data_4L0D
# 
_entry.id   4L0D 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4L0D         
RCSB  RCSB080021   
WWPDB D_1000080021 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1JBQ . unspecified 
PDB 4L27 . unspecified 
PDB 4L28 . unspecified 
PDB 4L3V . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4L0D 
_pdbx_database_status.recvd_initial_deposition_date   2013-05-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ereno, J.'           1 
'Majtan, T.'          2 
'Oyenarte, I.'        3 
'Kraus, J.P.'         4 
'Martinez-Cruz, L.A.' 5 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis of regulation and oligomerization of human cystathionine beta-synthase, the central enzyme of transsulfuration.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            110 
_citation.page_first                E3790 
_citation.page_last                 E3799 
_citation.year                      2013 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24043838 
_citation.pdbx_database_id_DOI      10.1073/pnas.1313683110 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ereno-Orbea, J.'     1 
primary 'Majtan, T.'          2 
primary 'Oyenarte, I.'        3 
primary 'Kraus, J.P.'         4 
primary 'Martinez-Cruz, L.A.' 5 
# 
_cell.entry_id           4L0D 
_cell.length_a           124.365 
_cell.length_b           136.203 
_cell.length_c           169.307 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4L0D 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cystathionine beta-synthase'     60605.305 2 4.2.1.22 P2G ? ? 
2 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE"          247.142   2 ?        ?   ? ? 
3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   2 ?        ?   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Beta-thionase, Serine sulfhydrase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDI
LKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAV
RGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEI
LQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVV
DKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEE
DLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVG
KVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQQRQMVFGVVTAIDLLNFVAAQERDQKELHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDI
LKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAV
RGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEI
LQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVV
DKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEE
DLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVG
KVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQQRQMVFGVVTAIDLLNFVAAQERDQKELHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   GLU n 
1 5   THR n 
1 6   PRO n 
1 7   GLN n 
1 8   ALA n 
1 9   GLU n 
1 10  VAL n 
1 11  GLY n 
1 12  PRO n 
1 13  THR n 
1 14  GLY n 
1 15  CYS n 
1 16  PRO n 
1 17  HIS n 
1 18  ARG n 
1 19  SER n 
1 20  GLY n 
1 21  PRO n 
1 22  HIS n 
1 23  SER n 
1 24  ALA n 
1 25  LYS n 
1 26  GLY n 
1 27  SER n 
1 28  LEU n 
1 29  GLU n 
1 30  LYS n 
1 31  GLY n 
1 32  SER n 
1 33  PRO n 
1 34  GLU n 
1 35  ASP n 
1 36  LYS n 
1 37  GLU n 
1 38  ALA n 
1 39  LYS n 
1 40  GLU n 
1 41  PRO n 
1 42  LEU n 
1 43  TRP n 
1 44  ILE n 
1 45  ARG n 
1 46  PRO n 
1 47  ASP n 
1 48  ALA n 
1 49  PRO n 
1 50  SER n 
1 51  ARG n 
1 52  CYS n 
1 53  THR n 
1 54  TRP n 
1 55  GLN n 
1 56  LEU n 
1 57  GLY n 
1 58  ARG n 
1 59  PRO n 
1 60  ALA n 
1 61  SER n 
1 62  GLU n 
1 63  SER n 
1 64  PRO n 
1 65  HIS n 
1 66  HIS n 
1 67  HIS n 
1 68  THR n 
1 69  ALA n 
1 70  PRO n 
1 71  ALA n 
1 72  LYS n 
1 73  SER n 
1 74  PRO n 
1 75  LYS n 
1 76  ILE n 
1 77  LEU n 
1 78  PRO n 
1 79  ASP n 
1 80  ILE n 
1 81  LEU n 
1 82  LYS n 
1 83  LYS n 
1 84  ILE n 
1 85  GLY n 
1 86  ASP n 
1 87  THR n 
1 88  PRO n 
1 89  MET n 
1 90  VAL n 
1 91  ARG n 
1 92  ILE n 
1 93  ASN n 
1 94  LYS n 
1 95  ILE n 
1 96  GLY n 
1 97  LYS n 
1 98  LYS n 
1 99  PHE n 
1 100 GLY n 
1 101 LEU n 
1 102 LYS n 
1 103 CYS n 
1 104 GLU n 
1 105 LEU n 
1 106 LEU n 
1 107 ALA n 
1 108 LYS n 
1 109 CYS n 
1 110 GLU n 
1 111 PHE n 
1 112 PHE n 
1 113 ASN n 
1 114 ALA n 
1 115 GLY n 
1 116 GLY n 
1 117 SER n 
1 118 VAL n 
1 119 LYS n 
1 120 ASP n 
1 121 ARG n 
1 122 ILE n 
1 123 SER n 
1 124 LEU n 
1 125 ARG n 
1 126 MET n 
1 127 ILE n 
1 128 GLU n 
1 129 ASP n 
1 130 ALA n 
1 131 GLU n 
1 132 ARG n 
1 133 ASP n 
1 134 GLY n 
1 135 THR n 
1 136 LEU n 
1 137 LYS n 
1 138 PRO n 
1 139 GLY n 
1 140 ASP n 
1 141 THR n 
1 142 ILE n 
1 143 ILE n 
1 144 GLU n 
1 145 PRO n 
1 146 THR n 
1 147 SER n 
1 148 GLY n 
1 149 ASN n 
1 150 THR n 
1 151 GLY n 
1 152 ILE n 
1 153 GLY n 
1 154 LEU n 
1 155 ALA n 
1 156 LEU n 
1 157 ALA n 
1 158 ALA n 
1 159 ALA n 
1 160 VAL n 
1 161 ARG n 
1 162 GLY n 
1 163 TYR n 
1 164 ARG n 
1 165 CYS n 
1 166 ILE n 
1 167 ILE n 
1 168 VAL n 
1 169 MET n 
1 170 PRO n 
1 171 GLU n 
1 172 LYS n 
1 173 MET n 
1 174 SER n 
1 175 SER n 
1 176 GLU n 
1 177 LYS n 
1 178 VAL n 
1 179 ASP n 
1 180 VAL n 
1 181 LEU n 
1 182 ARG n 
1 183 ALA n 
1 184 LEU n 
1 185 GLY n 
1 186 ALA n 
1 187 GLU n 
1 188 ILE n 
1 189 VAL n 
1 190 ARG n 
1 191 THR n 
1 192 PRO n 
1 193 THR n 
1 194 ASN n 
1 195 ALA n 
1 196 ARG n 
1 197 PHE n 
1 198 ASP n 
1 199 SER n 
1 200 PRO n 
1 201 GLU n 
1 202 SER n 
1 203 HIS n 
1 204 VAL n 
1 205 GLY n 
1 206 VAL n 
1 207 ALA n 
1 208 TRP n 
1 209 ARG n 
1 210 LEU n 
1 211 LYS n 
1 212 ASN n 
1 213 GLU n 
1 214 ILE n 
1 215 PRO n 
1 216 ASN n 
1 217 SER n 
1 218 HIS n 
1 219 ILE n 
1 220 LEU n 
1 221 ASP n 
1 222 GLN n 
1 223 TYR n 
1 224 ARG n 
1 225 ASN n 
1 226 ALA n 
1 227 SER n 
1 228 ASN n 
1 229 PRO n 
1 230 LEU n 
1 231 ALA n 
1 232 HIS n 
1 233 TYR n 
1 234 ASP n 
1 235 THR n 
1 236 THR n 
1 237 ALA n 
1 238 ASP n 
1 239 GLU n 
1 240 ILE n 
1 241 LEU n 
1 242 GLN n 
1 243 GLN n 
1 244 CYS n 
1 245 ASP n 
1 246 GLY n 
1 247 LYS n 
1 248 LEU n 
1 249 ASP n 
1 250 MET n 
1 251 LEU n 
1 252 VAL n 
1 253 ALA n 
1 254 SER n 
1 255 VAL n 
1 256 GLY n 
1 257 THR n 
1 258 GLY n 
1 259 GLY n 
1 260 THR n 
1 261 ILE n 
1 262 THR n 
1 263 GLY n 
1 264 ILE n 
1 265 ALA n 
1 266 ARG n 
1 267 LYS n 
1 268 LEU n 
1 269 LYS n 
1 270 GLU n 
1 271 LYS n 
1 272 CYS n 
1 273 PRO n 
1 274 GLY n 
1 275 CYS n 
1 276 ARG n 
1 277 ILE n 
1 278 ILE n 
1 279 GLY n 
1 280 VAL n 
1 281 ASP n 
1 282 PRO n 
1 283 GLU n 
1 284 GLY n 
1 285 SER n 
1 286 ILE n 
1 287 LEU n 
1 288 ALA n 
1 289 GLU n 
1 290 PRO n 
1 291 GLU n 
1 292 GLU n 
1 293 LEU n 
1 294 ASN n 
1 295 GLN n 
1 296 THR n 
1 297 GLU n 
1 298 GLN n 
1 299 THR n 
1 300 THR n 
1 301 TYR n 
1 302 GLU n 
1 303 VAL n 
1 304 GLU n 
1 305 GLY n 
1 306 ILE n 
1 307 GLY n 
1 308 TYR n 
1 309 ASP n 
1 310 PHE n 
1 311 ILE n 
1 312 PRO n 
1 313 THR n 
1 314 VAL n 
1 315 LEU n 
1 316 ASP n 
1 317 ARG n 
1 318 THR n 
1 319 VAL n 
1 320 VAL n 
1 321 ASP n 
1 322 LYS n 
1 323 TRP n 
1 324 PHE n 
1 325 LYS n 
1 326 SER n 
1 327 ASN n 
1 328 ASP n 
1 329 GLU n 
1 330 GLU n 
1 331 ALA n 
1 332 PHE n 
1 333 THR n 
1 334 PHE n 
1 335 ALA n 
1 336 ARG n 
1 337 MET n 
1 338 LEU n 
1 339 ILE n 
1 340 ALA n 
1 341 GLN n 
1 342 GLU n 
1 343 GLY n 
1 344 LEU n 
1 345 LEU n 
1 346 CYS n 
1 347 GLY n 
1 348 GLY n 
1 349 SER n 
1 350 ALA n 
1 351 GLY n 
1 352 SER n 
1 353 THR n 
1 354 VAL n 
1 355 ALA n 
1 356 VAL n 
1 357 ALA n 
1 358 VAL n 
1 359 LYS n 
1 360 ALA n 
1 361 ALA n 
1 362 GLN n 
1 363 GLU n 
1 364 LEU n 
1 365 GLN n 
1 366 GLU n 
1 367 GLY n 
1 368 GLN n 
1 369 ARG n 
1 370 CYS n 
1 371 VAL n 
1 372 VAL n 
1 373 ILE n 
1 374 LEU n 
1 375 PRO n 
1 376 ASP n 
1 377 SER n 
1 378 VAL n 
1 379 ARG n 
1 380 ASN n 
1 381 TYR n 
1 382 MET n 
1 383 THR n 
1 384 LYS n 
1 385 PHE n 
1 386 LEU n 
1 387 SER n 
1 388 ASP n 
1 389 ARG n 
1 390 TRP n 
1 391 MET n 
1 392 LEU n 
1 393 GLN n 
1 394 LYS n 
1 395 GLY n 
1 396 PHE n 
1 397 LEU n 
1 398 LYS n 
1 399 GLU n 
1 400 GLU n 
1 401 ASP n 
1 402 LEU n 
1 403 THR n 
1 404 GLU n 
1 405 LYS n 
1 406 LYS n 
1 407 PRO n 
1 408 TRP n 
1 409 TRP n 
1 410 TRP n 
1 411 HIS n 
1 412 LEU n 
1 413 ARG n 
1 414 VAL n 
1 415 GLN n 
1 416 GLU n 
1 417 LEU n 
1 418 GLY n 
1 419 LEU n 
1 420 SER n 
1 421 ALA n 
1 422 PRO n 
1 423 LEU n 
1 424 THR n 
1 425 VAL n 
1 426 LEU n 
1 427 PRO n 
1 428 THR n 
1 429 ILE n 
1 430 THR n 
1 431 CYS n 
1 432 GLY n 
1 433 HIS n 
1 434 THR n 
1 435 ILE n 
1 436 GLU n 
1 437 ILE n 
1 438 LEU n 
1 439 ARG n 
1 440 GLU n 
1 441 LYS n 
1 442 GLY n 
1 443 PHE n 
1 444 ASP n 
1 445 GLN n 
1 446 ALA n 
1 447 PRO n 
1 448 VAL n 
1 449 VAL n 
1 450 ASP n 
1 451 GLU n 
1 452 ALA n 
1 453 GLY n 
1 454 VAL n 
1 455 ILE n 
1 456 LEU n 
1 457 GLY n 
1 458 MET n 
1 459 VAL n 
1 460 THR n 
1 461 LEU n 
1 462 GLY n 
1 463 ASN n 
1 464 MET n 
1 465 LEU n 
1 466 SER n 
1 467 SER n 
1 468 LEU n 
1 469 LEU n 
1 470 ALA n 
1 471 GLY n 
1 472 LYS n 
1 473 VAL n 
1 474 GLN n 
1 475 PRO n 
1 476 SER n 
1 477 ASP n 
1 478 GLN n 
1 479 VAL n 
1 480 GLY n 
1 481 LYS n 
1 482 VAL n 
1 483 ILE n 
1 484 TYR n 
1 485 LYS n 
1 486 GLN n 
1 487 PHE n 
1 488 LYS n 
1 489 GLN n 
1 490 ILE n 
1 491 ARG n 
1 492 LEU n 
1 493 THR n 
1 494 ASP n 
1 495 THR n 
1 496 LEU n 
1 497 GLY n 
1 498 ARG n 
1 499 LEU n 
1 500 SER n 
1 501 HIS n 
1 502 ILE n 
1 503 LEU n 
1 504 GLU n 
1 505 MET n 
1 506 ASP n 
1 507 HIS n 
1 508 PHE n 
1 509 ALA n 
1 510 LEU n 
1 511 VAL n 
1 512 VAL n 
1 513 HIS n 
1 514 GLU n 
1 515 GLN n 
1 516 GLN n 
1 517 ARG n 
1 518 GLN n 
1 519 MET n 
1 520 VAL n 
1 521 PHE n 
1 522 GLY n 
1 523 VAL n 
1 524 VAL n 
1 525 THR n 
1 526 ALA n 
1 527 ILE n 
1 528 ASP n 
1 529 LEU n 
1 530 LEU n 
1 531 ASN n 
1 532 PHE n 
1 533 VAL n 
1 534 ALA n 
1 535 ALA n 
1 536 GLN n 
1 537 GLU n 
1 538 ARG n 
1 539 ASP n 
1 540 GLN n 
1 541 LYS n 
1 542 GLU n 
1 543 LEU n 
1 544 HIS n 
1 545 HIS n 
1 546 HIS n 
1 547 HIS n 
1 548 HIS n 
1 549 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 CBS 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CBS_HUMAN 
_struct_ref.pdbx_db_accession          P35520 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDI
LKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAV
RGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEI
LQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVV
DKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEE
DLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVG
KVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4L0D A 1 ? 541 ? P35520 1 ? 551 ? 1 551 
2 1 4L0D B 1 ? 541 ? P35520 1 ? 551 ? 1 551 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4L0D GLY A 2   ? UNP P35520 PRO 2   'ENGINEERED MUTATION' 2   1  
1 4L0D ?   A ?   ? UNP P35520 ILE 516 DELETION              ?   2  
1 4L0D ?   A ?   ? UNP P35520 GLN 517 DELETION              ?   3  
1 4L0D ?   A ?   ? UNP P35520 TYR 518 DELETION              ?   4  
1 4L0D ?   A ?   ? UNP P35520 HIS 519 DELETION              ?   5  
1 4L0D ?   A ?   ? UNP P35520 SER 520 DELETION              ?   6  
1 4L0D ?   A ?   ? UNP P35520 THR 521 DELETION              ?   7  
1 4L0D ?   A ?   ? UNP P35520 GLY 522 DELETION              ?   8  
1 4L0D ?   A ?   ? UNP P35520 LYS 523 DELETION              ?   9  
1 4L0D ?   A ?   ? UNP P35520 SER 524 DELETION              ?   10 
1 4L0D ?   A ?   ? UNP P35520 SER 525 DELETION              ?   11 
1 4L0D GLU A 542 ? UNP P35520 ?   ?   'EXPRESSION TAG'      552 12 
1 4L0D LEU A 543 ? UNP P35520 ?   ?   'EXPRESSION TAG'      553 13 
1 4L0D HIS A 544 ? UNP P35520 ?   ?   'EXPRESSION TAG'      554 14 
1 4L0D HIS A 545 ? UNP P35520 ?   ?   'EXPRESSION TAG'      555 15 
1 4L0D HIS A 546 ? UNP P35520 ?   ?   'EXPRESSION TAG'      556 16 
1 4L0D HIS A 547 ? UNP P35520 ?   ?   'EXPRESSION TAG'      557 17 
1 4L0D HIS A 548 ? UNP P35520 ?   ?   'EXPRESSION TAG'      558 18 
1 4L0D HIS A 549 ? UNP P35520 ?   ?   'EXPRESSION TAG'      559 19 
2 4L0D GLY B 2   ? UNP P35520 PRO 2   'ENGINEERED MUTATION' 2   20 
2 4L0D ?   B ?   ? UNP P35520 ILE 516 DELETION              ?   21 
2 4L0D ?   B ?   ? UNP P35520 GLN 517 DELETION              ?   22 
2 4L0D ?   B ?   ? UNP P35520 TYR 518 DELETION              ?   23 
2 4L0D ?   B ?   ? UNP P35520 HIS 519 DELETION              ?   24 
2 4L0D ?   B ?   ? UNP P35520 SER 520 DELETION              ?   25 
2 4L0D ?   B ?   ? UNP P35520 THR 521 DELETION              ?   26 
2 4L0D ?   B ?   ? UNP P35520 GLY 522 DELETION              ?   27 
2 4L0D ?   B ?   ? UNP P35520 LYS 523 DELETION              ?   28 
2 4L0D ?   B ?   ? UNP P35520 SER 524 DELETION              ?   29 
2 4L0D ?   B ?   ? UNP P35520 SER 525 DELETION              ?   30 
2 4L0D GLU B 542 ? UNP P35520 ?   ?   'EXPRESSION TAG'      552 31 
2 4L0D LEU B 543 ? UNP P35520 ?   ?   'EXPRESSION TAG'      553 32 
2 4L0D HIS B 544 ? UNP P35520 ?   ?   'EXPRESSION TAG'      554 33 
2 4L0D HIS B 545 ? UNP P35520 ?   ?   'EXPRESSION TAG'      555 34 
2 4L0D HIS B 546 ? UNP P35520 ?   ?   'EXPRESSION TAG'      556 35 
2 4L0D HIS B 547 ? UNP P35520 ?   ?   'EXPRESSION TAG'      557 36 
2 4L0D HIS B 548 ? UNP P35520 ?   ?   'EXPRESSION TAG'      558 37 
2 4L0D HIS B 549 ? UNP P35520 ?   ?   'EXPRESSION TAG'      559 38 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?                      'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?                      'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?                      'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?                      'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?                      'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ?                      'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?                      'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?                      'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME                   'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?                      'C6 H10 N3 O2 1'   156.162 
ILE 'L-peptide linking' y ISOLEUCINE                        ?                      'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?                      'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?                      'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?                      'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?                      'C9 H11 N O2'      165.189 
PLP non-polymer         . "PYRIDOXAL-5'-PHOSPHATE"          'VITAMIN B6 Phosphate' 'C8 H10 N O6 P'    247.142 
PRO 'L-peptide linking' y PROLINE                           ?                      'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?                      'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?                      'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?                      'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?                      'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?                      'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          4L0D 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.96 
_exptl_crystal.density_percent_sol   58.41 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '1 M sodium acetate, 0.1 M HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-11-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9793 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9793 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4L0D 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             53.062 
_reflns.d_resolution_high            2.97 
_reflns.number_obs                   29364 
_reflns.number_all                   30036 
_reflns.percent_possible_obs         97.79 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.37 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.97 
_reflns_shell.d_res_low              3.02 
_reflns_shell.percent_possible_all   95.30 
_reflns_shell.Rmerge_I_obs           0.45 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.16 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4L0D 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     29328 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.09 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             53.062 
_refine.ls_d_res_high                            2.970 
_refine.ls_percent_reflns_obs                    95.56 
_refine.ls_R_factor_obs                          0.2424 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2402 
_refine.ls_R_factor_R_free                       0.2839 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.10 
_refine.ls_number_reflns_R_free                  1495 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRIES 1JBQ AND 3KPC' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.46 
_refine.pdbx_overall_phase_error                 33.31 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7593 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         116 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               7709 
_refine_hist.d_res_high                       2.970 
_refine_hist.d_res_low                        53.062 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 7894  'X-RAY DIFFRACTION' ? 
f_angle_d          1.087  ? ? 10744 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 13.466 ? ? 2915  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.071  ? ? 1213  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 1367  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.9700 3.0212  2477 0.3876 91.00 0.3823 . . 152 . . . . 
'X-RAY DIFFRACTION' . 3.0212 3.0761  2612 0.3771 96.00 0.4703 . . 135 . . . . 
'X-RAY DIFFRACTION' . 3.0761 3.1353  2617 0.3750 96.00 0.3537 . . 150 . . . . 
'X-RAY DIFFRACTION' . 3.1353 3.1993  2613 0.3525 97.00 0.3890 . . 162 . . . . 
'X-RAY DIFFRACTION' . 3.1993 3.2688  2578 0.3581 94.00 0.4329 . . 131 . . . . 
'X-RAY DIFFRACTION' . 3.2688 3.3449  2639 0.3126 98.00 0.3308 . . 124 . . . . 
'X-RAY DIFFRACTION' . 3.3449 3.4285  2652 0.3187 97.00 0.3910 . . 147 . . . . 
'X-RAY DIFFRACTION' . 3.4285 3.5212  2644 0.3035 97.00 0.3185 . . 114 . . . . 
'X-RAY DIFFRACTION' . 3.5212 3.6248  2716 0.2800 99.00 0.3354 . . 145 . . . . 
'X-RAY DIFFRACTION' . 3.6248 3.7417  2617 0.3085 96.00 0.3387 . . 140 . . . . 
'X-RAY DIFFRACTION' . 3.7417 3.8754  2628 0.2538 97.00 0.2890 . . 165 . . . . 
'X-RAY DIFFRACTION' . 3.8754 4.0306  2610 0.2440 95.00 0.3259 . . 125 . . . . 
'X-RAY DIFFRACTION' . 4.0306 4.2139  2579 0.2274 96.00 0.2187 . . 144 . . . . 
'X-RAY DIFFRACTION' . 4.2139 4.4360  2573 0.2253 94.00 0.2931 . . 123 . . . . 
'X-RAY DIFFRACTION' . 4.4360 4.7138  2563 0.2085 94.00 0.2694 . . 124 . . . . 
'X-RAY DIFFRACTION' . 4.7138 5.0774  2659 0.1919 97.00 0.2718 . . 130 . . . . 
'X-RAY DIFFRACTION' . 5.0774 5.5879  2639 0.1998 97.00 0.2434 . . 156 . . . . 
'X-RAY DIFFRACTION' . 5.5879 6.3953  2601 0.2006 96.00 0.2502 . . 160 . . . . 
'X-RAY DIFFRACTION' . 6.3953 8.0529  2531 0.1825 93.00 0.2285 . . 153 . . . . 
'X-RAY DIFFRACTION' . 8.0529 53.0708 2458 0.1579 89.00 0.1851 . . 114 . . . . 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    4L0D 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  4L0D 
_struct.title                     
'Crystal structure of delta516-525 human cystathionine beta-synthase containing C-terminal 6xHis-tag' 
_struct.pdbx_descriptor           'Cystathionine beta-synthase (E.C.4.2.1.22)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4L0D 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            
;CBS domain, homocyteine, cysteine biosynthesis, heme, pyridoxal 5'-phosphate, S-adenosylmethionine, transsulfuration pathway, LYASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 59  ? SER A 63  ? PRO A 59  SER A 63  5 ? 5  
HELX_P HELX_P2  2  ASP A 79  ? ILE A 84  ? ASP A 79  ILE A 84  5 ? 6  
HELX_P HELX_P3  3  ASN A 93  ? PHE A 99  ? ASN A 93  PHE A 99  1 ? 7  
HELX_P HELX_P4  4  PHE A 111 ? ASN A 113 ? PHE A 111 ASN A 113 5 ? 3  
HELX_P HELX_P5  5  VAL A 118 ? ASP A 133 ? VAL A 118 ASP A 133 1 ? 16 
HELX_P HELX_P6  6  GLY A 148 ? GLY A 162 ? GLY A 148 GLY A 162 1 ? 15 
HELX_P HELX_P7  7  SER A 174 ? LEU A 184 ? SER A 174 LEU A 184 1 ? 11 
HELX_P HELX_P8  8  SER A 202 ? ILE A 214 ? SER A 202 ILE A 214 1 ? 13 
HELX_P HELX_P9  9  ALA A 226 ? THR A 235 ? ALA A 226 THR A 235 1 ? 10 
HELX_P HELX_P10 10 THR A 235 ? CYS A 244 ? THR A 235 CYS A 244 1 ? 10 
HELX_P HELX_P11 11 GLY A 258 ? CYS A 272 ? GLY A 258 CYS A 272 1 ? 15 
HELX_P HELX_P12 12 PRO A 290 ? GLN A 295 ? PRO A 290 GLN A 295 5 ? 6  
HELX_P HELX_P13 13 ASP A 316 ? VAL A 320 ? ASP A 316 VAL A 320 5 ? 5  
HELX_P HELX_P14 14 ASN A 327 ? GLY A 343 ? ASN A 327 GLY A 343 1 ? 17 
HELX_P HELX_P15 15 GLY A 347 ? ALA A 361 ? GLY A 347 ALA A 361 1 ? 15 
HELX_P HELX_P16 16 GLN A 362 ? LEU A 364 ? GLN A 362 LEU A 364 5 ? 3  
HELX_P HELX_P17 17 SER A 377 ? TYR A 381 ? SER A 377 TYR A 381 5 ? 5  
HELX_P HELX_P18 18 SER A 387 ? LYS A 394 ? SER A 387 LYS A 394 1 ? 8  
HELX_P HELX_P19 19 GLU A 400 ? ASP A 401 ? GLU A 400 ASP A 401 5 ? 2  
HELX_P HELX_P20 20 THR A 403 ? LYS A 405 ? THR A 403 LYS A 405 5 ? 3  
HELX_P HELX_P21 21 PRO A 407 ? HIS A 411 ? PRO A 407 HIS A 411 5 ? 5  
HELX_P HELX_P22 22 ARG A 413 ? GLY A 418 ? ARG A 413 GLY A 418 5 ? 6  
HELX_P HELX_P23 23 THR A 430 ? GLY A 442 ? THR A 430 GLY A 442 1 ? 13 
HELX_P HELX_P24 24 LEU A 461 ? ALA A 470 ? LEU A 461 ALA A 470 1 ? 10 
HELX_P HELX_P25 25 THR A 495 ? ASP A 506 ? THR A 495 ASP A 506 1 ? 12 
HELX_P HELX_P26 26 THR A 525 ? ARG A 538 ? THR A 535 ARG A 548 1 ? 14 
HELX_P HELX_P27 27 PRO B 59  ? SER B 63  ? PRO B 59  SER B 63  5 ? 5  
HELX_P HELX_P28 28 ASP B 79  ? ILE B 84  ? ASP B 79  ILE B 84  5 ? 6  
HELX_P HELX_P29 29 ASN B 93  ? PHE B 99  ? ASN B 93  PHE B 99  1 ? 7  
HELX_P HELX_P30 30 PHE B 111 ? ASN B 113 ? PHE B 111 ASN B 113 5 ? 3  
HELX_P HELX_P31 31 VAL B 118 ? ASP B 133 ? VAL B 118 ASP B 133 1 ? 16 
HELX_P HELX_P32 32 GLY B 148 ? GLY B 162 ? GLY B 148 GLY B 162 1 ? 15 
HELX_P HELX_P33 33 SER B 174 ? GLY B 185 ? SER B 174 GLY B 185 1 ? 12 
HELX_P HELX_P34 34 SER B 202 ? ILE B 214 ? SER B 202 ILE B 214 1 ? 13 
HELX_P HELX_P35 35 ALA B 226 ? THR B 235 ? ALA B 226 THR B 235 1 ? 10 
HELX_P HELX_P36 36 THR B 235 ? ASP B 245 ? THR B 235 ASP B 245 1 ? 11 
HELX_P HELX_P37 37 GLY B 258 ? CYS B 272 ? GLY B 258 CYS B 272 1 ? 15 
HELX_P HELX_P38 38 PRO B 290 ? GLN B 295 ? PRO B 290 GLN B 295 5 ? 6  
HELX_P HELX_P39 39 ASP B 316 ? VAL B 320 ? ASP B 316 VAL B 320 5 ? 5  
HELX_P HELX_P40 40 ASN B 327 ? GLY B 343 ? ASN B 327 GLY B 343 1 ? 17 
HELX_P HELX_P41 41 GLY B 347 ? ALA B 361 ? GLY B 347 ALA B 361 1 ? 15 
HELX_P HELX_P42 42 GLN B 362 ? LEU B 364 ? GLN B 362 LEU B 364 5 ? 3  
HELX_P HELX_P43 43 SER B 387 ? LYS B 394 ? SER B 387 LYS B 394 1 ? 8  
HELX_P HELX_P44 44 LYS B 398 ? LYS B 406 ? LYS B 398 LYS B 406 1 ? 9  
HELX_P HELX_P45 45 PRO B 407 ? HIS B 411 ? PRO B 407 HIS B 411 5 ? 5  
HELX_P HELX_P46 46 ARG B 413 ? GLY B 418 ? ARG B 413 GLY B 418 5 ? 6  
HELX_P HELX_P47 47 THR B 430 ? GLY B 442 ? THR B 430 GLY B 442 1 ? 13 
HELX_P HELX_P48 48 LEU B 461 ? ALA B 470 ? LEU B 461 ALA B 470 1 ? 10 
HELX_P HELX_P49 49 GLN B 478 ? VAL B 482 ? GLN B 478 VAL B 482 5 ? 5  
HELX_P HELX_P50 50 THR B 495 ? ASP B 506 ? THR B 495 ASP B 506 1 ? 12 
HELX_P HELX_P51 51 THR B 525 ? ASP B 539 ? THR B 535 ASP B 549 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B HIS 65  NE2 ? ? ? 1_555 F HEM . FE  ? ? B HIS 65  B HEM 602 1_555 ? ? ? ? ? ? ? 2.052 ?    
metalc2 metalc ? ? A HIS 65  NE2 ? ? ? 1_555 D HEM . FE  ? ? A HIS 65  A HEM 602 1_555 ? ? ? ? ? ? ? 2.070 ?    
metalc3 metalc ? ? A CYS 52  SG  ? ? ? 1_555 D HEM . FE  ? ? A CYS 52  A HEM 602 1_555 ? ? ? ? ? ? ? 2.213 ?    
metalc4 metalc ? ? B CYS 52  SG  ? ? ? 1_555 F HEM . FE  ? ? B CYS 52  B HEM 602 1_555 ? ? ? ? ? ? ? 2.222 ?    
covale1 covale ? ? A LYS 119 NZ  ? ? ? 1_555 C PLP . C4A ? ? A LYS 119 A PLP 601 1_555 ? ? ? ? ? ? ? 1.401 doub 
covale2 covale ? ? B LYS 119 NZ  ? ? ? 1_555 E PLP . C4A ? ? B LYS 119 B PLP 601 1_555 ? ? ? ? ? ? ? 1.418 doub 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 289 A . ? GLU 289 A PRO 290 A ? PRO 290 A 1 -2.19 
2 GLU 289 B . ? GLU 289 B PRO 290 B ? PRO 290 B 1 -2.52 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
C ? 4 ? 
D ? 2 ? 
E ? 3 ? 
F ? 4 ? 
G ? 2 ? 
H ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
B 6 7 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
G 1 2 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 76  ? LEU A 77  ? ILE A 76  LEU A 77  
A 2 MET B 89  ? ARG B 91  ? MET B 89  ARG B 91  
A 3 GLU B 104 ? CYS B 109 ? GLU B 104 CYS B 109 
A 4 ARG B 369 ? LEU B 374 ? ARG B 369 LEU B 374 
A 5 MET B 250 ? SER B 254 ? MET B 250 SER B 254 
A 6 ARG B 276 ? PRO B 282 ? ARG B 276 PRO B 282 
A 7 LYS B 322 ? SER B 326 ? LYS B 322 SER B 326 
B 1 LYS A 322 ? SER A 326 ? LYS A 322 SER A 326 
B 2 ARG A 276 ? PRO A 282 ? ARG A 276 PRO A 282 
B 3 MET A 250 ? SER A 254 ? MET A 250 SER A 254 
B 4 ARG A 369 ? LEU A 374 ? ARG A 369 LEU A 374 
B 5 GLU A 104 ? CYS A 109 ? GLU A 104 CYS A 109 
B 6 MET A 89  ? ARG A 91  ? MET A 89  ARG A 91  
B 7 ILE B 76  ? LEU B 77  ? ILE B 76  LEU B 77  
C 1 GLU A 187 ? THR A 191 ? GLU A 187 THR A 191 
C 2 ARG A 164 ? PRO A 170 ? ARG A 164 PRO A 170 
C 3 THR A 141 ? PRO A 145 ? THR A 141 PRO A 145 
C 4 SER A 217 ? HIS A 218 ? SER A 217 HIS A 218 
D 1 GLN A 445 ? VAL A 448 ? GLN A 445 VAL A 448 
D 2 GLY A 457 ? THR A 460 ? GLY A 457 THR A 460 
E 1 LYS A 488 ? ILE A 490 ? LYS A 488 ILE A 490 
E 2 ALA A 509 ? VAL A 512 ? ALA A 509 VAL A 512 
E 3 VAL A 520 ? VAL A 524 ? VAL A 530 VAL A 534 
F 1 GLU B 187 ? THR B 191 ? GLU B 187 THR B 191 
F 2 ARG B 164 ? PRO B 170 ? ARG B 164 PRO B 170 
F 3 THR B 141 ? PRO B 145 ? THR B 141 PRO B 145 
F 4 SER B 217 ? HIS B 218 ? SER B 217 HIS B 218 
G 1 GLN B 445 ? VAL B 448 ? GLN B 445 VAL B 448 
G 2 GLY B 457 ? THR B 460 ? GLY B 457 THR B 460 
H 1 LYS B 488 ? ILE B 490 ? LYS B 488 ILE B 490 
H 2 ALA B 509 ? VAL B 512 ? ALA B 509 VAL B 512 
H 3 VAL B 520 ? VAL B 524 ? VAL B 530 VAL B 534 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 77  ? N LEU A 77  O ARG B 91  ? O ARG B 91  
A 2 3 N VAL B 90  ? N VAL B 90  O ALA B 107 ? O ALA B 107 
A 3 4 N LYS B 108 ? N LYS B 108 O VAL B 372 ? O VAL B 372 
A 4 5 O VAL B 371 ? O VAL B 371 N VAL B 252 ? N VAL B 252 
A 5 6 N LEU B 251 ? N LEU B 251 O ILE B 278 ? O ILE B 278 
A 6 7 N ASP B 281 ? N ASP B 281 O PHE B 324 ? O PHE B 324 
B 1 2 O PHE A 324 ? O PHE A 324 N ASP A 281 ? N ASP A 281 
B 2 3 O ILE A 278 ? O ILE A 278 N LEU A 251 ? N LEU A 251 
B 3 4 N VAL A 252 ? N VAL A 252 O VAL A 371 ? O VAL A 371 
B 4 5 O CYS A 370 ? O CYS A 370 N GLU A 104 ? N GLU A 104 
B 5 6 O ALA A 107 ? O ALA A 107 N VAL A 90  ? N VAL A 90  
B 6 7 N ARG A 91  ? N ARG A 91  O LEU B 77  ? O LEU B 77  
C 1 2 O GLU A 187 ? O GLU A 187 N ILE A 167 ? N ILE A 167 
C 2 3 O ARG A 164 ? O ARG A 164 N ILE A 142 ? N ILE A 142 
C 3 4 N THR A 141 ? N THR A 141 O HIS A 218 ? O HIS A 218 
D 1 2 N ALA A 446 ? N ALA A 446 O VAL A 459 ? O VAL A 459 
E 1 2 N ILE A 490 ? N ILE A 490 O VAL A 512 ? O VAL A 512 
E 2 3 N VAL A 511 ? N VAL A 511 O PHE A 521 ? O PHE A 531 
F 1 2 O GLU B 187 ? O GLU B 187 N ILE B 167 ? N ILE B 167 
F 2 3 O ARG B 164 ? O ARG B 164 N ILE B 142 ? N ILE B 142 
F 3 4 N ILE B 143 ? N ILE B 143 O HIS B 218 ? O HIS B 218 
G 1 2 N ALA B 446 ? N ALA B 446 O VAL B 459 ? O VAL B 459 
H 1 2 N ILE B 490 ? N ILE B 490 O VAL B 512 ? O VAL B 512 
H 2 3 N VAL B 511 ? N VAL B 511 O PHE B 521 ? O PHE B 531 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE PLP A 601' 
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE HEM A 602' 
AC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE PLP B 601' 
AC4 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE HEM B 602' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 LYS A 119 ? LYS A 119 . ? 1_555 ? 
2  AC1 14 ASN A 149 ? ASN A 149 . ? 1_555 ? 
3  AC1 14 SER A 254 ? SER A 254 . ? 1_555 ? 
4  AC1 14 VAL A 255 ? VAL A 255 . ? 1_555 ? 
5  AC1 14 GLY A 256 ? GLY A 256 . ? 1_555 ? 
6  AC1 14 THR A 257 ? THR A 257 . ? 1_555 ? 
7  AC1 14 GLY A 258 ? GLY A 258 . ? 1_555 ? 
8  AC1 14 GLY A 259 ? GLY A 259 . ? 1_555 ? 
9  AC1 14 THR A 260 ? THR A 260 . ? 1_555 ? 
10 AC1 14 GLY A 305 ? GLY A 305 . ? 1_555 ? 
11 AC1 14 ILE A 306 ? ILE A 306 . ? 1_555 ? 
12 AC1 14 SER A 349 ? SER A 349 . ? 1_555 ? 
13 AC1 14 PRO A 375 ? PRO A 375 . ? 1_555 ? 
14 AC1 14 ASP A 376 ? ASP A 376 . ? 1_555 ? 
15 AC2 10 ARG A 51  ? ARG A 51  . ? 1_555 ? 
16 AC2 10 CYS A 52  ? CYS A 52  . ? 1_555 ? 
17 AC2 10 THR A 53  ? THR A 53  . ? 1_555 ? 
18 AC2 10 TRP A 54  ? TRP A 54  . ? 1_555 ? 
19 AC2 10 GLU A 62  ? GLU A 62  . ? 1_555 ? 
20 AC2 10 PRO A 64  ? PRO A 64  . ? 1_555 ? 
21 AC2 10 HIS A 65  ? HIS A 65  . ? 1_555 ? 
22 AC2 10 ALA A 226 ? ALA A 226 . ? 1_555 ? 
23 AC2 10 PRO A 229 ? PRO A 229 . ? 1_555 ? 
24 AC2 10 ARG A 266 ? ARG A 266 . ? 1_555 ? 
25 AC3 13 LYS B 119 ? LYS B 119 . ? 1_555 ? 
26 AC3 13 ASN B 149 ? ASN B 149 . ? 1_555 ? 
27 AC3 13 VAL B 255 ? VAL B 255 . ? 1_555 ? 
28 AC3 13 GLY B 256 ? GLY B 256 . ? 1_555 ? 
29 AC3 13 THR B 257 ? THR B 257 . ? 1_555 ? 
30 AC3 13 GLY B 258 ? GLY B 258 . ? 1_555 ? 
31 AC3 13 THR B 260 ? THR B 260 . ? 1_555 ? 
32 AC3 13 GLY B 305 ? GLY B 305 . ? 1_555 ? 
33 AC3 13 ILE B 306 ? ILE B 306 . ? 1_555 ? 
34 AC3 13 SER B 349 ? SER B 349 . ? 1_555 ? 
35 AC3 13 PRO B 375 ? PRO B 375 . ? 1_555 ? 
36 AC3 13 ASP B 376 ? ASP B 376 . ? 1_555 ? 
37 AC3 13 TYR B 381 ? TYR B 381 . ? 1_555 ? 
38 AC4 11 ARG B 51  ? ARG B 51  . ? 1_555 ? 
39 AC4 11 CYS B 52  ? CYS B 52  . ? 1_555 ? 
40 AC4 11 THR B 53  ? THR B 53  . ? 1_555 ? 
41 AC4 11 TRP B 54  ? TRP B 54  . ? 1_555 ? 
42 AC4 11 GLU B 62  ? GLU B 62  . ? 1_555 ? 
43 AC4 11 SER B 63  ? SER B 63  . ? 1_555 ? 
44 AC4 11 PRO B 64  ? PRO B 64  . ? 1_555 ? 
45 AC4 11 HIS B 65  ? HIS B 65  . ? 1_555 ? 
46 AC4 11 ALA B 226 ? ALA B 226 . ? 1_555 ? 
47 AC4 11 ARG B 266 ? ARG B 266 . ? 1_555 ? 
48 AC4 11 VAL B 314 ? VAL B 314 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4L0D 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4L0D 
_atom_sites.fract_transf_matrix[1][1]   0.008041 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007342 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005906 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 41  ? -13.000 -39.465 0.076   1.00 176.60 ? 41  PRO A N   1 
ATOM   2    C  CA  . PRO A 1 41  ? -13.993 -38.600 -0.570  1.00 177.42 ? 41  PRO A CA  1 
ATOM   3    C  C   . PRO A 1 41  ? -13.371 -37.719 -1.642  1.00 178.74 ? 41  PRO A C   1 
ATOM   4    O  O   . PRO A 1 41  ? -12.723 -36.721 -1.322  1.00 177.93 ? 41  PRO A O   1 
ATOM   5    C  CB  . PRO A 1 41  ? -14.510 -37.733 0.584   1.00 176.66 ? 41  PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 41  ? -13.430 -37.776 1.610   1.00 176.32 ? 41  PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 41  ? -12.839 -39.148 1.504   1.00 176.32 ? 41  PRO A CD  1 
ATOM   8    N  N   . LEU A 1 42  ? -13.565 -38.077 -2.906  1.00 131.20 ? 42  LEU A N   1 
ATOM   9    C  CA  . LEU A 1 42  ? -12.983 -37.282 -3.974  1.00 131.61 ? 42  LEU A CA  1 
ATOM   10   C  C   . LEU A 1 42  ? -14.031 -36.569 -4.823  1.00 127.93 ? 42  LEU A C   1 
ATOM   11   O  O   . LEU A 1 42  ? -14.751 -37.178 -5.621  1.00 131.28 ? 42  LEU A O   1 
ATOM   12   C  CB  . LEU A 1 42  ? -12.077 -38.147 -4.857  1.00 134.85 ? 42  LEU A CB  1 
ATOM   13   C  CG  . LEU A 1 42  ? -10.694 -38.477 -4.291  1.00 137.01 ? 42  LEU A CG  1 
ATOM   14   C  CD1 . LEU A 1 42  ? -10.097 -39.678 -5.009  1.00 138.07 ? 42  LEU A CD1 1 
ATOM   15   C  CD2 . LEU A 1 42  ? -9.774  -37.270 -4.405  1.00 138.08 ? 42  LEU A CD2 1 
ATOM   16   N  N   . TRP A 1 43  ? -14.098 -35.261 -4.624  1.00 150.93 ? 43  TRP A N   1 
ATOM   17   C  CA  . TRP A 1 43  ? -14.786 -34.361 -5.514  1.00 139.72 ? 43  TRP A CA  1 
ATOM   18   C  C   . TRP A 1 43  ? -14.156 -33.027 -5.178  1.00 134.38 ? 43  TRP A C   1 
ATOM   19   O  O   . TRP A 1 43  ? -13.619 -32.866 -4.079  1.00 135.78 ? 43  TRP A O   1 
ATOM   20   C  CB  . TRP A 1 43  ? -16.261 -34.326 -5.162  1.00 137.16 ? 43  TRP A CB  1 
ATOM   21   C  CG  . TRP A 1 43  ? -17.053 -33.442 -6.027  1.00 129.41 ? 43  TRP A CG  1 
ATOM   22   C  CD1 . TRP A 1 43  ? -16.987 -33.347 -7.386  1.00 124.36 ? 43  TRP A CD1 1 
ATOM   23   C  CD2 . TRP A 1 43  ? -18.009 -32.476 -5.601  1.00 123.78 ? 43  TRP A CD2 1 
ATOM   24   N  NE1 . TRP A 1 43  ? -17.876 -32.401 -7.837  1.00 122.66 ? 43  TRP A NE1 1 
ATOM   25   C  CE2 . TRP A 1 43  ? -18.512 -31.848 -6.760  1.00 122.46 ? 43  TRP A CE2 1 
ATOM   26   C  CE3 . TRP A 1 43  ? -18.500 -32.089 -4.353  1.00 122.31 ? 43  TRP A CE3 1 
ATOM   27   C  CZ2 . TRP A 1 43  ? -19.482 -30.854 -6.706  1.00 121.65 ? 43  TRP A CZ2 1 
ATOM   28   C  CZ3 . TRP A 1 43  ? -19.463 -31.110 -4.300  1.00 121.63 ? 43  TRP A CZ3 1 
ATOM   29   C  CH2 . TRP A 1 43  ? -19.944 -30.497 -5.471  1.00 121.48 ? 43  TRP A CH2 1 
ATOM   30   N  N   . ILE A 1 44  ? -14.208 -32.061 -6.084  1.00 95.60  ? 44  ILE A N   1 
ATOM   31   C  CA  . ILE A 1 44  ? -13.777 -30.719 -5.718  1.00 86.84  ? 44  ILE A CA  1 
ATOM   32   C  C   . ILE A 1 44  ? -14.752 -29.668 -6.198  1.00 87.63  ? 44  ILE A C   1 
ATOM   33   O  O   . ILE A 1 44  ? -14.931 -29.501 -7.400  1.00 86.88  ? 44  ILE A O   1 
ATOM   34   C  CB  . ILE A 1 44  ? -12.398 -30.374 -6.269  1.00 83.41  ? 44  ILE A CB  1 
ATOM   35   C  CG1 . ILE A 1 44  ? -11.394 -31.490 -5.969  1.00 74.31  ? 44  ILE A CG1 1 
ATOM   36   C  CG2 . ILE A 1 44  ? -11.921 -29.075 -5.653  1.00 75.49  ? 44  ILE A CG2 1 
ATOM   37   C  CD1 . ILE A 1 44  ? -9.978  -31.150 -6.380  1.00 65.48  ? 44  ILE A CD1 1 
ATOM   38   N  N   . ARG A 1 45  ? -15.364 -28.949 -5.263  1.00 99.84  ? 45  ARG A N   1 
ATOM   39   C  CA  . ARG A 1 45  ? -16.381 -27.971 -5.615  1.00 101.06 ? 45  ARG A CA  1 
ATOM   40   C  C   . ARG A 1 45  ? -15.857 -26.900 -6.559  1.00 98.88  ? 45  ARG A C   1 
ATOM   41   O  O   . ARG A 1 45  ? -14.940 -26.153 -6.222  1.00 98.58  ? 45  ARG A O   1 
ATOM   42   C  CB  . ARG A 1 45  ? -16.965 -27.313 -4.369  1.00 103.09 ? 45  ARG A CB  1 
ATOM   43   C  CG  . ARG A 1 45  ? -18.005 -28.153 -3.667  1.00 110.93 ? 45  ARG A CG  1 
ATOM   44   C  CD  . ARG A 1 45  ? -19.043 -27.276 -2.994  1.00 119.84 ? 45  ARG A CD  1 
ATOM   45   N  NE  . ARG A 1 45  ? -20.237 -28.023 -2.617  1.00 123.14 ? 45  ARG A NE  1 
ATOM   46   C  CZ  . ARG A 1 45  ? -21.441 -27.478 -2.471  1.00 124.59 ? 45  ARG A CZ  1 
ATOM   47   N  NH1 . ARG A 1 45  ? -22.478 -28.230 -2.123  1.00 125.05 1 45  ARG A NH1 1 
ATOM   48   N  NH2 . ARG A 1 45  ? -21.610 -26.176 -2.679  1.00 125.04 ? 45  ARG A NH2 1 
ATOM   49   N  N   . PRO A 1 46  ? -16.454 -26.823 -7.752  1.00 75.34  ? 46  PRO A N   1 
ATOM   50   C  CA  . PRO A 1 46  ? -16.175 -25.787 -8.745  1.00 76.08  ? 46  PRO A CA  1 
ATOM   51   C  C   . PRO A 1 46  ? -16.664 -24.422 -8.279  1.00 79.02  ? 46  PRO A C   1 
ATOM   52   O  O   . PRO A 1 46  ? -16.316 -23.420 -8.911  1.00 79.09  ? 46  PRO A O   1 
ATOM   53   C  CB  . PRO A 1 46  ? -16.973 -26.251 -9.964  1.00 73.81  ? 46  PRO A CB  1 
ATOM   54   C  CG  . PRO A 1 46  ? -18.082 -27.042 -9.396  1.00 70.80  ? 46  PRO A CG  1 
ATOM   55   C  CD  . PRO A 1 46  ? -17.481 -27.766 -8.223  1.00 73.34  ? 46  PRO A CD  1 
ATOM   56   N  N   . ASP A 1 47  ? -17.515 -24.390 -7.253  1.00 98.79  ? 47  ASP A N   1 
ATOM   57   C  CA  . ASP A 1 47  ? -18.005 -23.119 -6.721  1.00 101.15 ? 47  ASP A CA  1 
ATOM   58   C  C   . ASP A 1 47  ? -17.226 -22.606 -5.515  1.00 98.77  ? 47  ASP A C   1 
ATOM   59   O  O   . ASP A 1 47  ? -17.597 -21.587 -4.926  1.00 100.45 ? 47  ASP A O   1 
ATOM   60   C  CB  . ASP A 1 47  ? -19.500 -23.165 -6.412  1.00 104.70 ? 47  ASP A CB  1 
ATOM   61   C  CG  . ASP A 1 47  ? -19.811 -23.995 -5.192  1.00 110.41 ? 47  ASP A CG  1 
ATOM   62   O  OD1 . ASP A 1 47  ? -18.996 -24.884 -4.867  1.00 114.39 ? 47  ASP A OD1 1 
ATOM   63   O  OD2 . ASP A 1 47  ? -20.863 -23.760 -4.558  1.00 114.40 1 47  ASP A OD2 1 
ATOM   64   N  N   . ALA A 1 48  ? -16.164 -23.320 -5.149  1.00 90.25  ? 48  ALA A N   1 
ATOM   65   C  CA  . ALA A 1 48  ? -15.357 -22.972 -3.981  1.00 87.89  ? 48  ALA A CA  1 
ATOM   66   C  C   . ALA A 1 48  ? -14.879 -21.523 -4.052  1.00 91.46  ? 48  ALA A C   1 
ATOM   67   O  O   . ALA A 1 48  ? -14.712 -20.967 -5.140  1.00 88.20  ? 48  ALA A O   1 
ATOM   68   C  CB  . ALA A 1 48  ? -14.177 -23.914 -3.856  1.00 81.00  ? 48  ALA A CB  1 
ATOM   69   N  N   . PRO A 1 49  ? -14.686 -20.892 -2.889  1.00 126.74 ? 49  PRO A N   1 
ATOM   70   C  CA  . PRO A 1 49  ? -14.224 -19.502 -2.889  1.00 128.88 ? 49  PRO A CA  1 
ATOM   71   C  C   . PRO A 1 49  ? -12.793 -19.398 -3.397  1.00 127.13 ? 49  PRO A C   1 
ATOM   72   O  O   . PRO A 1 49  ? -12.006 -20.331 -3.215  1.00 128.28 ? 49  PRO A O   1 
ATOM   73   C  CB  . PRO A 1 49  ? -14.279 -19.126 -1.411  1.00 132.37 ? 49  PRO A CB  1 
ATOM   74   C  CG  . PRO A 1 49  ? -14.120 -20.426 -0.695  1.00 134.95 ? 49  PRO A CG  1 
ATOM   75   C  CD  . PRO A 1 49  ? -14.864 -21.418 -1.526  1.00 130.37 ? 49  PRO A CD  1 
ATOM   76   N  N   . SER A 1 50  ? -12.460 -18.274 -4.024  1.00 108.56 ? 50  SER A N   1 
ATOM   77   C  CA  . SER A 1 50  ? -11.135 -18.097 -4.601  1.00 103.60 ? 50  SER A CA  1 
ATOM   78   C  C   . SER A 1 50  ? -10.100 -17.787 -3.533  1.00 101.46 ? 50  SER A C   1 
ATOM   79   O  O   . SER A 1 50  ? -10.281 -16.886 -2.708  1.00 98.33  ? 50  SER A O   1 
ATOM   80   C  CB  . SER A 1 50  ? -11.138 -16.989 -5.655  1.00 103.49 ? 50  SER A CB  1 
ATOM   81   O  OG  . SER A 1 50  ? -9.966  -17.047 -6.453  1.00 103.35 ? 50  SER A OG  1 
ATOM   82   N  N   . ARG A 1 51  ? -9.000  -18.524 -3.565  1.00 86.87  ? 51  ARG A N   1 
ATOM   83   C  CA  . ARG A 1 51  ? -7.940  -18.321 -2.600  1.00 91.02  ? 51  ARG A CA  1 
ATOM   84   C  C   . ARG A 1 51  ? -6.940  -17.317 -3.128  1.00 91.76  ? 51  ARG A C   1 
ATOM   85   O  O   . ARG A 1 51  ? -5.915  -17.064 -2.500  1.00 87.86  ? 51  ARG A O   1 
ATOM   86   C  CB  . ARG A 1 51  ? -7.232  -19.634 -2.295  1.00 94.11  ? 51  ARG A CB  1 
ATOM   87   C  CG  . ARG A 1 51  ? -8.092  -20.610 -1.531  1.00 104.73 ? 51  ARG A CG  1 
ATOM   88   C  CD  . ARG A 1 51  ? -7.996  -21.989 -2.133  1.00 115.12 ? 51  ARG A CD  1 
ATOM   89   N  NE  . ARG A 1 51  ? -6.649  -22.538 -2.014  1.00 118.10 ? 51  ARG A NE  1 
ATOM   90   C  CZ  . ARG A 1 51  ? -6.205  -23.575 -2.717  1.00 119.31 ? 51  ARG A CZ  1 
ATOM   91   N  NH1 . ARG A 1 51  ? -7.003  -24.171 -3.594  1.00 119.66 1 51  ARG A NH1 1 
ATOM   92   N  NH2 . ARG A 1 51  ? -4.965  -24.015 -2.546  1.00 119.64 ? 51  ARG A NH2 1 
ATOM   93   N  N   . CYS A 1 52  ? -7.225  -16.756 -4.293  1.00 107.96 ? 52  CYS A N   1 
ATOM   94   C  CA  . CYS A 1 52  ? -6.278  -15.848 -4.909  1.00 114.59 ? 52  CYS A CA  1 
ATOM   95   C  C   . CYS A 1 52  ? -6.138  -14.558 -4.131  1.00 118.20 ? 52  CYS A C   1 
ATOM   96   O  O   . CYS A 1 52  ? -7.129  -13.942 -3.737  1.00 120.58 ? 52  CYS A O   1 
ATOM   97   C  CB  . CYS A 1 52  ? -6.670  -15.529 -6.341  1.00 114.95 ? 52  CYS A CB  1 
ATOM   98   S  SG  . CYS A 1 52  ? -5.372  -14.636 -7.190  1.00 114.09 ? 52  CYS A SG  1 
ATOM   99   N  N   . THR A 1 53  ? -4.892  -14.156 -3.916  1.00 100.90 ? 53  THR A N   1 
ATOM   100  C  CA  . THR A 1 53  ? -4.598  -12.972 -3.132  1.00 101.36 ? 53  THR A CA  1 
ATOM   101  C  C   . THR A 1 53  ? -4.441  -11.735 -4.007  1.00 100.01 ? 53  THR A C   1 
ATOM   102  O  O   . THR A 1 53  ? -4.103  -10.661 -3.506  1.00 101.49 ? 53  THR A O   1 
ATOM   103  C  CB  . THR A 1 53  ? -3.326  -13.165 -2.308  1.00 102.12 ? 53  THR A CB  1 
ATOM   104  O  OG1 . THR A 1 53  ? -2.223  -13.394 -3.188  1.00 102.90 ? 53  THR A OG1 1 
ATOM   105  C  CG2 . THR A 1 53  ? -3.487  -14.361 -1.391  1.00 102.95 ? 53  THR A CG2 1 
ATOM   106  N  N   . TRP A 1 54  ? -4.653  -11.894 -5.311  1.00 109.67 ? 54  TRP A N   1 
ATOM   107  C  CA  . TRP A 1 54  ? -4.614  -10.761 -6.225  1.00 105.75 ? 54  TRP A CA  1 
ATOM   108  C  C   . TRP A 1 54  ? -5.604  -9.706  -5.782  1.00 107.65 ? 54  TRP A C   1 
ATOM   109  O  O   . TRP A 1 54  ? -6.707  -10.019 -5.320  1.00 107.64 ? 54  TRP A O   1 
ATOM   110  C  CB  . TRP A 1 54  ? -4.956  -11.189 -7.651  1.00 100.96 ? 54  TRP A CB  1 
ATOM   111  C  CG  . TRP A 1 54  ? -4.914  -10.064 -8.653  1.00 91.80  ? 54  TRP A CG  1 
ATOM   112  C  CD1 . TRP A 1 54  ? -3.844  -9.693  -9.416  1.00 86.59  ? 54  TRP A CD1 1 
ATOM   113  C  CD2 . TRP A 1 54  ? -5.987  -9.183  -9.023  1.00 84.80  ? 54  TRP A CD2 1 
ATOM   114  N  NE1 . TRP A 1 54  ? -4.174  -8.632  -10.225 1.00 84.59  ? 54  TRP A NE1 1 
ATOM   115  C  CE2 . TRP A 1 54  ? -5.485  -8.299  -10.005 1.00 83.38  ? 54  TRP A CE2 1 
ATOM   116  C  CE3 . TRP A 1 54  ? -7.322  -9.049  -8.614  1.00 83.11  ? 54  TRP A CE3 1 
ATOM   117  C  CZ2 . TRP A 1 54  ? -6.266  -7.300  -10.587 1.00 81.05  ? 54  TRP A CZ2 1 
ATOM   118  C  CZ3 . TRP A 1 54  ? -8.097  -8.056  -9.193  1.00 81.33  ? 54  TRP A CZ3 1 
ATOM   119  C  CH2 . TRP A 1 54  ? -7.565  -7.194  -10.171 1.00 79.22  ? 54  TRP A CH2 1 
ATOM   120  N  N   . GLN A 1 55  ? -5.197  -8.451  -5.908  1.00 105.81 ? 55  GLN A N   1 
ATOM   121  C  CA  . GLN A 1 55  ? -6.101  -7.338  -5.693  1.00 108.69 ? 55  GLN A CA  1 
ATOM   122  C  C   . GLN A 1 55  ? -5.592  -6.168  -6.516  1.00 110.10 ? 55  GLN A C   1 
ATOM   123  O  O   . GLN A 1 55  ? -4.403  -6.103  -6.842  1.00 109.72 ? 55  GLN A O   1 
ATOM   124  C  CB  . GLN A 1 55  ? -6.185  -6.993  -4.209  1.00 108.92 ? 55  GLN A CB  1 
ATOM   125  C  CG  . GLN A 1 55  ? -4.863  -6.558  -3.628  1.00 111.77 ? 55  GLN A CG  1 
ATOM   126  C  CD  . GLN A 1 55  ? -4.822  -6.675  -2.125  1.00 114.73 ? 55  GLN A CD  1 
ATOM   127  O  OE1 . GLN A 1 55  ? -5.784  -7.128  -1.498  1.00 115.66 ? 55  GLN A OE1 1 
ATOM   128  N  NE2 . GLN A 1 55  ? -3.702  -6.273  -1.534  1.00 115.64 ? 55  GLN A NE2 1 
ATOM   129  N  N   . LEU A 1 56  ? -6.493  -5.257  -6.863  1.00 143.03 ? 56  LEU A N   1 
ATOM   130  C  CA  . LEU A 1 56  ? -6.155  -4.143  -7.734  1.00 142.88 ? 56  LEU A CA  1 
ATOM   131  C  C   . LEU A 1 56  ? -5.057  -3.273  -7.137  1.00 142.50 ? 56  LEU A C   1 
ATOM   132  O  O   . LEU A 1 56  ? -5.157  -2.839  -5.988  1.00 143.15 ? 56  LEU A O   1 
ATOM   133  C  CB  . LEU A 1 56  ? -7.394  -3.296  -8.013  1.00 143.51 ? 56  LEU A CB  1 
ATOM   134  C  CG  . LEU A 1 56  ? -7.237  -2.195  -9.057  1.00 144.02 ? 56  LEU A CG  1 
ATOM   135  C  CD1 . LEU A 1 56  ? -6.568  -2.744  -10.304 1.00 141.34 ? 56  LEU A CD1 1 
ATOM   136  C  CD2 . LEU A 1 56  ? -8.586  -1.584  -9.389  1.00 146.35 ? 56  LEU A CD2 1 
ATOM   137  N  N   . GLY A 1 57  ? -4.008  -3.024  -7.911  1.00 137.21 ? 57  GLY A N   1 
ATOM   138  C  CA  . GLY A 1 57  ? -2.933  -2.165  -7.453  1.00 138.01 ? 57  GLY A CA  1 
ATOM   139  C  C   . GLY A 1 57  ? -1.674  -2.918  -7.081  1.00 141.24 ? 57  GLY A C   1 
ATOM   140  O  O   . GLY A 1 57  ? -0.625  -2.313  -6.856  1.00 136.66 ? 57  GLY A O   1 
ATOM   141  N  N   . ARG A 1 58  ? -1.774  -4.240  -7.011  1.00 139.89 ? 58  ARG A N   1 
ATOM   142  C  CA  . ARG A 1 58  ? -0.616  -5.071  -6.716  1.00 147.46 ? 58  ARG A CA  1 
ATOM   143  C  C   . ARG A 1 58  ? 0.369   -5.030  -7.870  1.00 152.33 ? 58  ARG A C   1 
ATOM   144  O  O   . ARG A 1 58  ? -0.024  -5.117  -9.036  1.00 151.82 ? 58  ARG A O   1 
ATOM   145  C  CB  . ARG A 1 58  ? -1.036  -6.512  -6.450  1.00 148.03 ? 58  ARG A CB  1 
ATOM   146  C  CG  . ARG A 1 58  ? -1.795  -6.684  -5.161  1.00 150.04 ? 58  ARG A CG  1 
ATOM   147  C  CD  . ARG A 1 58  ? -0.872  -6.649  -3.966  1.00 151.47 ? 58  ARG A CD  1 
ATOM   148  N  NE  . ARG A 1 58  ? -0.214  -7.936  -3.768  1.00 151.87 ? 58  ARG A NE  1 
ATOM   149  C  CZ  . ARG A 1 58  ? -0.692  -8.908  -2.998  1.00 152.02 ? 58  ARG A CZ  1 
ATOM   150  N  NH1 . ARG A 1 58  ? -0.024  -10.049 -2.872  1.00 152.06 1 58  ARG A NH1 1 
ATOM   151  N  NH2 . ARG A 1 58  ? -1.840  -8.739  -2.353  1.00 152.08 ? 58  ARG A NH2 1 
ATOM   152  N  N   . PRO A 1 59  ? 1.657   -4.871  -7.547  1.00 165.56 ? 59  PRO A N   1 
ATOM   153  C  CA  . PRO A 1 59  ? 2.712   -4.916  -8.560  1.00 167.30 ? 59  PRO A CA  1 
ATOM   154  C  C   . PRO A 1 59  ? 2.709   -6.276  -9.232  1.00 166.47 ? 59  PRO A C   1 
ATOM   155  O  O   . PRO A 1 59  ? 2.647   -7.296  -8.541  1.00 168.02 ? 59  PRO A O   1 
ATOM   156  C  CB  . PRO A 1 59  ? 3.992   -4.756  -7.738  1.00 169.28 ? 59  PRO A CB  1 
ATOM   157  C  CG  . PRO A 1 59  ? 3.557   -4.086  -6.483  1.00 169.92 ? 59  PRO A CG  1 
ATOM   158  C  CD  . PRO A 1 59  ? 2.193   -4.626  -6.199  1.00 167.91 ? 59  PRO A CD  1 
ATOM   159  N  N   . ALA A 1 60  ? 2.794   -6.290  -10.558 1.00 155.25 ? 60  ALA A N   1 
ATOM   160  C  CA  . ALA A 1 60  ? 2.724   -7.529  -11.322 1.00 151.95 ? 60  ALA A CA  1 
ATOM   161  C  C   . ALA A 1 60  ? 3.853   -8.493  -10.965 1.00 149.87 ? 60  ALA A C   1 
ATOM   162  O  O   . ALA A 1 60  ? 3.811   -9.674  -11.313 1.00 149.84 ? 60  ALA A O   1 
ATOM   163  C  CB  . ALA A 1 60  ? 2.740   -7.226  -12.808 1.00 151.64 ? 60  ALA A CB  1 
ATOM   164  N  N   . SER A 1 61  ? 4.862   -7.983  -10.272 1.00 140.75 ? 61  SER A N   1 
ATOM   165  C  CA  . SER A 1 61  ? 6.008   -8.788  -9.877  1.00 138.20 ? 61  SER A CA  1 
ATOM   166  C  C   . SER A 1 61  ? 5.702   -9.733  -8.719  1.00 134.74 ? 61  SER A C   1 
ATOM   167  O  O   . SER A 1 61  ? 6.508   -10.606 -8.396  1.00 134.95 ? 61  SER A O   1 
ATOM   168  C  CB  . SER A 1 61  ? 7.174   -7.873  -9.505  1.00 139.87 ? 61  SER A CB  1 
ATOM   169  O  OG  . SER A 1 61  ? 6.717   -6.768  -8.741  1.00 142.59 ? 61  SER A OG  1 
ATOM   170  N  N   . GLU A 1 62  ? 4.537   -9.572  -8.104  1.00 141.35 ? 62  GLU A N   1 
ATOM   171  C  CA  . GLU A 1 62  ? 4.196   -10.359 -6.924  1.00 137.60 ? 62  GLU A CA  1 
ATOM   172  C  C   . GLU A 1 62  ? 3.544   -11.694 -7.259  1.00 132.75 ? 62  GLU A C   1 
ATOM   173  O  O   . GLU A 1 62  ? 3.372   -12.546 -6.384  1.00 132.42 ? 62  GLU A O   1 
ATOM   174  C  CB  . GLU A 1 62  ? 3.280   -9.555  -6.006  1.00 140.32 ? 62  GLU A CB  1 
ATOM   175  C  CG  . GLU A 1 62  ? 3.937   -8.329  -5.396  1.00 145.92 ? 62  GLU A CG  1 
ATOM   176  C  CD  . GLU A 1 62  ? 3.015   -7.613  -4.435  1.00 150.48 ? 62  GLU A CD  1 
ATOM   177  O  OE1 . GLU A 1 62  ? 1.892   -8.110  -4.228  1.00 151.52 ? 62  GLU A OE1 1 
ATOM   178  O  OE2 . GLU A 1 62  ? 3.402   -6.552  -3.902  1.00 151.53 1 62  GLU A OE2 1 
ATOM   179  N  N   . SER A 1 63  ? 3.192   -11.874 -8.527  1.00 123.05 ? 63  SER A N   1 
ATOM   180  C  CA  . SER A 1 63  ? 2.451   -13.052 -8.962  1.00 115.20 ? 63  SER A CA  1 
ATOM   181  C  C   . SER A 1 63  ? 3.250   -14.347 -8.883  1.00 104.60 ? 63  SER A C   1 
ATOM   182  O  O   . SER A 1 63  ? 4.331   -14.459 -9.469  1.00 106.00 ? 63  SER A O   1 
ATOM   183  C  CB  . SER A 1 63  ? 1.945   -12.864 -10.390 1.00 118.24 ? 63  SER A CB  1 
ATOM   184  O  OG  . SER A 1 63  ? 1.311   -14.040 -10.859 1.00 125.44 ? 63  SER A OG  1 
ATOM   185  N  N   . PRO A 1 64  ? 2.720   -15.330 -8.139  1.00 76.50  ? 64  PRO A N   1 
ATOM   186  C  CA  . PRO A 1 64  ? 3.273   -16.679 -8.029  1.00 74.23  ? 64  PRO A CA  1 
ATOM   187  C  C   . PRO A 1 64  ? 3.062   -17.455 -9.319  1.00 80.05  ? 64  PRO A C   1 
ATOM   188  O  O   . PRO A 1 64  ? 3.809   -18.395 -9.601  1.00 77.79  ? 64  PRO A O   1 
ATOM   189  C  CB  . PRO A 1 64  ? 2.432   -17.302 -6.920  1.00 67.41  ? 64  PRO A CB  1 
ATOM   190  C  CG  . PRO A 1 64  ? 1.125   -16.655 -7.071  1.00 61.21  ? 64  PRO A CG  1 
ATOM   191  C  CD  . PRO A 1 64  ? 1.399   -15.238 -7.503  1.00 69.62  ? 64  PRO A CD  1 
ATOM   192  N  N   . HIS A 1 65  ? 2.034   -17.078 -10.076 1.00 77.66  ? 65  HIS A N   1 
ATOM   193  C  CA  . HIS A 1 65  ? 1.668   -17.798 -11.286 1.00 88.24  ? 65  HIS A CA  1 
ATOM   194  C  C   . HIS A 1 65  ? 2.749   -17.601 -12.335 1.00 97.22  ? 65  HIS A C   1 
ATOM   195  O  O   . HIS A 1 65  ? 3.370   -16.539 -12.409 1.00 100.63 ? 65  HIS A O   1 
ATOM   196  C  CB  . HIS A 1 65  ? 0.318   -17.313 -11.814 1.00 86.57  ? 65  HIS A CB  1 
ATOM   197  C  CG  . HIS A 1 65  ? -0.751  -17.263 -10.775 1.00 77.32  ? 65  HIS A CG  1 
ATOM   198  N  ND1 . HIS A 1 65  ? -1.243  -18.391 -10.147 1.00 68.67  ? 65  HIS A ND1 1 
ATOM   199  C  CD2 . HIS A 1 65  ? -1.416  -16.219 -10.227 1.00 68.98  ? 65  HIS A CD2 1 
ATOM   200  C  CE1 . HIS A 1 65  ? -2.160  -18.040 -9.271  1.00 66.30  ? 65  HIS A CE1 1 
ATOM   201  N  NE2 . HIS A 1 65  ? -2.275  -16.723 -9.288  1.00 69.71  ? 65  HIS A NE2 1 
ATOM   202  N  N   . HIS A 1 66  ? 2.974   -18.627 -13.147 1.00 133.19 ? 66  HIS A N   1 
ATOM   203  C  CA  . HIS A 1 66  ? 3.926   -18.529 -14.238 1.00 137.14 ? 66  HIS A CA  1 
ATOM   204  C  C   . HIS A 1 66  ? 3.255   -17.925 -15.457 1.00 134.64 ? 66  HIS A C   1 
ATOM   205  O  O   . HIS A 1 66  ? 2.254   -18.446 -15.949 1.00 137.39 ? 66  HIS A O   1 
ATOM   206  C  CB  . HIS A 1 66  ? 4.482   -19.904 -14.588 1.00 141.30 ? 66  HIS A CB  1 
ATOM   207  C  CG  . HIS A 1 66  ? 5.015   -19.999 -15.982 1.00 147.67 ? 66  HIS A CG  1 
ATOM   208  N  ND1 . HIS A 1 66  ? 6.058   -19.222 -16.438 1.00 151.44 ? 66  HIS A ND1 1 
ATOM   209  C  CD2 . HIS A 1 66  ? 4.653   -20.786 -17.024 1.00 151.39 ? 66  HIS A CD2 1 
ATOM   210  C  CE1 . HIS A 1 66  ? 6.314   -19.522 -17.697 1.00 152.34 ? 66  HIS A CE1 1 
ATOM   211  N  NE2 . HIS A 1 66  ? 5.476   -20.472 -18.075 1.00 152.33 ? 66  HIS A NE2 1 
ATOM   212  N  N   . HIS A 1 67  ? 3.813   -16.832 -15.956 1.00 128.81 ? 67  HIS A N   1 
ATOM   213  C  CA  . HIS A 1 67  ? 3.227   -16.160 -17.099 1.00 121.95 ? 67  HIS A CA  1 
ATOM   214  C  C   . HIS A 1 67  ? 4.034   -16.446 -18.340 1.00 122.86 ? 67  HIS A C   1 
ATOM   215  O  O   . HIS A 1 67  ? 5.264   -16.499 -18.300 1.00 121.41 ? 67  HIS A O   1 
ATOM   216  C  CB  . HIS A 1 67  ? 3.190   -14.653 -16.877 1.00 117.54 ? 67  HIS A CB  1 
ATOM   217  C  CG  . HIS A 1 67  ? 2.328   -14.223 -15.737 1.00 106.52 ? 67  HIS A CG  1 
ATOM   218  N  ND1 . HIS A 1 67  ? 1.338   -13.279 -15.869 1.00 99.16  ? 67  HIS A ND1 1 
ATOM   219  C  CD2 . HIS A 1 67  ? 2.302   -14.610 -14.435 1.00 98.78  ? 67  HIS A CD2 1 
ATOM   220  C  CE1 . HIS A 1 67  ? 0.741   -13.095 -14.707 1.00 97.29  ? 67  HIS A CE1 1 
ATOM   221  N  NE2 . HIS A 1 67  ? 1.312   -13.895 -13.820 1.00 97.19  ? 67  HIS A NE2 1 
ATOM   222  N  N   . THR A 1 68  ? 3.332   -16.631 -19.449 1.00 110.91 ? 68  THR A N   1 
ATOM   223  C  CA  . THR A 1 68  ? 3.973   -16.690 -20.750 1.00 115.78 ? 68  THR A CA  1 
ATOM   224  C  C   . THR A 1 68  ? 3.399   -15.583 -21.613 1.00 124.26 ? 68  THR A C   1 
ATOM   225  O  O   . THR A 1 68  ? 2.182   -15.474 -21.771 1.00 122.00 ? 68  THR A O   1 
ATOM   226  C  CB  . THR A 1 68  ? 3.769   -18.049 -21.437 1.00 112.70 ? 68  THR A CB  1 
ATOM   227  O  OG1 . THR A 1 68  ? 2.418   -18.482 -21.245 1.00 109.10 ? 68  THR A OG1 1 
ATOM   228  C  CG2 . THR A 1 68  ? 4.709   -19.080 -20.842 1.00 109.06 ? 68  THR A CG2 1 
ATOM   229  N  N   . ALA A 1 69  ? 4.278   -14.752 -22.157 1.00 140.69 ? 69  ALA A N   1 
ATOM   230  C  CA  . ALA A 1 69  ? 3.849   -13.629 -22.971 1.00 151.13 ? 69  ALA A CA  1 
ATOM   231  C  C   . ALA A 1 69  ? 3.683   -14.061 -24.424 1.00 154.79 ? 69  ALA A C   1 
ATOM   232  O  O   . ALA A 1 69  ? 4.379   -14.968 -24.888 1.00 157.92 ? 69  ALA A O   1 
ATOM   233  C  CB  . ALA A 1 69  ? 4.849   -12.493 -22.862 1.00 155.28 ? 69  ALA A CB  1 
ATOM   234  N  N   . PRO A 1 70  ? 2.750   -13.415 -25.145 1.00 141.14 ? 70  PRO A N   1 
ATOM   235  C  CA  . PRO A 1 70  ? 2.536   -13.678 -26.570 1.00 141.48 ? 70  PRO A CA  1 
ATOM   236  C  C   . PRO A 1 70  ? 3.833   -13.511 -27.347 1.00 142.03 ? 70  PRO A C   1 
ATOM   237  O  O   . PRO A 1 70  ? 4.678   -12.697 -26.968 1.00 141.85 ? 70  PRO A O   1 
ATOM   238  C  CB  . PRO A 1 70  ? 1.548   -12.587 -26.981 1.00 141.20 ? 70  PRO A CB  1 
ATOM   239  C  CG  . PRO A 1 70  ? 0.813   -12.273 -25.744 1.00 140.89 ? 70  PRO A CG  1 
ATOM   240  C  CD  . PRO A 1 70  ? 1.810   -12.404 -24.631 1.00 140.98 ? 70  PRO A CD  1 
ATOM   241  N  N   . ALA A 1 71  ? 3.992   -14.287 -28.412 1.00 193.64 ? 71  ALA A N   1 
ATOM   242  C  CA  . ALA A 1 71  ? 5.194   -14.222 -29.225 1.00 193.26 ? 71  ALA A CA  1 
ATOM   243  C  C   . ALA A 1 71  ? 4.845   -14.156 -30.703 1.00 190.51 ? 71  ALA A C   1 
ATOM   244  O  O   . ALA A 1 71  ? 3.672   -14.088 -31.078 1.00 192.93 ? 71  ALA A O   1 
ATOM   245  C  CB  . ALA A 1 71  ? 6.079   -15.421 -28.948 1.00 196.12 ? 71  ALA A CB  1 
ATOM   246  N  N   . LYS A 1 72  ? 5.874   -14.174 -31.540 1.00 141.17 ? 72  LYS A N   1 
ATOM   247  C  CA  . LYS A 1 72  ? 5.680   -14.123 -32.980 1.00 133.96 ? 72  LYS A CA  1 
ATOM   248  C  C   . LYS A 1 72  ? 5.778   -15.515 -33.587 1.00 129.80 ? 72  LYS A C   1 
ATOM   249  O  O   . LYS A 1 72  ? 6.724   -16.260 -33.316 1.00 129.37 ? 72  LYS A O   1 
ATOM   250  C  CB  . LYS A 1 72  ? 6.688   -13.170 -33.619 1.00 133.12 ? 72  LYS A CB  1 
ATOM   251  C  CG  . LYS A 1 72  ? 6.722   -11.812 -32.937 1.00 131.85 ? 72  LYS A CG  1 
ATOM   252  C  CD  . LYS A 1 72  ? 7.428   -10.770 -33.785 1.00 131.34 ? 72  LYS A CD  1 
ATOM   253  C  CE  . LYS A 1 72  ? 7.401   -9.407  -33.106 1.00 131.25 ? 72  LYS A CE  1 
ATOM   254  N  NZ  . LYS A 1 72  ? 7.862   -8.316  -34.012 1.00 131.26 1 72  LYS A NZ  1 
