
B 1 102 LEU 102 451 451 LEU LEU A . n 
B 1 103 ALA 103 452 452 ALA ALA A . n 
B 1 104 TYR 104 453 453 TYR TYR A . n 
B 1 105 ARG 105 454 454 ARG ARG A . n 
B 1 106 SER 106 455 455 SER SER A . n 
B 1 107 LYS 107 456 456 LYS LYS A . n 
B 1 108 PRO 108 457 457 PRO PRO A . n 
B 1 109 GLY 109 458 458 GLY GLY A . n 
B 1 110 GLU 110 459 459 GLU GLU A . n 
B 1 111 GLY 111 460 460 GLY GLY A . n 
B 1 112 LYS 112 461 461 LYS LYS A . n 
B 1 113 LEU 113 462 462 LEU LEU A . n 
B 1 114 ILE 114 463 463 ILE ILE A . n 
B 1 115 PHE 115 464 464 PHE PHE A . n 
B 1 116 CYS 116 465 465 CYS CYS A . n 
B 1 117 SER 117 466 466 SER SER A . n 
B 1 118 GLY 118 467 467 GLY GLY A . n 
B 1 119 LEU 119 468 468 LEU LEU A . n 
B 1 120 VAL 120 469 469 VAL VAL A . n 
B 1 121 LEU 121 470 470 LEU LEU A . n 
B 1 122 HIS 122 471 471 HIS HIS A . n 
B 1 123 ARG 123 472 472 ARG ARG A . n 
B 1 124 LEU 124 473 473 LEU LEU A . n 
B 1 125 GLN 125 474 474 GLN GLN A . n 
B 1 126 CYS 126 475 475 CYS CYS A . n 
B 1 127 ALA 127 476 476 ALA ALA A . n 
B 1 128 ARG 128 477 477 ARG ARG A . n 
B 1 129 GLY 129 478 478 GLY GLY A . n 
B 1 130 PHE 130 479 479 PHE PHE A . n 
B 1 131 GLY 131 480 480 GLY GLY A . n 
B 1 132 ASP 132 481 481 ASP ASP A . n 
B 1 133 TRP 133 482 482 TRP TRP A . n 
B 1 134 ILE 134 483 483 ILE ILE A . n 
B 1 135 ASP 135 484 484 ASP ASP A . n 
B 1 136 SER 136 485 485 SER SER A . n 
B 1 137 ILE 137 486 486 ILE ILE A . n 
B 1 138 LEU 138 487 487 LEU LEU A . n 
B 1 139 ALA 139 488 488 ALA ALA A . n 
B 1 140 PHE 140 489 489 PHE PHE A . n 
B 1 141 SER 141 490 490 SER SER A . n 
B 1 142 ARG 142 491 491 ARG ARG A . n 
B 1 143 SER 143 492 492 SER SER A . n 
B 1 144 LEU 144 493 493 LEU LEU A . n 
B 1 145 HIS 145 494 494 HIS HIS A . n 
B 1 146 SER 146 495 495 SER SER A . n 
B 1 147 LEU 147 496 496 LEU LEU A . n 
B 1 148 LEU 148 497 497 LEU LEU A . n 
B 1 149 VAL 149 498 498 VAL VAL A . n 
B 1 150 ASP 150 499 499 ASP ASP A . n 
B 1 151 VAL 151 500 500 VAL VAL A . n 
B 1 152 PRO 152 501 501 PRO PRO A . n 
B 1 153 ALA 153 502 502 ALA ALA A . n 
B 1 154 PHE 154 503 503 PHE PHE A . n 
B 1 155 ALA 155 504 504 ALA ALA A . n 
B 1 156 CYS 156 505 505 CYS CYS A . n 
B 1 157 LEU 157 506 506 LEU LEU A . n 
B 1 158 SER 158 507 507 SER SER A . n 
B 1 159 ALA 159 508 508 ALA ALA A . n 