ATOM   255  N  N   . SER A 1 73  ? 4.781   -15.863 -34.395 1.00 107.84 ? 73  SER A N   1 
ATOM   256  C  CA  . SER A 1 73  ? 4.724   -17.176 -35.023 1.00 102.63 ? 73  SER A CA  1 
ATOM   257  C  C   . SER A 1 73  ? 5.755   -17.319 -36.133 1.00 98.53  ? 73  SER A C   1 
ATOM   258  O  O   . SER A 1 73  ? 6.014   -16.370 -36.877 1.00 99.74  ? 73  SER A O   1 
ATOM   259  C  CB  . SER A 1 73  ? 3.326   -17.438 -35.586 1.00 102.75 ? 73  SER A CB  1 
ATOM   260  O  OG  . SER A 1 73  ? 2.380   -17.611 -34.548 1.00 100.93 ? 73  SER A OG  1 
ATOM   261  N  N   . PRO A 1 74  ? 6.348   -18.517 -36.249 1.00 98.07  ? 74  PRO A N   1 
ATOM   262  C  CA  . PRO A 1 74  ? 7.286   -18.812 -37.331 1.00 95.78  ? 74  PRO A CA  1 
ATOM   263  C  C   . PRO A 1 74  ? 6.529   -18.820 -38.641 1.00 93.89  ? 74  PRO A C   1 
ATOM   264  O  O   . PRO A 1 74  ? 5.295   -18.903 -38.630 1.00 94.13  ? 74  PRO A O   1 
ATOM   265  C  CB  . PRO A 1 74  ? 7.759   -20.228 -37.008 1.00 95.60  ? 74  PRO A CB  1 
ATOM   266  C  CG  . PRO A 1 74  ? 6.629   -20.819 -36.247 1.00 95.90  ? 74  PRO A CG  1 
ATOM   267  C  CD  . PRO A 1 74  ? 6.093   -19.698 -35.409 1.00 97.14  ? 74  PRO A CD  1 
ATOM   268  N  N   . LYS A 1 75  ? 7.250   -18.729 -39.752 1.00 90.45  ? 75  LYS A N   1 
ATOM   269  C  CA  . LYS A 1 75  ? 6.618   -18.757 -41.057 1.00 86.46  ? 75  LYS A CA  1 
ATOM   270  C  C   . LYS A 1 75  ? 5.812   -20.036 -41.197 1.00 80.78  ? 75  LYS A C   1 
ATOM   271  O  O   . LYS A 1 75  ? 4.703   -20.032 -41.731 1.00 83.30  ? 75  LYS A O   1 
ATOM   272  C  CB  . LYS A 1 75  ? 7.667   -18.693 -42.157 1.00 88.81  ? 75  LYS A CB  1 
ATOM   273  C  CG  . LYS A 1 75  ? 8.525   -17.452 -42.107 1.00 90.84  ? 75  LYS A CG  1 
ATOM   274  C  CD  . LYS A 1 75  ? 9.315   -17.316 -43.388 1.00 92.15  ? 75  LYS A CD  1 
ATOM   275  C  CE  . LYS A 1 75  ? 10.297  -16.161 -43.306 1.00 92.40  ? 75  LYS A CE  1 
ATOM   276  N  NZ  . LYS A 1 75  ? 11.478  -16.516 -42.466 1.00 92.50  1 75  LYS A NZ  1 
ATOM   277  N  N   . ILE A 1 76  ? 6.378   -21.131 -40.710 1.00 81.52  ? 76  ILE A N   1 
ATOM   278  C  CA  . ILE A 1 76  ? 5.722   -22.419 -40.816 1.00 72.14  ? 76  ILE A CA  1 
ATOM   279  C  C   . ILE A 1 76  ? 5.382   -22.970 -39.441 1.00 73.14  ? 76  ILE A C   1 
ATOM   280  O  O   . ILE A 1 76  ? 6.271   -23.218 -38.620 1.00 70.55  ? 76  ILE A O   1 
ATOM   281  C  CB  . ILE A 1 76  ? 6.592   -23.425 -41.562 1.00 67.93  ? 76  ILE A CB  1 
ATOM   282  C  CG1 . ILE A 1 76  ? 6.879   -22.925 -42.978 1.00 60.23  ? 76  ILE A CG1 1 
ATOM   283  C  CG2 . ILE A 1 76  ? 5.895   -24.767 -41.632 1.00 61.99  ? 76  ILE A CG2 1 
ATOM   284  C  CD1 . ILE A 1 76  ? 7.827   -23.813 -43.750 1.00 54.54  ? 76  ILE A CD1 1 
ATOM   285  N  N   . LEU A 1 77  ? 4.087   -23.135 -39.192 1.00 84.73  ? 77  LEU A N   1 
ATOM   286  C  CA  . LEU A 1 77  ? 3.587   -23.660 -37.933 1.00 86.65  ? 77  LEU A CA  1 
ATOM   287  C  C   . LEU A 1 77  ? 3.853   -25.156 -37.849 1.00 91.24  ? 77  LEU A C   1 
ATOM   288  O  O   . LEU A 1 77  ? 3.472   -25.904 -38.751 1.00 94.38  ? 77  LEU A O   1 
ATOM   289  C  CB  . LEU A 1 77  ? 2.091   -23.415 -37.824 1.00 81.05  ? 77  LEU A CB  1 
ATOM   290  C  CG  . LEU A 1 77  ? 1.569   -22.045 -37.389 1.00 68.56  ? 77  LEU A CG  1 
ATOM   291  C  CD1 . LEU A 1 77  ? 2.387   -20.881 -37.922 1.00 58.22  ? 77  LEU A CD1 1 
ATOM   292  C  CD2 . LEU A 1 77  ? 0.133   -21.914 -37.865 1.00 59.04  ? 77  LEU A CD2 1 
ATOM   293  N  N   . PRO A 1 78  ? 4.508   -25.599 -36.765 1.00 70.78  ? 78  PRO A N   1 
ATOM   294  C  CA  . PRO A 1 78  ? 4.884   -27.007 -36.563 1.00 71.02  ? 78  PRO A CA  1 
ATOM   295  C  C   . PRO A 1 78  ? 3.672   -27.915 -36.362 1.00 71.13  ? 78  PRO A C   1 
ATOM   296  O  O   . PRO A 1 78  ? 3.724   -29.116 -36.645 1.00 73.52  ? 78  PRO A O   1 
ATOM   297  C  CB  . PRO A 1 78  ? 5.728   -26.964 -35.289 1.00 69.17  ? 78  PRO A CB  1 
ATOM   298  C  CG  . PRO A 1 78  ? 5.267   -25.728 -34.581 1.00 68.39  ? 78  PRO A CG  1 
ATOM   299  C  CD  . PRO A 1 78  ? 4.962   -24.740 -35.659 1.00 68.77  ? 78  PRO A CD  1 
ATOM   300  N  N   . ASP A 1 79  ? 2.595   -27.341 -35.845 1.00 80.75  ? 79  ASP A N   1 
ATOM   301  C  CA  . ASP A 1 79  ? 1.312   -28.024 -35.785 1.00 79.44  ? 79  ASP A CA  1 
ATOM   302  C  C   . ASP A 1 79  ? 0.213   -26.986 -35.705 1.00 75.56  ? 79  ASP A C   1 
ATOM   303  O  O   . ASP A 1 79  ? 0.478   -25.805 -35.449 1.00 75.63  ? 79  ASP A O   1 
ATOM   304  C  CB  . ASP A 1 79  ? 1.236   -29.035 -34.633 1.00 81.98  ? 79  ASP A CB  1 
ATOM   305  C  CG  . ASP A 1 79  ? 1.577   -28.423 -33.281 1.00 89.00  ? 79  ASP A CG  1 
ATOM   306  O  OD1 . ASP A 1 79  ? 1.138   -27.285 -32.992 1.00 96.36  ? 79  ASP A OD1 1 
ATOM   307  O  OD2 . ASP A 1 79  ? 2.299   -29.090 -32.507 1.00 96.32  1 79  ASP A OD2 1 
ATOM   308  N  N   . ILE A 1 80  ? -1.011  -27.422 -35.957 1.00 71.22  ? 80  ILE A N   1 
ATOM   309  C  CA  . ILE A 1 80  ? -2.149  -26.521 -36.011 1.00 68.07  ? 80  ILE A CA  1 
ATOM   310  C  C   . ILE A 1 80  ? -2.406  -25.758 -34.695 1.00 72.10  ? 80  ILE A C   1 
ATOM   311  O  O   . ILE A 1 80  ? -3.026  -24.686 -34.692 1.00 72.00  ? 80  ILE A O   1 
ATOM   312  C  CB  . ILE A 1 80  ? -3.398  -27.307 -36.413 1.00 63.93  ? 80  ILE A CB  1 
ATOM   313  C  CG1 . ILE A 1 80  ? -4.568  -26.370 -36.709 1.00 56.23  ? 80  ILE A CG1 1 
ATOM   314  C  CG2 . ILE A 1 80  ? -3.738  -28.325 -35.340 1.00 58.63  ? 80  ILE A CG2 1 
ATOM   315  C  CD1 . ILE A 1 80  ? -4.266  -25.384 -37.822 1.00 47.85  ? 80  ILE A CD1 1 
ATOM   316  N  N   . LEU A 1 81  ? -1.909  -26.300 -33.587 1.00 73.06  ? 81  LEU A N   1 
ATOM   317  C  CA  . LEU A 1 81  ? -2.125  -25.707 -32.272 1.00 75.74  ? 81  LEU A CA  1 
ATOM   318  C  C   . LEU A 1 81  ? -1.539  -24.309 -32.130 1.00 77.53  ? 81  LEU A C   1 
ATOM   319  O  O   . LEU A 1 81  ? -1.960  -23.537 -31.268 1.00 80.44  ? 81  LEU A O   1 
ATOM   320  C  CB  . LEU A 1 81  ? -1.565  -26.609 -31.182 1.00 74.54  ? 81  LEU A CB  1 
ATOM   321  C  CG  . LEU A 1 81  ? -2.246  -27.968 -31.115 1.00 71.01  ? 81  LEU A CG  1 
ATOM   322  C  CD1 . LEU A 1 81  ? -1.668  -28.789 -29.986 1.00 70.19  ? 81  LEU A CD1 1 
ATOM   323  C  CD2 . LEU A 1 81  ? -3.732  -27.763 -30.905 1.00 67.96  ? 81  LEU A CD2 1 
ATOM   324  N  N   . LYS A 1 82  ? -0.550  -23.991 -32.950 1.00 102.98 ? 82  LYS A N   1 
ATOM   325  C  CA  . LYS A 1 82  ? 0.066   -22.677 -32.887 1.00 101.18 ? 82  LYS A CA  1 
ATOM   326  C  C   . LYS A 1 82  ? -0.797  -21.619 -33.576 1.00 101.87 ? 82  LYS A C   1 
ATOM   327  O  O   . LYS A 1 82  ? -0.480  -20.429 -33.542 1.00 102.62 ? 82  LYS A O   1 
ATOM   328  C  CB  . LYS A 1 82  ? 1.472   -22.725 -33.478 1.00 99.17  ? 82  LYS A CB  1 
ATOM   329  C  CG  . LYS A 1 82  ? 2.411   -23.612 -32.667 1.00 95.46  ? 82  LYS A CG  1 
ATOM   330  C  CD  . LYS A 1 82  ? 2.810   -22.929 -31.365 1.00 93.64  ? 82  LYS A CD  1 
ATOM   331  C  CE  . LYS A 1 82  ? 3.763   -23.790 -30.541 1.00 94.65  ? 82  LYS A CE  1 
ATOM   332  N  NZ  . LYS A 1 82  ? 3.082   -25.008 -29.987 1.00 91.98  1 82  LYS A NZ  1 
ATOM   333  N  N   . LYS A 1 83  ? -1.880  -22.065 -34.211 1.00 71.24  ? 83  LYS A N   1 
ATOM   334  C  CA  . LYS A 1 83  ? -2.799  -21.179 -34.931 1.00 70.58  ? 83  LYS A CA  1 
ATOM   335  C  C   . LYS A 1 83  ? -3.824  -20.596 -33.958 1.00 69.69  ? 83  LYS A C   1 
ATOM   336  O  O   . LYS A 1 83  ? -4.707  -19.807 -34.321 1.00 70.60  ? 83  LYS A O   1 
ATOM   337  C  CB  . LYS A 1 83  ? -3.493  -21.947 -36.064 1.00 70.87  ? 83  LYS A CB  1 
ATOM   338  C  CG  . LYS A 1 83  ? -4.417  -21.121 -36.937 1.00 69.88  ? 83  LYS A CG  1 
ATOM   339  C  CD  . LYS A 1 83  ? -3.743  -19.821 -37.333 1.00 69.94  ? 83  LYS A CD  1 
ATOM   340  C  CE  . LYS A 1 83  ? -4.686  -18.959 -38.133 1.00 71.81  ? 83  LYS A CE  1 
ATOM   341  N  NZ  . LYS A 1 83  ? -5.900  -18.626 -37.335 1.00 73.52  1 83  LYS A NZ  1 
ATOM   342  N  N   . ILE A 1 84  ? -3.685  -20.977 -32.699 1.00 69.80  ? 84  ILE A N   1 
ATOM   343  C  CA  . ILE A 1 84  ? -4.552  -20.466 -31.655 1.00 67.37  ? 84  ILE A CA  1 
ATOM   344  C  C   . ILE A 1 84  ? -4.090  -19.095 -31.193 1.00 65.71  ? 84  ILE A C   1 
ATOM   345  O  O   . ILE A 1 84  ? -2.935  -18.927 -30.796 1.00 65.41  ? 84  ILE A O   1 
ATOM   346  C  CB  . ILE A 1 84  ? -4.570  -21.413 -30.475 1.00 67.10  ? 84  ILE A CB  1 
ATOM   347  C  CG1 . ILE A 1 84  ? -5.139  -22.759 -30.924 1.00 65.17  ? 84  ILE A CG1 1 
ATOM   348  C  CG2 . ILE A 1 84  ? -5.371  -20.807 -29.352 1.00 70.33  ? 84  ILE A CG2 1 
ATOM   349  C  CD1 . ILE A 1 84  ? -4.800  -23.899 -30.019 1.00 52.97  ? 84  ILE A CD1 1 
ATOM   350  N  N   . GLY A 1 85  ? -4.987  -18.115 -31.248 1.00 70.22  ? 85  GLY A N   1 
ATOM   351  C  CA  . GLY A 1 85  ? -4.652  -16.766 -30.841 1.00 69.69  ? 85  GLY A CA  1 
ATOM   352  C  C   . GLY A 1 85  ? -4.474  -15.813 -32.008 1.00 70.82  ? 85  GLY A C   1 
ATOM   353  O  O   . GLY A 1 85  ? -4.585  -16.212 -33.183 1.00 69.31  ? 85  GLY A O   1 
ATOM   354  N  N   . ASP A 1 86  ? -4.215  -14.547 -31.672 1.00 88.47  ? 86  ASP A N   1 
ATOM   355  C  CA  . ASP A 1 86  ? -4.046  -13.467 -32.649 1.00 92.91  ? 86  ASP A CA  1 
ATOM   356  C  C   . ASP A 1 86  ? -5.283  -13.268 -33.500 1.00 90.66  ? 86  ASP A C   1 
ATOM   357  O  O   . ASP A 1 86  ? -5.202  -13.002 -34.703 1.00 90.22  ? 86  ASP A O   1 
ATOM   358  C  CB  . ASP A 1 86  ? -2.813  -13.685 -33.528 1.00 97.84  ? 86  ASP A CB  1 
ATOM   359  C  CG  . ASP A 1 86  ? -1.556  -13.097 -32.920 1.00 111.26 ? 86  ASP A CG  1 
ATOM   360  O  OD1 . ASP A 1 86  ? -0.845  -13.818 -32.185 1.00 123.58 ? 86  ASP A OD1 1 
ATOM   361  O  OD2 . ASP A 1 86  ? -1.286  -11.902 -33.170 1.00 123.59 1 86  ASP A OD2 1 
ATOM   362  N  N   . THR A 1 87  ? -6.432  -13.400 -32.857 1.00 81.57  ? 87  THR A N   1 
ATOM   363  C  CA  . THR A 1 87  ? -7.706  -13.230 -33.523 1.00 80.58  ? 87  THR A CA  1 
ATOM   364  C  C   . THR A 1 87  ? -7.915  -11.760 -33.870 1.00 78.84  ? 87  THR A C   1 
ATOM   365  O  O   . THR A 1 87  ? -7.514  -10.872 -33.116 1.00 77.48  ? 87  THR A O   1 
ATOM   366  C  CB  . THR A 1 87  ? -8.839  -13.744 -32.640 1.00 80.78  ? 87  THR A CB  1 
ATOM   367  O  OG1 . THR A 1 87  ? -8.603  -13.334 -31.290 1.00 83.50  ? 87  THR A OG1 1 
ATOM   368  C  CG2 . THR A 1 87  ? -8.867  -15.256 -32.680 1.00 83.51  ? 87  THR A CG2 1 
ATOM   369  N  N   . PRO A 1 88  ? -8.535  -11.502 -35.029 1.00 67.53  ? 88  PRO A N   1 
ATOM   370  C  CA  . PRO A 1 88  ? -8.722  -10.152 -35.572 1.00 68.32  ? 88  PRO A CA  1 
ATOM   371  C  C   . PRO A 1 88  ? -9.780  -9.339  -34.847 1.00 69.71  ? 88  PRO A C   1 
ATOM   372  O  O   . PRO A 1 88  ? -10.794 -9.887  -34.411 1.00 70.49  ? 88  PRO A O   1 
ATOM   373  C  CB  . PRO A 1 88  ? -9.204  -10.423 -36.999 1.00 67.70  ? 88  PRO A CB  1 
ATOM   374  C  CG  . PRO A 1 88  ? -9.902  -11.732 -36.899 1.00 66.30  ? 88  PRO A CG  1 
ATOM   375  C  CD  . PRO A 1 88  ? -9.079  -12.533 -35.929 1.00 66.76  ? 88  PRO A CD  1 
ATOM   376  N  N   . MET A 1 89  ? -9.556  -8.037  -34.743 1.00 90.21  ? 89  MET A N   1 
ATOM   377  C  CA  . MET A 1 89  ? -10.573 -7.137  -34.241 1.00 90.71  ? 89  MET A CA  1 
ATOM   378  C  C   . MET A 1 89  ? -11.259 -6.535  -35.454 1.00 89.35  ? 89  MET A C   1 
ATOM   379  O  O   . MET A 1 89  ? -10.600 -6.167  -36.422 1.00 89.44  ? 89  MET A O   1 
ATOM   380  C  CB  . MET A 1 89  ? -9.939  -6.047  -33.386 1.00 91.92  ? 89  MET A CB  1 
ATOM   381  C  CG  . MET A 1 89  ? -10.934 -5.070  -32.798 1.00 96.36  ? 89  MET A CG  1 
ATOM   382  S  SD  . MET A 1 89  ? -11.699 -5.729  -31.300 1.00 102.64 ? 89  MET A SD  1 
ATOM   383  C  CE  . MET A 1 89  ? -10.251 -6.082  -30.311 1.00 104.62 ? 89  MET A CE  1 
ATOM   384  N  N   . VAL A 1 90  ? -12.580 -6.433  -35.416 1.00 76.40  ? 90  VAL A N   1 
ATOM   385  C  CA  . VAL A 1 90  ? -13.329 -6.025  -36.590 1.00 76.30  ? 90  VAL A CA  1 
ATOM   386  C  C   . VAL A 1 90  ? -14.406 -5.011  -36.258 1.00 76.67  ? 90  VAL A C   1 
ATOM   387  O  O   . VAL A 1 90  ? -15.228 -5.238  -35.369 1.00 74.30  ? 90  VAL A O   1 
ATOM   388  C  CB  . VAL A 1 90  ? -13.997 -7.235  -37.253 1.00 76.17  ? 90  VAL A CB  1 
ATOM   389  C  CG1 . VAL A 1 90  ? -15.002 -6.789  -38.297 1.00 76.97  ? 90  VAL A CG1 1 
ATOM   390  C  CG2 . VAL A 1 90  ? -12.951 -8.138  -37.866 1.00 78.81  ? 90  VAL A CG2 1 
ATOM   391  N  N   . ARG A 1 91  ? -14.409 -3.897  -36.978 1.00 77.52  ? 91  ARG A N   1 
ATOM   392  C  CA  . ARG A 1 91  ? -15.415 -2.873  -36.765 1.00 82.31  ? 91  ARG A CA  1 
ATOM   393  C  C   . ARG A 1 91  ? -16.797 -3.345  -37.182 1.00 84.41  ? 91  ARG A C   1 
ATOM   394  O  O   . ARG A 1 91  ? -16.958 -3.929  -38.254 1.00 84.61  ? 91  ARG A O   1 
ATOM   395  C  CB  . ARG A 1 91  ? -15.060 -1.615  -37.536 1.00 83.02  ? 91  ARG A CB  1 
ATOM   396  C  CG  . ARG A 1 91  ? -16.139 -0.560  -37.477 1.00 87.41  ? 91  ARG A CG  1 
ATOM   397  C  CD  . ARG A 1 91  ? -15.671 0.720   -38.117 1.00 92.96  ? 91  ARG A CD  1 
ATOM   398  N  NE  . ARG A 1 91  ? -14.466 1.232   -37.468 1.00 95.35  ? 91  ARG A NE  1 
ATOM   399  C  CZ  . ARG A 1 91  ? -13.269 1.276   -38.046 1.00 96.49  ? 91  ARG A CZ  1 
ATOM   400  N  NH1 . ARG A 1 91  ? -13.120 0.838   -39.295 1.00 96.87  1 91  ARG A NH1 1 
ATOM   401  N  NH2 . ARG A 1 91  ? -12.224 1.759   -37.381 1.00 96.88  ? 91  ARG A NH2 1 
ATOM   402  N  N   . ILE A 1 92  ? -17.792 -3.078  -36.339 1.00 96.36  ? 92  ILE A N   1 
ATOM   403  C  CA  . ILE A 1 92  ? -19.175 -3.382  -36.665 1.00 98.97  ? 92  ILE A CA  1 
ATOM   404  C  C   . ILE A 1 92  ? -19.814 -2.150  -37.279 1.00 100.26 ? 92  ILE A C   1 
ATOM   405  O  O   . ILE A 1 92  ? -20.033 -1.147  -36.594 1.00 99.14  ? 92  ILE A O   1 
ATOM   406  C  CB  . ILE A 1 92  ? -19.973 -3.740  -35.418 1.00 99.76  ? 92  ILE A CB  1 
ATOM   407  C  CG1 . ILE A 1 92  ? -19.298 -4.883  -34.663 1.00 101.07 ? 92  ILE A CG1 1 
ATOM   408  C  CG2 . ILE A 1 92  ? -21.387 -4.121  -35.804 1.00 101.52 ? 92  ILE A CG2 1 
ATOM   409  C  CD1 . ILE A 1 92  ? -19.357 -6.202  -35.384 1.00 102.35 ? 92  ILE A CD1 1 
ATOM   410  N  N   . ASN A 1 93  ? -20.116 -2.229  -38.568 1.00 97.68  ? 93  ASN A N   1 
ATOM   411  C  CA  . ASN A 1 93  ? -20.568 -1.062  -39.313 1.00 101.02 ? 93  ASN A CA  1 
ATOM   412  C  C   . ASN A 1 93  ? -22.052 -0.743  -39.223 1.00 102.14 ? 93  ASN A C   1 
ATOM   413  O  O   . ASN A 1 93  ? -22.439 0.332   -38.763 1.00 103.20 ? 93  ASN A O   1 
ATOM   414  C  CB  . ASN A 1 93  ? -20.119 -1.159  -40.766 1.00 101.83 ? 93  ASN A CB  1 
ATOM   415  C  CG  . ASN A 1 93  ? -18.649 -1.493  -40.888 1.00 104.03 ? 93  ASN A CG  1 
ATOM   416  O  OD1 . ASN A 1 93  ? -17.787 -0.712  -40.474 1.00 106.20 ? 93  ASN A OD1 1 
ATOM   417  N  ND2 . ASN A 1 93  ? -18.351 -2.662  -41.452 1.00 106.15 ? 93  ASN A ND2 1 
ATOM   418  N  N   . LYS A 1 94  ? -22.879 -1.677  -39.674 1.00 115.65 ? 94  LYS A N   1 
ATOM   419  C  CA  . LYS A 1 94  ? -24.309 -1.432  -39.804 1.00 115.51 ? 94  LYS A CA  1 
ATOM   420  C  C   . LYS A 1 94  ? -25.066 -1.478  -38.479 1.00 113.43 ? 94  LYS A C   1 
ATOM   421  O  O   . LYS A 1 94  ? -25.869 -0.586  -38.175 1.00 111.99 ? 94  LYS A O   1 
ATOM   422  C  CB  . LYS A 1 94  ? -24.925 -2.419  -40.795 1.00 117.11 ? 94  LYS A CB  1 
ATOM   423  C  CG  . LYS A 1 94  ? -24.319 -2.358  -42.187 1.00 124.02 ? 94  LYS A CG  1 
ATOM   424  C  CD  . LYS A 1 94  ? -24.940 -3.399  -43.104 1.00 131.87 ? 94  LYS A CD  1 
ATOM   425  C  CE  . LYS A 1 94  ? -24.362 -3.300  -44.504 1.00 134.36 ? 94  LYS A CE  1 
ATOM   426  N  NZ  . LYS A 1 94  ? -24.990 -4.281  -45.429 1.00 135.61 1 94  LYS A NZ  1 
ATOM   427  N  N   . ILE A 1 95  ? -24.797 -2.507  -37.684 1.00 115.87 ? 95  ILE A N   1 
ATOM   428  C  CA  . ILE A 1 95  ? -25.614 -2.779  -36.507 1.00 115.61 ? 95  ILE A CA  1 
ATOM   429  C  C   . ILE A 1 95  ? -25.456 -1.721  -35.420 1.00 118.83 ? 95  ILE A C   1 
ATOM   430  O  O   . ILE A 1 95  ? -26.439 -1.331  -34.784 1.00 118.44 ? 95  ILE A O   1 
ATOM   431  C  CB  . ILE A 1 95  ? -25.338 -4.180  -35.939 1.00 113.93 ? 95  ILE A CB  1 
ATOM   432  C  CG1 . ILE A 1 95  ? -25.743 -5.235  -36.965 1.00 109.60 ? 95  ILE A CG1 1 
ATOM   433  C  CG2 . ILE A 1 95  ? -26.117 -4.403  -34.659 1.00 110.65 ? 95  ILE A CG2 1 
ATOM   434  C  CD1 . ILE A 1 95  ? -25.728 -6.639  -36.428 1.00 101.17 ? 95  ILE A CD1 1 
ATOM   435  N  N   . GLY A 1 96  ? -24.230 -1.255  -35.211 1.00 121.20 ? 96  GLY A N   1 
ATOM   436  C  CA  . GLY A 1 96  ? -23.986 -0.212  -34.232 1.00 125.82 ? 96  GLY A CA  1 
ATOM   437  C  C   . GLY A 1 96  ? -24.837 1.012   -34.519 1.00 128.16 ? 96  GLY A C   1 
ATOM   438  O  O   . GLY A 1 96  ? -25.446 1.595   -33.620 1.00 129.62 ? 96  GLY A O   1 
ATOM   439  N  N   . LYS A 1 97  ? -24.885 1.392   -35.788 1.00 112.37 ? 97  LYS A N   1 
ATOM   440  C  CA  . LYS A 1 97  ? -25.636 2.561   -36.216 1.00 112.23 ? 97  LYS A CA  1 
ATOM   441  C  C   . LYS A 1 97  ? -27.139 2.309   -36.235 1.00 109.80 ? 97  LYS A C   1 
ATOM   442  O  O   . LYS A 1 97  ? -27.934 3.242   -36.096 1.00 108.89 ? 97  LYS A O   1 
ATOM   443  C  CB  . LYS A 1 97  ? -25.160 2.993   -37.598 1.00 115.46 ? 97  LYS A CB  1 
ATOM   444  C  CG  . LYS A 1 97  ? -23.652 3.107   -37.688 1.00 120.80 ? 97  LYS A CG  1 
ATOM   445  C  CD  . LYS A 1 97  ? -23.216 3.686   -39.019 1.00 125.19 ? 97  LYS A CD  1 
ATOM   446  C  CE  . LYS A 1 97  ? -21.704 3.823   -39.068 1.00 126.21 ? 97  LYS A CE  1 
ATOM   447  N  NZ  . LYS A 1 97  ? -21.193 4.586   -37.894 1.00 126.64 1 97  LYS A NZ  1 
ATOM   448  N  N   . LYS A 1 98  ? -27.527 1.051   -36.411 1.00 117.85 ? 98  LYS A N   1 
ATOM   449  C  CA  . LYS A 1 98  ? -28.942 0.704   -36.469 1.00 117.24 ? 98  LYS A CA  1 
ATOM   450  C  C   . LYS A 1 98  ? -29.648 1.013   -35.149 1.00 118.16 ? 98  LYS A C   1 
ATOM   451  O  O   . LYS A 1 98  ? -30.765 1.530   -35.134 1.00 116.79 ? 98  LYS A O   1 
ATOM   452  C  CB  . LYS A 1 98  ? -29.108 -0.776  -36.811 1.00 116.59 ? 98  LYS A CB  1 
ATOM   453  C  CG  . LYS A 1 98  ? -30.541 -1.220  -37.051 1.00 115.91 ? 98  LYS A CG  1 
ATOM   454  C  CD  . LYS A 1 98  ? -30.596 -2.725  -37.286 1.00 115.43 ? 98  LYS A CD  1 
ATOM   455  C  CE  . LYS A 1 98  ? -31.916 -3.154  -37.918 1.00 115.34 ? 98  LYS A CE  1 
ATOM   456  N  NZ  . LYS A 1 98  ? -33.102 -2.878  -37.053 1.00 115.33 1 98  LYS A NZ  1 
ATOM   457  N  N   . PHE A 1 99  ? -28.982 0.712   -34.042 1.00 124.00 ? 99  PHE A N   1 
ATOM   458  C  CA  . PHE A 1 99  ? -29.593 0.856   -32.726 1.00 126.05 ? 99  PHE A CA  1 
ATOM   459  C  C   . PHE A 1 99  ? -29.306 2.185   -32.045 1.00 125.45 ? 99  PHE A C   1 
ATOM   460  O  O   . PHE A 1 99  ? -29.697 2.398   -30.896 1.00 127.12 ? 99  PHE A O   1 
ATOM   461  C  CB  . PHE A 1 99  ? -29.223 -0.316  -31.824 1.00 127.42 ? 99  PHE A CB  1 
ATOM   462  C  CG  . PHE A 1 99  ? -29.830 -1.607  -32.258 1.00 129.61 ? 99  PHE A CG  1 
ATOM   463  C  CD1 . PHE A 1 99  ? -29.184 -2.414  -33.177 1.00 130.81 ? 99  PHE A CD1 1 
ATOM   464  C  CD2 . PHE A 1 99  ? -31.059 -2.004  -31.768 1.00 130.77 ? 99  PHE A CD2 1 
ATOM   465  C  CE1 . PHE A 1 99  ? -29.746 -3.602  -33.586 1.00 131.12 ? 99  PHE A CE1 1 
ATOM   466  C  CE2 . PHE A 1 99  ? -31.624 -3.190  -32.173 1.00 131.10 ? 99  PHE A CE2 1 
ATOM   467  C  CZ  . PHE A 1 99  ? -30.967 -3.990  -33.084 1.00 131.19 ? 99  PHE A CZ  1 
ATOM   468  N  N   . GLY A 1 100 ? -28.609 3.068   -32.746 1.00 124.82 ? 100 GLY A N   1 
ATOM   469  C  CA  . GLY A 1 100 ? -28.449 4.424   -32.265 1.00 121.83 ? 100 GLY A CA  1 
ATOM   470  C  C   . GLY A 1 100 ? -27.165 4.641   -31.500 1.00 120.31 ? 100 GLY A C   1 
ATOM   471  O  O   . GLY A 1 100 ? -27.032 5.630   -30.779 1.00 119.42 ? 100 GLY A O   1 
ATOM   472  N  N   . LEU A 1 101 ? -26.217 3.721   -31.642 1.00 130.11 ? 101 LEU A N   1 
ATOM   473  C  CA  . LEU A 1 101 ? -24.921 3.901   -31.003 1.00 128.00 ? 101 LEU A CA  1 
ATOM   474  C  C   . LEU A 1 101 ? -24.113 4.937   -31.762 1.00 127.75 ? 101 LEU A C   1 
ATOM   475  O  O   . LEU A 1 101 ? -23.958 4.848   -32.981 1.00 127.84 ? 101 LEU A O   1 
ATOM   476  C  CB  . LEU A 1 101 ? -24.149 2.587   -30.962 1.00 126.36 ? 101 LEU A CB  1 
ATOM   477  C  CG  . LEU A 1 101 ? -24.810 1.440   -30.207 1.00 124.23 ? 101 LEU A CG  1 
ATOM   478  C  CD1 . LEU A 1 101 ? -23.834 0.288   -30.088 1.00 122.84 ? 101 LEU A CD1 1 
ATOM   479  C  CD2 . LEU A 1 101 ? -25.267 1.902   -28.834 1.00 122.83 ? 101 LEU A CD2 1 
ATOM   480  N  N   . LYS A 1 102 ? -23.583 5.913   -31.035 1.00 131.10 ? 102 LYS A N   1 
ATOM   481  C  CA  . LYS A 1 102 ? -22.796 6.968   -31.649 1.00 131.91 ? 102 LYS A CA  1 
ATOM   482  C  C   . LYS A 1 102 ? -21.324 6.603   -31.653 1.00 130.24 ? 102 LYS A C   1 
ATOM   483  O  O   . LYS A 1 102 ? -20.506 7.284   -32.269 1.00 128.00 ? 102 LYS A O   1 
ATOM   484  C  CB  . LYS A 1 102 ? -23.004 8.282   -30.900 1.00 141.97 ? 102 LYS A CB  1 
ATOM   485  C  CG  . LYS A 1 102 ? -24.464 8.659   -30.717 1.00 149.73 ? 102 LYS A CG  1 
ATOM   486  C  CD  . LYS A 1 102 ? -24.616 9.878   -29.820 1.00 155.11 ? 102 LYS A CD  1 
ATOM   487  C  CE  . LYS A 1 102 ? -26.074 10.126  -29.464 1.00 156.10 ? 102 LYS A CE  1 
ATOM   488  N  NZ  . LYS A 1 102 ? -26.948 10.173  -30.670 1.00 156.49 1 102 LYS A NZ  1 
ATOM   489  N  N   . CYS A 1 103 ? -20.991 5.518   -30.968 1.00 153.85 ? 103 CYS A N   1 
ATOM   490  C  CA  . CYS A 1 103 ? -19.597 5.174   -30.749 1.00 156.58 ? 103 CYS A CA  1 
ATOM   491  C  C   . CYS A 1 103 ? -19.096 4.134   -31.734 1.00 155.88 ? 103 CYS A C   1 
ATOM   492  O  O   . CYS A 1 103 ? -19.846 3.637   -32.575 1.00 153.65 ? 103 CYS A O   1 
ATOM   493  C  CB  . CYS A 1 103 ? -19.402 4.669   -29.323 1.00 166.23 ? 103 CYS A CB  1 
ATOM   494  S  SG  . CYS A 1 103 ? -20.396 3.210   -28.947 1.00 171.96 ? 103 CYS A SG  1 
ATOM   495  N  N   . GLU A 1 104 ? -17.818 3.804   -31.613 1.00 134.75 ? 104 GLU A N   1 
ATOM   496  C  CA  . GLU A 1 104 ? -17.208 2.813   -32.476 1.00 135.78 ? 104 GLU A CA  1 
ATOM   497  C  C   . GLU A 1 104 ? -17.366 1.444   -31.845 1.00 135.64 ? 104 GLU A C   1 
ATOM   498  O  O   . GLU A 1 104 ? -16.983 1.228   -30.697 1.00 137.69 ? 104 GLU A O   1 
ATOM   499  C  CB  . GLU A 1 104 ? -15.728 3.123   -32.676 1.00 135.94 ? 104 GLU A CB  1 
ATOM   500  C  CG  . GLU A 1 104 ? -15.010 2.153   -33.600 1.00 136.55 ? 104 GLU A CG  1 
ATOM   501  C  CD  . GLU A 1 104 ? -13.519 2.423   -33.672 1.00 136.88 ? 104 GLU A CD  1 
ATOM   502  O  OE1 . GLU A 1 104 ? -12.897 2.628   -32.607 1.00 136.97 ? 104 GLU A OE1 1 
ATOM   503  O  OE2 . GLU A 1 104 ? -12.972 2.445   -34.795 1.00 137.03 1 104 GLU A OE2 1 
ATOM   504  N  N   . LEU A 1 105 ? -17.943 0.515   -32.591 1.00 109.02 ? 105 LEU A N   1 
ATOM   505  C  CA  . LEU A 1 105 ? -18.182 -0.810  -32.054 1.00 102.88 ? 105 LEU A CA  1 
ATOM   506  C  C   . LEU A 1 105 ? -17.239 -1.820  -32.689 1.00 99.94  ? 105 LEU A C   1 
ATOM   507  O  O   . LEU A 1 105 ? -17.290 -2.061  -33.898 1.00 100.07 ? 105 LEU A O   1 
ATOM   508  C  CB  . LEU A 1 105 ? -19.633 -1.225  -32.282 1.00 101.26 ? 105 LEU A CB  1 
ATOM   509  C  CG  . LEU A 1 105 ? -20.010 -2.597  -31.724 1.00 97.72  ? 105 LEU A CG  1 
ATOM   510  C  CD1 . LEU A 1 105 ? -19.793 -2.639  -30.220 1.00 95.02  ? 105 LEU A CD1 1 
ATOM   511  C  CD2 . LEU A 1 105 ? -21.448 -2.926  -32.072 1.00 95.09  ? 105 LEU A CD2 1 
ATOM   512  N  N   . LEU A 1 106 ? -16.376 -2.409  -31.870 1.00 97.46  ? 106 LEU A N   1 
ATOM   513  C  CA  . LEU A 1 106 ? -15.416 -3.382  -32.356 1.00 93.44  ? 106 LEU A CA  1 
ATOM   514  C  C   . LEU A 1 106 ? -15.770 -4.749  -31.810 1.00 91.03  ? 106 LEU A C   1 
ATOM   515  O  O   . LEU A 1 106 ? -16.323 -4.871  -30.716 1.00 91.03  ? 106 LEU A O   1 
ATOM   516  C  CB  . LEU A 1 106 ? -14.008 -3.017  -31.902 1.00 93.33  ? 106 LEU A CB  1 
ATOM   517  C  CG  . LEU A 1 106 ? -13.530 -1.596  -32.174 1.00 91.83  ? 106 LEU A CG  1 
ATOM   518  C  CD1 . LEU A 1 106 ? -12.097 -1.468  -31.711 1.00 88.05  ? 106 LEU A CD1 1 
ATOM   519  C  CD2 . LEU A 1 106 ? -13.637 -1.276  -33.652 1.00 90.64  ? 106 LEU A CD2 1 
ATOM   520  N  N   . ALA A 1 107 ? -15.425 -5.781  -32.560 1.00 70.12  ? 107 ALA A N   1 
ATOM   521  C  CA  . ALA A 1 107 ? -15.694 -7.139  -32.140 1.00 66.91  ? 107 ALA A CA  1 
ATOM   522  C  C   . ALA A 1 107 ? -14.429 -7.955  -32.258 1.00 66.99  ? 107 ALA A C   1 
ATOM   523  O  O   . ALA A 1 107 ? -13.779 -7.950  -33.299 1.00 65.22  ? 107 ALA A O   1 
ATOM   524  C  CB  . ALA A 1 107 ? -16.780 -7.740  -32.997 1.00 63.38  ? 107 ALA A CB  1 
ATOM   525  N  N   . LYS A 1 108 ? -14.075 -8.667  -31.200 1.00 82.25  ? 108 LYS A N   1 
ATOM   526  C  CA  . LYS A 1 108 ? -12.911 -9.524  -31.256 1.00 85.41  ? 108 LYS A CA  1 
ATOM   527  C  C   . LYS A 1 108 ? -13.425 -10.879 -31.688 1.00 86.71  ? 108 LYS A C   1 
ATOM   528  O  O   . LYS A 1 108 ? -14.131 -11.543 -30.930 1.00 87.95  ? 108 LYS A O   1 
ATOM   529  C  CB  . LYS A 1 108 ? -12.263 -9.619  -29.876 1.00 86.05  ? 108 LYS A CB  1 
ATOM   530  C  CG  . LYS A 1 108 ? -11.077 -10.560 -29.796 1.00 86.59  ? 108 LYS A CG  1 
ATOM   531  C  CD  . LYS A 1 108 ? -9.795  -9.869  -30.227 1.00 84.89  ? 108 LYS A CD  1 
ATOM   532  C  CE  . LYS A 1 108 ? -8.572  -10.665 -29.804 1.00 83.73  ? 108 LYS A CE  1 
ATOM   533  N  NZ  . LYS A 1 108 ? -7.342  -10.120 -30.445 1.00 82.99  1 108 LYS A NZ  1 
ATOM   534  N  N   . CYS A 1 109 ? -13.071 -11.309 -32.896 1.00 85.12  ? 109 CYS A N   1 
ATOM   535  C  CA  . CYS A 1 109 ? -13.688 -12.513 -33.423 1.00 85.00  ? 109 CYS A CA  1 
ATOM   536  C  C   . CYS A 1 109 ? -12.836 -13.720 -33.096 1.00 85.93  ? 109 CYS A C   1 
ATOM   537  O  O   . CYS A 1 109 ? -11.785 -13.936 -33.693 1.00 86.12  ? 109 CYS A O   1 
ATOM   538  C  CB  . CYS A 1 109 ? -13.847 -12.392 -34.932 1.00 84.00  ? 109 CYS A CB  1 
ATOM   539  S  SG  . CYS A 1 109 ? -14.841 -10.972 -35.429 1.00 82.01  ? 109 CYS A SG  1 
ATOM   540  N  N   . GLU A 1 110 ? -13.337 -14.531 -32.175 1.00 76.94  ? 110 GLU A N   1 
ATOM   541  C  CA  . GLU A 1 110 ? -12.562 -15.621 -31.613 1.00 77.47  ? 110 GLU A CA  1 
ATOM   542  C  C   . GLU A 1 110 ? -12.862 -16.943 -32.301 1.00 76.74  ? 110 GLU A C   1 
ATOM   543  O  O   . GLU A 1 110 ? -12.377 -18.000 -31.885 1.00 77.28  ? 110 GLU A O   1 
ATOM   544  C  CB  . GLU A 1 110 ? -12.796 -15.725 -30.107 1.00 77.96  ? 110 GLU A CB  1 
ATOM   545  C  CG  . GLU A 1 110 ? -11.574 -16.191 -29.350 1.00 80.18  ? 110 GLU A CG  1 
ATOM   546  C  CD  . GLU A 1 110 ? -10.540 -15.093 -29.196 1.00 83.62  ? 110 GLU A CD  1 
ATOM   547  O  OE1 . GLU A 1 110 ? -10.887 -13.915 -29.446 1.00 85.69  ? 110 GLU A OE1 1 
ATOM   548  O  OE2 . GLU A 1 110 ? -9.383  -15.406 -28.834 1.00 84.48  1 110 GLU A OE2 1 
ATOM   549  N  N   . PHE A 1 111 ? -13.704 -16.892 -33.323 1.00 79.85  ? 111 PHE A N   1 
ATOM   550  C  CA  . PHE A 1 111 ? -14.096 -18.108 -34.012 1.00 77.58  ? 111 PHE A CA  1 
ATOM   551  C  C   . PHE A 1 111 ? -13.129 -18.427 -35.146 1.00 76.77  ? 111 PHE A C   1 
ATOM   552  O  O   . PHE A 1 111 ? -13.328 -19.381 -35.897 1.00 77.63  ? 111 PHE A O   1 
ATOM   553  C  CB  . PHE A 1 111 ? -15.534 -18.017 -34.510 1.00 76.82  ? 111 PHE A CB  1 
ATOM   554  C  CG  . PHE A 1 111 ? -15.851 -16.742 -35.232 1.00 73.59  ? 111 PHE A CG  1 
ATOM   555  C  CD1 . PHE A 1 111 ? -15.752 -16.666 -36.616 1.00 71.74  ? 111 PHE A CD1 1 
ATOM   556  C  CD2 . PHE A 1 111 ? -16.270 -15.621 -34.528 1.00 70.17  ? 111 PHE A CD2 1 
ATOM   557  C  CE1 . PHE A 1 111 ? -16.056 -15.493 -37.281 1.00 70.00  ? 111 PHE A CE1 1 
ATOM   558  C  CE2 . PHE A 1 111 ? -16.575 -14.450 -35.186 1.00 69.07  ? 111 PHE A CE2 1 
ATOM   559  C  CZ  . PHE A 1 111 ? -16.466 -14.385 -36.566 1.00 69.26  ? 111 PHE A CZ  1 
ATOM   560  N  N   . PHE A 1 112 ? -12.079 -17.623 -35.266 1.00 78.12  ? 112 PHE A N   1 
ATOM   561  C  CA  . PHE A 1 112 ? -11.027 -17.903 -36.228 1.00 76.57  ? 112 PHE A CA  1 
ATOM   562  C  C   . PHE A 1 112 ? -9.939  -18.775 -35.652 1.00 76.71  ? 112 PHE A C   1 
ATOM   563  O  O   . PHE A 1 112 ? -8.968  -19.112 -36.331 1.00 75.27  ? 112 PHE A O   1 
ATOM   564  C  CB  . PHE A 1 112 ? -10.431 -16.610 -36.742 1.00 75.70  ? 112 PHE A CB  1 
ATOM   565  C  CG  . PHE A 1 112 ? -11.361 -15.851 -37.604 1.00 75.61  ? 112 PHE A CG  1 
ATOM   566  C  CD1 . PHE A 1 112 ? -12.054 -14.765 -37.110 1.00 76.83  ? 112 PHE A CD1 1 
ATOM   567  C  CD2 . PHE A 1 112 ? -11.576 -16.251 -38.908 1.00 76.04  ? 112 PHE A CD2 1 
ATOM   568  C  CE1 . PHE A 1 112 ? -12.923 -14.074 -37.915 1.00 78.03  ? 112 PHE A CE1 1 
ATOM   569  C  CE2 . PHE A 1 112 ? -12.446 -15.566 -39.712 1.00 77.19  ? 112 PHE A CE2 1 
ATOM   570  C  CZ  . PHE A 1 112 ? -13.120 -14.476 -39.217 1.00 78.21  ? 112 PHE A CZ  1 
ATOM   571  N  N   . ASN A 1 113 ? -10.102 -19.143 -34.392 1.00 73.54  ? 113 ASN A N   1 
ATOM   572  C  CA  . ASN A 1 113 ? -9.174  -20.062 -33.760 1.00 75.90  ? 113 ASN A CA  1 
ATOM   573  C  C   . ASN A 1 113 ? -9.317  -21.427 -34.393 1.00 75.17  ? 113 ASN A C   1 
ATOM   574  O  O   . ASN A 1 113 ? -10.312 -21.692 -35.080 1.00 75.21  ? 113 ASN A O   1 
ATOM   575  C  CB  . ASN A 1 113 ? -9.424  -20.141 -32.263 1.00 78.04  ? 113 ASN A CB  1 
ATOM   576  C  CG  . ASN A 1 113 ? -8.983  -18.894 -31.544 1.00 83.36  ? 113 ASN A CG  1 
ATOM   577  O  OD1 . ASN A 1 113 ? -8.004  -18.253 -31.933 1.00 88.82  ? 113 ASN A OD1 1 
ATOM   578  N  ND2 . ASN A 1 113 ? -9.701  -18.536 -30.489 1.00 88.59  ? 113 ASN A ND2 1 
ATOM   579  N  N   . ALA A 1 114 ? -8.302  -22.264 -34.193 1.00 76.81  ? 114 ALA A N   1 
ATOM   580  C  CA  . ALA A 1 114 ? -8.277  -23.609 -34.747 1.00 75.91  ? 114 ALA A CA  1 
ATOM   581  C  C   . ALA A 1 114 ? -9.613  -24.307 -34.540 1.00 75.43  ? 114 ALA A C   1 
ATOM   582  O  O   . ALA A 1 114 ? -10.316 -24.623 -35.507 1.00 76.88  ? 114 ALA A O   1 
ATOM   583  C  CB  . ALA A 1 114 ? -7.164  -24.417 -34.121 1.00 74.33  ? 114 ALA A CB  1 
ATOM   584  N  N   . GLY A 1 115 ? -9.967  -24.549 -33.284 1.00 91.65  ? 115 GLY A N   1 
ATOM   585  C  CA  . GLY A 1 115 ? -11.226 -25.200 -32.979 1.00 89.53  ? 115 GLY A CA  1 
ATOM   586  C  C   . GLY A 1 115 ? -12.426 -24.328 -33.311 1.00 88.21  ? 115 GLY A C   1 
ATOM   587  O  O   . GLY A 1 115 ? -13.543 -24.819 -33.421 1.00 88.03  ? 115 GLY A O   1 
ATOM   588  N  N   . GLY A 1 116 ? -12.202 -23.025 -33.463 1.00 83.31  ? 116 GLY A N   1 
ATOM   589  C  CA  . GLY A 1 116 ? -13.284 -22.142 -33.852 1.00 82.31  ? 116 GLY A CA  1 
ATOM   590  C  C   . GLY A 1 116 ? -14.027 -21.601 -32.656 1.00 82.25  ? 116 GLY A C   1 
ATOM   591  O  O   . GLY A 1 116 ? -15.140 -21.079 -32.800 1.00 81.04  ? 116 GLY A O   1 
ATOM   592  N  N   . SER A 1 117 ? -13.441 -21.730 -31.468 1.00 76.07  ? 117 SER A N   1 
ATOM   593  C  CA  . SER A 1 117 ? -14.013 -21.146 -30.265 1.00 75.37  ? 117 SER A CA  1 
ATOM   594  C  C   . SER A 1 117 ? -12.948 -20.504 -29.405 1.00 77.05  ? 117 SER A C   1 
ATOM   595  O  O   . SER A 1 117 ? -11.754 -20.760 -29.585 1.00 72.00  ? 117 SER A O   1 
ATOM   596  C  CB  . SER A 1 117 ? -14.796 -22.180 -29.461 1.00 73.69  ? 117 SER A CB  1 
ATOM   597  O  OG  . SER A 1 117 ? -13.911 -23.092 -28.825 1.00 83.82  ? 117 SER A OG  1 
ATOM   598  N  N   . VAL A 1 118 ? -13.380 -19.702 -28.440 1.00 59.60  ? 118 VAL A N   1 
ATOM   599  C  CA  . VAL A 1 118 ? -12.442 -19.023 -27.554 1.00 55.18  ? 118 VAL A CA  1 
ATOM   600  C  C   . VAL A 1 118 ? -11.777 -20.048 -26.639 1.00 54.53  ? 118 VAL A C   1 
ATOM   601  O  O   . VAL A 1 118 ? -10.634 -19.868 -26.180 1.00 56.19  ? 118 VAL A O   1 
ATOM   602  C  CB  . VAL A 1 118 ? -13.204 -17.963 -26.715 1.00 58.92  ? 118 VAL A CB  1 
ATOM   603  C  CG1 . VAL A 1 118 ? -14.356 -18.605 -25.972 1.00 64.55  ? 118 VAL A CG1 1 
ATOM   604  C  CG2 . VAL A 1 118 ? -12.278 -17.248 -25.771 1.00 58.41  ? 118 VAL A CG2 1 
ATOM   605  N  N   . LYS A 1 119 ? -12.450 -21.180 -26.471 1.00 74.71  ? 119 LYS A N   1 
ATOM   606  C  CA  . LYS A 1 119 ? -11.989 -22.189 -25.542 1.00 80.01  ? 119 LYS A CA  1 
ATOM   607  C  C   . LYS A 1 119 ? -10.675 -22.809 -25.976 1.00 79.61  ? 119 LYS A C   1 
ATOM   608  O  O   . LYS A 1 119 ? -9.885  -23.255 -25.130 1.00 75.69  ? 119 LYS A O   1 
ATOM   609  C  CB  . LYS A 1 119 ? -13.043 -23.272 -25.439 1.00 83.79  ? 119 LYS A CB  1 
ATOM   610  C  CG  . LYS A 1 119 ? -14.283 -22.787 -24.760 1.00 83.23  ? 119 LYS A CG  1 
ATOM   611  C  CD  . LYS A 1 119 ? -13.967 -22.333 -23.365 1.00 79.46  ? 119 LYS A CD  1 
ATOM   612  C  CE  . LYS A 1 119 ? -15.245 -22.170 -22.583 1.00 77.21  ? 119 LYS A CE  1 
ATOM   613  N  NZ  . LYS A 1 119 ? -15.944 -20.997 -23.133 1.00 83.20  1 119 LYS A NZ  1 
ATOM   614  N  N   . ASP A 1 120 ? -10.393 -22.741 -27.276 1.00 80.99  ? 120 ASP A N   1 
ATOM   615  C  CA  . ASP A 1 120 ? -9.146  -23.290 -27.797 1.00 82.37  ? 120 ASP A CA  1 
ATOM   616  C  C   . ASP A 1 120 ? -7.988  -22.646 -27.070 1.00 84.35  ? 120 ASP A C   1 
ATOM   617  O  O   . ASP A 1 120 ? -6.938  -23.279 -26.891 1.00 83.15  ? 120 ASP A O   1 
ATOM   618  C  CB  . ASP A 1 120 ? -9.013  -23.032 -29.302 1.00 90.16  ? 120 ASP A CB  1 
ATOM   619  C  CG  . ASP A 1 120 ? -10.165 -23.604 -30.105 1.00 90.75  ? 120 ASP A CG  1 
ATOM   620  O  OD1 . ASP A 1 120 ? -10.919 -24.464 -29.579 1.00 98.23  ? 120 ASP A OD1 1 
ATOM   621  O  OD2 . ASP A 1 120 ? -10.317 -23.189 -31.268 1.00 99.84  1 120 ASP A OD2 1 
ATOM   622  N  N   . ARG A 1 121 ? -8.140  -21.385 -26.665 1.00 63.78  ? 121 ARG A N   1 
ATOM   623  C  CA  . ARG A 1 121 ? -7.063  -20.768 -25.922 1.00 59.12  ? 121 ARG A CA  1 
ATOM   624  C  C   . ARG A 1 121 ? -6.817  -21.544 -24.639 1.00 61.54  ? 121 ARG A C   1 
ATOM   625  O  O   . ARG A 1 121 ? -5.757  -22.162 -24.432 1.00 68.35  ? 121 ARG A O   1 
ATOM   626  C  CB  . ARG A 1 121 ? -7.376  -19.318 -25.565 1.00 71.31  ? 121 ARG A CB  1 
ATOM   627  C  CG  . ARG A 1 121 ? -7.264  -18.344 -26.709 1.00 70.45  ? 121 ARG A CG  1 
ATOM   628  C  CD  . ARG A 1 121 ? -7.657  -16.959 -26.222 1.00 75.07  ? 121 ARG A CD  1 
ATOM   629  N  NE  . ARG A 1 121 ? -7.773  -15.985 -27.306 1.00 76.29  ? 121 ARG A NE  1 
ATOM   630  C  CZ  . ARG A 1 121 ? -6.800  -15.161 -27.684 1.00 74.58  ? 121 ARG A CZ  1 
ATOM   631  N  NH1 . ARG A 1 121 ? -5.629  -15.185 -27.056 1.00 75.63  1 121 ARG A NH1 1 
ATOM   632  N  NH2 . ARG A 1 121 ? -7.002  -14.300 -28.680 1.00 83.97  ? 121 ARG A NH2 1 
ATOM   633  N  N   . ILE A 1 122 ? -7.844  -21.572 -23.798 1.00 71.86  ? 122 ILE A N   1 
ATOM   634  C  CA  . ILE A 1 122 ? -7.647  -22.075 -22.457 1.00 72.17  ? 122 ILE A CA  1 
ATOM   635  C  C   . ILE A 1 122 ? -7.341  -23.554 -22.460 1.00 73.57  ? 122 ILE A C   1 
ATOM   636  O  O   . ILE A 1 122 ? -6.760  -24.065 -21.515 1.00 73.69  ? 122 ILE A O   1 
ATOM   637  C  CB  . ILE A 1 122 ? -8.799  -21.716 -21.547 1.00 71.64  ? 122 ILE A CB  1 
ATOM   638  C  CG1 . ILE A 1 122 ? -10.065 -22.413 -22.018 1.00 70.39  ? 122 ILE A CG1 1 
ATOM   639  C  CG2 . ILE A 1 122 ? -9.026  -20.236 -21.612 1.00 69.71  ? 122 ILE A CG2 1 
ATOM   640  C  CD1 . ILE A 1 122 ? -10.453 -23.559 -21.159 1.00 69.14  ? 122 ILE A CD1 1 
ATOM   641  N  N   . SER A 1 123 ? -7.715  -24.234 -23.532 1.00 73.83  ? 123 SER A N   1 
ATOM   642  C  CA  . SER A 1 123 ? -7.404  -25.642 -23.615 1.00 74.97  ? 123 SER A CA  1 
ATOM   643  C  C   . SER A 1 123 ? -5.902  -25.728 -23.662 1.00 76.26  ? 123 SER A C   1 
ATOM   644  O  O   . SER A 1 123 ? -5.270  -26.302 -22.762 1.00 78.84  ? 123 SER A O   1 
ATOM   645  C  CB  . SER A 1 123 ? -7.986  -26.248 -24.882 1.00 72.13  ? 123 SER A CB  1 
ATOM   646  O  OG  . SER A 1 123 ? -9.397  -26.226 -24.833 1.00 68.73  ? 123 SER A OG  1 
ATOM   647  N  N   . LEU A 1 124 ? -5.331  -25.064 -24.661 1.00 77.52  ? 124 LEU A N   1 
ATOM   648  C  CA  . LEU A 1 124 ? -3.922  -25.235 -24.954 1.00 75.55  ? 124 LEU A CA  1 
ATOM   649  C  C   . LEU A 1 124 ? -3.140  -24.918 -23.704 1.00 74.53  ? 124 LEU A C   1 
ATOM   650  O  O   . LEU A 1 124 ? -2.410  -25.771 -23.180 1.00 75.46  ? 124 LEU A O   1 
ATOM   651  C  CB  . LEU A 1 124 ? -3.486  -24.325 -26.094 1.00 75.40  ? 124 LEU A CB  1 
ATOM   652  C  CG  . LEU A 1 124 ? -2.018  -24.474 -26.478 1.00 72.01  ? 124 LEU A CG  1 
ATOM   653  C  CD1 . LEU A 1 124 ? -1.735  -25.909 -26.895 1.00 66.67  ? 124 LEU A CD1 1 
ATOM   654  C  CD2 . LEU A 1 124 ? -1.680  -23.514 -27.593 1.00 68.58  ? 124 LEU A CD2 1 
ATOM   655  N  N   . ARG A 1 125 ? -3.375  -23.715 -23.191 1.00 72.51  ? 125 ARG A N   1 
ATOM   656  C  CA  . ARG A 1 125 ? -2.704  -23.242 -21.991 1.00 70.89  ? 125 ARG A CA  1 
ATOM   657  C  C   . ARG A 1 125 ? -2.800  -24.279 -20.894 1.00 69.54  ? 125 ARG A C   1 
ATOM   658  O  O   . ARG A 1 125 ? -1.778  -24.708 -20.351 1.00 66.57  ? 125 ARG A O   1 
ATOM   659  C  CB  . ARG A 1 125 ? -3.318  -21.933 -21.508 1.00 71.94  ? 125 ARG A CB  1 
ATOM   660  C  CG  . ARG A 1 125 ? -2.655  -21.338 -20.282 1.00 76.05  ? 125 ARG A CG  1 
ATOM   661  C  CD  . ARG A 1 125 ? -1.207  -20.940 -20.527 1.00 83.63  ? 125 ARG A CD  1 
ATOM   662  N  NE  . ARG A 1 125 ? -0.641  -20.279 -19.350 1.00 89.62  ? 125 ARG A NE  1 
ATOM   663  C  CZ  . ARG A 1 125 ? -0.601  -18.959 -19.178 1.00 91.34  ? 125 ARG A CZ  1 
ATOM   664  N  NH1 . ARG A 1 125 ? -1.083  -18.147 -20.116 1.00 91.09  1 125 ARG A NH1 1 
ATOM   665  N  NH2 . ARG A 1 125 ? -0.069  -18.445 -18.073 1.00 92.68  ? 125 ARG A NH2 1 
ATOM   666  N  N   . MET A 1 126 ? -4.021  -24.712 -20.603 1.00 75.73  ? 126 MET A N   1 
ATOM   667  C  CA  . MET A 1 126 ? -4.225  -25.590 -19.464 1.00 78.79  ? 126 MET A CA  1 
ATOM   668  C  C   . MET A 1 126 ? -3.355  -26.812 -19.602 1.00 78.32  ? 126 MET A C   1 
ATOM   669  O  O   . MET A 1 126 ? -2.772  -27.280 -18.626 1.00 78.27  ? 126 MET A O   1 
ATOM   670  C  CB  . MET A 1 126 ? -5.685  -25.985 -19.315 1.00 80.43  ? 126 MET A CB  1 
ATOM   671  C  CG  . MET A 1 126 ? -6.531  -24.897 -18.693 1.00 88.15  ? 126 MET A CG  1 
ATOM   672  S  SD  . MET A 1 126 ? -8.292  -25.237 -18.872 1.00 97.89  ? 126 MET A SD  1 
ATOM   673  C  CE  . MET A 1 126 ? -8.511  -26.308 -17.472 1.00 97.83  ? 126 MET A CE  1 
ATOM   674  N  N   . ILE A 1 127 ? -3.224  -27.299 -20.827 1.00 74.29  ? 127 ILE A N   1 
ATOM   675  C  CA  . ILE A 1 127 ? -2.432  -28.489 -21.047 1.00 73.73  ? 127 ILE A CA  1 
ATOM   676  C  C   . ILE A 1 127 ? -0.953  -28.180 -20.872 1.00 75.31  ? 127 ILE A C   1 
ATOM   677  O  O   . ILE A 1 127 ? -0.236  -28.915 -20.182 1.00 75.81  ? 127 ILE A O   1 
ATOM   678  C  CB  . ILE A 1 127 ? -2.700  -29.114 -22.411 1.00 72.90  ? 127 ILE A CB  1 
ATOM   679  C  CG1 . ILE A 1 127 ? -4.167  -29.517 -22.509 1.00 69.13  ? 127 ILE A CG1 1 
ATOM   680  C  CG2 . ILE A 1 127 ? -1.831  -30.340 -22.606 1.00 70.53  ? 127 ILE A CG2 1 
ATOM   681  C  CD1 . ILE A 1 127 ? -4.475  -30.360 -23.717 1.00 61.59  ? 127 ILE A CD1 1 
ATOM   682  N  N   . GLU A 1 128 ? -0.499  -27.089 -21.485 1.00 82.75  ? 128 GLU A N   1 
ATOM   683  C  CA  . GLU A 1 128 ? 0.921   -26.765 -21.454 1.00 84.88  ? 128 GLU A CA  1 
ATOM   684  C  C   . GLU A 1 128 ? 1.401   -26.565 -20.028 1.00 84.20  ? 128 GLU A C   1 
ATOM   685  O  O   . GLU A 1 128 ? 2.423   -27.136 -19.623 1.00 83.29  ? 128 GLU A O   1 
ATOM   686  C  CB  . GLU A 1 128 ? 1.222   -25.540 -22.301 1.00 86.09  ? 128 GLU A CB  1 
ATOM   687  C  CG  . GLU A 1 128 ? 0.976   -25.775 -23.771 1.00 94.98  ? 128 GLU A CG  1 
ATOM   688  C  CD  . GLU A 1 128 ? 1.508   -24.649 -24.629 1.00 106.14 ? 128 GLU A CD  1 
ATOM   689  O  OE1 . GLU A 1 128 ? 1.961   -24.930 -25.761 1.00 109.23 ? 128 GLU A OE1 1 
ATOM   690  O  OE2 . GLU A 1 128 ? 1.472   -23.484 -24.169 1.00 110.35 1 128 GLU A OE2 1 
ATOM   691  N  N   . ASP A 1 129 ? 0.658   -25.767 -19.268 1.00 66.43  ? 129 ASP A N   1 
ATOM   692  C  CA  . ASP A 1 129 ? 0.951   -25.605 -17.851 1.00 67.75  ? 129 ASP A CA  1 
ATOM   693  C  C   . ASP A 1 129 ? 0.991   -26.970 -17.194 1.00 64.64  ? 129 ASP A C   1 
ATOM   694  O  O   . ASP A 1 129 ? 1.936   -27.294 -16.475 1.00 63.16  ? 129 ASP A O   1 
ATOM   695  C  CB  . ASP A 1 129 ? -0.082  -24.715 -17.164 1.00 72.59  ? 129 ASP A CB  1 
ATOM   696  C  CG  . ASP A 1 129 ? 0.122   -23.244 -17.473 1.00 82.44  ? 129 ASP A CG  1 
ATOM   697  O  OD1 . ASP A 1 129 ? -0.848  -22.464 -17.350 1.00 92.24  ? 129 ASP A OD1 1 
ATOM   698  O  OD2 . ASP A 1 129 ? 1.260   -22.867 -17.844 1.00 93.23  1 129 ASP A OD2 1 
ATOM   699  N  N   . ALA A 1 130 ? -0.003  -27.795 -17.493 1.00 51.06  ? 130 ALA A N   1 
ATOM   700  C  CA  . ALA A 1 130 ? -0.085  -29.121 -16.890 1.00 52.79  ? 130 ALA A CA  1 
ATOM   701  C  C   . ALA A 1 130 ? 1.122   -29.981 -17.237 1.00 57.59  ? 130 ALA A C   1 
ATOM   702  O  O   . ALA A 1 130 ? 1.443   -30.925 -16.516 1.00 54.43  ? 130 ALA A O   1 
ATOM   703  C  CB  . ALA A 1 130 ? -1.360  -29.826 -17.308 1.00 48.82  ? 130 ALA A CB  1 
ATOM   704  N  N   . GLU A 1 131 ? 1.765   -29.676 -18.359 1.00 71.15  ? 131 GLU A N   1 
ATOM   705  C  CA  . GLU A 1 131 ? 2.949   -30.411 -18.771 1.00 79.90  ? 131 GLU A CA  1 
ATOM   706  C  C   . GLU A 1 131 ? 4.174   -29.938 -18.011 1.00 84.94  ? 131 GLU A C   1 
ATOM   707  O  O   . GLU A 1 131 ? 5.060   -30.732 -17.694 1.00 87.50  ? 131 GLU A O   1 
ATOM   708  C  CB  . GLU A 1 131 ? 3.167   -30.270 -20.275 1.00 78.52  ? 131 GLU A CB  1 
ATOM   709  C  CG  . GLU A 1 131 ? 2.102   -30.944 -21.118 1.00 80.26  ? 131 GLU A CG  1 
ATOM   710  C  CD  . GLU A 1 131 ? 2.115   -30.463 -22.564 1.00 82.72  ? 131 GLU A CD  1 
ATOM   711  O  OE1 . GLU A 1 131 ? 1.632   -31.209 -23.451 1.00 83.76  ? 131 GLU A OE1 1 
ATOM   712  O  OE2 . GLU A 1 131 ? 2.607   -29.336 -22.813 1.00 83.79  1 131 GLU A OE2 1 
ATOM   713  N  N   . ARG A 1 132 ? 4.215   -28.645 -17.706 1.00 112.83 ? 132 ARG A N   1 
ATOM   714  C  CA  . ARG A 1 132 ? 5.349   -28.075 -16.991 1.00 118.51 ? 132 ARG A CA  1 
ATOM   715  C  C   . ARG A 1 132 ? 5.404   -28.588 -15.564 1.00 121.95 ? 132 ARG A C   1 
ATOM   716  O  O   . ARG A 1 132 ? 6.475   -28.906 -15.044 1.00 123.08 ? 132 ARG A O   1 
ATOM   717  C  CB  . ARG A 1 132 ? 5.286   -26.552 -17.013 1.00 118.22 ? 132 ARG A CB  1 
ATOM   718  C  CG  . ARG A 1 132 ? 5.409   -25.989 -18.405 1.00 119.85 ? 132 ARG A CG  1 
ATOM   719  C  CD  . ARG A 1 132 ? 5.408   -24.478 -18.411 1.00 121.26 ? 132 ARG A CD  1 
ATOM   720  N  NE  . ARG A 1 132 ? 5.474   -23.972 -19.779 1.00 121.99 ? 132 ARG A NE  1 
ATOM   721  C  CZ  . ARG A 1 132 ? 4.411   -23.640 -20.505 1.00 122.33 ? 132 ARG A CZ  1 
ATOM   722  N  NH1 . ARG A 1 132 ? 3.189   -23.760 -19.994 1.00 122.46 1 132 ARG A NH1 1 
ATOM   723  N  NH2 . ARG A 1 132 ? 4.569   -23.193 -21.747 1.00 122.43 ? 132 ARG A NH2 1 
ATOM   724  N  N   . ASP A 1 133 ? 4.234   -28.670 -14.943 1.00 95.59  ? 133 ASP A N   1 
ATOM   725  C  CA  . ASP A 1 133 ? 4.108   -29.132 -13.571 1.00 96.14  ? 133 ASP A CA  1 
ATOM   726  C  C   . ASP A 1 133 ? 4.494   -30.594 -13.432 1.00 94.74  ? 133 ASP A C   1 
ATOM   727  O  O   . ASP A 1 133 ? 4.711   -31.086 -12.322 1.00 96.15  ? 133 ASP A O   1 
ATOM   728  C  CB  . ASP A 1 133 ? 2.671   -28.951 -13.101 1.00 97.83  ? 133 ASP A CB  1 
ATOM   729  C  CG  . ASP A 1 133 ? 2.237   -27.507 -13.129 1.00 98.47  ? 133 ASP A CG  1 
ATOM   730  O  OD1 . ASP A 1 133 ? 3.125   -26.625 -13.181 1.00 97.70  ? 133 ASP A OD1 1 
ATOM   731  O  OD2 . ASP A 1 133 ? 1.016   -27.251 -13.095 1.00 98.85  1 133 ASP A OD2 1 
ATOM   732  N  N   . GLY A 1 134 ? 4.559   -31.295 -14.558 1.00 80.62  ? 134 GLY A N   1 
ATOM   733  C  CA  . GLY A 1 134 ? 4.856   -32.712 -14.548 1.00 76.77  ? 134 GLY A CA  1 
ATOM   734  C  C   . GLY A 1 134 ? 3.623   -33.507 -14.177 1.00 74.63  ? 134 GLY A C   1 
ATOM   735  O  O   . GLY A 1 134 ? 3.658   -34.739 -14.113 1.00 74.48  ? 134 GLY A O   1 
ATOM   736  N  N   . THR A 1 135 ? 2.525   -32.798 -13.937 1.00 83.82  ? 135 THR A N   1 
ATOM   737  C  CA  . THR A 1 135 ? 1.266   -33.434 -13.590 1.00 81.82  ? 135 THR A CA  1 
ATOM   738  C  C   . THR A 1 135 ? 0.739   -34.308 -14.715 1.00 79.45  ? 135 THR A C   1 
ATOM   739  O  O   . THR A 1 135 ? 0.241   -35.408 -14.476 1.00 80.25  ? 135 THR A O   1 
ATOM   740  C  CB  . THR A 1 135 ? 0.201   -32.385 -13.257 1.00 82.58  ? 135 THR A CB  1 
ATOM   741  O  OG1 . THR A 1 135 ? 0.350   -31.264 -14.137 1.00 82.63  ? 135 THR A OG1 1 
ATOM   742  C  CG2 . THR A 1 135 ? 0.361   -31.913 -11.826 1.00 83.26  ? 135 THR A CG2 1 
ATOM   743  N  N   . LEU A 1 136 ? 0.884   -33.828 -15.946 1.00 85.25  ? 136 LEU A N   1 
ATOM   744  C  CA  . LEU A 1 136 ? 0.358   -34.526 -17.109 1.00 82.80  ? 136 LEU A CA  1 
ATOM   745  C  C   . LEU A 1 136 ? 1.452   -35.169 -17.937 1.00 85.91  ? 136 LEU A C   1 
ATOM   746  O  O   . LEU A 1 136 ? 2.219   -34.488 -18.622 1.00 84.44  ? 136 LEU A O   1 
ATOM   747  C  CB  . LEU A 1 136 ? -0.414  -33.545 -17.982 1.00 78.74  ? 136 LEU A CB  1 
ATOM   748  C  CG  . LEU A 1 136 ? -0.985  -34.067 -19.297 1.00 71.75  ? 136 LEU A CG  1 
ATOM   749  C  CD1 . LEU A 1 136 ? -1.898  -35.265 -19.073 1.00 67.32  ? 136 LEU A CD1 1 
ATOM   750  C  CD2 . LEU A 1 136 ? -1.731  -32.936 -19.970 1.00 65.51  ? 136 LEU A CD2 1 
ATOM   751  N  N   . LYS A 1 137 ? 1.514   -36.491 -17.866 1.00 130.89 ? 137 LYS A N   1 
ATOM   752  C  CA  . LYS A 1 137 ? 2.458   -37.265 -18.647 1.00 138.75 ? 137 LYS A CA  1 
ATOM   753  C  C   . LYS A 1 137 ? 1.834   -37.691 -19.967 1.00 145.81 ? 137 LYS A C   1 
ATOM   754  O  O   . LYS A 1 137 ? 0.631   -37.918 -20.041 1.00 142.94 ? 137 LYS A O   1 
ATOM   755  C  CB  . LYS A 1 137 ? 2.908   -38.473 -17.836 1.00 138.39 ? 137 LYS A CB  1 
ATOM   756  C  CG  . LYS A 1 137 ? 3.551   -38.075 -16.516 1.00 141.84 ? 137 LYS A CG  1 
ATOM   757  C  CD  . LYS A 1 137 ? 3.429   -39.174 -15.475 1.00 145.50 ? 137 LYS A CD  1 
ATOM   758  C  CE  . LYS A 1 137 ? 2.018   -39.227 -14.896 1.00 146.74 ? 137 LYS A CE  1 
ATOM   759  N  NZ  . LYS A 1 137 ? 1.754   -38.107 -13.943 1.00 147.31 1 137 LYS A NZ  1 
ATOM   760  N  N   . PRO A 1 138 ? 2.647   -37.781 -21.024 1.00 105.83 ? 138 PRO A N   1 
ATOM   761  C  CA  . PRO A 1 138 ? 2.151   -38.274 -22.312 1.00 108.48 ? 138 PRO A CA  1 
ATOM   762  C  C   . PRO A 1 138 ? 1.600   -39.689 -22.199 1.00 105.92 ? 138 PRO A C   1 
ATOM   763  O  O   . PRO A 1 138 ? 2.188   -40.538 -21.523 1.00 109.36 ? 138 PRO A O   1 
ATOM   764  C  CB  . PRO A 1 138 ? 3.398   -38.260 -23.191 1.00 112.44 ? 138 PRO A CB  1 
ATOM   765  C  CG  . PRO A 1 138 ? 4.228   -37.176 -22.611 1.00 113.78 ? 138 PRO A CG  1 
ATOM   766  C  CD  . PRO A 1 138 ? 4.016   -37.255 -21.129 1.00 110.45 ? 138 PRO A CD  1 
ATOM   767  N  N   . GLY A 1 139 ? 0.469   -39.929 -22.851 1.00 131.94 ? 139 GLY A N   1 
ATOM   768  C  CA  . GLY A 1 139 ? -0.165  -41.229 -22.811 1.00 123.47 ? 139 GLY A CA  1 
ATOM   769  C  C   . GLY A 1 139 ? -1.128  -41.293 -21.648 1.00 119.00 ? 139 GLY A C   1 
ATOM   770  O  O   . GLY A 1 139 ? -1.575  -42.370 -21.249 1.00 118.09 ? 139 GLY A O   1 
ATOM   771  N  N   . ASP A 1 140 ? -1.469  -40.121 -21.119 1.00 94.13  ? 140 ASP A N   1 
ATOM   772  C  CA  . ASP A 1 140 ? -2.398  -40.030 -20.002 1.00 91.63  ? 140 ASP A CA  1 
ATOM   773  C  C   . ASP A 1 140 ? -3.744  -39.561 -20.495 1.00 85.85  ? 140 ASP A C   1 
ATOM   774  O  O   . ASP A 1 140 ? -3.845  -38.789 -21.448 1.00 85.06  ? 140 ASP A O   1 
ATOM   775  C  CB  . ASP A 1 140 ? -1.897  -39.076 -18.915 1.00 95.51  ? 140 ASP A CB  1 
ATOM   776  C  CG  . ASP A 1 140 ? -0.808  -39.684 -18.053 1.00 104.93 ? 140 ASP A CG  1 
ATOM   777  O  OD1 . ASP A 1 140 ? -0.673  -40.928 -18.040 1.00 113.75 ? 140 ASP A OD1 1 
ATOM   778  O  OD2 . ASP A 1 140 ? -0.086  -38.911 -17.388 1.00 113.71 1 140 ASP A OD2 1 
ATOM   779  N  N   . THR A 1 141 ? -4.780  -40.052 -19.834 1.00 73.89  ? 141 THR A N   1 
ATOM   780  C  CA  . THR A 1 141 ? -6.144  -39.704 -20.168 1.00 70.52  ? 141 THR A CA  1 
ATOM   781  C  C   . THR A 1 141 ? -6.541  -38.358 -19.579 1.00 68.35  ? 141 THR A C   1 
ATOM   782  O  O   . THR A 1 141 ? -6.231  -38.049 -18.432 1.00 64.83  ? 141 THR A O   1 
ATOM   783  C  CB  . THR A 1 141 ? -7.098  -40.764 -19.642 1.00 70.95  ? 141 THR A CB  1 
ATOM   784  O  OG1 . THR A 1 141 ? -6.719  -42.041 -20.168 1.00 73.32  ? 141 THR A OG1 1 
ATOM   785  C  CG2 . THR A 1 141 ? -8.516  -40.443 -20.050 1.00 72.31  ? 141 THR A CG2 1 
ATOM   786  N  N   . ILE A 1 142 ? -7.217  -37.556 -20.380 1.00 77.25  ? 142 ILE A N   1 
ATOM   787  C  CA  . ILE A 1 142 ? -7.775  -36.305 -19.934 1.00 78.85  ? 142 ILE A CA  1 
ATOM   788  C  C   . ILE A 1 142 ? -9.286  -36.474 -19.884 1.00 75.20  ? 142 ILE A C   1 
ATOM   789  O  O   . ILE A 1 142 ? -9.885  -37.114 -20.753 1.00 76.87  ? 142 ILE A O   1 
ATOM   790  C  CB  . ILE A 1 142 ? -7.429  -35.176 -20.899 1.00 81.45  ? 142 ILE A CB  1 
ATOM   791  C  CG1 . ILE A 1 142 ? -5.998  -34.719 -20.675 1.00 86.38  ? 142 ILE A CG1 1 
ATOM   792  C  CG2 . ILE A 1 142 ? -8.336  -33.984 -20.692 1.00 85.51  ? 142 ILE A CG2 1 
ATOM   793  C  CD1 . ILE A 1 142 ? -5.605  -33.592 -21.587 1.00 93.34  ? 142 ILE A CD1 1 
ATOM   794  N  N   . ILE A 1 143 ? -9.899  -35.931 -18.843 1.00 79.14  ? 143 ILE A N   1 
ATOM   795  C  CA  . ILE A 1 143 ? -11.340 -35.937 -18.731 1.00 73.03  ? 143 ILE A CA  1 
ATOM   796  C  C   . ILE A 1 143 ? -11.807 -34.519 -18.496 1.00 72.45  ? 143 ILE A C   1 
ATOM   797  O  O   . ILE A 1 143 ? -11.298 -33.846 -17.596 1.00 71.79  ? 143 ILE A O   1 
ATOM   798  C  CB  . ILE A 1 143 ? -11.777 -36.772 -17.541 1.00 71.22  ? 143 ILE A CB  1 
ATOM   799  C  CG1 . ILE A 1 143 ? -11.289 -38.208 -17.707 1.00 66.76  ? 143 ILE A CG1 1 
ATOM   800  C  CG2 . ILE A 1 143 ? -13.274 -36.728 -17.402 1.00 67.69  ? 143 ILE A CG2 1 
ATOM   801  C  CD1 . ILE A 1 143 ? -11.639 -39.089 -16.552 1.00 62.11  ? 143 ILE A CD1 1 
ATOM   802  N  N   . GLU A 1 144 ? -12.752 -34.031 -19.287 1.00 61.63  ? 144 GLU A N   1 
ATOM   803  C  CA  . GLU A 1 144 ? -13.250 -32.705 -18.974 1.00 62.68  ? 144 GLU A CA  1 
ATOM   804  C  C   . GLU A 1 144 ? -14.754 -32.586 -19.105 1.00 61.45  ? 144 GLU A C   1 
ATOM   805  O  O   . GLU A 1 144 ? -15.333 -33.056 -20.080 1.00 59.91  ? 144 GLU A O   1 
ATOM   806  C  CB  . GLU A 1 144 ? -12.595 -31.694 -19.916 1.00 65.18  ? 144 GLU A CB  1 
ATOM   807  C  CG  . GLU A 1 144 ? -12.894 -30.239 -19.615 1.00 71.21  ? 144 GLU A CG  1 
ATOM   808  C  CD  . GLU A 1 144 ? -12.183 -29.729 -18.372 1.00 75.41  ? 144 GLU A CD  1 
ATOM   809  O  OE1 . GLU A 1 144 ? -12.663 -28.731 -17.792 1.00 75.89  ? 144 GLU A OE1 1 
ATOM   810  O  OE2 . GLU A 1 144 ? -11.131 -30.307 -17.996 1.00 75.01  1 144 GLU A OE2 1 
ATOM   811  N  N   . PRO A 1 145 ? -15.390 -31.917 -18.133 1.00 70.78  ? 145 PRO A N   1 
ATOM   812  C  CA  . PRO A 1 145 ? -16.749 -31.393 -18.271 1.00 69.83  ? 145 PRO A CA  1 
ATOM   813  C  C   . PRO A 1 145 ? -16.724 -30.136 -19.115 1.00 67.48  ? 145 PRO A C   1 
ATOM   814  O  O   . PRO A 1 145 ? -15.837 -29.302 -18.911 1.00 67.93  ? 145 PRO A O   1 
ATOM   815  C  CB  . PRO A 1 145 ? -17.129 -31.042 -16.838 1.00 71.19  ? 145 PRO A CB  1 
ATOM   816  C  CG  . PRO A 1 145 ? -15.828 -30.808 -16.153 1.00 72.65  ? 145 PRO A CG  1 
ATOM   817  C  CD  . PRO A 1 145 ? -14.874 -31.770 -16.763 1.00 71.74  ? 145 PRO A CD  1 
ATOM   818  N  N   . THR A 1 146 ? -17.684 -29.964 -20.015 1.00 71.02  ? 146 THR A N   1 
ATOM   819  C  CA  . THR A 1 146 ? -17.706 -28.749 -20.823 1.00 68.55  ? 146 THR A CA  1 
ATOM   820  C  C   . THR A 1 146 ? -19.049 -28.433 -21.462 1.00 69.90  ? 146 THR A C   1 
ATOM   821  O  O   . THR A 1 146 ? -19.924 -29.298 -21.570 1.00 67.11  ? 146 THR A O   1 
ATOM   822  C  CB  . THR A 1 146 ? -16.644 -28.776 -21.929 1.00 67.48  ? 146 THR A CB  1 
ATOM   823  O  OG1 . THR A 1 146 ? -16.832 -27.640 -22.782 1.00 65.90  ? 146 THR A OG1 1 
ATOM   824  C  CG2 . THR A 1 146 ? -16.783 -30.053 -22.734 1.00 64.68  ? 146 THR A CG2 1 
ATOM   825  N  N   . SER A 1 147 ? -19.192 -27.187 -21.905 1.00 88.10  ? 147 SER A N   1 
ATOM   826  C  CA  . SER A 1 147 ? -20.284 -26.810 -22.790 1.00 94.04  ? 147 SER A CA  1 
ATOM   827  C  C   . SER A 1 147 ? -19.994 -27.388 -24.168 1.00 95.03  ? 147 SER A C   1 
ATOM   828  O  O   . SER A 1 147 ? -20.853 -27.383 -25.053 1.00 95.29  ? 147 SER A O   1 
ATOM   829  C  CB  . SER A 1 147 ? -20.397 -25.292 -22.890 1.00 95.79  ? 147 SER A CB  1 
ATOM   830  O  OG  . SER A 1 147 ? -20.610 -24.709 -21.618 1.00 104.65 ? 147 SER A OG  1 
ATOM   831  N  N   . GLY A 1 148 ? -18.779 -27.902 -24.330 1.00 91.55  ? 148 GLY A N   1 
ATOM   832  C  CA  . GLY A 1 148 ? -18.362 -28.570 -25.547 1.00 92.51  ? 148 GLY A CA  1 
ATOM   833  C  C   . GLY A 1 148 ? -17.353 -27.842 -26.401 1.00 92.56  ? 148 GLY A C   1 
ATOM   834  O  O   . GLY A 1 148 ? -16.729 -28.456 -27.259 1.00 93.52  ? 148 GLY A O   1 
ATOM   835  N  N   . ASN A 1 149 ? -17.152 -26.552 -26.169 1.00 84.96  ? 149 ASN A N   1 
ATOM   836  C  CA  . ASN A 1 149 ? -16.103 -25.865 -26.901 1.00 83.94  ? 149 ASN A CA  1 
ATOM   837  C  C   . ASN A 1 149 ? -14.740 -26.206 -26.317 1.00 82.51  ? 149 ASN A C   1 
ATOM   838  O  O   . ASN A 1 149 ? -13.803 -26.541 -27.046 1.00 81.89  ? 149 ASN A O   1 
ATOM   839  C  CB  . ASN A 1 149 ? -16.343 -24.367 -26.899 1.00 84.42  ? 149 ASN A CB  1 
ATOM   840  C  CG  . ASN A 1 149 ? -17.572 -23.977 -27.675 1.00 87.17  ? 149 ASN A CG  1 
ATOM   841  O  OD1 . ASN A 1 149 ? -18.609 -23.653 -27.095 1.00 90.90  ? 149 ASN A OD1 1 
ATOM   842  N  ND2 . ASN A 1 149 ? -17.466 -24.002 -29.001 1.00 90.52  ? 149 ASN A ND2 1 
ATOM   843  N  N   . THR A 1 150 ? -14.644 -26.143 -24.998 1.00 85.80  ? 150 THR A N   1 