B 1 160 LEU 160 509 509 LEU LEU A . n 
B 1 161 VAL 161 510 510 VAL VAL A . n 
B 1 162 LEU 162 511 511 LEU LEU A . n 
B 1 163 ILE 163 512 512 ILE ILE A . n 
B 1 164 THR 164 513 513 THR THR A . n 
B 1 165 ASP 165 514 514 ASP ASP A . n 
B 1 166 ARG 166 515 515 ARG ARG A . n 
B 1 167 HIS 167 516 516 HIS HIS A . n 
B 1 168 GLY 168 517 517 GLY GLY A . n 
B 1 169 LEU 169 518 518 LEU LEU A . n 
B 1 170 GLN 170 519 519 GLN GLN A . n 
B 1 171 GLU 171 520 520 GLU GLU A . n 
B 1 172 PRO 172 521 521 PRO PRO A . n 
B 1 173 ARG 173 522 522 ARG ARG A . n 
B 1 174 ARG 174 523 523 ARG ARG A . n 
B 1 175 VAL 175 524 524 VAL VAL A . n 
B 1 176 GLU 176 525 525 GLU GLU A . n 
B 1 177 GLU 177 526 526 GLU GLU A . n 
B 1 178 LEU 178 527 527 LEU LEU A . n 
B 1 179 GLN 179 528 528 GLN GLN A . n 
B 1 180 ASN 180 529 529 ASN ASN A . n 
B 1 181 ARG 181 530 530 ARG ARG A . n 
B 1 182 ILE 182 531 531 ILE ILE A . n 
B 1 183 ALA 183 532 532 ALA ALA A . n 
B 1 184 SER 184 533 533 SER SER A . n 
B 1 185 CYS 185 534 534 CYS CYS A . n 
B 1 186 LEU 186 535 535 LEU LEU A . n 
B 1 187 LYS 187 536 536 LYS LYS A . n 
B 1 188 GLU 188 537 537 GLU GLU A . n 
B 1 189 HIS 189 538 538 HIS HIS A . n 
B 1 190 VAL 190 539 539 VAL VAL A . n 
B 1 191 ALA 191 540 540 ALA ALA A . n 
B 1 192 ALA 192 541 541 ALA ALA A . n 
B 1 193 VAL 193 542 542 VAL VAL A . n 
B 1 194 ALA 194 543 543 ALA ALA A . n 
B 1 195 GLY 195 544 544 GLY GLY A . n 
B 1 196 GLU 196 545 ?   ?   ?   A . n 
B 1 197 PRO 197 546 ?   ?   ?   A . n 
B 1 198 GLN 198 547 ?   ?   ?   A . n 
B 1 199 PRO 199 548 ?   ?   ?   A . n 
B 1 200 ALA 200 549 ?   ?   ?   A . n 
B 1 201 SER 201 550 550 SER SER A . n 
B 1 202 CYS 202 551 551 CYS CYS A . n 
B 1 203 LEU 203 552 552 LEU LEU A . n 
B 1 204 SER 204 553 553 SER SER A . n 
B 1 205 ARG 205 554 554 ARG ARG A . n 
B 1 206 LEU 206 555 555 LEU LEU A . n 
B 1 207 LEU 207 556 556 LEU LEU A . n 
B 1 208 GLY 208 557 557 GLY GLY A . n 
B 1 209 LYS 209 558 558 LYS LYS A . n 
B 1 210 LEU 210 559 559 LEU LEU A . n 
B 1 211 PRO 211 560 560 PRO PRO A . n 
B 1 212 GLU 212 561 561 GLU GLU A . n 
B 1 213 LEU 213 562 562 LEU LEU A . n 
B 1 214 ARG 214 563 563 ARG ARG A . n 
B 1 215 THR 215 564 564 THR THR A . n 
B 1 216 LEU 216 565 565 LEU LEU A . n 
B 1 217 CYS 217 566 566 CYS CYS A . n 
B 1 218 THR 218 567 567 THR THR A . n 