ATOM   844  C  CA  . THR A 1 150 ? -13.418 -26.511 -24.311 1.00 84.54  ? 150 THR A CA  1 
ATOM   845  C  C   . THR A 1 150 ? -13.130 -27.958 -24.616 1.00 83.88  ? 150 THR A C   1 
ATOM   846  O  O   . THR A 1 150 ? -11.974 -28.354 -24.801 1.00 84.12  ? 150 THR A O   1 
ATOM   847  C  CB  . THR A 1 150 ? -13.551 -26.378 -22.801 1.00 84.70  ? 150 THR A CB  1 
ATOM   848  O  OG1 . THR A 1 150 ? -13.986 -25.061 -22.481 1.00 83.93  ? 150 THR A OG1 1 
ATOM   849  C  CG2 . THR A 1 150 ? -12.218 -26.599 -22.141 1.00 83.60  ? 150 THR A CG2 1 
ATOM   850  N  N   . GLY A 1 151 ? -14.192 -28.748 -24.665 1.00 82.01  ? 151 GLY A N   1 
ATOM   851  C  CA  . GLY A 1 151 ? -14.057 -30.146 -24.999 1.00 80.65  ? 151 GLY A CA  1 
ATOM   852  C  C   . GLY A 1 151 ? -13.431 -30.261 -26.371 1.00 80.13  ? 151 GLY A C   1 
ATOM   853  O  O   . GLY A 1 151 ? -12.603 -31.141 -26.604 1.00 79.44  ? 151 GLY A O   1 
ATOM   854  N  N   . ILE A 1 152 ? -13.814 -29.364 -27.277 1.00 63.61  ? 152 ILE A N   1 
ATOM   855  C  CA  . ILE A 1 152 ? -13.282 -29.390 -28.637 1.00 63.86  ? 152 ILE A CA  1 
ATOM   856  C  C   . ILE A 1 152 ? -11.806 -29.050 -28.645 1.00 64.63  ? 152 ILE A C   1 
ATOM   857  O  O   . ILE A 1 152 ? -11.008 -29.779 -29.234 1.00 64.68  ? 152 ILE A O   1 
ATOM   858  C  CB  . ILE A 1 152 ? -14.034 -28.436 -29.568 1.00 63.85  ? 152 ILE A CB  1 
ATOM   859  C  CG1 . ILE A 1 152 ? -15.375 -29.043 -29.957 1.00 63.57  ? 152 ILE A CG1 1 
ATOM   860  C  CG2 . ILE A 1 152 ? -13.253 -28.196 -30.824 1.00 61.85  ? 152 ILE A CG2 1 
ATOM   861  C  CD1 . ILE A 1 152 ? -16.252 -28.099 -30.739 1.00 62.52  ? 152 ILE A CD1 1 
ATOM   862  N  N   . GLY A 1 153 ? -11.442 -27.962 -27.972 1.00 69.92  ? 153 GLY A N   1 
ATOM   863  C  CA  . GLY A 1 153 ? -10.050 -27.557 -27.895 1.00 70.96  ? 153 GLY A CA  1 
ATOM   864  C  C   . GLY A 1 153 ? -9.178  -28.673 -27.353 1.00 71.82  ? 153 GLY A C   1 
ATOM   865  O  O   . GLY A 1 153 ? -8.121  -29.012 -27.911 1.00 71.73  ? 153 GLY A O   1 
ATOM   866  N  N   . LEU A 1 154 ? -9.646  -29.274 -26.271 1.00 61.30  ? 154 LEU A N   1 
ATOM   867  C  CA  . LEU A 1 154 ? -8.898  -30.330 -25.619 1.00 62.85  ? 154 LEU A CA  1 
ATOM   868  C  C   . LEU A 1 154 ? -8.786  -31.562 -26.506 1.00 65.33  ? 154 LEU A C   1 
ATOM   869  O  O   . LEU A 1 154 ? -7.719  -32.159 -26.616 1.00 65.53  ? 154 LEU A O   1 
ATOM   870  C  CB  . LEU A 1 154 ? -9.544  -30.686 -24.284 1.00 61.39  ? 154 LEU A CB  1 
ATOM   871  C  CG  . LEU A 1 154 ? -9.288  -29.630 -23.209 1.00 58.47  ? 154 LEU A CG  1 
ATOM   872  C  CD1 . LEU A 1 154 ? -10.146 -29.883 -21.986 1.00 54.44  ? 154 LEU A CD1 1 
ATOM   873  C  CD2 . LEU A 1 154 ? -7.825  -29.648 -22.823 1.00 53.91  ? 154 LEU A CD2 1 
ATOM   874  N  N   . ALA A 1 155 ? -9.885  -31.927 -27.152 1.00 74.33  ? 155 ALA A N   1 
ATOM   875  C  CA  . ALA A 1 155 ? -9.909  -33.118 -27.989 1.00 75.38  ? 155 ALA A CA  1 
ATOM   876  C  C   . ALA A 1 155 ? -8.955  -32.937 -29.157 1.00 73.88  ? 155 ALA A C   1 
ATOM   877  O  O   . ALA A 1 155 ? -8.300  -33.880 -29.606 1.00 75.87  ? 155 ALA A O   1 
ATOM   878  C  CB  . ALA A 1 155 ? -11.305 -33.367 -28.494 1.00 78.14  ? 155 ALA A CB  1 
ATOM   879  N  N   . LEU A 1 156 ? -8.902  -31.708 -29.645 1.00 73.25  ? 156 LEU A N   1 
ATOM   880  C  CA  . LEU A 1 156 ? -8.062  -31.328 -30.757 1.00 68.53  ? 156 LEU A CA  1 
ATOM   881  C  C   . LEU A 1 156 ? -6.600  -31.490 -30.355 1.00 68.21  ? 156 LEU A C   1 
ATOM   882  O  O   . LEU A 1 156 ? -5.811  -32.224 -30.999 1.00 66.01  ? 156 LEU A O   1 
ATOM   883  C  CB  . LEU A 1 156 ? -8.360  -29.868 -31.091 1.00 66.06  ? 156 LEU A CB  1 
ATOM   884  C  CG  . LEU A 1 156 ? -7.538  -29.153 -32.153 1.00 62.26  ? 156 LEU A CG  1 
ATOM   885  C  CD1 . LEU A 1 156 ? -7.432  -30.040 -33.356 1.00 58.84  ? 156 LEU A CD1 1 
ATOM   886  C  CD2 . LEU A 1 156 ? -8.198  -27.842 -32.535 1.00 60.07  ? 156 LEU A CD2 1 
ATOM   887  N  N   . ALA A 1 157 ? -6.256  -30.825 -29.254 1.00 63.96  ? 157 ALA A N   1 
ATOM   888  C  CA  . ALA A 1 157 ? -4.895  -30.861 -28.733 1.00 64.98  ? 157 ALA A CA  1 
ATOM   889  C  C   . ALA A 1 157 ? -4.466  -32.289 -28.441 1.00 65.46  ? 157 ALA A C   1 
ATOM   890  O  O   . ALA A 1 157 ? -3.304  -32.635 -28.603 1.00 67.66  ? 157 ALA A O   1 
ATOM   891  C  CB  . ALA A 1 157 ? -4.777  -30.016 -27.495 1.00 61.13  ? 157 ALA A CB  1 
ATOM   892  N  N   . ALA A 1 158 ? -5.413  -33.115 -28.017 1.00 61.12  ? 158 ALA A N   1 
ATOM   893  C  CA  . ALA A 1 158 ? -5.134  -34.498 -27.674 1.00 60.12  ? 158 ALA A CA  1 
ATOM   894  C  C   . ALA A 1 158 ? -4.875  -35.296 -28.943 1.00 60.10  ? 158 ALA A C   1 
ATOM   895  O  O   . ALA A 1 158 ? -3.992  -36.159 -28.984 1.00 59.35  ? 158 ALA A O   1 
ATOM   896  C  CB  . ALA A 1 158 ? -6.296  -35.090 -26.930 1.00 59.86  ? 158 ALA A CB  1 
ATOM   897  N  N   . ALA A 1 159 ? -5.661  -35.008 -29.975 1.00 69.05  ? 159 ALA A N   1 
ATOM   898  C  CA  . ALA A 1 159 ? -5.509  -35.671 -31.256 1.00 70.14  ? 159 ALA A CA  1 
ATOM   899  C  C   . ALA A 1 159 ? -4.104  -35.413 -31.741 1.00 69.68  ? 159 ALA A C   1 
ATOM   900  O  O   . ALA A 1 159 ? -3.431  -36.318 -32.244 1.00 68.50  ? 159 ALA A O   1 
ATOM   901  C  CB  . ALA A 1 159 ? -6.504  -35.135 -32.247 1.00 74.06  ? 159 ALA A CB  1 
ATOM   902  N  N   . VAL A 1 160 ? -3.662  -34.168 -31.591 1.00 71.63  ? 160 VAL A N   1 
ATOM   903  C  CA  . VAL A 1 160 ? -2.301  -33.823 -31.979 1.00 71.59  ? 160 VAL A CA  1 
ATOM   904  C  C   . VAL A 1 160 ? -1.238  -34.508 -31.119 1.00 77.90  ? 160 VAL A C   1 
ATOM   905  O  O   . VAL A 1 160 ? -0.300  -35.123 -31.643 1.00 78.02  ? 160 VAL A O   1 
ATOM   906  C  CB  . VAL A 1 160 ? -2.075  -32.308 -31.922 1.00 68.87  ? 160 VAL A CB  1 
ATOM   907  C  CG1 . VAL A 1 160 ? -0.597  -31.992 -32.013 1.00 61.56  ? 160 VAL A CG1 1 
ATOM   908  C  CG2 . VAL A 1 160 ? -2.844  -31.632 -33.033 1.00 60.23  ? 160 VAL A CG2 1 
ATOM   909  N  N   . ARG A 1 161 ? -1.400  -34.416 -29.802 1.00 70.39  ? 161 ARG A N   1 
ATOM   910  C  CA  . ARG A 1 161 ? -0.345  -34.788 -28.865 1.00 79.68  ? 161 ARG A CA  1 
ATOM   911  C  C   . ARG A 1 161 ? -0.438  -36.210 -28.335 1.00 86.79  ? 161 ARG A C   1 
ATOM   912  O  O   . ARG A 1 161 ? 0.412   -36.634 -27.550 1.00 83.98  ? 161 ARG A O   1 
ATOM   913  C  CB  . ARG A 1 161 ? -0.291  -33.798 -27.703 1.00 80.99  ? 161 ARG A CB  1 
ATOM   914  C  CG  . ARG A 1 161 ? -0.143  -32.364 -28.148 1.00 83.57  ? 161 ARG A CG  1 
ATOM   915  C  CD  . ARG A 1 161 ? 0.408   -31.496 -27.042 1.00 89.22  ? 161 ARG A CD  1 
ATOM   916  N  NE  . ARG A 1 161 ? 0.786   -30.182 -27.550 1.00 91.13  ? 161 ARG A NE  1 
ATOM   917  C  CZ  . ARG A 1 161 ? 1.367   -29.234 -26.822 1.00 93.08  ? 161 ARG A CZ  1 
ATOM   918  N  NH1 . ARG A 1 161 ? 1.629   -29.453 -25.537 1.00 95.03  1 161 ARG A NH1 1 
ATOM   919  N  NH2 . ARG A 1 161 ? 1.681   -28.064 -27.375 1.00 91.07  ? 161 ARG A NH2 1 
ATOM   920  N  N   . GLY A 1 162 ? -1.458  -36.951 -28.750 1.00 66.61  ? 162 GLY A N   1 
ATOM   921  C  CA  . GLY A 1 162 ? -1.518  -38.364 -28.415 1.00 74.68  ? 162 GLY A CA  1 
ATOM   922  C  C   . GLY A 1 162 ? -2.161  -38.684 -27.075 1.00 74.52  ? 162 GLY A C   1 
ATOM   923  O  O   . GLY A 1 162 ? -2.145  -39.837 -26.626 1.00 78.82  ? 162 GLY A O   1 
ATOM   924  N  N   . TYR A 1 163 ? -2.727  -37.667 -26.435 1.00 101.63 ? 163 TYR A N   1 
ATOM   925  C  CA  . TYR A 1 163 ? -3.475  -37.862 -25.203 1.00 90.16  ? 163 TYR A CA  1 
ATOM   926  C  C   . TYR A 1 163 ? -4.797  -38.532 -25.520 1.00 82.89  ? 163 TYR A C   1 
ATOM   927  O  O   . TYR A 1 163 ? -5.310  -38.410 -26.633 1.00 84.48  ? 163 TYR A O   1 
ATOM   928  C  CB  . TYR A 1 163 ? -3.728  -36.529 -24.517 1.00 87.47  ? 163 TYR A CB  1 
ATOM   929  C  CG  . TYR A 1 163 ? -2.481  -35.866 -24.000 1.00 86.73  ? 163 TYR A CG  1 
ATOM   930  C  CD1 . TYR A 1 163 ? -2.266  -34.507 -24.192 1.00 85.37  ? 163 TYR A CD1 1 
ATOM   931  C  CD2 . TYR A 1 163 ? -1.518  -36.598 -23.308 1.00 88.91  ? 163 TYR A CD2 1 
ATOM   932  C  CE1 . TYR A 1 163 ? -1.128  -33.891 -23.714 1.00 88.20  ? 163 TYR A CE1 1 
ATOM   933  C  CE2 . TYR A 1 163 ? -0.382  -35.991 -22.822 1.00 90.28  ? 163 TYR A CE2 1 
ATOM   934  C  CZ  . TYR A 1 163 ? -0.187  -34.637 -23.030 1.00 89.98  ? 163 TYR A CZ  1 
ATOM   935  O  OH  . TYR A 1 163 ? 0.952   -34.027 -22.551 1.00 89.74  ? 163 TYR A OH  1 
ATOM   936  N  N   . ARG A 1 164 ? -5.348  -39.244 -24.546 1.00 85.52  ? 164 ARG A N   1 
ATOM   937  C  CA  . ARG A 1 164 ? -6.656  -39.852 -24.717 1.00 76.98  ? 164 ARG A CA  1 
ATOM   938  C  C   . ARG A 1 164 ? -7.714  -38.919 -24.144 1.00 73.47  ? 164 ARG A C   1 
ATOM   939  O  O   . ARG A 1 164 ? -7.616  -38.510 -22.998 1.00 71.03  ? 164 ARG A O   1 
ATOM   940  C  CB  . ARG A 1 164 ? -6.705  -41.196 -24.007 1.00 75.22  ? 164 ARG A CB  1 
ATOM   941  C  CG  . ARG A 1 164 ? -8.114  -41.706 -23.769 1.00 74.23  ? 164 ARG A CG  1 
ATOM   942  C  CD  . ARG A 1 164 ? -8.056  -43.144 -23.329 1.00 77.80  ? 164 ARG A CD  1 
ATOM   943  N  NE  . ARG A 1 164 ? -9.369  -43.676 -22.991 1.00 82.05  ? 164 ARG A NE  1 
ATOM   944  C  CZ  . ARG A 1 164 ? -9.616  -44.394 -21.901 1.00 84.21  ? 164 ARG A CZ  1 
ATOM   945  N  NH1 . ARG A 1 164 ? -8.632  -44.656 -21.044 1.00 84.64  1 164 ARG A NH1 1 
ATOM   946  N  NH2 . ARG A 1 164 ? -10.843 -44.848 -21.661 1.00 85.62  ? 164 ARG A NH2 1 
ATOM   947  N  N   . CYS A 1 165 ? -8.732  -38.582 -24.925 1.00 71.68  ? 165 CYS A N   1 
ATOM   948  C  CA  . CYS A 1 165 ? -9.650  -37.545 -24.494 1.00 71.73  ? 165 CYS A CA  1 
ATOM   949  C  C   . CYS A 1 165 ? -11.038 -38.075 -24.192 1.00 70.93  ? 165 CYS A C   1 
ATOM   950  O  O   . CYS A 1 165 ? -11.620 -38.812 -24.985 1.00 70.00  ? 165 CYS A O   1 
ATOM   951  C  CB  . CYS A 1 165 ? -9.731  -36.444 -25.543 1.00 72.77  ? 165 CYS A CB  1 
ATOM   952  S  SG  . CYS A 1 165 ? -10.373 -34.883 -24.906 1.00 77.03  ? 165 CYS A SG  1 
ATOM   953  N  N   . ILE A 1 166 ? -11.562 -37.698 -23.033 1.00 67.20  ? 166 ILE A N   1 
ATOM   954  C  CA  . ILE A 1 166 ? -12.903 -38.075 -22.638 1.00 68.48  ? 166 ILE A CA  1 
ATOM   955  C  C   . ILE A 1 166 ? -13.715 -36.867 -22.205 1.00 67.67  ? 166 ILE A C   1 
ATOM   956  O  O   . ILE A 1 166 ? -13.383 -36.184 -21.224 1.00 68.29  ? 166 ILE A O   1 
ATOM   957  C  CB  . ILE A 1 166 ? -12.890 -39.080 -21.504 1.00 69.49  ? 166 ILE A CB  1 
ATOM   958  C  CG1 . ILE A 1 166 ? -12.128 -40.331 -21.925 1.00 71.12  ? 166 ILE A CG1 1 
ATOM   959  C  CG2 . ILE A 1 166 ? -14.311 -39.444 -21.137 1.00 71.16  ? 166 ILE A CG2 1 
ATOM   960  C  CD1 . ILE A 1 166 ? -12.194 -41.428 -20.910 1.00 71.17  ? 166 ILE A CD1 1 
ATOM   961  N  N   . ILE A 1 167 ? -14.794 -36.612 -22.927 1.00 79.03  ? 167 ILE A N   1 
ATOM   962  C  CA  . ILE A 1 167 ? -15.573 -35.418 -22.689 1.00 77.53  ? 167 ILE A CA  1 
ATOM   963  C  C   . ILE A 1 167 ? -16.886 -35.731 -22.006 1.00 77.41  ? 167 ILE A C   1 
ATOM   964  O  O   . ILE A 1 167 ? -17.503 -36.759 -22.266 1.00 77.19  ? 167 ILE A O   1 
ATOM   965  C  CB  . ILE A 1 167 ? -15.827 -34.690 -24.001 1.00 77.05  ? 167 ILE A CB  1 
ATOM   966  C  CG1 . ILE A 1 167 ? -14.488 -34.275 -24.595 1.00 76.03  ? 167 ILE A CG1 1 
ATOM   967  C  CG2 . ILE A 1 167 ? -16.663 -33.445 -23.784 1.00 76.24  ? 167 ILE A CG2 1 
ATOM   968  C  CD1 . ILE A 1 167 ? -13.647 -33.485 -23.626 1.00 75.49  ? 167 ILE A CD1 1 
ATOM   969  N  N   . VAL A 1 168 ? -17.306 -34.829 -21.130 1.00 67.30  ? 168 VAL A N   1 
ATOM   970  C  CA  . VAL A 1 168 ? -18.585 -34.932 -20.467 1.00 67.44  ? 168 VAL A CA  1 
ATOM   971  C  C   . VAL A 1 168 ? -19.352 -33.641 -20.681 1.00 66.51  ? 168 VAL A C   1 
ATOM   972  O  O   . VAL A 1 168 ? -18.941 -32.574 -20.210 1.00 66.01  ? 168 VAL A O   1 
ATOM   973  C  CB  . VAL A 1 168 ? -18.403 -35.147 -18.969 1.00 68.12  ? 168 VAL A CB  1 
ATOM   974  C  CG1 . VAL A 1 168 ? -19.741 -35.250 -18.308 1.00 69.63  ? 168 VAL A CG1 1 
ATOM   975  C  CG2 . VAL A 1 168 ? -17.595 -36.400 -18.723 1.00 69.55  ? 168 VAL A CG2 1 
ATOM   976  N  N   . MET A 1 169 ? -20.475 -33.735 -21.385 1.00 69.55  ? 169 MET A N   1 
ATOM   977  C  CA  . MET A 1 169 ? -21.256 -32.547 -21.665 1.00 70.84  ? 169 MET A CA  1 
ATOM   978  C  C   . MET A 1 169 ? -22.738 -32.828 -21.492 1.00 71.23  ? 169 MET A C   1 
ATOM   979  O  O   . MET A 1 169 ? -23.187 -33.965 -21.647 1.00 68.05  ? 169 MET A O   1 
ATOM   980  C  CB  . MET A 1 169 ? -20.953 -31.992 -23.062 1.00 71.36  ? 169 MET A CB  1 
ATOM   981  C  CG  . MET A 1 169 ? -21.322 -32.933 -24.189 1.00 79.37  ? 169 MET A CG  1 
ATOM   982  S  SD  . MET A 1 169 ? -20.752 -32.369 -25.807 1.00 92.38  ? 169 MET A SD  1 
ATOM   983  C  CE  . MET A 1 169 ? -21.149 -30.632 -25.694 1.00 91.97  ? 169 MET A CE  1 
ATOM   984  N  N   . PRO A 1 170 ? -23.504 -31.789 -21.142 1.00 66.01  ? 170 PRO A N   1 
ATOM   985  C  CA  . PRO A 1 170 ? -24.951 -31.912 -20.956 1.00 68.20  ? 170 PRO A CA  1 
ATOM   986  C  C   . PRO A 1 170 ? -25.623 -32.346 -22.244 1.00 69.18  ? 170 PRO A C   1 
ATOM   987  O  O   . PRO A 1 170 ? -25.040 -32.191 -23.324 1.00 70.87  ? 170 PRO A O   1 
ATOM   988  C  CB  . PRO A 1 170 ? -25.379 -30.490 -20.608 1.00 68.71  ? 170 PRO A CB  1 
ATOM   989  C  CG  . PRO A 1 170 ? -24.178 -29.896 -19.991 1.00 68.08  ? 170 PRO A CG  1 
ATOM   990  C  CD  . PRO A 1 170 ? -23.010 -30.463 -20.740 1.00 66.68  ? 170 PRO A CD  1 
ATOM   991  N  N   . GLU A 1 171 ? -26.842 -32.864 -22.143 1.00 70.01  ? 171 GLU A N   1 
ATOM   992  C  CA  . GLU A 1 171 ? -27.513 -33.401 -23.314 1.00 70.13  ? 171 GLU A CA  1 
ATOM   993  C  C   . GLU A 1 171 ? -28.216 -32.319 -24.125 1.00 66.99  ? 171 GLU A C   1 
ATOM   994  O  O   . GLU A 1 171 ? -28.835 -32.604 -25.157 1.00 64.68  ? 171 GLU A O   1 
ATOM   995  C  CB  . GLU A 1 171 ? -28.445 -34.558 -22.944 1.00 74.30  ? 171 GLU A CB  1 
ATOM   996  C  CG  . GLU A 1 171 ? -29.281 -34.310 -21.704 1.00 83.90  ? 171 GLU A CG  1 
ATOM   997  C  CD  . GLU A 1 171 ? -29.875 -35.593 -21.145 1.00 91.24  ? 171 GLU A CD  1 
ATOM   998  O  OE1 . GLU A 1 171 ? -29.399 -36.689 -21.533 1.00 93.28  ? 171 GLU A OE1 1 
ATOM   999  O  OE2 . GLU A 1 171 ? -30.814 -35.501 -20.320 1.00 92.38  1 171 GLU A OE2 1 
ATOM   1000 N  N   . LYS A 1 172 ? -28.094 -31.077 -23.668 1.00 75.54  ? 172 LYS A N   1 
ATOM   1001 C  CA  . LYS A 1 172 ? -28.702 -29.949 -24.351 1.00 75.95  ? 172 LYS A CA  1 
ATOM   1002 C  C   . LYS A 1 172 ? -27.905 -29.584 -25.574 1.00 77.38  ? 172 LYS A C   1 
ATOM   1003 O  O   . LYS A 1 172 ? -28.462 -29.209 -26.610 1.00 76.82  ? 172 LYS A O   1 
ATOM   1004 C  CB  . LYS A 1 172 ? -28.715 -28.731 -23.440 1.00 75.02  ? 172 LYS A CB  1 
ATOM   1005 C  CG  . LYS A 1 172 ? -29.471 -27.555 -24.014 1.00 73.64  ? 172 LYS A CG  1 
ATOM   1006 C  CD  . LYS A 1 172 ? -29.382 -26.337 -23.108 1.00 73.08  ? 172 LYS A CD  1 
ATOM   1007 C  CE  . LYS A 1 172 ? -27.990 -25.727 -23.132 1.00 73.56  ? 172 LYS A CE  1 
ATOM   1008 N  NZ  . LYS A 1 172 ? -27.979 -24.414 -22.426 1.00 75.73  1 172 LYS A NZ  1 
ATOM   1009 N  N   . MET A 1 173 ? -26.592 -29.694 -25.437 1.00 71.19  ? 173 MET A N   1 
ATOM   1010 C  CA  . MET A 1 173 ? -25.666 -29.138 -26.404 1.00 72.31  ? 173 MET A CA  1 
ATOM   1011 C  C   . MET A 1 173 ? -25.808 -29.788 -27.771 1.00 72.48  ? 173 MET A C   1 
ATOM   1012 O  O   . MET A 1 173 ? -26.180 -30.960 -27.879 1.00 74.27  ? 173 MET A O   1 
ATOM   1013 C  CB  . MET A 1 173 ? -24.249 -29.279 -25.883 1.00 72.76  ? 173 MET A CB  1 
ATOM   1014 C  CG  . MET A 1 173 ? -24.067 -28.735 -24.468 1.00 71.76  ? 173 MET A CG  1 
ATOM   1015 S  SD  . MET A 1 173 ? -24.467 -26.975 -24.349 1.00 72.20  ? 173 MET A SD  1 
ATOM   1016 C  CE  . MET A 1 173 ? -24.270 -26.709 -22.592 1.00 66.85  ? 173 MET A CE  1 
ATOM   1017 N  N   . SER A 1 174 ? -25.486 -29.022 -28.810 1.00 68.81  ? 174 SER A N   1 
ATOM   1018 C  CA  . SER A 1 174 ? -25.764 -29.412 -30.193 1.00 67.15  ? 174 SER A CA  1 
ATOM   1019 C  C   . SER A 1 174 ? -25.008 -30.648 -30.675 1.00 66.88  ? 174 SER A C   1 
ATOM   1020 O  O   . SER A 1 174 ? -23.906 -30.956 -30.200 1.00 65.07  ? 174 SER A O   1 
ATOM   1021 C  CB  . SER A 1 174 ? -25.502 -28.239 -31.143 1.00 66.60  ? 174 SER A CB  1 
ATOM   1022 O  OG  . SER A 1 174 ? -24.119 -27.927 -31.215 1.00 67.57  ? 174 SER A OG  1 
ATOM   1023 N  N   . SER A 1 175 ? -25.620 -31.356 -31.621 1.00 71.82  ? 175 SER A N   1 
ATOM   1024 C  CA  . SER A 1 175 ? -25.066 -32.597 -32.146 1.00 75.33  ? 175 SER A CA  1 
ATOM   1025 C  C   . SER A 1 175 ? -23.874 -32.360 -33.058 1.00 77.99  ? 175 SER A C   1 
ATOM   1026 O  O   . SER A 1 175 ? -23.092 -33.278 -33.311 1.00 77.65  ? 175 SER A O   1 
ATOM   1027 C  CB  . SER A 1 175 ? -26.132 -33.373 -32.904 1.00 74.48  ? 175 SER A CB  1 
ATOM   1028 O  OG  . SER A 1 175 ? -26.903 -32.483 -33.688 1.00 76.74  ? 175 SER A OG  1 
ATOM   1029 N  N   . GLU A 1 176 ? -23.748 -31.144 -33.575 1.00 86.13  ? 176 GLU A N   1 
ATOM   1030 C  CA  . GLU A 1 176 ? -22.601 -30.819 -34.404 1.00 87.26  ? 176 GLU A CA  1 
ATOM   1031 C  C   . GLU A 1 176 ? -21.323 -30.957 -33.590 1.00 86.69  ? 176 GLU A C   1 
ATOM   1032 O  O   . GLU A 1 176 ? -20.312 -31.510 -34.068 1.00 88.39  ? 176 GLU A O   1 
ATOM   1033 C  CB  . GLU A 1 176 ? -22.722 -29.405 -34.963 1.00 85.52  ? 176 GLU A CB  1 
ATOM   1034 C  CG  . GLU A 1 176 ? -23.718 -29.273 -36.111 1.00 88.07  ? 176 GLU A CG  1 
ATOM   1035 C  CD  . GLU A 1 176 ? -25.139 -29.015 -35.646 1.00 91.86  ? 176 GLU A CD  1 
ATOM   1036 O  OE1 . GLU A 1 176 ? -25.388 -29.055 -34.419 1.00 93.33  ? 176 GLU A OE1 1 
ATOM   1037 O  OE2 . GLU A 1 176 ? -26.002 -28.764 -36.516 1.00 93.25  1 176 GLU A OE2 1 
ATOM   1038 N  N   . LYS A 1 177 ? -21.381 -30.471 -32.354 1.00 75.50  ? 177 LYS A N   1 
ATOM   1039 C  CA  . LYS A 1 177 ? -20.259 -30.588 -31.444 1.00 69.72  ? 177 LYS A CA  1 
ATOM   1040 C  C   . LYS A 1 177 ? -19.891 -32.045 -31.276 1.00 67.28  ? 177 LYS A C   1 
ATOM   1041 O  O   . LYS A 1 177 ? -18.717 -32.407 -31.327 1.00 67.17  ? 177 LYS A O   1 
ATOM   1042 C  CB  . LYS A 1 177 ? -20.609 -29.993 -30.096 1.00 68.59  ? 177 LYS A CB  1 
ATOM   1043 C  CG  . LYS A 1 177 ? -20.819 -28.505 -30.148 1.00 63.51  ? 177 LYS A CG  1 
ATOM   1044 C  CD  . LYS A 1 177 ? -20.934 -27.957 -28.745 1.00 59.41  ? 177 LYS A CD  1 
ATOM   1045 C  CE  . LYS A 1 177 ? -21.143 -26.458 -28.775 1.00 58.57  ? 177 LYS A CE  1 
ATOM   1046 N  NZ  . LYS A 1 177 ? -21.256 -25.941 -27.379 1.00 60.93  1 177 LYS A NZ  1 
ATOM   1047 N  N   . VAL A 1 178 ? -20.901 -32.878 -31.080 1.00 63.76  ? 178 VAL A N   1 
ATOM   1048 C  CA  . VAL A 1 178 ? -20.678 -34.302 -30.919 1.00 61.44  ? 178 VAL A CA  1 
ATOM   1049 C  C   . VAL A 1 178 ? -19.978 -34.857 -32.143 1.00 63.68  ? 178 VAL A C   1 
ATOM   1050 O  O   . VAL A 1 178 ? -19.049 -35.655 -32.030 1.00 61.88  ? 178 VAL A O   1 
ATOM   1051 C  CB  . VAL A 1 178 ? -21.994 -35.046 -30.754 1.00 59.66  ? 178 VAL A CB  1 
ATOM   1052 C  CG1 . VAL A 1 178 ? -21.758 -36.550 -30.797 1.00 56.49  ? 178 VAL A CG1 1 
ATOM   1053 C  CG2 . VAL A 1 178 ? -22.634 -34.638 -29.454 1.00 57.74  ? 178 VAL A CG2 1 
ATOM   1054 N  N   . ASP A 1 179 ? -20.436 -34.435 -33.315 1.00 70.51  ? 179 ASP A N   1 
ATOM   1055 C  CA  . ASP A 1 179 ? -19.863 -34.907 -34.561 1.00 76.53  ? 179 ASP A CA  1 
ATOM   1056 C  C   . ASP A 1 179 ? -18.375 -34.596 -34.633 1.00 74.21  ? 179 ASP A C   1 
ATOM   1057 O  O   . ASP A 1 179 ? -17.541 -35.501 -34.812 1.00 73.89  ? 179 ASP A O   1 
ATOM   1058 C  CB  . ASP A 1 179 ? -20.589 -34.266 -35.736 1.00 81.88  ? 179 ASP A CB  1 
ATOM   1059 C  CG  . ASP A 1 179 ? -21.905 -34.933 -36.034 1.00 98.20  ? 179 ASP A CG  1 
ATOM   1060 O  OD1 . ASP A 1 179 ? -21.983 -36.171 -35.871 1.00 113.08 ? 179 ASP A OD1 1 
ATOM   1061 O  OD2 . ASP A 1 179 ? -22.855 -34.227 -36.439 1.00 113.07 1 179 ASP A OD2 1 
ATOM   1062 N  N   . VAL A 1 180 ? -18.046 -33.318 -34.486 1.00 66.15  ? 180 VAL A N   1 
ATOM   1063 C  CA  . VAL A 1 180 ? -16.656 -32.896 -34.518 1.00 64.38  ? 180 VAL A CA  1 
ATOM   1064 C  C   . VAL A 1 180 ? -15.808 -33.631 -33.483 1.00 65.56  ? 180 VAL A C   1 
ATOM   1065 O  O   . VAL A 1 180 ? -14.709 -34.110 -33.789 1.00 64.84  ? 180 VAL A O   1 
ATOM   1066 C  CB  . VAL A 1 180 ? -16.530 -31.393 -34.277 1.00 63.43  ? 180 VAL A CB  1 
ATOM   1067 C  CG1 . VAL A 1 180 ? -15.075 -30.983 -34.275 1.00 60.16  ? 180 VAL A CG1 1 
ATOM   1068 C  CG2 . VAL A 1 180 ? -17.293 -30.636 -35.340 1.00 60.95  ? 180 VAL A CG2 1 
ATOM   1069 N  N   . LEU A 1 181 ? -16.327 -33.723 -32.263 1.00 69.28  ? 181 LEU A N   1 
ATOM   1070 C  CA  . LEU A 1 181 ? -15.617 -34.364 -31.167 1.00 70.61  ? 181 LEU A CA  1 
ATOM   1071 C  C   . LEU A 1 181 ? -15.323 -35.820 -31.464 1.00 71.68  ? 181 LEU A C   1 
ATOM   1072 O  O   . LEU A 1 181 ? -14.252 -36.338 -31.146 1.00 73.54  ? 181 LEU A O   1 
ATOM   1073 C  CB  . LEU A 1 181 ? -16.427 -34.283 -29.881 1.00 70.12  ? 181 LEU A CB  1 
ATOM   1074 C  CG  . LEU A 1 181 ? -16.403 -32.927 -29.184 1.00 67.49  ? 181 LEU A CG  1 
ATOM   1075 C  CD1 . LEU A 1 181 ? -17.405 -32.930 -28.047 1.00 64.41  ? 181 LEU A CD1 1 
ATOM   1076 C  CD2 . LEU A 1 181 ? -15.014 -32.614 -28.678 1.00 65.25  ? 181 LEU A CD2 1 
ATOM   1077 N  N   . ARG A 1 182 ? -16.299 -36.489 -32.046 1.00 69.62  ? 182 ARG A N   1 
ATOM   1078 C  CA  . ARG A 1 182 ? -16.175 -37.897 -32.329 1.00 68.98  ? 182 ARG A CA  1 
ATOM   1079 C  C   . ARG A 1 182 ? -15.157 -38.073 -33.446 1.00 70.22  ? 182 ARG A C   1 
ATOM   1080 O  O   . ARG A 1 182 ? -14.408 -39.057 -33.479 1.00 69.50  ? 182 ARG A O   1 
ATOM   1081 C  CB  . ARG A 1 182 ? -17.535 -38.461 -32.732 1.00 67.39  ? 182 ARG A CB  1 
ATOM   1082 C  CG  . ARG A 1 182 ? -17.557 -39.955 -32.969 1.00 65.81  ? 182 ARG A CG  1 
ATOM   1083 C  CD  . ARG A 1 182 ? -18.979 -40.449 -32.939 1.00 69.18  ? 182 ARG A CD  1 
ATOM   1084 N  NE  . ARG A 1 182 ? -19.898 -39.429 -33.435 1.00 73.31  ? 182 ARG A NE  1 
ATOM   1085 C  CZ  . ARG A 1 182 ? -21.213 -39.449 -33.233 1.00 76.92  ? 182 ARG A CZ  1 
ATOM   1086 N  NH1 . ARG A 1 182 ? -21.771 -40.442 -32.542 1.00 78.58  1 182 ARG A NH1 1 
ATOM   1087 N  NH2 . ARG A 1 182 ? -21.978 -38.476 -33.719 1.00 78.52  ? 182 ARG A NH2 1 
ATOM   1088 N  N   . ALA A 1 183 ? -15.133 -37.106 -34.359 1.00 68.21  ? 183 ALA A N   1 
ATOM   1089 C  CA  . ALA A 1 183 ? -14.192 -37.135 -35.472 1.00 69.35  ? 183 ALA A CA  1 
ATOM   1090 C  C   . ALA A 1 183 ? -12.760 -36.967 -34.982 1.00 68.05  ? 183 ALA A C   1 
ATOM   1091 O  O   . ALA A 1 183 ? -11.809 -37.426 -35.621 1.00 69.13  ? 183 ALA A O   1 
ATOM   1092 C  CB  . ALA A 1 183 ? -14.531 -36.050 -36.469 1.00 72.89  ? 183 ALA A CB  1 
ATOM   1093 N  N   . LEU A 1 184 ? -12.617 -36.297 -33.846 1.00 58.72  ? 184 LEU A N   1 
ATOM   1094 C  CA  . LEU A 1 184 ? -11.310 -36.022 -33.269 1.00 56.67  ? 184 LEU A CA  1 
ATOM   1095 C  C   . LEU A 1 184 ? -10.766 -37.213 -32.502 1.00 58.73  ? 184 LEU A C   1 
ATOM   1096 O  O   . LEU A 1 184 ? -9.590  -37.236 -32.132 1.00 55.63  ? 184 LEU A O   1 
ATOM   1097 C  CB  . LEU A 1 184 ? -11.374 -34.787 -32.383 1.00 54.64  ? 184 LEU A CB  1 
ATOM   1098 C  CG  . LEU A 1 184 ? -11.436 -33.517 -33.228 1.00 53.07  ? 184 LEU A CG  1 
ATOM   1099 C  CD1 . LEU A 1 184 ? -12.015 -32.393 -32.408 1.00 54.47  ? 184 LEU A CD1 1 
ATOM   1100 C  CD2 . LEU A 1 184 ? -10.049 -33.149 -33.714 1.00 49.42  ? 184 LEU A CD2 1 
ATOM   1101 N  N   . GLY A 1 185 ? -11.625 -38.196 -32.254 1.00 76.67  ? 185 GLY A N   1 
ATOM   1102 C  CA  . GLY A 1 185 ? -11.199 -39.417 -31.596 1.00 82.69  ? 185 GLY A CA  1 
ATOM   1103 C  C   . GLY A 1 185 ? -11.520 -39.415 -30.118 1.00 83.82  ? 185 GLY A C   1 
ATOM   1104 O  O   . GLY A 1 185 ? -11.039 -40.258 -29.354 1.00 88.47  ? 185 GLY A O   1 
ATOM   1105 N  N   . ALA A 1 186 ? -12.372 -38.479 -29.722 1.00 86.56  ? 186 ALA A N   1 
ATOM   1106 C  CA  . ALA A 1 186 ? -12.747 -38.319 -28.329 1.00 81.72  ? 186 ALA A CA  1 
ATOM   1107 C  C   . ALA A 1 186 ? -13.881 -39.262 -27.961 1.00 79.54  ? 186 ALA A C   1 
ATOM   1108 O  O   . ALA A 1 186 ? -14.752 -39.553 -28.783 1.00 78.82  ? 186 ALA A O   1 
ATOM   1109 C  CB  . ALA A 1 186 ? -13.147 -36.884 -28.059 1.00 79.85  ? 186 ALA A CB  1 
ATOM   1110 N  N   . GLU A 1 187 ? -13.838 -39.781 -26.738 1.00 76.71  ? 187 GLU A N   1 
ATOM   1111 C  CA  . GLU A 1 187 ? -14.949 -40.552 -26.206 1.00 76.00  ? 187 GLU A CA  1 
ATOM   1112 C  C   . GLU A 1 187 ? -15.914 -39.581 -25.563 1.00 73.07  ? 187 GLU A C   1 
ATOM   1113 O  O   . GLU A 1 187 ? -15.500 -38.587 -24.950 1.00 72.74  ? 187 GLU A O   1 
ATOM   1114 C  CB  . GLU A 1 187 ? -14.467 -41.577 -25.191 1.00 77.47  ? 187 GLU A CB  1 
ATOM   1115 C  CG  . GLU A 1 187 ? -13.609 -42.643 -25.812 1.00 85.34  ? 187 GLU A CG  1 
ATOM   1116 C  CD  . GLU A 1 187 ? -12.621 -43.228 -24.834 1.00 94.18  ? 187 GLU A CD  1 
ATOM   1117 O  OE1 . GLU A 1 187 ? -11.436 -42.835 -24.886 1.00 97.17  ? 187 GLU A OE1 1 
ATOM   1118 O  OE2 . GLU A 1 187 ? -13.031 -44.062 -24.001 1.00 97.22  1 187 GLU A OE2 1 
ATOM   1119 N  N   . ILE A 1 188 ? -17.204 -39.855 -25.703 1.00 97.45  ? 188 ILE A N   1 
ATOM   1120 C  CA  . ILE A 1 188 ? -18.197 -38.879 -25.307 1.00 94.45  ? 188 ILE A CA  1 
ATOM   1121 C  C   . ILE A 1 188 ? -19.168 -39.423 -24.271 1.00 93.00  ? 188 ILE A C   1 
ATOM   1122 O  O   . ILE A 1 188 ? -19.642 -40.557 -24.367 1.00 93.39  ? 188 ILE A O   1 
ATOM   1123 C  CB  . ILE A 1 188 ? -18.962 -38.378 -26.526 1.00 93.96  ? 188 ILE A CB  1 
ATOM   1124 C  CG1 . ILE A 1 188 ? -17.978 -37.805 -27.541 1.00 92.28  ? 188 ILE A CG1 1 
ATOM   1125 C  CG2 . ILE A 1 188 ? -19.977 -37.327 -26.125 1.00 93.37  ? 188 ILE A CG2 1 
ATOM   1126 C  CD1 . ILE A 1 188 ? -18.524 -37.745 -28.928 1.00 89.53  ? 188 ILE A CD1 1 
ATOM   1127 N  N   . VAL A 1 189 ? -19.436 -38.601 -23.264 1.00 77.51  ? 189 VAL A N   1 
ATOM   1128 C  CA  . VAL A 1 189 ? -20.387 -38.917 -22.216 1.00 74.28  ? 189 VAL A CA  1 
ATOM   1129 C  C   . VAL A 1 189 ? -21.300 -37.723 -21.972 1.00 73.42  ? 189 VAL A C   1 
ATOM   1130 O  O   . VAL A 1 189 ? -20.849 -36.575 -21.914 1.00 73.54  ? 189 VAL A O   1 
ATOM   1131 C  CB  . VAL A 1 189 ? -19.657 -39.259 -20.918 1.00 73.89  ? 189 VAL A CB  1 
ATOM   1132 C  CG1 . VAL A 1 189 ? -20.642 -39.462 -19.794 1.00 71.94  ? 189 VAL A CG1 1 
ATOM   1133 C  CG2 . VAL A 1 189 ? -18.806 -40.498 -21.118 1.00 71.23  ? 189 VAL A CG2 1 
ATOM   1134 N  N   . ARG A 1 190 ? -22.588 -37.991 -21.811 1.00 58.24  ? 190 ARG A N   1 
ATOM   1135 C  CA  . ARG A 1 190 ? -23.542 -36.912 -21.630 1.00 58.48  ? 190 ARG A CA  1 
ATOM   1136 C  C   . ARG A 1 190 ? -24.177 -36.925 -20.255 1.00 58.87  ? 190 ARG A C   1 
ATOM   1137 O  O   . ARG A 1 190 ? -24.245 -37.968 -19.591 1.00 55.78  ? 190 ARG A O   1 
ATOM   1138 C  CB  . ARG A 1 190 ? -24.644 -36.958 -22.684 1.00 58.23  ? 190 ARG A CB  1 
ATOM   1139 C  CG  . ARG A 1 190 ? -24.143 -36.990 -24.108 1.00 64.61  ? 190 ARG A CG  1 
ATOM   1140 C  CD  . ARG A 1 190 ? -23.301 -35.772 -24.430 1.00 71.09  ? 190 ARG A CD  1 
ATOM   1141 N  NE  . ARG A 1 190 ? -24.066 -34.528 -24.550 1.00 72.73  ? 190 ARG A NE  1 
ATOM   1142 C  CZ  . ARG A 1 190 ? -24.731 -34.158 -25.645 1.00 73.21  ? 190 ARG A CZ  1 
ATOM   1143 N  NH1 . ARG A 1 190 ? -24.766 -34.955 -26.709 1.00 71.76  1 190 ARG A NH1 1 
ATOM   1144 N  NH2 . ARG A 1 190 ? -25.382 -32.999 -25.676 1.00 72.03  ? 190 ARG A NH2 1 
ATOM   1145 N  N   . THR A 1 191 ? -24.630 -35.750 -19.828 1.00 70.56  ? 191 THR A N   1 
ATOM   1146 C  CA  . THR A 1 191 ? -25.310 -35.609 -18.550 1.00 75.52  ? 191 THR A CA  1 
ATOM   1147 C  C   . THR A 1 191 ? -26.625 -34.876 -18.740 1.00 75.29  ? 191 THR A C   1 
ATOM   1148 O  O   . THR A 1 191 ? -26.763 -34.077 -19.662 1.00 76.20  ? 191 THR A O   1 
ATOM   1149 C  CB  . THR A 1 191 ? -24.455 -34.809 -17.576 1.00 77.39  ? 191 THR A CB  1 
ATOM   1150 O  OG1 . THR A 1 191 ? -24.220 -33.508 -18.122 1.00 81.69  ? 191 THR A OG1 1 
ATOM   1151 C  CG2 . THR A 1 191 ? -23.143 -35.500 -17.390 1.00 81.25  ? 191 THR A CG2 1 
ATOM   1152 N  N   . PRO A 1 192 ? -27.601 -35.138 -17.860 1.00 57.94  ? 192 PRO A N   1 
ATOM   1153 C  CA  . PRO A 1 192 ? -28.888 -34.443 -17.932 1.00 62.19  ? 192 PRO A CA  1 
ATOM   1154 C  C   . PRO A 1 192 ? -28.699 -32.948 -17.803 1.00 71.42  ? 192 PRO A C   1 
ATOM   1155 O  O   . PRO A 1 192 ? -27.885 -32.484 -17.003 1.00 69.08  ? 192 PRO A O   1 
ATOM   1156 C  CB  . PRO A 1 192 ? -29.626 -34.951 -16.696 1.00 57.59  ? 192 PRO A CB  1 
ATOM   1157 C  CG  . PRO A 1 192 ? -29.041 -36.284 -16.453 1.00 52.66  ? 192 PRO A CG  1 
ATOM   1158 C  CD  . PRO A 1 192 ? -27.585 -36.155 -16.798 1.00 55.04  ? 192 PRO A CD  1 
ATOM   1159 N  N   . THR A 1 193 ? -29.447 -32.196 -18.590 1.00 96.69  ? 193 THR A N   1 
ATOM   1160 C  CA  . THR A 1 193 ? -29.347 -30.758 -18.558 1.00 96.69  ? 193 THR A CA  1 
ATOM   1161 C  C   . THR A 1 193 ? -29.957 -30.264 -17.262 1.00 96.69  ? 193 THR A C   1 
ATOM   1162 O  O   . THR A 1 193 ? -29.615 -29.194 -16.763 1.00 96.69  ? 193 THR A O   1 
ATOM   1163 C  CB  . THR A 1 193 ? -30.085 -30.146 -19.720 1.00 86.69  ? 193 THR A CB  1 
ATOM   1164 O  OG1 . THR A 1 193 ? -31.489 -30.350 -19.540 1.00 86.69  ? 193 THR A OG1 1 
ATOM   1165 C  CG2 . THR A 1 193 ? -29.674 -30.839 -20.968 1.00 86.69  ? 193 THR A CG2 1 
ATOM   1166 N  N   . ASN A 1 194 ? -30.891 -31.047 -16.738 1.00 162.00 ? 194 ASN A N   1 
ATOM   1167 C  CA  . ASN A 1 194 ? -31.654 -30.650 -15.569 1.00 154.99 ? 194 ASN A CA  1 
ATOM   1168 C  C   . ASN A 1 194 ? -30.921 -30.863 -14.250 1.00 148.92 ? 194 ASN A C   1 
ATOM   1169 O  O   . ASN A 1 194 ? -31.359 -30.386 -13.204 1.00 149.17 ? 194 ASN A O   1 
ATOM   1170 C  CB  . ASN A 1 194 ? -32.986 -31.400 -15.548 1.00 55.70  ? 194 ASN A CB  1 
ATOM   1171 N  N   . ALA A 1 195 ? -29.797 -31.565 -14.303 1.00 81.25  ? 195 ALA A N   1 
ATOM   1172 C  CA  . ALA A 1 195 ? -29.060 -31.901 -13.091 1.00 75.94  ? 195 ALA A CA  1 
ATOM   1173 C  C   . ALA A 1 195 ? -28.370 -30.694 -12.458 1.00 74.89  ? 195 ALA A C   1 
ATOM   1174 O  O   . ALA A 1 195 ? -27.757 -29.879 -13.153 1.00 73.46  ? 195 ALA A O   1 
ATOM   1175 C  CB  . ALA A 1 195 ? -28.045 -32.986 -13.382 1.00 71.11  ? 195 ALA A CB  1 
ATOM   1176 N  N   . ARG A 1 196 ? -28.480 -30.587 -11.137 1.00 101.05 ? 196 ARG A N   1 
ATOM   1177 C  CA  . ARG A 1 196 ? -27.795 -29.548 -10.385 1.00 102.33 ? 196 ARG A CA  1 
ATOM   1178 C  C   . ARG A 1 196 ? -26.361 -29.992 -10.163 1.00 105.28 ? 196 ARG A C   1 
ATOM   1179 O  O   . ARG A 1 196 ? -26.111 -31.173 -9.915  1.00 106.34 ? 196 ARG A O   1 
ATOM   1180 C  CB  . ARG A 1 196 ? -28.479 -29.330 -9.040  1.00 100.91 ? 196 ARG A CB  1 
ATOM   1181 C  CG  . ARG A 1 196 ? -29.860 -28.709 -9.130  1.00 94.64  ? 196 ARG A CG  1 
ATOM   1182 C  CD  . ARG A 1 196 ? -29.755 -27.196 -9.057  1.00 88.50  ? 196 ARG A CD  1 
ATOM   1183 N  NE  . ARG A 1 196 ? -29.077 -26.767 -7.836  1.00 86.83  ? 196 ARG A NE  1 
ATOM   1184 C  CZ  . ARG A 1 196 ? -28.732 -25.510 -7.576  1.00 86.33  ? 196 ARG A CZ  1 
ATOM   1185 N  NH1 . ARG A 1 196 ? -28.991 -24.548 -8.457  1.00 82.41  1 196 ARG A NH1 1 
ATOM   1186 N  NH2 . ARG A 1 196 ? -28.115 -25.214 -6.442  1.00 88.63  ? 196 ARG A NH2 1 
ATOM   1187 N  N   . PHE A 1 197 ? -25.424 -29.050 -10.224 1.00 84.46  ? 197 PHE A N   1 
ATOM   1188 C  CA  . PHE A 1 197 ? -23.999 -29.376 -10.148 1.00 87.56  ? 197 PHE A CA  1 
ATOM   1189 C  C   . PHE A 1 197 ? -23.603 -30.138 -8.885  1.00 92.67  ? 197 PHE A C   1 
ATOM   1190 O  O   . PHE A 1 197 ? -22.583 -30.831 -8.870  1.00 93.08  ? 197 PHE A O   1 
ATOM   1191 C  CB  . PHE A 1 197 ? -23.148 -28.117 -10.255 1.00 84.10  ? 197 PHE A CB  1 
ATOM   1192 C  CG  . PHE A 1 197 ? -23.266 -27.211 -9.072  1.00 79.99  ? 197 PHE A CG  1 
ATOM   1193 C  CD1 . PHE A 1 197 ? -22.286 -27.206 -8.088  1.00 77.23  ? 197 PHE A CD1 1 
ATOM   1194 C  CD2 . PHE A 1 197 ? -24.366 -26.383 -8.924  1.00 77.20  ? 197 PHE A CD2 1 
ATOM   1195 C  CE1 . PHE A 1 197 ? -22.390 -26.380 -6.995  1.00 75.95  ? 197 PHE A CE1 1 
ATOM   1196 C  CE2 . PHE A 1 197 ? -24.473 -25.555 -7.831  1.00 75.38  ? 197 PHE A CE2 1 
ATOM   1197 C  CZ  . PHE A 1 197 ? -23.481 -25.554 -6.866  1.00 75.41  ? 197 PHE A CZ  1 
ATOM   1198 N  N   . ASP A 1 198 ? -24.401 -30.003 -7.833  1.00 98.03  ? 198 ASP A N   1 
ATOM   1199 C  CA  . ASP A 1 198 ? -24.194 -30.775 -6.619  1.00 101.72 ? 198 ASP A CA  1 
ATOM   1200 C  C   . ASP A 1 198 ? -24.333 -32.242 -6.940  1.00 97.04  ? 198 ASP A C   1 
ATOM   1201 O  O   . ASP A 1 198 ? -23.505 -33.064 -6.540  1.00 101.09 ? 198 ASP A O   1 
ATOM   1202 C  CB  . ASP A 1 198 ? -25.252 -30.414 -5.590  1.00 107.61 ? 198 ASP A CB  1 
ATOM   1203 C  CG  . ASP A 1 198 ? -25.153 -28.981 -5.148  1.00 115.89 ? 198 ASP A CG  1 
ATOM   1204 O  OD1 . ASP A 1 198 ? -24.023 -28.445 -5.174  1.00 121.35 ? 198 ASP A OD1 1 
ATOM   1205 O  OD2 . ASP A 1 198 ? -26.194 -28.393 -4.780  1.00 121.31 1 198 ASP A OD2 1 
ATOM   1206 N  N   . SER A 1 199 ? -25.410 -32.559 -7.646  1.00 87.89  ? 199 SER A N   1 
ATOM   1207 C  CA  . SER A 1 199 ? -25.813 -33.932 -7.873  1.00 77.28  ? 199 SER A CA  1 
ATOM   1208 C  C   . SER A 1 199 ? -24.728 -34.720 -8.552  1.00 70.59  ? 199 SER A C   1 
ATOM   1209 O  O   . SER A 1 199 ? -23.892 -34.159 -9.262  1.00 65.51  ? 199 SER A O   1 
ATOM   1210 C  CB  . SER A 1 199 ? -27.072 -33.983 -8.727  1.00 79.05  ? 199 SER A CB  1 
ATOM   1211 O  OG  . SER A 1 199 ? -26.881 -33.220 -9.904  1.00 80.83  ? 199 SER A OG  1 
ATOM   1212 N  N   . PRO A 1 200 ? -24.730 -36.034 -8.329  1.00 65.25  ? 200 PRO A N   1 
ATOM   1213 C  CA  . PRO A 1 200 ? -23.808 -36.918 -9.036  1.00 67.32  ? 200 PRO A CA  1 
ATOM   1214 C  C   . PRO A 1 200 ? -23.953 -36.868 -10.551 1.00 72.35  ? 200 PRO A C   1 
ATOM   1215 O  O   . PRO A 1 200 ? -22.964 -37.084 -11.242 1.00 73.22  ? 200 PRO A O   1 
ATOM   1216 C  CB  . PRO A 1 200 ? -24.208 -38.316 -8.536  1.00 64.71  ? 200 PRO A CB  1 
ATOM   1217 C  CG  . PRO A 1 200 ? -25.447 -38.119 -7.704  1.00 60.58  ? 200 PRO A CG  1 
ATOM   1218 C  CD  . PRO A 1 200 ? -25.398 -36.719 -7.216  1.00 62.59  ? 200 PRO A CD  1 
ATOM   1219 N  N   . GLU A 1 201 ? -25.137 -36.546 -11.060 1.00 91.00  ? 201 GLU A N   1 
ATOM   1220 C  CA  . GLU A 1 201 ? -25.394 -36.694 -12.491 1.00 96.60  ? 201 GLU A CA  1 
ATOM   1221 C  C   . GLU A 1 201 ? -24.927 -35.524 -13.325 1.00 99.31  ? 201 GLU A C   1 
ATOM   1222 O  O   . GLU A 1 201 ? -24.906 -35.608 -14.548 1.00 101.23 ? 201 GLU A O   1 
ATOM   1223 C  CB  . GLU A 1 201 ? -26.872 -36.956 -12.773 1.00 96.71  ? 201 GLU A CB  1 
ATOM   1224 C  CG  . GLU A 1 201 ? -27.352 -38.315 -12.325 1.00 98.65  ? 201 GLU A CG  1 
ATOM   1225 C  CD  . GLU A 1 201 ? -27.523 -38.392 -10.825 1.00 100.55 ? 201 GLU A CD  1 
ATOM   1226 O  OE1 . GLU A 1 201 ? -27.773 -37.330 -10.209 1.00 101.73 ? 201 GLU A OE1 1 
ATOM   1227 O  OE2 . GLU A 1 201 ? -27.396 -39.507 -10.269 1.00 100.45 1 201 GLU A OE2 1 
ATOM   1228 N  N   . SER A 1 202 ? -24.552 -34.434 -12.675 1.00 82.01  ? 202 SER A N   1 
ATOM   1229 C  CA  . SER A 1 202 ? -24.096 -33.263 -13.404 1.00 80.94  ? 202 SER A CA  1 
ATOM   1230 C  C   . SER A 1 202 ? -22.770 -33.589 -14.074 1.00 80.01  ? 202 SER A C   1 
ATOM   1231 O  O   . SER A 1 202 ? -22.092 -34.552 -13.703 1.00 83.21  ? 202 SER A O   1 
ATOM   1232 C  CB  . SER A 1 202 ? -23.939 -32.069 -12.469 1.00 78.45  ? 202 SER A CB  1 
ATOM   1233 O  OG  . SER A 1 202 ? -22.778 -32.202 -11.661 1.00 75.54  ? 202 SER A OG  1 
ATOM   1234 N  N   . HIS A 1 203 ? -22.422 -32.811 -15.091 1.00 83.80  ? 203 HIS A N   1 
ATOM   1235 C  CA  . HIS A 1 203 ? -21.211 -33.071 -15.856 1.00 77.95  ? 203 HIS A CA  1 
ATOM   1236 C  C   . HIS A 1 203 ? -19.967 -33.108 -14.984 1.00 76.38  ? 203 HIS A C   1 
ATOM   1237 O  O   . HIS A 1 203 ? -19.127 -33.986 -15.131 1.00 74.68  ? 203 HIS A O   1 
ATOM   1238 C  CB  . HIS A 1 203 ? -21.055 -32.080 -17.011 1.00 76.02  ? 203 HIS A CB  1 
ATOM   1239 C  CG  . HIS A 1 203 ? -21.069 -30.640 -16.592 1.00 71.96  ? 203 HIS A CG  1 
ATOM   1240 N  ND1 . HIS A 1 203 ? -21.939 -30.141 -15.645 1.00 70.70  ? 203 HIS A ND1 1 
ATOM   1241 C  CD2 . HIS A 1 203 ? -20.326 -29.588 -16.999 1.00 69.55  ? 203 HIS A CD2 1 
ATOM   1242 C  CE1 . HIS A 1 203 ? -21.727 -28.851 -15.488 1.00 69.51  ? 203 HIS A CE1 1 
ATOM   1243 N  NE2 . HIS A 1 203 ? -20.755 -28.485 -16.302 1.00 69.19  ? 203 HIS A NE2 1 
ATOM   1244 N  N   . VAL A 1 204 ? -19.862 -32.165 -14.060 1.00 67.29  ? 204 VAL A N   1 
ATOM   1245 C  CA  . VAL A 1 204 ? -18.747 -32.154 -13.129 1.00 66.02  ? 204 VAL A CA  1 
ATOM   1246 C  C   . VAL A 1 204 ? -18.688 -33.447 -12.325 1.00 69.14  ? 204 VAL A C   1 
ATOM   1247 O  O   . VAL A 1 204 ? -17.632 -34.089 -12.238 1.00 72.31  ? 204 VAL A O   1 
ATOM   1248 C  CB  . VAL A 1 204 ? -18.845 -30.978 -12.167 1.00 63.17  ? 204 VAL A CB  1 
ATOM   1249 C  CG1 . VAL A 1 204 ? -17.571 -30.858 -11.373 1.00 57.48  ? 204 VAL A CG1 1 
ATOM   1250 C  CG2 . VAL A 1 204 ? -19.113 -29.706 -12.949 1.00 55.67  ? 204 VAL A CG2 1 
ATOM   1251 N  N   . GLY A 1 205 ? -19.829 -33.823 -11.754 1.00 71.41  ? 205 GLY A N   1 
ATOM   1252 C  CA  . GLY A 1 205 ? -19.926 -35.027 -10.949 1.00 70.70  ? 205 GLY A CA  1 
ATOM   1253 C  C   . GLY A 1 205 ? -19.511 -36.261 -11.725 1.00 70.59  ? 205 GLY A C   1 
ATOM   1254 O  O   . GLY A 1 205 ? -18.646 -37.041 -11.285 1.00 70.14  ? 205 GLY A O   1 
ATOM   1255 N  N   . VAL A 1 206 ? -20.134 -36.444 -12.885 1.00 80.59  ? 206 VAL A N   1 
ATOM   1256 C  CA  . VAL A 1 206 ? -19.825 -37.583 -13.734 1.00 81.02  ? 206 VAL A CA  1 
ATOM   1257 C  C   . VAL A 1 206 ? -18.339 -37.607 -14.080 1.00 82.19  ? 206 VAL A C   1 
ATOM   1258 O  O   . VAL A 1 206 ? -17.689 -38.659 -14.044 1.00 82.09  ? 206 VAL A O   1 
ATOM   1259 C  CB  . VAL A 1 206 ? -20.621 -37.528 -15.033 1.00 80.71  ? 206 VAL A CB  1 
ATOM   1260 C  CG1 . VAL A 1 206 ? -20.254 -38.702 -15.911 1.00 79.79  ? 206 VAL A CG1 1 
ATOM   1261 C  CG2 . VAL A 1 206 ? -22.098 -37.545 -14.728 1.00 79.18  ? 206 VAL A CG2 1 
ATOM   1262 N  N   . ALA A 1 207 ? -17.805 -36.431 -14.388 1.00 64.97  ? 207 ALA A N   1 
ATOM   1263 C  CA  . ALA A 1 207 ? -16.403 -36.292 -14.733 1.00 66.21  ? 207 ALA A CA  1 
ATOM   1264 C  C   . ALA A 1 207 ? -15.547 -36.828 -13.602 1.00 66.53  ? 207 ALA A C   1 
ATOM   1265 O  O   . ALA A 1 207 ? -14.663 -37.669 -13.809 1.00 65.18  ? 207 ALA A O   1 
ATOM   1266 C  CB  . ALA A 1 207 ? -16.068 -34.838 -14.994 1.00 69.07  ? 207 ALA A CB  1 
ATOM   1267 N  N   . TRP A 1 208 ? -15.828 -36.352 -12.397 1.00 65.48  ? 208 TRP A N   1 
ATOM   1268 C  CA  . TRP A 1 208 ? -15.023 -36.725 -11.250 1.00 67.65  ? 208 TRP A CA  1 
ATOM   1269 C  C   . TRP A 1 208 ? -15.110 -38.217 -10.969 1.00 67.43  ? 208 TRP A C   1 
ATOM   1270 O  O   . TRP A 1 208 ? -14.107 -38.853 -10.615 1.00 65.85  ? 208 TRP A O   1 
ATOM   1271 C  CB  . TRP A 1 208 ? -15.398 -35.900 -10.031 1.00 70.25  ? 208 TRP A CB  1 
ATOM   1272 C  CG  . TRP A 1 208 ? -14.748 -34.568 -10.043 1.00 76.02  ? 208 TRP A CG  1 
ATOM   1273 C  CD1 . TRP A 1 208 ? -15.321 -33.370 -10.378 1.00 78.41  ? 208 TRP A CD1 1 
ATOM   1274 C  CD2 . TRP A 1 208 ? -13.388 -34.283 -9.711  1.00 80.99  ? 208 TRP A CD2 1 
ATOM   1275 N  NE1 . TRP A 1 208 ? -14.398 -32.355 -10.264 1.00 80.43  ? 208 TRP A NE1 1 
ATOM   1276 C  CE2 . TRP A 1 208 ? -13.203 -32.890 -9.857  1.00 81.48  ? 208 TRP A CE2 1 
ATOM   1277 C  CE3 . TRP A 1 208 ? -12.306 -35.069 -9.298  1.00 82.27  ? 208 TRP A CE3 1 
ATOM   1278 C  CZ2 . TRP A 1 208 ? -11.985 -32.269 -9.605  1.00 81.69  ? 208 TRP A CZ2 1 
ATOM   1279 C  CZ3 . TRP A 1 208 ? -11.102 -34.454 -9.047  1.00 82.71  ? 208 TRP A CZ3 1 
ATOM   1280 C  CH2 . TRP A 1 208 ? -10.948 -33.065 -9.201  1.00 82.37  ? 208 TRP A CH2 1 
ATOM   1281 N  N   A ARG A 1 209 ? -16.303 -38.778 -11.129 0.47 59.94  ? 209 ARG A N   1 
ATOM   1282 N  N   B ARG A 1 209 ? -16.300 -38.781 -11.142 0.53 59.94  ? 209 ARG A N   1 
ATOM   1283 C  CA  A ARG A 1 209 ? -16.500 -40.201 -10.875 0.47 63.25  ? 209 ARG A CA  1 
ATOM   1284 C  CA  B ARG A 1 209 ? -16.499 -40.200 -10.869 0.53 63.25  ? 209 ARG A CA  1 
ATOM   1285 C  C   A ARG A 1 209 ? -15.751 -41.063 -11.881 0.47 61.54  ? 209 ARG A C   1 
ATOM   1286 C  C   B ARG A 1 209 ? -15.770 -41.077 -11.884 0.53 61.54  ? 209 ARG A C   1 
ATOM   1287 O  O   A ARG A 1 209 ? -15.153 -42.087 -11.519 0.47 59.78  ? 209 ARG A O   1 
ATOM   1288 O  O   B ARG A 1 209 ? -15.194 -42.118 -11.529 0.53 59.78  ? 209 ARG A O   1 
ATOM   1289 C  CB  A ARG A 1 209 ? -17.987 -40.546 -10.853 0.47 66.58  ? 209 ARG A CB  1 
ATOM   1290 C  CB  B ARG A 1 209 ? -17.987 -40.536 -10.813 0.53 66.58  ? 209 ARG A CB  1 
ATOM   1291 C  CG  A ARG A 1 209 ? -18.687 -39.880 -9.691  0.47 79.91  ? 209 ARG A CG  1 
ATOM   1292 C  CG  B ARG A 1 209 ? -18.691 -39.901 -9.620  0.53 79.91  ? 209 ARG A CG  1 
ATOM   1293 C  CD  A ARG A 1 209 ? -20.144 -40.248 -9.564  0.47 94.73  ? 209 ARG A CD  1 
ATOM   1294 C  CD  B ARG A 1 209 ? -20.161 -40.254 -9.599  0.53 94.73  ? 209 ARG A CD  1 
ATOM   1295 N  NE  A ARG A 1 209 ? -20.659 -39.673 -8.329  0.47 99.77  ? 209 ARG A NE  1 
ATOM   1296 N  NE  B ARG A 1 209 ? -20.862 -39.692 -10.747 0.53 99.77  ? 209 ARG A NE  1 
ATOM   1297 C  CZ  A ARG A 1 209 ? -20.956 -38.387 -8.181  0.47 101.91 ? 209 ARG A CZ  1 
ATOM   1298 C  CZ  B ARG A 1 209 ? -22.158 -39.862 -10.986 0.53 101.91 ? 209 ARG A CZ  1 
ATOM   1299 N  NH1 A ARG A 1 209 ? -20.820 -37.553 -9.205  0.47 102.58 1 209 ARG A NH1 1 
ATOM   1300 N  NH1 B ARG A 1 209 ? -22.902 -40.580 -10.157 0.53 102.58 1 209 ARG A NH1 1 
ATOM   1301 N  NH2 A ARG A 1 209 ? -21.410 -37.936 -7.021  0.47 102.54 ? 209 ARG A NH2 1 
ATOM   1302 N  NH2 B ARG A 1 209 ? -22.711 -39.313 -12.057 0.53 102.54 ? 209 ARG A NH2 1 
ATOM   1303 N  N   . LEU A 1 210 ? -15.789 -40.654 -13.144 1.00 84.06  ? 210 LEU A N   1 
ATOM   1304 C  CA  . LEU A 1 210 ? -14.990 -41.302 -14.174 1.00 85.65  ? 210 LEU A CA  1 
ATOM   1305 C  C   . LEU A 1 210 ? -13.516 -41.228 -13.785 1.00 85.53  ? 210 LEU A C   1 
ATOM   1306 O  O   . LEU A 1 210 ? -12.792 -42.224 -13.866 1.00 85.03  ? 210 LEU A O   1 
ATOM   1307 C  CB  . LEU A 1 210 ? -15.192 -40.629 -15.526 1.00 86.98  ? 210 LEU A CB  1 
ATOM   1308 C  CG  . LEU A 1 210 ? -16.574 -40.703 -16.169 1.00 91.20  ? 210 LEU A CG  1 
ATOM   1309 C  CD1 . LEU A 1 210 ? -16.571 -39.918 -17.464 1.00 94.12  ? 210 LEU A CD1 1 
ATOM   1310 C  CD2 . LEU A 1 210 ? -16.967 -42.140 -16.433 1.00 95.77  ? 210 LEU A CD2 1 
ATOM   1311 N  N   . LYS A 1 211 ? -13.089 -40.048 -13.340 1.00 101.92 ? 211 LYS A N   1 
ATOM   1312 C  CA  . LYS A 1 211 ? -11.703 -39.827 -12.942 1.00 104.82 ? 211 LYS A CA  1 
ATOM   1313 C  C   . LYS A 1 211 ? -11.325 -40.815 -11.858 1.00 109.26 ? 211 LYS A C   1 
ATOM   1314 O  O   . LYS A 1 211 ? -10.195 -41.310 -11.817 1.00 108.06 ? 211 LYS A O   1 
ATOM   1315 C  CB  . LYS A 1 211 ? -11.495 -38.395 -12.454 1.00 102.86 ? 211 LYS A CB  1 
ATOM   1316 C  CG  . LYS A 1 211 ? -10.040 -38.004 -12.266 1.00 100.52 ? 211 LYS A CG  1 
ATOM   1317 C  CD  . LYS A 1 211 ? -9.579  -38.197 -10.834 1.00 99.50  ? 211 LYS A CD  1 
ATOM   1318 C  CE  . LYS A 1 211 ? -8.119  -37.802 -10.686 1.00 98.99  ? 211 LYS A CE  1 
ATOM   1319 N  NZ  . LYS A 1 211 ? -7.920  -36.329 -10.820 1.00 97.25  1 211 LYS A NZ  1 
ATOM   1320 N  N   . ASN A 1 212 ? -12.277 -41.097 -10.977 1.00 85.93  ? 212 ASN A N   1 
ATOM   1321 C  CA  . ASN A 1 212 ? -12.057 -42.103 -9.954  1.00 91.17  ? 212 ASN A CA  1 
ATOM   1322 C  C   . ASN A 1 212 ? -11.936 -43.485 -10.567 1.00 90.86  ? 212 ASN A C   1 
ATOM   1323 O  O   . ASN A 1 212 ? -11.161 -44.314 -10.084 1.00 93.21  ? 212 ASN A O   1 
ATOM   1324 C  CB  . ASN A 1 212 ? -13.155 -42.081 -8.897  1.00 94.74  ? 212 ASN A CB  1 
ATOM   1325 C  CG  . ASN A 1 212 ? -13.068 -40.868 -8.009  1.00 98.53  ? 212 ASN A CG  1 
ATOM   1326 O  OD1 . ASN A 1 212 ? -12.015 -40.229 -7.913  1.00 102.41 ? 212 ASN A OD1 1 
ATOM   1327 N  ND2 . ASN A 1 212 ? -14.175 -40.535 -7.354  1.00 102.43 ? 212 ASN A ND2 1 
ATOM   1328 N  N   . GLU A 1 213 ? -12.699 -43.748 -11.624 1.00 112.29 ? 213 GLU A N   1 
ATOM   1329 C  CA  . GLU A 1 213 ? -12.629 -45.086 -12.216 1.00 110.26 ? 213 GLU A CA  1 
ATOM   1330 C  C   . GLU A 1 213 ? -11.524 -45.306 -13.264 1.00 107.76 ? 213 GLU A C   1 
ATOM   1331 O  O   . GLU A 1 213 ? -11.274 -46.444 -13.668 1.00 104.95 ? 213 GLU A O   1 
ATOM   1332 C  CB  . GLU A 1 213 ? -13.987 -45.518 -12.764 1.00 111.97 ? 213 GLU A CB  1 
ATOM   1333 C  CG  . GLU A 1 213 ? -15.091 -45.487 -11.722 1.00 121.17 ? 213 GLU A CG  1 
ATOM   1334 C  CD  . GLU A 1 213 ? -14.768 -46.345 -10.508 1.00 129.43 ? 213 GLU A CD  1 
ATOM   1335 O  OE1 . GLU A 1 213 ? -14.106 -47.396 -10.674 1.00 131.61 ? 213 GLU A OE1 1 
ATOM   1336 O  OE2 . GLU A 1 213 ? -15.174 -45.964 -9.386  1.00 131.60 1 213 GLU A OE2 1 
ATOM   1337 N  N   . ILE A 1 214 ? -10.883 -44.233 -13.720 1.00 98.35  ? 214 ILE A N   1 
ATOM   1338 C  CA  . ILE A 1 214 ? -9.795  -44.367 -14.688 1.00 100.82 ? 214 ILE A CA  1 
ATOM   1339 C  C   . ILE A 1 214 ? -8.406  -44.099 -14.114 1.00 101.65 ? 214 ILE A C   1 
ATOM   1340 O  O   . ILE A 1 214 ? -8.152  -43.026 -13.561 1.00 101.55 ? 214 ILE A O   1 
ATOM   1341 C  CB  . ILE A 1 214 ? -10.006 -43.481 -15.915 1.00 101.50 ? 214 ILE A CB  1 
ATOM   1342 C  CG1 . ILE A 1 214 ? -11.168 -44.012 -16.741 1.00 103.05 ? 214 ILE A CG1 1 
ATOM   1343 C  CG2 . ILE A 1 214 ? -8.766  -43.473 -16.782 1.00 102.58 ? 214 ILE A CG2 1 
ATOM   1344 C  CD1 . ILE A 1 214 ? -12.227 -42.990 -16.981 1.00 103.17 ? 214 ILE A CD1 1 
ATOM   1345 N  N   . PRO A 1 215 ? -7.496  -45.077 -14.263 1.00 96.81  ? 215 PRO A N   1 
ATOM   1346 C  CA  . PRO A 1 215 ? -6.090  -44.967 -13.859 1.00 98.82  ? 215 PRO A CA  1 
ATOM   1347 C  C   . PRO A 1 215 ? -5.339  -43.904 -14.652 1.00 101.41 ? 215 PRO A C   1 
ATOM   1348 O  O   . PRO A 1 215 ? -5.541  -43.794 -15.869 1.00 100.34 ? 215 PRO A O   1 
ATOM   1349 C  CB  . PRO A 1 215 ? -5.517  -46.343 -14.211 1.00 98.85  ? 215 PRO A CB  1 
ATOM   1350 C  CG  . PRO A 1 215 ? -6.689  -47.244 -14.284 1.00 98.36  ? 215 PRO A CG  1 
ATOM   1351 C  CD  . PRO A 1 215 ? -7.807  -46.407 -14.811 1.00 97.63  ? 215 PRO A CD  1 
ATOM   1352 N  N   . ASN A 1 216 ? -4.485  -43.143 -13.973 1.00 121.15 ? 216 ASN A N   1 
ATOM   1353 C  CA  . ASN A 1 216 ? -3.642  -42.145 -14.631 1.00 124.30 ? 216 ASN A CA  1 
ATOM   1354 C  C   . ASN A 1 216 ? -4.426  -41.172 -15.496 1.00 121.86 ? 216 ASN A C   1 
ATOM   1355 O  O   . ASN A 1 216 ? -4.037  -40.864 -16.622 1.00 125.15 ? 216 ASN A O   1 
ATOM   1356 C  CB  . ASN A 1 216 ? -2.538  -42.812 -15.454 1.00 127.65 ? 216 ASN A CB  1 
ATOM   1357 C  CG  . ASN A 1 216 ? -1.491  -43.481 -14.587 1.00 132.09 ? 216 ASN A CG  1 
ATOM   1358 O  OD1 . ASN A 1 216 ? -1.444  -43.269 -13.372 1.00 135.05 ? 216 ASN A OD1 1 
ATOM   1359 N  ND2 . ASN A 1 216 ? -0.634  -44.283 -15.208 1.00 135.00 ? 216 ASN A ND2 1 
ATOM   1360 N  N   . SER A 1 217 ? -5.544  -40.705 -14.964 1.00 94.79  ? 217 SER A N   1 
ATOM   1361 C  CA  . SER A 1 217 ? -6.393  -39.765 -15.670 1.00 85.81  ? 217 SER A CA  1 
ATOM   1362 C  C   . SER A 1 217 ? -6.430  -38.454 -14.920 1.00 78.91  ? 217 SER A C   1 
ATOM   1363 O  O   . SER A 1 217 ? -6.410  -38.437 -13.691 1.00 78.90  ? 217 SER A O   1 
ATOM   1364 C  CB  . SER A 1 217 ? -7.799  -40.327 -15.778 1.00 86.50  ? 217 SER A CB  1 
ATOM   1365 O  OG  . SER A 1 217 ? -8.281  -40.673 -14.490 1.00 86.65  ? 217 SER A OG  1 
ATOM   1366 N  N   . HIS A 1 218 ? -6.511  -37.352 -15.651 1.00 86.85  ? 218 HIS A N   1 
ATOM   1367 C  CA  . HIS A 1 218 ? -6.526  -36.047 -15.018 1.00 81.06  ? 218 HIS A CA  1 
ATOM   1368 C  C   . HIS A 1 218 ? -7.751  -35.254 -15.410 1.00 76.51  ? 218 HIS A C   1 
ATOM   1369 O  O   . HIS A 1 218 ? -8.344  -35.474 -16.463 1.00 75.19  ? 218 HIS A O   1 
ATOM   1370 C  CB  . HIS A 1 218 ? -5.285  -35.252 -15.412 1.00 81.38  ? 218 HIS A CB  1 
ATOM   1371 C  CG  . HIS A 1 218 ? -3.994  -35.950 -15.110 1.00 87.95  ? 218 HIS A CG  1 
ATOM   1372 N  ND1 . HIS A 1 218 ? -3.462  -36.921 -15.930 1.00 94.73  ? 218 HIS A ND1 1 
ATOM   1373 C  CD2 . HIS A 1 218 ? -3.130  -35.810 -14.081 1.00 94.67  ? 218 HIS A CD2 1 
ATOM   1374 C  CE1 . HIS A 1 218 ? -2.323  -37.348 -15.418 1.00 97.24  ? 218 HIS A CE1 1 
ATOM   1375 N  NE2 . HIS A 1 218 ? -2.098  -36.693 -14.296 1.00 97.24  ? 218 HIS A NE2 1 
ATOM   1376 N  N   . ILE A 1 219 ? -8.127  -34.320 -14.553 1.00 62.94  ? 219 ILE A N   1 
ATOM   1377 C  CA  . ILE A 1 219 ? -9.162  -33.366 -14.884 1.00 61.66  ? 219 ILE A CA  1 
ATOM   1378 C  C   . ILE A 1 219 ? -8.569  -31.984 -14.789 1.00 64.32  ? 219 ILE A C   1 
ATOM   1379 O  O   . ILE A 1 219 ? -8.221  -31.538 -13.695 1.00 64.31  ? 219 ILE A O   1 
ATOM   1380 C  CB  . ILE A 1 219 ? -10.309 -33.449 -13.900 1.00 59.76  ? 219 ILE A CB  1 
ATOM   1381 C  CG1 . ILE A 1 219 ? -10.975 -34.812 -14.000 1.00 56.55  ? 219 ILE A CG1 1 
ATOM   1382 C  CG2 . ILE A 1 219 ? -11.312 -32.337 -14.158 1.00 55.55  ? 219 ILE A CG2 1 
ATOM   1383 C  CD1 . ILE A 1 219 ? -12.216 -34.910 -13.143 1.00 55.50  ? 219 ILE A CD1 1 
ATOM   1384 N  N   . LEU A 1 220 ? -8.451  -31.292 -15.911 1.00 87.26  ? 220 LEU A N   1 
ATOM   1385 C  CA  . LEU A 1 220 ? -7.821  -29.985 -15.875 1.00 89.38  ? 220 LEU A CA  1 
ATOM   1386 C  C   . LEU A 1 220 ? -8.676  -28.960 -15.133 1.00 90.74  ? 220 LEU A C   1 
ATOM   1387 O  O   . LEU A 1 220 ? -8.141  -28.009 -14.542 1.00 93.35  ? 220 LEU A O   1 
ATOM   1388 C  CB  . LEU A 1 220 ? -7.478  -29.508 -17.278 1.00 88.92  ? 220 LEU A CB  1 
ATOM   1389 C  CG  . LEU A 1 220 ? -6.448  -30.364 -18.005 1.00 85.86  ? 220 LEU A CG  1 
ATOM   1390 C  CD1 . LEU A 1 220 ? -5.915  -29.617 -19.207 1.00 82.69  ? 220 LEU A CD1 1 
ATOM   1391 C  CD2 . LEU A 1 220 ? -5.319  -30.758 -17.065 1.00 80.85  ? 220 LEU A CD2 1 
ATOM   1392 N  N   . ASP A 1 221 ? -9.991  -29.169 -15.157 1.00 80.90  ? 221 ASP A N   1 
ATOM   1393 C  CA  . ASP A 1 221 ? -10.919 -28.357 -14.372 1.00 80.60  ? 221 ASP A CA  1 
ATOM   1394 C  C   . ASP A 1 221 ? -10.912 -26.851 -14.666 1.00 79.63  ? 221 ASP A C   1 
ATOM   1395 O  O   . ASP A 1 221 ? -10.438 -26.045 -13.860 1.00 77.34  ? 221 ASP A O   1 
ATOM   1396 C  CB  . ASP A 1 221 ? -10.726 -28.602 -12.879 1.00 81.18  ? 221 ASP A CB  1 
ATOM   1397 C  CG  . ASP A 1 221 ? -11.973 -28.297 -12.086 1.00 87.87  ? 221 ASP A CG  1 
ATOM   1398 O  OD1 . ASP A 1 221 ? -12.072 -28.758 -10.926 1.00 96.49  ? 221 ASP A OD1 1 
ATOM   1399 O  OD2 . ASP A 1 221 ? -12.861 -27.605 -12.640 1.00 96.46  1 221 ASP A OD2 1 
ATOM   1400 N  N   . GLN A 1 222 ? -11.452 -26.486 -15.822 1.00 76.26  ? 222 GLN A N   1 
ATOM   1401 C  CA  . GLN A 1 222 ? -11.502 -25.098 -16.274 1.00 77.79  ? 222 GLN A CA  1 
ATOM   1402 C  C   . GLN A 1 222 ? -12.166 -24.154 -15.284 1.00 76.73  ? 222 GLN A C   1 
ATOM   1403 O  O   . GLN A 1 222 ? -11.972 -22.937 -15.347 1.00 78.39  ? 222 GLN A O   1 
ATOM   1404 C  CB  . GLN A 1 222 ? -12.256 -25.036 -17.596 1.00 79.26  ? 222 GLN A CB  1 
ATOM   1405 C  CG  . GLN A 1 222 ? -13.558 -25.821 -17.539 1.00 82.26  ? 222 GLN A CG  1 
ATOM   1406 C  CD  . GLN A 1 222 ? -14.397 -25.656 -18.783 1.00 86.83  ? 222 GLN A CD  1 
ATOM   1407 O  OE1 . GLN A 1 222 ? -14.130 -24.788 -19.617 1.00 89.40  ? 222 GLN A OE1 1 
ATOM   1408 N  NE2 . GLN A 1 222 ? -15.407 -26.507 -18.929 1.00 88.18  ? 222 GLN A NE2 1 
ATOM   1409 N  N   . TYR A 1 223 ? -12.957 -24.709 -14.377 1.00 78.50  ? 223 TYR A N   1 
ATOM   1410 C  CA  . TYR A 1 223 ? -13.630 -23.884 -13.395 1.00 75.70  ? 223 TYR A CA  1 
ATOM   1411 C  C   . TYR A 1 223 ? -12.674 -23.475 -12.272 1.00 75.29  ? 223 TYR A C   1 
ATOM   1412 O  O   . TYR A 1 223 ? -12.753 -22.359 -11.761 1.00 73.56  ? 223 TYR A O   1 
ATOM   1413 C  CB  . TYR A 1 223 ? -14.848 -24.602 -12.832 1.00 74.67  ? 223 TYR A CB  1 
ATOM   1414 C  CG  . TYR A 1 223 ? -15.815 -25.072 -13.886 1.00 73.83  ? 223 TYR A CG  1 
ATOM   1415 C  CD1 . TYR A 1 223 ? -16.746 -24.199 -14.441 1.00 72.91  ? 223 TYR A CD1 1 
ATOM   1416 C  CD2 . TYR A 1 223 ? -15.816 -26.398 -14.313 1.00 74.28  ? 223 TYR A CD2 1 
ATOM   1417 C  CE1 . TYR A 1 223 ? -17.639 -24.631 -15.409 1.00 71.78  ? 223 TYR A CE1 1 
ATOM   1418 C  CE2 . TYR A 1 223 ? -16.708 -26.841 -15.275 1.00 72.73  ? 223 TYR A CE2 1 
ATOM   1419 C  CZ  . TYR A 1 223 ? -17.616 -25.954 -15.816 1.00 71.73  ? 223 TYR A CZ  1 
ATOM   1420 O  OH  . TYR A 1 223 ? -18.501 -26.392 -16.769 1.00 71.55  ? 223 TYR A OH  1 
ATOM   1421 N  N   . ARG A 1 224 ? -11.831 -24.400 -11.823 1.00 83.72  ? 224 ARG A N   1 
ATOM   1422 C  CA  . ARG A 1 224 ? -10.840 -24.054 -10.810 1.00 85.92  ? 224 ARG A CA  1 
ATOM   1423 C  C   . ARG A 1 224 ? -9.424  -23.763 -11.293 1.00 85.26  ? 224 ARG A C   1 
ATOM   1424 O  O   . ARG A 1 224 ? -8.572  -23.377 -10.487 1.00 85.10  ? 224 ARG A O   1 
ATOM   1425 C  CB  . ARG A 1 224 ? -10.778 -25.139 -9.749  1.00 87.44  ? 224 ARG A CB  1 
ATOM   1426 C  CG  . ARG A 1 224 ? -12.089 -25.357 -9.051  1.00 94.41  ? 224 ARG A CG  1 
ATOM   1427 C  CD  . ARG A 1 224 ? -11.987 -26.521 -8.108  1.00 105.20 ? 224 ARG A CD  1 
ATOM   1428 N  NE  . ARG A 1 224 ? -11.454 -27.712 -8.766  1.00 110.19 ? 224 ARG A NE  1 
ATOM   1429 C  CZ  . ARG A 1 224 ? -10.231 -28.188 -8.561  1.00 112.64 ? 224 ARG A CZ  1 
ATOM   1430 N  NH1 . ARG A 1 224 ? -9.415  -27.567 -7.715  1.00 113.58 1 224 ARG A NH1 1 
ATOM   1431 N  NH2 . ARG A 1 224 ? -9.821  -29.279 -9.198  1.00 113.52 ? 224 ARG A NH2 1 
ATOM   1432 N  N   . ASN A 1 225 ? -9.158  -23.934 -12.583 1.00 74.91  ? 225 ASN A N   1 
ATOM   1433 C  CA  . ASN A 1 225 ? -7.772  -23.887 -13.037 1.00 75.42  ? 225 ASN A CA  1 
ATOM   1434 C  C   . ASN A 1 225 ? -7.317  -22.482 -13.378 1.00 76.89  ? 225 ASN A C   1 
ATOM   1435 O  O   . ASN A 1 225 ? -7.964  -21.777 -14.154 1.00 76.60  ? 225 ASN A O   1 
ATOM   1436 C  CB  . ASN A 1 225 ? -7.533  -24.825 -14.213 1.00 74.46  ? 225 ASN A CB  1 
ATOM   1437 C  CG  . ASN A 1 225 ? -6.058  -25.050 -14.492 1.00 73.16  ? 225 ASN A CG  1 
ATOM   1438 O  OD1 . ASN A 1 225 ? -5.217  -24.171 -14.258 1.00 72.43  ? 225 ASN A OD1 1 
ATOM   1439 N  ND2 . ASN A 1 225 ? -5.734  -26.240 -14.990 1.00 70.57  ? 225 ASN A ND2 1 
ATOM   1440 N  N   . ALA A 1 226 ? -6.187  -22.091 -12.801 1.00 83.19  ? 226 ALA A N   1 
ATOM   1441 C  CA  . ALA A 1 226 ? -5.662  -20.750 -12.983 1.00 84.71  ? 226 ALA A CA  1 
ATOM   1442 C  C   . ALA A 1 226 ? -5.360  -20.499 -14.445 1.00 83.93  ? 226 ALA A C   1 
ATOM   1443 O  O   . ALA A 1 226 ? -5.458  -19.371 -14.937 1.00 84.54  ? 226 ALA A O   1 
ATOM   1444 C  CB  . ALA A 1 226 ? -4.416  -20.567 -12.155 1.00 87.90  ? 226 ALA A CB  1 
ATOM   1445 N  N   . SER A 1 227 ? -5.008  -21.571 -15.138 1.00 77.99  ? 227 SER A N   1 
ATOM   1446 C  CA  . SER A 1 227 ? -4.526  -21.465 -16.498 1.00 75.06  ? 227 SER A CA  1 
ATOM   1447 C  C   . SER A 1 227 ? -5.542  -20.837 -17.447 1.00 75.65  ? 227 SER A C   1 
ATOM   1448 O  O   . SER A 1 227 ? -5.157  -20.216 -18.420 1.00 74.82  ? 227 SER A O   1 
ATOM   1449 C  CB  . SER A 1 227 ? -4.106  -22.843 -17.005 1.00 73.67  ? 227 SER A CB  1 
ATOM   1450 O  OG  . SER A 1 227 ? -3.252  -23.482 -16.073 1.00 67.36  ? 227 SER A OG  1 
ATOM   1451 N  N   . ASN A 1 228 ? -6.831  -21.034 -17.195 1.00 79.30  ? 228 ASN A N   1 
ATOM   1452 C  CA  . ASN A 1 228 ? -7.866  -20.425 -18.030 1.00 81.04  ? 228 ASN A CA  1 
ATOM   1453 C  C   . ASN A 1 228 ? -7.924  -18.869 -17.977 1.00 82.36  ? 228 ASN A C   1 
ATOM   1454 O  O   . ASN A 1 228 ? -7.652  -18.175 -18.997 1.00 82.73  ? 228 ASN A O   1 
ATOM   1455 C  CB  . ASN A 1 228 ? -9.205  -21.138 -17.720 1.00 80.91  ? 228 ASN A CB  1 
ATOM   1456 C  CG  . ASN A 1 228 ? -10.442 -20.307 -18.034 1.00 80.85  ? 228 ASN A CG  1 
ATOM   1457 O  OD1 . ASN A 1 228 ? -10.449 -19.445 -18.916 1.00 83.12  ? 228 ASN A OD1 1 
ATOM   1458 N  ND2 . ASN A 1 228 ? -11.517 -20.591 -17.309 1.00 78.14  ? 228 ASN A ND2 1 
ATOM   1459 N  N   . PRO A 1 229 ? -8.191  -18.303 -16.781 1.00 83.30  ? 229 PRO A N   1 
ATOM   1460 C  CA  . PRO A 1 229 ? -8.248  -16.840 -16.772 1.00 84.17  ? 229 PRO A CA  1 
ATOM   1461 C  C   . PRO A 1 229 ? -6.864  -16.265 -16.986 1.00 84.86  ? 229 PRO A C   1 
ATOM   1462 O  O   . PRO A 1 229 ? -6.751  -15.142 -17.469 1.00 85.93  ? 229 PRO A O   1 
ATOM   1463 C  CB  . PRO A 1 229 ? -8.743  -16.513 -15.364 1.00 83.99  ? 229 PRO A CB  1 
ATOM   1464 C  CG  . PRO A 1 229 ? -8.304  -17.667 -14.549 1.00 83.21  ? 229 PRO A CG  1 
ATOM   1465 C  CD  . PRO A 1 229 ? -8.449  -18.860 -15.441 1.00 83.32  ? 229 PRO A CD  1 
ATOM   1466 N  N   . LEU A 1 230 ? -5.833  -17.021 -16.622 1.00 69.03  ? 230 LEU A N   1 
ATOM   1467 C  CA  . LEU A 1 230 ? -4.479  -16.569 -16.864 1.00 68.15  ? 230 LEU A CA  1 
ATOM   1468 C  C   . LEU A 1 230 ? -4.235  -16.474 -18.344 1.00 64.77  ? 230 LEU A C   1 
ATOM   1469 O  O   . LEU A 1 230 ? -3.604  -15.532 -18.811 1.00 64.50  ? 230 LEU A O   1 
ATOM   1470 C  CB  . LEU A 1 230 ? -3.462  -17.518 -16.258 1.00 70.67  ? 230 LEU A CB  1 
ATOM   1471 C  CG  . LEU A 1 230 ? -3.137  -17.228 -14.803 1.00 77.22  ? 230 LEU A CG  1 
ATOM   1472 C  CD1 . LEU A 1 230 ? -1.973  -18.091 -14.388 1.00 84.74  ? 230 LEU A CD1 1 
ATOM   1473 C  CD2 . LEU A 1 230 ? -2.800  -15.757 -14.653 1.00 83.75  ? 230 LEU A CD2 1 
ATOM   1474 N  N   . ALA A 1 231 ? -4.734  -17.458 -19.081 1.00 66.02  ? 231 ALA A N   1 
ATOM   1475 C  CA  . ALA A 1 231 ? -4.539  -17.495 -20.523 1.00 64.55  ? 231 ALA A CA  1 
ATOM   1476 C  C   . ALA A 1 231 ? -5.240  -16.298 -21.105 1.00 66.74  ? 231 ALA A C   1 
ATOM   1477 O  O   . ALA A 1 231 ? -4.748  -15.684 -22.054 1.00 63.73  ? 231 ALA A O   1 
ATOM   1478 C  CB  . ALA A 1 231 ? -5.081  -18.763 -21.126 1.00 60.94  ? 231 ALA A CB  1 
ATOM   1479 N  N   . HIS A 1 232 ? -6.390  -15.946 -20.541 1.00 76.46  ? 232 HIS A N   1 
ATOM   1480 C  CA  . HIS A 1 232 ? -7.023  -14.725 -21.022 1.00 84.34  ? 232 HIS A CA  1 
ATOM   1481 C  C   . HIS A 1 232 ? -6.281  -13.450 -20.608 1.00 88.87  ? 232 HIS A C   1 
ATOM   1482 O  O   . HIS A 1 232 ? -6.367  -12.419 -21.282 1.00 90.35  ? 232 HIS A O   1 
ATOM   1483 C  CB  . HIS A 1 232 ? -8.488  -14.671 -20.624 1.00 84.89  ? 232 HIS A CB  1 
ATOM   1484 C  CG  . HIS A 1 232 ? -9.369  -15.506 -21.496 1.00 86.43  ? 232 HIS A CG  1 
ATOM   1485 N  ND1 . HIS A 1 232 ? -9.677  -16.816 -21.210 1.00 87.92  ? 232 HIS A ND1 1 
ATOM   1486 C  CD2 . HIS A 1 232 ? -9.981  -15.223 -22.669 1.00 86.45  ? 232 HIS A CD2 1 
ATOM   1487 C  CE1 . HIS A 1 232 ? -10.463 -17.297 -22.155 1.00 88.03  ? 232 HIS A CE1 1 
ATOM   1488 N  NE2 . HIS A 1 232 ? -10.659 -16.349 -23.052 1.00 88.02  ? 232 HIS A NE2 1 
ATOM   1489 N  N   . TYR A 1 233 ? -5.540  -13.535 -19.511 1.00 102.92 ? 233 TYR A N   1 
ATOM   1490 C  CA  . TYR A 1 233 ? -4.828  -12.392 -18.957 1.00 106.47 ? 233 TYR A CA  1 
ATOM   1491 C  C   . TYR A 1 233 ? -3.604  -12.066 -19.797 1.00 105.86 ? 233 TYR A C   1 
ATOM   1492 O  O   . TYR A 1 233 ? -3.386  -10.919 -20.186 1.00 107.31 ? 233 TYR A O   1 
ATOM   1493 C  CB  . TYR A 1 233 ? -4.416  -12.702 -17.516 1.00 108.74 ? 233 TYR A CB  1 
ATOM   1494 C  CG  . TYR A 1 233 ? -3.658  -11.605 -16.802 1.00 114.61 ? 233 TYR A CG  1 
ATOM   1495 C  CD1 . TYR A 1 233 ? -4.329  -10.520 -16.252 1.00 118.83 ? 233 TYR A CD1 1 
ATOM   1496 C  CD2 . TYR A 1 233 ? -2.279  -11.683 -16.625 1.00 118.85 ? 233 TYR A CD2 1 
ATOM   1497 C  CE1 . TYR A 1 233 ? -3.648  -9.524  -15.580 1.00 120.36 ? 233 TYR A CE1 1 
ATOM   1498 C  CE2 . TYR A 1 233 ? -1.588  -10.693 -15.952 1.00 120.39 ? 233 TYR A CE2 1 
ATOM   1499 C  CZ  . TYR A 1 233 ? -2.279  -9.615  -15.431 1.00 120.84 ? 233 TYR A CZ  1 
ATOM   1500 O  OH  . TYR A 1 233 ? -1.603  -8.624  -14.758 1.00 121.25 ? 233 TYR A OH  1 
ATOM   1501 N  N   . ASP A 1 234 ? -2.813  -13.088 -20.084 1.00 94.16  ? 234 ASP A N   1 
ATOM   1502 C  CA  . ASP A 1 234 ? -1.545  -12.921 -20.767 1.00 91.20  ? 234 ASP A CA  1 
ATOM   1503 C  C   . ASP A 1 234 ? -1.716  -12.548 -22.231 1.00 87.98  ? 234 ASP A C   1 
ATOM   1504 O  O   . ASP A 1 234 ? -0.973  -11.717 -22.752 1.00 87.56  ? 234 ASP A O   1 
ATOM   1505 C  CB  . ASP A 1 234 ? -0.728  -14.206 -20.665 1.00 93.63  ? 234 ASP A CB  1 
ATOM   1506 C  CG  . ASP A 1 234 ? -0.276  -14.495 -19.251 1.00 95.99  ? 234 ASP A CG  1 
ATOM   1507 O  OD1 . ASP A 1 234 ? -0.026  -13.527 -18.499 1.00 97.68  ? 234 ASP A OD1 1 
ATOM   1508 O  OD2 . ASP A 1 234 ? -0.180  -15.687 -18.889 1.00 96.71  1 234 ASP A OD2 1 
ATOM   1509 N  N   . THR A 1 235 ? -2.692  -13.152 -22.898 1.00 85.61  ? 235 THR A N   1 
ATOM   1510 C  CA  . THR A 1 235 ? -2.763  -13.045 -24.350 1.00 81.58  ? 235 THR A CA  1 
ATOM   1511 C  C   . THR A 1 235 ? -3.897  -12.161 -24.847 1.00 81.38  ? 235 THR A C   1 
ATOM   1512 O  O   . THR A 1 235 ? -3.647  -11.104 -25.429 1.00 79.21  ? 235 THR A O   1 
ATOM   1513 C  CB  . THR A 1 235 ? -2.931  -14.424 -24.998 1.00 80.51  ? 235 THR A CB  1 
ATOM   1514 O  OG1 . THR A 1 235 ? -4.267  -14.887 -24.782 1.00 78.69  ? 235 THR A OG1 1 
ATOM   1515 C  CG2 . THR A 1 235 ? -1.950  -15.412 -24.392 1.00 79.00  ? 235 THR A CG2 1 
ATOM   1516 N  N   . THR A 1 236 ? -5.133  -12.611 -24.638 1.00 72.47  ? 236 THR A N   1 
ATOM   1517 C  CA  . THR A 1 236 ? -6.309  -11.934 -25.185 1.00 74.27  ? 236 THR A CA  1 
ATOM   1518 C  C   . THR A 1 236 ? -6.304  -10.443 -24.880 1.00 73.01  ? 236 THR A C   1 
ATOM   1519 O  O   . THR A 1 236 ? -6.453  -9.609  -25.783 1.00 73.18  ? 236 THR A O   1 
ATOM   1520 C  CB  . THR A 1 236 ? -7.618  -12.539 -24.652 1.00 76.28  ? 236 THR A CB  1 
ATOM   1521 O  OG1 . THR A 1 236 ? -7.620  -13.955 -24.871 1.00 79.72  ? 236 THR A OG1 1 
ATOM   1522 C  CG2 . THR A 1 236 ? -8.797  -11.937 -25.377 1.00 78.57  ? 236 THR A CG2 1 
ATOM   1523 N  N   . ALA A 1 237 ? -6.108  -10.111 -23.611 1.00 100.20 ? 237 ALA A N   1 
ATOM   1524 C  CA  . ALA A 1 237 ? -6.088  -8.719  -23.195 1.00 101.28 ? 237 ALA A CA  1 
ATOM   1525 C  C   . ALA A 1 237 ? -5.016  -7.941  -23.940 1.00 105.05 ? 237 ALA A C   1 
ATOM   1526 O  O   . ALA A 1 237 ? -5.293  -6.869  -24.478 1.00 103.49 ? 237 ALA A O   1 
ATOM   1527 C  CB  . ALA A 1 237 ? -5.863  -8.616  -21.712 1.00 95.51  ? 237 ALA A CB  1 
ATOM   1528 N  N   . ASP A 1 238 ? -3.800  -8.480  -23.960 1.00 99.88  ? 238 ASP A N   1 
ATOM   1529 C  CA  . ASP A 1 238 ? -2.699  -7.866  -24.692 1.00 107.58 ? 238 ASP A CA  1 
ATOM   1530 C  C   . ASP A 1 238 ? -3.091  -7.596  -26.133 1.00 105.96 ? 238 ASP A C   1 
ATOM   1531 O  O   . ASP A 1 238 ? -2.824  -6.519  -26.661 1.00 105.71 ? 238 ASP A O   1 
ATOM   1532 C  CB  . ASP A 1 238 ? -1.458  -8.754  -24.652 1.00 116.10 ? 238 ASP A CB  1 
ATOM   1533 C  CG  . ASP A 1 238 ? -0.602  -8.501  -23.425 1.00 129.03 ? 238 ASP A CG  1 
ATOM   1534 O  OD1 . ASP A 1 238 ? -1.154  -8.052  -22.395 1.00 138.70 ? 238 ASP A OD1 1 
ATOM   1535 O  OD2 . ASP A 1 238 ? 0.623   -8.748  -23.490 1.00 138.72 1 238 ASP A OD2 1 
ATOM   1536 N  N   . GLU A 1 239 ? -3.723  -8.582  -26.765 1.00 101.07 ? 239 GLU A N   1 
ATOM   1537 C  CA  . GLU A 1 239 ? -4.162  -8.440  -28.147 1.00 98.47  ? 239 GLU A CA  1 
ATOM   1538 C  C   . GLU A 1 239 ? -5.134  -7.283  -28.296 1.00 97.40  ? 239 GLU A C   1 
ATOM   1539 O  O   . GLU A 1 239 ? -5.004  -6.471  -29.211 1.00 98.24  ? 239 GLU A O   1 
ATOM   1540 C  CB  . GLU A 1 239 ? -4.821  -9.726  -28.646 1.00 96.74  ? 239 GLU A CB  1 
ATOM   1541 C  CG  . GLU A 1 239 ? -3.887  -10.918 -28.689 1.00 95.05  ? 239 GLU A CG  1 
ATOM   1542 C  CD  . GLU A 1 239 ? -4.543  -12.156 -29.283 1.00 93.02  ? 239 GLU A CD  1 
ATOM   1543 O  OE1 . GLU A 1 239 ? -3.994  -13.264 -29.111 1.00 91.12  ? 239 GLU A OE1 1 
ATOM   1544 O  OE2 . GLU A 1 239 ? -5.602  -12.018 -29.935 1.00 92.81  1 239 GLU A OE2 1 
ATOM   1545 N  N   . ILE A 1 240 ? -6.102  -7.200  -27.392 1.00 100.91 ? 240 ILE A N   1 
ATOM   1546 C  CA  . ILE A 1 240 ? -7.098  -6.139  -27.473 1.00 99.04  ? 240 ILE A CA  1 
ATOM   1547 C  C   . ILE A 1 240 ? -6.465  -4.763  -27.290 1.00 100.79 ? 240 ILE A C   1 
ATOM   1548 O  O   . ILE A 1 240 ? -6.798  -3.809  -27.999 1.00 99.49  ? 240 ILE A O   1 
ATOM   1549 C  CB  . ILE A 1 240 ? -8.201  -6.315  -26.432 1.00 96.57  ? 240 ILE A CB  1 
ATOM   1550 C  CG1 . ILE A 1 240 ? -8.821  -7.703  -26.549 1.00 94.19  ? 240 ILE A CG1 1 
ATOM   1551 C  CG2 . ILE A 1 240 ? -9.276  -5.260  -26.623 1.00 94.59  ? 240 ILE A CG2 1 
ATOM   1552 C  CD1 . ILE A 1 240 ? -9.881  -7.962  -25.519 1.00 90.68  ? 240 ILE A CD1 1 
ATOM   1553 N  N   . LEU A 1 241 ? -5.556  -4.674  -26.327 1.00 105.56 ? 241 LEU A N   1 
ATOM   1554 C  CA  . LEU A 1 241 ? -4.860  -3.435  -26.016 1.00 108.19 ? 241 LEU A CA  1 
ATOM   1555 C  C   . LEU A 1 241 ? -4.051  -2.969  -27.206 1.00 111.95 ? 241 LEU A C   1 
ATOM   1556 O  O   . LEU A 1 241 ? -4.133  -1.813  -27.623 1.00 113.45 ? 241 LEU A O   1 
ATOM   1557 C  CB  . LEU A 1 241 ? -3.915  -3.655  -24.839 1.00 105.37 ? 241 LEU A CB  1 
ATOM   1558 C  CG  . LEU A 1 241 ? -4.542  -3.852  -23.464 1.00 99.20  ? 241 LEU A CG  1 
ATOM   1559 C  CD1 . LEU A 1 241 ? -3.448  -4.139  -22.459 1.00 92.82  ? 241 LEU A CD1 1 
ATOM   1560 C  CD2 . LEU A 1 241 ? -5.316  -2.612  -23.058 1.00 89.27  ? 241 LEU A CD2 1 
ATOM   1561 N  N   . GLN A 1 242 ? -3.255  -3.887  -27.735 1.00 115.93 ? 242 GLN A N   1 
ATOM   1562 C  CA  . GLN A 1 242 ? -2.381  -3.602  -28.850 1.00 117.76 ? 242 GLN A CA  1 
ATOM   1563 C  C   . GLN A 1 242 ? -3.204  -3.179  -30.050 1.00 113.89 ? 242 GLN A C   1 
ATOM   1564 O  O   . GLN A 1 242 ? -2.844  -2.246  -30.763 1.00 114.41 ? 242 GLN A O   1 
ATOM   1565 C  CB  . GLN A 1 242 ? -1.547  -4.832  -29.178 1.00 122.91 ? 242 GLN A CB  1 
ATOM   1566 C  CG  . GLN A 1 242 ? -0.340  -4.538  -30.028 1.00 133.38 ? 242 GLN A CG  1 
ATOM   1567 C  CD  . GLN A 1 242 ? 0.667   -5.661  -29.975 1.00 140.97 ? 242 GLN A CD  1 
ATOM   1568 O  OE1 . GLN A 1 242 ? 0.565   -6.561  -29.138 1.00 142.60 ? 242 GLN A OE1 1 
ATOM   1569 N  NE2 . GLN A 1 242 ? 1.654   -5.614  -30.860 1.00 142.56 ? 242 GLN A NE2 1 
ATOM   1570 N  N   . GLN A 1 243 ? -4.335  -3.850  -30.239 1.00 115.50 ? 243 GLN A N   1 
ATOM   1571 C  CA  . GLN A 1 243 ? -5.226  -3.563  -31.354 1.00 111.62 ? 243 GLN A CA  1 
ATOM   1572 C  C   . GLN A 1 243 ? -5.927  -2.220  -31.184 1.00 109.35 ? 243 GLN A C   1 
ATOM   1573 O  O   . GLN A 1 243 ? -6.260  -1.551  -32.165 1.00 108.08 ? 243 GLN A O   1 
ATOM   1574 C  CB  . GLN A 1 243 ? -6.242  -4.693  -31.531 1.00 112.23 ? 243 GLN A CB  1 
ATOM   1575 C  CG  . GLN A 1 243 ? -5.673  -5.912  -32.247 1.00 114.37 ? 243 GLN A CG  1 
ATOM   1576 C  CD  . GLN A 1 243 ? -6.603  -7.112  -32.210 1.00 116.43 ? 243 GLN A CD  1 
ATOM   1577 O  OE1 . GLN A 1 243 ? -7.460  -7.225  -31.330 1.00 116.95 ? 243 GLN A OE1 1 
ATOM   1578 N  NE2 . GLN A 1 243 ? -6.443  -8.015  -33.176 1.00 116.94 ? 243 GLN A NE2 1 
ATOM   1579 N  N   . CYS A 1 244 ? -6.152  -1.831  -29.935 1.00 114.19 ? 244 CYS A N   1 
ATOM   1580 C  CA  . CYS A 1 244 ? -6.794  -0.557  -29.642 1.00 117.44 ? 244 CYS A CA  1 
ATOM   1581 C  C   . CYS A 1 244 ? -5.782  0.547   -29.370 1.00 119.15 ? 244 CYS A C   1 
ATOM   1582 O  O   . CYS A 1 244 ? -6.170  1.674   -29.046 1.00 114.60 ? 244 CYS A O   1 
ATOM   1583 C  CB  . CYS A 1 244 ? -7.740  -0.693  -28.449 1.00 127.69 ? 244 CYS A CB  1 
ATOM   1584 S  SG  . CYS A 1 244 ? -9.172  -1.752  -28.741 1.00 134.35 ? 244 CYS A SG  1 
ATOM   1585 N  N   . ASP A 1 245 ? -4.497  0.206   -29.482 1.00 131.69 ? 245 ASP A N   1 
ATOM   1586 C  CA  . ASP A 1 245 ? -3.382  1.098   -29.134 1.00 137.23 ? 245 ASP A CA  1 
ATOM   1587 C  C   . ASP A 1 245 ? -3.275  1.312   -27.629 1.00 137.98 ? 245 ASP A C   1 
ATOM   1588 O  O   . ASP A 1 245 ? -2.330  1.941   -27.150 1.00 139.08 ? 245 ASP A O   1 
ATOM   1589 C  CB  . ASP A 1 245 ? -3.467  2.449   -29.853 1.00 139.84 ? 245 ASP A CB  1 
ATOM   1590 C  CG  . ASP A 1 245 ? -3.414  2.313   -31.353 1.00 144.02 ? 245 ASP A CG  1 
ATOM   1591 O  OD1 . ASP A 1 245 ? -2.552  1.555   -31.843 1.00 147.02 ? 245 ASP A OD1 1 
ATOM   1592 O  OD2 . ASP A 1 245 ? -4.227  2.966   -32.041 1.00 147.03 1 245 ASP A OD2 1 
ATOM   1593 N  N   . GLY A 1 246 ? -4.234  0.765   -26.888 1.00 126.13 ? 246 GLY A N   1 
ATOM   1594 C  CA  . GLY A 1 246 ? -4.305  0.966   -25.455 1.00 125.87 ? 246 GLY A CA  1 
ATOM   1595 C  C   . GLY A 1 246 ? -5.421  1.913   -25.050 1.00 126.87 ? 246 GLY A C   1 
ATOM   1596 O  O   . GLY A 1 246 ? -5.608  2.188   -23.864 1.00 124.84 ? 246 GLY A O   1 
ATOM   1597 N  N   . LYS A 1 247 ? -6.162  2.418   -26.030 1.00 123.50 ? 247 LYS A N   1 
ATOM   1598 C  CA  . LYS A 1 247 ? -7.264  3.334   -25.750 1.00 126.30 ? 247 LYS A CA  1 
ATOM   1599 C  C   . LYS A 1 247 ? -8.603  2.622   -25.901 1.00 125.63 ? 247 LYS A C   1 
ATOM   1600 O  O   . LYS A 1 247 ? -8.995  2.251   -27.006 1.00 124.78 ? 247 LYS A O   1 
ATOM   1601 C  CB  . LYS A 1 247 ? -7.209  4.544   -26.679 1.00 129.30 ? 247 LYS A CB  1 
ATOM   1602 C  CG  . LYS A 1 247 ? -5.807  5.062   -26.943 1.00 136.34 ? 247 LYS A CG  1 
ATOM   1603 C  CD  . LYS A 1 247 ? -5.101  5.469   -25.661 1.00 142.70 ? 247 LYS A CD  1 
ATOM   1604 C  CE  . LYS A 1 247 ? -3.681  5.924   -25.958 1.00 144.34 ? 247 LYS A CE  1 
ATOM   1605 N  NZ  . LYS A 1 247 ? -2.905  6.224   -24.722 1.00 145.08 1 247 LYS A NZ  1 
ATOM   1606 N  N   . LEU A 1 248 ? -9.311  2.443   -24.793 1.00 130.16 ? 248 LEU A N   1 
ATOM   1607 C  CA  . LEU A 1 248 ? -10.560 1.700   -24.818 1.00 127.68 ? 248 LEU A CA  1 
ATOM   1608 C  C   . LEU A 1 248 ? -11.532 2.229   -23.766 1.00 125.60 ? 248 LEU A C   1 
ATOM   1609 O  O   . LEU A 1 248 ? -11.126 2.600   -22.664 1.00 129.89 ? 248 LEU A O   1 
ATOM   1610 C  CB  . LEU A 1 248 ? -10.273 0.215   -24.591 1.00 127.02 ? 248 LEU A CB  1 
ATOM   1611 C  CG  . LEU A 1 248 ? -11.473 -0.721  -24.507 1.00 122.09 ? 248 LEU A CG  1 
ATOM   1612 C  CD1 . LEU A 1 248 ? -12.345 -0.521  -25.724 1.00 117.40 ? 248 LEU A CD1 1 
ATOM   1613 C  CD2 . LEU A 1 248 ? -11.006 -2.160  -24.415 1.00 117.39 ? 248 LEU A CD2 1 
ATOM   1614 N  N   . ASP A 1 249 ? -12.817 2.243   -24.105 1.00 129.59 ? 249 ASP A N   1 
ATOM   1615 C  CA  . ASP A 1 249 ? -13.837 2.795   -23.220 1.00 123.02 ? 249 ASP A CA  1 
ATOM   1616 C  C   . ASP A 1 249 ? -14.667 1.724   -22.518 1.00 118.02 ? 249 ASP A C   1 
ATOM   1617 O  O   . ASP A 1 249 ? -14.666 1.636   -21.293 1.00 114.97 ? 249 ASP A O   1 
ATOM   1618 C  CB  . ASP A 1 249 ? -14.748 3.767   -23.972 1.00 125.97 ? 249 ASP A CB  1 
ATOM   1619 C  CG  . ASP A 1 249 ? -14.022 5.018   -24.423 1.00 130.18 ? 249 ASP A CG  1 
ATOM   1620 O  OD1 . ASP A 1 249 ? -13.901 5.959   -23.609 1.00 133.63 ? 249 ASP A OD1 1 
ATOM   1621 O  OD2 . ASP A 1 249 ? -13.581 5.064   -25.592 1.00 133.71 1 249 ASP A OD2 1 
ATOM   1622 N  N   . MET A 1 250 ? -15.398 0.934   -23.299 1.00 110.92 ? 250 MET A N   1 
ATOM   1623 C  CA  . MET A 1 250 ? -16.263 -0.107  -22.756 1.00 109.74 ? 250 MET A CA  1 
ATOM   1624 C  C   . MET A 1 250 ? -15.938 -1.482  -23.336 1.00 109.45 ? 250 MET A C   1 
ATOM   1625 O  O   . MET A 1 250 ? -15.570 -1.599  -24.503 1.00 109.84 ? 250 MET A O   1 
ATOM   1626 C  CB  . MET A 1 250 ? -17.728 0.243   -23.024 1.00 109.09 ? 250 MET A CB  1 
ATOM   1627 C  CG  . MET A 1 250 ? -18.695 -0.908  -22.803 1.00 107.77 ? 250 MET A CG  1 
ATOM   1628 S  SD  . MET A 1 250 ? -20.401 -0.350  -22.773 1.00 108.94 ? 250 MET A SD  1 
ATOM   1629 C  CE  . MET A 1 250 ? -20.331 0.710   -21.330 1.00 109.56 ? 250 MET A CE  1 
ATOM   1630 N  N   . LEU A 1 251 ? -16.077 -2.521  -22.518 1.00 97.68  ? 251 LEU A N   1 
ATOM   1631 C  CA  . LEU A 1 251 ? -15.879 -3.891  -22.972 1.00 96.17  ? 251 LEU A CA  1 
ATOM   1632 C  C   . LEU A 1 251 ? -17.048 -4.789  -22.584 1.00 97.10  ? 251 LEU A C   1 
ATOM   1633 O  O   . LEU A 1 251 ? -17.420 -4.845  -21.422 1.00 98.13  ? 251 LEU A O   1 
ATOM   1634 C  CB  . LEU A 1 251 ? -14.605 -4.472  -22.377 1.00 92.85  ? 251 LEU A CB  1 
ATOM   1635 C  CG  . LEU A 1 251 ? -14.478 -5.964  -22.675 1.00 88.15  ? 251 LEU A CG  1 
ATOM   1636 C  CD1 . LEU A 1 251 ? -13.574 -6.196  -23.859 1.00 84.59  ? 251 LEU A CD1 1 
ATOM   1637 C  CD2 . LEU A 1 251 ? -13.983 -6.718  -21.459 1.00 85.23  ? 251 LEU A CD2 1 
ATOM   1638 N  N   . VAL A 1 252 ? -17.622 -5.491  -23.556 1.00 97.37  ? 252 VAL A N   1 
ATOM   1639 C  CA  . VAL A 1 252 ? -18.737 -6.394  -23.299 1.00 95.98  ? 252 VAL A CA  1 
ATOM   1640 C  C   . VAL A 1 252 ? -18.387 -7.868  -23.495 1.00 95.05  ? 252 VAL A C   1 
ATOM   1641 O  O   . VAL A 1 252 ? -17.876 -8.277  -24.560 1.00 96.44  ? 252 VAL A O   1 
ATOM   1642 C  CB  . VAL A 1 252 ? -19.937 -6.046  -24.174 1.00 96.56  ? 252 VAL A CB  1 
ATOM   1643 C  CG1 . VAL A 1 252 ? -21.157 -6.809  -23.705 1.00 94.59  ? 252 VAL A CG1 1 
ATOM   1644 C  CG2 . VAL A 1 252 ? -20.186 -4.552  -24.136 1.00 94.60  ? 252 VAL A CG2 1 
ATOM   1645 N  N   . ALA A 1 253 ? -18.662 -8.665  -22.465 1.00 76.50  ? 253 ALA A N   1 
ATOM   1646 C  CA  . ALA A 1 253 ? -18.402 -10.098 -22.531 1.00 74.78  ? 253 ALA A CA  1 
ATOM   1647 C  C   . ALA A 1 253 ? -19.473 -10.939 -21.846 1.00 77.32  ? 253 ALA A C   1 
ATOM   1648 O  O   . ALA A 1 253 ? -19.870 -10.654 -20.713 1.00 74.19  ? 253 ALA A O   1 
ATOM   1649 C  CB  . ALA A 1 253 ? -17.041 -10.412 -21.943 1.00 69.77  ? 253 ALA A CB  1 
ATOM   1650 N  N   . SER A 1 254 ? -19.922 -11.990 -22.522 1.00 81.93  ? 254 SER A N   1 
ATOM   1651 C  CA  . SER A 1 254 ? -20.800 -12.960 -21.889 1.00 89.23  ? 254 SER A CA  1 
ATOM   1652 C  C   . SER A 1 254 ? -19.925 -13.851 -21.035 1.00 86.69  ? 254 SER A C   1 
ATOM   1653 O  O   . SER A 1 254 ? -18.755 -14.081 -21.363 1.00 89.68  ? 254 SER A O   1 
ATOM   1654 C  CB  . SER A 1 254 ? -21.510 -13.806 -22.936 1.00 94.48  ? 254 SER A CB  1 
ATOM   1655 O  OG  . SER A 1 254 ? -20.562 -14.396 -23.810 1.00 107.69 ? 254 SER A OG  1 
ATOM   1656 N  N   . VAL A 1 255 ? -20.469 -14.340 -19.928 1.00 83.24  ? 255 VAL A N   1 
ATOM   1657 C  CA  . VAL A 1 255 ? -19.658 -15.122 -19.018 1.00 76.40  ? 255 VAL A CA  1 
ATOM   1658 C  C   . VAL A 1 255 ? -20.205 -16.522 -18.835 1.00 73.93  ? 255 VAL A C   1 
ATOM   1659 O  O   . VAL A 1 255 ? -21.264 -16.676 -18.224 1.00 72.37  ? 255 VAL A O   1 
ATOM   1660 C  CB  . VAL A 1 255 ? -19.740 -14.471 -17.643 1.00 75.45  ? 255 VAL A CB  1 
ATOM   1661 C  CG1 . VAL A 1 255 ? -18.950 -15.256 -16.631 1.00 72.23  ? 255 VAL A CG1 1 
ATOM   1662 C  CG2 . VAL A 1 255 ? -19.298 -13.023 -17.721 1.00 74.18  ? 255 VAL A CG2 1 
ATOM   1663 N  N   . GLY A 1 256 ? -19.560 -17.545 -19.396 1.00 80.05  ? 256 GLY A N   1 
ATOM   1664 C  CA  . GLY A 1 256 ? -19.734 -18.877 -18.846 1.00 78.71  ? 256 GLY A CA  1 
ATOM   1665 C  C   . GLY A 1 256 ? -18.958 -19.279 -17.598 1.00 78.04  ? 256 GLY A C   1 
ATOM   1666 O  O   . GLY A 1 256 ? -19.523 -19.508 -16.530 1.00 77.81  ? 256 GLY A O   1 
ATOM   1667 N  N   . THR A 1 257 ? -17.634 -19.323 -17.728 1.00 74.37  ? 257 THR A N   1 
ATOM   1668 C  CA  . THR A 1 257 ? -16.768 -19.656 -16.602 1.00 73.82  ? 257 THR A CA  1 
ATOM   1669 C  C   . THR A 1 257 ? -16.120 -18.442 -15.986 1.00 77.22  ? 257 THR A C   1 
ATOM   1670 O  O   . THR A 1 257 ? -15.433 -18.549 -14.969 1.00 77.56  ? 257 THR A O   1 
ATOM   1671 C  CB  . THR A 1 257 ? -15.659 -20.639 -17.001 1.00 72.24  ? 257 THR A CB  1 
ATOM   1672 O  OG1 . THR A 1 257 ? -14.718 -19.959 -17.839 1.00 66.64  ? 257 THR A OG1 1 
ATOM   1673 C  CG2 . THR A 1 257 ? -16.245 -21.811 -17.760 1.00 67.11  ? 257 THR A CG2 1 
ATOM   1674 N  N   . GLY A 1 258 ? -16.331 -17.289 -16.609 1.00 84.71  ? 258 GLY A N   1 
ATOM   1675 C  CA  . GLY A 1 258 ? -15.724 -16.064 -16.134 1.00 86.30  ? 258 GLY A CA  1 
ATOM   1676 C  C   . GLY A 1 258 ? -14.295 -15.844 -16.584 1.00 85.30  ? 258 GLY A C   1 
ATOM   1677 O  O   . GLY A 1 258 ? -13.819 -14.709 -16.548 1.00 88.08  ? 258 GLY A O   1 
ATOM   1678 N  N   . GLY A 1 259 ? -13.629 -16.906 -17.033 1.00 86.68  ? 259 GLY A N   1 
ATOM   1679 C  CA  . GLY A 1 259 ? -12.214 -16.836 -17.354 1.00 82.29  ? 259 GLY A CA  1 
ATOM   1680 C  C   . GLY A 1 259 ? -11.879 -15.681 -18.272 1.00 81.19  ? 259 GLY A C   1 
ATOM   1681 O  O   . GLY A 1 259 ? -10.963 -14.890 -17.993 1.00 78.56  ? 259 GLY A O   1 
ATOM   1682 N  N   . THR A 1 260 ? -12.651 -15.564 -19.346 1.00 76.73  ? 260 THR A N   1 
ATOM   1683 C  CA  . THR A 1 260 ? -12.444 -14.514 -20.327 1.00 80.43  ? 260 THR A CA  1 
ATOM   1684 C  C   . THR A 1 260 ? -12.536 -13.150 -19.672 1.00 78.31  ? 260 THR A C   1 
ATOM   1685 O  O   . THR A 1 260 ? -11.564 -12.375 -19.666 1.00 77.72  ? 260 THR A O   1 
ATOM   1686 C  CB  . THR A 1 260 ? -13.494 -14.594 -21.429 1.00 82.30  ? 260 THR A CB  1 
ATOM   1687 O  OG1 . THR A 1 260 ? -13.384 -15.856 -22.097 1.00 89.01  ? 260 THR A OG1 1 
ATOM   1688 C  CG2 . THR A 1 260 ? -13.302 -13.467 -22.421 1.00 89.59  ? 260 THR A CG2 1 
ATOM   1689 N  N   . ILE A 1 261 ? -13.700 -12.880 -19.094 1.00 87.11  ? 261 ILE A N   1 
ATOM   1690 C  CA  . ILE A 1 261 ? -13.963 -11.589 -18.486 1.00 85.49  ? 261 ILE A CA  1 
ATOM   1691 C  C   . ILE A 1 261 ? -13.056 -11.349 -17.284 1.00 86.37  ? 261 ILE A C   1 
ATOM   1692 O  O   . ILE A 1 261 ? -12.732 -10.209 -16.956 1.00 87.52  ? 261 ILE A O   1 
ATOM   1693 C  CB  . ILE A 1 261 ? -15.436 -11.406 -18.102 1.00 84.34  ? 261 ILE A CB  1 
ATOM   1694 C  CG1 . ILE A 1 261 ? -15.760 -9.917  -18.015 1.00 81.01  ? 261 ILE A CG1 1 
ATOM   1695 C  CG2 . ILE A 1 261 ? -15.748 -12.099 -16.780 1.00 81.36  ? 261 ILE A CG2 1 
ATOM   1696 C  CD1 . ILE A 1 261 ? -17.195 -9.636  -17.683 1.00 77.05  ? 261 ILE A CD1 1 
ATOM   1697 N  N   . THR A 1 262 ? -12.607 -12.423 -16.651 1.00 81.91  ? 262 THR A N   1 
ATOM   1698 C  CA  . THR A 1 262 ? -11.769 -12.263 -15.483 1.00 80.77  ? 262 THR A CA  1 
ATOM   1699 C  C   . THR A 1 262 ? -10.405 -11.773 -15.920 1.00 82.79  ? 262 THR A C   1 
ATOM   1700 O  O   . THR A 1 262 ? -10.012 -10.657 -15.572 1.00 82.40  ? 262 THR A O   1 
ATOM   1701 C  CB  . THR A 1 262 ? -11.633 -13.564 -14.681 1.00 79.92  ? 262 THR A CB  1 
ATOM   1702 O  OG1 . THR A 1 262 ? -12.887 -13.877 -14.063 1.00 75.80  ? 262 THR A OG1 1 
ATOM   1703 C  CG2 . THR A 1 262 ? -10.581 -13.405 -13.611 1.00 75.67  ? 262 THR A CG2 1 
ATOM   1704 N  N   . GLY A 1 263 ? -9.703  -12.586 -16.706 1.00 92.58  ? 263 GLY A N   1 
ATOM   1705 C  CA  . GLY A 1 263 ? -8.375  -12.219 -17.163 1.00 94.33  ? 263 GLY A CA  1 
ATOM   1706 C  C   . GLY A 1 263 ? -8.385  -10.868 -17.855 1.00 94.46  ? 263 GLY A C   1 
ATOM   1707 O  O   . GLY A 1 263 ? -7.590  -9.956  -17.518 1.00 95.99  ? 263 GLY A O   1 
ATOM   1708 N  N   . ILE A 1 264 ? -9.308  -10.723 -18.803 1.00 78.07  ? 264 ILE A N   1 
ATOM   1709 C  CA  . ILE A 1 264 ? -9.411  -9.479  -19.542 1.00 76.78  ? 264 ILE A CA  1 
ATOM   1710 C  C   . ILE A 1 264 ? -9.607  -8.289  -18.622 1.00 77.94  ? 264 ILE A C   1 
ATOM   1711 O  O   . ILE A 1 264 ? -8.846  -7.325  -18.686 1.00 77.86  ? 264 ILE A O   1 
ATOM   1712 C  CB  . ILE A 1 264 ? -10.536 -9.501  -20.563 1.00 75.34  ? 264 ILE A CB  1 
ATOM   1713 C  CG1 . ILE A 1 264 ? -10.191 -10.461 -21.695 1.00 73.83  ? 264 ILE A CG1 1 
ATOM   1714 C  CG2 . ILE A 1 264 ? -10.755 -8.106  -21.122 1.00 73.04  ? 264 ILE A CG2 1 
ATOM   1715 C  CD1 . ILE A 1 264 ? -11.231 -10.485 -22.782 1.00 70.00  ? 264 ILE A CD1 1 
ATOM   1716 N  N   . ALA A 1 265 ? -10.615 -8.362  -17.757 1.00 80.57  ? 265 ALA A N   1 
ATOM   1717 C  CA  . ALA A 1 265 ? -10.916 -7.230  -16.889 1.00 82.52  ? 265 ALA A CA  1 
ATOM   1718 C  C   . ALA A 1 265 ? -9.791  -6.907  -15.918 1.00 83.61  ? 265 ALA A C   1 
ATOM   1719 O  O   . ALA A 1 265 ? -9.589  -5.746  -15.576 1.00 84.89  ? 265 ALA A O   1 
ATOM   1720 C  CB  . ALA A 1 265 ? -12.214 -7.433  -16.141 1.00 82.04  ? 265 ALA A CB  1 
ATOM   1721 N  N   . ARG A 1 266 ? -9.068  -7.920  -15.457 1.00 83.06  ? 266 ARG A N   1 
ATOM   1722 C  CA  . ARG A 1 266 ? -7.947  -7.646  -14.572 1.00 83.59  ? 266 ARG A CA  1 
ATOM   1723 C  C   . ARG A 1 266 ? -6.865  -6.883  -15.324 1.00 84.57  ? 266 ARG A C   1 
ATOM   1724 O  O   . ARG A 1 266 ? -6.487  -5.755  -14.929 1.00 84.03  ? 266 ARG A O   1 
ATOM   1725 C  CB  . ARG A 1 266 ? -7.385  -8.930  -13.967 1.00 83.10  ? 266 ARG A CB  1 
ATOM   1726 C  CG  . ARG A 1 266 ? -8.248  -9.506  -12.866 1.00 83.73  ? 266 ARG A CG  1 
ATOM   1727 C  CD  . ARG A 1 266 ? -7.519  -10.588 -12.097 1.00 84.19  ? 266 ARG A CD  1 
ATOM   1728 N  NE  . ARG A 1 266 ? -8.338  -11.100 -11.004 1.00 87.39  ? 266 ARG A NE  1 
ATOM   1729 C  CZ  . ARG A 1 266 ? -7.937  -12.028 -10.141 1.00 89.46  ? 266 ARG A CZ  1 
ATOM   1730 N  NH1 . ARG A 1 266 ? -6.718  -12.541 -10.240 1.00 89.26  1 266 ARG A NH1 1 
ATOM   1731 N  NH2 . ARG A 1 266 ? -8.750  -12.437 -9.173  1.00 87.82  ? 266 ARG A NH2 1 
ATOM   1732 N  N   . LYS A 1 267 ? -6.400  -7.459  -16.434 1.00 84.59  ? 267 LYS A N   1 
ATOM   1733 C  CA  . LYS A 1 267 ? -5.325  -6.800  -17.167 1.00 87.23  ? 267 LYS A CA  1 
ATOM   1734 C  C   . LYS A 1 267 ? -5.754  -5.413  -17.653 1.00 89.95  ? 267 LYS A C   1 
ATOM   1735 O  O   . LYS A 1 267 ? -4.929  -4.517  -17.841 1.00 89.40  ? 267 LYS A O   1 
ATOM   1736 C  CB  . LYS A 1 267 ? -4.815  -7.658  -18.325 1.00 87.58  ? 267 LYS A CB  1 
ATOM   1737 C  CG  . LYS A 1 267 ? -3.693  -6.997  -19.118 1.00 86.80  ? 267 LYS A CG  1 
ATOM   1738 C  CD  . LYS A 1 267 ? -2.683  -7.996  -19.622 1.00 87.08  ? 267 LYS A CD  1 
ATOM   1739 C  CE  . LYS A 1 267 ? -1.507  -8.118  -18.666 1.00 87.39  ? 267 LYS A CE  1 
ATOM   1740 N  NZ  . LYS A 1 267 ? -0.421  -8.954  -19.251 1.00 89.76  1 267 LYS A NZ  1 
ATOM   1741 N  N   . LEU A 1 268 ? -7.056  -5.230  -17.815 1.00 105.84 ? 268 LEU A N   1 
ATOM   1742 C  CA  . LEU A 1 268 ? -7.594  -3.960  -18.268 1.00 111.12 ? 268 LEU A CA  1 
ATOM   1743 C  C   . LEU A 1 268 ? -7.614  -2.935  -17.144 1.00 114.91 ? 268 LEU A C   1 
ATOM   1744 O  O   . LEU A 1 268 ? -7.238  -1.786  -17.344 1.00 114.91 ? 268 LEU A O   1 
ATOM   1745 C  CB  . LEU A 1 268 ? -9.002  -4.164  -18.810 1.00 110.05 ? 268 LEU A CB  1 
ATOM   1746 C  CG  . LEU A 1 268 ? -9.316  -3.485  -20.135 1.00 110.24 ? 268 LEU A CG  1 
ATOM   1747 C  CD1 . LEU A 1 268 ? -8.196  -3.725  -21.122 1.00 110.58 ? 268 LEU A CD1 1 
ATOM   1748 C  CD2 . LEU A 1 268 ? -10.608 -4.061  -20.667 1.00 110.53 ? 268 LEU A CD2 1 
ATOM   1749 N  N   . LYS A 1 269 ? -8.035  -3.359  -15.959 1.00 137.10 ? 269 LYS A N   1 
ATOM   1750 C  CA  . LYS A 1 269 ? -8.040  -2.485  -14.797 1.00 140.24 ? 269 LYS A CA  1 
ATOM   1751 C  C   . LYS A 1 269 ? -6.619  -2.039  -14.536 1.00 139.78 ? 269 LYS A C   1 
ATOM   1752 O  O   . LYS A 1 269 ? -6.378  -0.919  -14.083 1.00 140.42 ? 269 LYS A O   1 
ATOM   1753 C  CB  . LYS A 1 269 ? -8.594  -3.198  -13.567 1.00 143.07 ? 269 LYS A CB  1 
ATOM   1754 C  CG  . LYS A 1 269 ? -10.088 -3.432  -13.608 1.00 146.54 ? 269 LYS A CG  1 
ATOM   1755 C  CD  . LYS A 1 269 ? -10.869 -2.138  -13.480 1.00 148.89 ? 269 LYS A CD  1 
ATOM   1756 C  CE  . LYS A 1 269 ? -12.338 -2.375  -13.782 1.00 149.35 ? 269 LYS A CE  1 
ATOM   1757 N  NZ  . LYS A 1 269 ? -12.884 -3.515  -12.991 1.00 149.48 1 269 LYS A NZ  1 
ATOM   1758 N  N   . GLU A 1 270 ? -5.666  -2.912  -14.842 1.00 120.24 ? 270 GLU A N   1 
ATOM   1759 C  CA  . GLU A 1 270 ? -4.277  -2.511  -14.699 1.00 118.26 ? 270 GLU A CA  1 
ATOM   1760 C  C   . GLU A 1 270 ? -3.857  -1.508  -15.779 1.00 117.01 ? 270 GLU A C   1 
ATOM   1761 O  O   . GLU A 1 270 ? -3.531  -0.359  -15.474 1.00 115.15 ? 270 GLU A O   1 
ATOM   1762 C  CB  . GLU A 1 270 ? -3.358  -3.727  -14.713 1.00 118.14 ? 270 GLU A CB  1 
ATOM   1763 C  CG  . GLU A 1 270 ? -3.649  -4.721  -13.608 1.00 120.89 ? 270 GLU A CG  1 
ATOM   1764 C  CD  . GLU A 1 270 ? -2.625  -5.834  -13.566 1.00 124.31 ? 270 GLU A CD  1 
ATOM   1765 O  OE1 . GLU A 1 270 ? -1.656  -5.776  -14.357 1.00 125.39 ? 270 GLU A OE1 1 
ATOM   1766 O  OE2 . GLU A 1 270 ? -2.788  -6.766  -12.749 1.00 125.36 1 270 GLU A OE2 1 
ATOM   1767 N  N   . LYS A 1 271 ? -3.889  -1.935  -17.038 1.00 131.96 ? 271 LYS A N   1 
ATOM   1768 C  CA  . LYS A 1 271 ? -3.363  -1.130  -18.142 1.00 131.86 ? 271 LYS A CA  1 
ATOM   1769 C  C   . LYS A 1 271 ? -4.271  0.002   -18.638 1.00 129.82 ? 271 LYS A C   1 
ATOM   1770 O  O   . LYS A 1 271 ? -3.788  1.088   -18.965 1.00 127.99 ? 271 LYS A O   1 
ATOM   1771 C  CB  . LYS A 1 271 ? -2.940  -2.027  -19.304 1.00 135.66 ? 271 LYS A CB  1 
ATOM   1772 C  CG  . LYS A 1 271 ? -1.765  -2.932  -18.986 1.00 140.80 ? 271 LYS A CG  1 
ATOM   1773 C  CD  . LYS A 1 271 ? -0.501  -2.126  -18.744 1.00 144.83 ? 271 LYS A CD  1 
ATOM   1774 C  CE  . LYS A 1 271 ? 0.598   -3.006  -18.179 1.00 145.68 ? 271 LYS A CE  1 
ATOM   1775 N  NZ  . LYS A 1 271 ? 0.883   -4.171  -19.065 1.00 146.05 1 271 LYS A NZ  1 
ATOM   1776 N  N   . CYS A 1 272 ? -5.572  -0.251  -18.723 1.00 140.33 ? 272 CYS A N   1 
ATOM   1777 C  CA  . CYS A 1 272 ? -6.509  0.784   -19.154 1.00 141.26 ? 272 CYS A CA  1 
ATOM   1778 C  C   . CYS A 1 272 ? -7.677  0.865   -18.182 1.00 142.64 ? 272 CYS A C   1 
ATOM   1779 O  O   . CYS A 1 272 ? -8.795  0.458   -18.504 1.00 141.29 ? 272 CYS A O   1 
ATOM   1780 C  CB  . CYS A 1 272 ? -7.017  0.502   -20.565 1.00 141.87 ? 272 CYS A CB  1 
ATOM   1781 S  SG  . CYS A 1 272 ? -8.163  1.754   -21.199 1.00 142.16 ? 272 CYS A SG  1 
ATOM   1782 N  N   . PRO A 1 273 ? -7.414  1.388   -16.978 1.00 121.36 ? 273 PRO A N   1 
ATOM   1783 C  CA  . PRO A 1 273 ? -8.337  1.351   -15.840 1.00 122.90 ? 273 PRO A CA  1 
ATOM   1784 C  C   . PRO A 1 273 ? -9.641  2.094   -16.103 1.00 122.53 ? 273 PRO A C   1 
ATOM   1785 O  O   . PRO A 1 273 ? -10.611 1.894   -15.371 1.00 124.79 ? 273 PRO A O   1 
ATOM   1786 C  CB  . PRO A 1 273 ? -7.550  2.051   -14.731 1.00 122.08 ? 273 PRO A CB  1 
ATOM   1787 C  CG  . PRO A 1 273 ? -6.582  2.917   -15.454 1.00 121.09 ? 273 PRO A CG  1 
ATOM   1788 C  CD  . PRO A 1 273 ? -6.192  2.146   -16.664 1.00 120.65 ? 273 PRO A CD  1 
ATOM   1789 N  N   . GLY A 1 274 ? -9.662  2.941   -17.127 1.00 115.09 ? 274 GLY A N   1 
ATOM   1790 C  CA  . GLY A 1 274 ? -10.844 3.730   -17.418 1.00 111.73 ? 274 GLY A CA  1 
ATOM   1791 C  C   . GLY A 1 274 ? -11.876 2.966   -18.228 1.00 110.30 ? 274 GLY A C   1 
ATOM   1792 O  O   . GLY A 1 274 ? -12.846 3.546   -18.724 1.00 109.38 ? 274 GLY A O   1 
ATOM   1793 N  N   . CYS A 1 275 ? -11.666 1.663   -18.375 1.00 127.96 ? 275 CYS A N   1 
ATOM   1794 C  CA  . CYS A 1 275 ? -12.560 0.847   -19.179 1.00 129.83 ? 275 CYS A CA  1 
ATOM   1795 C  C   . CYS A 1 275 ? -13.633 0.182   -18.326 1.00 130.49 ? 275 CYS A C   1 
ATOM   1796 O  O   . CYS A 1 275 ? -13.321 -0.532  -17.371 1.00 128.48 ? 275 CYS A O   1 
ATOM   1797 C  CB  . CYS A 1 275 ? -11.769 -0.219  -19.933 1.00 131.34 ? 275 CYS A CB  1 
ATOM   1798 S  SG  . CYS A 1 275 ? -12.779 -1.263  -21.007 1.00 136.57 ? 275 CYS A SG  1 
ATOM   1799 N  N   . ARG A 1 276 ? -14.896 0.403   -18.678 1.00 114.92 ? 276 ARG A N   1 
ATOM   1800 C  CA  . ARG A 1 276 ? -15.989 -0.274  -17.993 1.00 117.38 ? 276 ARG A CA  1 
ATOM   1801 C  C   . ARG A 1 276 ? -16.109 -1.706  -18.480 1.00 114.54 ? 276 ARG A C   1 
ATOM   1802 O  O   . ARG A 1 276 ? -16.012 -1.975  -19.676 1.00 117.97 ? 276 ARG A O   1 
ATOM   1803 C  CB  . ARG A 1 276 ? -17.313 0.451   -18.210 1.00 120.77 ? 276 ARG A CB  1 
ATOM   1804 C  CG  . ARG A 1 276 ? -17.383 1.827   -17.583 1.00 125.01 ? 276 ARG A CG  1 
ATOM   1805 C  CD  . ARG A 1 276 ? -18.823 2.166   -17.245 1.00 127.65 ? 276 ARG A CD  1 
ATOM   1806 N  NE  . ARG A 1 276 ? -19.224 1.618   -15.951 1.00 128.21 ? 276 ARG A NE  1 
ATOM   1807 C  CZ  . ARG A 1 276 ? -20.486 1.401   -15.593 1.00 128.39 ? 276 ARG A CZ  1 
ATOM   1808 N  NH1 . ARG A 1 276 ? -21.471 1.668   -16.442 1.00 128.43 1 276 ARG A NH1 1 
ATOM   1809 N  NH2 . ARG A 1 276 ? -20.764 0.902   -14.395 1.00 128.39 ? 276 ARG A NH2 1 
ATOM   1810 N  N   . ILE A 1 277 ? -16.320 -2.624  -17.548 1.00 114.18 ? 277 ILE A N   1 
ATOM   1811 C  CA  . ILE A 1 277 ? -16.468 -4.027  -17.892 1.00 106.52 ? 277 ILE A CA  1 
ATOM   1812 C  C   . ILE A 1 277 ? -17.913 -4.466  -17.716 1.00 104.47 ? 277 ILE A C   1 
ATOM   1813 O  O   . ILE A 1 277 ? -18.483 -4.344  -16.633 1.00 103.61 ? 277 ILE A O   1 
ATOM   1814 C  CB  . ILE A 1 277 ? -15.584 -4.906  -17.015 1.00 104.43 ? 277 ILE A CB  1 
ATOM   1815 C  CG1 . ILE A 1 277 ? -14.152 -4.371  -17.009 1.00 101.35 ? 277 ILE A CG1 1 
ATOM   1816 C  CG2 . ILE A 1 277 ? -15.632 -6.340  -17.502 1.00 100.77 ? 277 ILE A CG2 1 
ATOM   1817 C  CD1 . ILE A 1 277 ? -13.499 -4.401  -18.366 1.00 98.29  ? 277 ILE A CD1 1 
ATOM   1818 N  N   . ILE A 1 278 ? -18.499 -4.980  -18.787 1.00 99.96  ? 278 ILE A N   1 
ATOM   1819 C  CA  . ILE A 1 278 ? -19.896 -5.371  -18.790 1.00 96.81  ? 278 ILE A CA  1 
ATOM   1820 C  C   . ILE A 1 278 ? -20.037 -6.873  -18.944 1.00 96.64  ? 278 ILE A C   1 
ATOM   1821 O  O   . ILE A 1 278 ? -19.614 -7.450  -19.953 1.00 98.44  ? 278 ILE A O   1 
ATOM   1822 C  CB  . ILE A 1 278 ? -20.646 -4.706  -19.943 1.00 95.89  ? 278 ILE A CB  1 
ATOM   1823 C  CG1 . ILE A 1 278 ? -20.374 -3.206  -19.948 1.00 92.22  ? 278 ILE A CG1 1 
ATOM   1824 C  CG2 . ILE A 1 278 ? -22.129 -4.981  -19.827 1.00 91.33  ? 278 ILE A CG2 1 
ATOM   1825 C  CD1 . ILE A 1 278 ? -20.696 -2.545  -18.631 1.00 90.32  ? 278 ILE A CD1 1 
ATOM   1826 N  N   . GLY A 1 279 ? -20.645 -7.506  -17.949 1.00 87.39  ? 279 GLY A N   1 
ATOM   1827 C  CA  . GLY A 1 279 ? -20.887 -8.929  -18.018 1.00 85.96  ? 279 GLY A CA  1 
ATOM   1828 C  C   . GLY A 1 279 ? -22.238 -9.208  -18.633 1.00 86.86  ? 279 GLY A C   1 
ATOM   1829 O  O   . GLY A 1 279 ? -23.159 -8.387  -18.551 1.00 84.80  ? 279 GLY A O   1 
ATOM   1830 N  N   . VAL A 1 280 ? -22.363 -10.366 -19.265 1.00 95.83  ? 280 VAL A N   1 
ATOM   1831 C  CA  . VAL A 1 280 ? -23.635 -10.779 -19.829 1.00 98.76  ? 280 VAL A CA  1 
ATOM   1832 C  C   . VAL A 1 280 ? -24.007 -12.163 -19.340 1.00 100.72 ? 280 VAL A C   1 
ATOM   1833 O  O   . VAL A 1 280 ? -23.253 -13.120 -19.531 1.00 101.23 ? 280 VAL A O   1 
ATOM   1834 C  CB  . VAL A 1 280 ? -23.587 -10.800 -21.343 1.00 98.56  ? 280 VAL A CB  1 
ATOM   1835 C  CG1 . VAL A 1 280 ? -24.931 -11.215 -21.889 1.00 98.66  ? 280 VAL A CG1 1 
ATOM   1836 C  CG2 . VAL A 1 280 ? -23.176 -9.440  -21.866 1.00 98.62  ? 280 VAL A CG2 1 
ATOM   1837 N  N   . ASP A 1 281 ? -25.177 -12.277 -18.724 1.00 95.76  ? 281 ASP A N   1 
ATOM   1838 C  CA  . ASP A 1 281 ? -25.601 -13.550 -18.182 1.00 95.97  ? 281 ASP A CA  1 
ATOM   1839 C  C   . ASP A 1 281 ? -26.970 -13.898 -18.747 1.00 93.11  ? 281 ASP A C   1 
ATOM   1840 O  O   . ASP A 1 281 ? -27.823 -13.023 -18.899 1.00 93.17  ? 281 ASP A O   1 
ATOM   1841 C  CB  . ASP A 1 281 ? -25.675 -13.439 -16.659 1.00 98.88  ? 281 ASP A CB  1 
ATOM   1842 C  CG  . ASP A 1 281 ? -25.750 -14.787 -15.967 1.00 103.77 ? 281 ASP A CG  1 
ATOM   1843 O  OD1 . ASP A 1 281 ? -26.385 -14.859 -14.893 1.00 107.84 ? 281 ASP A OD1 1 
ATOM   1844 O  OD2 . ASP A 1 281 ? -25.165 -15.767 -16.482 1.00 107.85 1 281 ASP A OD2 1 
ATOM   1845 N  N   . PRO A 1 282 ? -27.188 -15.180 -19.069 1.00 85.59  ? 282 PRO A N   1 
ATOM   1846 C  CA  . PRO A 1 282 ? -28.518 -15.568 -19.541 1.00 82.92  ? 282 PRO A CA  1 
ATOM   1847 C  C   . PRO A 1 282 ? -29.490 -15.620 -18.375 1.00 80.94  ? 282 PRO A C   1 
ATOM   1848 O  O   . PRO A 1 282 ? -29.076 -15.930 -17.251 1.00 80.16  ? 282 PRO A O   1 
ATOM   1849 C  CB  . PRO A 1 282 ? -28.298 -16.975 -20.099 1.00 82.56  ? 282 PRO A CB  1 
ATOM   1850 C  CG  . PRO A 1 282 ? -27.120 -17.482 -19.367 1.00 82.87  ? 282 PRO A CG  1 
ATOM   1851 C  CD  . PRO A 1 282 ? -26.232 -16.298 -19.123 1.00 85.09  ? 282 PRO A CD  1 
ATOM   1852 N  N   . GLU A 1 283 ? -30.758 -15.322 -18.629 1.00 76.52  ? 283 GLU A N   1 
ATOM   1853 C  CA  . GLU A 1 283 ? -31.768 -15.466 -17.599 1.00 76.42  ? 283 GLU A CA  1 
ATOM   1854 C  C   . GLU A 1 283 ? -31.896 -16.940 -17.230 1.00 75.89  ? 283 GLU A C   1 
ATOM   1855 O  O   . GLU A 1 283 ? -32.005 -17.799 -18.110 1.00 74.08  ? 283 GLU A O   1 
ATOM   1856 C  CB  . GLU A 1 283 ? -33.096 -14.903 -18.081 1.00 76.50  ? 283 GLU A CB  1 
ATOM   1857 C  CG  . GLU A 1 283 ? -33.081 -13.389 -18.212 1.00 82.45  ? 283 GLU A CG  1 
ATOM   1858 C  CD  . GLU A 1 283 ? -34.368 -12.846 -18.810 1.00 90.81  ? 283 GLU A CD  1 
ATOM   1859 O  OE1 . GLU A 1 283 ? -34.482 -11.609 -18.968 1.00 93.92  ? 283 GLU A OE1 1 
ATOM   1860 O  OE2 . GLU A 1 283 ? -35.270 -13.660 -19.118 1.00 93.92  1 283 GLU A OE2 1 
ATOM   1861 N  N   . GLY A 1 284 ? -31.893 -17.231 -15.933 1.00 75.95  ? 284 GLY A N   1 
ATOM   1862 C  CA  . GLY A 1 284 ? -31.885 -18.605 -15.466 1.00 78.61  ? 284 GLY A CA  1 
ATOM   1863 C  C   . GLY A 1 284 ? -30.518 -18.968 -14.917 1.00 79.26  ? 284 GLY A C   1 
ATOM   1864 O  O   . GLY A 1 284 ? -30.291 -20.080 -14.424 1.00 81.08  ? 284 GLY A O   1 
ATOM   1865 N  N   . SER A 1 285 ? -29.596 -18.020 -15.011 1.00 80.91  ? 285 SER A N   1 
ATOM   1866 C  CA  . SER A 1 285 ? -28.287 -18.179 -14.414 1.00 80.50  ? 285 SER A CA  1 
ATOM   1867 C  C   . SER A 1 285 ? -28.195 -17.243 -13.226 1.00 80.43  ? 285 SER A C   1 
ATOM   1868 O  O   . SER A 1 285 ? -28.757 -16.145 -13.240 1.00 80.60  ? 285 SER A O   1 
ATOM   1869 C  CB  . SER A 1 285 ? -27.185 -17.875 -15.425 1.00 79.97  ? 285 SER A CB  1 
ATOM   1870 O  OG  . SER A 1 285 ? -25.924 -17.751 -14.786 1.00 80.66  ? 285 SER A OG  1 
ATOM   1871 N  N   . ILE A 1 286 ? -27.488 -17.683 -12.196 1.00 82.94  ? 286 ILE A N   1 
ATOM   1872 C  CA  . ILE A 1 286 ? -27.384 -16.926 -10.953 1.00 82.30  ? 286 ILE A CA  1 
ATOM   1873 C  C   . ILE A 1 286 ? -26.152 -16.024 -10.872 1.00 86.65  ? 286 ILE A C   1 
ATOM   1874 O  O   . ILE A 1 286 ? -25.889 -15.405 -9.832  1.00 88.25  ? 286 ILE A O   1 
ATOM   1875 C  CB  . ILE A 1 286 ? -27.480 -17.849 -9.733  1.00 79.86  ? 286 ILE A CB  1 
ATOM   1876 C  CG1 . ILE A 1 286 ? -26.623 -19.094 -9.948  1.00 70.71  ? 286 ILE A CG1 1 
ATOM   1877 C  CG2 . ILE A 1 286 ? -28.907 -18.295 -9.553  1.00 73.88  ? 286 ILE A CG2 1 
ATOM   1878 C  CD1 . ILE A 1 286 ? -25.280 -19.010 -9.321  1.00 57.83  ? 286 ILE A CD1 1 
ATOM   1879 N  N   . LEU A 1 287 ? -25.400 -15.968 -11.967 1.00 102.48 ? 287 LEU A N   1 
ATOM   1880 C  CA  . LEU A 1 287 ? -24.107 -15.293 -11.990 1.00 103.50 ? 287 LEU A CA  1 
ATOM   1881 C  C   . LEU A 1 287 ? -24.116 -13.776 -11.780 1.00 103.55 ? 287 LEU A C   1 
ATOM   1882 O  O   . LEU A 1 287 ? -23.175 -13.231 -11.200 1.00 104.54 ? 287 LEU A O   1 
ATOM   1883 C  CB  . LEU A 1 287 ? -23.387 -15.607 -13.299 1.00 104.10 ? 287 LEU A CB  1 
ATOM   1884 C  CG  . LEU A 1 287 ? -22.996 -17.072 -13.484 1.00 103.06 ? 287 LEU A CG  1 
ATOM   1885 C  CD1 . LEU A 1 287 ? -22.427 -17.286 -14.875 1.00 97.81  ? 287 LEU A CD1 1 
ATOM   1886 C  CD2 . LEU A 1 287 ? -21.992 -17.495 -12.427 1.00 98.04  ? 287 LEU A CD2 1 
ATOM   1887 N  N   . ALA A 1 288 ? -25.149 -13.088 -12.247 1.00 89.81  ? 288 ALA A N   1 
ATOM   1888 C  CA  . ALA A 1 288 ? -25.083 -11.629 -12.276 1.00 89.78  ? 288 ALA A CA  1 
ATOM   1889 C  C   . ALA A 1 288 ? -25.212 -10.990 -10.888 1.00 93.50  ? 288 ALA A C   1 
ATOM   1890 O  O   . ALA A 1 288 ? -25.383 -11.678 -9.871  1.00 92.02  ? 288 ALA A O   1 
ATOM   1891 C  CB  . ALA A 1 288 ? -26.128 -11.072 -13.203 1.00 83.27  ? 288 ALA A CB  1 
ATOM   1892 N  N   . GLU A 1 289 ? -25.117 -9.665  -10.859 1.00 114.29 ? 289 GLU A N   1 
ATOM   1893 C  CA  . GLU A 1 289 ? -25.317 -8.900  -9.638  1.00 121.59 ? 289 GLU A CA  1 
ATOM   1894 C  C   . GLU A 1 289 ? -26.001 -7.592  -9.990  1.00 122.63 ? 289 GLU A C   1 
ATOM   1895 O  O   . GLU A 1 289 ? -25.746 -7.024  -11.053 1.00 123.33 ? 289 GLU A O   1 
ATOM   1896 C  CB  . GLU A 1 289 ? -23.985 -8.597  -8.963  1.00 125.15 ? 289 GLU A CB  1 
ATOM   1897 C  CG  . GLU A 1 289 ? -23.347 -9.778  -8.281  1.00 133.59 ? 289 GLU A CG  1 
ATOM   1898 C  CD  . GLU A 1 289 ? -21.920 -9.491  -7.862  1.00 139.92 ? 289 GLU A CD  1 
ATOM   1899 O  OE1 . GLU A 1 289 ? -21.189 -8.846  -8.647  1.00 141.43 ? 289 GLU A OE1 1 
ATOM   1900 O  OE2 . GLU A 1 289 ? -21.530 -9.903  -6.749  1.00 141.42 1 289 GLU A OE2 1 
ATOM   1901 N  N   . PRO A 1 290 ? -26.862 -7.091  -9.093  1.00 118.74 ? 290 PRO A N   1 
ATOM   1902 C  CA  . PRO A 1 290 ? -27.272 -7.671  -7.810  1.00 120.81 ? 290 PRO A CA  1 
ATOM   1903 C  C   . PRO A 1 290 ? -28.201 -8.855  -8.025  1.00 124.43 ? 290 PRO A C   1 
ATOM   1904 O  O   . PRO A 1 290 ? -28.749 -9.009  -9.119  1.00 126.35 ? 290 PRO A O   1 
ATOM   1905 C  CB  . PRO A 1 290 ? -28.052 -6.533  -7.164  1.00 117.61 ? 290 PRO A CB  1 
ATOM   1906 C  CG  . PRO A 1 290 ? -28.648 -5.819  -8.322  1.00 115.17 ? 290 PRO A CG  1 
ATOM   1907 C  CD  . PRO A 1 290 ? -27.587 -5.843  -9.380  1.00 116.13 ? 290 PRO A CD  1 
ATOM   1908 N  N   . GLU A 1 291 ? -28.382 -9.670  -6.991  1.00 115.59 ? 291 GLU A N   1 
ATOM   1909 C  CA  . GLU A 1 291 ? -29.179 -10.887 -7.103  1.00 116.62 ? 291 GLU A CA  1 
ATOM   1910 C  C   . GLU A 1 291 ? -30.615 -10.632 -7.564  1.00 114.57 ? 291 GLU A C   1 
ATOM   1911 O  O   . GLU A 1 291 ? -31.289 -11.539 -8.060  1.00 115.05 ? 291 GLU A O   1 
ATOM   1912 C  CB  . GLU A 1 291 ? -29.168 -11.657 -5.782  1.00 118.88 ? 291 GLU A CB  1 
ATOM   1913 C  CG  . GLU A 1 291 ? -29.784 -13.046 -5.869  1.00 123.89 ? 291 GLU A CG  1 
ATOM   1914 C  CD  . GLU A 1 291 ? -29.006 -13.987 -6.781  1.00 128.20 ? 291 GLU A CD  1 
ATOM   1915 O  OE1 . GLU A 1 291 ? -27.790 -13.762 -6.991  1.00 129.37 ? 291 GLU A OE1 1 
ATOM   1916 O  OE2 . GLU A 1 291 ? -29.618 -14.951 -7.293  1.00 129.33 1 291 GLU A OE2 1 
ATOM   1917 N  N   . GLU A 1 292 ? -31.076 -9.396  -7.411  1.00 132.03 ? 292 GLU A N   1 
ATOM   1918 C  CA  . GLU A 1 292 ? -32.402 -9.014  -7.877  1.00 128.63 ? 292 GLU A CA  1 
ATOM   1919 C  C   . GLU A 1 292 ? -32.593 -9.297  -9.366  1.00 124.56 ? 292 GLU A C   1 
ATOM   1920 O  O   . GLU A 1 292 ? -33.722 -9.455  -9.835  1.00 124.56 ? 292 GLU A O   1 
ATOM   1921 C  CB  . GLU A 1 292 ? -32.669 -7.538  -7.590  1.00 130.00 ? 292 GLU A CB  1 
ATOM   1922 C  CG  . GLU A 1 292 ? -33.237 -7.280  -6.208  1.00 134.04 ? 292 GLU A CG  1 
ATOM   1923 C  CD  . GLU A 1 292 ? -32.185 -7.380  -5.123  1.00 137.77 ? 292 GLU A CD  1 
ATOM   1924 O  OE1 . GLU A 1 292 ? -30.981 -7.311  -5.452  1.00 138.77 ? 292 GLU A OE1 1 
ATOM   1925 O  OE2 . GLU A 1 292 ? -32.563 -7.529  -3.941  1.00 138.75 1 292 GLU A OE2 1 
ATOM   1926 N  N   . LEU A 1 293 ? -31.490 -9.353  -10.106 1.00 110.78 ? 293 LEU A N   1 
ATOM   1927 C  CA  . LEU A 1 293 ? -31.545 -9.604  -11.540 1.00 106.14 ? 293 LEU A CA  1 
ATOM   1928 C  C   . LEU A 1 293 ? -31.861 -11.056 -11.846 1.00 107.80 ? 293 LEU A C   1 
ATOM   1929 O  O   . LEU A 1 293 ? -32.449 -11.374 -12.881 1.00 107.22 ? 293 LEU A O   1 
ATOM   1930 C  CB  . LEU A 1 293 ? -30.213 -9.250  -12.186 1.00 101.90 ? 293 LEU A CB  1 
ATOM   1931 C  CG  . LEU A 1 293 ? -29.866 -7.768  -12.217 1.00 92.02  ? 293 LEU A CG  1 
ATOM   1932 C  CD1 . LEU A 1 293 ? -28.473 -7.567  -12.791 1.00 83.94  ? 293 LEU A CD1 1 
ATOM   1933 C  CD2 . LEU A 1 293 ? -30.902 -7.005  -13.024 1.00 81.72  ? 293 LEU A CD2 1 
ATOM   1934 N  N   . ASN A 1 294 ? -31.482 -11.938 -10.933 1.00 103.28 ? 294 ASN A N   1 
ATOM   1935 C  CA  . ASN A 1 294 ? -31.593 -13.365 -11.182 1.00 106.14 ? 294 ASN A CA  1 
ATOM   1936 C  C   . ASN A 1 294 ? -32.954 -13.931 -10.855 1.00 108.09 ? 294 ASN A C   1 
ATOM   1937 O  O   . ASN A 1 294 ? -33.172 -15.137 -10.989 1.00 107.43 ? 294 ASN A O   1 
ATOM   1938 C  CB  . ASN A 1 294 ? -30.524 -14.119 -10.409 1.00 106.28 ? 294 ASN A CB  1 
ATOM   1939 C  CG  . ASN A 1 294 ? -29.149 -13.601 -10.702 1.00 107.20 ? 294 ASN A CG  1 
ATOM   1940 O  OD1 . ASN A 1 294 ? -28.954 -12.856 -11.666 1.00 108.24 ? 294 ASN A OD1 1 
ATOM   1941 N  ND2 . ASN A 1 294 ? -28.183 -13.971 -9.872  1.00 108.22 ? 294 ASN A ND2 1 
ATOM   1942 N  N   . GLN A 1 295 ? -33.880 -13.077 -10.435 1.00 102.55 ? 295 GLN A N   1 
ATOM   1943 C  CA  . GLN A 1 295 ? -35.170 -13.595 -10.037 1.00 106.70 ? 295 GLN A CA  1 
ATOM   1944 C  C   . GLN A 1 295 ? -35.906 -13.889 -11.325 1.00 107.73 ? 295 GLN A C   1 
ATOM   1945 O  O   . GLN A 1 295 ? -36.193 -12.986 -12.116 1.00 106.43 ? 295 GLN A O   1 
ATOM   1946 C  CB  . GLN A 1 295 ? -35.937 -12.546 -9.239  1.00 108.49 ? 295 GLN A CB  1 
ATOM   1947 C  CG  . GLN A 1 295 ? -35.176 -11.955 -8.058  1.00 115.16 ? 295 GLN A CG  1 
ATOM   1948 C  CD  . GLN A 1 295 ? -35.029 -12.920 -6.897  1.00 121.28 ? 295 GLN A CD  1 
ATOM   1949 O  OE1 . GLN A 1 295 ? -36.023 -13.386 -6.331  1.00 122.99 ? 295 GLN A OE1 1 
ATOM   1950 N  NE2 . GLN A 1 295 ? -33.785 -13.208 -6.519  1.00 122.96 ? 295 GLN A NE2 1 
ATOM   1951 N  N   . THR A 1 296 ? -36.219 -15.161 -11.529 1.00 109.52 ? 296 THR A N   1 
ATOM   1952 C  CA  . THR A 1 296 ? -36.866 -15.583 -12.755 1.00 113.01 ? 296 THR A CA  1 
ATOM   1953 C  C   . THR A 1 296 ? -37.555 -16.920 -12.578 1.00 118.59 ? 296 THR A C   1 
ATOM   1954 O  O   . THR A 1 296 ? -37.232 -17.683 -11.662 1.00 117.44 ? 296 THR A O   1 
ATOM   1955 C  CB  . THR A 1 296 ? -35.864 -15.712 -13.895 1.00 110.84 ? 296 THR A CB  1 
ATOM   1956 O  OG1 . THR A 1 296 ? -36.545 -16.168 -15.070 1.00 109.19 ? 296 THR A OG1 1 
ATOM   1957 C  CG2 . THR A 1 296 ? -34.791 -16.719 -13.520 1.00 109.18 ? 296 THR A CG2 1 
ATOM   1958 N  N   . GLU A 1 297 ? -38.481 -17.214 -13.481 1.00 171.69 ? 297 GLU A N   1 
ATOM   1959 C  CA  . GLU A 1 297 ? -39.220 -18.462 -13.417 1.00 181.73 ? 297 GLU A CA  1 
ATOM   1960 C  C   . GLU A 1 297 ? -38.450 -19.614 -14.039 1.00 182.93 ? 297 GLU A C   1 
ATOM   1961 O  O   . GLU A 1 297 ? -38.034 -20.541 -13.343 1.00 186.97 ? 297 GLU A O   1 
ATOM   1962 C  CB  . GLU A 1 297 ? -40.579 -18.310 -14.093 1.00 186.40 ? 297 GLU A CB  1 
ATOM   1963 C  CG  . GLU A 1 297 ? -41.463 -17.297 -13.404 1.00 193.07 ? 297 GLU A CG  1 
ATOM   1964 C  CD  . GLU A 1 297 ? -41.631 -17.600 -11.929 1.00 196.84 ? 297 GLU A CD  1 
ATOM   1965 O  OE1 . GLU A 1 297 ? -41.871 -18.777 -11.584 1.00 197.60 ? 297 GLU A OE1 1 
ATOM   1966 O  OE2 . GLU A 1 297 ? -41.516 -16.662 -11.112 1.00 197.60 1 297 GLU A OE2 1 
ATOM   1967 N  N   . GLN A 1 298 ? -38.252 -19.547 -15.351 1.00 163.20 ? 298 GLN A N   1 
ATOM   1968 C  CA  . GLN A 1 298 ? -37.643 -20.654 -16.078 1.00 160.76 ? 298 GLN A CA  1 
ATOM   1969 C  C   . GLN A 1 298 ? -36.201 -20.915 -15.673 1.00 160.62 ? 298 GLN A C   1 
ATOM   1970 O  O   . GLN A 1 298 ? -35.399 -19.990 -15.534 1.00 159.62 ? 298 GLN A O   1 
ATOM   1971 C  CB  . GLN A 1 298 ? -37.743 -20.434 -17.586 1.00 159.26 ? 298 GLN A CB  1 
ATOM   1972 C  CG  . GLN A 1 298 ? -39.115 -20.750 -18.147 1.00 158.36 ? 298 GLN A CG  1 
ATOM   1973 C  CD  . GLN A 1 298 ? -39.535 -22.184 -17.872 1.00 157.99 ? 298 GLN A CD  1 
ATOM   1974 O  OE1 . GLN A 1 298 ? -38.718 -23.107 -17.933 1.00 157.95 ? 298 GLN A OE1 1 
ATOM   1975 N  NE2 . GLN A 1 298 ? -40.814 -22.379 -17.569 1.00 157.92 ? 298 GLN A NE2 1 
ATOM   1976 N  N   . THR A 1 299 ? -35.890 -22.189 -15.475 1.00 123.13 ? 299 THR A N   1 
ATOM   1977 C  CA  . THR A 1 299 ? -34.560 -22.603 -15.053 1.00 123.00 ? 299 THR A CA  1 
ATOM   1978 C  C   . THR A 1 299 ? -33.623 -22.943 -16.213 1.00 118.32 ? 299 THR A C   1 
ATOM   1979 O  O   . THR A 1 299 ? -32.430 -23.171 -16.003 1.00 121.49 ? 299 THR A O   1 
ATOM   1980 C  CB  . THR A 1 299 ? -34.633 -23.823 -14.128 1.00 125.66 ? 299 THR A CB  1 
ATOM   1981 O  OG1 . THR A 1 299 ? -33.327 -24.396 -13.992 1.00 127.93 ? 299 THR A OG1 1 
ATOM   1982 C  CG2 . THR A 1 299 ? -35.580 -24.863 -14.714 1.00 127.92 ? 299 THR A CG2 1 
ATOM   1983 N  N   . THR A 1 300 ? -34.158 -22.990 -17.430 1.00 122.21 ? 300 THR A N   1 
ATOM   1984 C  CA  . THR A 1 300 ? -33.370 -23.415 -18.586 1.00 107.99 ? 300 THR A CA  1 
ATOM   1985 C  C   . THR A 1 300 ? -33.488 -22.467 -19.767 1.00 99.36  ? 300 THR A C   1 
ATOM   1986 O  O   . THR A 1 300 ? -34.474 -21.740 -19.901 1.00 98.88  ? 300 THR A O   1 
ATOM   1987 C  CB  . THR A 1 300 ? -33.753 -24.831 -19.053 1.00 107.22 ? 300 THR A CB  1 
ATOM   1988 O  OG1 . THR A 1 300 ? -35.177 -24.922 -19.180 1.00 105.55 ? 300 THR A OG1 1 
ATOM   1989 C  CG2 . THR A 1 300 ? -33.270 -25.864 -18.051 1.00 105.05 ? 300 THR A CG2 1 
ATOM   1990 N  N   . TYR A 1 301 ? -32.471 -22.479 -20.622 1.00 91.14  ? 301 TYR A N   1 
ATOM   1991 C  CA  . TYR A 1 301 ? -32.436 -21.607 -21.788 1.00 81.62  ? 301 TYR A CA  1 
ATOM   1992 C  C   . TYR A 1 301 ? -31.718 -22.319 -22.923 1.00 78.99  ? 301 TYR A C   1 
ATOM   1993 O  O   . TYR A 1 301 ? -30.988 -23.288 -22.699 1.00 76.27  ? 301 TYR A O   1 
ATOM   1994 C  CB  . TYR A 1 301 ? -31.745 -20.288 -21.465 1.00 78.65  ? 301 TYR A CB  1 
ATOM   1995 C  CG  . TYR A 1 301 ? -30.429 -20.466 -20.758 1.00 72.68  ? 301 TYR A CG  1 
ATOM   1996 C  CD1 . TYR A 1 301 ? -29.274 -20.779 -21.469 1.00 70.18  ? 301 TYR A CD1 1 
ATOM   1997 C  CD2 . TYR A 1 301 ? -30.336 -20.322 -19.378 1.00 69.13  ? 301 TYR A CD2 1 
ATOM   1998 C  CE1 . TYR A 1 301 ? -28.076 -20.943 -20.832 1.00 69.61  ? 301 TYR A CE1 1 
ATOM   1999 C  CE2 . TYR A 1 301 ? -29.135 -20.481 -18.733 1.00 69.04  ? 301 TYR A CE2 1 
ATOM   2000 C  CZ  . TYR A 1 301 ? -28.011 -20.792 -19.469 1.00 69.78  ? 301 TYR A CZ  1 
ATOM   2001 O  OH  . TYR A 1 301 ? -26.803 -20.957 -18.843 1.00 72.52  ? 301 TYR A OH  1 
ATOM   2002 N  N   . GLU A 1 302 ? -31.941 -21.856 -24.145 1.00 76.53  ? 302 GLU A N   1 
ATOM   2003 C  CA  . GLU A 1 302 ? -31.377 -22.525 -25.313 1.00 76.29  ? 302 GLU A CA  1 
ATOM   2004 C  C   . GLU A 1 302 ? -29.918 -22.215 -25.668 1.00 73.71  ? 302 GLU A C   1 
ATOM   2005 O  O   . GLU A 1 302 ? -29.226 -23.074 -26.222 1.00 74.15  ? 302 GLU A O   1 
ATOM   2006 C  CB  . GLU A 1 302 ? -32.279 -22.321 -26.527 1.00 77.95  ? 302 GLU A CB  1 
ATOM   2007 C  CG  . GLU A 1 302 ? -33.622 -23.003 -26.376 1.00 83.40  ? 302 GLU A CG  1 
ATOM   2008 C  CD  . GLU A 1 302 ? -33.505 -24.522 -26.341 1.00 89.37  ? 302 GLU A CD  1 
ATOM   2009 O  OE1 . GLU A 1 302 ? -32.438 -25.069 -26.721 1.00 89.82  ? 302 GLU A OE1 1 
ATOM   2010 O  OE2 . GLU A 1 302 ? -34.491 -25.169 -25.930 1.00 92.77  1 302 GLU A OE2 1 
ATOM   2011 N  N   . VAL A 1 303 ? -29.464 -20.999 -25.374 1.00 72.29  ? 303 VAL A N   1 
ATOM   2012 C  CA  . VAL A 1 303 ? -28.095 -20.597 -25.691 1.00 69.05  ? 303 VAL A CA  1 
ATOM   2013 C  C   . VAL A 1 303 ? -27.082 -21.501 -25.007 1.00 68.28  ? 303 VAL A C   1 
ATOM   2014 O  O   . VAL A 1 303 ? -27.202 -21.794 -23.813 1.00 66.52  ? 303 VAL A O   1 
ATOM   2015 C  CB  . VAL A 1 303 ? -27.819 -19.139 -25.297 1.00 68.54  ? 303 VAL A CB  1 
ATOM   2016 C  CG1 . VAL A 1 303 ? -26.371 -18.778 -25.552 1.00 66.35  ? 303 VAL A CG1 1 
ATOM   2017 C  CG2 . VAL A 1 303 ? -28.736 -18.213 -26.061 1.00 68.78  ? 303 VAL A CG2 1 
ATOM   2018 N  N   . GLU A 1 304 ? -26.095 -21.959 -25.770 1.00 75.55  ? 304 GLU A N   1 
ATOM   2019 C  CA  . GLU A 1 304 ? -25.093 -22.863 -25.243 1.00 77.64  ? 304 GLU A CA  1 
ATOM   2020 C  C   . GLU A 1 304 ? -23.832 -22.104 -24.875 1.00 78.16  ? 304 GLU A C   1 
ATOM   2021 O  O   . GLU A 1 304 ? -23.447 -21.146 -25.556 1.00 77.83  ? 304 GLU A O   1 