B 1 219 GLN 219 568 568 GLN GLN A . n 
B 1 220 GLY 220 569 569 GLY GLY A . n 
B 1 221 LEU 221 570 570 LEU LEU A . n 
B 1 222 GLN 222 571 571 GLN GLN A . n 
B 1 223 ARG 223 572 572 ARG ARG A . n 
B 1 224 ILE 224 573 573 ILE ILE A . n 
B 1 225 PHE 225 574 574 PHE PHE A . n 
B 1 226 TYR 226 575 575 TYR TYR A . n 
B 1 227 LEU 227 576 576 LEU LEU A . n 
B 1 228 LYS 228 577 577 LYS LYS A . n 
B 1 229 LEU 229 578 578 LEU LEU A . n 
B 1 230 GLU 230 579 579 GLU GLU A . n 
B 1 231 ASP 231 580 580 ASP ASP A . n 
B 1 232 LEU 232 581 581 LEU LEU A . n 
B 1 233 VAL 233 582 582 VAL VAL A . n 
B 1 234 PRO 234 583 583 PRO PRO A . n 
B 1 235 PRO 235 584 584 PRO PRO A . n 
B 1 236 PRO 236 585 585 PRO PRO A . n 
B 1 237 PRO 237 586 586 PRO PRO A . n 
B 1 238 ILE 238 587 587 ILE ILE A . n 
B 1 239 ILE 239 588 588 ILE ILE A . n 
B 1 240 ASP 240 589 589 ASP ASP A . n 
B 1 241 LYS 241 590 590 LYS LYS A . n 
B 1 242 ILE 242 591 591 ILE ILE A . n 
B 1 243 PHE 243 592 592 PHE PHE A . n 
B 1 244 MET 244 593 593 MET MET A . n 
B 1 245 ASP 245 594 594 ASP ASP A . n 
B 1 246 THR 246 595 595 THR THR A . n 
B 1 247 LEU 247 596 596 LEU LEU A . n 
B 1 248 PRO 248 597 597 PRO PRO A . n 
B 1 249 PHE 249 598 598 PHE PHE A . n 
B 1 250 LEU 250 599 ?   ?   ?   A . n 
B 1 251 GLU 251 600 ?   ?   ?   A . n 
B 1 252 HIS 252 601 ?   ?   ?   A . n 
B 1 253 HIS 253 602 ?   ?   ?   A . n 
B 1 254 HIS 254 603 ?   ?   ?   A . n 
B 1 255 HIS 255 604 ?   ?   ?   A . n 
B 1 256 HIS 256 605 ?   ?   ?   A . n 
B 1 257 HIS 257 606 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 GOL 1  701 632 GOL GOL B . 
D 2 GOL 1  701 632 GOL GOL A . 
E 2 GOL 1  702 633 GOL GOL A . 
F 3 ZJ0 1  703 1   ZJ0 ZJ0 A . 
G 4 HOH 1  801 2   HOH HOH B . 
G 4 HOH 2  802 3   HOH HOH B . 
G 4 HOH 3  803 9   HOH HOH B . 
G 4 HOH 4  804 10  HOH HOH B . 
G 4 HOH 5  805 11  HOH HOH B . 
G 4 HOH 6  806 12  HOH HOH B . 
G 4 HOH 7  807 13  HOH HOH B . 
G 4 HOH 8  808 14  HOH HOH B . 
G 4 HOH 9  809 23  HOH HOH B . 
G 4 HOH 10 810 24  HOH HOH B . 
G 4 HOH 11 811 27  HOH HOH B . 
G 4 HOH 12 812 29  HOH HOH B . 
G 4 HOH 13 813 34  HOH HOH B . 
G 4 HOH 14 814 38  HOH HOH B . 
G 4 HOH 15 815 42  HOH HOH B . 
G 4 HOH 16 816 44  HOH HOH B . 
G 4 HOH 17 817 45  HOH HOH B . 
G 4 HOH 18 818 46  HOH HOH B . 