ATOM   2022 C  CB  . GLU A 1 304 ? -24.766 -23.944 -26.268 1.00 78.19  ? 304 GLU A CB  1 
ATOM   2023 C  CG  . GLU A 1 304 ? -25.987 -24.707 -26.739 1.00 82.35  ? 304 GLU A CG  1 
ATOM   2024 C  CD  . GLU A 1 304 ? -25.651 -25.795 -27.748 1.00 86.15  ? 304 GLU A CD  1 
ATOM   2025 O  OE1 . GLU A 1 304 ? -26.506 -26.086 -28.618 1.00 85.29  ? 304 GLU A OE1 1 
ATOM   2026 O  OE2 . GLU A 1 304 ? -24.531 -26.355 -27.670 1.00 89.07  1 304 GLU A OE2 1 
ATOM   2027 N  N   . GLY A 1 305 ? -23.197 -22.525 -23.786 1.00 97.45  ? 305 GLY A N   1 
ATOM   2028 C  CA  . GLY A 1 305 ? -21.878 -22.033 -23.445 1.00 98.50  ? 305 GLY A CA  1 
ATOM   2029 C  C   . GLY A 1 305 ? -21.833 -20.971 -22.369 1.00 98.17  ? 305 GLY A C   1 
ATOM   2030 O  O   . GLY A 1 305 ? -20.795 -20.780 -21.735 1.00 99.85  ? 305 GLY A O   1 
ATOM   2031 N  N   . ILE A 1 306 ? -22.943 -20.283 -22.136 1.00 72.16  ? 306 ILE A N   1 
ATOM   2032 C  CA  . ILE A 1 306 ? -22.953 -19.271 -21.087 1.00 68.95  ? 306 ILE A CA  1 
ATOM   2033 C  C   . ILE A 1 306 ? -23.963 -19.558 -19.992 1.00 71.25  ? 306 ILE A C   1 
ATOM   2034 O  O   . ILE A 1 306 ? -24.996 -20.201 -20.228 1.00 71.72  ? 306 ILE A O   1 
ATOM   2035 C  CB  . ILE A 1 306 ? -23.192 -17.861 -21.625 1.00 66.98  ? 306 ILE A CB  1 
ATOM   2036 C  CG1 . ILE A 1 306 ? -24.545 -17.779 -22.317 1.00 58.81  ? 306 ILE A CG1 1 
ATOM   2037 C  CG2 . ILE A 1 306 ? -22.121 -17.493 -22.592 1.00 62.22  ? 306 ILE A CG2 1 
ATOM   2038 C  CD1 . ILE A 1 306 ? -24.864 -16.384 -22.760 1.00 46.63  ? 306 ILE A CD1 1 
ATOM   2039 N  N   . GLY A 1 307 ? -23.643 -19.089 -18.790 1.00 82.72  ? 307 GLY A N   1 
ATOM   2040 C  CA  . GLY A 1 307 ? -24.530 -19.206 -17.651 1.00 85.04  ? 307 GLY A CA  1 
ATOM   2041 C  C   . GLY A 1 307 ? -24.332 -20.506 -16.901 1.00 86.35  ? 307 GLY A C   1 
ATOM   2042 O  O   . GLY A 1 307 ? -23.989 -21.539 -17.482 1.00 87.60  ? 307 GLY A O   1 
ATOM   2043 N  N   . TYR A 1 308 ? -24.572 -20.456 -15.598 1.00 83.43  ? 308 TYR A N   1 
ATOM   2044 C  CA  . TYR A 1 308 ? -24.381 -21.610 -14.735 1.00 84.26  ? 308 TYR A CA  1 
ATOM   2045 C  C   . TYR A 1 308 ? -25.214 -21.465 -13.476 1.00 84.71  ? 308 TYR A C   1 
ATOM   2046 O  O   . TYR A 1 308 ? -25.659 -20.367 -13.137 1.00 84.25  ? 308 TYR A O   1 
ATOM   2047 C  CB  . TYR A 1 308 ? -22.908 -21.770 -14.368 1.00 84.31  ? 308 TYR A CB  1 
ATOM   2048 C  CG  . TYR A 1 308 ? -22.098 -22.602 -15.334 1.00 85.65  ? 308 TYR A CG  1 
ATOM   2049 C  CD1 . TYR A 1 308 ? -21.207 -22.006 -16.219 1.00 86.57  ? 308 TYR A CD1 1 
ATOM   2050 C  CD2 . TYR A 1 308 ? -22.223 -23.989 -15.357 1.00 87.49  ? 308 TYR A CD2 1 
ATOM   2051 C  CE1 . TYR A 1 308 ? -20.455 -22.767 -17.098 1.00 88.91  ? 308 TYR A CE1 1 
ATOM   2052 C  CE2 . TYR A 1 308 ? -21.480 -24.758 -16.226 1.00 89.10  ? 308 TYR A CE2 1 
ATOM   2053 C  CZ  . TYR A 1 308 ? -20.598 -24.143 -17.097 1.00 89.79  ? 308 TYR A CZ  1 
ATOM   2054 O  OH  . TYR A 1 308 ? -19.857 -24.910 -17.968 1.00 90.78  ? 308 TYR A OH  1 
ATOM   2055 N  N   . ASP A 1 309 ? -25.421 -22.574 -12.778 1.00 83.62  ? 309 ASP A N   1 
ATOM   2056 C  CA  . ASP A 1 309 ? -26.198 -22.548 -11.547 1.00 84.17  ? 309 ASP A CA  1 
ATOM   2057 C  C   . ASP A 1 309 ? -25.302 -22.317 -10.333 1.00 83.87  ? 309 ASP A C   1 
ATOM   2058 O  O   . ASP A 1 309 ? -25.777 -22.297 -9.192  1.00 84.79  ? 309 ASP A O   1 
ATOM   2059 C  CB  . ASP A 1 309 ? -27.006 -23.838 -11.390 1.00 84.59  ? 309 ASP A CB  1 
ATOM   2060 C  CG  . ASP A 1 309 ? -26.139 -25.081 -11.482 1.00 84.31  ? 309 ASP A CG  1 
ATOM   2061 O  OD1 . ASP A 1 309 ? -24.984 -24.962 -11.959 1.00 84.64  ? 309 ASP A OD1 1 
ATOM   2062 O  OD2 . ASP A 1 309 ? -26.613 -26.172 -11.091 1.00 80.41  1 309 ASP A OD2 1 
ATOM   2063 N  N   . PHE A 1 310 ? -24.008 -22.140 -10.580 1.00 76.91  ? 310 PHE A N   1 
ATOM   2064 C  CA  . PHE A 1 310 ? -23.057 -21.907 -9.502  1.00 74.98  ? 310 PHE A CA  1 
ATOM   2065 C  C   . PHE A 1 310 ? -22.037 -20.856 -9.898  1.00 75.67  ? 310 PHE A C   1 
ATOM   2066 O  O   . PHE A 1 310 ? -21.968 -20.446 -11.058 1.00 75.17  ? 310 PHE A O   1 
ATOM   2067 C  CB  . PHE A 1 310 ? -22.331 -23.195 -9.135  1.00 73.32  ? 310 PHE A CB  1 
ATOM   2068 C  CG  . PHE A 1 310 ? -21.392 -23.670 -10.187 1.00 68.51  ? 310 PHE A CG  1 
ATOM   2069 C  CD1 . PHE A 1 310 ? -20.041 -23.365 -10.114 1.00 65.38  ? 310 PHE A CD1 1 
ATOM   2070 C  CD2 . PHE A 1 310 ? -21.857 -24.407 -11.262 1.00 65.18  ? 310 PHE A CD2 1 
ATOM   2071 C  CE1 . PHE A 1 310 ? -19.174 -23.793 -11.080 1.00 64.51  ? 310 PHE A CE1 1 
ATOM   2072 C  CE2 . PHE A 1 310 ? -20.990 -24.842 -12.236 1.00 64.15  ? 310 PHE A CE2 1 
ATOM   2073 C  CZ  . PHE A 1 310 ? -19.647 -24.535 -12.144 1.00 64.02  ? 310 PHE A CZ  1 
ATOM   2074 N  N   . ILE A 1 311 ? -21.241 -20.426 -8.927  1.00 90.89  ? 311 ILE A N   1 
ATOM   2075 C  CA  . ILE A 1 311 ? -20.216 -19.429 -9.171  1.00 90.45  ? 311 ILE A CA  1 
ATOM   2076 C  C   . ILE A 1 311 ? -18.855 -20.088 -9.219  1.00 91.54  ? 311 ILE A C   1 
ATOM   2077 O  O   . ILE A 1 311 ? -18.327 -20.491 -8.187  1.00 92.45  ? 311 ILE A O   1 
ATOM   2078 C  CB  . ILE A 1 311 ? -20.159 -18.404 -8.050  1.00 89.61  ? 311 ILE A CB  1 
ATOM   2079 C  CG1 . ILE A 1 311 ? -21.532 -17.775 -7.825  1.00 87.04  ? 311 ILE A CG1 1 
ATOM   2080 C  CG2 . ILE A 1 311 ? -19.119 -17.343 -8.375  1.00 86.49  ? 311 ILE A CG2 1 
ATOM   2081 C  CD1 . ILE A 1 311 ? -21.860 -16.690 -8.812  1.00 87.52  ? 311 ILE A CD1 1 
ATOM   2082 N  N   . PRO A 1 312 ? -18.269 -20.169 -10.419 1.00 92.10  ? 312 PRO A N   1 
ATOM   2083 C  CA  . PRO A 1 312 ? -16.979 -20.822 -10.655 1.00 93.60  ? 312 PRO A CA  1 
ATOM   2084 C  C   . PRO A 1 312 ? -15.864 -20.103 -9.920  1.00 96.24  ? 312 PRO A C   1 
ATOM   2085 O  O   . PRO A 1 312 ? -15.887 -18.871 -9.836  1.00 97.28  ? 312 PRO A O   1 
ATOM   2086 C  CB  . PRO A 1 312 ? -16.781 -20.671 -12.164 1.00 92.42  ? 312 PRO A CB  1 
ATOM   2087 C  CG  . PRO A 1 312 ? -18.141 -20.420 -12.707 1.00 89.81  ? 312 PRO A CG  1 
ATOM   2088 C  CD  . PRO A 1 312 ? -18.840 -19.624 -11.659 1.00 90.22  ? 312 PRO A CD  1 
ATOM   2089 N  N   . THR A 1 313 ? -14.896 -20.854 -9.407  1.00 92.21  ? 313 THR A N   1 
ATOM   2090 C  CA  . THR A 1 313 ? -13.831 -20.258 -8.613  1.00 92.33  ? 313 THR A CA  1 
ATOM   2091 C  C   . THR A 1 313 ? -13.016 -19.277 -9.440  1.00 90.09  ? 313 THR A C   1 
ATOM   2092 O  O   . THR A 1 313 ? -12.528 -18.270 -8.916  1.00 90.98  ? 313 THR A O   1 
ATOM   2093 C  CB  . THR A 1 313 ? -12.877 -21.314 -8.047  1.00 93.46  ? 313 THR A CB  1 
ATOM   2094 O  OG1 . THR A 1 313 ? -11.980 -21.730 -9.078  1.00 96.31  ? 313 THR A OG1 1 
ATOM   2095 C  CG2 . THR A 1 313 ? -13.645 -22.518 -7.566  1.00 94.47  ? 313 THR A CG2 1 
ATOM   2096 N  N   . VAL A 1 314 ? -12.869 -19.559 -10.733 1.00 76.28  ? 314 VAL A N   1 
ATOM   2097 C  CA  . VAL A 1 314 ? -12.051 -18.700 -11.585 1.00 72.38  ? 314 VAL A CA  1 
ATOM   2098 C  C   . VAL A 1 314 ? -12.741 -17.386 -11.879 1.00 71.18  ? 314 VAL A C   1 
ATOM   2099 O  O   . VAL A 1 314 ? -12.155 -16.485 -12.475 1.00 69.87  ? 314 VAL A O   1 
ATOM   2100 C  CB  . VAL A 1 314 ? -11.691 -19.359 -12.922 1.00 71.84  ? 314 VAL A CB  1 
ATOM   2101 C  CG1 . VAL A 1 314 ? -10.627 -20.414 -12.718 1.00 70.45  ? 314 VAL A CG1 1 
ATOM   2102 C  CG2 . VAL A 1 314 ? -12.930 -19.936 -13.563 1.00 70.38  ? 314 VAL A CG2 1 
ATOM   2103 N  N   . LEU A 1 315 ? -14.000 -17.280 -11.495 1.00 84.15  ? 315 LEU A N   1 
ATOM   2104 C  CA  . LEU A 1 315 ? -14.718 -16.057 -11.755 1.00 84.70  ? 315 LEU A CA  1 
ATOM   2105 C  C   . LEU A 1 315 ? -14.502 -15.058 -10.630 1.00 89.68  ? 315 LEU A C   1 
ATOM   2106 O  O   . LEU A 1 315 ? -14.738 -15.365 -9.460  1.00 90.19  ? 315 LEU A O   1 
ATOM   2107 C  CB  . LEU A 1 315 ? -16.200 -16.348 -11.952 1.00 80.46  ? 315 LEU A CB  1 
ATOM   2108 C  CG  . LEU A 1 315 ? -17.110 -15.138 -12.139 1.00 70.95  ? 315 LEU A CG  1 
ATOM   2109 C  CD1 . LEU A 1 315 ? -16.597 -14.222 -13.235 1.00 61.91  ? 315 LEU A CD1 1 
ATOM   2110 C  CD2 . LEU A 1 315 ? -18.495 -15.629 -12.486 1.00 62.21  ? 315 LEU A CD2 1 
ATOM   2111 N  N   . ASP A 1 316 ? -14.024 -13.874 -10.990 1.00 111.33 ? 316 ASP A N   1 
ATOM   2112 C  CA  . ASP A 1 316 ? -13.928 -12.775 -10.053 1.00 115.23 ? 316 ASP A CA  1 
ATOM   2113 C  C   . ASP A 1 316 ? -15.008 -11.787 -10.437 1.00 114.98 ? 316 ASP A C   1 
ATOM   2114 O  O   . ASP A 1 316 ? -14.902 -11.125 -11.467 1.00 117.21 ? 316 ASP A O   1 
ATOM   2115 C  CB  . ASP A 1 316 ? -12.563 -12.108 -10.174 1.00 116.93 ? 316 ASP A CB  1 
ATOM   2116 C  CG  . ASP A 1 316 ? -12.343 -11.032 -9.130  1.00 120.97 ? 316 ASP A CG  1 
ATOM   2117 O  OD1 . ASP A 1 316 ? -11.180 -10.844 -8.713  1.00 124.27 ? 316 ASP A OD1 1 
ATOM   2118 O  OD2 . ASP A 1 316 ? -13.331 -10.373 -8.730  1.00 124.25 1 316 ASP A OD2 1 
ATOM   2119 N  N   . ARG A 1 317 ? -16.045 -11.677 -9.617  1.00 83.26  ? 317 ARG A N   1 
ATOM   2120 C  CA  . ARG A 1 317 ? -17.191 -10.849 -9.976  1.00 83.49  ? 317 ARG A CA  1 
ATOM   2121 C  C   . ARG A 1 317 ? -16.980 -9.395  -9.588  1.00 82.25  ? 317 ARG A C   1 
ATOM   2122 O  O   . ARG A 1 317 ? -17.727 -8.509  -10.018 1.00 77.72  ? 317 ARG A O   1 
ATOM   2123 C  CB  . ARG A 1 317 ? -18.451 -11.386 -9.309  1.00 87.55  ? 317 ARG A CB  1 
ATOM   2124 C  CG  . ARG A 1 317 ? -18.723 -12.843 -9.626  1.00 97.02  ? 317 ARG A CG  1 
ATOM   2125 C  CD  . ARG A 1 317 ? -19.584 -13.468 -8.558  1.00 106.53 ? 317 ARG A CD  1 
ATOM   2126 N  NE  . ARG A 1 317 ? -20.969 -13.019 -8.605  1.00 110.13 ? 317 ARG A NE  1 
ATOM   2127 C  CZ  . ARG A 1 317 ? -21.874 -13.347 -7.691  1.00 113.36 ? 317 ARG A CZ  1 
ATOM   2128 N  NH1 . ARG A 1 317 ? -21.525 -14.123 -6.670  1.00 112.21 1 317 ARG A NH1 1 
ATOM   2129 N  NH2 . ARG A 1 317 ? -23.123 -12.905 -7.792  1.00 114.82 ? 317 ARG A NH2 1 
ATOM   2130 N  N   . THR A 1 318 ? -15.949 -9.154  -8.788  1.00 91.41  ? 318 THR A N   1 
ATOM   2131 C  CA  . THR A 1 318 ? -15.690 -7.827  -8.251  1.00 95.79  ? 318 THR A CA  1 
ATOM   2132 C  C   . THR A 1 318 ? -15.118 -6.894  -9.307  1.00 98.25  ? 318 THR A C   1 
ATOM   2133 O  O   . THR A 1 318 ? -15.082 -5.676  -9.118  1.00 100.83 ? 318 THR A O   1 
ATOM   2134 C  CB  . THR A 1 318 ? -14.705 -7.899  -7.090  1.00 96.06  ? 318 THR A CB  1 
ATOM   2135 O  OG1 . THR A 1 318 ? -13.419 -8.289  -7.588  1.00 96.07  ? 318 THR A OG1 1 
ATOM   2136 C  CG2 . THR A 1 318 ? -15.182 -8.927  -6.080  1.00 94.11  ? 318 THR A CG2 1 
ATOM   2137 N  N   . VAL A 1 319 ? -14.655 -7.473  -10.410 1.00 133.92 ? 319 VAL A N   1 
ATOM   2138 C  CA  . VAL A 1 319 ? -14.046 -6.696  -11.481 1.00 131.63 ? 319 VAL A CA  1 
ATOM   2139 C  C   . VAL A 1 319 ? -15.055 -6.329  -12.562 1.00 129.63 ? 319 VAL A C   1 
ATOM   2140 O  O   . VAL A 1 319 ? -14.707 -5.697  -13.558 1.00 129.73 ? 319 VAL A O   1 
ATOM   2141 C  CB  . VAL A 1 319 ? -12.891 -7.463  -12.137 1.00 131.58 ? 319 VAL A CB  1 
ATOM   2142 C  CG1 . VAL A 1 319 ? -11.833 -7.813  -11.105 1.00 131.99 ? 319 VAL A CG1 1 
ATOM   2143 C  CG2 . VAL A 1 319 ? -13.419 -8.721  -12.791 1.00 131.99 ? 319 VAL A CG2 1 
ATOM   2144 N  N   . VAL A 1 320 ? -16.305 -6.730  -12.367 1.00 91.21  ? 320 VAL A N   1 
ATOM   2145 C  CA  . VAL A 1 320 ? -17.348 -6.460  -13.344 1.00 88.24  ? 320 VAL A CA  1 
ATOM   2146 C  C   . VAL A 1 320 ? -18.141 -5.218  -12.977 1.00 89.13  ? 320 VAL A C   1 
ATOM   2147 O  O   . VAL A 1 320 ? -18.873 -5.220  -11.987 1.00 85.80  ? 320 VAL A O   1 
ATOM   2148 C  CB  . VAL A 1 320 ? -18.318 -7.631  -13.428 1.00 87.24  ? 320 VAL A CB  1 
ATOM   2149 C  CG1 . VAL A 1 320 ? -19.363 -7.357  -14.478 1.00 85.52  ? 320 VAL A CG1 1 
ATOM   2150 C  CG2 . VAL A 1 320 ? -17.556 -8.898  -13.749 1.00 85.64  ? 320 VAL A CG2 1 
ATOM   2151 N  N   . ASP A 1 321 ? -18.027 -4.171  -13.785 1.00 101.51 ? 321 ASP A N   1 
ATOM   2152 C  CA  . ASP A 1 321 ? -18.673 -2.906  -13.458 1.00 107.80 ? 321 ASP A CA  1 
ATOM   2153 C  C   . ASP A 1 321 ? -20.189 -2.991  -13.444 1.00 106.78 ? 321 ASP A C   1 
ATOM   2154 O  O   . ASP A 1 321 ? -20.844 -2.380  -12.599 1.00 106.34 ? 321 ASP A O   1 
ATOM   2155 C  CB  . ASP A 1 321 ? -18.237 -1.813  -14.426 1.00 112.83 ? 321 ASP A CB  1 
ATOM   2156 C  CG  . ASP A 1 321 ? -16.806 -1.401  -14.220 1.00 125.29 ? 321 ASP A CG  1 
ATOM   2157 O  OD1 . ASP A 1 321 ? -16.024 -2.222  -13.693 1.00 135.84 ? 321 ASP A OD1 1 
ATOM   2158 O  OD2 . ASP A 1 321 ? -16.465 -0.257  -14.585 1.00 135.90 1 321 ASP A OD2 1 
ATOM   2159 N  N   . LYS A 1 322 ? -20.751 -3.738  -14.385 1.00 103.77 ? 322 LYS A N   1 
ATOM   2160 C  CA  . LYS A 1 322 ? -22.188 -3.935  -14.415 1.00 102.82 ? 322 LYS A CA  1 
ATOM   2161 C  C   . LYS A 1 322 ? -22.535 -5.243  -15.100 1.00 103.76 ? 322 LYS A C   1 
ATOM   2162 O  O   . LYS A 1 322 ? -21.782 -5.730  -15.946 1.00 105.54 ? 322 LYS A O   1 
ATOM   2163 C  CB  . LYS A 1 322 ? -22.877 -2.766  -15.121 1.00 100.95 ? 322 LYS A CB  1 
ATOM   2164 C  CG  . LYS A 1 322 ? -24.394 -2.805  -15.035 1.00 94.77  ? 322 LYS A CG  1 
ATOM   2165 C  CD  . LYS A 1 322 ? -25.014 -1.606  -15.717 1.00 91.57  ? 322 LYS A CD  1 
ATOM   2166 C  CE  . LYS A 1 322 ? -26.539 -1.672  -15.658 1.00 94.53  ? 322 LYS A CE  1 
ATOM   2167 N  NZ  . LYS A 1 322 ? -27.191 -0.508  -16.336 1.00 95.87  1 322 LYS A NZ  1 
ATOM   2168 N  N   . TRP A 1 323 ? -23.681 -5.804  -14.739 1.00 96.70  ? 323 TRP A N   1 
ATOM   2169 C  CA  . TRP A 1 323 ? -24.164 -7.016  -15.370 1.00 93.78  ? 323 TRP A CA  1 
ATOM   2170 C  C   . TRP A 1 323 ? -25.402 -6.714  -16.180 1.00 93.92  ? 323 TRP A C   1 
ATOM   2171 O  O   . TRP A 1 323 ? -26.161 -5.798  -15.857 1.00 93.89  ? 323 TRP A O   1 
ATOM   2172 C  CB  . TRP A 1 323 ? -24.493 -8.070  -14.329 1.00 91.33  ? 323 TRP A CB  1 
ATOM   2173 C  CG  . TRP A 1 323 ? -23.304 -8.640  -13.682 1.00 87.28  ? 323 TRP A CG  1 
ATOM   2174 C  CD1 . TRP A 1 323 ? -22.629 -8.130  -12.609 1.00 86.10  ? 323 TRP A CD1 1 
ATOM   2175 C  CD2 . TRP A 1 323 ? -22.638 -9.850  -14.040 1.00 84.58  ? 323 TRP A CD2 1 
ATOM   2176 N  NE1 . TRP A 1 323 ? -21.572 -8.949  -12.281 1.00 85.36  ? 323 TRP A NE1 1 
ATOM   2177 C  CE2 . TRP A 1 323 ? -21.556 -10.014 -13.145 1.00 84.09  ? 323 TRP A CE2 1 
ATOM   2178 C  CE3 . TRP A 1 323 ? -22.847 -10.813 -15.035 1.00 83.53  ? 323 TRP A CE3 1 
ATOM   2179 C  CZ2 . TRP A 1 323 ? -20.687 -11.097 -13.212 1.00 82.49  ? 323 TRP A CZ2 1 
ATOM   2180 C  CZ3 . TRP A 1 323 ? -21.984 -11.889 -15.102 1.00 82.65  ? 323 TRP A CZ3 1 
ATOM   2181 C  CH2 . TRP A 1 323 ? -20.915 -12.023 -14.193 1.00 81.92  ? 323 TRP A CH2 1 
ATOM   2182 N  N   . PHE A 1 324 ? -25.594 -7.481  -17.246 1.00 94.67  ? 324 PHE A N   1 
ATOM   2183 C  CA  . PHE A 1 324 ? -26.808 -7.397  -18.039 1.00 93.66  ? 324 PHE A CA  1 
ATOM   2184 C  C   . PHE A 1 324 ? -27.367 -8.786  -18.262 1.00 91.85  ? 324 PHE A C   1 
ATOM   2185 O  O   . PHE A 1 324 ? -26.615 -9.749  -18.465 1.00 93.09  ? 324 PHE A O   1 
ATOM   2186 C  CB  . PHE A 1 324 ? -26.536 -6.747  -19.383 1.00 94.83  ? 324 PHE A CB  1 
ATOM   2187 C  CG  . PHE A 1 324 ? -26.621 -5.264  -19.364 1.00 94.21  ? 324 PHE A CG  1 
ATOM   2188 C  CD1 . PHE A 1 324 ? -27.721 -4.620  -19.903 1.00 92.22  ? 324 PHE A CD1 1 
ATOM   2189 C  CD2 . PHE A 1 324 ? -25.603 -4.506  -18.813 1.00 95.24  ? 324 PHE A CD2 1 
ATOM   2190 C  CE1 . PHE A 1 324 ? -27.804 -3.247  -19.897 1.00 92.53  ? 324 PHE A CE1 1 
ATOM   2191 C  CE2 . PHE A 1 324 ? -25.679 -3.133  -18.802 1.00 95.68  ? 324 PHE A CE2 1 
ATOM   2192 C  CZ  . PHE A 1 324 ? -26.783 -2.502  -19.345 1.00 95.42  ? 324 PHE A CZ  1 
ATOM   2193 N  N   . LYS A 1 325 ? -28.688 -8.889  -18.220 1.00 78.96  ? 325 LYS A N   1 
ATOM   2194 C  CA  . LYS A 1 325 ? -29.344 -10.159 -18.464 1.00 77.02  ? 325 LYS A CA  1 
ATOM   2195 C  C   . LYS A 1 325 ? -29.816 -10.258 -19.905 1.00 79.45  ? 325 LYS A C   1 
ATOM   2196 O  O   . LYS A 1 325 ? -30.390 -9.317  -20.456 1.00 76.06  ? 325 LYS A O   1 
ATOM   2197 C  CB  . LYS A 1 325 ? -30.511 -10.369 -17.500 1.00 74.43  ? 325 LYS A CB  1 
ATOM   2198 C  CG  . LYS A 1 325 ? -30.100 -10.846 -16.117 1.00 71.45  ? 325 LYS A CG  1 
ATOM   2199 C  CD  . LYS A 1 325 ? -29.138 -12.024 -16.236 1.00 69.64  ? 325 LYS A CD  1 
ATOM   2200 C  CE  . LYS A 1 325 ? -29.198 -12.939 -15.026 1.00 68.97  ? 325 LYS A CE  1 
ATOM   2201 N  NZ  . LYS A 1 325 ? -30.344 -13.885 -15.122 1.00 69.74  1 325 LYS A NZ  1 
ATOM   2202 N  N   . SER A 1 326 ? -29.538 -11.395 -20.526 1.00 94.12  ? 326 SER A N   1 
ATOM   2203 C  CA  . SER A 1 326 ? -29.957 -11.638 -21.891 1.00 100.14 ? 326 SER A CA  1 
ATOM   2204 C  C   . SER A 1 326 ? -30.858 -12.862 -21.951 1.00 100.74 ? 326 SER A C   1 
ATOM   2205 O  O   . SER A 1 326 ? -30.780 -13.742 -21.090 1.00 101.00 ? 326 SER A O   1 
ATOM   2206 C  CB  . SER A 1 326 ? -28.734 -11.868 -22.771 1.00 103.96 ? 326 SER A CB  1 
ATOM   2207 O  OG  . SER A 1 326 ? -28.129 -13.108 -22.447 1.00 109.90 ? 326 SER A OG  1 
ATOM   2208 N  N   . ASN A 1 327 ? -31.717 -12.919 -22.963 1.00 110.74 ? 327 ASN A N   1 
ATOM   2209 C  CA  . ASN A 1 327 ? -32.547 -14.097 -23.169 1.00 108.34 ? 327 ASN A CA  1 
ATOM   2210 C  C   . ASN A 1 327 ? -32.173 -14.781 -24.474 1.00 106.82 ? 327 ASN A C   1 
ATOM   2211 O  O   . ASN A 1 327 ? -31.266 -14.334 -25.178 1.00 107.65 ? 327 ASN A O   1 
ATOM   2212 C  CB  . ASN A 1 327 ? -34.036 -13.732 -23.159 1.00 107.43 ? 327 ASN A CB  1 
ATOM   2213 C  CG  . ASN A 1 327 ? -34.413 -12.733 -24.248 1.00 105.35 ? 327 ASN A CG  1 
ATOM   2214 O  OD1 . ASN A 1 327 ? -34.016 -12.865 -25.407 1.00 104.28 ? 327 ASN A OD1 1 
ATOM   2215 N  ND2 . ASN A 1 327 ? -35.191 -11.728 -23.873 1.00 104.29 ? 327 ASN A ND2 1 
ATOM   2216 N  N   . ASP A 1 328 ? -32.885 -15.849 -24.808 1.00 87.27  ? 328 ASP A N   1 
ATOM   2217 C  CA  . ASP A 1 328 ? -32.594 -16.577 -26.034 1.00 84.25  ? 328 ASP A CA  1 
ATOM   2218 C  C   . ASP A 1 328 ? -32.995 -15.787 -27.272 1.00 84.90  ? 328 ASP A C   1 
ATOM   2219 O  O   . ASP A 1 328 ? -32.224 -15.697 -28.229 1.00 83.01  ? 328 ASP A O   1 
ATOM   2220 C  CB  . ASP A 1 328 ? -33.256 -17.954 -26.036 1.00 82.14  ? 328 ASP A CB  1 
ATOM   2221 C  CG  . ASP A 1 328 ? -32.557 -18.935 -25.118 1.00 78.21  ? 328 ASP A CG  1 
ATOM   2222 O  OD1 . ASP A 1 328 ? -33.212 -19.882 -24.636 1.00 76.54  ? 328 ASP A OD1 1 
ATOM   2223 O  OD2 . ASP A 1 328 ? -31.341 -18.761 -24.885 1.00 75.06  1 328 ASP A OD2 1 
ATOM   2224 N  N   . GLU A 1 329 ? -34.200 -15.228 -27.253 1.00 92.21  ? 329 GLU A N   1 
ATOM   2225 C  CA  . GLU A 1 329 ? -34.734 -14.504 -28.402 1.00 95.56  ? 329 GLU A CA  1 
ATOM   2226 C  C   . GLU A 1 329 ? -33.788 -13.389 -28.845 1.00 92.73  ? 329 GLU A C   1 
ATOM   2227 O  O   . GLU A 1 329 ? -33.452 -13.266 -30.034 1.00 92.12  ? 329 GLU A O   1 
ATOM   2228 C  CB  . GLU A 1 329 ? -36.106 -13.934 -28.064 1.00 99.52  ? 329 GLU A CB  1 
ATOM   2229 C  CG  . GLU A 1 329 ? -36.726 -13.104 -29.165 1.00 112.98 ? 329 GLU A CG  1 
ATOM   2230 C  CD  . GLU A 1 329 ? -38.226 -13.322 -29.254 1.00 125.17 ? 329 GLU A CD  1 
ATOM   2231 O  OE1 . GLU A 1 329 ? -38.894 -12.570 -29.995 1.00 128.60 ? 329 GLU A OE1 1 
ATOM   2232 O  OE2 . GLU A 1 329 ? -38.734 -14.260 -28.596 1.00 128.57 1 329 GLU A OE2 1 
ATOM   2233 N  N   . GLU A 1 330 ? -33.349 -12.602 -27.870 1.00 89.13  ? 330 GLU A N   1 
ATOM   2234 C  CA  . GLU A 1 330 ? -32.364 -11.558 -28.089 1.00 87.79  ? 330 GLU A CA  1 
ATOM   2235 C  C   . GLU A 1 330 ? -31.169 -12.140 -28.812 1.00 83.16  ? 330 GLU A C   1 
ATOM   2236 O  O   . GLU A 1 330 ? -30.775 -11.669 -29.887 1.00 80.39  ? 330 GLU A O   1 
ATOM   2237 C  CB  . GLU A 1 330 ? -31.874 -11.051 -26.743 1.00 91.08  ? 330 GLU A CB  1 
ATOM   2238 C  CG  . GLU A 1 330 ? -32.419 -9.720  -26.313 1.00 104.22 ? 330 GLU A CG  1 
ATOM   2239 C  CD  . GLU A 1 330 ? -31.868 -9.319  -24.959 1.00 117.57 ? 330 GLU A CD  1 
ATOM   2240 O  OE1 . GLU A 1 330 ? -31.371 -10.212 -24.238 1.00 121.36 ? 330 GLU A OE1 1 
ATOM   2241 O  OE2 . GLU A 1 330 ? -31.913 -8.119  -24.620 1.00 121.43 1 330 GLU A OE2 1 
ATOM   2242 N  N   . ALA A 1 331 ? -30.619 -13.192 -28.212 1.00 87.36  ? 331 ALA A N   1 
ATOM   2243 C  CA  . ALA A 1 331 ? -29.381 -13.806 -28.665 1.00 86.84  ? 331 ALA A CA  1 
ATOM   2244 C  C   . ALA A 1 331 ? -29.463 -14.234 -30.114 1.00 87.57  ? 331 ALA A C   1 
ATOM   2245 O  O   . ALA A 1 331 ? -28.664 -13.805 -30.942 1.00 87.61  ? 331 ALA A O   1 
ATOM   2246 C  CB  . ALA A 1 331 ? -29.052 -14.997 -27.808 1.00 85.01  ? 331 ALA A CB  1 
ATOM   2247 N  N   . PHE A 1 332 ? -30.444 -15.069 -30.424 1.00 81.06  ? 332 PHE A N   1 
ATOM   2248 C  CA  . PHE A 1 332 ? -30.538 -15.619 -31.760 1.00 82.58  ? 332 PHE A CA  1 
ATOM   2249 C  C   . PHE A 1 332 ? -30.901 -14.561 -32.784 1.00 84.36  ? 332 PHE A C   1 
ATOM   2250 O  O   . PHE A 1 332 ? -30.388 -14.581 -33.912 1.00 84.94  ? 332 PHE A O   1 
ATOM   2251 C  CB  . PHE A 1 332 ? -31.498 -16.797 -31.789 1.00 81.94  ? 332 PHE A CB  1 
ATOM   2252 C  CG  . PHE A 1 332 ? -31.042 -17.950 -30.954 1.00 78.93  ? 332 PHE A CG  1 
ATOM   2253 C  CD1 . PHE A 1 332 ? -29.688 -18.243 -30.845 1.00 75.22  ? 332 PHE A CD1 1 
ATOM   2254 C  CD2 . PHE A 1 332 ? -31.951 -18.745 -30.281 1.00 76.74  ? 332 PHE A CD2 1 
ATOM   2255 C  CE1 . PHE A 1 332 ? -29.250 -19.308 -30.083 1.00 73.40  ? 332 PHE A CE1 1 
ATOM   2256 C  CE2 . PHE A 1 332 ? -31.519 -19.813 -29.514 1.00 75.48  ? 332 PHE A CE2 1 
ATOM   2257 C  CZ  . PHE A 1 332 ? -30.167 -20.093 -29.416 1.00 74.02  ? 332 PHE A CZ  1 
ATOM   2258 N  N   . THR A 1 333 ? -31.757 -13.623 -32.397 1.00 78.82  ? 333 THR A N   1 
ATOM   2259 C  CA  . THR A 1 333 ? -32.099 -12.546 -33.315 1.00 79.14  ? 333 THR A CA  1 
ATOM   2260 C  C   . THR A 1 333 ? -30.855 -11.749 -33.686 1.00 78.84  ? 333 THR A C   1 
ATOM   2261 O  O   . THR A 1 333 ? -30.631 -11.415 -34.859 1.00 79.45  ? 333 THR A O   1 
ATOM   2262 C  CB  . THR A 1 333 ? -33.146 -11.611 -32.725 1.00 79.86  ? 333 THR A CB  1 
ATOM   2263 O  OG1 . THR A 1 333 ? -34.370 -12.333 -32.578 1.00 79.68  ? 333 THR A OG1 1 
ATOM   2264 C  CG2 . THR A 1 333 ? -33.387 -10.438 -33.650 1.00 78.10  ? 333 THR A CG2 1 
ATOM   2265 N  N   . PHE A 1 334 ? -30.022 -11.475 -32.692 1.00 86.78  ? 334 PHE A N   1 
ATOM   2266 C  CA  . PHE A 1 334 ? -28.834 -10.684 -32.945 1.00 84.95  ? 334 PHE A CA  1 
ATOM   2267 C  C   . PHE A 1 334 ? -27.720 -11.455 -33.618 1.00 80.69  ? 334 PHE A C   1 
ATOM   2268 O  O   . PHE A 1 334 ? -26.873 -10.860 -34.276 1.00 80.96  ? 334 PHE A O   1 
ATOM   2269 C  CB  . PHE A 1 334 ? -28.309 -10.073 -31.663 1.00 87.44  ? 334 PHE A CB  1 
ATOM   2270 C  CG  . PHE A 1 334 ? -28.920 -8.765  -31.340 1.00 94.30  ? 334 PHE A CG  1 
ATOM   2271 C  CD1 . PHE A 1 334 ? -30.141 -8.702  -30.697 1.00 99.68  ? 334 PHE A CD1 1 
ATOM   2272 C  CD2 . PHE A 1 334 ? -28.286 -7.591  -31.700 1.00 99.84  ? 334 PHE A CD2 1 
ATOM   2273 C  CE1 . PHE A 1 334 ? -30.708 -7.488  -30.400 1.00 103.27 ? 334 PHE A CE1 1 
ATOM   2274 C  CE2 . PHE A 1 334 ? -28.849 -6.376  -31.406 1.00 103.15 ? 334 PHE A CE2 1 
ATOM   2275 C  CZ  . PHE A 1 334 ? -30.060 -6.324  -30.755 1.00 104.17 ? 334 PHE A CZ  1 
ATOM   2276 N  N   . ALA A 1 335 ? -27.705 -12.769 -33.447 1.00 81.32  ? 335 ALA A N   1 
ATOM   2277 C  CA  . ALA A 1 335 ? -26.694 -13.584 -34.099 1.00 77.00  ? 335 ALA A CA  1 
ATOM   2278 C  C   . ALA A 1 335 ? -27.034 -13.676 -35.580 1.00 76.29  ? 335 ALA A C   1 
ATOM   2279 O  O   . ALA A 1 335 ? -26.173 -13.471 -36.450 1.00 74.96  ? 335 ALA A O   1 
ATOM   2280 C  CB  . ALA A 1 335 ? -26.633 -14.960 -33.481 1.00 73.72  ? 335 ALA A CB  1 
ATOM   2281 N  N   . ARG A 1 336 ? -28.298 -13.968 -35.865 1.00 69.99  ? 336 ARG A N   1 
ATOM   2282 C  CA  . ARG A 1 336 ? -28.735 -14.024 -37.248 1.00 74.12  ? 336 ARG A CA  1 
ATOM   2283 C  C   . ARG A 1 336 ? -28.518 -12.663 -37.895 1.00 76.63  ? 336 ARG A C   1 
ATOM   2284 O  O   . ARG A 1 336 ? -28.039 -12.567 -39.038 1.00 74.17  ? 336 ARG A O   1 
ATOM   2285 C  CB  . ARG A 1 336 ? -30.201 -14.445 -37.338 1.00 76.61  ? 336 ARG A CB  1 
ATOM   2286 C  CG  . ARG A 1 336 ? -30.432 -15.897 -36.950 1.00 80.05  ? 336 ARG A CG  1 
ATOM   2287 C  CD  . ARG A 1 336 ? -31.910 -16.208 -36.834 1.00 85.66  ? 336 ARG A CD  1 
ATOM   2288 N  NE  . ARG A 1 336 ? -32.364 -17.183 -37.821 1.00 90.55  ? 336 ARG A NE  1 
ATOM   2289 C  CZ  . ARG A 1 336 ? -33.237 -16.909 -38.785 1.00 91.68  ? 336 ARG A CZ  1 
ATOM   2290 N  NH1 . ARG A 1 336 ? -33.608 -17.852 -39.641 1.00 92.12  1 336 ARG A NH1 1 
ATOM   2291 N  NH2 . ARG A 1 336 ? -33.749 -15.686 -38.887 1.00 92.17  ? 336 ARG A NH2 1 
ATOM   2292 N  N   . MET A 1 337 ? -28.840 -11.613 -37.148 1.00 89.80  ? 337 MET A N   1 
ATOM   2293 C  CA  . MET A 1 337 ? -28.634 -10.258 -37.628 1.00 94.97  ? 337 MET A CA  1 
ATOM   2294 C  C   . MET A 1 337 ? -27.159 -9.994  -37.894 1.00 91.61  ? 337 MET A C   1 
ATOM   2295 O  O   . MET A 1 337 ? -26.797 -9.264  -38.816 1.00 92.50  ? 337 MET A O   1 
ATOM   2296 C  CB  . MET A 1 337 ? -29.147 -9.256  -36.603 1.00 101.22 ? 337 MET A CB  1 
ATOM   2297 C  CG  . MET A 1 337 ? -29.155 -7.829  -37.103 1.00 114.28 ? 337 MET A CG  1 
ATOM   2298 S  SD  . MET A 1 337 ? -29.894 -6.713  -35.898 1.00 125.07 ? 337 MET A SD  1 
ATOM   2299 C  CE  . MET A 1 337 ? -31.390 -7.624  -35.507 1.00 127.88 ? 337 MET A CE  1 
ATOM   2300 N  N   . LEU A 1 338 ? -26.310 -10.607 -37.083 1.00 87.20  ? 338 LEU A N   1 
ATOM   2301 C  CA  . LEU A 1 338 ? -24.876 -10.387 -37.152 1.00 80.63  ? 338 LEU A CA  1 
ATOM   2302 C  C   . LEU A 1 338 ? -24.335 -11.023 -38.420 1.00 76.40  ? 338 LEU A C   1 
ATOM   2303 O  O   . LEU A 1 338 ? -23.534 -10.425 -39.140 1.00 74.82  ? 338 LEU A O   1 
ATOM   2304 C  CB  . LEU A 1 338 ? -24.193 -10.990 -35.928 1.00 80.60  ? 338 LEU A CB  1 
ATOM   2305 C  CG  . LEU A 1 338 ? -22.960 -10.285 -35.370 1.00 80.89  ? 338 LEU A CG  1 
ATOM   2306 C  CD1 . LEU A 1 338 ? -23.267 -8.829  -35.115 1.00 81.89  ? 338 LEU A CD1 1 
ATOM   2307 C  CD2 . LEU A 1 338 ? -22.538 -10.944 -34.082 1.00 82.36  ? 338 LEU A CD2 1 
ATOM   2308 N  N   . ILE A 1 339 ? -24.774 -12.247 -38.687 1.00 73.57  ? 339 ILE A N   1 
ATOM   2309 C  CA  . ILE A 1 339 ? -24.396 -12.925 -39.916 1.00 70.77  ? 339 ILE A CA  1 
ATOM   2310 C  C   . ILE A 1 339 ? -24.881 -12.156 -41.135 1.00 72.56  ? 339 ILE A C   1 
ATOM   2311 O  O   . ILE A 1 339 ? -24.094 -11.789 -42.014 1.00 71.03  ? 339 ILE A O   1 
ATOM   2312 C  CB  . ILE A 1 339 ? -24.994 -14.325 -39.987 1.00 68.93  ? 339 ILE A CB  1 
ATOM   2313 C  CG1 . ILE A 1 339 ? -24.432 -15.186 -38.861 1.00 65.17  ? 339 ILE A CG1 1 
ATOM   2314 C  CG2 . ILE A 1 339 ? -24.694 -14.956 -41.336 1.00 65.53  ? 339 ILE A CG2 1 
ATOM   2315 C  CD1 . ILE A 1 339 ? -25.141 -16.508 -38.703 1.00 60.92  ? 339 ILE A CD1 1 
ATOM   2316 N  N   . ALA A 1 340 ? -26.184 -11.907 -41.181 1.00 83.65  ? 340 ALA A N   1 
ATOM   2317 C  CA  . ALA A 1 340 ? -26.785 -11.308 -42.362 1.00 87.41  ? 340 ALA A CA  1 
ATOM   2318 C  C   . ALA A 1 340 ? -26.248 -9.912  -42.656 1.00 89.70  ? 340 ALA A C   1 
ATOM   2319 O  O   . ALA A 1 340 ? -25.929 -9.595  -43.801 1.00 91.73  ? 340 ALA A O   1 
ATOM   2320 C  CB  . ALA A 1 340 ? -28.286 -11.281 -42.238 1.00 86.38  ? 340 ALA A CB  1 
ATOM   2321 N  N   . GLN A 1 341 ? -26.195 -9.056  -41.644 1.00 88.88  ? 341 GLN A N   1 
ATOM   2322 C  CA  . GLN A 1 341 ? -25.699 -7.706  -41.863 1.00 89.90  ? 341 GLN A CA  1 
ATOM   2323 C  C   . GLN A 1 341 ? -24.178 -7.589  -41.928 1.00 88.51  ? 341 GLN A C   1 
ATOM   2324 O  O   . GLN A 1 341 ? -23.637 -6.970  -42.841 1.00 87.55  ? 341 GLN A O   1 
ATOM   2325 C  CB  . GLN A 1 341 ? -26.217 -6.781  -40.764 1.00 91.56  ? 341 GLN A CB  1 
ATOM   2326 C  CG  . GLN A 1 341 ? -27.729 -6.733  -40.664 1.00 99.49  ? 341 GLN A CG  1 
ATOM   2327 C  CD  . GLN A 1 341 ? -28.337 -5.696  -41.584 1.00 109.54 ? 341 GLN A CD  1 
ATOM   2328 O  OE1 . GLN A 1 341 ? -27.741 -5.311  -42.595 1.00 113.01 ? 341 GLN A OE1 1 
ATOM   2329 N  NE2 . GLN A 1 341 ? -29.529 -5.228  -41.233 1.00 113.03 ? 341 GLN A NE2 1 
ATOM   2330 N  N   . GLU A 1 342 ? -23.492 -8.161  -40.946 1.00 80.43  ? 342 GLU A N   1 
ATOM   2331 C  CA  . GLU A 1 342 ? -22.047 -7.977  -40.831 1.00 82.60  ? 342 GLU A CA  1 
ATOM   2332 C  C   . GLU A 1 342 ? -21.186 -9.074  -41.459 1.00 80.97  ? 342 GLU A C   1 
ATOM   2333 O  O   . GLU A 1 342 ? -19.961 -8.922  -41.572 1.00 77.91  ? 342 GLU A O   1 
ATOM   2334 C  CB  . GLU A 1 342 ? -21.650 -7.776  -39.364 1.00 85.24  ? 342 GLU A CB  1 
ATOM   2335 C  CG  . GLU A 1 342 ? -22.233 -6.523  -38.730 1.00 99.82  ? 342 GLU A CG  1 
ATOM   2336 C  CD  . GLU A 1 342 ? -21.624 -5.246  -39.283 1.00 114.09 ? 342 GLU A CD  1 
ATOM   2337 O  OE1 . GLU A 1 342 ? -20.568 -5.317  -39.951 1.00 118.18 ? 342 GLU A OE1 1 
ATOM   2338 O  OE2 . GLU A 1 342 ? -22.197 -4.164  -39.035 1.00 118.18 1 342 GLU A OE2 1 
ATOM   2339 N  N   . GLY A 1 343 ? -21.813 -10.165 -41.878 1.00 88.91  ? 343 GLY A N   1 
ATOM   2340 C  CA  . GLY A 1 343 ? -21.066 -11.281 -42.430 1.00 91.34  ? 343 GLY A CA  1 
ATOM   2341 C  C   . GLY A 1 343 ? -20.151 -12.007 -41.456 1.00 91.99  ? 343 GLY A C   1 
ATOM   2342 O  O   . GLY A 1 343 ? -19.208 -12.689 -41.862 1.00 92.73  ? 343 GLY A O   1 
ATOM   2343 N  N   . LEU A 1 344 ? -20.432 -11.883 -40.167 1.00 73.97  ? 344 LEU A N   1 
ATOM   2344 C  CA  . LEU A 1 344 ? -19.660 -12.581 -39.155 1.00 72.94  ? 344 LEU A CA  1 
ATOM   2345 C  C   . LEU A 1 344 ? -20.335 -13.893 -38.855 1.00 73.78  ? 344 LEU A C   1 
ATOM   2346 O  O   . LEU A 1 344 ? -21.428 -13.905 -38.293 1.00 74.67  ? 344 LEU A O   1 
ATOM   2347 C  CB  . LEU A 1 344 ? -19.629 -11.763 -37.879 1.00 71.56  ? 344 LEU A CB  1 
ATOM   2348 C  CG  . LEU A 1 344 ? -19.004 -10.387 -38.012 1.00 66.70  ? 344 LEU A CG  1 
ATOM   2349 C  CD1 . LEU A 1 344 ? -19.345 -9.570  -36.790 1.00 62.67  ? 344 LEU A CD1 1 
ATOM   2350 C  CD2 . LEU A 1 344 ? -17.502 -10.552 -38.121 1.00 61.07  ? 344 LEU A CD2 1 
ATOM   2351 N  N   . LEU A 1 345 ? -19.692 -15.009 -39.164 1.00 75.62  ? 345 LEU A N   1 
ATOM   2352 C  CA  . LEU A 1 345 ? -20.366 -16.263 -38.922 1.00 75.33  ? 345 LEU A CA  1 
ATOM   2353 C  C   . LEU A 1 345 ? -19.979 -16.664 -37.527 1.00 77.87  ? 345 LEU A C   1 
ATOM   2354 O  O   . LEU A 1 345 ? -18.834 -17.031 -37.274 1.00 79.04  ? 345 LEU A O   1 
ATOM   2355 C  CB  . LEU A 1 345 ? -19.896 -17.328 -39.903 1.00 72.76  ? 345 LEU A CB  1 
ATOM   2356 C  CG  . LEU A 1 345 ? -20.013 -16.988 -41.389 1.00 65.45  ? 345 LEU A CG  1 
ATOM   2357 C  CD1 . LEU A 1 345 ? -19.574 -18.179 -42.230 1.00 58.49  ? 345 LEU A CD1 1 
ATOM   2358 C  CD2 . LEU A 1 345 ? -21.421 -16.579 -41.739 1.00 55.68  ? 345 LEU A CD2 1 
ATOM   2359 N  N   . CYS A 1 346 ? -20.939 -16.619 -36.615 1.00 87.43  ? 346 CYS A N   1 
ATOM   2360 C  CA  . CYS A 1 346 ? -20.614 -16.718 -35.205 1.00 88.58  ? 346 CYS A CA  1 
ATOM   2361 C  C   . CYS A 1 346 ? -21.756 -17.325 -34.416 1.00 90.29  ? 346 CYS A C   1 
ATOM   2362 O  O   . CYS A 1 346 ? -22.894 -17.373 -34.888 1.00 92.50  ? 346 CYS A O   1 
ATOM   2363 C  CB  . CYS A 1 346 ? -20.264 -15.343 -34.641 1.00 86.07  ? 346 CYS A CB  1 
ATOM   2364 S  SG  . CYS A 1 346 ? -21.650 -14.204 -34.652 1.00 83.15  ? 346 CYS A SG  1 
ATOM   2365 N  N   . GLY A 1 347 ? -21.443 -17.774 -33.206 1.00 118.87 ? 347 GLY A N   1 
ATOM   2366 C  CA  . GLY A 1 347 ? -22.412 -18.449 -32.370 1.00 117.43 ? 347 GLY A CA  1 
ATOM   2367 C  C   . GLY A 1 347 ? -23.414 -17.536 -31.699 1.00 115.85 ? 347 GLY A C   1 
ATOM   2368 O  O   . GLY A 1 347 ? -23.333 -16.308 -31.808 1.00 116.87 ? 347 GLY A O   1 
ATOM   2369 N  N   . GLY A 1 348 ? -24.357 -18.144 -30.986 1.00 85.59  ? 348 GLY A N   1 
ATOM   2370 C  CA  . GLY A 1 348 ? -25.428 -17.398 -30.355 1.00 81.27  ? 348 GLY A CA  1 
ATOM   2371 C  C   . GLY A 1 348 ? -24.926 -16.672 -29.132 1.00 79.48  ? 348 GLY A C   1 
ATOM   2372 O  O   . GLY A 1 348 ? -25.503 -15.671 -28.716 1.00 77.07  ? 348 GLY A O   1 
ATOM   2373 N  N   . SER A 1 349 ? -23.837 -17.177 -28.570 1.00 82.05  ? 349 SER A N   1 
ATOM   2374 C  CA  . SER A 1 349 ? -23.187 -16.546 -27.439 1.00 83.78  ? 349 SER A CA  1 
ATOM   2375 C  C   . SER A 1 349 ? -22.862 -15.106 -27.822 1.00 86.53  ? 349 SER A C   1 
ATOM   2376 O  O   . SER A 1 349 ? -23.184 -14.138 -27.099 1.00 86.97  ? 349 SER A O   1 
ATOM   2377 C  CB  . SER A 1 349 ? -21.905 -17.302 -27.140 1.00 82.46  ? 349 SER A CB  1 
ATOM   2378 O  OG  . SER A 1 349 ? -21.432 -16.977 -25.858 1.00 79.34  ? 349 SER A OG  1 
ATOM   2379 N  N   . ALA A 1 350 ? -22.234 -14.989 -28.988 1.00 93.63  ? 350 ALA A N   1 
ATOM   2380 C  CA  . ALA A 1 350 ? -21.908 -13.707 -29.582 1.00 95.38  ? 350 ALA A CA  1 
ATOM   2381 C  C   . ALA A 1 350 ? -23.170 -12.876 -29.735 1.00 95.20  ? 350 ALA A C   1 
ATOM   2382 O  O   . ALA A 1 350 ? -23.160 -11.660 -29.511 1.00 97.86  ? 350 ALA A O   1 
ATOM   2383 C  CB  . ALA A 1 350 ? -21.276 -13.924 -30.932 1.00 95.22  ? 350 ALA A CB  1 
ATOM   2384 N  N   . GLY A 1 351 ? -24.253 -13.541 -30.125 1.00 100.82 ? 351 GLY A N   1 
ATOM   2385 C  CA  . GLY A 1 351 ? -25.533 -12.881 -30.286 1.00 96.58  ? 351 GLY A CA  1 
ATOM   2386 C  C   . GLY A 1 351 ? -25.965 -12.198 -29.006 1.00 94.18  ? 351 GLY A C   1 
ATOM   2387 O  O   . GLY A 1 351 ? -26.334 -11.025 -29.015 1.00 93.55  ? 351 GLY A O   1 
ATOM   2388 N  N   . SER A 1 352 ? -25.898 -12.935 -27.901 1.00 64.25  ? 352 SER A N   1 
ATOM   2389 C  CA  . SER A 1 352 ? -26.231 -12.414 -26.585 1.00 64.15  ? 352 SER A CA  1 
ATOM   2390 C  C   . SER A 1 352 ? -25.371 -11.201 -26.318 1.00 64.80  ? 352 SER A C   1 
ATOM   2391 O  O   . SER A 1 352 ? -25.862 -10.128 -25.933 1.00 62.53  ? 352 SER A O   1 
ATOM   2392 C  CB  . SER A 1 352 ? -25.933 -13.461 -25.516 1.00 64.15  ? 352 SER A CB  1 
ATOM   2393 O  OG  . SER A 1 352 ? -26.576 -14.683 -25.811 1.00 66.07  ? 352 SER A OG  1 
ATOM   2394 N  N   . THR A 1 353 ? -24.074 -11.389 -26.527 1.00 79.00  ? 353 THR A N   1 
ATOM   2395 C  CA  . THR A 1 353 ? -23.101 -10.362 -26.211 1.00 82.32  ? 353 THR A CA  1 
ATOM   2396 C  C   . THR A 1 353 ? -23.377 -9.032  -26.907 1.00 82.60  ? 353 THR A C   1 
ATOM   2397 O  O   . THR A 1 353 ? -23.377 -7.963  -26.275 1.00 83.87  ? 353 THR A O   1 
ATOM   2398 C  CB  . THR A 1 353 ? -21.708 -10.827 -26.566 1.00 82.78  ? 353 THR A CB  1 
ATOM   2399 O  OG1 . THR A 1 353 ? -21.464 -12.084 -25.929 1.00 85.24  ? 353 THR A OG1 1 
ATOM   2400 C  CG2 . THR A 1 353 ? -20.693 -9.812  -26.101 1.00 85.31  ? 353 THR A CG2 1 
ATOM   2401 N  N   . VAL A 1 354 ? -23.622 -9.096  -28.208 1.00 84.28  ? 354 VAL A N   1 
ATOM   2402 C  CA  . VAL A 1 354 ? -23.887 -7.880  -28.956 1.00 83.32  ? 354 VAL A CA  1 
ATOM   2403 C  C   . VAL A 1 354 ? -25.229 -7.315  -28.538 1.00 83.42  ? 354 VAL A C   1 
ATOM   2404 O  O   . VAL A 1 354 ? -25.391 -6.095  -28.384 1.00 81.66  ? 354 VAL A O   1 
ATOM   2405 C  CB  . VAL A 1 354 ? -23.858 -8.120  -30.469 1.00 82.68  ? 354 VAL A CB  1 
ATOM   2406 C  CG1 . VAL A 1 354 ? -24.463 -6.934  -31.203 1.00 82.83  ? 354 VAL A CG1 1 
ATOM   2407 C  CG2 . VAL A 1 354 ? -22.430 -8.340  -30.922 1.00 83.08  ? 354 VAL A CG2 1 
ATOM   2408 N  N   . ALA A 1 355 ? -26.181 -8.219  -28.329 1.00 91.45  ? 355 ALA A N   1 
ATOM   2409 C  CA  . ALA A 1 355 ? -27.522 -7.852  -27.890 1.00 93.92  ? 355 ALA A CA  1 
ATOM   2410 C  C   . ALA A 1 355 ? -27.460 -6.983  -26.648 1.00 95.34  ? 355 ALA A C   1 
ATOM   2411 O  O   . ALA A 1 355 ? -28.238 -6.042  -26.496 1.00 96.90  ? 355 ALA A O   1 
ATOM   2412 C  CB  . ALA A 1 355 ? -28.351 -9.088  -27.618 1.00 92.75  ? 355 ALA A CB  1 
ATOM   2413 N  N   . VAL A 1 356 ? -26.519 -7.291  -25.765 1.00 94.04  ? 356 VAL A N   1 
ATOM   2414 C  CA  . VAL A 1 356 ? -26.306 -6.463  -24.591 1.00 92.96  ? 356 VAL A CA  1 
ATOM   2415 C  C   . VAL A 1 356 ? -25.592 -5.181  -24.980 1.00 95.82  ? 356 VAL A C   1 
ATOM   2416 O  O   . VAL A 1 356 ? -25.945 -4.082  -24.518 1.00 97.69  ? 356 VAL A O   1 
ATOM   2417 C  CB  . VAL A 1 356 ? -25.495 -7.206  -23.530 1.00 91.53  ? 356 VAL A CB  1 
ATOM   2418 C  CG1 . VAL A 1 356 ? -24.853 -6.227  -22.561 1.00 85.20  ? 356 VAL A CG1 1 
ATOM   2419 C  CG2 . VAL A 1 356 ? -26.392 -8.161  -22.797 1.00 85.69  ? 356 VAL A CG2 1 
ATOM   2420 N  N   . ALA A 1 357 ? -24.582 -5.336  -25.830 1.00 104.81 ? 357 ALA A N   1 
ATOM   2421 C  CA  . ALA A 1 357 ? -23.756 -4.213  -26.251 1.00 105.04 ? 357 ALA A CA  1 
ATOM   2422 C  C   . ALA A 1 357 ? -24.574 -3.024  -26.749 1.00 105.97 ? 357 ALA A C   1 
ATOM   2423 O  O   . ALA A 1 357 ? -24.327 -1.883  -26.349 1.00 104.27 ? 357 ALA A O   1 
ATOM   2424 C  CB  . ALA A 1 357 ? -22.777 -4.651  -27.311 1.00 105.41 ? 357 ALA A CB  1 
ATOM   2425 N  N   . VAL A 1 358 ? -25.561 -3.285  -27.599 1.00 100.00 ? 358 VAL A N   1 
ATOM   2426 C  CA  . VAL A 1 358 ? -26.333 -2.189  -28.185 1.00 102.61 ? 358 VAL A CA  1 
ATOM   2427 C  C   . VAL A 1 358 ? -27.099 -1.378  -27.143 1.00 103.80 ? 358 VAL A C   1 
ATOM   2428 O  O   . VAL A 1 358 ? -27.473 -0.228  -27.385 1.00 104.92 ? 358 VAL A O   1 
ATOM   2429 C  CB  . VAL A 1 358 ? -27.314 -2.691  -29.252 1.00 102.37 ? 358 VAL A CB  1 
ATOM   2430 C  CG1 . VAL A 1 358 ? -26.558 -3.119  -30.492 1.00 102.29 ? 358 VAL A CG1 1 
ATOM   2431 C  CG2 . VAL A 1 358 ? -28.140 -3.838  -28.703 1.00 102.29 ? 358 VAL A CG2 1 
ATOM   2432 N  N   . LYS A 1 359 ? -27.320 -1.980  -25.980 1.00 98.44  ? 359 LYS A N   1 
ATOM   2433 C  CA  . LYS A 1 359 ? -27.970 -1.298  -24.871 1.00 96.19  ? 359 LYS A CA  1 
ATOM   2434 C  C   . LYS A 1 359 ? -26.943 -0.583  -24.018 1.00 92.31  ? 359 LYS A C   1 
ATOM   2435 O  O   . LYS A 1 359 ? -26.978 0.642   -23.873 1.00 91.68  ? 359 LYS A O   1 
ATOM   2436 C  CB  . LYS A 1 359 ? -28.748 -2.285  -24.012 1.00 98.45  ? 359 LYS A CB  1 
ATOM   2437 C  CG  . LYS A 1 359 ? -29.996 -2.805  -24.682 1.00 103.84 ? 359 LYS A CG  1 
ATOM   2438 C  CD  . LYS A 1 359 ? -30.952 -1.666  -25.009 1.00 110.56 ? 359 LYS A CD  1 
ATOM   2439 C  CE  . LYS A 1 359 ? -32.199 -2.188  -25.703 1.00 112.90 ? 359 LYS A CE  1 
ATOM   2440 N  NZ  . LYS A 1 359 ? -31.883 -2.808  -27.024 1.00 114.15 1 359 LYS A NZ  1 
ATOM   2441 N  N   . ALA A 1 360 ? -26.047 -1.373  -23.433 1.00 106.01 ? 360 ALA A N   1 
ATOM   2442 C  CA  . ALA A 1 360 ? -25.038 -0.857  -22.515 1.00 105.26 ? 360 ALA A CA  1 
ATOM   2443 C  C   . ALA A 1 360 ? -24.189 0.273   -23.097 1.00 107.44 ? 360 ALA A C   1 
ATOM   2444 O  O   . ALA A 1 360 ? -23.752 1.161   -22.368 1.00 102.84 ? 360 ALA A O   1 
ATOM   2445 C  CB  . ALA A 1 360 ? -24.146 -1.984  -22.025 1.00 107.48 ? 360 ALA A CB  1 
ATOM   2446 N  N   . ALA A 1 361 ? -23.967 0.254   -24.405 1.00 127.84 ? 361 ALA A N   1 
ATOM   2447 C  CA  . ALA A 1 361 ? -23.076 1.234   -25.015 1.00 135.36 ? 361 ALA A CA  1 
ATOM   2448 C  C   . ALA A 1 361 ? -23.766 2.557   -25.326 1.00 138.33 ? 361 ALA A C   1 
ATOM   2449 O  O   . ALA A 1 361 ? -23.131 3.491   -25.822 1.00 141.11 ? 361 ALA A O   1 
ATOM   2450 C  CB  . ALA A 1 361 ? -22.439 0.666   -26.266 1.00 137.30 ? 361 ALA A CB  1 
ATOM   2451 N  N   . GLN A 1 362 ? -25.060 2.632   -25.039 1.00 134.23 ? 362 GLN A N   1 
ATOM   2452 C  CA  . GLN A 1 362 ? -25.844 3.817   -25.365 1.00 136.43 ? 362 GLN A CA  1 
ATOM   2453 C  C   . GLN A 1 362 ? -25.301 5.082   -24.727 1.00 139.03 ? 362 GLN A C   1 
ATOM   2454 O  O   . GLN A 1 362 ? -25.401 6.167   -25.304 1.00 134.31 ? 362 GLN A O   1 
ATOM   2455 C  CB  . GLN A 1 362 ? -27.301 3.623   -24.956 1.00 137.90 ? 362 GLN A CB  1 
ATOM   2456 C  CG  . GLN A 1 362 ? -28.140 2.947   -26.014 1.00 141.65 ? 362 GLN A CG  1 
ATOM   2457 C  CD  . GLN A 1 362 ? -28.503 3.891   -27.144 1.00 144.68 ? 362 GLN A CD  1 
ATOM   2458 O  OE1 . GLN A 1 362 ? -28.212 5.088   -27.088 1.00 145.34 ? 362 GLN A OE1 1 
ATOM   2459 N  NE2 . GLN A 1 362 ? -29.149 3.359   -28.175 1.00 145.31 ? 362 GLN A NE2 1 
ATOM   2460 N  N   . GLU A 1 363 ? -24.727 4.945   -23.538 1.00 124.45 ? 363 GLU A N   1 
ATOM   2461 C  CA  . GLU A 1 363 ? -24.249 6.104   -22.797 1.00 132.38 ? 363 GLU A CA  1 
ATOM   2462 C  C   . GLU A 1 363 ? -23.006 6.728   -23.426 1.00 132.07 ? 363 GLU A C   1 
ATOM   2463 O  O   . GLU A 1 363 ? -22.709 7.901   -23.197 1.00 135.60 ? 363 GLU A O   1 
ATOM   2464 C  CB  . GLU A 1 363 ? -23.971 5.731   -21.339 1.00 136.86 ? 363 GLU A CB  1 
ATOM   2465 C  CG  . GLU A 1 363 ? -22.863 4.703   -21.149 1.00 142.75 ? 363 GLU A CG  1 
ATOM   2466 C  CD  . GLU A 1 363 ? -22.624 4.373   -19.684 1.00 146.21 ? 363 GLU A CD  1 
ATOM   2467 O  OE1 . GLU A 1 363 ? -23.560 4.543   -18.871 1.00 146.93 ? 363 GLU A OE1 1 
ATOM   2468 O  OE2 . GLU A 1 363 ? -21.499 3.947   -19.343 1.00 146.89 1 363 GLU A OE2 1 
ATOM   2469 N  N   . LEU A 1 364 ? -22.288 5.948   -24.226 1.00 134.64 ? 364 LEU A N   1 
ATOM   2470 C  CA  . LEU A 1 364 ? -21.059 6.432   -24.843 1.00 127.65 ? 364 LEU A CA  1 
ATOM   2471 C  C   . LEU A 1 364 ? -21.352 7.468   -25.906 1.00 127.84 ? 364 LEU A C   1 
ATOM   2472 O  O   . LEU A 1 364 ? -22.456 7.525   -26.449 1.00 127.77 ? 364 LEU A O   1 
ATOM   2473 C  CB  . LEU A 1 364 ? -20.263 5.289   -25.466 1.00 122.78 ? 364 LEU A CB  1 
ATOM   2474 C  CG  . LEU A 1 364 ? -19.452 4.432   -24.500 1.00 113.15 ? 364 LEU A CG  1 
ATOM   2475 C  CD1 . LEU A 1 364 ? -20.352 3.444   -23.789 1.00 104.54 ? 364 LEU A CD1 1 
ATOM   2476 C  CD2 . LEU A 1 364 ? -18.348 3.709   -25.241 1.00 104.52 ? 364 LEU A CD2 1 
ATOM   2477 N  N   . GLN A 1 365 ? -20.351 8.278   -26.215 1.00 144.53 ? 365 GLN A N   1 
ATOM   2478 C  CA  . GLN A 1 365 ? -20.494 9.295   -27.240 1.00 145.70 ? 365 GLN A CA  1 
ATOM   2479 C  C   . GLN A 1 365 ? -19.425 9.118   -28.306 1.00 145.99 ? 365 GLN A C   1 
ATOM   2480 O  O   . GLN A 1 365 ? -18.420 8.440   -28.078 1.00 142.74 ? 365 GLN A O   1 
ATOM   2481 C  CB  . GLN A 1 365 ? -20.415 10.680  -26.609 1.00 148.08 ? 365 GLN A CB  1 
ATOM   2482 C  CG  . GLN A 1 365 ? -19.224 10.845  -25.690 1.00 153.21 ? 365 GLN A CG  1 
ATOM   2483 C  CD  . GLN A 1 365 ? -19.122 12.237  -25.120 1.00 157.26 ? 365 GLN A CD  1 
ATOM   2484 O  OE1 . GLN A 1 365 ? -20.103 12.982  -25.092 1.00 158.17 ? 365 GLN A OE1 1 
ATOM   2485 N  NE2 . GLN A 1 365 ? -17.934 12.598  -24.652 1.00 158.14 ? 365 GLN A NE2 1 
ATOM   2486 N  N   . GLU A 1 366 ? -19.648 9.724   -29.470 1.00 168.74 ? 366 GLU A N   1 
ATOM   2487 C  CA  . GLU A 1 366 ? -18.751 9.549   -30.606 1.00 171.81 ? 366 GLU A CA  1 
ATOM   2488 C  C   . GLU A 1 366 ? -17.322 9.957   -30.279 1.00 168.17 ? 366 GLU A C   1 
ATOM   2489 O  O   . GLU A 1 366 ? -17.086 10.923  -29.550 1.00 170.95 ? 366 GLU A O   1 
ATOM   2490 C  CB  . GLU A 1 366 ? -19.258 10.300  -31.838 1.00 176.61 ? 366 GLU A CB  1 
ATOM   2491 C  CG  . GLU A 1 366 ? -19.383 11.801  -31.661 1.00 182.56 ? 366 GLU A CG  1 
ATOM   2492 C  CD  . GLU A 1 366 ? -19.729 12.493  -32.962 1.00 186.18 ? 366 GLU A CD  1 
ATOM   2493 O  OE1 . GLU A 1 366 ? -20.147 11.796  -33.911 1.00 186.89 ? 366 GLU A OE1 1 
ATOM   2494 O  OE2 . GLU A 1 366 ? -19.581 13.730  -33.037 1.00 186.92 1 366 GLU A OE2 1 
ATOM   2495 N  N   . GLY A 1 367 ? -16.372 9.207   -30.824 1.00 133.41 ? 367 GLY A N   1 
ATOM   2496 C  CA  . GLY A 1 367 ? -14.974 9.392   -30.496 1.00 130.09 ? 367 GLY A CA  1 
ATOM   2497 C  C   . GLY A 1 367 ? -14.523 8.286   -29.565 1.00 128.02 ? 367 GLY A C   1 
ATOM   2498 O  O   . GLY A 1 367 ? -13.328 8.033   -29.413 1.00 126.17 ? 367 GLY A O   1 
ATOM   2499 N  N   . GLN A 1 368 ? -15.489 7.620   -28.941 1.00 122.68 ? 368 GLN A N   1 
ATOM   2500 C  CA  . GLN A 1 368 ? -15.195 6.520   -28.034 1.00 123.49 ? 368 GLN A CA  1 
ATOM   2501 C  C   . GLN A 1 368 ? -15.384 5.189   -28.733 1.00 120.77 ? 368 GLN A C   1 
ATOM   2502 O  O   . GLN A 1 368 ? -15.778 5.137   -29.900 1.00 121.35 ? 368 GLN A O   1 
ATOM   2503 C  CB  . GLN A 1 368 ? -16.099 6.582   -26.810 1.00 127.02 ? 368 GLN A CB  1 
ATOM   2504 C  CG  . GLN A 1 368 ? -15.950 7.844   -26.001 1.00 132.80 ? 368 GLN A CG  1 
ATOM   2505 C  CD  . GLN A 1 368 ? -16.836 7.831   -24.782 1.00 136.89 ? 368 GLN A CD  1 
ATOM   2506 O  OE1 . GLN A 1 368 ? -18.032 8.104   -24.869 1.00 137.74 ? 368 GLN A OE1 1 
ATOM   2507 N  NE2 . GLN A 1 368 ? -16.263 7.485   -23.638 1.00 137.78 ? 368 GLN A NE2 1 
ATOM   2508 N  N   . ARG A 1 369 ? -15.118 4.106   -28.014 1.00 123.34 ? 369 ARG A N   1 
ATOM   2509 C  CA  . ARG A 1 369 ? -15.216 2.786   -28.613 1.00 119.94 ? 369 ARG A CA  1 
ATOM   2510 C  C   . ARG A 1 369 ? -15.627 1.713   -27.619 1.00 118.26 ? 369 ARG A C   1 
ATOM   2511 O  O   . ARG A 1 369 ? -15.317 1.792   -26.431 1.00 117.00 ? 369 ARG A O   1 
ATOM   2512 C  CB  . ARG A 1 369 ? -13.894 2.410   -29.274 1.00 119.97 ? 369 ARG A CB  1 
ATOM   2513 C  CG  . ARG A 1 369 ? -12.771 2.134   -28.292 1.00 119.89 ? 369 ARG A CG  1 
ATOM   2514 C  CD  . ARG A 1 369 ? -11.518 1.766   -29.048 1.00 120.15 ? 369 ARG A CD  1 
ATOM   2515 N  NE  . ARG A 1 369 ? -11.202 2.771   -30.059 1.00 120.20 ? 369 ARG A NE  1 
ATOM   2516 C  CZ  . ARG A 1 369 ? -10.113 2.751   -30.817 1.00 120.23 ? 369 ARG A CZ  1 
ATOM   2517 N  NH1 . ARG A 1 369 ? -9.237  1.763   -30.692 1.00 120.24 1 369 ARG A NH1 1 
ATOM   2518 N  NH2 . ARG A 1 369 ? -9.906  3.710   -31.713 1.00 120.23 ? 369 ARG A NH2 1 
ATOM   2519 N  N   . CYS A 1 370 ? -16.325 0.703   -28.122 1.00 112.29 ? 370 CYS A N   1 
ATOM   2520 C  CA  . CYS A 1 370 ? -16.787 -0.400  -27.298 1.00 110.53 ? 370 CYS A CA  1 
ATOM   2521 C  C   . CYS A 1 370 ? -16.418 -1.730  -27.933 1.00 108.54 ? 370 CYS A C   1 
ATOM   2522 O  O   . CYS A 1 370 ? -16.840 -2.026  -29.048 1.00 108.86 ? 370 CYS A O   1 
ATOM   2523 C  CB  . CYS A 1 370 ? -18.299 -0.322  -27.122 1.00 111.17 ? 370 CYS A CB  1 
ATOM   2524 S  SG  . CYS A 1 370 ? -19.007 -1.781  -26.341 1.00 111.17 ? 370 CYS A SG  1 
ATOM   2525 N  N   . VAL A 1 371 ? -15.637 -2.534  -27.224 1.00 104.90 ? 371 VAL A N   1 
ATOM   2526 C  CA  . VAL A 1 371 ? -15.197 -3.822  -27.743 1.00 102.78 ? 371 VAL A CA  1 
ATOM   2527 C  C   . VAL A 1 371 ? -16.055 -4.974  -27.244 1.00 99.73  ? 371 VAL A C   1 
ATOM   2528 O  O   . VAL A 1 371 ? -16.325 -5.084  -26.055 1.00 97.78  ? 371 VAL A O   1 
ATOM   2529 C  CB  . VAL A 1 371 ? -13.730 -4.095  -27.385 1.00 104.57 ? 371 VAL A CB  1 
ATOM   2530 C  CG1 . VAL A 1 371 ? -13.339 -5.510  -27.774 1.00 107.46 ? 371 VAL A CG1 1 
ATOM   2531 C  CG2 . VAL A 1 371 ? -12.835 -3.087  -28.072 1.00 106.99 ? 371 VAL A CG2 1 
ATOM   2532 N  N   . VAL A 1 372 ? -16.471 -5.834  -28.164 1.00 100.10 ? 372 VAL A N   1 
ATOM   2533 C  CA  . VAL A 1 372 ? -17.350 -6.945  -27.843 1.00 99.27  ? 372 VAL A CA  1 
ATOM   2534 C  C   . VAL A 1 372 ? -16.656 -8.278  -28.095 1.00 97.51  ? 372 VAL A C   1 
ATOM   2535 O  O   . VAL A 1 372 ? -15.957 -8.430  -29.097 1.00 98.04  ? 372 VAL A O   1 
ATOM   2536 C  CB  . VAL A 1 372 ? -18.606 -6.865  -28.706 1.00 99.84  ? 372 VAL A CB  1 
ATOM   2537 C  CG1 . VAL A 1 372 ? -19.237 -8.228  -28.874 1.00 100.96 ? 372 VAL A CG1 1 
ATOM   2538 C  CG2 . VAL A 1 372 ? -19.576 -5.889  -28.097 1.00 101.30 ? 372 VAL A CG2 1 
ATOM   2539 N  N   . ILE A 1 373 ? -16.835 -9.245  -27.203 1.00 86.37  ? 373 ILE A N   1 
ATOM   2540 C  CA  . ILE A 1 373 ? -16.218 -10.548 -27.444 1.00 82.59  ? 373 ILE A CA  1 
ATOM   2541 C  C   . ILE A 1 373 ? -17.154 -11.557 -28.118 1.00 82.89  ? 373 ILE A C   1 
ATOM   2542 O  O   . ILE A 1 373 ? -18.214 -11.888 -27.571 1.00 83.64  ? 373 ILE A O   1 
ATOM   2543 C  CB  . ILE A 1 373 ? -15.694 -11.151 -26.148 1.00 81.27  ? 373 ILE A CB  1 
ATOM   2544 C  CG1 . ILE A 1 373 ? -14.917 -10.093 -25.366 1.00 76.64  ? 373 ILE A CG1 1 
ATOM   2545 C  CG2 . ILE A 1 373 ? -14.876 -12.395 -26.435 1.00 76.36  ? 373 ILE A CG2 1 
ATOM   2546 C  CD1 . ILE A 1 373 ? -13.791 -9.482  -26.149 1.00 71.43  ? 373 ILE A CD1 1 
ATOM   2547 N  N   . LEU A 1 374 ? -16.760 -12.062 -29.288 1.00 77.71  ? 374 LEU A N   1 
ATOM   2548 C  CA  . LEU A 1 374 ? -17.550 -13.083 -29.970 1.00 75.48  ? 374 LEU A CA  1 
ATOM   2549 C  C   . LEU A 1 374 ? -16.881 -14.436 -29.826 1.00 73.21  ? 374 LEU A C   1 
ATOM   2550 O  O   . LEU A 1 374 ? -15.896 -14.718 -30.502 1.00 74.77  ? 374 LEU A O   1 
ATOM   2551 C  CB  . LEU A 1 374 ? -17.673 -12.760 -31.446 1.00 75.66  ? 374 LEU A CB  1 
ATOM   2552 C  CG  . LEU A 1 374 ? -18.021 -11.318 -31.778 1.00 73.79  ? 374 LEU A CG  1 
ATOM   2553 C  CD1 . LEU A 1 374 ? -18.071 -11.159 -33.286 1.00 73.23  ? 374 LEU A CD1 1 
ATOM   2554 C  CD2 . LEU A 1 374 ? -19.354 -10.949 -31.169 1.00 70.67  ? 374 LEU A CD2 1 
ATOM   2555 N  N   . PRO A 1 375 ? -17.451 -15.297 -28.975 1.00 76.99  ? 375 PRO A N   1 
ATOM   2556 C  CA  . PRO A 1 375 ? -16.859 -16.570 -28.544 1.00 75.76  ? 375 PRO A CA  1 
ATOM   2557 C  C   . PRO A 1 375 ? -16.680 -17.681 -29.582 1.00 76.89  ? 375 PRO A C   1 
ATOM   2558 O  O   . PRO A 1 375 ? -15.624 -18.315 -29.556 1.00 76.17  ? 375 PRO A O   1 
ATOM   2559 C  CB  . PRO A 1 375 ? -17.811 -17.040 -27.440 1.00 73.78  ? 375 PRO A CB  1 
ATOM   2560 C  CG  . PRO A 1 375 ? -18.530 -15.803 -27.006 1.00 72.17  ? 375 PRO A CG  1 
ATOM   2561 C  CD  . PRO A 1 375 ? -18.689 -14.995 -28.244 1.00 74.80  ? 375 PRO A CD  1 
ATOM   2562 N  N   . ASP A 1 376 ? -17.652 -17.935 -30.453 1.00 74.40  ? 376 ASP A N   1 
ATOM   2563 C  CA  . ASP A 1 376 ? -17.521 -19.078 -31.364 1.00 78.14  ? 376 ASP A CA  1 
ATOM   2564 C  C   . ASP A 1 376 ? -18.301 -18.939 -32.671 1.00 78.21  ? 376 ASP A C   1 
ATOM   2565 O  O   . ASP A 1 376 ? -18.957 -17.923 -32.902 1.00 77.62  ? 376 ASP A O   1 
ATOM   2566 C  CB  . ASP A 1 376 ? -17.873 -20.391 -30.658 1.00 80.29  ? 376 ASP A CB  1 
ATOM   2567 C  CG  . ASP A 1 376 ? -19.339 -20.485 -30.305 1.00 88.31  ? 376 ASP A CG  1 
ATOM   2568 O  OD1 . ASP A 1 376 ? -20.008 -19.425 -30.235 1.00 96.55  ? 376 ASP A OD1 1 
ATOM   2569 O  OD2 . ASP A 1 376 ? -19.820 -21.620 -30.091 1.00 96.59  1 376 ASP A OD2 1 
ATOM   2570 N  N   . SER A 1 377 ? -18.217 -19.962 -33.520 1.00 96.17  ? 377 SER A N   1 
ATOM   2571 C  CA  . SER A 1 377 ? -18.772 -19.889 -34.868 1.00 97.31  ? 377 SER A CA  1 
ATOM   2572 C  C   . SER A 1 377 ? -20.087 -20.629 -35.013 1.00 97.83  ? 377 SER A C   1 
ATOM   2573 O  O   . SER A 1 377 ? -20.559 -21.292 -34.084 1.00 99.01  ? 377 SER A O   1 
ATOM   2574 C  CB  . SER A 1 377 ? -17.791 -20.492 -35.869 1.00 96.87  ? 377 SER A CB  1 
ATOM   2575 O  OG  . SER A 1 377 ? -17.623 -21.878 -35.611 1.00 97.32  ? 377 SER A OG  1 
ATOM   2576 N  N   . VAL A 1 378 ? -20.654 -20.551 -36.209 1.00 79.76  ? 378 VAL A N   1 
ATOM   2577 C  CA  . VAL A 1 378 ? -21.926 -21.193 -36.491 1.00 79.54  ? 378 VAL A CA  1 
ATOM   2578 C  C   . VAL A 1 378 ? -21.788 -22.692 -36.662 1.00 82.09  ? 378 VAL A C   1 
ATOM   2579 O  O   . VAL A 1 378 ? -22.786 -23.409 -36.697 1.00 80.78  ? 378 VAL A O   1 
ATOM   2580 C  CB  . VAL A 1 378 ? -22.561 -20.634 -37.755 1.00 78.40  ? 378 VAL A CB  1 
ATOM   2581 C  CG1 . VAL A 1 378 ? -23.114 -19.266 -37.483 1.00 77.07  ? 378 VAL A CG1 1 
ATOM   2582 C  CG2 . VAL A 1 378 ? -21.518 -20.567 -38.846 1.00 75.02  ? 378 VAL A CG2 1 
ATOM   2583 N  N   . ARG A 1 379 ? -20.555 -23.158 -36.797 1.00 94.15  ? 379 ARG A N   1 
ATOM   2584 C  CA  . ARG A 1 379 ? -20.297 -24.565 -37.058 1.00 99.15  ? 379 ARG A CA  1 
ATOM   2585 C  C   . ARG A 1 379 ? -20.983 -25.507 -36.067 1.00 104.36 ? 379 ARG A C   1 
ATOM   2586 O  O   . ARG A 1 379 ? -21.415 -26.598 -36.438 1.00 107.32 ? 379 ARG A O   1 
ATOM   2587 C  CB  . ARG A 1 379 ? -18.798 -24.826 -37.064 1.00 96.44  ? 379 ARG A CB  1 
ATOM   2588 C  CG  . ARG A 1 379 ? -18.437 -26.270 -37.305 1.00 91.04  ? 379 ARG A CG  1 
ATOM   2589 C  CD  . ARG A 1 379 ? -16.937 -26.431 -37.305 1.00 85.72  ? 379 ARG A CD  1 
ATOM   2590 N  NE  . ARG A 1 379 ? -16.364 -25.890 -36.075 1.00 84.31  ? 379 ARG A NE  1 
ATOM   2591 C  CZ  . ARG A 1 379 ? -16.511 -26.453 -34.878 1.00 83.78  ? 379 ARG A CZ  1 
ATOM   2592 N  NH1 . ARG A 1 379 ? -17.213 -27.576 -34.751 1.00 83.58  1 379 ARG A NH1 1 
ATOM   2593 N  NH2 . ARG A 1 379 ? -15.964 -25.894 -33.804 1.00 83.64  ? 379 ARG A NH2 1 
ATOM   2594 N  N   . ASN A 1 380 ? -21.088 -25.089 -34.812 1.00 109.25 ? 380 ASN A N   1 
ATOM   2595 C  CA  . ASN A 1 380 ? -21.718 -25.922 -33.792 1.00 108.34 ? 380 ASN A CA  1 
ATOM   2596 C  C   . ASN A 1 380 ? -23.225 -25.873 -33.876 1.00 105.73 ? 380 ASN A C   1 
ATOM   2597 O  O   . ASN A 1 380 ? -23.926 -26.808 -33.493 1.00 109.19 ? 380 ASN A O   1 
ATOM   2598 C  CB  . ASN A 1 380 ? -21.304 -25.464 -32.401 1.00 107.34 ? 380 ASN A CB  1 
ATOM   2599 C  CG  . ASN A 1 380 ? -19.848 -25.702 -32.124 1.00 108.02 ? 380 ASN A CG  1 
ATOM   2600 O  OD1 . ASN A 1 380 ? -19.223 -26.579 -32.728 1.00 110.00 ? 380 ASN A OD1 1 
ATOM   2601 N  ND2 . ASN A 1 380 ? -19.293 -24.934 -31.195 1.00 108.49 ? 380 ASN A ND2 1 
ATOM   2602 N  N   . TYR A 1 381 ? -23.707 -24.736 -34.342 1.00 95.75  ? 381 TYR A N   1 
ATOM   2603 C  CA  . TYR A 1 381 ? -25.120 -24.413 -34.328 1.00 85.91  ? 381 TYR A CA  1 
ATOM   2604 C  C   . TYR A 1 381 ? -25.904 -24.687 -35.609 1.00 81.31  ? 381 TYR A C   1 
ATOM   2605 O  O   . TYR A 1 381 ? -27.065 -24.278 -35.719 1.00 77.87  ? 381 TYR A O   1 
ATOM   2606 C  CB  . TYR A 1 381 ? -25.307 -22.997 -33.811 1.00 84.55  ? 381 TYR A CB  1 
ATOM   2607 C  CG  . TYR A 1 381 ? -24.524 -22.797 -32.543 1.00 83.33  ? 381 TYR A CG  1 
ATOM   2608 C  CD1 . TYR A 1 381 ? -23.637 -21.740 -32.406 1.00 83.68  ? 381 TYR A CD1 1 
ATOM   2609 C  CD2 . TYR A 1 381 ? -24.686 -23.668 -31.468 1.00 84.65  ? 381 TYR A CD2 1 
ATOM   2610 C  CE1 . TYR A 1 381 ? -22.925 -21.563 -31.239 1.00 86.98  ? 381 TYR A CE1 1 
ATOM   2611 C  CE2 . TYR A 1 381 ? -23.977 -23.502 -30.304 1.00 87.62  ? 381 TYR A CE2 1 
ATOM   2612 C  CZ  . TYR A 1 381 ? -23.102 -22.445 -30.190 1.00 88.82  ? 381 TYR A CZ  1 
ATOM   2613 O  OH  . TYR A 1 381 ? -22.397 -22.273 -29.022 1.00 91.45  ? 381 TYR A OH  1 
ATOM   2614 N  N   . MET A 1 382 ? -25.263 -25.336 -36.578 1.00 77.57  ? 382 MET A N   1 
ATOM   2615 C  CA  . MET A 1 382 ? -25.774 -25.411 -37.948 1.00 77.28  ? 382 MET A CA  1 
ATOM   2616 C  C   . MET A 1 382 ? -27.252 -25.744 -38.026 1.00 78.02  ? 382 MET A C   1 
ATOM   2617 O  O   . MET A 1 382 ? -28.002 -25.115 -38.771 1.00 76.67  ? 382 MET A O   1 
ATOM   2618 C  CB  . MET A 1 382 ? -25.036 -26.498 -38.725 1.00 76.42  ? 382 MET A CB  1 
ATOM   2619 C  CG  . MET A 1 382 ? -23.578 -26.228 -39.014 1.00 77.44  ? 382 MET A CG  1 
ATOM   2620 S  SD  . MET A 1 382 ? -23.340 -25.497 -40.638 1.00 81.54  ? 382 MET A SD  1 
ATOM   2621 C  CE  . MET A 1 382 ? -23.564 -23.766 -40.237 1.00 80.02  ? 382 MET A CE  1 
ATOM   2622 N  N   . THR A 1 383 ? -27.670 -26.732 -37.246 1.00 74.01  ? 383 THR A N   1 
ATOM   2623 C  CA  . THR A 1 383 ? -29.049 -27.193 -37.299 1.00 75.96  ? 383 THR A CA  1 
ATOM   2624 C  C   . THR A 1 383 ? -29.957 -26.526 -36.287 1.00 77.95  ? 383 THR A C   1 
ATOM   2625 O  O   . THR A 1 383 ? -31.121 -26.906 -36.163 1.00 80.40  ? 383 THR A O   1 
ATOM   2626 C  CB  . THR A 1 383 ? -29.159 -28.706 -37.096 1.00 75.95  ? 383 THR A CB  1 
ATOM   2627 O  OG1 . THR A 1 383 ? -28.605 -29.062 -35.823 1.00 73.83  ? 383 THR A OG1 1 
ATOM   2628 C  CG2 . THR A 1 383 ? -28.421 -29.420 -38.202 1.00 72.23  ? 383 THR A CG2 1 
ATOM   2629 N  N   . LYS A 1 384 ? -29.454 -25.567 -35.524 1.00 73.53  ? 384 LYS A N   1 
ATOM   2630 C  CA  . LYS A 1 384 ? -30.351 -25.008 -34.538 1.00 71.88  ? 384 LYS A CA  1 
ATOM   2631 C  C   . LYS A 1 384 ? -30.846 -23.613 -34.864 1.00 75.01  ? 384 LYS A C   1 
ATOM   2632 O  O   . LYS A 1 384 ? -31.922 -23.477 -35.435 1.00 76.69  ? 384 LYS A O   1 
ATOM   2633 C  CB  . LYS A 1 384 ? -29.709 -25.046 -33.155 1.00 67.98  ? 384 LYS A CB  1 
ATOM   2634 C  CG  . LYS A 1 384 ? -29.158 -26.418 -32.833 1.00 55.49  ? 384 LYS A CG  1 
ATOM   2635 C  CD  . LYS A 1 384 ? -28.570 -26.478 -31.445 1.00 41.36  ? 384 LYS A CD  1 
ATOM   2636 C  CE  . LYS A 1 384 ? -29.607 -26.926 -30.429 1.00 34.23  ? 384 LYS A CE  1 
ATOM   2637 N  NZ  . LYS A 1 384 ? -28.908 -27.322 -29.153 1.00 28.90  1 384 LYS A NZ  1 
ATOM   2638 N  N   . PHE A 1 385 ? -30.057 -22.579 -34.625 1.00 77.59  ? 385 PHE A N   1 
ATOM   2639 C  CA  . PHE A 1 385 ? -30.653 -21.255 -34.748 1.00 81.04  ? 385 PHE A CA  1 
ATOM   2640 C  C   . PHE A 1 385 ? -30.513 -20.751 -36.166 1.00 87.92  ? 385 PHE A C   1 
ATOM   2641 O  O   . PHE A 1 385 ? -31.090 -19.732 -36.555 1.00 86.87  ? 385 PHE A O   1 
ATOM   2642 C  CB  . PHE A 1 385 ? -30.108 -20.268 -33.718 1.00 77.07  ? 385 PHE A CB  1 
ATOM   2643 C  CG  . PHE A 1 385 ? -28.766 -19.698 -34.056 1.00 69.46  ? 385 PHE A CG  1 
ATOM   2644 C  CD1 . PHE A 1 385 ? -28.661 -18.552 -34.837 1.00 64.60  ? 385 PHE A CD1 1 
ATOM   2645 C  CD2 . PHE A 1 385 ? -27.609 -20.286 -33.570 1.00 63.64  ? 385 PHE A CD2 1 
ATOM   2646 C  CE1 . PHE A 1 385 ? -27.431 -18.014 -35.135 1.00 63.31  ? 385 PHE A CE1 1 
ATOM   2647 C  CE2 . PHE A 1 385 ? -26.379 -19.750 -33.859 1.00 62.11  ? 385 PHE A CE2 1 
ATOM   2648 C  CZ  . PHE A 1 385 ? -26.289 -18.614 -34.642 1.00 62.54  ? 385 PHE A CZ  1 
ATOM   2649 N  N   . LEU A 1 386 ? -29.725 -21.483 -36.933 1.00 119.67 ? 386 LEU A N   1 
ATOM   2650 C  CA  . LEU A 1 386 ? -29.534 -21.166 -38.322 1.00 123.83 ? 386 LEU A CA  1 
ATOM   2651 C  C   . LEU A 1 386 ? -30.748 -21.659 -39.094 1.00 125.07 ? 386 LEU A C   1 
ATOM   2652 O  O   . LEU A 1 386 ? -31.177 -21.031 -40.063 1.00 127.19 ? 386 LEU A O   1 
ATOM   2653 C  CB  . LEU A 1 386 ? -28.264 -21.836 -38.817 1.00 126.14 ? 386 LEU A CB  1 
ATOM   2654 C  CG  . LEU A 1 386 ? -27.624 -21.171 -40.023 1.00 128.80 ? 386 LEU A CG  1 
ATOM   2655 C  CD1 . LEU A 1 386 ? -26.156 -21.472 -40.025 1.00 124.89 ? 386 LEU A CD1 1 
ATOM   2656 C  CD2 . LEU A 1 386 ? -28.266 -21.692 -41.281 1.00 128.63 ? 386 LEU A CD2 1 
ATOM   2657 N  N   . SER A 1 387 ? -31.303 -22.784 -38.656 1.00 95.68  ? 387 SER A N   1 
ATOM   2658 C  CA  . SER A 1 387 ? -32.487 -23.346 -39.294 1.00 94.92  ? 387 SER A CA  1 
ATOM   2659 C  C   . SER A 1 387 ? -33.736 -22.571 -38.900 1.00 93.38  ? 387 SER A C   1 
ATOM   2660 O  O   . SER A 1 387 ? -34.065 -22.464 -37.716 1.00 91.87  ? 387 SER A O   1 
ATOM   2661 C  CB  . SER A 1 387 ? -32.658 -24.815 -38.910 1.00 96.90  ? 387 SER A CB  1 
ATOM   2662 O  OG  . SER A 1 387 ? -33.983 -25.247 -39.161 1.00 97.95  ? 387 SER A OG  1 
ATOM   2663 N  N   . ASP A 1 388 ? -34.445 -22.051 -39.894 1.00 95.64  ? 388 ASP A N   1 
ATOM   2664 C  CA  . ASP A 1 388 ? -35.623 -21.242 -39.625 1.00 97.04  ? 388 ASP A CA  1 
ATOM   2665 C  C   . ASP A 1 388 ? -36.723 -22.050 -38.963 1.00 97.35  ? 388 ASP A C   1 
ATOM   2666 O  O   . ASP A 1 388 ? -37.473 -21.521 -38.147 1.00 96.26  ? 388 ASP A O   1 
ATOM   2667 C  CB  . ASP A 1 388 ? -36.141 -20.614 -40.912 1.00 97.72  ? 388 ASP A CB  1 
ATOM   2668 C  CG  . ASP A 1 388 ? -35.177 -19.599 -41.489 1.00 101.53 ? 388 ASP A CG  1 
ATOM   2669 O  OD1 . ASP A 1 388 ? -35.484 -18.388 -41.428 1.00 105.91 ? 388 ASP A OD1 1 
ATOM   2670 O  OD2 . ASP A 1 388 ? -34.105 -20.016 -41.988 1.00 105.92 1 388 ASP A OD2 1 
ATOM   2671 N  N   . ARG A 1 389 ? -36.817 -23.328 -39.309 1.00 107.90 ? 389 ARG A N   1 
ATOM   2672 C  CA  . ARG A 1 389 ? -37.883 -24.169 -38.777 1.00 109.06 ? 389 ARG A CA  1 
ATOM   2673 C  C   . ARG A 1 389 ? -37.683 -24.475 -37.298 1.00 103.46 ? 389 ARG A C   1 
ATOM   2674 O  O   . ARG A 1 389 ? -38.640 -24.767 -36.589 1.00 104.71 ? 389 ARG A O   1 
ATOM   2675 C  CB  . ARG A 1 389 ? -38.031 -25.461 -39.586 1.00 113.93 ? 389 ARG A CB  1 
ATOM   2676 C  CG  . ARG A 1 389 ? -36.817 -26.369 -39.560 1.00 126.43 ? 389 ARG A CG  1 
ATOM   2677 C  CD  . ARG A 1 389 ? -36.916 -27.431 -38.484 1.00 138.59 ? 389 ARG A CD  1 
ATOM   2678 N  NE  . ARG A 1 389 ? -35.603 -27.987 -38.173 1.00 142.43 ? 389 ARG A NE  1 
ATOM   2679 C  CZ  . ARG A 1 389 ? -35.332 -28.694 -37.081 1.00 144.01 ? 389 ARG A CZ  1 
ATOM   2680 N  NH1 . ARG A 1 389 ? -36.287 -28.932 -36.189 1.00 144.49 1 389 ARG A NH1 1 
ATOM   2681 N  NH2 . ARG A 1 389 ? -34.105 -29.160 -36.878 1.00 144.48 ? 389 ARG A NH2 1 
ATOM   2682 N  N   . TRP A 1 390 ? -36.434 -24.441 -36.851 1.00 78.65  ? 390 TRP A N   1 
ATOM   2683 C  CA  . TRP A 1 390 ? -36.103 -24.665 -35.454 1.00 70.49  ? 390 TRP A CA  1 
ATOM   2684 C  C   . TRP A 1 390 ? -36.410 -23.403 -34.669 1.00 68.28  ? 390 TRP A C   1 
ATOM   2685 O  O   . TRP A 1 390 ? -36.825 -23.459 -33.507 1.00 65.62  ? 390 TRP A O   1 
ATOM   2686 C  CB  . TRP A 1 390 ? -34.626 -25.008 -35.337 1.00 68.42  ? 390 TRP A CB  1 
ATOM   2687 C  CG  . TRP A 1 390 ? -34.124 -25.291 -33.954 1.00 62.25  ? 390 TRP A CG  1 
ATOM   2688 C  CD1 . TRP A 1 390 ? -33.962 -26.521 -33.373 1.00 59.51  ? 390 TRP A CD1 1 
ATOM   2689 C  CD2 . TRP A 1 390 ? -33.675 -24.333 -32.992 1.00 56.34  ? 390 TRP A CD2 1 
ATOM   2690 N  NE1 . TRP A 1 390 ? -33.447 -26.385 -32.107 1.00 56.40  ? 390 TRP A NE1 1 
ATOM   2691 C  CE2 . TRP A 1 390 ? -33.259 -25.052 -31.846 1.00 54.85  ? 390 TRP A CE2 1 
ATOM   2692 C  CE3 . TRP A 1 390 ? -33.587 -22.935 -32.984 1.00 53.83  ? 390 TRP A CE3 1 
ATOM   2693 C  CZ2 . TRP A 1 390 ? -32.768 -24.421 -30.703 1.00 52.59  ? 390 TRP A CZ2 1 
ATOM   2694 C  CZ3 . TRP A 1 390 ? -33.089 -22.311 -31.860 1.00 52.16  ? 390 TRP A CZ3 1 
ATOM   2695 C  CH2 . TRP A 1 390 ? -32.692 -23.054 -30.726 1.00 51.97  ? 390 TRP A CH2 1 
ATOM   2696 N  N   . MET A 1 391 ? -36.181 -22.263 -35.307 1.00 77.83  ? 391 MET A N   1 
ATOM   2697 C  CA  . MET A 1 391 ? -36.466 -20.975 -34.696 1.00 79.16  ? 391 MET A CA  1 
ATOM   2698 C  C   . MET A 1 391 ? -37.955 -20.769 -34.576 1.00 81.41  ? 391 MET A C   1 
ATOM   2699 O  O   . MET A 1 391 ? -38.433 -20.112 -33.651 1.00 80.84  ? 391 MET A O   1 
ATOM   2700 C  CB  . MET A 1 391 ? -35.861 -19.857 -35.519 1.00 78.22  ? 391 MET A CB  1 
ATOM   2701 C  CG  . MET A 1 391 ? -34.361 -19.892 -35.515 1.00 76.84  ? 391 MET A CG  1 
ATOM   2702 S  SD  . MET A 1 391 ? -33.755 -19.101 -34.019 1.00 76.16  ? 391 MET A SD  1 
ATOM   2703 C  CE  . MET A 1 391 ? -34.480 -17.465 -34.221 1.00 70.42  ? 391 MET A CE  1 
ATOM   2704 N  N   . LEU A 1 392 ? -38.692 -21.318 -35.530 1.00 81.44  ? 392 LEU A N   1 
ATOM   2705 C  CA  . LEU A 1 392 ? -40.140 -21.255 -35.482 1.00 85.72  ? 392 LEU A CA  1 
ATOM   2706 C  C   . LEU A 1 392 ? -40.650 -22.241 -34.451 1.00 86.81  ? 392 LEU A C   1 
ATOM   2707 O  O   . LEU A 1 392 ? -41.530 -21.922 -33.651 1.00 86.46  ? 392 LEU A O   1 
ATOM   2708 C  CB  . LEU A 1 392 ? -40.730 -21.590 -36.846 1.00 88.26  ? 392 LEU A CB  1 
ATOM   2709 C  CG  . LEU A 1 392 ? -40.618 -20.476 -37.881 1.00 93.21  ? 392 LEU A CG  1 
ATOM   2710 C  CD1 . LEU A 1 392 ? -40.807 -21.033 -39.279 1.00 92.12  ? 392 LEU A CD1 1 
ATOM   2711 C  CD2 . LEU A 1 392 ? -41.656 -19.413 -37.589 1.00 98.72  ? 392 LEU A CD2 1 
ATOM   2712 N  N   . GLN A 1 393 ? -40.067 -23.432 -34.464 1.00 94.24  ? 393 GLN A N   1 
ATOM   2713 C  CA  . GLN A 1 393 ? -40.479 -24.505 -33.579 1.00 97.44  ? 393 GLN A CA  1 
ATOM   2714 C  C   . GLN A 1 393 ? -40.301 -24.112 -32.125 1.00 97.21  ? 393 GLN A C   1 
ATOM   2715 O  O   . GLN A 1 393 ? -41.097 -24.499 -31.272 1.00 97.30  ? 393 GLN A O   1 
ATOM   2716 C  CB  . GLN A 1 393 ? -39.678 -25.766 -33.877 1.00 99.26  ? 393 GLN A CB  1 
ATOM   2717 C  CG  . GLN A 1 393 ? -39.966 -26.920 -32.948 1.00 106.45 ? 393 GLN A CG  1 
ATOM   2718 C  CD  . GLN A 1 393 ? -38.970 -28.048 -33.118 1.00 113.80 ? 393 GLN A CD  1 
ATOM   2719 O  OE1 . GLN A 1 393 ? -38.411 -28.242 -34.202 1.00 116.08 ? 393 GLN A OE1 1 
ATOM   2720 N  NE2 . GLN A 1 393 ? -38.737 -28.800 -32.045 1.00 116.10 ? 393 GLN A NE2 1 
ATOM   2721 N  N   . LYS A 1 394 ? -39.260 -23.336 -31.844 1.00 88.15  ? 394 LYS A N   1 
ATOM   2722 C  CA  . LYS A 1 394 ? -38.939 -22.964 -30.469 1.00 88.74  ? 394 LYS A CA  1 
ATOM   2723 C  C   . LYS A 1 394 ? -39.598 -21.652 -30.054 1.00 90.30  ? 394 LYS A C   1 
ATOM   2724 O  O   . LYS A 1 394 ? -39.438 -21.204 -28.913 1.00 89.73  ? 394 LYS A O   1 
ATOM   2725 C  CB  . LYS A 1 394 ? -37.422 -22.888 -30.263 1.00 87.85  ? 394 LYS A CB  1 
ATOM   2726 C  CG  . LYS A 1 394 ? -36.740 -24.242 -30.179 1.00 86.71  ? 394 LYS A CG  1 
ATOM   2727 C  CD  . LYS A 1 394 ? -37.036 -24.894 -28.838 1.00 84.48  ? 394 LYS A CD  1 
ATOM   2728 C  CE  . LYS A 1 394 ? -36.807 -26.395 -28.879 1.00 85.01  ? 394 LYS A CE  1 
ATOM   2729 N  NZ  . LYS A 1 394 ? -35.391 -26.749 -29.150 1.00 84.62  1 394 LYS A NZ  1 
ATOM   2730 N  N   . GLY A 1 395 ? -40.333 -21.039 -30.976 1.00 82.31  ? 395 GLY A N   1 
ATOM   2731 C  CA  . GLY A 1 395 ? -41.092 -19.846 -30.653 1.00 85.81  ? 395 GLY A CA  1 
ATOM   2732 C  C   . GLY A 1 395 ? -40.268 -18.575 -30.638 1.00 88.19  ? 395 GLY A C   1 
ATOM   2733 O  O   . GLY A 1 395 ? -40.604 -17.618 -29.938 1.00 88.14  ? 395 GLY A O   1 
ATOM   2734 N  N   . PHE A 1 396 ? -39.172 -18.568 -31.392 1.00 112.03 ? 396 PHE A N   1 
ATOM   2735 C  CA  . PHE A 1 396 ? -38.359 -17.364 -31.532 1.00 113.53 ? 396 PHE A CA  1 
ATOM   2736 C  C   . PHE A 1 396 ? -38.746 -16.581 -32.775 1.00 116.51 ? 396 PHE A C   1 
ATOM   2737 O  O   . PHE A 1 396 ? -38.211 -15.503 -33.039 1.00 118.31 ? 396 PHE A O   1 
ATOM   2738 C  CB  . PHE A 1 396 ? -36.884 -17.726 -31.590 1.00 111.77 ? 396 PHE A CB  1 
ATOM   2739 C  CG  . PHE A 1 396 ? -36.401 -18.424 -30.370 1.00 103.92 ? 396 PHE A CG  1 
ATOM   2740 C  CD1 . PHE A 1 396 ? -36.524 -17.823 -29.130 1.00 95.97  ? 396 PHE A CD1 1 
ATOM   2741 C  CD2 . PHE A 1 396 ? -35.832 -19.681 -30.455 1.00 97.15  ? 396 PHE A CD2 1 
ATOM   2742 C  CE1 . PHE A 1 396 ? -36.085 -18.460 -28.001 1.00 91.75  ? 396 PHE A CE1 1 
ATOM   2743 C  CE2 . PHE A 1 396 ? -35.388 -20.322 -29.325 1.00 93.85  ? 396 PHE A CE2 1 
ATOM   2744 C  CZ  . PHE A 1 396 ? -35.516 -19.712 -28.098 1.00 91.33  ? 396 PHE A CZ  1 
ATOM   2745 N  N   . LEU A 1 397 ? -39.676 -17.132 -33.542 1.00 117.26 ? 397 LEU A N   1 
ATOM   2746 C  CA  . LEU A 1 397 ? -40.151 -16.463 -34.737 1.00 119.65 ? 397 LEU A CA  1 
ATOM   2747 C  C   . LEU A 1 397 ? -41.654 -16.557 -34.845 1.00 127.30 ? 397 LEU A C   1 
ATOM   2748 O  O   . LEU A 1 397 ? -42.226 -17.646 -34.797 1.00 125.63 ? 397 LEU A O   1 
ATOM   2749 C  CB  . LEU A 1 397 ? -39.501 -17.053 -35.984 1.00 114.20 ? 397 LEU A CB  1 
ATOM   2750 C  CG  . LEU A 1 397 ? -38.057 -16.630 -36.219 1.00 103.81 ? 397 LEU A CG  1 
ATOM   2751 C  CD1 . LEU A 1 397 ? -37.528 -17.273 -37.485 1.00 94.85  ? 397 LEU A CD1 1 
ATOM   2752 C  CD2 . LEU A 1 397 ? -37.993 -15.115 -36.310 1.00 94.88  ? 397 LEU A CD2 1 
ATOM   2753 N  N   . LYS A 1 398 ? -42.290 -15.401 -34.972 1.00 148.20 ? 398 LYS A N   1 
ATOM   2754 C  CA  . LYS A 1 398 ? -43.710 -15.357 -35.246 1.00 153.46 ? 398 LYS A CA  1 
ATOM   2755 C  C   . LYS A 1 398 ? -43.878 -15.364 -36.756 1.00 153.72 ? 398 LYS A C   1 
ATOM   2756 O  O   . LYS A 1 398 ? -43.254 -14.565 -37.458 1.00 156.48 ? 398 LYS A O   1 
ATOM   2757 C  CB  . LYS A 1 398 ? -44.333 -14.100 -34.642 1.00 157.30 ? 398 LYS A CB  1 
ATOM   2758 N  N   . GLU A 1 399 ? -44.710 -16.275 -37.250 1.00 112.57 ? 399 GLU A N   1 
ATOM   2759 C  CA  . GLU A 1 399 ? -44.938 -16.416 -38.682 1.00 110.07 ? 399 GLU A CA  1 
ATOM   2760 C  C   . GLU A 1 399 ? -45.357 -15.089 -39.307 1.00 110.39 ? 399 GLU A C   1 
ATOM   2761 O  O   . GLU A 1 399 ? -45.054 -14.816 -40.477 1.00 108.61 ? 399 GLU A O   1 
ATOM   2762 C  CB  . GLU A 1 399 ? -46.002 -17.479 -38.948 1.00 107.59 ? 399 GLU A CB  1 
ATOM   2763 N  N   . GLU A 1 400 ? -46.051 -14.274 -38.516 1.00 180.41 ? 400 GLU A N   1 
ATOM   2764 C  CA  . GLU A 1 400 ? -46.504 -12.960 -38.952 1.00 182.83 ? 400 GLU A CA  1 
ATOM   2765 C  C   . GLU A 1 400 ? -45.329 -12.115 -39.427 1.00 187.06 ? 400 GLU A C   1 
ATOM   2766 O  O   . GLU A 1 400 ? -45.415 -11.431 -40.447 1.00 193.85 ? 400 GLU A O   1 
ATOM   2767 C  CB  . GLU A 1 400 ? -47.238 -12.256 -37.825 1.00 135.35 ? 400 GLU A CB  1 
ATOM   2768 N  N   . ASP A 1 401 ? -44.226 -12.179 -38.688 1.00 146.51 ? 401 ASP A N   1 
ATOM   2769 C  CA  . ASP A 1 401 ? -43.037 -11.410 -39.028 1.00 146.53 ? 401 ASP A CA  1 
ATOM   2770 C  C   . ASP A 1 401 ? -42.421 -11.900 -40.335 1.00 148.51 ? 401 ASP A C   1 
ATOM   2771 O  O   . ASP A 1 401 ? -42.041 -11.099 -41.189 1.00 153.47 ? 401 ASP A O   1 
ATOM   2772 C  CB  . ASP A 1 401 ? -42.023 -11.482 -37.901 1.00 128.21 ? 401 ASP A CB  1 
ATOM   2773 N  N   . THR A 1 403 ? -44.006 -13.410 -42.675 1.00 174.66 ? 403 THR A N   1 
ATOM   2774 C  CA  . THR A 1 403 ? -44.908 -12.978 -43.736 1.00 173.71 ? 403 THR A CA  1 
ATOM   2775 C  C   . THR A 1 403 ? -44.751 -11.489 -44.026 1.00 176.42 ? 403 THR A C   1 
ATOM   2776 O  O   . THR A 1 403 ? -45.005 -11.033 -45.141 1.00 181.44 ? 403 THR A O   1 
ATOM   2777 C  CB  . THR A 1 403 ? -46.350 -13.296 -43.368 1.00 150.00 ? 403 THR A CB  1 
ATOM   2778 N  N   . GLU A 1 404 ? -44.322 -10.732 -43.023 1.00 152.40 ? 404 GLU A N   1 
ATOM   2779 C  CA  . GLU A 1 404 ? -44.117 -9.303  -43.205 1.00 151.24 ? 404 GLU A CA  1 
ATOM   2780 C  C   . GLU A 1 404 ? -42.884 -9.043  -44.057 1.00 153.42 ? 404 GLU A C   1 
ATOM   2781 O  O   . GLU A 1 404 ? -42.887 -8.163  -44.920 1.00 157.97 ? 404 GLU A O   1 
ATOM   2782 C  CB  . GLU A 1 404 ? -43.991 -8.607  -41.865 1.00 125.19 ? 404 GLU A CB  1 
ATOM   2783 N  N   . LYS A 1 405 ? -41.834 -9.818  -43.815 1.00 179.62 ? 405 LYS A N   1 
ATOM   2784 C  CA  . LYS A 1 405 ? -40.569 -9.636  -44.514 1.00 179.27 ? 405 LYS A CA  1 
ATOM   2785 C  C   . LYS A 1 405 ? -40.669 -10.008 -45.988 1.00 179.86 ? 405 LYS A C   1 
ATOM   2786 O  O   . LYS A 1 405 ? -39.959 -9.453  -46.828 1.00 179.07 ? 405 LYS A O   1 
ATOM   2787 C  CB  . LYS A 1 405 ? -39.475 -10.443 -43.840 1.00 178.32 ? 405 LYS A CB  1 
ATOM   2788 N  N   . LYS A 1 406 ? -41.554 -10.948 -46.295 1.00 154.93 ? 406 LYS A N   1 
ATOM   2789 C  CA  . LYS A 1 406 ? -41.640 -11.520 -47.632 1.00 155.52 ? 406 LYS A CA  1 
ATOM   2790 C  C   . LYS A 1 406 ? -42.130 -10.528 -48.691 1.00 154.61 ? 406 LYS A C   1 
ATOM   2791 O  O   . LYS A 1 406 ? -42.875 -9.596  -48.381 1.00 155.85 ? 406 LYS A O   1 
ATOM   2792 C  CB  . LYS A 1 406 ? -42.519 -12.755 -47.608 1.00 156.50 ? 406 LYS A CB  1 
ATOM   2793 N  N   . PRO A 1 407 ? -41.689 -10.723 -49.946 1.00 188.15 ? 407 PRO A N   1 
ATOM   2794 C  CA  . PRO A 1 407 ? -42.141 -9.962  -51.117 1.00 186.16 ? 407 PRO A CA  1 
ATOM   2795 C  C   . PRO A 1 407 ? -43.606 -10.227 -51.436 1.00 184.10 ? 407 PRO A C   1 
ATOM   2796 O  O   . PRO A 1 407 ? -44.174 -11.207 -50.954 1.00 184.87 ? 407 PRO A O   1 
ATOM   2797 C  CB  . PRO A 1 407 ? -41.258 -10.499 -52.246 1.00 186.21 ? 407 PRO A CB  1 
ATOM   2798 C  CG  . PRO A 1 407 ? -40.050 -11.019 -51.559 1.00 186.56 ? 407 PRO A CG  1 
ATOM   2799 C  CD  . PRO A 1 407 ? -40.549 -11.596 -50.275 1.00 187.34 ? 407 PRO A CD  1 
ATOM   2800 N  N   . TRP A 1 408 ? -44.199 -9.364  -52.256 1.00 141.54 ? 408 TRP A N   1 
ATOM   2801 C  CA  . TRP A 1 408 ? -45.635 -9.388  -52.519 1.00 135.88 ? 408 TRP A CA  1 
ATOM   2802 C  C   . TRP A 1 408 ? -46.168 -10.725 -53.024 1.00 132.60 ? 408 TRP A C   1 
ATOM   2803 O  O   . TRP A 1 408 ? -47.266 -11.143 -52.649 1.00 132.32 ? 408 TRP A O   1 
ATOM   2804 C  CB  . TRP A 1 408 ? -46.010 -8.295  -53.520 1.00 135.28 ? 408 TRP A CB  1 
ATOM   2805 C  CG  . TRP A 1 408 ? -45.351 -8.471  -54.844 1.00 133.79 ? 408 TRP A CG  1 
ATOM   2806 C  CD1 . TRP A 1 408 ? -44.116 -8.018  -55.212 1.00 133.13 ? 408 TRP A CD1 1 
ATOM   2807 C  CD2 . TRP A 1 408 ? -45.877 -9.171  -55.976 1.00 133.10 ? 408 TRP A CD2 1 
ATOM   2808 N  NE1 . TRP A 1 408 ? -43.847 -8.380  -56.510 1.00 132.97 ? 408 TRP A NE1 1 
ATOM   2809 C  CE2 . TRP A 1 408 ? -44.910 -9.091  -57.000 1.00 132.97 ? 408 TRP A CE2 1 
ATOM   2810 C  CE3 . TRP A 1 408 ? -47.074 -9.854  -56.225 1.00 132.96 ? 408 TRP A CE3 1 
ATOM   2811 C  CZ2 . TRP A 1 408 ? -45.105 -9.666  -58.253 1.00 132.93 ? 408 TRP A CZ2 1 
ATOM   2812 C  CZ3 . TRP A 1 408 ? -47.264 -10.425 -57.463 1.00 132.92 ? 408 TRP A CZ3 1 
ATOM   2813 C  CH2 . TRP A 1 408 ? -46.285 -10.327 -58.465 1.00 132.92 ? 408 TRP A CH2 1 
ATOM   2814 N  N   . TRP A 1 409 ? -45.397 -11.399 -53.869 1.00 144.43 ? 409 TRP A N   1 
ATOM   2815 C  CA  . TRP A 1 409 ? -45.881 -12.622 -54.492 1.00 140.77 ? 409 TRP A CA  1 
ATOM   2816 C  C   . TRP A 1 409 ? -45.922 -13.795 -53.529 1.00 138.74 ? 409 TRP A C   1 
ATOM   2817 O  O   . TRP A 1 409 ? -46.522 -14.827 -53.840 1.00 139.50 ? 409 TRP A O   1 
ATOM   2818 C  CB  . TRP A 1 409 ? -45.035 -12.984 -55.715 1.00 139.61 ? 409 TRP A CB  1 
ATOM   2819 C  CG  . TRP A 1 409 ? -43.701 -13.611 -55.402 1.00 137.69 ? 409 TRP A CG  1 
ATOM   2820 C  CD1 . TRP A 1 409 ? -43.467 -14.890 -54.966 1.00 136.73 ? 409 TRP A CD1 1 
ATOM   2821 C  CD2 . TRP A 1 409 ? -42.418 -13.000 -55.547 1.00 136.20 ? 409 TRP A CD2 1 
ATOM   2822 N  NE1 . TRP A 1 409 ? -42.120 -15.099 -54.811 1.00 136.09 ? 409 TRP A NE1 1 
ATOM   2823 C  CE2 . TRP A 1 409 ? -41.451 -13.954 -55.166 1.00 135.53 ? 409 TRP A CE2 1 
ATOM   2824 C  CE3 . TRP A 1 409 ? -41.989 -11.732 -55.955 1.00 135.78 ? 409 TRP A CE3 1 
ATOM   2825 C  CZ2 . TRP A 1 409 ? -40.088 -13.683 -55.181 1.00 133.55 ? 409 TRP A CZ2 1 
ATOM   2826 C  CZ3 . TRP A 1 409 ? -40.637 -11.463 -55.970 1.00 135.02 ? 409 TRP A CZ3 1 
ATOM   2827 C  CH2 . TRP A 1 409 ? -39.700 -12.433 -55.586 1.00 132.83 ? 409 TRP A CH2 1 
ATOM   2828 N  N   . TRP A 1 410 ? -45.293 -13.627 -52.368 1.00 163.04 ? 410 TRP A N   1 
ATOM   2829 C  CA  . TRP A 1 410 ? -45.034 -14.743 -51.464 1.00 160.13 ? 410 TRP A CA  1 
ATOM   2830 C  C   . TRP A 1 410 ? -46.262 -15.582 -51.175 1.00 162.86 ? 410 TRP A C   1 
ATOM   2831 O  O   . TRP A 1 410 ? -46.189 -16.812 -51.161 1.00 161.25 ? 410 TRP A O   1 
ATOM   2832 C  CB  . TRP A 1 410 ? -44.418 -14.273 -50.157 1.00 156.19 ? 410 TRP A CB  1 
ATOM   2833 C  CG  . TRP A 1 410 ? -43.677 -15.364 -49.476 1.00 147.66 ? 410 TRP A CG  1 
ATOM   2834 C  CD1 . TRP A 1 410 ? -44.055 -16.041 -48.352 1.00 142.48 ? 410 TRP A CD1 1 
ATOM   2835 C  CD2 . TRP A 1 410 ? -42.428 -15.927 -49.884 1.00 142.05 ? 410 TRP A CD2 1 
ATOM   2836 N  NE1 . TRP A 1 410 ? -43.111 -16.986 -48.029 1.00 140.94 ? 410 TRP A NE1 1 
ATOM   2837 C  CE2 . TRP A 1 410 ? -42.101 -16.936 -48.955 1.00 140.79 ? 410 TRP A CE2 1 
ATOM   2838 C  CE3 . TRP A 1 410 ? -41.550 -15.671 -50.943 1.00 140.65 ? 410 TRP A CE3 1 
ATOM   2839 C  CZ2 . TRP A 1 410 ? -40.935 -17.691 -49.053 1.00 140.06 ? 410 TRP A CZ2 1 
ATOM   2840 C  CZ3 . TRP A 1 410 ? -40.396 -16.419 -51.039 1.00 139.98 ? 410 TRP A CZ3 1 
ATOM   2841 C  CH2 . TRP A 1 410 ? -40.097 -17.418 -50.098 1.00 139.85 ? 410 TRP A CH2 1 
ATOM   2842 N  N   . HIS A 1 411 ? -47.390 -14.928 -50.930 1.00 125.69 ? 411 HIS A N   1 
ATOM   2843 C  CA  . HIS A 1 411 ? -48.624 -15.682 -50.887 1.00 129.29 ? 411 HIS A CA  1 
ATOM   2844 C  C   . HIS A 1 411 ? -49.364 -15.452 -52.184 1.00 126.01 ? 411 HIS A C   1 
ATOM   2845 O  O   . HIS A 1 411 ? -49.957 -14.396 -52.412 1.00 128.78 ? 411 HIS A O   1 
ATOM   2846 C  CB  . HIS A 1 411 ? -49.482 -15.255 -49.700 1.00 134.03 ? 411 HIS A CB  1 
ATOM   2847 C  CG  . HIS A 1 411 ? -48.945 -15.712 -48.378 1.00 141.88 ? 411 HIS A CG  1 
ATOM   2848 N  ND1 . HIS A 1 411 ? -48.011 -14.994 -47.666 1.00 146.75 ? 411 HIS A ND1 1 
ATOM   2849 C  CD2 . HIS A 1 411 ? -49.197 -16.826 -47.657 1.00 146.74 ? 411 HIS A CD2 1 
ATOM   2850 C  CE1 . HIS A 1 411 ? -47.721 -15.643 -46.552 1.00 148.01 ? 411 HIS A CE1 1 
ATOM   2851 N  NE2 . HIS A 1 411 ? -48.425 -16.757 -46.522 1.00 148.01 ? 411 HIS A NE2 1 
ATOM   2852 N  N   . LEU A 1 412 ? -49.324 -16.481 -53.019 1.00 120.51 ? 412 LEU A N   1 
ATOM   2853 C  CA  . LEU A 1 412 ? -50.120 -16.563 -54.218 1.00 113.99 ? 412 LEU A CA  1 
ATOM   2854 C  C   . LEU A 1 412 ? -50.135 -18.039 -54.546 1.00 116.85 ? 412 LEU A C   1 
ATOM   2855 O  O   . LEU A 1 412 ? -49.220 -18.766 -54.166 1.00 113.96 ? 412 LEU A O   1 
ATOM   2856 C  CB  . LEU A 1 412 ? -49.454 -15.786 -55.351 1.00 107.52 ? 412 LEU A CB  1 
ATOM   2857 C  CG  . LEU A 1 412 ? -49.888 -14.333 -55.531 1.00 95.76  ? 412 LEU A CG  1 
ATOM   2858 C  CD1 . LEU A 1 412 ? -48.897 -13.580 -56.402 1.00 86.09  ? 412 LEU A CD1 1 
ATOM   2859 C  CD2 . LEU A 1 412 ? -51.273 -14.283 -56.135 1.00 86.46  ? 412 LEU A CD2 1 
ATOM   2860 N  N   . ARG A 1 413 ? -51.149 -18.481 -55.271 1.00 137.58 ? 413 ARG A N   1 
ATOM   2861 C  CA  . ARG A 1 413 ? -51.199 -19.868 -55.699 1.00 142.22 ? 413 ARG A CA  1 
ATOM   2862 C  C   . ARG A 1 413 ? -50.334 -20.092 -56.928 1.00 142.73 ? 413 ARG A C   1 
ATOM   2863 O  O   . ARG A 1 413 ? -50.064 -19.162 -57.693 1.00 144.48 ? 413 ARG A O   1 
ATOM   2864 C  CB  . ARG A 1 413 ? -52.637 -20.324 -55.924 1.00 144.74 ? 413 ARG A CB  1 
ATOM   2865 C  CG  . ARG A 1 413 ? -53.487 -20.274 -54.660 1.00 146.58 ? 413 ARG A CG  1 
ATOM   2866 C  CD  . ARG A 1 413 ? -52.989 -21.266 -53.629 1.00 147.47 ? 413 ARG A CD  1 
ATOM   2867 N  NE  . ARG A 1 413 ? -53.684 -21.157 -52.345 1.00 147.63 ? 413 ARG A NE  1 
ATOM   2868 C  CZ  . ARG A 1 413 ? -53.298 -21.785 -51.236 1.00 147.69 ? 413 ARG A CZ  1 
ATOM   2869 N  NH1 . ARG A 1 413 ? -52.233 -22.578 -51.259 1.00 147.71 1 413 ARG A NH1 1 
ATOM   2870 N  NH2 . ARG A 1 413 ? -53.979 -21.641 -50.107 1.00 147.70 ? 413 ARG A NH2 1 
ATOM   2871 N  N   . VAL A 1 414 ? -49.897 -21.333 -57.102 1.00 117.33 ? 414 VAL A N   1 
ATOM   2872 C  CA  . VAL A 1 414 ? -49.189 -21.752 -58.300 1.00 117.33 ? 414 VAL A CA  1 
ATOM   2873 C  C   . VAL A 1 414 ? -50.076 -21.546 -59.515 1.00 117.33 ? 414 VAL A C   1 
ATOM   2874 O  O   . VAL A 1 414 ? -49.597 -21.235 -60.610 1.00 117.33 ? 414 VAL A O   1 
ATOM   2875 C  CB  . VAL A 1 414 ? -48.846 -23.242 -58.205 1.00 117.33 ? 414 VAL A CB  1 
ATOM   2876 C  CG1 . VAL A 1 414 ? -48.151 -23.724 -59.465 1.00 117.33 ? 414 VAL A CG1 1 
ATOM   2877 C  CG2 . VAL A 1 414 ? -47.992 -23.498 -56.980 1.00 117.33 ? 414 VAL A CG2 1 
ATOM   2878 N  N   . GLN A 1 415 ? -51.378 -21.704 -59.302 1.00 134.73 ? 415 GLN A N   1 
ATOM   2879 C  CA  . GLN A 1 415 ? -52.369 -21.587 -60.357 1.00 137.07 ? 415 GLN A CA  1 
ATOM   2880 C  C   . GLN A 1 415 ? -52.222 -20.272 -61.117 1.00 139.63 ? 415 GLN A C   1 
ATOM   2881 O  O   . GLN A 1 415 ? -52.441 -20.210 -62.329 1.00 137.99 ? 415 GLN A O   1 
ATOM   2882 C  CB  . GLN A 1 415 ? -53.765 -21.704 -59.753 1.00 136.40 ? 415 GLN A CB  1 
ATOM   2883 C  CG  . GLN A 1 415 ? -54.889 -21.775 -60.758 1.00 135.92 ? 415 GLN A CG  1 
ATOM   2884 C  CD  . GLN A 1 415 ? -56.009 -22.678 -60.282 1.00 136.16 ? 415 GLN A CD  1 
ATOM   2885 O  OE1 . GLN A 1 415 ? -55.947 -23.236 -59.183 1.00 136.35 ? 415 GLN A OE1 1 
ATOM   2886 N  NE2 . GLN A 1 415 ? -57.037 -22.833 -61.109 1.00 136.33 ? 415 GLN A NE2 1 
ATOM   2887 N  N   . GLU A 1 416 ? -51.816 -19.233 -60.396 1.00 134.45 ? 416 GLU A N   1 
ATOM   2888 C  CA  . GLU A 1 416 ? -51.693 -17.894 -60.956 1.00 137.36 ? 416 GLU A CA  1 
ATOM   2889 C  C   . GLU A 1 416 ? -50.627 -17.795 -62.058 1.00 134.39 ? 416 GLU A C   1 
ATOM   2890 O  O   . GLU A 1 416 ? -50.659 -16.878 -62.882 1.00 137.23 ? 416 GLU A O   1 
ATOM   2891 C  CB  . GLU A 1 416 ? -51.389 -16.896 -59.837 1.00 141.44 ? 416 GLU A CB  1 
ATOM   2892 C  CG  . GLU A 1 416 ? -51.563 -15.442 -60.227 1.00 147.51 ? 416 GLU A CG  1 
ATOM   2893 C  CD  . GLU A 1 416 ? -53.000 -14.975 -60.086 1.00 151.61 ? 416 GLU A CD  1 
ATOM   2894 O  OE1 . GLU A 1 416 ? -53.765 -15.620 -59.335 1.00 152.53 ? 416 GLU A OE1 1 
ATOM   2895 O  OE2 . GLU A 1 416 ? -53.365 -13.963 -60.724 1.00 152.54 1 416 GLU A OE2 1 
ATOM   2896 N  N   . LEU A 1 417 ? -49.688 -18.737 -62.073 1.00 142.92 ? 417 LEU A N   1 
ATOM   2897 C  CA  . LEU A 1 417 ? -48.652 -18.774 -63.102 1.00 136.33 ? 417 LEU A CA  1 
ATOM   2898 C  C   . LEU A 1 417 ? -49.272 -19.086 -64.451 1.00 139.21 ? 417 LEU A C   1 
ATOM   2899 O  O   . LEU A 1 417 ? -48.842 -18.575 -65.487 1.00 140.03 ? 417 LEU A O   1 
ATOM   2900 C  CB  . LEU A 1 417 ? -47.625 -19.852 -62.778 1.00 127.13 ? 417 LEU A CB  1 
ATOM   2901 C  CG  . LEU A 1 417 ? -46.769 -19.629 -61.536 1.00 114.29 ? 417 LEU A CG  1 
ATOM   2902 C  CD1 . LEU A 1 417 ? -45.956 -20.873 -61.237 1.00 108.00 ? 417 LEU A CD1 1 
ATOM   2903 C  CD2 . LEU A 1 417 ? -45.860 -18.442 -61.733 1.00 98.49  ? 417 LEU A CD2 1 
ATOM   2904 N  N   . GLY A 1 418 ? -50.267 -19.964 -64.421 1.00 187.27 ? 418 GLY A N   1 
ATOM   2905 C  CA  . GLY A 1 418 ? -51.040 -20.321 -65.592 1.00 188.06 ? 418 GLY A CA  1 
ATOM   2906 C  C   . GLY A 1 418 ? -50.427 -21.488 -66.335 1.00 188.02 ? 418 GLY A C   1 
ATOM   2907 O  O   . GLY A 1 418 ? -51.125 -22.214 -67.044 1.00 189.27 ? 418 GLY A O   1 
ATOM   2908 N  N   . LEU A 1 419 ? -49.123 -21.669 -66.158 1.00 116.69 ? 419 LEU A N   1 
ATOM   2909 C  CA  . LEU A 1 419 ? -48.440 -22.892 -66.565 1.00 115.65 ? 419 LEU A CA  1 
ATOM   2910 C  C   . LEU A 1 419 ? -48.687 -23.358 -67.990 1.00 116.29 ? 419 LEU A C   1 
ATOM   2911 O  O   . LEU A 1 419 ? -48.768 -22.566 -68.931 1.00 115.19 ? 419 LEU A O   1 
ATOM   2912 C  CB  . LEU A 1 419 ? -48.845 -24.032 -65.633 1.00 114.51 ? 419 LEU A CB  1 
ATOM   2913 C  CG  . LEU A 1 419 ? -48.026 -24.214 -64.364 1.00 113.28 ? 419 LEU A CG  1 
ATOM   2914 C  CD1 . LEU A 1 419 ? -48.589 -25.371 -63.565 1.00 112.58 ? 419 LEU A CD1 1 
ATOM   2915 C  CD2 . LEU A 1 419 ? -46.576 -24.472 -64.742 1.00 112.60 ? 419 LEU A CD2 1 
ATOM   2916 N  N   . SER A 1 420 ? -48.833 -24.676 -68.095 1.00 113.51 ? 420 SER A N   1 
ATOM   2917 C  CA  . SER A 1 420 ? -49.131 -25.394 -69.323 1.00 114.42 ? 420 SER A CA  1 
ATOM   2918 C  C   . SER A 1 420 ? -49.107 -26.866 -68.968 1.00 113.23 ? 420 SER A C   1 
ATOM   2919 O  O   . SER A 1 420 ? -48.567 -27.248 -67.929 1.00 116.14 ? 420 SER A O   1 
ATOM   2920 C  CB  . SER A 1 420 ? -48.083 -25.132 -70.400 1.00 115.99 ? 420 SER A CB  1 
ATOM   2921 O  OG  . SER A 1 420 ? -48.263 -26.025 -71.488 1.00 116.61 ? 420 SER A OG  1 
ATOM   2922 N  N   . ALA A 1 421 ? -49.676 -27.697 -69.828 1.00 144.79 ? 421 ALA A N   1 
ATOM   2923 C  CA  . ALA A 1 421 ? -49.644 -29.130 -69.599 1.00 139.31 ? 421 ALA A CA  1 
ATOM   2924 C  C   . ALA A 1 421 ? -48.561 -29.754 -70.463 1.00 135.26 ? 421 ALA A C   1 
ATOM   2925 O  O   . ALA A 1 421 ? -48.538 -29.561 -71.679 1.00 139.27 ? 421 ALA A O   1 
ATOM   2926 C  CB  . ALA A 1 421 ? -50.988 -29.750 -69.889 1.00 133.63 ? 421 ALA A CB  1 
ATOM   2927 N  N   . PRO A 1 422 ? -47.647 -30.493 -69.829 1.00 121.28 ? 422 PRO A N   1 
ATOM   2928 C  CA  . PRO A 1 422 ? -46.479 -31.061 -70.501 1.00 116.69 ? 422 PRO A CA  1 
ATOM   2929 C  C   . PRO A 1 422 ? -46.810 -32.366 -71.192 1.00 113.26 ? 422 PRO A C   1 
ATOM   2930 O  O   . PRO A 1 422 ? -47.944 -32.844 -71.143 1.00 112.80 ? 422 PRO A O   1 
ATOM   2931 C  CB  . PRO A 1 422 ? -45.527 -31.338 -69.344 1.00 115.88 ? 422 PRO A CB  1 
ATOM   2932 C  CG  . PRO A 1 422 ? -46.444 -31.689 -68.230 1.00 116.69 ? 422 PRO A CG  1 
ATOM   2933 C  CD  . PRO A 1 422 ? -47.656 -30.808 -68.392 1.00 119.44 ? 422 PRO A CD  1 
ATOM   2934 N  N   . LEU A 1 423 ? -45.799 -32.940 -71.825 1.00 101.86 ? 423 LEU A N   1 
ATOM   2935 C  CA  . LEU A 1 423 ? -45.934 -34.194 -72.534 1.00 98.68  ? 423 LEU A CA  1 
ATOM   2936 C  C   . LEU A 1 423 ? -45.159 -35.281 -71.815 1.00 95.73  ? 423 LEU A C   1 
ATOM   2937 O  O   . LEU A 1 423 ? -44.009 -35.077 -71.432 1.00 93.23  ? 423 LEU A O   1 
ATOM   2938 C  CB  . LEU A 1 423 ? -45.385 -34.040 -73.942 1.00 100.33 ? 423 LEU A CB  1 
ATOM   2939 C  CG  . LEU A 1 423 ? -45.299 -35.349 -74.712 1.00 104.52 ? 423 LEU A CG  1 
ATOM   2940 C  CD1 . LEU A 1 423 ? -46.694 -35.887 -74.976 1.00 109.82 ? 423 LEU A CD1 1 
ATOM   2941 C  CD2 . LEU A 1 423 ? -44.549 -35.108 -75.998 1.00 108.43 ? 423 LEU A CD2 1 
ATOM   2942 N  N   . THR A 1 424 ? -45.772 -36.444 -71.646 1.00 108.29 ? 424 THR A N   1 
ATOM   2943 C  CA  . THR A 1 424 ? -45.152 -37.493 -70.855 1.00 108.95 ? 424 THR A CA  1 
ATOM   2944 C  C   . THR A 1 424 ? -44.722 -38.636 -71.746 1.00 106.91 ? 424 THR A C   1 
ATOM   2945 O  O   . THR A 1 424 ? -45.347 -38.905 -72.773 1.00 105.83 ? 424 THR A O   1 
ATOM   2946 C  CB  . THR A 1 424 ? -46.129 -38.049 -69.831 1.00 109.73 ? 424 THR A CB  1 
ATOM   2947 O  OG1 . THR A 1 424 ? -47.067 -38.907 -70.492 1.00 114.15 ? 424 THR A OG1 1 
ATOM   2948 C  CG2 . THR A 1 424 ? -46.867 -36.912 -69.154 1.00 114.11 ? 424 THR A CG2 1 
ATOM   2949 N  N   . VAL A 1 425 ? -43.645 -39.310 -71.362 1.00 78.61  ? 425 VAL A N   1 
ATOM   2950 C  CA  . VAL A 1 425 ? -43.162 -40.446 -72.135 1.00 77.04  ? 425 VAL A CA  1 
ATOM   2951 C  C   . VAL A 1 425 ? -42.918 -41.677 -71.266 1.00 80.18  ? 425 VAL A C   1 
ATOM   2952 O  O   . VAL A 1 425 ? -42.759 -41.569 -70.045 1.00 79.93  ? 425 VAL A O   1 
ATOM   2953 C  CB  . VAL A 1 425 ? -41.863 -40.103 -72.895 1.00 73.74  ? 425 VAL A CB  1 
ATOM   2954 C  CG1 . VAL A 1 425 ? -42.057 -38.851 -73.730 1.00 69.97  ? 425 VAL A CG1 1 
ATOM   2955 C  CG2 . VAL A 1 425 ? -40.720 -39.897 -71.917 1.00 70.51  ? 425 VAL A CG2 1 
ATOM   2956 N  N   . LEU A 1 426 ? -42.866 -42.842 -71.906 1.00 103.56 ? 426 LEU A N   1 
ATOM   2957 C  CA  . LEU A 1 426 ? -42.581 -44.091 -71.214 1.00 107.51 ? 426 LEU A CA  1 
ATOM   2958 C  C   . LEU A 1 426 ? -41.085 -44.240 -71.004 1.00 111.20 ? 426 LEU A C   1 
ATOM   2959 O  O   . LEU A 1 426 ? -40.300 -43.745 -71.803 1.00 111.40 ? 426 LEU A O   1 
ATOM   2960 C  CB  . LEU A 1 426 ? -43.094 -45.283 -72.018 1.00 106.09 ? 426 LEU A CB  1 
ATOM   2961 C  CG  . LEU A 1 426 ? -44.595 -45.427 -72.243 1.00 105.87 ? 426 LEU A CG  1 
ATOM   2962 C  CD1 . LEU A 1 426 ? -44.930 -46.900 -72.422 1.00 105.79 ? 426 LEU A CD1 1 
ATOM   2963 C  CD2 . LEU A 1 426 ? -45.393 -44.821 -71.090 1.00 105.79 ? 426 LEU A CD2 1 
ATOM   2964 N  N   . PRO A 1 427 ? -40.681 -44.917 -69.920 1.00 110.58 ? 427 PRO A N   1 
ATOM   2965 C  CA  . PRO A 1 427 ? -39.258 -45.091 -69.608 1.00 112.04 ? 427 PRO A CA  1 
ATOM   2966 C  C   . PRO A 1 427 ? -38.557 -46.022 -70.589 1.00 111.96 ? 427 PRO A C   1 
ATOM   2967 O  O   . PRO A 1 427 ? -37.327 -46.015 -70.676 1.00 114.43 ? 427 PRO A O   1 
ATOM   2968 C  CB  . PRO A 1 427 ? -39.280 -45.733 -68.223 1.00 112.44 ? 427 PRO A CB  1 
ATOM   2969 C  CG  . PRO A 1 427 ? -40.569 -46.457 -68.185 1.00 112.03 ? 427 PRO A CG  1 
ATOM   2970 C  CD  . PRO A 1 427 ? -41.539 -45.595 -68.935 1.00 110.96 ? 427 PRO A CD  1 
ATOM   2971 N  N   . THR A 1 428 ? -39.331 -46.823 -71.307 1.00 107.10 ? 428 THR A N   1 
ATOM   2972 C  CA  . THR A 1 428 ? -38.762 -47.792 -72.231 1.00 105.10 ? 428 THR A CA  1 
ATOM   2973 C  C   . THR A 1 428 ? -38.403 -47.128 -73.547 1.00 101.70 ? 428 THR A C   1 
ATOM   2974 O  O   . THR A 1 428 ? -37.806 -47.750 -74.426 1.00 99.62  ? 428 THR A O   1 
ATOM   2975 C  CB  . THR A 1 428 ? -39.741 -48.932 -72.506 1.00 106.47 ? 428 THR A CB  1 
ATOM   2976 O  OG1 . THR A 1 428 ? -41.069 -48.398 -72.577 1.00 111.18 ? 428 THR A OG1 1 
ATOM   2977 C  CG2 . THR A 1 428 ? -39.675 -49.952 -71.386 1.00 111.17 ? 428 THR A CG2 1 
ATOM   2978 N  N   . ILE A 1 429 ? -38.786 -45.864 -73.680 1.00 110.55 ? 429 ILE A N   1 
ATOM   2979 C  CA  . ILE A 1 429 ? -38.538 -45.119 -74.899 1.00 109.46 ? 429 ILE A CA  1 
ATOM   2980 C  C   . ILE A 1 429 ? -37.038 -44.888 -75.051 1.00 110.84 ? 429 ILE A C   1 
ATOM   2981 O  O   . ILE A 1 429 ? -36.283 -44.948 -74.076 1.00 110.16 ? 429 ILE A O   1 
ATOM   2982 C  CB  . ILE A 1 429 ? -39.269 -43.770 -74.887 1.00 108.40 ? 429 ILE A CB  1 
ATOM   2983 C  CG1 . ILE A 1 429 ? -39.480 -43.252 -76.307 1.00 106.13 ? 429 ILE A CG1 1 
ATOM   2984 C  CG2 . ILE A 1 429 ? -38.509 -42.754 -74.060 1.00 106.36 ? 429 ILE A CG2 1 
ATOM   2985 C  CD1 . ILE A 1 429 ? -40.065 -41.866 -76.342 1.00 103.91 ? 429 ILE A CD1 1 
ATOM   2986 N  N   . THR A 1 430 ? -36.604 -44.645 -76.281 1.00 98.74  ? 430 THR A N   1 
ATOM   2987 C  CA  . THR A 1 430 ? -35.192 -44.455 -76.553 1.00 101.39 ? 430 THR A CA  1 
ATOM   2988 C  C   . THR A 1 430 ? -34.824 -42.983 -76.530 1.00 102.06 ? 430 THR A C   1 
ATOM   2989 O  O   . THR A 1 430 ? -35.686 -42.116 -76.366 1.00 101.58 ? 430 THR A O   1 
ATOM   2990 C  CB  . THR A 1 430 ? -34.817 -45.032 -77.916 1.00 101.83 ? 430 THR A CB  1 
ATOM   2991 O  OG1 . THR A 1 430 ? -35.746 -44.552 -78.898 1.00 103.85 ? 430 THR A OG1 1 
ATOM   2992 C  CG2 . THR A 1 430 ? -34.872 -46.546 -77.873 1.00 103.81 ? 430 THR A CG2 1 
ATOM   2993 N  N   . CYS A 1 431 ? -33.540 -42.703 -76.706 1.00 121.33 ? 431 CYS A N   1 
ATOM   2994 C  CA  . CYS A 1 431 ? -33.068 -41.332 -76.698 1.00 122.94 ? 431 CYS A CA  1 
ATOM   2995 C  C   . CYS A 1 431 ? -33.474 -40.644 -77.990 1.00 120.82 ? 431 CYS A C   1 
ATOM   2996 O  O   . CYS A 1 431 ? -34.076 -39.560 -77.979 1.00 120.69 ? 431 CYS A O   1 
ATOM   2997 C  CB  . CYS A 1 431 ? -31.552 -41.307 -76.550 1.00 125.04 ? 431 CYS A CB  1 
ATOM   2998 S  SG  . CYS A 1 431 ? -30.957 -42.094 -75.035 1.00 132.47 ? 431 CYS A SG  1 
ATOM   2999 N  N   . GLY A 1 432 ? -33.155 -41.294 -79.106 1.00 85.68  ? 432 GLY A N   1 
ATOM   3000 C  CA  . GLY A 1 432 ? -33.465 -40.754 -80.414 1.00 82.31  ? 432 GLY A CA  1 
ATOM   3001 C  C   . GLY A 1 432 ? -34.935 -40.417 -80.546 1.00 79.55  ? 432 GLY A C   1 
ATOM   3002 O  O   . GLY A 1 432 ? -35.294 -39.287 -80.890 1.00 79.53  ? 432 GLY A O   1 
ATOM   3003 N  N   . HIS A 1 433 ? -35.783 -41.389 -80.224 1.00 106.46 ? 433 HIS A N   1 
ATOM   3004 C  CA  . HIS A 1 433 ? -37.217 -41.205 -80.341 1.00 105.62 ? 433 HIS A CA  1 
ATOM   3005 C  C   . HIS A 1 433 ? -37.657 -40.040 -79.475 1.00 103.12 ? 433 HIS A C   1 
ATOM   3006 O  O   . HIS A 1 433 ? -38.588 -39.311 -79.818 1.00 100.07 ? 433 HIS A O   1 
ATOM   3007 C  CB  . HIS A 1 433 ? -37.961 -42.476 -79.950 1.00 107.44 ? 433 HIS A CB  1 
ATOM   3008 C  CG  . HIS A 1 433 ? -39.365 -42.525 -80.459 1.00 118.54 ? 433 HIS A CG  1 
ATOM   3009 N  ND1 . HIS A 1 433 ? -40.252 -43.519 -80.101 1.00 128.12 ? 433 HIS A ND1 1 
ATOM   3010 C  CD2 . HIS A 1 433 ? -40.042 -41.700 -81.288 1.00 128.14 ? 433 HIS A CD2 1 
ATOM   3011 C  CE1 . HIS A 1 433 ? -41.409 -43.307 -80.697 1.00 131.42 ? 433 HIS A CE1 1 
ATOM   3012 N  NE2 . HIS A 1 433 ? -41.311 -42.207 -81.424 1.00 131.44 ? 433 HIS A NE2 1 
ATOM   3013 N  N   . THR A 1 434 ? -36.970 -39.870 -78.355 1.00 95.20  ? 434 THR A N   1 
ATOM   3014 C  CA  . THR A 1 434 ? -37.253 -38.779 -77.442 1.00 96.92  ? 434 THR A CA  1 
ATOM   3015 C  C   . THR A 1 434 ? -37.002 -37.445 -78.118 1.00 90.33  ? 434 THR A C   1 
ATOM   3016 O  O   . THR A 1 434 ? -37.842 -36.540 -78.065 1.00 90.92  ? 434 THR A O   1 
ATOM   3017 C  CB  . THR A 1 434 ? -36.372 -38.861 -76.202 1.00 100.51 ? 434 THR A CB  1 
ATOM   3018 O  OG1 . THR A 1 434 ? -36.544 -40.138 -75.579 1.00 109.96 ? 434 THR A OG1 1 
ATOM   3019 C  CG2 . THR A 1 434 ? -36.706 -37.740 -75.233 1.00 109.95 ? 434 THR A CG2 1 
ATOM   3020 N  N   . ILE A 1 435 ? -35.834 -37.325 -78.743 1.00 95.11  ? 435 ILE A N   1 
ATOM   3021 C  CA  . ILE A 1 435 ? -35.498 -36.100 -79.461 1.00 87.48  ? 435 ILE A CA  1 
ATOM   3022 C  C   . ILE A 1 435 ? -36.531 -35.832 -80.543 1.00 86.36  ? 435 ILE A C   1 
ATOM   3023 O  O   . ILE A 1 435 ? -37.046 -34.714 -80.680 1.00 84.45  ? 435 ILE A O   1 
ATOM   3024 C  CB  . ILE A 1 435 ? -34.115 -36.173 -80.110 1.00 85.54  ? 435 ILE A CB  1 
ATOM   3025 C  CG1 . ILE A 1 435 ? -33.032 -36.083 -79.047 1.00 81.20  ? 435 ILE A CG1 1 
ATOM   3026 C  CG2 . ILE A 1 435 ? -33.934 -35.044 -81.103 1.00 81.90  ? 435 ILE A CG2 1 
ATOM   3027 C  CD1 . ILE A 1 435 ? -32.243 -37.341 -78.911 1.00 77.10  ? 435 ILE A CD1 1 
ATOM   3028 N  N   . GLU A 1 436 ? -36.823 -36.875 -81.311 1.00 81.49  ? 436 GLU A N   1 
ATOM   3029 C  CA  . GLU A 1 436 ? -37.786 -36.787 -82.387 1.00 83.93  ? 436 GLU A CA  1 
ATOM   3030 C  C   . GLU A 1 436 ? -39.088 -36.205 -81.870 1.00 82.44  ? 436 GLU A C   1 
ATOM   3031 O  O   . GLU A 1 436 ? -39.540 -35.168 -82.349 1.00 80.82  ? 436 GLU A O   1 
ATOM   3032 C  CB  . GLU A 1 436 ? -38.032 -38.171 -82.988 1.00 86.88  ? 436 GLU A CB  1 
ATOM   3033 C  CG  . GLU A 1 436 ? -36.922 -38.653 -83.900 1.00 97.94  ? 436 GLU A CG  1 
ATOM   3034 C  CD  . GLU A 1 436 ? -37.149 -40.067 -84.415 1.00 107.91 ? 436 GLU A CD  1 
ATOM   3035 O  OE1 . GLU A 1 436 ? -38.167 -40.691 -84.038 1.00 110.66 ? 436 GLU A OE1 1 
ATOM   3036 O  OE2 . GLU A 1 436 ? -36.302 -40.554 -85.196 1.00 110.67 1 436 GLU A OE2 1 
ATOM   3037 N  N   . ILE A 1 437 ? -39.658 -36.843 -80.857 1.00 73.65  ? 437 ILE A N   1 
ATOM   3038 C  CA  . ILE A 1 437 ? -40.952 -36.433 -80.335 1.00 75.20  ? 437 ILE A CA  1 
ATOM   3039 C  C   . ILE A 1 437 ? -40.919 -35.011 -79.810 1.00 80.22  ? 437 ILE A C   1 
ATOM   3040 O  O   . ILE A 1 437 ? -41.777 -34.196 -80.143 1.00 79.42  ? 437 ILE A O   1 
ATOM   3041 C  CB  . ILE A 1 437 ? -41.416 -37.338 -79.212 1.00 73.18  ? 437 ILE A CB  1 
ATOM   3042 C  CG1 . ILE A 1 437 ? -41.647 -38.745 -79.754 1.00 68.93  ? 437 ILE A CG1 1 
ATOM   3043 C  CG2 . ILE A 1 437 ? -42.693 -36.796 -78.613 1.00 69.03  ? 437 ILE A CG2 1 
ATOM   3044 C  CD1 . ILE A 1 437 ? -42.235 -39.695 -78.734 1.00 62.40  ? 437 ILE A CD1 1 
ATOM   3045 N  N   . LEU A 1 438 ? -39.929 -34.723 -78.978 1.00 90.94  ? 438 LEU A N   1 
ATOM   3046 C  CA  . LEU A 1 438 ? -39.813 -33.406 -78.371 1.00 96.16  ? 438 LEU A CA  1 
ATOM   3047 C  C   . LEU A 1 438 ? -39.741 -32.306 -79.418 1.00 97.16  ? 438 LEU A C   1 
ATOM   3048 O  O   . LEU A 1 438 ? -40.382 -31.263 -79.279 1.00 100.28 ? 438 LEU A O   1 
ATOM   3049 C  CB  . LEU A 1 438 ? -38.610 -33.337 -77.439 1.00 98.09  ? 438 LEU A CB  1 
ATOM   3050 C  CG  . LEU A 1 438 ? -38.817 -33.989 -76.081 1.00 98.85  ? 438 LEU A CG  1 
ATOM   3051 C  CD1 . LEU A 1 438 ? -37.501 -34.045 -75.350 1.00 96.58  ? 438 LEU A CD1 1 
ATOM   3052 C  CD2 . LEU A 1 438 ? -39.820 -33.183 -75.284 1.00 96.56  ? 438 LEU A CD2 1 
ATOM   3053 N  N   . ARG A 1 439 ? -38.955 -32.532 -80.463 1.00 88.35  ? 439 ARG A N   1 
ATOM   3054 C  CA  . ARG A 1 439 ? -38.818 -31.524 -81.501 1.00 86.25  ? 439 ARG A CA  1 
ATOM   3055 C  C   . ARG A 1 439 ? -40.097 -31.396 -82.315 1.00 85.71  ? 439 ARG A C   1 
ATOM   3056 O  O   . ARG A 1 439 ? -40.568 -30.287 -82.578 1.00 83.66  ? 439 ARG A O   1 
ATOM   3057 C  CB  . ARG A 1 439 ? -37.629 -31.833 -82.401 1.00 85.60  ? 439 ARG A CB  1 
ATOM   3058 C  CG  . ARG A 1 439 ? -36.305 -31.686 -81.680 1.00 87.53  ? 439 ARG A CG  1 
ATOM   3059 C  CD  . ARG A 1 439 ? -35.129 -31.716 -82.637 1.00 90.19  ? 439 ARG A CD  1 
ATOM   3060 N  NE  . ARG A 1 439 ? -35.541 -31.623 -84.036 1.00 90.37  ? 439 ARG A NE  1 
ATOM   3061 C  CZ  . ARG A 1 439 ? -35.461 -30.516 -84.768 1.00 88.60  ? 439 ARG A CZ  1 
ATOM   3062 N  NH1 . ARG A 1 439 ? -34.980 -29.395 -84.235 1.00 87.75  1 439 ARG A NH1 1 
ATOM   3063 N  NH2 . ARG A 1 439 ? -35.856 -30.531 -86.035 1.00 83.54  ? 439 ARG A NH2 1 
ATOM   3064 N  N   . GLU A 1 440 ? -40.660 -32.537 -82.690 1.00 100.23 ? 440 GLU A N   1 
ATOM   3065 C  CA  . GLU A 1 440 ? -41.868 -32.593 -83.501 1.00 103.54 ? 440 GLU A CA  1 
ATOM   3066 C  C   . GLU A 1 440 ? -43.035 -31.873 -82.834 1.00 104.16 ? 440 GLU A C   1 
ATOM   3067 O  O   . GLU A 1 440 ? -43.781 -31.132 -83.480 1.00 103.13 ? 440 GLU A O   1 
ATOM   3068 C  CB  . GLU A 1 440 ? -42.233 -34.049 -83.760 1.00 104.73 ? 440 GLU A CB  1 
ATOM   3069 C  CG  . GLU A 1 440 ? -43.416 -34.247 -84.675 1.00 111.72 ? 440 GLU A CG  1 
ATOM   3070 C  CD  . GLU A 1 440 ? -43.666 -35.714 -84.947 1.00 119.06 ? 440 GLU A CD  1 
ATOM   3071 O  OE1 . GLU A 1 440 ? -43.541 -36.521 -84.001 1.00 121.34 ? 440 GLU A OE1 1 
ATOM   3072 O  OE2 . GLU A 1 440 ? -43.975 -36.062 -86.106 1.00 121.39 1 440 GLU A OE2 1 
ATOM   3073 N  N   . LYS A 1 441 ? -43.181 -32.098 -81.534 1.00 108.58 ? 441 LYS A N   1 
ATOM   3074 C  CA  . LYS A 1 441 ? -44.268 -31.517 -80.759 1.00 110.85 ? 441 LYS A CA  1 
ATOM   3075 C  C   . LYS A 1 441 ? -43.911 -30.115 -80.284 1.00 111.86 ? 441 LYS A C   1 
ATOM   3076 O  O   . LYS A 1 441 ? -44.782 -29.360 -79.847 1.00 110.20 ? 441 LYS A O   1 
ATOM   3077 C  CB  . LYS A 1 441 ? -44.600 -32.401 -79.558 1.00 112.83 ? 441 LYS A CB  1 
ATOM   3078 C  CG  . LYS A 1 441 ? -44.942 -33.839 -79.909 1.00 117.23 ? 441 LYS A CG  1 
ATOM   3079 C  CD  . LYS A 1 441 ? -46.411 -33.987 -80.271 1.00 124.01 ? 441 LYS A CD  1 
ATOM   3080 C  CE  . LYS A 1 441 ? -46.801 -35.453 -80.418 1.00 125.94 ? 441 LYS A CE  1 
ATOM   3081 N  NZ  . LYS A 1 441 ? -46.124 -36.117 -81.567 1.00 127.10 1 441 LYS A NZ  1 
ATOM   3082 N  N   . GLY A 1 442 ? -42.629 -29.776 -80.362 1.00 131.57 ? 442 GLY A N   1 
ATOM   3083 C  CA  . GLY A 1 442 ? -42.159 -28.462 -79.957 1.00 136.84 ? 442 GLY A CA  1 
ATOM   3084 C  C   . GLY A 1 442 ? -42.062 -28.285 -78.454 1.00 140.26 ? 442 GLY A C   1 
ATOM   3085 O  O   . GLY A 1 442 ? -42.411 -27.232 -77.915 1.00 140.64 ? 442 GLY A O   1 
ATOM   3086 N  N   . PHE A 1 443 ? -41.567 -29.312 -77.774 1.00 98.63  ? 443 PHE A N   1 
ATOM   3087 C  CA  . PHE A 1 443 ? -41.393 -29.245 -76.331 1.00 101.47 ? 443 PHE A CA  1 
ATOM   3088 C  C   . PHE A 1 443 ? -39.942 -29.474 -75.953 1.00 98.93  ? 443 PHE A C   1 
ATOM   3089 O  O   . PHE A 1 443 ? -39.264 -30.326 -76.529 1.00 99.34  ? 443 PHE A O   1 
ATOM   3090 C  CB  . PHE A 1 443 ? -42.268 -30.278 -75.629 1.00 105.36 ? 443 PHE A CB  1 
ATOM   3091 C  CG  . PHE A 1 443 ? -43.714 -29.923 -75.616 1.00 113.97 ? 443 PHE A CG  1 
ATOM   3092 C  CD1 . PHE A 1 443 ? -44.183 -28.931 -74.773 1.00 120.15 ? 443 PHE A CD1 1 
ATOM   3093 C  CD2 . PHE A 1 443 ? -44.610 -30.585 -76.436 1.00 120.14 ? 443 PHE A CD2 1 
ATOM   3094 C  CE1 . PHE A 1 443 ? -45.519 -28.598 -74.756 1.00 122.14 ? 443 PHE A CE1 1 
ATOM   3095 C  CE2 . PHE A 1 443 ? -45.947 -30.258 -76.424 1.00 122.14 ? 443 PHE A CE2 1 
ATOM   3096 C  CZ  . PHE A 1 443 ? -46.403 -29.263 -75.581 1.00 122.74 ? 443 PHE A CZ  1 
ATOM   3097 N  N   . ASP A 1 444 ? -39.465 -28.693 -74.993 1.00 120.26 ? 444 ASP A N   1 
ATOM   3098 C  CA  . ASP A 1 444 ? -38.104 -28.836 -74.511 1.00 116.43 ? 444 ASP A CA  1 
ATOM   3099 C  C   . ASP A 1 444 ? -37.957 -29.977 -73.509 1.00 111.00 ? 444 ASP A C   1 
ATOM   3100 O  O   . ASP A 1 444 ? -36.926 -30.648 -73.470 1.00 109.50 ? 444 ASP A O   1 
ATOM   3101 C  CB  . ASP A 1 444 ? -37.600 -27.532 -73.902 1.00 119.19 ? 444 ASP A CB  1 
ATOM   3102 C  CG  . ASP A 1 444 ? -36.143 -27.614 -73.496 1.00 126.69 ? 444 ASP A CG  1 
ATOM   3103 O  OD1 . ASP A 1 444 ? -35.342 -28.208 -74.254 1.00 134.22 ? 444 ASP A OD1 1 
ATOM   3104 O  OD2 . ASP A 1 444 ? -35.795 -27.084 -72.421 1.00 134.27 1 444 ASP A OD2 1 
ATOM   3105 N  N   . GLN A 1 445 ? -38.979 -30.190 -72.688 1.00 99.38  ? 445 GLN A N   1 
ATOM   3106 C  CA  . GLN A 1 445 ? -38.855 -31.126 -71.576 1.00 95.57  ? 445 GLN A CA  1 
ATOM   3107 C  C   . GLN A 1 445 ? -40.041 -32.070 -71.415 1.00 91.52  ? 445 GLN A C   1 
ATOM   3108 O  O   . GLN A 1 445 ? -41.207 -31.658 -71.446 1.00 90.16  ? 445 GLN A O   1 
ATOM   3109 C  CB  . GLN A 1 445 ? -38.640 -30.343 -70.282 1.00 96.52  ? 445 GLN A CB  1 
ATOM   3110 C  CG  . GLN A 1 445 ? -39.741 -29.334 -69.990 1.00 102.80 ? 445 GLN A CG  1 
ATOM   3111 C  CD  . GLN A 1 445 ? -39.240 -28.172 -69.166 1.00 109.33 ? 445 GLN A CD  1 
ATOM   3112 O  OE1 . GLN A 1 445 ? -38.042 -28.061 -68.893 1.00 111.29 ? 445 GLN A OE1 1 
ATOM   3113 N  NE2 . GLN A 1 445 ? -40.150 -27.287 -68.775 1.00 111.23 ? 445 GLN A NE2 1 
ATOM   3114 N  N   . ALA A 1 446 ? -39.724 -33.350 -71.258 1.00 93.70  ? 446 ALA A N   1 
ATOM   3115 C  CA  . ALA A 1 446 ? -40.727 -34.369 -70.980 1.00 90.68  ? 446 ALA A CA  1 
ATOM   3116 C  C   . ALA A 1 446 ? -40.487 -35.053 -69.640 1.00 88.46  ? 446 ALA A C   1 
ATOM   3117 O  O   . ALA A 1 446 ? -39.421 -35.625 -69.413 1.00 88.48  ? 446 ALA A O   1 
ATOM   3118 C  CB  . ALA A 1 446 ? -40.771 -35.388 -72.090 1.00 90.52  ? 446 ALA A CB  1 
ATOM   3119 N  N   . PRO A 1 447 ? -41.471 -34.990 -68.736 1.00 65.77  ? 447 PRO A N   1 
ATOM   3120 C  CA  . PRO A 1 447 ? -41.395 -35.877 -67.572 1.00 64.00  ? 447 PRO A CA  1 
ATOM   3121 C  C   . PRO A 1 447 ? -41.539 -37.323 -67.993 1.00 62.62  ? 447 PRO A C   1 
ATOM   3122 O  O   . PRO A 1 447 ? -42.346 -37.634 -68.865 1.00 62.06  ? 447 PRO A O   1 
ATOM   3123 C  CB  . PRO A 1 447 ? -42.595 -35.459 -66.714 1.00 63.67  ? 447 PRO A CB  1 
ATOM   3124 C  CG  . PRO A 1 447 ? -43.440 -34.620 -67.605 1.00 64.19  ? 447 PRO A CG  1 
ATOM   3125 C  CD  . PRO A 1 447 ? -42.516 -33.971 -68.585 1.00 65.55  ? 447 PRO A CD  1 
ATOM   3126 N  N   . VAL A 1 448 ? -40.762 -38.201 -67.380 1.00 80.43  ? 448 VAL A N   1 
ATOM   3127 C  CA  . VAL A 1 448 ? -40.857 -39.609 -67.694 1.00 80.20  ? 448 VAL A CA  1 
ATOM   3128 C  C   . VAL A 1 448 ? -41.813 -40.262 -66.719 1.00 84.55  ? 448 VAL A C   1 
ATOM   3129 O  O   . VAL A 1 448 ? -41.509 -40.394 -65.535 1.00 83.77  ? 448 VAL A O   1 
ATOM   3130 C  CB  . VAL A 1 448 ? -39.492 -40.284 -67.538 1.00 78.22  ? 448 VAL A CB  1 
ATOM   3131 C  CG1 . VAL A 1 448 ? -39.587 -41.763 -67.858 1.00 72.17  ? 448 VAL A CG1 1 
ATOM   3132 C  CG2 . VAL A 1 448 ? -38.475 -39.608 -68.429 1.00 74.30  ? 448 VAL A CG2 1 
ATOM   3133 N  N   . VAL A 1 449 ? -42.970 -40.680 -67.216 1.00 73.96  ? 449 VAL A N   1 
ATOM   3134 C  CA  . VAL A 1 449 ? -43.928 -41.387 -66.379 1.00 79.98  ? 449 VAL A CA  1 
ATOM   3135 C  C   . VAL A 1 449 ? -43.960 -42.873 -66.698 1.00 91.59  ? 449 VAL A C   1 
ATOM   3136 O  O   . VAL A 1 449 ? -43.199 -43.354 -67.537 1.00 92.55  ? 449 VAL A O   1 
ATOM   3137 C  CB  . VAL A 1 449 ? -45.323 -40.793 -66.499 1.00 76.21  ? 449 VAL A CB  1 
ATOM   3138 C  CG1 . VAL A 1 449 ? -45.256 -39.306 -66.248 1.00 65.56  ? 449 VAL A CG1 1 
ATOM   3139 C  CG2 . VAL A 1 449 ? -45.877 -41.066 -67.894 1.00 67.74  ? 449 VAL A CG2 1 
ATOM   3140 N  N   . ASP A 1 450 ? -44.842 -43.599 -66.024 1.00 123.34 ? 450 ASP A N   1 
ATOM   3141 C  CA  . ASP A 1 450 ? -44.933 -45.032 -66.223 1.00 135.87 ? 450 ASP A CA  1 
ATOM   3142 C  C   . ASP A 1 450 ? -46.372 -45.444 -66.523 1.00 142.07 ? 450 ASP A C   1 
ATOM   3143 O  O   . ASP A 1 450 ? -47.308 -44.673 -66.294 1.00 143.67 ? 450 ASP A O   1 
ATOM   3144 C  CB  . ASP A 1 450 ? -44.440 -45.749 -64.970 1.00 137.32 ? 450 ASP A CB  1 
ATOM   3145 C  CG  . ASP A 1 450 ? -44.169 -47.217 -65.209 1.00 141.41 ? 450 ASP A CG  1 
ATOM   3146 O  OD1 . ASP A 1 450 ? -44.398 -47.689 -66.346 1.00 144.16 ? 450 ASP A OD1 1 
ATOM   3147 O  OD2 . ASP A 1 450 ? -43.726 -47.898 -64.261 1.00 144.18 1 450 ASP A OD2 1 
ATOM   3148 N  N   . GLU A 1 451 ? -46.540 -46.659 -67.038 1.00 142.64 ? 451 GLU A N   1 
ATOM   3149 C  CA  . GLU A 1 451 ? -47.862 -47.239 -67.229 1.00 143.58 ? 451 GLU A CA  1 
ATOM   3150 C  C   . GLU A 1 451 ? -48.517 -47.439 -65.870 1.00 140.98 ? 451 GLU A C   1 
ATOM   3151 O  O   . GLU A 1 451 ? -49.737 -47.335 -65.733 1.00 143.04 ? 451 GLU A O   1 
ATOM   3152 C  CB  . GLU A 1 451 ? -47.752 -48.583 -67.945 1.00 147.69 ? 451 GLU A CB  1 
ATOM   3153 N  N   . ALA A 1 452 ? -47.698 -47.752 -64.871 1.00 127.91 ? 452 ALA A N   1 
ATOM   3154 C  CA  . ALA A 1 452 ? -48.175 -47.894 -63.502 1.00 117.46 ? 452 ALA A CA  1 
ATOM   3155 C  C   . ALA A 1 452 ? -48.576 -46.533 -62.945 1.00 110.96 ? 452 ALA A C   1 
ATOM   3156 O  O   . ALA A 1 452 ? -49.407 -46.445 -62.039 1.00 110.22 ? 452 ALA A O   1 
ATOM   3157 C  CB  . ALA A 1 452 ? -47.118 -48.529 -62.637 1.00 116.18 ? 452 ALA A CB  1 
ATOM   3158 N  N   . GLY A 1 453 ? -47.972 -45.475 -63.482 1.00 114.91 ? 453 GLY A N   1 
ATOM   3159 C  CA  . GLY A 1 453 ? -48.313 -44.119 -63.084 1.00 108.85 ? 453 GLY A CA  1 
ATOM   3160 C  C   . GLY A 1 453 ? -47.286 -43.456 -62.192 1.00 106.46 ? 453 GLY A C   1 
ATOM   3161 O  O   . GLY A 1 453 ? -47.473 -42.322 -61.745 1.00 104.65 ? 453 GLY A O   1 
ATOM   3162 N  N   . VAL A 1 454 ? -46.197 -44.166 -61.929 1.00 83.46  ? 454 VAL A N   1 
ATOM   3163 C  CA  . VAL A 1 454 ? -45.119 -43.642 -61.098 1.00 82.21  ? 454 VAL A CA  1 
ATOM   3164 C  C   . VAL A 1 454 ? -44.161 -42.770 -61.908 1.00 78.61  ? 454 VAL A C   1 
ATOM   3165 O  O   . VAL A 1 454 ? -43.605 -43.203 -62.928 1.00 77.67  ? 454 VAL A O   1 
ATOM   3166 C  CB  . VAL A 1 454 ? -44.345 -44.776 -60.390 1.00 83.84  ? 454 VAL A CB  1 
ATOM   3167 C  CG1 . VAL A 1 454 ? -44.116 -45.938 -61.345 1.00 86.41  ? 454 VAL A CG1 1 
ATOM   3168 C  CG2 . VAL A 1 454 ? -43.027 -44.263 -59.847 1.00 87.39  ? 454 VAL A CG2 1 
ATOM   3169 N  N   . ILE A 1 455 ? -43.971 -41.537 -61.460 1.00 83.90  ? 455 ILE A N   1 
ATOM   3170 C  CA  . ILE A 1 455 ? -43.113 -40.620 -62.179 1.00 80.49  ? 455 ILE A CA  1 
ATOM   3171 C  C   . ILE A 1 455 ? -41.666 -40.943 -61.859 1.00 81.92  ? 455 ILE A C   1 
ATOM   3172 O  O   . ILE A 1 455 ? -41.253 -40.870 -60.698 1.00 81.03  ? 455 ILE A O   1 
ATOM   3173 C  CB  . ILE A 1 455 ? -43.377 -39.212 -61.704 1.00 78.67  ? 455 ILE A CB  1 
ATOM   3174 C  CG1 . ILE A 1 455 ? -44.849 -38.882 -61.908 1.00 74.74  ? 455 ILE A CG1 1 
ATOM   3175 C  CG2 . ILE A 1 455 ? -42.464 -38.225 -62.415 1.00 73.61  ? 455 ILE A CG2 1 
ATOM   3176 C  CD1 . ILE A 1 455 ? -45.251 -37.633 -61.212 1.00 69.42  ? 455 ILE A CD1 1 
ATOM   3177 N  N   . LEU A 1 456 ? -40.893 -41.307 -62.879 1.00 79.64  ? 456 LEU A N   1 
ATOM   3178 C  CA  . LEU A 1 456 ? -39.498 -41.671 -62.667 1.00 80.76  ? 456 LEU A CA  1 
ATOM   3179 C  C   . LEU A 1 456 ? -38.499 -40.530 -62.773 1.00 79.91  ? 456 LEU A C   1 
ATOM   3180 O  O   . LEU A 1 456 ? -37.340 -40.700 -62.391 1.00 81.64  ? 456 LEU A O   1 
ATOM   3181 C  CB  . LEU A 1 456 ? -39.078 -42.756 -63.657 1.00 82.06  ? 456 LEU A CB  1 
ATOM   3182 C  CG  . LEU A 1 456 ? -39.808 -44.092 -63.598 1.00 82.31  ? 456 LEU A CG  1 
ATOM   3183 C  CD1 . LEU A 1 456 ? -39.165 -45.057 -64.577 1.00 79.19  ? 456 LEU A CD1 1 
ATOM   3184 C  CD2 . LEU A 1 456 ? -39.735 -44.644 -62.186 1.00 81.78  ? 456 LEU A CD2 1 
ATOM   3185 N  N   . GLY A 1 457 ? -38.909 -39.383 -63.307 1.00 79.14  ? 457 GLY A N   1 
ATOM   3186 C  CA  . GLY A 1 457 ? -37.925 -38.352 -63.578 1.00 76.84  ? 457 GLY A CA  1 
ATOM   3187 C  C   . GLY A 1 457 ? -38.201 -37.376 -64.708 1.00 76.89  ? 457 GLY A C   1 
ATOM   3188 O  O   . GLY A 1 457 ? -39.345 -37.092 -65.069 1.00 74.88  ? 457 GLY A O   1 
ATOM   3189 N  N   . MET A 1 458 ? -37.118 -36.834 -65.250 1.00 89.39  ? 458 MET A N   1 
ATOM   3190 C  CA  . MET A 1 458 ? -37.193 -35.854 -66.319 1.00 91.13  ? 458 MET A CA  1 
ATOM   3191 C  C   . MET A 1 458 ? -36.214 -36.125 -67.448 1.00 88.02  ? 458 MET A C   1 
ATOM   3192 O  O   . MET A 1 458 ? -35.115 -36.628 -67.221 1.00 89.83  ? 458 MET A O   1 
ATOM   3193 C  CB  . MET A 1 458 ? -36.905 -34.469 -65.752 1.00 94.51  ? 458 MET A CB  1 
ATOM   3194 C  CG  . MET A 1 458 ? -38.123 -33.778 -65.236 1.00 100.41 ? 458 MET A CG  1 
ATOM   3195 S  SD  . MET A 1 458 ? -39.132 -33.306 -66.636 1.00 108.00 ? 458 MET A SD  1 
ATOM   3196 C  CE  . MET A 1 458 ? -40.546 -32.665 -65.762 1.00 106.78 ? 458 MET A CE  1 
ATOM   3197 N  N   . VAL A 1 459 ? -36.618 -35.796 -68.669 1.00 72.02  ? 459 VAL A N   1 
ATOM   3198 C  CA  . VAL A 1 459 ? -35.670 -35.681 -69.768 1.00 64.90  ? 459 VAL A CA  1 
ATOM   3199 C  C   . VAL A 1 459 ? -35.852 -34.343 -70.445 1.00 67.73  ? 459 VAL A C   1 