G 4 HOH 19 819 47  HOH HOH B . 
G 4 HOH 20 820 52  HOH HOH B . 
G 4 HOH 21 821 53  HOH HOH B . 
G 4 HOH 22 822 57  HOH HOH B . 
G 4 HOH 23 823 59  HOH HOH B . 
G 4 HOH 24 824 60  HOH HOH B . 
G 4 HOH 25 825 61  HOH HOH B . 
G 4 HOH 26 826 62  HOH HOH B . 
G 4 HOH 27 827 64  HOH HOH B . 
G 4 HOH 28 828 65  HOH HOH B . 
G 4 HOH 29 829 67  HOH HOH B . 
G 4 HOH 30 830 70  HOH HOH B . 
G 4 HOH 31 831 72  HOH HOH B . 
G 4 HOH 32 832 80  HOH HOH B . 
G 4 HOH 33 833 84  HOH HOH B . 
G 4 HOH 34 834 85  HOH HOH B . 
G 4 HOH 35 835 90  HOH HOH B . 
G 4 HOH 36 836 91  HOH HOH B . 
G 4 HOH 37 837 92  HOH HOH B . 
G 4 HOH 38 838 93  HOH HOH B . 
H 4 HOH 1  801 1   HOH HOH A . 
H 4 HOH 2  802 4   HOH HOH A . 
H 4 HOH 3  803 5   HOH HOH A . 
H 4 HOH 4  804 6   HOH HOH A . 
H 4 HOH 5  805 7   HOH HOH A . 
H 4 HOH 6  806 8   HOH HOH A . 
H 4 HOH 7  807 15  HOH HOH A . 
H 4 HOH 8  808 16  HOH HOH A . 
H 4 HOH 9  809 17  HOH HOH A . 
H 4 HOH 10 810 18  HOH HOH A . 
H 4 HOH 11 811 19  HOH HOH A . 
H 4 HOH 12 812 20  HOH HOH A . 
H 4 HOH 13 813 21  HOH HOH A . 
H 4 HOH 14 814 22  HOH HOH A . 
H 4 HOH 15 815 25  HOH HOH A . 
H 4 HOH 16 816 26  HOH HOH A . 
H 4 HOH 17 817 28  HOH HOH A . 
H 4 HOH 18 818 30  HOH HOH A . 
H 4 HOH 19 819 31  HOH HOH A . 
H 4 HOH 20 820 32  HOH HOH A . 
H 4 HOH 21 821 33  HOH HOH A . 
H 4 HOH 22 822 35  HOH HOH A . 
H 4 HOH 23 823 36  HOH HOH A . 
H 4 HOH 24 824 37  HOH HOH A . 
H 4 HOH 25 825 39  HOH HOH A . 
H 4 HOH 26 826 40  HOH HOH A . 
H 4 HOH 27 827 41  HOH HOH A . 
H 4 HOH 28 828 43  HOH HOH A . 
H 4 HOH 29 829 48  HOH HOH A . 
H 4 HOH 30 830 49  HOH HOH A . 
H 4 HOH 31 831 50  HOH HOH A . 
H 4 HOH 32 832 51  HOH HOH A . 
H 4 HOH 33 833 54  HOH HOH A . 
H 4 HOH 34 834 55  HOH HOH A . 
H 4 HOH 35 835 56  HOH HOH A . 
H 4 HOH 36 836 58  HOH HOH A . 
H 4 HOH 37 837 63  HOH HOH A . 
H 4 HOH 38 838 66  HOH HOH A . 
H 4 HOH 39 839 69  HOH HOH A . 
H 4 HOH 40 840 71  HOH HOH A . 
H 4 HOH 41 841 73  HOH HOH A . 
H 4 HOH 42 842 74  HOH HOH A . 
H 4 HOH 43 843 75  HOH HOH A . 
H 4 HOH 44 844 76  HOH HOH A . 
H 4 HOH 45 845 77  HOH HOH A . 