ATOM   3200 O  O   . VAL A 1 459 ? -36.951 -33.779 -70.445 1.00 70.17  ? 459 VAL A O   1 
ATOM   3201 C  CB  . VAL A 1 459 ? -35.809 -36.797 -70.814 1.00 59.71  ? 459 VAL A CB  1 
ATOM   3202 C  CG1 . VAL A 1 459 ? -35.132 -38.039 -70.329 1.00 48.47  ? 459 VAL A CG1 1 
ATOM   3203 C  CG2 . VAL A 1 459 ? -37.267 -37.069 -71.112 1.00 49.24  ? 459 VAL A CG2 1 
ATOM   3204 N  N   . THR A 1 460 ? -34.774 -33.832 -71.018 1.00 80.04  ? 460 THR A N   1 
ATOM   3205 C  CA  . THR A 1 460 ? -34.826 -32.541 -71.678 1.00 79.99  ? 460 THR A CA  1 
ATOM   3206 C  C   . THR A 1 460 ? -34.075 -32.615 -72.997 1.00 79.23  ? 460 THR A C   1 
ATOM   3207 O  O   . THR A 1 460 ? -33.132 -33.399 -73.143 1.00 79.00  ? 460 THR A O   1 
ATOM   3208 C  CB  . THR A 1 460 ? -34.255 -31.419 -70.788 1.00 80.27  ? 460 THR A CB  1 
ATOM   3209 O  OG1 . THR A 1 460 ? -33.971 -30.264 -71.587 1.00 81.85  ? 460 THR A OG1 1 
ATOM   3210 C  CG2 . THR A 1 460 ? -32.976 -31.885 -70.138 1.00 81.28  ? 460 THR A CG2 1 
ATOM   3211 N  N   . LEU A 1 461 ? -34.523 -31.815 -73.959 1.00 73.57  ? 461 LEU A N   1 
ATOM   3212 C  CA  . LEU A 1 461 ? -33.977 -31.830 -75.306 1.00 74.44  ? 461 LEU A CA  1 
ATOM   3213 C  C   . LEU A 1 461 ? -32.515 -31.396 -75.335 1.00 76.82  ? 461 LEU A C   1 
ATOM   3214 O  O   . LEU A 1 461 ? -31.697 -32.002 -76.024 1.00 74.77  ? 461 LEU A O   1 
ATOM   3215 C  CB  . LEU A 1 461 ? -34.797 -30.914 -76.207 1.00 73.50  ? 461 LEU A CB  1 
ATOM   3216 C  CG  . LEU A 1 461 ? -34.352 -30.847 -77.665 1.00 72.48  ? 461 LEU A CG  1 
ATOM   3217 C  CD1 . LEU A 1 461 ? -34.312 -32.246 -78.271 1.00 70.41  ? 461 LEU A CD1 1 
ATOM   3218 C  CD2 . LEU A 1 461 ? -35.280 -29.935 -78.439 1.00 68.57  ? 461 LEU A CD2 1 
ATOM   3219 N  N   . GLY A 1 462 ? -32.197 -30.337 -74.596 1.00 91.71  ? 462 GLY A N   1 
ATOM   3220 C  CA  . GLY A 1 462 ? -30.850 -29.797 -74.576 1.00 98.47  ? 462 GLY A CA  1 
ATOM   3221 C  C   . GLY A 1 462 ? -29.843 -30.798 -74.054 1.00 103.14 ? 462 GLY A C   1 
ATOM   3222 O  O   . GLY A 1 462 ? -28.753 -30.948 -74.607 1.00 102.61 ? 462 GLY A O   1 
ATOM   3223 N  N   . ASN A 1 463 ? -30.214 -31.488 -72.985 1.00 76.88  ? 463 ASN A N   1 
ATOM   3224 C  CA  . ASN A 1 463 ? -29.314 -32.436 -72.352 1.00 79.81  ? 463 ASN A CA  1 
ATOM   3225 C  C   . ASN A 1 463 ? -29.218 -33.728 -73.145 1.00 77.99  ? 463 ASN A C   1 
ATOM   3226 O  O   . ASN A 1 463 ? -28.162 -34.368 -73.184 1.00 79.82  ? 463 ASN A O   1 
ATOM   3227 C  CB  . ASN A 1 463 ? -29.762 -32.724 -70.924 1.00 82.76  ? 463 ASN A CB  1 
ATOM   3228 C  CG  . ASN A 1 463 ? -28.845 -33.681 -70.205 1.00 87.14  ? 463 ASN A CG  1 
ATOM   3229 O  OD1 . ASN A 1 463 ? -29.181 -34.852 -69.996 1.00 89.38  ? 463 ASN A OD1 1 
ATOM   3230 N  ND2 . ASN A 1 463 ? -27.670 -33.191 -69.823 1.00 88.14  ? 463 ASN A ND2 1 
ATOM   3231 N  N   . MET A 1 464 ? -30.324 -34.112 -73.771 1.00 95.27  ? 464 MET A N   1 
ATOM   3232 C  CA  . MET A 1 464 ? -30.324 -35.267 -74.654 1.00 90.47  ? 464 MET A CA  1 
ATOM   3233 C  C   . MET A 1 464 ? -29.362 -35.011 -75.795 1.00 88.89  ? 464 MET A C   1 
ATOM   3234 O  O   . MET A 1 464 ? -28.466 -35.823 -76.083 1.00 86.39  ? 464 MET A O   1 
ATOM   3235 C  CB  . MET A 1 464 ? -31.718 -35.517 -75.208 1.00 89.31  ? 464 MET A CB  1 
ATOM   3236 C  CG  . MET A 1 464 ? -32.424 -36.647 -74.510 1.00 89.11  ? 464 MET A CG  1 
ATOM   3237 S  SD  . MET A 1 464 ? -31.498 -38.188 -74.713 1.00 90.74  ? 464 MET A SD  1 
ATOM   3238 C  CE  . MET A 1 464 ? -32.543 -39.276 -73.736 1.00 94.64  ? 464 MET A CE  1 
ATOM   3239 N  N   . LEU A 1 465 ? -29.558 -33.869 -76.442 1.00 80.33  ? 465 LEU A N   1 
ATOM   3240 C  CA  . LEU A 1 465 ? -28.721 -33.474 -77.557 1.00 83.62  ? 465 LEU A CA  1 
ATOM   3241 C  C   . LEU A 1 465 ? -27.267 -33.426 -77.138 1.00 81.76  ? 465 LEU A C   1 
ATOM   3242 O  O   . LEU A 1 465 ? -26.431 -34.036 -77.786 1.00 79.96  ? 465 LEU A O   1 
ATOM   3243 C  CB  . LEU A 1 465 ? -29.145 -32.122 -78.131 1.00 89.57  ? 465 LEU A CB  1 
ATOM   3244 C  CG  . LEU A 1 465 ? -30.183 -32.224 -79.249 1.00 97.99  ? 465 LEU A CG  1 
ATOM   3245 C  CD1 . LEU A 1 465 ? -30.505 -30.854 -79.822 1.00 101.92 ? 465 LEU A CD1 1 
ATOM   3246 C  CD2 . LEU A 1 465 ? -29.693 -33.169 -80.334 1.00 101.87 ? 465 LEU A CD2 1 
ATOM   3247 N  N   . SER A 1 466 ? -26.974 -32.717 -76.053 1.00 76.43  ? 466 SER A N   1 
ATOM   3248 C  CA  . SER A 1 466 ? -25.610 -32.630 -75.549 1.00 77.07  ? 466 SER A CA  1 
ATOM   3249 C  C   . SER A 1 466 ? -24.997 -34.007 -75.343 1.00 76.77  ? 466 SER A C   1 
ATOM   3250 O  O   . SER A 1 466 ? -23.860 -34.253 -75.748 1.00 78.50  ? 466 SER A O   1 
ATOM   3251 C  CB  . SER A 1 466 ? -25.564 -31.860 -74.232 1.00 76.80  ? 466 SER A CB  1 
ATOM   3252 O  OG  . SER A 1 466 ? -24.236 -31.796 -73.740 1.00 77.99  ? 466 SER A OG  1 
ATOM   3253 N  N   . SER A 1 467 ? -25.750 -34.897 -74.707 1.00 69.06  ? 467 SER A N   1 
ATOM   3254 C  CA  . SER A 1 467 ? -25.255 -36.239 -74.430 1.00 68.81  ? 467 SER A CA  1 
ATOM   3255 C  C   . SER A 1 467 ? -24.918 -36.988 -75.710 1.00 68.48  ? 467 SER A C   1 
ATOM   3256 O  O   . SER A 1 467 ? -23.793 -37.478 -75.854 1.00 68.50  ? 467 SER A O   1 
ATOM   3257 C  CB  . SER A 1 467 ? -26.260 -37.036 -73.608 1.00 68.84  ? 467 SER A CB  1 
ATOM   3258 O  OG  . SER A 1 467 ? -26.551 -36.361 -72.403 1.00 68.85  ? 467 SER A OG  1 
ATOM   3259 N  N   . LEU A 1 468 ? -25.883 -37.091 -76.626 1.00 89.75  ? 468 LEU A N   1 
ATOM   3260 C  CA  . LEU A 1 468 ? -25.654 -37.800 -77.889 1.00 89.43  ? 468 LEU A CA  1 
ATOM   3261 C  C   . LEU A 1 468 ? -24.477 -37.218 -78.647 1.00 89.46  ? 468 LEU A C   1 
ATOM   3262 O  O   . LEU A 1 468 ? -23.567 -37.933 -79.076 1.00 89.43  ? 468 LEU A O   1 
ATOM   3263 C  CB  . LEU A 1 468 ? -26.879 -37.721 -78.788 1.00 89.22  ? 468 LEU A CB  1 
ATOM   3264 C  CG  . LEU A 1 468 ? -27.933 -38.806 -78.616 1.00 89.08  ? 468 LEU A CG  1 
ATOM   3265 C  CD1 . LEU A 1 468 ? -29.063 -38.532 -79.565 1.00 89.00  ? 468 LEU A CD1 1 
ATOM   3266 C  CD2 . LEU A 1 468 ? -27.340 -40.160 -78.919 1.00 89.12  ? 468 LEU A CD2 1 
ATOM   3267 N  N   . LEU A 1 469 ? -24.520 -35.904 -78.805 1.00 70.76  ? 469 LEU A N   1 
ATOM   3268 C  CA  . LEU A 1 469 ? -23.537 -35.144 -79.556 1.00 70.85  ? 469 LEU A CA  1 
ATOM   3269 C  C   . LEU A 1 469 ? -22.142 -35.326 -78.985 1.00 72.13  ? 469 LEU A C   1 
ATOM   3270 O  O   . LEU A 1 469 ? -21.145 -35.217 -79.700 1.00 72.20  ? 469 LEU A O   1 
ATOM   3271 C  CB  . LEU A 1 469 ? -23.892 -33.668 -79.467 1.00 69.93  ? 469 LEU A CB  1 
ATOM   3272 C  CG  . LEU A 1 469 ? -23.943 -32.842 -80.736 1.00 69.17  ? 469 LEU A CG  1 
ATOM   3273 C  CD1 . LEU A 1 469 ? -24.874 -33.493 -81.740 1.00 68.93  ? 469 LEU A CD1 1 
ATOM   3274 C  CD2 . LEU A 1 469 ? -24.441 -31.467 -80.369 1.00 68.92  ? 469 LEU A CD2 1 
ATOM   3275 N  N   . ALA A 1 470 ? -22.073 -35.580 -77.685 1.00 82.53  ? 470 ALA A N   1 
ATOM   3276 C  CA  . ALA A 1 470 ? -20.797 -35.785 -77.026 1.00 83.83  ? 470 ALA A CA  1 
ATOM   3277 C  C   . ALA A 1 470 ? -20.463 -37.269 -76.979 1.00 84.86  ? 470 ALA A C   1 
ATOM   3278 O  O   . ALA A 1 470 ? -19.444 -37.665 -76.415 1.00 84.97  ? 470 ALA A O   1 
ATOM   3279 C  CB  . ALA A 1 470 ? -20.832 -35.212 -75.639 1.00 83.99  ? 470 ALA A CB  1 
ATOM   3280 N  N   . GLY A 1 471 ? -21.337 -38.093 -77.545 1.00 77.90  ? 471 GLY A N   1 
ATOM   3281 C  CA  . GLY A 1 471 ? -21.071 -39.515 -77.642 1.00 78.78  ? 471 GLY A CA  1 
ATOM   3282 C  C   . GLY A 1 471 ? -21.227 -40.217 -76.310 1.00 79.53  ? 471 GLY A C   1 
ATOM   3283 O  O   . GLY A 1 471 ? -20.726 -41.329 -76.120 1.00 79.62  ? 471 GLY A O   1 
ATOM   3284 N  N   . LYS A 1 472 ? -21.939 -39.573 -75.391 1.00 116.40 ? 472 LYS A N   1 
ATOM   3285 C  CA  . LYS A 1 472 ? -22.159 -40.139 -74.071 1.00 116.98 ? 472 LYS A CA  1 
ATOM   3286 C  C   . LYS A 1 472 ? -23.219 -41.226 -74.152 1.00 117.55 ? 472 LYS A C   1 
ATOM   3287 O  O   . LYS A 1 472 ? -23.163 -42.226 -73.437 1.00 117.60 ? 472 LYS A O   1 
ATOM   3288 C  CB  . LYS A 1 472 ? -22.601 -39.053 -73.089 1.00 116.96 ? 472 LYS A CB  1 
ATOM   3289 C  CG  . LYS A 1 472 ? -21.662 -37.855 -73.003 1.00 116.91 ? 472 LYS A CG  1 
ATOM   3290 C  CD  . LYS A 1 472 ? -20.285 -38.215 -72.462 1.00 116.86 ? 472 LYS A CD  1 
ATOM   3291 C  CE  . LYS A 1 472 ? -19.345 -37.016 -72.565 1.00 116.80 ? 472 LYS A CE  1 
ATOM   3292 N  NZ  . LYS A 1 472 ? -17.964 -37.318 -72.090 1.00 116.80 1 472 LYS A NZ  1 
ATOM   3293 N  N   . VAL A 1 473 ? -24.187 -41.024 -75.037 1.00 87.74  ? 473 VAL A N   1 
ATOM   3294 C  CA  . VAL A 1 473 ? -25.291 -41.962 -75.204 1.00 88.33  ? 473 VAL A CA  1 
ATOM   3295 C  C   . VAL A 1 473 ? -25.543 -42.283 -76.671 1.00 89.39  ? 473 VAL A C   1 
ATOM   3296 O  O   . VAL A 1 473 ? -25.002 -41.623 -77.564 1.00 89.41  ? 473 VAL A O   1 
ATOM   3297 C  CB  . VAL A 1 473 ? -26.581 -41.410 -74.598 1.00 87.93  ? 473 VAL A CB  1 
ATOM   3298 C  CG1 . VAL A 1 473 ? -26.409 -41.180 -73.116 1.00 87.79  ? 473 VAL A CG1 1 
ATOM   3299 C  CG2 . VAL A 1 473 ? -26.939 -40.114 -75.286 1.00 87.78  ? 473 VAL A CG2 1 
ATOM   3300 N  N   . GLN A 1 474 ? -26.356 -43.306 -76.913 1.00 118.59 ? 474 GLN A N   1 
ATOM   3301 C  CA  . GLN A 1 474 ? -26.705 -43.712 -78.268 1.00 119.53 ? 474 GLN A CA  1 
ATOM   3302 C  C   . GLN A 1 474 ? -28.192 -43.487 -78.480 1.00 118.93 ? 474 GLN A C   1 
ATOM   3303 O  O   . GLN A 1 474 ? -28.961 -43.484 -77.520 1.00 118.95 ? 474 GLN A O   1 
ATOM   3304 C  CB  . GLN A 1 474 ? -26.364 -45.185 -78.491 1.00 120.67 ? 474 GLN A CB  1 
ATOM   3305 C  CG  . GLN A 1 474 ? -24.917 -45.529 -78.205 1.00 121.46 ? 474 GLN A CG  1 
ATOM   3306 C  CD  . GLN A 1 474 ? -23.952 -44.755 -79.081 1.00 122.02 ? 474 GLN A CD  1 
ATOM   3307 O  OE1 . GLN A 1 474 ? -23.926 -44.922 -80.302 1.00 122.16 ? 474 GLN A OE1 1 
ATOM   3308 N  NE2 . GLN A 1 474 ? -23.150 -43.898 -78.460 1.00 122.38 ? 474 GLN A NE2 1 
ATOM   3309 N  N   . PRO A 1 475 ? -28.610 -43.289 -79.739 1.00 85.44  ? 475 PRO A N   1 
ATOM   3310 C  CA  . PRO A 1 475 ? -30.028 -43.030 -80.007 1.00 85.24  ? 475 PRO A CA  1 
ATOM   3311 C  C   . PRO A 1 475 ? -30.879 -44.224 -79.619 1.00 85.37  ? 475 PRO A C   1 
ATOM   3312 O  O   . PRO A 1 475 ? -32.077 -44.081 -79.375 1.00 85.36  ? 475 PRO A O   1 
ATOM   3313 C  CB  . PRO A 1 475 ? -30.067 -42.835 -81.521 1.00 85.04  ? 475 PRO A CB  1 
ATOM   3314 C  CG  . PRO A 1 475 ? -28.675 -42.472 -81.894 1.00 85.01  ? 475 PRO A CG  1 
ATOM   3315 C  CD  . PRO A 1 475 ? -27.804 -43.248 -80.969 1.00 85.15  ? 475 PRO A CD  1 
ATOM   3316 N  N   . SER A 1 476 ? -30.258 -45.397 -79.578 1.00 110.27 ? 476 SER A N   1 
ATOM   3317 C  CA  . SER A 1 476 ? -30.949 -46.625 -79.227 1.00 110.50 ? 476 SER A CA  1 
ATOM   3318 C  C   . SER A 1 476 ? -30.905 -46.877 -77.729 1.00 110.80 ? 476 SER A C   1 
ATOM   3319 O  O   . SER A 1 476 ? -31.528 -47.818 -77.230 1.00 110.82 ? 476 SER A O   1 
ATOM   3320 C  CB  . SER A 1 476 ? -30.315 -47.803 -79.952 1.00 110.47 ? 476 SER A CB  1 
ATOM   3321 O  OG  . SER A 1 476 ? -28.917 -47.805 -79.713 1.00 110.45 ? 476 SER A OG  1 
ATOM   3322 N  N   . ASP A 1 477 ? -30.163 -46.041 -77.013 1.00 108.28 ? 477 ASP A N   1 
ATOM   3323 C  CA  . ASP A 1 477 ? -30.001 -46.226 -75.579 1.00 108.47 ? 477 ASP A CA  1 
ATOM   3324 C  C   . ASP A 1 477 ? -31.268 -45.892 -74.813 1.00 108.18 ? 477 ASP A C   1 
ATOM   3325 O  O   . ASP A 1 477 ? -32.132 -45.150 -75.295 1.00 108.18 ? 477 ASP A O   1 
ATOM   3326 C  CB  . ASP A 1 477 ? -28.833 -45.403 -75.042 1.00 108.74 ? 477 ASP A CB  1 
ATOM   3327 C  CG  . ASP A 1 477 ? -27.493 -46.062 -75.296 1.00 108.87 ? 477 ASP A CG  1 
ATOM   3328 O  OD1 . ASP A 1 477 ? -26.468 -45.346 -75.316 1.00 108.94 ? 477 ASP A OD1 1 
ATOM   3329 O  OD2 . ASP A 1 477 ? -27.467 -47.302 -75.467 1.00 108.92 1 477 ASP A OD2 1 
ATOM   3330 N  N   . GLN A 1 478 ? -31.362 -46.450 -73.612 1.00 117.16 ? 478 GLN A N   1 
ATOM   3331 C  CA  . GLN A 1 478 ? -32.502 -46.229 -72.745 1.00 116.65 ? 478 GLN A CA  1 
ATOM   3332 C  C   . GLN A 1 478 ? -32.428 -44.859 -72.110 1.00 115.08 ? 478 GLN A C   1 
ATOM   3333 O  O   . GLN A 1 478 ? -31.341 -44.373 -71.794 1.00 114.98 ? 478 GLN A O   1 
ATOM   3334 C  CB  . GLN A 1 478 ? -32.538 -47.288 -71.650 1.00 117.41 ? 478 GLN A CB  1 
ATOM   3335 C  CG  . GLN A 1 478 ? -32.900 -48.666 -72.138 1.00 117.97 ? 478 GLN A CG  1 
ATOM   3336 C  CD  . GLN A 1 478 ? -34.396 -48.834 -72.280 1.00 118.33 ? 478 GLN A CD  1 
ATOM   3337 O  OE1 . GLN A 1 478 ? -35.156 -47.874 -72.135 1.00 118.33 ? 478 GLN A OE1 1 
ATOM   3338 N  NE2 . GLN A 1 478 ? -34.832 -50.059 -72.554 1.00 118.59 ? 478 GLN A NE2 1 
ATOM   3339 N  N   . VAL A 1 479 ? -33.584 -44.232 -71.945 1.00 115.45 ? 479 VAL A N   1 
ATOM   3340 C  CA  . VAL A 1 479 ? -33.652 -42.921 -71.330 1.00 114.02 ? 479 VAL A CA  1 
ATOM   3341 C  C   . VAL A 1 479 ? -33.031 -42.982 -69.939 1.00 113.38 ? 479 VAL A C   1 
ATOM   3342 O  O   . VAL A 1 479 ? -32.271 -42.093 -69.531 1.00 113.30 ? 479 VAL A O   1 
ATOM   3343 C  CB  . VAL A 1 479 ? -35.100 -42.431 -71.255 1.00 113.37 ? 479 VAL A CB  1 
ATOM   3344 C  CG1 . VAL A 1 479 ? -35.282 -41.471 -70.102 1.00 113.08 ? 479 VAL A CG1 1 
ATOM   3345 C  CG2 . VAL A 1 479 ? -35.492 -41.784 -72.557 1.00 113.25 ? 479 VAL A CG2 1 
ATOM   3346 N  N   . GLY A 1 480 ? -33.363 -44.063 -69.235 1.00 153.24 ? 480 GLY A N   1 
ATOM   3347 C  CA  . GLY A 1 480 ? -32.971 -44.269 -67.853 1.00 152.66 ? 480 GLY A CA  1 
ATOM   3348 C  C   . GLY A 1 480 ? -31.479 -44.173 -67.628 1.00 152.09 ? 480 GLY A C   1 
ATOM   3349 O  O   . GLY A 1 480 ? -31.024 -43.870 -66.526 1.00 152.01 ? 480 GLY A O   1 
ATOM   3350 C  CA  . LYS A 1 481 ? -28.724 -42.656 -68.321 1.00 127.08 ? 481 LYS A CA  1 
ATOM   3351 C  C   . LYS A 1 481 ? -28.780 -41.137 -68.412 1.00 121.32 ? 481 LYS A C   1 
ATOM   3352 O  O   . LYS A 1 481 ? -27.977 -40.445 -67.788 1.00 119.72 ? 481 LYS A O   1 
ATOM   3353 C  CB  . LYS A 1 481 ? -28.193 -43.270 -69.615 1.00 126.75 ? 481 LYS A CB  1 
ATOM   3354 C  CG  . LYS A 1 481 ? -28.397 -44.773 -69.688 1.00 128.48 ? 481 LYS A CG  1 
ATOM   3355 C  CD  . LYS A 1 481 ? -27.711 -45.370 -70.903 1.00 131.29 ? 481 LYS A CD  1 
ATOM   3356 C  CE  . LYS A 1 481 ? -28.004 -46.858 -71.007 1.00 132.22 ? 481 LYS A CE  1 
ATOM   3357 N  NZ  . LYS A 1 481 ? -29.469 -47.130 -71.100 1.00 132.68 1 481 LYS A NZ  1 
ATOM   3358 N  N   . VAL A 1 482 ? -29.704 -40.614 -69.211 1.00 91.96  ? 482 VAL A N   1 
ATOM   3359 C  CA  . VAL A 1 482 ? -29.829 -39.166 -69.340 1.00 88.79  ? 482 VAL A CA  1 
ATOM   3360 C  C   . VAL A 1 482 ? -30.811 -38.555 -68.337 1.00 80.95  ? 482 VAL A C   1 
ATOM   3361 O  O   . VAL A 1 482 ? -30.778 -37.347 -68.067 1.00 79.33  ? 482 VAL A O   1 
ATOM   3362 C  CB  . VAL A 1 482 ? -30.194 -38.797 -70.804 1.00 92.83  ? 482 VAL A CB  1 
ATOM   3363 C  CG1 . VAL A 1 482 ? -30.952 -37.483 -70.904 1.00 101.96 ? 482 VAL A CG1 1 
ATOM   3364 C  CG2 . VAL A 1 482 ? -28.933 -38.730 -71.638 1.00 99.99  ? 482 VAL A CG2 1 
ATOM   3365 N  N   . ILE A 1 483 ? -31.622 -39.403 -67.716 1.00 77.56  ? 483 ILE A N   1 
ATOM   3366 C  CA  . ILE A 1 483 ? -32.771 -38.918 -66.953 1.00 71.70  ? 483 ILE A CA  1 
ATOM   3367 C  C   . ILE A 1 483 ? -32.392 -38.084 -65.718 1.00 71.11  ? 483 ILE A C   1 
ATOM   3368 O  O   . ILE A 1 483 ? -31.373 -38.336 -65.071 1.00 69.52  ? 483 ILE A O   1 
ATOM   3369 C  CB  . ILE A 1 483 ? -33.698 -40.075 -66.535 1.00 69.47  ? 483 ILE A CB  1 
ATOM   3370 C  CG1 . ILE A 1 483 ? -35.104 -39.561 -66.248 1.00 66.06  ? 483 ILE A CG1 1 
ATOM   3371 C  CG2 . ILE A 1 483 ? -33.145 -40.785 -65.297 1.00 68.26  ? 483 ILE A CG2 1 
ATOM   3372 C  CD1 . ILE A 1 483 ? -35.996 -40.598 -65.618 1.00 62.72  ? 483 ILE A CD1 1 
ATOM   3373 N  N   . TYR A 1 484 ? -33.200 -37.075 -65.405 1.00 72.59  ? 484 TYR A N   1 
ATOM   3374 C  CA  . TYR A 1 484 ? -33.005 -36.314 -64.183 1.00 74.78  ? 484 TYR A CA  1 
ATOM   3375 C  C   . TYR A 1 484 ? -33.900 -36.918 -63.116 1.00 77.10  ? 484 TYR A C   1 
ATOM   3376 O  O   . TYR A 1 484 ? -35.124 -36.772 -63.174 1.00 78.46  ? 484 TYR A O   1 
ATOM   3377 C  CB  . TYR A 1 484 ? -33.409 -34.860 -64.375 1.00 73.80  ? 484 TYR A CB  1 
ATOM   3378 C  CG  . TYR A 1 484 ? -32.551 -34.084 -65.329 1.00 71.26  ? 484 TYR A CG  1 
ATOM   3379 C  CD1 . TYR A 1 484 ? -31.270 -34.515 -65.660 1.00 70.43  ? 484 TYR A CD1 1 
ATOM   3380 C  CD2 . TYR A 1 484 ? -33.017 -32.901 -65.886 1.00 68.09  ? 484 TYR A CD2 1 
ATOM   3381 C  CE1 . TYR A 1 484 ? -30.481 -33.785 -66.537 1.00 71.01  ? 484 TYR A CE1 1 
ATOM   3382 C  CE2 . TYR A 1 484 ? -32.248 -32.168 -66.755 1.00 68.03  ? 484 TYR A CE2 1 
ATOM   3383 C  CZ  . TYR A 1 484 ? -30.980 -32.610 -67.080 1.00 70.13  ? 484 TYR A CZ  1 
ATOM   3384 O  OH  . TYR A 1 484 ? -30.212 -31.871 -67.948 1.00 71.55  ? 484 TYR A OH  1 
ATOM   3385 N  N   . LYS A 1 485 ? -33.299 -37.551 -62.116 1.00 90.02  ? 485 LYS A N   1 
ATOM   3386 C  CA  . LYS A 1 485 ? -34.068 -38.304 -61.135 1.00 90.61  ? 485 LYS A CA  1 
ATOM   3387 C  C   . LYS A 1 485 ? -34.741 -37.440 -60.076 1.00 89.86  ? 485 LYS A C   1 
ATOM   3388 O  O   . LYS A 1 485 ? -35.823 -37.768 -59.590 1.00 90.61  ? 485 LYS A O   1 
ATOM   3389 C  CB  . LYS A 1 485 ? -33.181 -39.350 -60.461 1.00 91.46  ? 485 LYS A CB  1 
ATOM   3390 C  CG  . LYS A 1 485 ? -32.855 -40.547 -61.331 1.00 92.68  ? 485 LYS A CG  1 
ATOM   3391 C  CD  . LYS A 1 485 ? -34.068 -41.458 -61.430 1.00 94.82  ? 485 LYS A CD  1 
ATOM   3392 C  CE  . LYS A 1 485 ? -33.720 -42.784 -62.086 1.00 96.52  ? 485 LYS A CE  1 
ATOM   3393 N  NZ  . LYS A 1 485 ? -34.918 -43.678 -62.151 1.00 97.59  1 485 LYS A NZ  1 
ATOM   3394 N  N   . GLN A 1 486 ? -34.098 -36.341 -59.716 1.00 81.12  ? 486 GLN A N   1 
ATOM   3395 C  CA  . GLN A 1 486 ? -34.519 -35.586 -58.548 1.00 79.06  ? 486 GLN A CA  1 
ATOM   3396 C  C   . GLN A 1 486 ? -35.501 -34.450 -58.839 1.00 78.77  ? 486 GLN A C   1 
ATOM   3397 O  O   . GLN A 1 486 ? -35.208 -33.523 -59.593 1.00 78.09  ? 486 GLN A O   1 
ATOM   3398 C  CB  . GLN A 1 486 ? -33.295 -35.063 -57.805 1.00 78.39  ? 486 GLN A CB  1 
ATOM   3399 C  CG  . GLN A 1 486 ? -33.621 -34.283 -56.560 1.00 76.68  ? 486 GLN A CG  1 
ATOM   3400 C  CD  . GLN A 1 486 ? -32.373 -33.926 -55.780 1.00 75.97  ? 486 GLN A CD  1 
ATOM   3401 O  OE1 . GLN A 1 486 ? -31.419 -34.712 -55.721 1.00 78.06  ? 486 GLN A OE1 1 
ATOM   3402 N  NE2 . GLN A 1 486 ? -32.360 -32.731 -55.191 1.00 73.74  ? 486 GLN A NE2 1 
ATOM   3403 N  N   . PHE A 1 487 ? -36.670 -34.527 -58.215 1.00 69.66  ? 487 PHE A N   1 
ATOM   3404 C  CA  . PHE A 1 487 ? -37.695 -33.502 -58.366 1.00 71.88  ? 487 PHE A CA  1 
ATOM   3405 C  C   . PHE A 1 487 ? -38.611 -33.466 -57.150 1.00 77.18  ? 487 PHE A C   1 
ATOM   3406 O  O   . PHE A 1 487 ? -38.469 -34.263 -56.219 1.00 74.92  ? 487 PHE A O   1 
ATOM   3407 C  CB  . PHE A 1 487 ? -38.539 -33.770 -59.607 1.00 68.85  ? 487 PHE A CB  1 
ATOM   3408 C  CG  . PHE A 1 487 ? -39.332 -35.037 -59.528 1.00 64.79  ? 487 PHE A CG  1 
ATOM   3409 C  CD1 . PHE A 1 487 ? -38.729 -36.262 -59.787 1.00 61.73  ? 487 PHE A CD1 1 
ATOM   3410 C  CD2 . PHE A 1 487 ? -40.674 -35.010 -59.175 1.00 62.94  ? 487 PHE A CD2 1 
ATOM   3411 C  CE1 . PHE A 1 487 ? -39.452 -37.433 -59.714 1.00 60.13  ? 487 PHE A CE1 1 
ATOM   3412 C  CE2 . PHE A 1 487 ? -41.403 -36.178 -59.099 1.00 62.19  ? 487 PHE A CE2 1 
ATOM   3413 C  CZ  . PHE A 1 487 ? -40.793 -37.391 -59.371 1.00 60.90  ? 487 PHE A CZ  1 
ATOM   3414 N  N   . LYS A 1 488 ? -39.572 -32.551 -57.178 1.00 98.10  ? 488 LYS A N   1 
ATOM   3415 C  CA  . LYS A 1 488 ? -40.503 -32.407 -56.071 1.00 106.61 ? 488 LYS A CA  1 
ATOM   3416 C  C   . LYS A 1 488 ? -41.915 -32.051 -56.524 1.00 105.09 ? 488 LYS A C   1 
ATOM   3417 O  O   . LYS A 1 488 ? -42.114 -31.289 -57.472 1.00 106.74 ? 488 LYS A O   1 
ATOM   3418 C  CB  . LYS A 1 488 ? -40.000 -31.370 -55.072 1.00 112.43 ? 488 LYS A CB  1 
ATOM   3419 C  CG  . LYS A 1 488 ? -40.720 -31.444 -53.743 1.00 125.72 ? 488 LYS A CG  1 
ATOM   3420 C  CD  . LYS A 1 488 ? -40.471 -32.795 -53.092 1.00 137.68 ? 488 LYS A CD  1 
ATOM   3421 C  CE  . LYS A 1 488 ? -41.194 -32.925 -51.761 1.00 140.82 ? 488 LYS A CE  1 
ATOM   3422 N  NZ  . LYS A 1 488 ? -42.676 -32.876 -51.921 1.00 142.21 1 488 LYS A NZ  1 
ATOM   3423 N  N   . GLN A 1 489 ? -42.888 -32.647 -55.842 1.00 93.55  ? 489 GLN A N   1 
ATOM   3424 C  CA  . GLN A 1 489 ? -44.304 -32.478 -56.147 1.00 89.22  ? 489 GLN A CA  1 
ATOM   3425 C  C   . GLN A 1 489 ? -44.924 -31.189 -55.616 1.00 89.75  ? 489 GLN A C   1 
ATOM   3426 O  O   . GLN A 1 489 ? -44.433 -30.597 -54.655 1.00 88.34  ? 489 GLN A O   1 
ATOM   3427 C  CB  . GLN A 1 489 ? -45.079 -33.682 -55.644 1.00 86.57  ? 489 GLN A CB  1 
ATOM   3428 C  CG  . GLN A 1 489 ? -44.304 -34.964 -55.838 1.00 81.45  ? 489 GLN A CG  1 
ATOM   3429 C  CD  . GLN A 1 489 ? -45.066 -35.966 -56.664 1.00 77.80  ? 489 GLN A CD  1 
ATOM   3430 O  OE1 . GLN A 1 489 ? -45.529 -35.652 -57.760 1.00 76.52  ? 489 GLN A OE1 1 
ATOM   3431 N  NE2 . GLN A 1 489 ? -45.206 -37.180 -56.146 1.00 77.46  ? 489 GLN A NE2 1 
ATOM   3432 N  N   . ILE A 1 490 ? -46.011 -30.771 -56.255 1.00 92.12  ? 490 ILE A N   1 
ATOM   3433 C  CA  . ILE A 1 490 ? -46.714 -29.547 -55.899 1.00 97.34  ? 490 ILE A CA  1 
ATOM   3434 C  C   . ILE A 1 490 ? -48.210 -29.680 -56.237 1.00 101.83 ? 490 ILE A C   1 
ATOM   3435 O  O   . ILE A 1 490 ? -48.580 -30.431 -57.139 1.00 99.90  ? 490 ILE A O   1 
ATOM   3436 C  CB  . ILE A 1 490 ? -46.078 -28.337 -56.634 1.00 96.24  ? 490 ILE A CB  1 
ATOM   3437 C  CG1 . ILE A 1 490 ? -44.935 -27.750 -55.812 1.00 98.31  ? 490 ILE A CG1 1 
ATOM   3438 C  CG2 . ILE A 1 490 ? -47.091 -27.239 -56.905 1.00 97.55  ? 490 ILE A CG2 1 
ATOM   3439 C  CD1 . ILE A 1 490 ? -45.407 -27.035 -54.581 1.00 102.19 ? 490 ILE A CD1 1 
ATOM   3440 N  N   . ARG A 1 491 ? -49.069 -28.990 -55.489 1.00 134.79 ? 491 ARG A N   1 
ATOM   3441 C  CA  . ARG A 1 491 ? -50.488 -28.903 -55.822 1.00 136.36 ? 491 ARG A CA  1 
ATOM   3442 C  C   . ARG A 1 491 ? -50.764 -27.510 -56.379 1.00 133.49 ? 491 ARG A C   1 
ATOM   3443 O  O   . ARG A 1 491 ? -50.095 -26.552 -55.987 1.00 136.15 ? 491 ARG A O   1 
ATOM   3444 C  CB  . ARG A 1 491 ? -51.351 -29.143 -54.586 1.00 139.59 ? 491 ARG A CB  1 
ATOM   3445 C  CG  . ARG A 1 491 ? -50.914 -30.324 -53.743 1.00 143.45 ? 491 ARG A CG  1 
ATOM   3446 C  CD  . ARG A 1 491 ? -51.829 -30.503 -52.545 1.00 146.72 ? 491 ARG A CD  1 
ATOM   3447 N  NE  . ARG A 1 491 ? -51.203 -31.313 -51.506 1.00 147.67 ? 491 ARG A NE  1 
ATOM   3448 C  CZ  . ARG A 1 491 ? -50.503 -30.814 -50.494 1.00 148.02 ? 491 ARG A CZ  1 
ATOM   3449 N  NH1 . ARG A 1 491 ? -50.340 -29.501 -50.382 1.00 148.10 1 491 ARG A NH1 1 
ATOM   3450 N  NH2 . ARG A 1 491 ? -49.966 -31.625 -49.592 1.00 148.11 ? 491 ARG A NH2 1 
ATOM   3451 N  N   . LEU A 1 492 ? -51.727 -27.391 -57.293 1.00 117.31 ? 492 LEU A N   1 
ATOM   3452 C  CA  . LEU A 1 492 ? -52.094 -26.083 -57.849 1.00 111.15 ? 492 LEU A CA  1 
ATOM   3453 C  C   . LEU A 1 492 ? -52.427 -25.072 -56.765 1.00 111.97 ? 492 LEU A C   1 
ATOM   3454 O  O   . LEU A 1 492 ? -52.275 -23.861 -56.948 1.00 108.82 ? 492 LEU A O   1 
ATOM   3455 C  CB  . LEU A 1 492 ? -53.300 -26.196 -58.773 1.00 107.02 ? 492 LEU A CB  1 
ATOM   3456 C  CG  . LEU A 1 492 ? -53.077 -26.589 -60.226 1.00 98.81  ? 492 LEU A CG  1 
ATOM   3457 C  CD1 . LEU A 1 492 ? -53.105 -28.097 -60.392 1.00 93.31  ? 492 LEU A CD1 1 
ATOM   3458 C  CD2 . LEU A 1 492 ? -54.141 -25.926 -61.082 1.00 90.76  ? 492 LEU A CD2 1 
ATOM   3459 N  N   . THR A 1 493 ? -52.889 -25.591 -55.637 1.00 137.23 ? 493 THR A N   1 
ATOM   3460 C  CA  . THR A 1 493 ? -53.329 -24.779 -54.521 1.00 140.47 ? 493 THR A CA  1 
ATOM   3461 C  C   . THR A 1 493 ? -52.181 -24.478 -53.579 1.00 141.86 ? 493 THR A C   1 
ATOM   3462 O  O   . THR A 1 493 ? -52.406 -24.007 -52.482 1.00 144.44 ? 493 THR A O   1 
ATOM   3463 C  CB  . THR A 1 493 ? -54.439 -25.465 -53.728 1.00 140.45 ? 493 THR A CB  1 
ATOM   3464 O  OG1 . THR A 1 493 ? -53.953 -26.709 -53.211 1.00 139.38 ? 493 THR A OG1 1 
ATOM   3465 C  CG2 . THR A 1 493 ? -55.636 -25.721 -54.621 1.00 139.36 ? 493 THR A CG2 1 
ATOM   3466 N  N   . ASP A 1 494 ? -50.963 -24.857 -53.941 1.00 117.77 ? 494 ASP A N   1 
ATOM   3467 C  CA  . ASP A 1 494 ? -49.810 -24.471 -53.128 1.00 117.07 ? 494 ASP A CA  1 
ATOM   3468 C  C   . ASP A 1 494 ? -49.430 -23.010 -53.299 1.00 111.66 ? 494 ASP A C   1 
ATOM   3469 O  O   . ASP A 1 494 ? -49.791 -22.370 -54.286 1.00 111.94 ? 494 ASP A O   1 
ATOM   3470 C  CB  . ASP A 1 494 ? -48.614 -25.358 -53.431 1.00 121.35 ? 494 ASP A CB  1 
ATOM   3471 C  CG  . ASP A 1 494 ? -48.771 -26.737 -52.852 1.00 131.79 ? 494 ASP A CG  1 
ATOM   3472 O  OD1 . ASP A 1 494 ? -49.576 -26.891 -51.906 1.00 141.17 ? 494 ASP A OD1 1 
ATOM   3473 O  OD2 . ASP A 1 494 ? -48.102 -27.667 -53.342 1.00 141.18 1 494 ASP A OD2 1 
ATOM   3474 N  N   . THR A 1 495 ? -48.704 -22.488 -52.320 1.00 108.59 ? 495 THR A N   1 
ATOM   3475 C  CA  . THR A 1 495 ? -48.255 -21.105 -52.349 1.00 102.15 ? 495 THR A CA  1 
ATOM   3476 C  C   . THR A 1 495 ? -46.898 -20.953 -53.035 1.00 97.36  ? 495 THR A C   1 
ATOM   3477 O  O   . THR A 1 495 ? -46.045 -21.839 -52.940 1.00 96.29  ? 495 THR A O   1 
ATOM   3478 C  CB  . THR A 1 495 ? -48.175 -20.513 -50.940 1.00 102.38 ? 495 THR A CB  1 
ATOM   3479 O  OG1 . THR A 1 495 ? -47.572 -19.214 -51.004 1.00 103.40 ? 495 THR A OG1 1 
ATOM   3480 C  CG2 . THR A 1 495 ? -47.334 -21.407 -50.049 1.00 103.41 ? 495 THR A CG2 1 
ATOM   3481 N  N   . LEU A 1 496 ? -46.716 -19.844 -53.748 1.00 103.61 ? 496 LEU A N   1 
ATOM   3482 C  CA  . LEU A 1 496 ? -45.462 -19.566 -54.449 1.00 100.93 ? 496 LEU A CA  1 
ATOM   3483 C  C   . LEU A 1 496 ? -44.224 -19.555 -53.549 1.00 98.73  ? 496 LEU A C   1 
ATOM   3484 O  O   . LEU A 1 496 ? -43.115 -19.836 -54.011 1.00 96.84  ? 496 LEU A O   1 
ATOM   3485 C  CB  . LEU A 1 496 ? -45.546 -18.232 -55.191 1.00 101.60 ? 496 LEU A CB  1 
ATOM   3486 C  CG  . LEU A 1 496 ? -46.493 -18.184 -56.388 1.00 106.60 ? 496 LEU A CG  1 
ATOM   3487 C  CD1 . LEU A 1 496 ? -46.286 -16.895 -57.171 1.00 111.33 ? 496 LEU A CD1 1 
ATOM   3488 C  CD2 . LEU A 1 496 ? -46.298 -19.402 -57.282 1.00 111.32 ? 496 LEU A CD2 1 
ATOM   3489 N  N   . GLY A 1 497 ? -44.403 -19.208 -52.279 1.00 101.95 ? 497 GLY A N   1 
ATOM   3490 C  CA  . GLY A 1 497 ? -43.282 -19.173 -51.360 1.00 100.28 ? 497 GLY A CA  1 
ATOM   3491 C  C   . GLY A 1 497 ? -42.726 -20.569 -51.174 1.00 98.78  ? 497 GLY A C   1 
ATOM   3492 O  O   . GLY A 1 497 ? -41.510 -20.798 -51.274 1.00 98.84  ? 497 GLY A O   1 
ATOM   3493 N  N   . ARG A 1 498 ? -43.631 -21.505 -50.911 1.00 91.82  ? 498 ARG A N   1 
ATOM   3494 C  CA  . ARG A 1 498 ? -43.284 -22.913 -50.795 1.00 89.90  ? 498 ARG A CA  1 
ATOM   3495 C  C   . ARG A 1 498 ? -42.488 -23.339 -52.025 1.00 89.36  ? 498 ARG A C   1 
ATOM   3496 O  O   . ARG A 1 498 ? -41.482 -24.065 -51.925 1.00 88.58  ? 498 ARG A O   1 
ATOM   3497 C  CB  . ARG A 1 498 ? -44.558 -23.738 -50.660 1.00 89.29  ? 498 ARG A CB  1 
ATOM   3498 C  CG  . ARG A 1 498 ? -44.363 -25.237 -50.639 1.00 89.48  ? 498 ARG A CG  1 
ATOM   3499 C  CD  . ARG A 1 498 ? -44.037 -25.772 -49.263 1.00 92.70  ? 498 ARG A CD  1 
ATOM   3500 N  NE  . ARG A 1 498 ? -43.681 -27.188 -49.335 1.00 97.31  ? 498 ARG A NE  1 
ATOM   3501 C  CZ  . ARG A 1 498 ? -42.452 -27.668 -49.171 1.00 99.54  ? 498 ARG A CZ  1 
ATOM   3502 N  NH1 . ARG A 1 498 ? -41.439 -26.842 -48.921 1.00 100.89 1 498 ARG A NH1 1 
ATOM   3503 N  NH2 . ARG A 1 498 ? -42.233 -28.976 -49.259 1.00 100.01 ? 498 ARG A NH2 1 
ATOM   3504 N  N   . LEU A 1 499 ? -42.934 -22.862 -53.181 1.00 77.53  ? 499 LEU A N   1 
ATOM   3505 C  CA  . LEU A 1 499 ? -42.217 -23.091 -54.419 1.00 78.86  ? 499 LEU A CA  1 
ATOM   3506 C  C   . LEU A 1 499 ? -40.795 -22.554 -54.292 1.00 79.19  ? 499 LEU A C   1 
ATOM   3507 O  O   . LEU A 1 499 ? -39.851 -23.239 -54.649 1.00 77.71  ? 499 LEU A O   1 
ATOM   3508 C  CB  . LEU A 1 499 ? -42.932 -22.436 -55.598 1.00 79.60  ? 499 LEU A CB  1 
ATOM   3509 C  CG  . LEU A 1 499 ? -42.239 -22.541 -56.954 1.00 83.19  ? 499 LEU A CG  1 
ATOM   3510 C  CD1 . LEU A 1 499 ? -42.223 -23.985 -57.424 1.00 86.47  ? 499 LEU A CD1 1 
ATOM   3511 C  CD2 . LEU A 1 499 ? -42.935 -21.654 -57.962 1.00 88.09  ? 499 LEU A CD2 1 
ATOM   3512 N  N   . SER A 1 500 ? -40.639 -21.343 -53.762 1.00 101.89 ? 500 SER A N   1 
ATOM   3513 C  CA  . SER A 1 500 ? -39.304 -20.772 -53.596 1.00 104.38 ? 500 SER A CA  1 
ATOM   3514 C  C   . SER A 1 500 ? -38.410 -21.654 -52.745 1.00 104.91 ? 500 SER A C   1 
ATOM   3515 O  O   . SER A 1 500 ? -37.246 -21.865 -53.081 1.00 105.38 ? 500 SER A O   1 
ATOM   3516 C  CB  . SER A 1 500 ? -39.365 -19.376 -52.986 1.00 105.08 ? 500 SER A CB  1 
ATOM   3517 O  OG  . SER A 1 500 ? -40.035 -18.486 -53.853 1.00 108.25 ? 500 SER A OG  1 
ATOM   3518 N  N   . HIS A 1 501 ? -38.948 -22.168 -51.645 1.00 102.96 ? 501 HIS A N   1 
ATOM   3519 C  CA  . HIS A 1 501 ? -38.169 -23.065 -50.798 1.00 104.10 ? 501 HIS A CA  1 
ATOM   3520 C  C   . HIS A 1 501 ? -37.735 -24.312 -51.552 1.00 100.41 ? 501 HIS A C   1 
ATOM   3521 O  O   . HIS A 1 501 ? -36.540 -24.675 -51.576 1.00 99.05  ? 501 HIS A O   1 
ATOM   3522 C  CB  . HIS A 1 501 ? -38.963 -23.471 -49.566 1.00 108.34 ? 501 HIS A CB  1 
ATOM   3523 C  CG  . HIS A 1 501 ? -39.165 -22.354 -48.594 1.00 121.46 ? 501 HIS A CG  1 
ATOM   3524 N  ND1 . HIS A 1 501 ? -38.420 -21.200 -48.626 1.00 131.20 ? 501 HIS A ND1 1 
ATOM   3525 C  CD2 . HIS A 1 501 ? -40.014 -22.228 -47.546 1.00 131.19 ? 501 HIS A CD2 1 
ATOM   3526 C  CE1 . HIS A 1 501 ? -38.810 -20.398 -47.650 1.00 134.10 ? 501 HIS A CE1 1 
ATOM   3527 N  NE2 . HIS A 1 501 ? -39.773 -21.002 -46.980 1.00 134.11 ? 501 HIS A NE2 1 
ATOM   3528 N  N   . ILE A 1 502 ? -38.710 -24.974 -52.164 1.00 89.17  ? 502 ILE A N   1 
ATOM   3529 C  CA  . ILE A 1 502 ? -38.423 -26.188 -52.912 1.00 87.82  ? 502 ILE A CA  1 
ATOM   3530 C  C   . ILE A 1 502 ? -37.329 -25.914 -53.934 1.00 86.44  ? 502 ILE A C   1 
ATOM   3531 O  O   . ILE A 1 502 ? -36.438 -26.740 -54.146 1.00 84.92  ? 502 ILE A O   1 
ATOM   3532 C  CB  . ILE A 1 502 ? -39.664 -26.716 -53.630 1.00 88.10  ? 502 ILE A CB  1 
ATOM   3533 C  CG1 . ILE A 1 502 ? -40.767 -27.005 -52.626 1.00 90.89  ? 502 ILE A CG1 1 
ATOM   3534 C  CG2 . ILE A 1 502 ? -39.340 -27.983 -54.380 1.00 88.38  ? 502 ILE A CG2 1 
ATOM   3535 C  CD1 . ILE A 1 502 ? -42.005 -27.538 -53.274 1.00 95.70  ? 502 ILE A CD1 1 
ATOM   3536 N  N   . LEU A 1 503 ? -37.399 -24.737 -54.547 1.00 82.52  ? 503 LEU A N   1 
ATOM   3537 C  CA  . LEU A 1 503 ? -36.425 -24.320 -55.543 1.00 81.93  ? 503 LEU A CA  1 
ATOM   3538 C  C   . LEU A 1 503 ? -35.081 -23.990 -54.927 1.00 84.13  ? 503 LEU A C   1 
ATOM   3539 O  O   . LEU A 1 503 ? -34.061 -23.986 -55.620 1.00 85.46  ? 503 LEU A O   1 
ATOM   3540 C  CB  . LEU A 1 503 ? -36.937 -23.119 -56.323 1.00 79.92  ? 503 LEU A CB  1 
ATOM   3541 C  CG  . LEU A 1 503 ? -38.152 -23.483 -57.163 1.00 71.02  ? 503 LEU A CG  1 
ATOM   3542 C  CD1 . LEU A 1 503 ? -38.574 -22.303 -57.999 1.00 60.67  ? 503 LEU A CD1 1 
ATOM   3543 C  CD2 . LEU A 1 503 ? -37.853 -24.697 -58.023 1.00 61.08  ? 503 LEU A CD2 1 
ATOM   3544 N  N   . GLU A 1 504 ? -35.071 -23.693 -53.634 1.00 76.45  ? 504 GLU A N   1 
ATOM   3545 C  CA  . GLU A 1 504 ? -33.804 -23.573 -52.937 1.00 78.35  ? 504 GLU A CA  1 
ATOM   3546 C  C   . GLU A 1 504 ? -33.218 -24.958 -52.800 1.00 76.49  ? 504 GLU A C   1 
ATOM   3547 O  O   . GLU A 1 504 ? -32.000 -25.115 -52.780 1.00 74.41  ? 504 GLU A O   1 
ATOM   3548 C  CB  . GLU A 1 504 ? -33.950 -22.933 -51.556 1.00 80.67  ? 504 GLU A CB  1 
ATOM   3549 C  CG  . GLU A 1 504 ? -34.253 -21.450 -51.574 1.00 93.60  ? 504 GLU A CG  1 
ATOM   3550 C  CD  . GLU A 1 504 ? -34.202 -20.838 -50.180 1.00 106.82 ? 504 GLU A CD  1 
ATOM   3551 O  OE1 . GLU A 1 504 ? -34.062 -21.601 -49.195 1.00 110.84 ? 504 GLU A OE1 1 
ATOM   3552 O  OE2 . GLU A 1 504 ? -34.295 -19.597 -50.068 1.00 110.81 1 504 GLU A OE2 1 
ATOM   3553 N  N   . MET A 1 505 ? -34.069 -25.964 -52.626 1.00 80.33  ? 505 MET A N   1 
ATOM   3554 C  CA  . MET A 1 505 ? -33.539 -27.333 -52.618 1.00 81.40  ? 505 MET A CA  1 
ATOM   3555 C  C   . MET A 1 505 ? -33.553 -28.154 -53.920 1.00 80.50  ? 505 MET A C   1 
ATOM   3556 O  O   . MET A 1 505 ? -32.889 -29.191 -53.994 1.00 80.52  ? 505 MET A O   1 
ATOM   3557 C  CB  . MET A 1 505 ? -34.175 -28.148 -51.491 1.00 83.17  ? 505 MET A CB  1 
ATOM   3558 C  CG  . MET A 1 505 ? -33.555 -27.930 -50.126 1.00 87.01  ? 505 MET A CG  1 
ATOM   3559 S  SD  . MET A 1 505 ? -31.851 -28.489 -50.022 1.00 89.90  ? 505 MET A SD  1 
ATOM   3560 C  CE  . MET A 1 505 ? -31.673 -28.589 -48.243 1.00 90.57  ? 505 MET A CE  1 
ATOM   3561 N  N   . ASP A 1 506 ? -34.263 -27.692 -54.948 1.00 84.10  ? 506 ASP A N   1 
ATOM   3562 C  CA  . ASP A 1 506 ? -34.501 -28.531 -56.134 1.00 83.49  ? 506 ASP A CA  1 
ATOM   3563 C  C   . ASP A 1 506 ? -34.662 -27.748 -57.427 1.00 81.95  ? 506 ASP A C   1 
ATOM   3564 O  O   . ASP A 1 506 ? -35.075 -26.589 -57.415 1.00 79.94  ? 506 ASP A O   1 
ATOM   3565 C  CB  . ASP A 1 506 ? -35.742 -29.406 -55.931 1.00 84.65  ? 506 ASP A CB  1 
ATOM   3566 C  CG  . ASP A 1 506 ? -35.438 -30.697 -55.202 1.00 90.37  ? 506 ASP A CG  1 
ATOM   3567 O  OD1 . ASP A 1 506 ? -34.451 -31.368 -55.577 1.00 95.19  ? 506 ASP A OD1 1 
ATOM   3568 O  OD2 . ASP A 1 506 ? -36.186 -31.037 -54.257 1.00 96.40  1 506 ASP A OD2 1 
ATOM   3569 N  N   . HIS A 1 507 ? -34.313 -28.372 -58.545 1.00 78.44  ? 507 HIS A N   1 
ATOM   3570 C  CA  . HIS A 1 507 ? -34.531 -27.731 -59.831 1.00 79.55  ? 507 HIS A CA  1 
ATOM   3571 C  C   . HIS A 1 507 ? -35.954 -27.859 -60.379 1.00 81.54  ? 507 HIS A C   1 
ATOM   3572 O  O   . HIS A 1 507 ? -36.503 -26.895 -60.921 1.00 80.95  ? 507 HIS A O   1 
ATOM   3573 C  CB  . HIS A 1 507 ? -33.524 -28.200 -60.874 1.00 79.58  ? 507 HIS A CB  1 
ATOM   3574 C  CG  . HIS A 1 507 ? -33.591 -27.426 -62.150 1.00 74.62  ? 507 HIS A CG  1 
ATOM   3575 N  ND1 . HIS A 1 507 ? -34.046 -27.965 -63.332 1.00 69.84  ? 507 HIS A ND1 1 
ATOM   3576 C  CD2 . HIS A 1 507 ? -33.297 -26.130 -62.425 1.00 69.71  ? 507 HIS A CD2 1 
ATOM   3577 C  CE1 . HIS A 1 507 ? -34.011 -27.049 -64.279 1.00 67.27  ? 507 HIS A CE1 1 
ATOM   3578 N  NE2 . HIS A 1 507 ? -33.559 -25.925 -63.750 1.00 67.26  ? 507 HIS A NE2 1 
ATOM   3579 N  N   . PHE A 1 508 ? -36.540 -29.050 -60.253 1.00 93.15  ? 508 PHE A N   1 
ATOM   3580 C  CA  . PHE A 1 508 ? -37.860 -29.306 -60.827 1.00 95.43  ? 508 PHE A CA  1 
ATOM   3581 C  C   . PHE A 1 508 ? -38.977 -29.441 -59.810 1.00 93.25  ? 508 PHE A C   1 
ATOM   3582 O  O   . PHE A 1 508 ? -38.859 -30.170 -58.823 1.00 93.26  ? 508 PHE A O   1 
ATOM   3583 C  CB  . PHE A 1 508 ? -37.842 -30.564 -61.685 1.00 100.43 ? 508 PHE A CB  1 
ATOM   3584 C  CG  . PHE A 1 508 ? -37.023 -30.431 -62.913 1.00 105.01 ? 508 PHE A CG  1 
ATOM   3585 C  CD1 . PHE A 1 508 ? -37.447 -29.618 -63.953 1.00 102.93 ? 508 PHE A CD1 1 
ATOM   3586 C  CD2 . PHE A 1 508 ? -35.833 -31.119 -63.044 1.00 102.94 ? 508 PHE A CD2 1 
ATOM   3587 C  CE1 . PHE A 1 508 ? -36.691 -29.487 -65.101 1.00 100.97 ? 508 PHE A CE1 1 
ATOM   3588 C  CE2 . PHE A 1 508 ? -35.073 -30.993 -64.188 1.00 101.09 ? 508 PHE A CE2 1 
ATOM   3589 C  CZ  . PHE A 1 508 ? -35.503 -30.177 -65.218 1.00 100.31 ? 508 PHE A CZ  1 
ATOM   3590 N  N   . ALA A 1 509 ? -40.079 -28.752 -60.082 1.00 81.15  ? 509 ALA A N   1 
ATOM   3591 C  CA  . ALA A 1 509 ? -41.294 -28.913 -59.302 1.00 78.60  ? 509 ALA A CA  1 
ATOM   3592 C  C   . ALA A 1 509 ? -42.441 -29.323 -60.216 1.00 78.20  ? 509 ALA A C   1 
ATOM   3593 O  O   . ALA A 1 509 ? -42.818 -28.577 -61.120 1.00 76.91  ? 509 ALA A O   1 
ATOM   3594 C  CB  . ALA A 1 509 ? -41.632 -27.622 -58.588 1.00 76.73  ? 509 ALA A CB  1 
ATOM   3595 N  N   . LEU A 1 510 ? -42.986 -30.516 -59.988 1.00 74.64  ? 510 LEU A N   1 
ATOM   3596 C  CA  . LEU A 1 510 ? -44.108 -31.021 -60.783 1.00 77.60  ? 510 LEU A CA  1 
ATOM   3597 C  C   . LEU A 1 510 ? -45.420 -30.835 -60.059 1.00 79.95  ? 510 LEU A C   1 
ATOM   3598 O  O   . LEU A 1 510 ? -45.575 -31.292 -58.923 1.00 78.59  ? 510 LEU A O   1 
ATOM   3599 C  CB  . LEU A 1 510 ? -43.956 -32.503 -61.095 1.00 80.80  ? 510 LEU A CB  1 
ATOM   3600 C  CG  . LEU A 1 510 ? -42.600 -32.955 -61.596 1.00 76.90  ? 510 LEU A CG  1 
ATOM   3601 C  CD1 . LEU A 1 510 ? -42.735 -34.374 -62.100 1.00 69.81  ? 510 LEU A CD1 1 
ATOM   3602 C  CD2 . LEU A 1 510 ? -42.154 -32.027 -62.694 1.00 69.81  ? 510 LEU A CD2 1 
ATOM   3603 N  N   . VAL A 1 511 ? -46.378 -30.182 -60.701 1.00 80.12  ? 511 VAL A N   1 
ATOM   3604 C  CA  . VAL A 1 511 ? -47.673 -30.025 -60.056 1.00 82.72  ? 511 VAL A CA  1 
ATOM   3605 C  C   . VAL A 1 511 ? -48.537 -31.290 -60.179 1.00 85.69  ? 511 VAL A C   1 
ATOM   3606 O  O   . VAL A 1 511 ? -48.749 -31.785 -61.285 1.00 85.92  ? 511 VAL A O   1 
ATOM   3607 C  CB  . VAL A 1 511 ? -48.414 -28.836 -60.636 1.00 82.53  ? 511 VAL A CB  1 
ATOM   3608 C  CG1 . VAL A 1 511 ? -49.583 -28.487 -59.746 1.00 82.49  ? 511 VAL A CG1 1 
ATOM   3609 C  CG2 . VAL A 1 511 ? -47.467 -27.657 -60.745 1.00 82.42  ? 511 VAL A CG2 1 
ATOM   3610 N  N   . VAL A 1 512 ? -48.994 -31.836 -59.046 1.00 140.25 ? 512 VAL A N   1 
ATOM   3611 C  CA  . VAL A 1 512 ? -49.722 -33.115 -59.040 1.00 143.40 ? 512 VAL A CA  1 
ATOM   3612 C  C   . VAL A 1 512 ? -50.914 -33.240 -58.082 1.00 146.99 ? 512 VAL A C   1 
ATOM   3613 O  O   . VAL A 1 512 ? -51.108 -32.414 -57.187 1.00 147.26 ? 512 VAL A O   1 
ATOM   3614 C  CB  . VAL A 1 512 ? -48.794 -34.284 -58.694 1.00 143.10 ? 512 VAL A CB  1 
ATOM   3615 C  CG1 . VAL A 1 512 ? -47.702 -34.438 -59.738 1.00 143.01 ? 512 VAL A CG1 1 
ATOM   3616 C  CG2 . VAL A 1 512 ? -48.215 -34.079 -57.307 1.00 142.91 ? 512 VAL A CG2 1 
ATOM   3617 N  N   . HIS A 1 513 ? -51.705 -34.290 -58.303 1.00 184.99 ? 513 HIS A N   1 
ATOM   3618 C  CA  . HIS A 1 513 ? -52.803 -34.690 -57.421 1.00 188.67 ? 513 HIS A CA  1 
ATOM   3619 C  C   . HIS A 1 513 ? -52.431 -35.946 -56.597 1.00 189.48 ? 513 HIS A C   1 
ATOM   3620 O  O   . HIS A 1 513 ? -51.363 -36.526 -56.796 1.00 189.62 ? 513 HIS A O   1 
ATOM   3621 C  CB  . HIS A 1 513 ? -54.052 -34.931 -58.286 1.00 190.66 ? 513 HIS A CB  1 
ATOM   3622 C  CG  . HIS A 1 513 ? -55.134 -35.712 -57.609 1.00 192.65 ? 513 HIS A CG  1 
ATOM   3623 N  ND1 . HIS A 1 513 ? -55.863 -35.221 -56.548 1.00 193.46 ? 513 HIS A ND1 1 
ATOM   3624 C  CD2 . HIS A 1 513 ? -55.593 -36.968 -57.829 1.00 193.63 ? 513 HIS A CD2 1 
ATOM   3625 C  CE1 . HIS A 1 513 ? -56.730 -36.135 -56.148 1.00 194.05 ? 513 HIS A CE1 1 
ATOM   3626 N  NE2 . HIS A 1 513 ? -56.585 -37.204 -56.911 1.00 194.09 ? 513 HIS A NE2 1 
ATOM   3627 N  N   . GLU A 1 514 ? -53.313 -36.376 -55.696 1.00 201.40 ? 514 GLU A N   1 
ATOM   3628 C  CA  . GLU A 1 514 ? -53.129 -37.621 -54.959 1.00 201.75 ? 514 GLU A CA  1 
ATOM   3629 C  C   . GLU A 1 514 ? -54.072 -38.698 -55.486 1.00 201.83 ? 514 GLU A C   1 
ATOM   3630 O  O   . GLU A 1 514 ? -53.941 -39.146 -56.626 1.00 201.79 ? 514 GLU A O   1 
ATOM   3631 C  CB  . GLU A 1 514 ? -53.378 -37.400 -53.466 1.00 201.87 ? 514 GLU A CB  1 
ATOM   3632 N  N   . GLN A 1 518 ? -50.640 -38.983 -58.822 1.00 148.28 ? 528 GLN A N   1 
ATOM   3633 C  CA  . GLN A 1 518 ? -50.846 -39.810 -60.006 1.00 148.49 ? 528 GLN A CA  1 
ATOM   3634 C  C   . GLN A 1 518 ? -50.412 -39.111 -61.298 1.00 151.08 ? 528 GLN A C   1 
ATOM   3635 O  O   . GLN A 1 518 ? -49.541 -39.601 -62.018 1.00 151.25 ? 528 GLN A O   1 
ATOM   3636 C  CB  . GLN A 1 518 ? -52.318 -40.230 -60.111 1.00 146.78 ? 528 GLN A CB  1 
ATOM   3637 C  CG  . GLN A 1 518 ? -53.314 -39.101 -59.842 1.00 145.47 ? 528 GLN A CG  1 
ATOM   3638 C  CD  . GLN A 1 518 ? -54.677 -39.367 -60.446 1.00 144.57 ? 528 GLN A CD  1 
ATOM   3639 O  OE1 . GLN A 1 518 ? -55.393 -40.272 -60.016 1.00 144.36 ? 528 GLN A OE1 1 
ATOM   3640 N  NE2 . GLN A 1 518 ? -55.041 -38.581 -61.456 1.00 143.95 ? 528 GLN A NE2 1 
ATOM   3641 N  N   . MET A 1 519 ? -51.024 -37.959 -61.569 1.00 160.26 ? 529 MET A N   1 
ATOM   3642 C  CA  . MET A 1 519 ? -50.888 -37.235 -62.835 1.00 162.60 ? 529 MET A CA  1 
ATOM   3643 C  C   . MET A 1 519 ? -50.254 -35.847 -62.684 1.00 160.71 ? 529 MET A C   1 
ATOM   3644 O  O   . MET A 1 519 ? -50.495 -35.159 -61.689 1.00 160.73 ? 529 MET A O   1 
ATOM   3645 C  CB  . MET A 1 519 ? -52.251 -37.129 -63.513 1.00 165.56 ? 529 MET A CB  1 
ATOM   3646 C  CG  . MET A 1 519 ? -52.216 -36.543 -64.909 1.00 167.34 ? 529 MET A CG  1 
ATOM   3647 S  SD  . MET A 1 519 ? -53.822 -36.685 -65.713 1.00 169.04 ? 529 MET A SD  1 
ATOM   3648 C  CE  . MET A 1 519 ? -53.534 -35.736 -67.202 1.00 170.02 ? 529 MET A CE  1 
ATOM   3649 N  N   . VAL A 1 520 ? -49.470 -35.430 -63.679 1.00 129.24 ? 530 VAL A N   1 
ATOM   3650 C  CA  . VAL A 1 520 ? -48.758 -34.147 -63.621 1.00 126.86 ? 530 VAL A CA  1 
ATOM   3651 C  C   . VAL A 1 520 ? -49.420 -33.024 -64.407 1.00 124.17 ? 530 VAL A C   1 
ATOM   3652 O  O   . VAL A 1 520 ? -49.640 -33.132 -65.615 1.00 123.98 ? 530 VAL A O   1 
ATOM   3653 C  CB  . VAL A 1 520 ? -47.334 -34.281 -64.182 1.00 127.05 ? 530 VAL A CB  1 
ATOM   3654 C  CG1 . VAL A 1 520 ? -46.725 -32.905 -64.421 1.00 127.09 ? 530 VAL A CG1 1 
ATOM   3655 C  CG2 . VAL A 1 520 ? -46.474 -35.076 -63.239 1.00 127.17 ? 530 VAL A CG2 1 
ATOM   3656 N  N   . PHE A 1 521 ? -49.738 -31.946 -63.695 1.00 95.27  ? 531 PHE A N   1 
ATOM   3657 C  CA  . PHE A 1 521 ? -50.388 -30.785 -64.284 1.00 92.84  ? 531 PHE A CA  1 
ATOM   3658 C  C   . PHE A 1 521 ? -49.434 -29.744 -64.871 1.00 90.42  ? 531 PHE A C   1 
ATOM   3659 O  O   . PHE A 1 521 ? -49.870 -28.856 -65.601 1.00 90.24  ? 531 PHE A O   1 
ATOM   3660 C  CB  . PHE A 1 521 ? -51.268 -30.116 -63.234 1.00 92.84  ? 531 PHE A CB  1 
ATOM   3661 C  CG  . PHE A 1 521 ? -52.410 -30.965 -62.784 1.00 92.90  ? 531 PHE A CG  1 
ATOM   3662 C  CD1 . PHE A 1 521 ? -53.539 -31.104 -63.568 1.00 92.86  ? 531 PHE A CD1 1 
ATOM   3663 C  CD2 . PHE A 1 521 ? -52.343 -31.647 -61.580 1.00 92.91  ? 531 PHE A CD2 1 
ATOM   3664 C  CE1 . PHE A 1 521 ? -54.591 -31.897 -63.153 1.00 92.87  ? 531 PHE A CE1 1 
ATOM   3665 C  CE2 . PHE A 1 521 ? -53.391 -32.440 -61.160 1.00 92.95  ? 531 PHE A CE2 1 
ATOM   3666 C  CZ  . PHE A 1 521 ? -54.518 -32.565 -61.949 1.00 92.90  ? 531 PHE A CZ  1 
ATOM   3667 N  N   . GLY A 1 522 ? -48.150 -29.826 -64.541 1.00 151.93 ? 532 GLY A N   1 
ATOM   3668 C  CA  . GLY A 1 522 ? -47.195 -28.858 -65.056 1.00 149.68 ? 532 GLY A CA  1 
ATOM   3669 C  C   . GLY A 1 522 ? -45.790 -28.997 -64.503 1.00 147.55 ? 532 GLY A C   1 
ATOM   3670 O  O   . GLY A 1 522 ? -45.562 -29.723 -63.526 1.00 147.40 ? 532 GLY A O   1 
ATOM   3671 N  N   . VAL A 1 523 ? -44.857 -28.255 -65.103 1.00 97.37  ? 533 VAL A N   1 
ATOM   3672 C  CA  . VAL A 1 523 ? -43.442 -28.315 -64.726 1.00 92.35  ? 533 VAL A CA  1 
ATOM   3673 C  C   . VAL A 1 523 ? -42.851 -26.935 -64.455 1.00 92.89  ? 533 VAL A C   1 
ATOM   3674 O  O   . VAL A 1 523 ? -42.883 -26.053 -65.317 1.00 92.29  ? 533 VAL A O   1 
ATOM   3675 C  CB  . VAL A 1 523 ? -42.607 -28.944 -65.850 1.00 90.92  ? 533 VAL A CB  1 
ATOM   3676 C  CG1 . VAL A 1 523 ? -41.141 -28.941 -65.475 1.00 85.06  ? 533 VAL A CG1 1 
ATOM   3677 C  CG2 . VAL A 1 523 ? -43.078 -30.350 -66.123 1.00 84.68  ? 533 VAL A CG2 1 
ATOM   3678 N  N   . VAL A 1 524 ? -42.283 -26.758 -63.267 1.00 96.07  ? 534 VAL A N   1 
ATOM   3679 C  CA  . VAL A 1 524 ? -41.807 -25.448 -62.843 1.00 95.64  ? 534 VAL A CA  1 
ATOM   3680 C  C   . VAL A 1 524 ? -40.369 -25.429 -62.358 1.00 94.48  ? 534 VAL A C   1 
ATOM   3681 O  O   . VAL A 1 524 ? -39.946 -26.286 -61.575 1.00 95.17  ? 534 VAL A O   1 
ATOM   3682 C  CB  . VAL A 1 524 ? -42.655 -24.884 -61.702 1.00 95.97  ? 534 VAL A CB  1 
ATOM   3683 C  CG1 . VAL A 1 524 ? -42.526 -23.377 -61.659 1.00 96.68  ? 534 VAL A CG1 1 
ATOM   3684 C  CG2 . VAL A 1 524 ? -44.101 -25.286 -61.871 1.00 96.12  ? 534 VAL A CG2 1 
ATOM   3685 N  N   . THR A 1 525 ? -39.627 -24.426 -62.811 1.00 85.73  ? 535 THR A N   1 
ATOM   3686 C  CA  . THR A 1 525 ? -38.281 -24.184 -62.333 1.00 82.29  ? 535 THR A CA  1 
ATOM   3687 C  C   . THR A 1 525 ? -38.241 -22.771 -61.800 1.00 81.46  ? 535 THR A C   1 
ATOM   3688 O  O   . THR A 1 525 ? -39.259 -22.067 -61.809 1.00 82.08  ? 535 THR A O   1 
ATOM   3689 C  CB  . THR A 1 525 ? -37.259 -24.283 -63.457 1.00 82.23  ? 535 THR A CB  1 
ATOM   3690 O  OG1 . THR A 1 525 ? -37.506 -23.242 -64.411 1.00 77.68  ? 535 THR A OG1 1 
ATOM   3691 C  CG2 . THR A 1 525 ? -37.356 -25.646 -64.127 1.00 78.71  ? 535 THR A CG2 1 
ATOM   3692 N  N   . ALA A 1 526 ? -37.063 -22.350 -61.356 1.00 76.95  ? 536 ALA A N   1 
ATOM   3693 C  CA  . ALA A 1 526 ? -36.892 -21.005 -60.834 1.00 75.30  ? 536 ALA A CA  1 
ATOM   3694 C  C   . ALA A 1 526 ? -37.174 -19.973 -61.915 1.00 75.84  ? 536 ALA A C   1 
ATOM   3695 O  O   . ALA A 1 526 ? -37.762 -18.918 -61.658 1.00 75.72  ? 536 ALA A O   1 
ATOM   3696 C  CB  . ALA A 1 526 ? -35.489 -20.834 -60.317 1.00 71.69  ? 536 ALA A CB  1 
ATOM   3697 N  N   . ILE A 1 527 ? -36.751 -20.294 -63.130 1.00 105.03 ? 537 ILE A N   1 
ATOM   3698 C  CA  . ILE A 1 527 ? -36.810 -19.352 -64.230 1.00 107.41 ? 537 ILE A CA  1 
ATOM   3699 C  C   . ILE A 1 527 ? -38.243 -19.007 -64.573 1.00 109.53 ? 537 ILE A C   1 
ATOM   3700 O  O   . ILE A 1 527 ? -38.535 -17.891 -64.980 1.00 109.38 ? 537 ILE A O   1 
ATOM   3701 C  CB  . ILE A 1 527 ? -36.168 -19.927 -65.491 1.00 107.22 ? 537 ILE A CB  1 
ATOM   3702 C  CG1 . ILE A 1 527 ? -34.876 -20.664 -65.151 1.00 108.36 ? 537 ILE A CG1 1 
ATOM   3703 C  CG2 . ILE A 1 527 ? -35.925 -18.827 -66.510 1.00 105.87 ? 537 ILE A CG2 1 
ATOM   3704 C  CD1 . ILE A 1 527 ? -34.295 -21.391 -66.337 1.00 110.92 ? 537 ILE A CD1 1 
ATOM   3705 N  N   . ASP A 1 528 ? -39.133 -19.979 -64.421 1.00 90.10  ? 538 ASP A N   1 
ATOM   3706 C  CA  . ASP A 1 528 ? -40.533 -19.780 -64.750 1.00 92.76  ? 538 ASP A CA  1 
ATOM   3707 C  C   . ASP A 1 528 ? -41.138 -18.769 -63.793 1.00 89.32  ? 538 ASP A C   1 
ATOM   3708 O  O   . ASP A 1 528 ? -41.772 -17.780 -64.203 1.00 89.24  ? 538 ASP A O   1 
ATOM   3709 C  CB  . ASP A 1 528 ? -41.267 -21.113 -64.653 1.00 97.47  ? 538 ASP A CB  1 
ATOM   3710 C  CG  . ASP A 1 528 ? -40.829 -22.091 -65.723 1.00 108.86 ? 538 ASP A CG  1 
ATOM   3711 O  OD1 . ASP A 1 528 ? -41.411 -23.192 -65.804 1.00 119.10 ? 538 ASP A OD1 1 
ATOM   3712 O  OD2 . ASP A 1 528 ? -39.902 -21.752 -66.492 1.00 119.06 1 538 ASP A OD2 1 
ATOM   3713 N  N   . LEU A 1 529 ? -40.905 -19.023 -62.511 1.00 93.16  ? 539 LEU A N   1 
ATOM   3714 C  CA  . LEU A 1 529 ? -41.344 -18.150 -61.439 1.00 90.25  ? 539 LEU A CA  1 
ATOM   3715 C  C   . LEU A 1 529 ? -40.814 -16.743 -61.657 1.00 93.66  ? 539 LEU A C   1 
ATOM   3716 O  O   . LEU A 1 529 ? -41.519 -15.739 -61.462 1.00 92.06  ? 539 LEU A O   1 
ATOM   3717 C  CB  . LEU A 1 529 ? -40.821 -18.688 -60.117 1.00 85.73  ? 539 LEU A CB  1 
ATOM   3718 C  CG  . LEU A 1 529 ? -41.153 -17.860 -58.884 1.00 77.44  ? 539 LEU A CG  1 
ATOM   3719 C  CD1 . LEU A 1 529 ? -42.648 -17.804 -58.688 1.00 71.99  ? 539 LEU A CD1 1 
ATOM   3720 C  CD2 . LEU A 1 529 ? -40.498 -18.485 -57.674 1.00 70.01  ? 539 LEU A CD2 1 
ATOM   3721 N  N   . LEU A 1 530 ? -39.561 -16.676 -62.077 1.00 111.69 ? 540 LEU A N   1 
ATOM   3722 C  CA  . LEU A 1 530 ? -38.928 -15.398 -62.306 1.00 118.56 ? 540 LEU A CA  1 
ATOM   3723 C  C   . LEU A 1 530 ? -39.566 -14.665 -63.477 1.00 118.92 ? 540 LEU A C   1 
ATOM   3724 O  O   . LEU A 1 530 ? -39.777 -13.456 -63.416 1.00 119.81 ? 540 LEU A O   1 
ATOM   3725 C  CB  . LEU A 1 530 ? -37.447 -15.579 -62.566 1.00 122.35 ? 540 LEU A CB  1 
ATOM   3726 C  CG  . LEU A 1 530 ? -36.756 -14.235 -62.741 1.00 131.67 ? 540 LEU A CG  1 
ATOM   3727 C  CD1 . LEU A 1 530 ? -36.939 -13.380 -61.491 1.00 139.68 ? 540 LEU A CD1 1 
ATOM   3728 C  CD2 . LEU A 1 530 ? -35.301 -14.445 -63.069 1.00 139.68 ? 540 LEU A CD2 1 
ATOM   3729 N  N   . ASN A 1 531 ? -39.882 -15.406 -64.533 1.00 140.33 ? 541 ASN A N   1 
ATOM   3730 C  CA  . ASN A 1 531 ? -40.531 -14.838 -65.703 1.00 140.47 ? 541 ASN A CA  1 
ATOM   3731 C  C   . ASN A 1 531 ? -41.835 -14.227 -65.279 1.00 139.03 ? 541 ASN A C   1 
ATOM   3732 O  O   . ASN A 1 531 ? -42.166 -13.110 -65.670 1.00 138.65 ? 541 ASN A O   1 
ATOM   3733 C  CB  . ASN A 1 531 ? -40.804 -15.905 -66.763 1.00 142.33 ? 541 ASN A CB  1 
ATOM   3734 C  CG  . ASN A 1 531 ? -39.683 -16.037 -67.764 1.00 147.07 ? 541 ASN A CG  1 
ATOM   3735 O  OD1 . ASN A 1 531 ? -38.974 -15.072 -68.049 1.00 151.01 ? 541 ASN A OD1 1 
ATOM   3736 N  ND2 . ASN A 1 531 ? -39.528 -17.232 -68.325 1.00 150.97 ? 541 ASN A ND2 1 
ATOM   3737 N  N   . PHE A 1 532 ? -42.564 -14.969 -64.460 1.00 109.95 ? 542 PHE A N   1 
ATOM   3738 C  CA  . PHE A 1 532 ? -43.837 -14.500 -63.955 1.00 109.32 ? 542 PHE A CA  1 
ATOM   3739 C  C   . PHE A 1 532 ? -43.681 -13.190 -63.185 1.00 107.72 ? 542 PHE A C   1 
ATOM   3740 O  O   . PHE A 1 532 ? -44.292 -12.169 -63.542 1.00 106.81 ? 542 PHE A O   1 
ATOM   3741 C  CB  . PHE A 1 532 ? -44.442 -15.569 -63.060 1.00 110.62 ? 542 PHE A CB  1 
ATOM   3742 C  CG  . PHE A 1 532 ? -45.661 -15.127 -62.328 1.00 114.49 ? 542 PHE A CG  1 
ATOM   3743 C  CD1 . PHE A 1 532 ? -46.894 -15.135 -62.956 1.00 117.69 ? 542 PHE A CD1 1 
ATOM   3744 C  CD2 . PHE A 1 532 ? -45.584 -14.726 -61.006 1.00 117.68 ? 542 PHE A CD2 1 
ATOM   3745 C  CE1 . PHE A 1 532 ? -48.023 -14.738 -62.286 1.00 118.85 ? 542 PHE A CE1 1 
ATOM   3746 C  CE2 . PHE A 1 532 ? -46.708 -14.327 -60.329 1.00 118.83 ? 542 PHE A CE2 1 
ATOM   3747 C  CZ  . PHE A 1 532 ? -47.931 -14.334 -60.970 1.00 119.21 ? 542 PHE A CZ  1 
ATOM   3748 N  N   . VAL A 1 533 ? -42.848 -13.211 -62.149 1.00 101.71 ? 543 VAL A N   1 
ATOM   3749 C  CA  . VAL A 1 533 ? -42.690 -12.030 -61.305 1.00 102.96 ? 543 VAL A CA  1 
ATOM   3750 C  C   . VAL A 1 533 ? -42.255 -10.817 -62.114 1.00 103.73 ? 543 VAL A C   1 
ATOM   3751 O  O   . VAL A 1 533 ? -42.803 -9.725  -61.964 1.00 101.19 ? 543 VAL A O   1 
ATOM   3752 C  CB  . VAL A 1 533 ? -41.676 -12.252 -60.183 1.00 103.44 ? 543 VAL A CB  1 
ATOM   3753 C  CG1 . VAL A 1 533 ? -41.604 -11.015 -59.307 1.00 107.44 ? 543 VAL A CG1 1 
ATOM   3754 C  CG2 . VAL A 1 533 ? -42.059 -13.465 -59.365 1.00 106.94 ? 543 VAL A CG2 1 
ATOM   3755 N  N   . ALA A 1 534 ? -41.273 -11.028 -62.979 1.00 109.53 ? 544 ALA A N   1 
ATOM   3756 C  CA  . ALA A 1 534 ? -40.736 -9.966  -63.811 1.00 116.04 ? 544 ALA A CA  1 
ATOM   3757 C  C   . ALA A 1 534 ? -41.838 -9.404  -64.695 1.00 121.91 ? 544 ALA A C   1 
ATOM   3758 O  O   . ALA A 1 534 ? -41.933 -8.192  -64.897 1.00 121.61 ? 544 ALA A O   1 
ATOM   3759 C  CB  . ALA A 1 534 ? -39.605 -10.490 -64.659 1.00 113.32 ? 544 ALA A CB  1 
ATOM   3760 N  N   . ALA A 1 535 ? -42.669 -10.299 -65.217 1.00 164.77 ? 545 ALA A N   1 
ATOM   3761 C  CA  . ALA A 1 535 ? -43.785 -9.909  -66.063 1.00 171.55 ? 545 ALA A CA  1 
ATOM   3762 C  C   . ALA A 1 535 ? -44.737 -9.044  -65.261 1.00 173.57 ? 545 ALA A C   1 
ATOM   3763 O  O   . ALA A 1 535 ? -45.392 -8.153  -65.804 1.00 176.24 ? 545 ALA A O   1 
ATOM   3764 C  CB  . ALA A 1 535 ? -44.507 -11.132 -66.584 1.00 174.85 ? 545 ALA A CB  1 
ATOM   3765 N  N   . GLN A 1 536 ? -44.831 -9.324  -63.967 1.00 131.18 ? 546 GLN A N   1 
ATOM   3766 C  CA  . GLN A 1 536 ? -45.675 -8.523  -63.095 1.00 130.02 ? 546 GLN A CA  1 
ATOM   3767 C  C   . GLN A 1 536 ? -45.023 -7.180  -62.758 1.00 131.28 ? 546 GLN A C   1 
ATOM   3768 O  O   . GLN A 1 536 ? -45.707 -6.225  -62.386 1.00 129.73 ? 546 GLN A O   1 
ATOM   3769 C  CB  . GLN A 1 536 ? -46.030 -9.275  -61.813 1.00 128.38 ? 546 GLN A CB  1 
ATOM   3770 C  CG  . GLN A 1 536 ? -46.862 -10.532 -62.022 1.00 126.49 ? 546 GLN A CG  1 
ATOM   3771 C  CD  . GLN A 1 536 ? -48.163 -10.296 -62.768 1.00 125.47 ? 546 GLN A CD  1 
ATOM   3772 O  OE1 . GLN A 1 536 ? -48.667 -9.174  -62.849 1.00 125.30 ? 546 GLN A OE1 1 
ATOM   3773 N  NE2 . GLN A 1 536 ? -48.735 -11.377 -63.288 1.00 125.29 ? 546 GLN A NE2 1 
ATOM   3774 N  N   . GLU A 1 537 ? -43.696 -7.119  -62.849 1.00 137.49 ? 547 GLU A N   1 
ATOM   3775 C  CA  . GLU A 1 537 ? -42.986 -5.877  -62.566 1.00 141.75 ? 547 GLU A CA  1 
ATOM   3776 C  C   . GLU A 1 537 ? -43.278 -4.842  -63.651 1.00 145.82 ? 547 GLU A C   1 
ATOM   3777 O  O   . GLU A 1 537 ? -43.293 -3.642  -63.391 1.00 145.42 ? 547 GLU A O   1 
ATOM   3778 C  CB  . GLU A 1 537 ? -41.478 -6.123  -62.477 1.00 140.87 ? 547 GLU A CB  1 
ATOM   3779 C  CG  . GLU A 1 537 ? -41.079 -7.186  -61.470 1.00 139.13 ? 547 GLU A CG  1 
ATOM   3780 C  CD  . GLU A 1 537 ? -41.341 -6.760  -60.039 1.00 137.46 ? 547 GLU A CD  1 
ATOM   3781 O  OE1 . GLU A 1 537 ? -41.349 -7.639  -59.150 1.00 137.00 ? 547 GLU A OE1 1 
ATOM   3782 O  OE2 . GLU A 1 537 ? -41.522 -5.546  -59.802 1.00 137.01 1 547 GLU A OE2 1 
ATOM   3783 N  N   . ARG A 1 538 ? -43.452 -5.321  -64.877 1.00 169.16 ? 548 ARG A N   1 
ATOM   3784 C  CA  . ARG A 1 538 ? -43.757 -4.483  -66.035 1.00 173.97 ? 548 ARG A CA  1 
ATOM   3785 C  C   . ARG A 1 538 ? -45.239 -4.103  -66.099 1.00 175.78 ? 548 ARG A C   1 
ATOM   3786 O  O   . ARG A 1 538 ? -45.622 -3.183  -66.823 1.00 176.61 ? 548 ARG A O   1 
ATOM   3787 C  CB  . ARG A 1 538 ? -43.352 -5.198  -67.316 1.00 175.16 ? 548 ARG A CB  1 
ATOM   3788 C  CG  . ARG A 1 538 ? -41.862 -5.452  -67.421 1.00 176.84 ? 548 ARG A CG  1 