H 4 HOH 46 846 78  HOH HOH A . 
H 4 HOH 47 847 79  HOH HOH A . 
H 4 HOH 48 848 81  HOH HOH A . 
H 4 HOH 49 849 82  HOH HOH A . 
H 4 HOH 50 850 83  HOH HOH A . 
H 4 HOH 51 851 86  HOH HOH A . 
H 4 HOH 52 852 87  HOH HOH A . 
H 4 HOH 53 853 88  HOH HOH A . 
H 4 HOH 54 854 89  HOH HOH A . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,G     
2 1 B,D,E,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-12-18 
2 'Structure model' 1 1 2017-11-15 
3 'Structure model' 1 2 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Refinement description' 
2 3 'Structure model' 'Database references'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' software           
2 3 'Structure model' citation           
3 3 'Structure model' citation_author    
4 3 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_citation.journal_abbrev'          
2  3 'Structure model' '_citation.journal_id_ISSN'         
3  3 'Structure model' '_citation.journal_volume'          
4  3 'Structure model' '_citation.page_first'              
5  3 'Structure model' '_citation.page_last'               
6  3 'Structure model' '_citation.pdbx_database_id_PubMed' 
7  3 'Structure model' '_citation.title'                   
8  3 'Structure model' '_citation.year'                    
9  3 'Structure model' '_citation_author.name'             
10 3 'Structure model' '_struct_ref_seq_dif.details'       
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .    ?                package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data reduction'  
http://www.hkl-xray.com/                     ?          ? 
2 SCALEPACK   .    ?                package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
3 REFMAC      .    ?                program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.11 'April 22, 2011' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
5 Blu-Ice     .    ?                ?       ?                    ?                        'data collection' ? ?          ? 
6 HKL-2000    .    ?                ?       ?                    ?                        'data reduction'  ? ?          ? 
7 HKL-2000    .    ?                ?       ?                    ?                        'data scaling'    ? ?          ? 
8 PHASER      .    ?                ?       ?                    ?                        phasing           ? ?          ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   B ALA 549 ? ? OG  B SER 553 ? ? 2.09 
2 1 NH2 A ARG 370 ? ? OD1 A ASP 374 ? ? 2.11 
3 1 OE1 A GLU 445 ? ? C9  A ZJ0 703 ? ? 2.15 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OE1 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    GLU 
_pdbx_validate_symm_contact.auth_seq_id_1     459 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OD2 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    ASP 
_pdbx_validate_symm_contact.auth_seq_id_2     580 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_544 
_pdbx_validate_symm_contact.dist              2.05 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              392 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              393 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CD 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              393 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                93.94 
_pdbx_validate_rmsd_angle.angle_target_value         120.60 
_pdbx_validate_rmsd_angle.angle_deviation            -26.66 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.20 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA B 362 ? ? 97.44  -103.09 
2 1 GLU B 398 ? ? -45.31 153.33  
3 1 GLU B 545 ? ? -54.13 -178.08 
4 1 PRO B 597 ? ? -66.53 35.71   
5 1 THR A 379 ? ? -48.72 -81.41  
6 1 ALA A 380 ? ? -52.24 103.25  
7 1 LYS A 381 ? ? 126.98 2.93    
8 1 PRO A 597 ? ? -70.32 36.97   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   LEU 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    392 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    393 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -38.37 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B ALA 362 ? CB  ? A ALA 13  CB  
2  1 Y 1 B LYS 381 ? CG  ? A LYS 32  CG  
3  1 Y 1 B LYS 381 ? CD  ? A LYS 32  CD  
4  1 Y 1 B LYS 381 ? CE  ? A LYS 32  CE  
5  1 Y 1 B LYS 381 ? NZ  ? A LYS 32  NZ  
6  1 Y 1 B GLN 388 ? CD  ? A GLN 39  CD  
7  1 Y 1 B GLN 388 ? OE1 ? A GLN 39  OE1 
8  1 Y 1 B GLN 388 ? NE2 ? A GLN 39  NE2 
9  1 Y 1 B LYS 397 ? CG  ? A LYS 48  CG  
10 1 Y 1 B LYS 397 ? CD  ? A LYS 48  CD  
11 1 Y 1 B LYS 397 ? CE  ? A LYS 48  CE  
12 1 Y 1 B LYS 397 ? NZ  ? A LYS 48  NZ  
13 1 Y 1 B GLU 545 ? CG  ? A GLU 196 CG  
14 1 Y 1 B GLU 545 ? CD  ? A GLU 196 CD  
15 1 Y 1 B GLU 545 ? OE1 ? A GLU 196 OE1 
16 1 Y 1 B GLU 545 ? OE2 ? A GLU 196 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B MET 350 ? A MET 1   
2  1 Y 1 B SER 351 ? A SER 2   
3  1 Y 1 B LYS 352 ? A LYS 3   
4  1 Y 1 B PRO 353 ? A PRO 4   
5  1 Y 1 B LYS 354 ? A LYS 5   
6  1 Y 1 B GLN 355 ? A GLN 6   
7  1 Y 1 B PRO 356 ? A PRO 7   
8  1 Y 1 B PRO 357 ? A PRO 8   
9  1 Y 1 B ASP 358 ? A ASP 9   
10 1 Y 1 B ALA 359 ? A ALA 10  
11 1 Y 1 B SER 360 ? A SER 11  
12 1 Y 1 B PHE 395 ? A PHE 46  
13 1 Y 1 B GLY 396 ? A GLY 47  
14 1 Y 1 B GLN 547 ? A GLN 198 
15 1 Y 1 B PRO 548 ? A PRO 199 
16 1 Y 1 B LEU 599 ? A LEU 250 
17 1 Y 1 B GLU 600 ? A GLU 251 
18 1 Y 1 B HIS 601 ? A HIS 252 
19 1 Y 1 B HIS 602 ? A HIS 253 
20 1 Y 1 B HIS 603 ? A HIS 254 
21 1 Y 1 B HIS 604 ? A HIS 255 
22 1 Y 1 B HIS 605 ? A HIS 256 
23 1 Y 1 B HIS 606 ? A HIS 257 
24 1 Y 1 A MET 350 ? B MET 1   
25 1 Y 1 A SER 351 ? B SER 2   
26 1 Y 1 A LYS 352 ? B LYS 3   
27 1 Y 1 A PRO 353 ? B PRO 4   
28 1 Y 1 A LYS 354 ? B LYS 5   
29 1 Y 1 A GLN 355 ? B GLN 6   
30 1 Y 1 A PRO 356 ? B PRO 7   
31 1 Y 1 A PRO 357 ? B PRO 8   
32 1 Y 1 A ASP 358 ? B ASP 9   
33 1 Y 1 A ALA 359 ? B ALA 10  
34 1 Y 1 A SER 360 ? B SER 11  
35 1 Y 1 A PRO 361 ? B PRO 12  
36 1 Y 1 A GLU 545 ? B GLU 196 
37 1 Y 1 A PRO 546 ? B PRO 197 
38 1 Y 1 A GLN 547 ? B GLN 198 
39 1 Y 1 A PRO 548 ? B PRO 199 
40 1 Y 1 A ALA 549 ? B ALA 200 
41 1 Y 1 A LEU 599 ? B LEU 250 
42 1 Y 1 A GLU 600 ? B GLU 251 
43 1 Y 1 A HIS 601 ? B HIS 252 
44 1 Y 1 A HIS 602 ? B HIS 253 
45 1 Y 1 A HIS 603 ? B HIS 254 
46 1 Y 1 A HIS 604 ? B HIS 255 
47 1 Y 1 A HIS 605 ? B HIS 256 
48 1 Y 1 A HIS 606 ? B HIS 257 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCEROL                             GOL 
3 '1-(3,5-dimethoxyphenyl)decan-1-one' ZJ0 
4 water                                HOH 
#