ATOM   3789 C  CD  . ARG A 1 538 ? -41.613 -6.650  -68.302 1.00 177.52 ? 548 ARG A CD  1 
ATOM   3790 N  NE  . ARG A 1 538 ? -40.197 -6.964  -68.451 1.00 177.64 ? 548 ARG A NE  1 
ATOM   3791 C  CZ  . ARG A 1 538 ? -39.747 -8.147  -68.852 1.00 177.67 ? 548 ARG A CZ  1 
ATOM   3792 N  NH1 . ARG A 1 538 ? -38.443 -8.367  -68.971 1.00 177.67 1 548 ARG A NH1 1 
ATOM   3793 N  NH2 . ARG A 1 538 ? -40.607 -9.118  -69.130 1.00 177.69 ? 548 ARG A NH2 1 
ATOM   3794 N  N   . ASP A 1 539 ? -46.074 -4.835  -65.368 1.00 173.22 ? 549 ASP A N   1 
ATOM   3795 C  CA  . ASP A 1 539 ? -47.519 -4.635  -65.430 1.00 173.87 ? 549 ASP A CA  1 
ATOM   3796 C  C   . ASP A 1 539 ? -48.007 -3.527  -64.501 1.00 174.15 ? 549 ASP A C   1 
ATOM   3797 O  O   . ASP A 1 539 ? -49.209 -3.272  -64.409 1.00 174.26 ? 549 ASP A O   1 
ATOM   3798 C  CB  . ASP A 1 539 ? -48.251 -5.941  -65.107 1.00 174.05 ? 549 ASP A CB  1 
ATOM   3799 N  N   . GLN A 1 540 ? -47.075 -2.876  -63.811 1.00 179.92 ? 550 GLN A N   1 
ATOM   3800 C  CA  . GLN A 1 540 ? -47.407 -1.724  -62.977 1.00 179.99 ? 550 GLN A CA  1 
ATOM   3801 C  C   . GLN A 1 540 ? -47.095 -0.408  -63.691 1.00 180.01 ? 550 GLN A C   1 
ATOM   3802 O  O   . GLN A 1 540 ? -46.119 -0.304  -64.437 1.00 180.01 ? 550 GLN A O   1 
ATOM   3803 C  CB  . GLN A 1 540 ? -46.658 -1.787  -61.643 1.00 180.02 ? 550 GLN A CB  1 
ATOM   3804 C  CG  . GLN A 1 540 ? -45.152 -1.889  -61.797 1.00 180.05 ? 550 GLN A CG  1 
ATOM   3805 C  CD  . GLN A 1 540 ? -44.398 -1.585  -60.519 1.00 180.07 ? 550 GLN A CD  1 
ATOM   3806 O  OE1 . GLN A 1 540 ? -44.253 -0.425  -60.133 1.00 180.08 ? 550 GLN A OE1 1 
ATOM   3807 N  NE2 . GLN A 1 540 ? -43.903 -2.627  -59.859 1.00 180.06 ? 550 GLN A NE2 1 
ATOM   3808 N  N   . PRO B 1 41  ? -28.605 -13.755 -79.024 1.00 140.22 ? 41  PRO B N   1 
ATOM   3809 C  CA  . PRO B 1 41  ? -28.133 -15.001 -78.408 1.00 140.55 ? 41  PRO B CA  1 
ATOM   3810 C  C   . PRO B 1 41  ? -27.128 -14.739 -77.290 1.00 140.96 ? 41  PRO B C   1 
ATOM   3811 O  O   . PRO B 1 41  ? -25.961 -14.451 -77.564 1.00 140.71 ? 41  PRO B O   1 
ATOM   3812 C  CB  . PRO B 1 41  ? -27.453 -15.733 -79.572 1.00 140.25 ? 41  PRO B CB  1 
ATOM   3813 C  CG  . PRO B 1 41  ? -27.110 -14.659 -80.554 1.00 140.15 ? 41  PRO B CG  1 
ATOM   3814 C  CD  . PRO B 1 41  ? -28.212 -13.653 -80.439 1.00 140.13 ? 41  PRO B CD  1 
ATOM   3815 N  N   . LEU B 1 42  ? -27.572 -14.843 -76.041 1.00 179.93 ? 42  LEU B N   1 
ATOM   3816 C  CA  . LEU B 1 42  ? -26.668 -14.575 -74.934 1.00 178.72 ? 42  LEU B CA  1 
ATOM   3817 C  C   . LEU B 1 42  ? -26.341 -15.800 -74.088 1.00 173.97 ? 42  LEU B C   1 
ATOM   3818 O  O   . LEU B 1 42  ? -27.157 -16.291 -73.307 1.00 177.13 ? 42  LEU B O   1 
ATOM   3819 C  CB  . LEU B 1 42  ? -27.236 -13.462 -74.050 1.00 181.61 ? 42  LEU B CB  1 
ATOM   3820 C  CG  . LEU B 1 42  ? -27.075 -12.041 -74.595 1.00 183.99 ? 42  LEU B CG  1 
ATOM   3821 C  CD1 . LEU B 1 42  ? -28.051 -11.085 -73.930 1.00 185.30 ? 42  LEU B CD1 1 
ATOM   3822 C  CD2 . LEU B 1 42  ? -25.643 -11.567 -74.398 1.00 185.29 ? 42  LEU B CD2 1 
ATOM   3823 N  N   . TRP B 1 43  ? -25.116 -16.268 -74.270 1.00 130.85 ? 43  TRP B N   1 
ATOM   3824 C  CA  . TRP B 1 43  ? -24.451 -17.194 -73.380 1.00 116.14 ? 43  TRP B CA  1 
ATOM   3825 C  C   . TRP B 1 43  ? -22.994 -17.006 -73.712 1.00 110.62 ? 43  TRP B C   1 
ATOM   3826 O  O   . TRP B 1 43  ? -22.669 -16.562 -74.815 1.00 111.44 ? 43  TRP B O   1 
ATOM   3827 C  CB  . TRP B 1 43  ? -24.852 -18.623 -73.698 1.00 111.73 ? 43  TRP B CB  1 
ATOM   3828 C  CG  . TRP B 1 43  ? -24.149 -19.607 -72.851 1.00 100.40 ? 43  TRP B CG  1 
ATOM   3829 C  CD1 . TRP B 1 43  ? -23.883 -19.493 -71.519 1.00 93.74  ? 43  TRP B CD1 1 
ATOM   3830 C  CD2 . TRP B 1 43  ? -23.628 -20.874 -73.260 1.00 93.30  ? 43  TRP B CD2 1 
ATOM   3831 N  NE1 . TRP B 1 43  ? -23.219 -20.609 -71.070 1.00 92.11  ? 43  TRP B NE1 1 
ATOM   3832 C  CE2 . TRP B 1 43  ? -23.055 -21.475 -72.117 1.00 91.96  ? 43  TRP B CE2 1 
ATOM   3833 C  CE3 . TRP B 1 43  ? -23.592 -21.561 -74.478 1.00 91.86  ? 43  TRP B CE3 1 
ATOM   3834 C  CZ2 . TRP B 1 43  ? -22.453 -22.730 -72.158 1.00 91.26  ? 43  TRP B CZ2 1 
ATOM   3835 C  CZ3 . TRP B 1 43  ? -22.995 -22.804 -74.518 1.00 91.27  ? 43  TRP B CZ3 1 
ATOM   3836 C  CH2 . TRP B 1 43  ? -22.432 -23.377 -73.362 1.00 91.14  ? 43  TRP B CH2 1 
ATOM   3837 N  N   . ILE B 1 44  ? -22.100 -17.349 -72.795 1.00 103.37 ? 44  ILE B N   1 
ATOM   3838 C  CA  . ILE B 1 44  ? -20.687 -17.355 -73.134 1.00 95.70  ? 44  ILE B CA  1 
ATOM   3839 C  C   . ILE B 1 44  ? -20.046 -18.623 -72.621 1.00 95.92  ? 44  ILE B C   1 
ATOM   3840 O  O   . ILE B 1 44  ? -19.998 -18.851 -71.408 1.00 95.88  ? 44  ILE B O   1 
ATOM   3841 C  CB  . ILE B 1 44  ? -19.950 -16.139 -72.579 1.00 93.08  ? 44  ILE B CB  1 
ATOM   3842 C  CG1 . ILE B 1 44  ? -20.719 -14.859 -72.909 1.00 84.98  ? 44  ILE B CG1 1 
ATOM   3843 C  CG2 . ILE B 1 44  ? -18.566 -16.076 -73.171 1.00 86.10  ? 44  ILE B CG2 1 
ATOM   3844 C  CD1 . ILE B 1 44  ? -20.002 -13.601 -72.532 1.00 76.83  ? 44  ILE B CD1 1 
ATOM   3845 N  N   . ARG B 1 45  ? -19.543 -19.437 -73.542 1.00 106.02 ? 45  ARG B N   1 
ATOM   3846 C  CA  . ARG B 1 45  ? -19.001 -20.734 -73.181 1.00 105.86 ? 45  ARG B CA  1 
ATOM   3847 C  C   . ARG B 1 45  ? -17.899 -20.603 -72.146 1.00 103.45 ? 45  ARG B C   1 
ATOM   3848 O  O   . ARG B 1 45  ? -16.902 -19.912 -72.368 1.00 102.74 ? 45  ARG B O   1 
ATOM   3849 C  CB  . ARG B 1 45  ? -18.481 -21.474 -74.407 1.00 107.34 ? 45  ARG B CB  1 
ATOM   3850 C  CG  . ARG B 1 45  ? -19.561 -22.129 -75.223 1.00 114.40 ? 45  ARG B CG  1 
ATOM   3851 C  CD  . ARG B 1 45  ? -19.049 -23.381 -75.898 1.00 122.84 ? 45  ARG B CD  1 
ATOM   3852 N  NE  . ARG B 1 45  ? -20.146 -24.191 -76.409 1.00 126.03 ? 45  ARG B NE  1 
ATOM   3853 C  CZ  . ARG B 1 45  ? -20.079 -25.503 -76.602 1.00 127.44 ? 45  ARG B CZ  1 
ATOM   3854 N  NH1 . ARG B 1 45  ? -21.132 -26.160 -77.074 1.00 127.87 1 45  ARG B NH1 1 
ATOM   3855 N  NH2 . ARG B 1 45  ? -18.959 -26.158 -76.317 1.00 127.89 ? 45  ARG B NH2 1 
ATOM   3856 N  N   . PRO B 1 46  ? -18.093 -21.249 -70.992 1.00 104.47 ? 46  PRO B N   1 
ATOM   3857 C  CA  . PRO B 1 46  ? -17.090 -21.305 -69.930 1.00 104.95 ? 46  PRO B CA  1 
ATOM   3858 C  C   . PRO B 1 46  ? -15.894 -22.138 -70.368 1.00 107.14 ? 46  PRO B C   1 
ATOM   3859 O  O   . PRO B 1 46  ? -14.848 -22.088 -69.727 1.00 107.36 ? 46  PRO B O   1 
ATOM   3860 C  CB  . PRO B 1 46  ? -17.829 -22.015 -68.800 1.00 103.13 ? 46  PRO B CB  1 
ATOM   3861 C  CG  . PRO B 1 46  ? -18.815 -22.874 -69.503 1.00 100.62 ? 46  PRO B CG  1 
ATOM   3862 C  CD  . PRO B 1 46  ? -19.277 -22.060 -70.669 1.00 102.87 ? 46  PRO B CD  1 
ATOM   3863 N  N   . ASP B 1 47  ? -16.065 -22.929 -71.422 1.00 77.55  ? 47  ASP B N   1 
ATOM   3864 C  CA  . ASP B 1 47  ? -14.980 -23.757 -71.938 1.00 79.73  ? 47  ASP B CA  1 
ATOM   3865 C  C   . ASP B 1 47  ? -14.202 -23.118 -73.090 1.00 78.22  ? 47  ASP B C   1 
ATOM   3866 O  O   . ASP B 1 47  ? -13.359 -23.774 -73.711 1.00 79.47  ? 47  ASP B O   1 
ATOM   3867 C  CB  . ASP B 1 47  ? -15.454 -25.173 -72.277 1.00 82.71  ? 47  ASP B CB  1 
ATOM   3868 C  CG  . ASP B 1 47  ? -16.347 -25.213 -73.484 1.00 87.38  ? 47  ASP B CG  1 
ATOM   3869 O  OD1 . ASP B 1 47  ? -16.984 -24.181 -73.786 1.00 91.05  ? 47  ASP B OD1 1 
ATOM   3870 O  OD2 . ASP B 1 47  ? -16.416 -26.282 -74.123 1.00 91.04  1 47  ASP B OD2 1 
ATOM   3871 N  N   . ALA B 1 48  ? -14.511 -21.858 -73.390 1.00 99.71  ? 48  ALA B N   1 
ATOM   3872 C  CA  . ALA B 1 48  ? -13.873 -21.140 -74.491 1.00 98.89  ? 48  ALA B CA  1 
ATOM   3873 C  C   . ALA B 1 48  ? -12.349 -21.183 -74.392 1.00 103.33 ? 48  ALA B C   1 
ATOM   3874 O  O   . ALA B 1 48  ? -11.792 -21.270 -73.297 1.00 99.89  ? 48  ALA B O   1 
ATOM   3875 C  CB  . ALA B 1 48  ? -14.345 -19.704 -74.511 1.00 92.91  ? 48  ALA B CB  1 
ATOM   3876 N  N   . PRO B 1 49  ? -11.663 -21.148 -75.544 1.00 93.84  ? 49  PRO B N   1 
ATOM   3877 C  CA  . PRO B 1 49  ? -10.200 -21.162 -75.517 1.00 97.83  ? 49  PRO B CA  1 
ATOM   3878 C  C   . PRO B 1 49  ? -9.677  -19.852 -74.955 1.00 97.26  ? 49  PRO B C   1 
ATOM   3879 O  O   . PRO B 1 49  ? -10.322 -18.807 -75.116 1.00 98.46  ? 49  PRO B O   1 
ATOM   3880 C  CB  . PRO B 1 49  ? -9.824  -21.288 -76.991 1.00 102.08 ? 49  PRO B CB  1 
ATOM   3881 C  CG  . PRO B 1 49  ? -10.971 -20.682 -77.709 1.00 104.66 ? 49  PRO B CG  1 
ATOM   3882 C  CD  . PRO B 1 49  ? -12.184 -21.077 -76.918 1.00 98.75  ? 49  PRO B CD  1 
ATOM   3883 N  N   . SER B 1 50  ? -8.521  -19.913 -74.302 1.00 101.01 ? 50  SER B N   1 
ATOM   3884 C  CA  . SER B 1 50  ? -7.949  -18.747 -73.652 1.00 100.99 ? 50  SER B CA  1 
ATOM   3885 C  C   . SER B 1 50  ? -7.275  -17.814 -74.649 1.00 101.06 ? 50  SER B C   1 
ATOM   3886 O  O   . SER B 1 50  ? -6.468  -18.248 -75.475 1.00 99.17  ? 50  SER B O   1 
ATOM   3887 C  CB  . SER B 1 50  ? -6.959  -19.173 -72.574 1.00 101.52 ? 50  SER B CB  1 
ATOM   3888 O  OG  . SER B 1 50  ? -6.679  -18.094 -71.703 1.00 103.50 ? 50  SER B OG  1 
ATOM   3889 N  N   . ARG B 1 51  ? -7.616  -16.534 -74.569 1.00 102.58 ? 51  ARG B N   1 
ATOM   3890 C  CA  . ARG B 1 51  ? -7.048  -15.532 -75.458 1.00 105.90 ? 51  ARG B CA  1 
ATOM   3891 C  C   . ARG B 1 51  ? -5.817  -14.891 -74.844 1.00 104.06 ? 51  ARG B C   1 
ATOM   3892 O  O   . ARG B 1 51  ? -5.238  -13.970 -75.421 1.00 102.53 ? 51  ARG B O   1 
ATOM   3893 C  CB  . ARG B 1 51  ? -8.085  -14.455 -75.766 1.00 109.32 ? 51  ARG B CB  1 
ATOM   3894 C  CG  . ARG B 1 51  ? -9.231  -14.938 -76.642 1.00 120.57 ? 51  ARG B CG  1 
ATOM   3895 C  CD  . ARG B 1 51  ? -10.574 -14.517 -76.067 1.00 132.62 ? 51  ARG B CD  1 
ATOM   3896 N  NE  . ARG B 1 51  ? -10.747 -13.068 -76.045 1.00 136.54 ? 51  ARG B NE  1 
ATOM   3897 C  CZ  . ARG B 1 51  ? -11.662 -12.440 -75.311 1.00 137.88 ? 51  ARG B CZ  1 
ATOM   3898 N  NH1 . ARG B 1 51  ? -12.480 -13.136 -74.529 1.00 138.25 1 51  ARG B NH1 1 
ATOM   3899 N  NH2 . ARG B 1 51  ? -11.753 -11.116 -75.350 1.00 138.27 ? 51  ARG B NH2 1 
ATOM   3900 N  N   . CYS B 1 52  ? -5.428  -15.366 -73.666 1.00 103.17 ? 52  CYS B N   1 
ATOM   3901 C  CA  . CYS B 1 52  ? -4.311  -14.775 -72.952 1.00 103.44 ? 52  CYS B CA  1 
ATOM   3902 C  C   . CYS B 1 52  ? -2.997  -15.057 -73.667 1.00 105.56 ? 52  CYS B C   1 
ATOM   3903 O  O   . CYS B 1 52  ? -2.711  -16.198 -74.041 1.00 106.82 ? 52  CYS B O   1 
ATOM   3904 C  CB  . CYS B 1 52  ? -4.256  -15.288 -71.523 1.00 101.25 ? 52  CYS B CB  1 
ATOM   3905 S  SG  . CYS B 1 52  ? -3.108  -14.384 -70.515 1.00 98.49  ? 52  CYS B SG  1 
ATOM   3906 N  N   . THR B 1 53  ? -2.194  -14.012 -73.843 1.00 100.76 ? 53  THR B N   1 
ATOM   3907 C  CA  . THR B 1 53  ? -0.944  -14.115 -74.587 1.00 101.02 ? 53  THR B CA  1 
ATOM   3908 C  C   . THR B 1 53  ? 0.253   -14.390 -73.695 1.00 98.62  ? 53  THR B C   1 
ATOM   3909 O  O   . THR B 1 53  ? 1.392   -14.419 -74.174 1.00 100.57 ? 53  THR B O   1 
ATOM   3910 C  CB  . THR B 1 53  ? -0.670  -12.840 -75.386 1.00 102.34 ? 53  THR B CB  1 
ATOM   3911 O  OG1 . THR B 1 53  ? -0.594  -11.730 -74.485 1.00 103.90 ? 53  THR B OG1 1 
ATOM   3912 C  CG2 . THR B 1 53  ? -1.790  -12.601 -76.363 1.00 103.95 ? 53  THR B CG2 1 
ATOM   3913 N  N   . TRP B 1 54  ? -0.003  -14.564 -72.403 1.00 88.10  ? 54  TRP B N   1 
ATOM   3914 C  CA  . TRP B 1 54  ? 1.044   -14.926 -71.463 1.00 83.55  ? 54  TRP B CA  1 
ATOM   3915 C  C   . TRP B 1 54  ? 1.728   -16.198 -71.936 1.00 86.08  ? 54  TRP B C   1 
ATOM   3916 O  O   . TRP B 1 54  ? 1.083   -17.119 -72.446 1.00 85.64  ? 54  TRP B O   1 
ATOM   3917 C  CB  . TRP B 1 54  ? 0.458   -15.153 -70.070 1.00 76.86  ? 54  TRP B CB  1 
ATOM   3918 C  CG  . TRP B 1 54  ? 1.459   -15.529 -69.017 1.00 67.00  ? 54  TRP B CG  1 
ATOM   3919 C  CD1 . TRP B 1 54  ? 2.101   -14.683 -68.147 1.00 62.73  ? 54  TRP B CD1 1 
ATOM   3920 C  CD2 . TRP B 1 54  ? 1.930   -16.849 -68.709 1.00 60.80  ? 54  TRP B CD2 1 
ATOM   3921 N  NE1 . TRP B 1 54  ? 2.939   -15.398 -67.316 1.00 61.25  ? 54  TRP B NE1 1 
ATOM   3922 C  CE2 . TRP B 1 54  ? 2.857   -16.728 -67.646 1.00 59.90  ? 54  TRP B CE2 1 
ATOM   3923 C  CE3 . TRP B 1 54  ? 1.664   -18.123 -69.232 1.00 59.77  ? 54  TRP B CE3 1 
ATOM   3924 C  CZ2 . TRP B 1 54  ? 3.515   -17.828 -67.101 1.00 57.54  ? 54  TRP B CZ2 1 
ATOM   3925 C  CZ3 . TRP B 1 54  ? 2.314   -19.211 -68.685 1.00 58.12  ? 54  TRP B CZ3 1 
ATOM   3926 C  CH2 . TRP B 1 54  ? 3.232   -19.056 -67.633 1.00 55.30  ? 54  TRP B CH2 1 
ATOM   3927 N  N   . GLN B 1 55  ? 3.042   -16.237 -71.774 1.00 92.44  ? 55  GLN B N   1 
ATOM   3928 C  CA  . GLN B 1 55  ? 3.810   -17.442 -72.021 1.00 98.09  ? 55  GLN B CA  1 
ATOM   3929 C  C   . GLN B 1 55  ? 5.026   -17.364 -71.121 1.00 101.42 ? 55  GLN B C   1 
ATOM   3930 O  O   . GLN B 1 55  ? 5.438   -16.271 -70.719 1.00 99.53  ? 55  GLN B O   1 
ATOM   3931 C  CB  . GLN B 1 55  ? 4.208   -17.569 -73.495 1.00 98.33  ? 55  GLN B CB  1 
ATOM   3932 C  CG  . GLN B 1 55  ? 5.087   -16.443 -74.013 1.00 103.27 ? 55  GLN B CG  1 
ATOM   3933 C  CD  . GLN B 1 55  ? 5.125   -16.390 -75.530 1.00 107.75 ? 55  GLN B CD  1 
ATOM   3934 O  OE1 . GLN B 1 55  ? 4.466   -17.184 -76.206 1.00 109.03 ? 55  GLN B OE1 1 
ATOM   3935 N  NE2 . GLN B 1 55  ? 5.900   -15.454 -76.074 1.00 109.00 ? 55  GLN B NE2 1 
ATOM   3936 N  N   . LEU B 1 56  ? 5.583   -18.520 -70.782 1.00 78.99  ? 56  LEU B N   1 
ATOM   3937 C  CA  . LEU B 1 56  ? 6.680   -18.560 -69.827 1.00 83.55  ? 56  LEU B CA  1 
ATOM   3938 C  C   . LEU B 1 56  ? 7.887   -17.771 -70.324 1.00 82.28  ? 56  LEU B C   1 
ATOM   3939 O  O   . LEU B 1 56  ? 8.349   -17.958 -71.457 1.00 85.42  ? 56  LEU B O   1 
ATOM   3940 C  CB  . LEU B 1 56  ? 7.072   -20.001 -69.512 1.00 86.98  ? 56  LEU B CB  1 
ATOM   3941 C  CG  . LEU B 1 56  ? 8.073   -20.131 -68.365 1.00 87.49  ? 56  LEU B CG  1 
ATOM   3942 C  CD1 . LEU B 1 56  ? 7.650   -19.263 -67.188 1.00 84.81  ? 56  LEU B CD1 1 
ATOM   3943 C  CD2 . LEU B 1 56  ? 8.165   -21.580 -67.928 1.00 89.82  ? 56  LEU B CD2 1 
ATOM   3944 N  N   . GLY B 1 57  ? 8.384   -16.878 -69.475 1.00 89.89  ? 57  GLY B N   1 
ATOM   3945 C  CA  . GLY B 1 57  ? 9.544   -16.082 -69.814 1.00 87.67  ? 57  GLY B CA  1 
ATOM   3946 C  C   . GLY B 1 57  ? 9.181   -14.644 -70.115 1.00 89.69  ? 57  GLY B C   1 
ATOM   3947 O  O   . GLY B 1 57  ? 10.062  -13.787 -70.228 1.00 85.68  ? 57  GLY B O   1 
ATOM   3948 N  N   . ARG B 1 58  ? 7.888   -14.367 -70.244 1.00 105.89 ? 58  ARG B N   1 
ATOM   3949 C  CA  . ARG B 1 58  ? 7.456   -12.998 -70.468 1.00 114.37 ? 58  ARG B CA  1 
ATOM   3950 C  C   . ARG B 1 58  ? 7.707   -12.172 -69.220 1.00 119.69 ? 58  ARG B C   1 
ATOM   3951 O  O   . ARG B 1 58  ? 7.332   -12.575 -68.115 1.00 119.28 ? 58  ARG B O   1 
ATOM   3952 C  CB  . ARG B 1 58  ? 5.974   -12.944 -70.822 1.00 115.24 ? 58  ARG B CB  1 
ATOM   3953 C  CG  . ARG B 1 58  ? 5.640   -13.509 -72.182 1.00 117.47 ? 58  ARG B CG  1 
ATOM   3954 C  CD  . ARG B 1 58  ? 5.999   -12.542 -73.291 1.00 119.00 ? 58  ARG B CD  1 
ATOM   3955 N  NE  . ARG B 1 58  ? 4.988   -11.500 -73.472 1.00 119.42 ? 58  ARG B NE  1 
ATOM   3956 C  CZ  . ARG B 1 58  ? 3.955   -11.596 -74.305 1.00 119.57 ? 58  ARG B CZ  1 
ATOM   3957 N  NH1 . ARG B 1 58  ? 3.092   -10.593 -74.414 1.00 119.62 1 58  ARG B NH1 1 
ATOM   3958 N  NH2 . ARG B 1 58  ? 3.785   -12.694 -75.033 1.00 119.63 ? 58  ARG B NH2 1 
ATOM   3959 N  N   . PRO B 1 59  ? 8.341   -11.005 -69.394 1.00 139.98 ? 59  PRO B N   1 
ATOM   3960 C  CA  . PRO B 1 59  ? 8.529   -10.069 -68.285 1.00 141.49 ? 59  PRO B CA  1 
ATOM   3961 C  C   . PRO B 1 59  ? 7.179   -9.596  -67.775 1.00 140.24 ? 59  PRO B C   1 
ATOM   3962 O  O   . PRO B 1 59  ? 6.306   -9.236  -68.570 1.00 142.16 ? 59  PRO B O   1 
ATOM   3963 C  CB  . PRO B 1 59  ? 9.285   -8.908  -68.932 1.00 143.62 ? 59  PRO B CB  1 
ATOM   3964 C  CG  . PRO B 1 59  ? 9.960   -9.514  -70.112 1.00 144.27 ? 59  PRO B CG  1 
ATOM   3965 C  CD  . PRO B 1 59  ? 9.017   -10.554 -70.621 1.00 142.39 ? 59  PRO B CD  1 
ATOM   3966 N  N   . ALA B 1 60  ? 7.017   -9.590  -66.457 1.00 127.37 ? 60  ALA B N   1 
ATOM   3967 C  CA  . ALA B 1 60  ? 5.751   -9.231  -65.836 1.00 123.82 ? 60  ALA B CA  1 
ATOM   3968 C  C   . ALA B 1 60  ? 5.329   -7.801  -66.159 1.00 122.65 ? 60  ALA B C   1 
ATOM   3969 O  O   . ALA B 1 60  ? 4.181   -7.417  -65.923 1.00 121.54 ? 60  ALA B O   1 
ATOM   3970 C  CB  . ALA B 1 60  ? 5.830   -9.427  -64.342 1.00 122.43 ? 60  ALA B CB  1 
ATOM   3971 N  N   . SER B 1 61  ? 6.252   -7.013  -66.695 1.00 144.18 ? 61  SER B N   1 
ATOM   3972 C  CA  . SER B 1 61  ? 5.950   -5.630  -67.023 1.00 145.29 ? 61  SER B CA  1 
ATOM   3973 C  C   . SER B 1 61  ? 5.063   -5.540  -68.261 1.00 140.84 ? 61  SER B C   1 
ATOM   3974 O  O   . SER B 1 61  ? 4.555   -4.469  -68.592 1.00 143.32 ? 61  SER B O   1 
ATOM   3975 C  CB  . SER B 1 61  ? 7.241   -4.842  -67.239 1.00 149.62 ? 61  SER B CB  1 
ATOM   3976 O  OG  . SER B 1 61  ? 8.174   -5.600  -67.991 1.00 156.24 ? 61  SER B OG  1 
ATOM   3977 N  N   . GLU B 1 62  ? 4.880   -6.664  -68.946 1.00 117.83 ? 62  GLU B N   1 
ATOM   3978 C  CA  . GLU B 1 62  ? 4.077   -6.672  -70.162 1.00 112.56 ? 62  GLU B CA  1 
ATOM   3979 C  C   . GLU B 1 62  ? 2.596   -6.908  -69.882 1.00 107.23 ? 62  GLU B C   1 
ATOM   3980 O  O   . GLU B 1 62  ? 1.764   -6.762  -70.776 1.00 106.66 ? 62  GLU B O   1 
ATOM   3981 C  CB  . GLU B 1 62  ? 4.591   -7.715  -71.157 1.00 115.09 ? 62  GLU B CB  1 
ATOM   3982 C  CG  . GLU B 1 62  ? 5.957   -7.396  -71.748 1.00 120.43 ? 62  GLU B CG  1 
ATOM   3983 C  CD  . GLU B 1 62  ? 6.378   -8.397  -72.811 1.00 124.89 ? 62  GLU B CD  1 
ATOM   3984 O  OE1 . GLU B 1 62  ? 5.587   -9.321  -73.097 1.00 125.92 ? 62  GLU B OE1 1 
ATOM   3985 O  OE2 . GLU B 1 62  ? 7.487   -8.250  -73.374 1.00 125.92 1 62  GLU B OE2 1 
ATOM   3986 N  N   . SER B 1 63  ? 2.268   -7.270  -68.647 1.00 114.64 ? 63  SER B N   1 
ATOM   3987 C  CA  . SER B 1 63  ? 0.896   -7.626  -68.308 1.00 110.00 ? 63  SER B CA  1 
ATOM   3988 C  C   . SER B 1 63  ? -0.044  -6.427  -68.350 1.00 103.52 ? 63  SER B C   1 
ATOM   3989 O  O   . SER B 1 63  ? 0.187   -5.423  -67.675 1.00 103.64 ? 63  SER B O   1 
ATOM   3990 C  CB  . SER B 1 63  ? 0.829   -8.288  -66.937 1.00 111.88 ? 63  SER B CB  1 
ATOM   3991 O  OG  . SER B 1 63  ? -0.517  -8.561  -66.590 1.00 118.56 ? 63  SER B OG  1 
ATOM   3992 N  N   . PRO B 1 64  ? -1.110  -6.531  -69.158 1.00 94.27  ? 64  PRO B N   1 
ATOM   3993 C  CA  . PRO B 1 64  ? -2.179  -5.543  -69.294 1.00 93.43  ? 64  PRO B CA  1 
ATOM   3994 C  C   . PRO B 1 64  ? -3.056  -5.525  -68.054 1.00 97.10  ? 64  PRO B C   1 
ATOM   3995 O  O   . PRO B 1 64  ? -3.678  -4.503  -67.757 1.00 97.48  ? 64  PRO B O   1 
ATOM   3996 C  CB  . PRO B 1 64  ? -2.985  -6.083  -70.470 1.00 88.97  ? 64  PRO B CB  1 
ATOM   3997 C  CG  . PRO B 1 64  ? -2.852  -7.545  -70.336 1.00 83.40  ? 64  PRO B CG  1 
ATOM   3998 C  CD  . PRO B 1 64  ? -1.464  -7.792  -69.822 1.00 89.55  ? 64  PRO B CD  1 
ATOM   3999 N  N   . HIS B 1 65  ? -3.098  -6.654  -67.346 1.00 101.25 ? 65  HIS B N   1 
ATOM   4000 C  CA  . HIS B 1 65  ? -3.968  -6.827  -66.196 1.00 105.32 ? 65  HIS B CA  1 
ATOM   4001 C  C   . HIS B 1 65  ? -3.536  -5.919  -65.056 1.00 112.48 ? 65  HIS B C   1 
ATOM   4002 O  O   . HIS B 1 65  ? -2.350  -5.619  -64.905 1.00 114.87 ? 65  HIS B O   1 
ATOM   4003 C  CB  . HIS B 1 65  ? -3.964  -8.283  -65.728 1.00 101.01 ? 65  HIS B CB  1 
ATOM   4004 C  CG  . HIS B 1 65  ? -4.229  -9.278  -66.812 1.00 88.75  ? 65  HIS B CG  1 
ATOM   4005 N  ND1 . HIS B 1 65  ? -5.426  -9.330  -67.502 1.00 78.61  ? 65  HIS B ND1 1 
ATOM   4006 C  CD2 . HIS B 1 65  ? -3.484  -10.298 -67.295 1.00 78.98  ? 65  HIS B CD2 1 
ATOM   4007 C  CE1 . HIS B 1 65  ? -5.388  -10.313 -68.375 1.00 76.00  ? 65  HIS B CE1 1 
ATOM   4008 N  NE2 . HIS B 1 65  ? -4.224  -10.925 -68.267 1.00 80.38  ? 65  HIS B NE2 1 
ATOM   4009 N  N   . HIS B 1 66  ? -4.504  -5.461  -64.271 1.00 133.76 ? 66  HIS B N   1 
ATOM   4010 C  CA  . HIS B 1 66  ? -4.203  -4.659  -63.098 1.00 137.50 ? 66  HIS B CA  1 
ATOM   4011 C  C   . HIS B 1 66  ? -3.904  -5.555  -61.907 1.00 136.71 ? 66  HIS B C   1 
ATOM   4012 O  O   . HIS B 1 66  ? -4.728  -6.389  -61.527 1.00 138.39 ? 66  HIS B O   1 
ATOM   4013 C  CB  . HIS B 1 66  ? -5.374  -3.748  -62.756 1.00 140.23 ? 66  HIS B CB  1 
ATOM   4014 C  CG  . HIS B 1 66  ? -5.394  -3.319  -61.322 1.00 143.98 ? 66  HIS B CG  1 
ATOM   4015 N  ND1 . HIS B 1 66  ? -4.375  -2.585  -60.750 1.00 146.08 ? 66  HIS B ND1 1 
ATOM   4016 C  CD2 . HIS B 1 66  ? -6.295  -3.537  -60.339 1.00 146.05 ? 66  HIS B CD2 1 
ATOM   4017 C  CE1 . HIS B 1 66  ? -4.658  -2.360  -59.482 1.00 146.54 ? 66  HIS B CE1 1 
ATOM   4018 N  NE2 . HIS B 1 66  ? -5.818  -2.926  -59.206 1.00 146.54 ? 66  HIS B NE2 1 
ATOM   4019 N  N   . HIS B 1 67  ? -2.726  -5.387  -61.320 1.00 117.06 ? 67  HIS B N   1 
ATOM   4020 C  CA  . HIS B 1 67  ? -2.338  -6.208  -60.186 1.00 113.53 ? 67  HIS B CA  1 
ATOM   4021 C  C   . HIS B 1 67  ? -2.374  -5.403  -58.900 1.00 114.73 ? 67  HIS B C   1 
ATOM   4022 O  O   . HIS B 1 67  ? -2.026  -4.220  -58.884 1.00 114.55 ? 67  HIS B O   1 
ATOM   4023 C  CB  . HIS B 1 67  ? -0.935  -6.769  -60.391 1.00 110.73 ? 67  HIS B CB  1 
ATOM   4024 C  CG  . HIS B 1 67  ? -0.814  -7.672  -61.577 1.00 101.97 ? 67  HIS B CG  1 
ATOM   4025 N  ND1 . HIS B 1 67  ? -0.315  -8.955  -61.491 1.00 95.77  ? 67  HIS B ND1 1 
ATOM   4026 C  CD2 . HIS B 1 67  ? -1.117  -7.480  -62.882 1.00 95.39  ? 67  HIS B CD2 1 
ATOM   4027 C  CE1 . HIS B 1 67  ? -0.321  -9.510  -62.686 1.00 94.15  ? 67  HIS B CE1 1 
ATOM   4028 N  NE2 . HIS B 1 67  ? -0.802  -8.633  -63.550 1.00 94.05  ? 67  HIS B NE2 1 
ATOM   4029 N  N   . THR B 1 68  ? -2.806  -6.047  -57.823 1.00 125.48 ? 68  THR B N   1 
ATOM   4030 C  CA  . THR B 1 68  ? -2.690  -5.470  -56.494 1.00 128.78 ? 68  THR B CA  1 
ATOM   4031 C  C   . THR B 1 68  ? -1.847  -6.391  -55.639 1.00 135.83 ? 68  THR B C   1 
ATOM   4032 O  O   . THR B 1 68  ? -2.133  -7.585  -55.528 1.00 133.62 ? 68  THR B O   1 
ATOM   4033 C  CB  . THR B 1 68  ? -4.050  -5.272  -55.826 1.00 125.73 ? 68  THR B CB  1 
ATOM   4034 O  OG1 . THR B 1 68  ? -4.867  -6.425  -56.062 1.00 122.30 ? 68  THR B OG1 1 
ATOM   4035 C  CG2 . THR B 1 68  ? -4.735  -4.041  -56.384 1.00 122.25 ? 68  THR B CG2 1 
ATOM   4036 N  N   . ALA B 1 69  ? -0.802  -5.832  -55.043 1.00 140.71 ? 69  ALA B N   1 
ATOM   4037 C  CA  . ALA B 1 69  ? 0.114   -6.612  -54.233 1.00 146.67 ? 69  ALA B CA  1 
ATOM   4038 C  C   . ALA B 1 69  ? -0.388  -6.692  -52.801 1.00 147.77 ? 69  ALA B C   1 
ATOM   4039 O  O   . ALA B 1 69  ? -1.050  -5.769  -52.321 1.00 150.04 ? 69  ALA B O   1 
ATOM   4040 C  CB  . ALA B 1 69  ? 1.501   -6.002  -54.278 1.00 149.68 ? 69  ALA B CB  1 
ATOM   4041 N  N   . PRO B 1 70  ? -0.081  -7.808  -52.118 1.00 133.87 ? 70  PRO B N   1 
ATOM   4042 C  CA  . PRO B 1 70  ? -0.444  -7.971  -50.710 1.00 133.48 ? 70  PRO B CA  1 
ATOM   4043 C  C   . PRO B 1 70  ? 0.102   -6.829  -49.876 1.00 134.42 ? 70  PRO B C   1 
ATOM   4044 O  O   . PRO B 1 70  ? 1.175   -6.296  -50.164 1.00 133.44 ? 70  PRO B O   1 
ATOM   4045 C  CB  . PRO B 1 70  ? 0.256   -9.273  -50.319 1.00 132.37 ? 70  PRO B CB  1 
ATOM   4046 C  CG  . PRO B 1 70  ? 0.339   -10.034 -51.582 1.00 132.00 ? 70  PRO B CG  1 
ATOM   4047 C  CD  . PRO B 1 70  ? 0.570   -9.013  -52.660 1.00 132.74 ? 70  PRO B CD  1 
ATOM   4048 N  N   . ALA B 1 71  ? -0.645  -6.460  -48.845 1.00 135.47 ? 71  ALA B N   1 
ATOM   4049 C  CA  . ALA B 1 71  ? -0.241  -5.383  -47.968 1.00 137.49 ? 71  ALA B CA  1 
ATOM   4050 C  C   . ALA B 1 71  ? -0.415  -5.823  -46.529 1.00 137.64 ? 71  ALA B C   1 
ATOM   4051 O  O   . ALA B 1 71  ? -0.788  -6.966  -46.252 1.00 139.75 ? 71  ALA B O   1 
ATOM   4052 C  CB  . ALA B 1 71  ? -1.058  -4.136  -48.247 1.00 139.10 ? 71  ALA B CB  1 
ATOM   4053 N  N   . LYS B 1 72  ? -0.149  -4.909  -45.611 1.00 144.18 ? 72  LYS B N   1 
ATOM   4054 C  CA  . LYS B 1 72  ? -0.289  -5.214  -44.204 1.00 140.76 ? 72  LYS B CA  1 
ATOM   4055 C  C   . LYS B 1 72  ? -1.616  -4.666  -43.707 1.00 138.16 ? 72  LYS B C   1 
ATOM   4056 O  O   . LYS B 1 72  ? -1.935  -3.493  -43.916 1.00 138.27 ? 72  LYS B O   1 
ATOM   4057 C  CB  . LYS B 1 72  ? 0.886   -4.632  -43.421 1.00 140.79 ? 72  LYS B CB  1 
ATOM   4058 C  CG  . LYS B 1 72  ? 2.235   -4.973  -44.043 1.00 140.81 ? 72  LYS B CG  1 
ATOM   4059 C  CD  . LYS B 1 72  ? 3.393   -4.687  -43.105 1.00 141.05 ? 72  LYS B CD  1 
ATOM   4060 C  CE  . LYS B 1 72  ? 4.717   -5.063  -43.754 1.00 141.12 ? 72  LYS B CE  1 
ATOM   4061 N  NZ  . LYS B 1 72  ? 5.853   -5.014  -42.795 1.00 141.19 1 72  LYS B NZ  1 
ATOM   4062 N  N   . SER B 1 73  ? -2.394  -5.527  -43.063 1.00 129.85 ? 73  SER B N   1 
ATOM   4063 C  CA  . SER B 1 73  ? -3.694  -5.133  -42.550 1.00 125.70 ? 73  SER B CA  1 
ATOM   4064 C  C   . SER B 1 73  ? -3.537  -4.251  -41.323 1.00 122.77 ? 73  SER B C   1 
ATOM   4065 O  O   . SER B 1 73  ? -2.639  -4.465  -40.503 1.00 124.14 ? 73  SER B O   1 
ATOM   4066 C  CB  . SER B 1 73  ? -4.544  -6.361  -42.224 1.00 125.48 ? 73  SER B CB  1 
ATOM   4067 O  OG  . SER B 1 73  ? -4.934  -7.023  -43.413 1.00 122.65 ? 73  SER B OG  1 
ATOM   4068 N  N   . PRO B 1 74  ? -4.418  -3.254  -41.192 1.00 120.60 ? 74  PRO B N   1 
ATOM   4069 C  CA  . PRO B 1 74  ? -4.429  -2.371  -40.026 1.00 117.41 ? 74  PRO B CA  1 
ATOM   4070 C  C   . PRO B 1 74  ? -4.815  -3.161  -38.788 1.00 114.67 ? 74  PRO B C   1 
ATOM   4071 O  O   . PRO B 1 74  ? -5.317  -4.284  -38.917 1.00 115.05 ? 74  PRO B O   1 
ATOM   4072 C  CB  . PRO B 1 74  ? -5.528  -1.365  -40.366 1.00 117.21 ? 74  PRO B CB  1 
ATOM   4073 C  CG  . PRO B 1 74  ? -6.425  -2.102  -41.299 1.00 117.65 ? 74  PRO B CG  1 
ATOM   4074 C  CD  . PRO B 1 74  ? -5.512  -2.945  -42.129 1.00 119.35 ? 74  PRO B CD  1 
ATOM   4075 N  N   . LYS B 1 75  ? -4.560  -2.594  -37.612 1.00 124.63 ? 75  LYS B N   1 
ATOM   4076 C  CA  . LYS B 1 75  ? -4.901  -3.248  -36.355 1.00 120.61 ? 75  LYS B CA  1 
ATOM   4077 C  C   . LYS B 1 75  ? -6.375  -3.606  -36.310 1.00 116.42 ? 75  LYS B C   1 
ATOM   4078 O  O   . LYS B 1 75  ? -6.761  -4.680  -35.842 1.00 117.65 ? 75  LYS B O   1 
ATOM   4079 C  CB  . LYS B 1 75  ? -4.596  -2.328  -35.180 1.00 121.64 ? 75  LYS B CB  1 
ATOM   4080 C  CG  . LYS B 1 75  ? -3.153  -1.933  -35.047 1.00 122.78 ? 75  LYS B CG  1 
ATOM   4081 C  CD  . LYS B 1 75  ? -2.934  -1.301  -33.694 1.00 123.63 ? 75  LYS B CD  1 
ATOM   4082 C  CE  . LYS B 1 75  ? -1.526  -0.794  -33.554 1.00 123.81 ? 75  LYS B CE  1 
ATOM   4083 N  NZ  . LYS B 1 75  ? -1.331  0.461   -34.328 1.00 123.90 1 75  LYS B NZ  1 
ATOM   4084 N  N   . ILE B 1 76  ? -7.196  -2.692  -36.804 1.00 103.29 ? 76  ILE B N   1 
ATOM   4085 C  CA  . ILE B 1 76  ? -8.626  -2.881  -36.782 1.00 96.74  ? 76  ILE B CA  1 
ATOM   4086 C  C   . ILE B 1 76  ? -9.152  -2.986  -38.195 1.00 97.97  ? 76  ILE B C   1 
ATOM   4087 O  O   . ILE B 1 76  ? -9.082  -2.030  -38.970 1.00 96.28  ? 76  ILE B O   1 
ATOM   4088 C  CB  . ILE B 1 76  ? -9.315  -1.728  -36.069 1.00 93.72  ? 76  ILE B CB  1 
ATOM   4089 C  CG1 . ILE B 1 76  ? -8.798  -1.630  -34.637 1.00 86.91  ? 76  ILE B CG1 1 
ATOM   4090 C  CG2 . ILE B 1 76  ? -10.818 -1.924  -36.084 1.00 88.70  ? 76  ILE B CG2 1 
ATOM   4091 C  CD1 . ILE B 1 76  ? -9.330  -0.435  -33.892 1.00 80.53  ? 76  ILE B CD1 1 
ATOM   4092 N  N   . LEU B 1 77  ? -9.690  -4.153  -38.518 1.00 94.62  ? 77  LEU B N   1 
ATOM   4093 C  CA  . LEU B 1 77  ? -10.229 -4.409  -39.838 1.00 95.66  ? 77  LEU B CA  1 
ATOM   4094 C  C   . LEU B 1 77  ? -11.523 -3.636  -39.975 1.00 97.83  ? 77  LEU B C   1 
ATOM   4095 O  O   . LEU B 1 77  ? -12.412 -3.761  -39.133 1.00 101.75 ? 77  LEU B O   1 
ATOM   4096 C  CB  . LEU B 1 77  ? -10.491 -5.901  -40.020 1.00 93.23  ? 77  LEU B CB  1 
ATOM   4097 C  CG  . LEU B 1 77  ? -9.343  -6.840  -40.402 1.00 83.28  ? 77  LEU B CG  1 
ATOM   4098 C  CD1 . LEU B 1 77  ? -8.035  -6.451  -39.761 1.00 73.11  ? 77  LEU B CD1 1 
ATOM   4099 C  CD2 . LEU B 1 77  ? -9.698  -8.246  -39.980 1.00 73.71  ? 77  LEU B CD2 1 
ATOM   4100 N  N   . PRO B 1 78  ? -11.631 -2.824  -41.033 1.00 97.77  ? 78  PRO B N   1 
ATOM   4101 C  CA  . PRO B 1 78  ? -12.808 -1.980  -41.265 1.00 96.73  ? 78  PRO B CA  1 
ATOM   4102 C  C   . PRO B 1 78  ? -14.044 -2.813  -41.557 1.00 96.75  ? 78  PRO B C   1 
ATOM   4103 O  O   . PRO B 1 78  ? -15.160 -2.358  -41.315 1.00 98.53  ? 78  PRO B O   1 
ATOM   4104 C  CB  . PRO B 1 78  ? -12.414 -1.161  -42.493 1.00 93.89  ? 78  PRO B CB  1 
ATOM   4105 C  CG  . PRO B 1 78  ? -11.378 -1.982  -43.172 1.00 92.90  ? 78  PRO B CG  1 
ATOM   4106 C  CD  . PRO B 1 78  ? -10.612 -2.648  -42.078 1.00 94.43  ? 78  PRO B CD  1 
ATOM   4107 N  N   . ASP B 1 79  ? -13.844 -4.007  -42.101 1.00 109.15 ? 79  ASP B N   1 
ATOM   4108 C  CA  . ASP B 1 79  ? -14.915 -4.985  -42.219 1.00 106.69 ? 79  ASP B CA  1 
ATOM   4109 C  C   . ASP B 1 79  ? -14.305 -6.366  -42.312 1.00 104.53 ? 79  ASP B C   1 
ATOM   4110 O  O   . ASP B 1 79  ? -13.106 -6.510  -42.558 1.00 102.81 ? 79  ASP B O   1 
ATOM   4111 C  CB  . ASP B 1 79  ? -15.848 -4.701  -43.400 1.00 107.11 ? 79  ASP B CB  1 
ATOM   4112 C  CG  . ASP B 1 79  ? -15.111 -4.584  -44.718 1.00 110.76 ? 79  ASP B CG  1 
ATOM   4113 O  OD1 . ASP B 1 79  ? -14.180 -5.378  -44.975 1.00 115.97 ? 79  ASP B OD1 1 
ATOM   4114 O  OD2 . ASP B 1 79  ? -15.478 -3.692  -45.511 1.00 115.98 1 79  ASP B OD2 1 
ATOM   4115 N  N   . ILE B 1 80  ? -15.132 -7.380  -42.108 1.00 83.03  ? 80  ILE B N   1 
ATOM   4116 C  CA  . ILE B 1 80  ? -14.661 -8.753  -42.085 1.00 82.32  ? 80  ILE B CA  1 
ATOM   4117 C  C   . ILE B 1 80  ? -14.011 -9.176  -43.407 1.00 86.50  ? 80  ILE B C   1 
ATOM   4118 O  O   . ILE B 1 80  ? -13.222 -10.119 -43.448 1.00 87.05  ? 80  ILE B O   1 
ATOM   4119 C  CB  . ILE B 1 80  ? -15.811 -9.705  -41.733 1.00 78.99  ? 80  ILE B CB  1 
ATOM   4120 C  CG1 . ILE B 1 80  ? -15.294 -11.127 -41.526 1.00 72.03  ? 80  ILE B CG1 1 
ATOM   4121 C  CG2 . ILE B 1 80  ? -16.865 -9.662  -42.815 1.00 74.36  ? 80  ILE B CG2 1 
ATOM   4122 C  CD1 . ILE B 1 80  ? -14.240 -11.223 -40.438 1.00 63.94  ? 80  ILE B CD1 1 
ATOM   4123 N  N   . LEU B 1 81  ? -14.327 -8.471  -44.487 1.00 93.95  ? 81  LEU B N   1 
ATOM   4124 C  CA  . LEU B 1 81  ? -13.805 -8.831  -45.801 1.00 96.34  ? 81  LEU B CA  1 
ATOM   4125 C  C   . LEU B 1 81  ? -12.282 -8.755  -45.892 1.00 98.51  ? 81  LEU B C   1 
ATOM   4126 O  O   . LEU B 1 81  ? -11.669 -9.443  -46.709 1.00 100.92 ? 81  LEU B O   1 
ATOM   4127 C  CB  . LEU B 1 81  ? -14.432 -7.947  -46.870 1.00 94.54  ? 81  LEU B CB  1 
ATOM   4128 C  CG  . LEU B 1 81  ? -15.946 -8.108  -46.944 1.00 90.63  ? 81  LEU B CG  1 
ATOM   4129 C  CD1 . LEU B 1 81  ? -16.527 -7.243  -48.047 1.00 89.59  ? 81  LEU B CD1 1 
ATOM   4130 C  CD2 . LEU B 1 81  ? -16.282 -9.566  -47.171 1.00 87.37  ? 81  LEU B CD2 1 
ATOM   4131 N  N   . LYS B 1 82  ? -11.674 -7.934  -45.043 1.00 104.47 ? 82  LYS B N   1 
ATOM   4132 C  CA  . LYS B 1 82  ? -10.225 -7.780  -45.037 1.00 103.01 ? 82  LYS B CA  1 
ATOM   4133 C  C   . LYS B 1 82  ? -9.548  -8.957  -44.352 1.00 103.52 ? 82  LYS B C   1 
ATOM   4134 O  O   . LYS B 1 82  ? -8.324  -9.076  -44.365 1.00 104.03 ? 82  LYS B O   1 
ATOM   4135 C  CB  . LYS B 1 82  ? -9.824  -6.480  -44.347 1.00 101.59 ? 82  LYS B CB  1 
ATOM   4136 C  CG  . LYS B 1 82  ? -10.276 -5.210  -45.049 1.00 97.77  ? 82  LYS B CG  1 
ATOM   4137 C  CD  . LYS B 1 82  ? -9.430  -4.928  -46.285 1.00 95.79  ? 82  LYS B CD  1 
ATOM   4138 C  CE  . LYS B 1 82  ? -9.833  -3.611  -46.947 1.00 96.38  ? 82  LYS B CE  1 
ATOM   4139 N  NZ  . LYS B 1 82  ? -11.194 -3.657  -47.571 1.00 94.05  1 82  LYS B NZ  1 
ATOM   4140 N  N   . LYS B 1 83  ? -10.353 -9.833  -43.765 1.00 96.43  ? 83  LYS B N   1 
ATOM   4141 C  CA  . LYS B 1 83  ? -9.839  -10.989 -43.042 1.00 95.83  ? 83  LYS B CA  1 
ATOM   4142 C  C   . LYS B 1 83  ? -9.569  -12.108 -44.039 1.00 94.96  ? 83  LYS B C   1 
ATOM   4143 O  O   . LYS B 1 83  ? -9.161  -13.215 -43.684 1.00 95.65  ? 83  LYS B O   1 
ATOM   4144 C  CB  . LYS B 1 83  ? -10.832 -11.426 -41.958 1.00 96.27  ? 83  LYS B CB  1 
ATOM   4145 C  CG  . LYS B 1 83  ? -10.399 -12.593 -41.078 1.00 95.52  ? 83  LYS B CG  1 
ATOM   4146 C  CD  . LYS B 1 83  ? -8.973  -12.438 -40.577 1.00 95.53  ? 83  LYS B CD  1 
ATOM   4147 C  CE  . LYS B 1 83  ? -8.544  -13.653 -39.760 1.00 97.40  ? 83  LYS B CE  1 
ATOM   4148 N  NZ  . LYS B 1 83  ? -8.580  -14.925 -40.537 1.00 99.10  1 83  LYS B NZ  1 
ATOM   4149 N  N   . ILE B 1 84  ? -9.811  -11.816 -45.306 1.00 110.18 ? 84  ILE B N   1 
ATOM   4150 C  CA  . ILE B 1 84  ? -9.512  -12.775 -46.347 1.00 107.81 ? 84  ILE B CA  1 
ATOM   4151 C  C   . ILE B 1 84  ? -8.036  -12.711 -46.728 1.00 106.03 ? 84  ILE B C   1 
ATOM   4152 O  O   . ILE B 1 84  ? -7.519  -11.646 -47.073 1.00 105.92 ? 84  ILE B O   1 
ATOM   4153 C  CB  . ILE B 1 84  ? -10.385 -12.528 -47.567 1.00 107.57 ? 84  ILE B CB  1 
ATOM   4154 C  CG1 . ILE B 1 84  ? -11.848 -12.781 -47.198 1.00 105.70 ? 84  ILE B CG1 1 
ATOM   4155 C  CG2 . ILE B 1 84  ? -9.963  -13.440 -48.697 1.00 109.99 ? 84  ILE B CG2 1 
ATOM   4156 C  CD1 . ILE B 1 84  ? -12.831 -12.171 -48.151 1.00 95.43  ? 84  ILE B CD1 1 
ATOM   4157 N  N   . GLY B 1 85  ? -7.364  -13.856 -46.659 1.00 110.98 ? 85  GLY B N   1 
ATOM   4158 C  CA  . GLY B 1 85  ? -5.954  -13.943 -46.984 1.00 108.07 ? 85  GLY B CA  1 
ATOM   4159 C  C   . GLY B 1 85  ? -5.038  -14.102 -45.785 1.00 105.86 ? 85  GLY B C   1 
ATOM   4160 O  O   . GLY B 1 85  ? -5.488  -14.083 -44.634 1.00 106.40 ? 85  GLY B O   1 
ATOM   4161 N  N   . ASP B 1 86  ? -3.747  -14.253 -46.074 1.00 97.09  ? 86  ASP B N   1 
ATOM   4162 C  CA  . ASP B 1 86  ? -2.716  -14.485 -45.064 1.00 95.43  ? 86  ASP B CA  1 
ATOM   4163 C  C   . ASP B 1 86  ? -2.962  -15.761 -44.288 1.00 90.53  ? 86  ASP B C   1 
ATOM   4164 O  O   . ASP B 1 86  ? -2.731  -15.834 -43.076 1.00 89.23  ? 86  ASP B O   1 
ATOM   4165 C  CB  . ASP B 1 86  ? -2.574  -13.299 -44.120 1.00 99.03  ? 86  ASP B CB  1 
ATOM   4166 C  CG  . ASP B 1 86  ? -1.619  -12.264 -44.645 1.00 110.85 ? 86  ASP B CG  1 
ATOM   4167 O  OD1 . ASP B 1 86  ? -2.077  -11.332 -45.341 1.00 121.77 ? 86  ASP B OD1 1 
ATOM   4168 O  OD2 . ASP B 1 86  ? -0.406  -12.395 -44.373 1.00 121.77 1 86  ASP B OD2 1 
ATOM   4169 N  N   . THR B 1 87  ? -3.422  -16.774 -45.004 1.00 75.06  ? 87  THR B N   1 
ATOM   4170 C  CA  . THR B 1 87  ? -3.710  -18.059 -44.406 1.00 72.66  ? 87  THR B CA  1 
ATOM   4171 C  C   . THR B 1 87  ? -2.422  -18.751 -44.007 1.00 70.34  ? 87  THR B C   1 
ATOM   4172 O  O   . THR B 1 87  ? -1.414  -18.632 -44.699 1.00 68.71  ? 87  THR B O   1 
ATOM   4173 C  CB  . THR B 1 87  ? -4.487  -18.936 -45.377 1.00 72.46  ? 87  THR B CB  1 
ATOM   4174 O  OG1 . THR B 1 87  ? -3.908  -18.810 -46.680 1.00 75.71  ? 87  THR B OG1 1 
ATOM   4175 C  CG2 . THR B 1 87  ? -5.935  -18.481 -45.431 1.00 75.71  ? 87  THR B CG2 1 
ATOM   4176 N  N   . PRO B 1 88  ? -2.450  -19.467 -42.876 1.00 72.98  ? 88  PRO B N   1 
ATOM   4177 C  CA  . PRO B 1 88  ? -1.265  -20.124 -42.317 1.00 74.44  ? 88  PRO B CA  1 
ATOM   4178 C  C   . PRO B 1 88  ? -0.821  -21.375 -43.069 1.00 77.74  ? 88  PRO B C   1 
ATOM   4179 O  O   . PRO B 1 88  ? -1.647  -22.140 -43.573 1.00 77.77  ? 88  PRO B O   1 
ATOM   4180 C  CB  . PRO B 1 88  ? -1.725  -20.522 -40.916 1.00 72.86  ? 88  PRO B CB  1 
ATOM   4181 C  CG  . PRO B 1 88  ? -3.191  -20.709 -41.065 1.00 70.69  ? 88  PRO B CG  1 
ATOM   4182 C  CD  . PRO B 1 88  ? -3.626  -19.631 -42.007 1.00 71.43  ? 88  PRO B CD  1 
ATOM   4183 N  N   . MET B 1 89  ? 0.490   -21.578 -43.118 1.00 75.57  ? 89  MET B N   1 
ATOM   4184 C  CA  . MET B 1 89  ? 1.085   -22.801 -43.628 1.00 78.41  ? 89  MET B CA  1 
ATOM   4185 C  C   . MET B 1 89  ? 1.398   -23.685 -42.432 1.00 76.15  ? 89  MET B C   1 
ATOM   4186 O  O   . MET B 1 89  ? 1.898   -23.192 -41.422 1.00 77.90  ? 89  MET B O   1 
ATOM   4187 C  CB  . MET B 1 89  ? 2.375   -22.467 -44.373 1.00 81.67  ? 89  MET B CB  1 
ATOM   4188 C  CG  . MET B 1 89  ? 3.120   -23.650 -44.965 1.00 88.62  ? 89  MET B CG  1 
ATOM   4189 S  SD  . MET B 1 89  ? 2.523   -24.154 -46.581 1.00 96.42  ? 89  MET B SD  1 
ATOM   4190 C  CE  . MET B 1 89  ? 2.695   -22.608 -47.472 1.00 98.75  ? 89  MET B CE  1 
ATOM   4191 N  N   . VAL B 1 90  ? 1.103   -24.976 -42.521 1.00 68.95  ? 90  VAL B N   1 
ATOM   4192 C  CA  . VAL B 1 90  ? 1.255   -25.860 -41.371 1.00 65.72  ? 90  VAL B CA  1 
ATOM   4193 C  C   . VAL B 1 90  ? 1.857   -27.213 -41.721 1.00 64.80  ? 90  VAL B C   1 
ATOM   4194 O  O   . VAL B 1 90  ? 1.372   -27.896 -42.619 1.00 61.65  ? 90  VAL B O   1 
ATOM   4195 C  CB  . VAL B 1 90  ? -0.094  -26.096 -40.683 1.00 65.28  ? 90  VAL B CB  1 
ATOM   4196 C  CG1 . VAL B 1 90  ? 0.017   -27.223 -39.672 1.00 65.63  ? 90  VAL B CG1 1 
ATOM   4197 C  CG2 . VAL B 1 90  ? -0.571  -24.823 -40.009 1.00 68.30  ? 90  VAL B CG2 1 
ATOM   4198 N  N   . ARG B 1 91  ? 2.894   -27.611 -40.990 1.00 66.51  ? 91  ARG B N   1 
ATOM   4199 C  CA  . ARG B 1 91  ? 3.552   -28.893 -41.213 1.00 71.36  ? 91  ARG B CA  1 
ATOM   4200 C  C   . ARG B 1 91  ? 2.628   -30.067 -40.881 1.00 73.81  ? 91  ARG B C   1 
ATOM   4201 O  O   . ARG B 1 91  ? 1.947   -30.057 -39.851 1.00 73.29  ? 91  ARG B O   1 
ATOM   4202 C  CB  . ARG B 1 91  ? 4.826   -28.971 -40.367 1.00 71.97  ? 91  ARG B CB  1 
ATOM   4203 C  CG  . ARG B 1 91  ? 5.538   -30.316 -40.400 1.00 76.56  ? 91  ARG B CG  1 
ATOM   4204 C  CD  . ARG B 1 91  ? 6.872   -30.257 -39.653 1.00 81.95  ? 91  ARG B CD  1 
ATOM   4205 N  NE  . ARG B 1 91  ? 7.767   -29.245 -40.214 1.00 84.02  ? 91  ARG B NE  1 
ATOM   4206 C  CZ  . ARG B 1 91  ? 8.129   -28.130 -39.583 1.00 84.96  ? 91  ARG B CZ  1 
ATOM   4207 N  NH1 . ARG B 1 91  ? 7.684   -27.886 -38.349 1.00 85.27  1 91  ARG B NH1 1 
ATOM   4208 N  NH2 . ARG B 1 91  ? 8.946   -27.265 -40.180 1.00 85.27  ? 91  ARG B NH2 1 
ATOM   4209 N  N   . ILE B 1 92  ? 2.601   -31.076 -41.746 1.00 64.97  ? 92  ILE B N   1 
ATOM   4210 C  CA  . ILE B 1 92  ? 1.824   -32.269 -41.453 1.00 69.23  ? 92  ILE B CA  1 
ATOM   4211 C  C   . ILE B 1 92  ? 2.728   -33.297 -40.796 1.00 70.63  ? 92  ILE B C   1 
ATOM   4212 O  O   . ILE B 1 92  ? 3.588   -33.904 -41.459 1.00 70.07  ? 92  ILE B O   1 
ATOM   4213 C  CB  . ILE B 1 92  ? 1.281   -32.894 -42.737 1.00 70.75  ? 92  ILE B CB  1 
ATOM   4214 C  CG1 . ILE B 1 92  ? 0.532   -31.847 -43.556 1.00 72.60  ? 92  ILE B CG1 1 
ATOM   4215 C  CG2 . ILE B 1 92  ? 0.401   -34.091 -42.423 1.00 73.02  ? 92  ILE B CG2 1 
ATOM   4216 C  CD1 . ILE B 1 92  ? -0.743  -31.400 -42.929 1.00 74.16  ? 92  ILE B CD1 1 
ATOM   4217 N  N   . ASN B 1 93  ? 2.511   -33.510 -39.500 1.00 72.39  ? 93  ASN B N   1 
ATOM   4218 C  CA  . ASN B 1 93  ? 3.410   -34.339 -38.716 1.00 74.72  ? 93  ASN B CA  1 
ATOM   4219 C  C   . ASN B 1 93  ? 3.266   -35.856 -38.819 1.00 74.99  ? 93  ASN B C   1 
ATOM   4220 O  O   . ASN B 1 93  ? 4.239   -36.560 -39.084 1.00 76.31  ? 93  ASN B O   1 
ATOM   4221 C  CB  . ASN B 1 93  ? 3.365   -33.868 -37.277 1.00 75.77  ? 93  ASN B CB  1 
ATOM   4222 C  CG  . ASN B 1 93  ? 3.773   -32.416 -37.151 1.00 78.05  ? 93  ASN B CG  1 
ATOM   4223 O  OD1 . ASN B 1 93  ? 4.815   -32.009 -37.678 1.00 80.28  ? 93  ASN B OD1 1 
ATOM   4224 N  ND2 . ASN B 1 93  ? 2.945   -31.616 -36.483 1.00 80.24  ? 93  ASN B ND2 1 
ATOM   4225 N  N   . LYS B 1 94  ? 2.061   -36.362 -38.589 1.00 84.00  ? 94  LYS B N   1 
ATOM   4226 C  CA  . LYS B 1 94  ? 1.840   -37.809 -38.541 1.00 84.61  ? 94  LYS B CA  1 
ATOM   4227 C  C   . LYS B 1 94  ? 1.698   -38.549 -39.876 1.00 84.26  ? 94  LYS B C   1 
ATOM   4228 O  O   . LYS B 1 94  ? 2.288   -39.613 -40.069 1.00 81.66  ? 94  LYS B O   1 
ATOM   4229 C  CB  . LYS B 1 94  ? 0.632   -38.122 -37.664 1.00 86.54  ? 94  LYS B CB  1 
ATOM   4230 C  CG  . LYS B 1 94  ? 0.782   -37.635 -36.238 1.00 93.83  ? 94  LYS B CG  1 
ATOM   4231 C  CD  . LYS B 1 94  ? -0.472  -37.935 -35.445 1.00 101.01 ? 94  LYS B CD  1 
ATOM   4232 C  CE  . LYS B 1 94  ? -0.328  -37.499 -34.001 1.00 102.95 ? 94  LYS B CE  1 
ATOM   4233 N  NZ  . LYS B 1 94  ? -1.549  -37.837 -33.219 1.00 103.84 1 94  LYS B NZ  1 
ATOM   4234 N  N   . ILE B 1 95  ? 0.884   -38.005 -40.774 1.00 101.26 ? 95  ILE B N   1 
ATOM   4235 C  CA  . ILE B 1 95  ? 0.482   -38.738 -41.974 1.00 105.03 ? 95  ILE B CA  1 
ATOM   4236 C  C   . ILE B 1 95  ? 1.601   -38.920 -42.997 1.00 109.89 ? 95  ILE B C   1 
ATOM   4237 O  O   . ILE B 1 95  ? 1.750   -39.998 -43.602 1.00 110.09 ? 95  ILE B O   1 
ATOM   4238 C  CB  . ILE B 1 95  ? -0.725  -38.079 -42.645 1.00 103.92 ? 95  ILE B CB  1 
ATOM   4239 C  CG1 . ILE B 1 95  ? -1.911  -38.075 -41.683 1.00 100.57 ? 95  ILE B CG1 1 
ATOM   4240 C  CG2 . ILE B 1 95  ? -1.082  -38.805 -43.926 1.00 101.57 ? 95  ILE B CG2 1 
ATOM   4241 C  CD1 . ILE B 1 95  ? -3.209  -37.648 -42.323 1.00 92.68  ? 95  ILE B CD1 1 
ATOM   4242 N  N   . GLY B 1 96  ? 2.384   -37.862 -43.183 1.00 103.35 ? 96  GLY B N   1 
ATOM   4243 C  CA  . GLY B 1 96  ? 3.504   -37.904 -44.101 1.00 107.53 ? 96  GLY B CA  1 
ATOM   4244 C  C   . GLY B 1 96  ? 4.409   -39.055 -43.731 1.00 108.26 ? 96  GLY B C   1 
ATOM   4245 O  O   . GLY B 1 96  ? 4.827   -39.838 -44.587 1.00 111.41 ? 96  GLY B O   1 
ATOM   4246 N  N   . LYS B 1 97  ? 4.679   -39.186 -42.439 1.00 90.66  ? 97  LYS B N   1 
ATOM   4247 C  CA  . LYS B 1 97  ? 5.541   -40.252 -41.963 1.00 89.02  ? 97  LYS B CA  1 
ATOM   4248 C  C   . LYS B 1 97  ? 4.791   -41.574 -42.017 1.00 85.11  ? 97  LYS B C   1 
ATOM   4249 O  O   . LYS B 1 97  ? 5.401   -42.637 -42.139 1.00 84.87  ? 97  LYS B O   1 
ATOM   4250 C  CB  . LYS B 1 97  ? 6.022   -39.966 -40.538 1.00 92.73  ? 97  LYS B CB  1 
ATOM   4251 C  CG  . LYS B 1 97  ? 6.598   -38.570 -40.360 1.00 98.30  ? 97  LYS B CG  1 
ATOM   4252 C  CD  . LYS B 1 97  ? 7.222   -38.390 -38.987 1.00 102.84 ? 97  LYS B CD  1 
ATOM   4253 C  CE  . LYS B 1 97  ? 7.818   -36.999 -38.840 1.00 103.89 ? 97  LYS B CE  1 
ATOM   4254 N  NZ  . LYS B 1 97  ? 8.765   -36.672 -39.950 1.00 104.34 1 97  LYS B NZ  1 
ATOM   4255 N  N   . LYS B 1 98  ? 3.467   -41.508 -41.925 1.00 100.50 ? 98  LYS B N   1 
ATOM   4256 C  CA  . LYS B 1 98  ? 2.657   -42.715 -41.958 1.00 97.85  ? 98  LYS B CA  1 
ATOM   4257 C  C   . LYS B 1 98  ? 2.792   -43.409 -43.301 1.00 98.26  ? 98  LYS B C   1 
ATOM   4258 O  O   . LYS B 1 98  ? 2.867   -44.639 -43.370 1.00 96.42  ? 98  LYS B O   1 
ATOM   4259 C  CB  . LYS B 1 98  ? 1.188   -42.401 -41.689 1.00 96.43  ? 98  LYS B CB  1 
ATOM   4260 C  CG  . LYS B 1 98  ? 0.313   -43.637 -41.573 1.00 95.15  ? 98  LYS B CG  1 
ATOM   4261 C  CD  . LYS B 1 98  ? -1.152  -43.253 -41.410 1.00 94.63  ? 98  LYS B CD  1 
ATOM   4262 C  CE  . LYS B 1 98  ? -1.987  -44.422 -40.898 1.00 94.58  ? 98  LYS B CE  1 
ATOM   4263 N  NZ  . LYS B 1 98  ? -2.009  -45.574 -41.843 1.00 94.59  1 98  LYS B NZ  1 
ATOM   4264 N  N   . PHE B 1 99  ? 2.801   -42.620 -44.373 1.00 115.82 ? 99  PHE B N   1 
ATOM   4265 C  CA  . PHE B 1 99  ? 2.837   -43.201 -45.712 1.00 118.58 ? 99  PHE B CA  1 
ATOM   4266 C  C   . PHE B 1 99  ? 4.221   -43.325 -46.345 1.00 118.73 ? 99  PHE B C   1 
ATOM   4267 O  O   . PHE B 1 99  ? 4.344   -43.744 -47.498 1.00 120.57 ? 99  PHE B O   1 
ATOM   4268 C  CB  . PHE B 1 99  ? 1.866   -42.479 -46.635 1.00 119.47 ? 99  PHE B CB  1 
ATOM   4269 C  CG  . PHE B 1 99  ? 0.441   -42.736 -46.291 1.00 120.80 ? 99  PHE B CG  1 
ATOM   4270 C  CD1 . PHE B 1 99  ? -0.242  -41.886 -45.439 1.00 121.41 ? 99  PHE B CD1 1 
ATOM   4271 C  CD2 . PHE B 1 99  ? -0.207  -43.856 -46.782 1.00 121.37 ? 99  PHE B CD2 1 
ATOM   4272 C  CE1 . PHE B 1 99  ? -1.555  -42.134 -45.107 1.00 121.54 ? 99  PHE B CE1 1 
ATOM   4273 C  CE2 . PHE B 1 99  ? -1.519  -44.109 -46.454 1.00 121.51 ? 99  PHE B CE2 1 
ATOM   4274 C  CZ  . PHE B 1 99  ? -2.193  -43.248 -45.612 1.00 121.57 ? 99  PHE B CZ  1 
ATOM   4275 N  N   . GLY B 1 100 ? 5.256   -42.952 -45.601 1.00 114.25 ? 100 GLY B N   1 
ATOM   4276 C  CA  . GLY B 1 100 ? 6.617   -43.233 -46.021 1.00 112.19 ? 100 GLY B CA  1 
ATOM   4277 C  C   . GLY B 1 100 ? 7.301   -42.112 -46.771 1.00 111.61 ? 100 GLY B C   1 
ATOM   4278 O  O   . GLY B 1 100 ? 8.330   -42.321 -47.419 1.00 110.17 ? 100 GLY B O   1 
ATOM   4279 N  N   . LEU B 1 101 ? 6.738   -40.916 -46.690 1.00 78.99  ? 101 LEU B N   1 
ATOM   4280 C  CA  . LEU B 1 101 ? 7.372   -39.761 -47.300 1.00 81.14  ? 101 LEU B CA  1 
ATOM   4281 C  C   . LEU B 1 101 ? 8.553   -39.342 -46.456 1.00 83.80  ? 101 LEU B C   1 
ATOM   4282 O  O   . LEU B 1 101 ? 8.458   -39.268 -45.230 1.00 83.38  ? 101 LEU B O   1 
ATOM   4283 C  CB  . LEU B 1 101 ? 6.403   -38.598 -47.425 1.00 79.70  ? 101 LEU B CB  1 
ATOM   4284 C  CG  . LEU B 1 101 ? 5.166   -38.859 -48.263 1.00 77.89  ? 101 LEU B CG  1 
ATOM   4285 C  CD1 . LEU B 1 101 ? 4.437   -37.545 -48.450 1.00 76.63  ? 101 LEU B CD1 1 
ATOM   4286 C  CD2 . LEU B 1 101 ? 5.564   -39.461 -49.597 1.00 76.59  ? 101 LEU B CD2 1 
ATOM   4287 N  N   . LYS B 1 102 ? 9.675   -39.092 -47.109 1.00 80.09  ? 102 LYS B N   1 
ATOM   4288 C  CA  . LYS B 1 102 ? 10.873  -38.680 -46.405 1.00 84.08  ? 102 LYS B CA  1 
ATOM   4289 C  C   . LYS B 1 102 ? 10.942  -37.161 -46.311 1.00 81.62  ? 102 LYS B C   1 
ATOM   4290 O  O   . LYS B 1 102 ? 11.820  -36.614 -45.643 1.00 80.28  ? 102 LYS B O   1 
ATOM   4291 C  CB  . LYS B 1 102 ? 12.107  -39.228 -47.114 1.00 89.34  ? 102 LYS B CB  1 
ATOM   4292 C  CG  . LYS B 1 102 ? 12.004  -40.716 -47.366 1.00 98.23  ? 102 LYS B CG  1 
ATOM   4293 C  CD  . LYS B 1 102 ? 13.145  -41.230 -48.219 1.00 105.58 ? 102 LYS B CD  1 
ATOM   4294 C  CE  . LYS B 1 102 ? 12.878  -42.668 -48.635 1.00 107.32 ? 102 LYS B CE  1 
ATOM   4295 N  NZ  . LYS B 1 102 ? 12.531  -43.528 -47.463 1.00 108.07 1 102 LYS B NZ  1 
ATOM   4296 N  N   . CYS B 1 103 ? 10.025  -36.474 -46.983 1.00 95.71  ? 103 CYS B N   1 
ATOM   4297 C  CA  . CYS B 1 103 ? 10.135  -35.026 -47.083 1.00 97.92  ? 103 CYS B CA  1 
ATOM   4298 C  C   . CYS B 1 103 ? 9.280   -34.290 -46.065 1.00 96.50  ? 103 CYS B C   1 
ATOM   4299 O  O   . CYS B 1 103 ? 8.521   -34.896 -45.304 1.00 94.68  ? 103 CYS B O   1 
ATOM   4300 C  CB  . CYS B 1 103 ? 9.754   -34.559 -48.489 1.00 102.86 ? 103 CYS B CB  1 
ATOM   4301 S  SG  . CYS B 1 103 ? 8.060   -34.975 -48.966 1.00 109.69 ? 103 CYS B SG  1 
ATOM   4302 N  N   . GLU B 1 104 ? 9.397   -32.968 -46.087 1.00 75.94  ? 104 GLU B N   1 
ATOM   4303 C  CA  . GLU B 1 104 ? 8.634   -32.103 -45.214 1.00 74.18  ? 104 GLU B CA  1 
ATOM   4304 C  C   . GLU B 1 104 ? 7.333   -31.773 -45.917 1.00 69.53  ? 104 GLU B C   1 
ATOM   4305 O  O   . GLU B 1 104 ? 7.338   -31.274 -47.041 1.00 73.77  ? 104 GLU B O   1 
ATOM   4306 C  CB  . GLU B 1 104 ? 9.408   -30.827 -44.922 1.00 76.05  ? 104 GLU B CB  1 
ATOM   4307 C  CG  . GLU B 1 104 ? 8.676   -29.865 -44.014 1.00 77.44  ? 104 GLU B CG  1 
ATOM   4308 C  CD  . GLU B 1 104 ? 9.416   -28.548 -43.850 1.00 78.19  ? 104 GLU B CD  1 
ATOM   4309 O  OE1 . GLU B 1 104 ? 9.898   -27.996 -44.869 1.00 78.33  ? 104 GLU B OE1 1 
ATOM   4310 O  OE2 . GLU B 1 104 ? 9.515   -28.067 -42.698 1.00 78.37  1 104 GLU B OE2 1 
ATOM   4311 N  N   . LEU B 1 105 ? 6.219   -32.054 -45.256 1.00 102.31 ? 105 LEU B N   1 
ATOM   4312 C  CA  . LEU B 1 105 ? 4.914   -31.869 -45.863 1.00 92.00  ? 105 LEU B CA  1 
ATOM   4313 C  C   . LEU B 1 105 ? 4.167   -30.697 -45.257 1.00 88.74  ? 105 LEU B C   1 
ATOM   4314 O  O   . LEU B 1 105 ? 3.827   -30.705 -44.075 1.00 87.29  ? 105 LEU B O   1 
ATOM   4315 C  CB  . LEU B 1 105 ? 4.098   -33.141 -45.716 1.00 88.06  ? 105 LEU B CB  1 
ATOM   4316 C  CG  . LEU B 1 105 ? 2.705   -33.106 -46.321 1.00 82.81  ? 105 LEU B CG  1 
ATOM   4317 C  CD1 . LEU B 1 105 ? 2.799   -32.813 -47.807 1.00 79.37  ? 105 LEU B CD1 1 
ATOM   4318 C  CD2 . LEU B 1 105 ? 2.054   -34.449 -46.084 1.00 79.38  ? 105 LEU B CD2 1 
ATOM   4319 N  N   . LEU B 1 106 ? 3.892   -29.698 -46.080 1.00 80.80  ? 106 LEU B N   1 
ATOM   4320 C  CA  . LEU B 1 106 ? 3.228   -28.498 -45.613 1.00 78.36  ? 106 LEU B CA  1 
ATOM   4321 C  C   . LEU B 1 106 ? 1.840   -28.422 -46.190 1.00 75.73  ? 106 LEU B C   1 
ATOM   4322 O  O   . LEU B 1 106 ? 1.575   -28.957 -47.265 1.00 76.64  ? 106 LEU B O   1 
ATOM   4323 C  CB  . LEU B 1 106 ? 4.000   -27.266 -46.052 1.00 79.58  ? 106 LEU B CB  1 
ATOM   4324 C  CG  . LEU B 1 106 ? 5.484   -27.291 -45.733 1.00 78.99  ? 106 LEU B CG  1 
ATOM   4325 C  CD1 . LEU B 1 106 ? 6.071   -25.972 -46.147 1.00 75.72  ? 106 LEU B CD1 1 
ATOM   4326 C  CD2 . LEU B 1 106 ? 5.678   -27.517 -44.253 1.00 78.27  ? 106 LEU B CD2 1 
ATOM   4327 N  N   . ALA B 1 107 ? 0.942   -27.772 -45.466 1.00 54.41  ? 107 ALA B N   1 
ATOM   4328 C  CA  . ALA B 1 107 ? -0.414  -27.585 -45.951 1.00 51.93  ? 107 ALA B CA  1 
ATOM   4329 C  C   . ALA B 1 107 ? -0.785  -26.124 -45.794 1.00 51.86  ? 107 ALA B C   1 
ATOM   4330 O  O   . ALA B 1 107 ? -0.638  -25.550 -44.712 1.00 51.28  ? 107 ALA B O   1 
ATOM   4331 C  CB  . ALA B 1 107 ? -1.368  -28.455 -45.184 1.00 49.40  ? 107 ALA B CB  1 
ATOM   4332 N  N   . LYS B 1 108 ? -1.263  -25.509 -46.864 1.00 63.18  ? 108 LYS B N   1 
ATOM   4333 C  CA  . LYS B 1 108 ? -1.694  -24.137 -46.761 1.00 65.78  ? 108 LYS B CA  1 
ATOM   4334 C  C   . LYS B 1 108 ? -3.173  -24.228 -46.449 1.00 68.86  ? 108 LYS B C   1 
ATOM   4335 O  O   . LYS B 1 108 ? -3.979  -24.645 -47.292 1.00 68.71  ? 108 LYS B O   1 
ATOM   4336 C  CB  . LYS B 1 108 ? -1.471  -23.421 -48.082 1.00 64.59  ? 108 LYS B CB  1 
ATOM   4337 C  CG  . LYS B 1 108 ? -1.943  -21.983 -48.114 1.00 62.98  ? 108 LYS B CG  1 
ATOM   4338 C  CD  . LYS B 1 108 ? -0.882  -21.033 -47.599 1.00 59.91  ? 108 LYS B CD  1 
ATOM   4339 C  CE  . LYS B 1 108 ? -1.229  -19.612 -48.023 1.00 58.48  ? 108 LYS B CE  1 
ATOM   4340 N  NZ  . LYS B 1 108 ? -0.380  -18.578 -47.378 1.00 57.65  1 108 LYS B NZ  1 
ATOM   4341 N  N   . CYS B 1 109 ? -3.544  -23.844 -45.233 1.00 90.74  ? 109 CYS B N   1 
ATOM   4342 C  CA  . CYS B 1 109 ? -4.907  -24.063 -44.800 1.00 93.54  ? 109 CYS B CA  1 
ATOM   4343 C  C   . CYS B 1 109 ? -5.687  -22.811 -45.105 1.00 93.47  ? 109 CYS B C   1 
ATOM   4344 O  O   . CYS B 1 109 ? -5.513  -21.776 -44.463 1.00 95.67  ? 109 CYS B O   1 
ATOM   4345 C  CB  . CYS B 1 109 ? -4.945  -24.383 -43.313 1.00 94.90  ? 109 CYS B CB  1 
ATOM   4346 S  SG  . CYS B 1 109 ? -3.981  -25.853 -42.892 1.00 95.84  ? 109 CYS B SG  1 
ATOM   4347 N  N   . GLU B 1 110 ? -6.565  -22.929 -46.090 1.00 78.93  ? 110 GLU B N   1 
ATOM   4348 C  CA  . GLU B 1 110 ? -7.243  -21.776 -46.644 1.00 75.86  ? 110 GLU B CA  1 
ATOM   4349 C  C   . GLU B 1 110 ? -8.611  -21.588 -46.008 1.00 74.47  ? 110 GLU B C   1 
ATOM   4350 O  O   . GLU B 1 110 ? -9.349  -20.660 -46.349 1.00 73.88  ? 110 GLU B O   1 
ATOM   4351 C  CB  . GLU B 1 110 ? -7.347  -21.920 -48.164 1.00 74.92  ? 110 GLU B CB  1 
ATOM   4352 C  CG  . GLU B 1 110 ? -7.302  -20.613 -48.923 1.00 75.12  ? 110 GLU B CG  1 
ATOM   4353 C  CD  . GLU B 1 110 ? -5.911  -20.034 -49.030 1.00 77.41  ? 110 GLU B CD  1 
ATOM   4354 O  OE1 . GLU B 1 110 ? -4.931  -20.756 -48.738 1.00 79.28  ? 110 GLU B OE1 1 
ATOM   4355 O  OE2 . GLU B 1 110 ? -5.803  -18.852 -49.419 1.00 78.05  1 110 GLU B OE2 1 
ATOM   4356 N  N   . PHE B 1 111 ? -8.933  -22.458 -45.056 1.00 80.12  ? 111 PHE B N   1 
ATOM   4357 C  CA  . PHE B 1 111 ? -10.250 -22.445 -44.434 1.00 79.25  ? 111 PHE B CA  1 
ATOM   4358 C  C   . PHE B 1 111 ? -10.316 -21.520 -43.230 1.00 80.09  ? 111 PHE B C   1 
ATOM   4359 O  O   . PHE B 1 111 ? -11.322 -21.472 -42.524 1.00 80.47  ? 111 PHE B O   1 
ATOM   4360 C  CB  . PHE B 1 111 ? -10.689 -23.855 -44.054 1.00 77.93  ? 111 PHE B CB  1 
ATOM   4361 C  CG  . PHE B 1 111 ? -9.654  -24.637 -43.303 1.00 74.20  ? 111 PHE B CG  1 
ATOM   4362 C  CD1 . PHE B 1 111 ? -9.411  -24.389 -41.962 1.00 72.07  ? 111 PHE B CD1 1 
ATOM   4363 C  CD2 . PHE B 1 111 ? -8.943  -25.644 -43.936 1.00 70.50  ? 111 PHE B CD2 1 
ATOM   4364 C  CE1 . PHE B 1 111 ? -8.475  -25.127 -41.273 1.00 70.28  ? 111 PHE B CE1 1 
ATOM   4365 C  CE2 . PHE B 1 111 ? -8.002  -26.381 -43.250 1.00 69.33  ? 111 PHE B CE2 1 
ATOM   4366 C  CZ  . PHE B 1 111 ? -7.771  -26.123 -41.917 1.00 69.50  ? 111 PHE B CZ  1 
ATOM   4367 N  N   . PHE B 1 112 ? -9.227  -20.808 -42.982 1.00 82.78  ? 112 PHE B N   1 
ATOM   4368 C  CA  . PHE B 1 112 ? -9.211  -19.791 -41.949 1.00 83.61  ? 112 PHE B CA  1 
ATOM   4369 C  C   . PHE B 1 112 ? -9.676  -18.461 -42.515 1.00 84.47  ? 112 PHE B C   1 
ATOM   4370 O  O   . PHE B 1 112 ? -9.702  -17.451 -41.810 1.00 83.54  ? 112 PHE B O   1 
ATOM   4371 C  CB  . PHE B 1 112 ? -7.824  -19.665 -41.346 1.00 83.52  ? 112 PHE B CB  1 
ATOM   4372 C  CG  . PHE B 1 112 ? -7.424  -20.847 -40.539 1.00 84.48  ? 112 PHE B CG  1 
ATOM   4373 C  CD1 . PHE B 1 112 ? -6.592  -21.814 -41.069 1.00 86.24  ? 112 PHE B CD1 1 
ATOM   4374 C  CD2 . PHE B 1 112 ? -7.913  -21.014 -39.258 1.00 85.45  ? 112 PHE B CD2 1 
ATOM   4375 C  CE1 . PHE B 1 112 ? -6.230  -22.911 -40.323 1.00 87.57  ? 112 PHE B CE1 1 
ATOM   4376 C  CE2 . PHE B 1 112 ? -7.558  -22.110 -38.512 1.00 86.73  ? 112 PHE B CE2 1 
ATOM   4377 C  CZ  . PHE B 1 112 ? -6.717  -23.061 -39.048 1.00 87.78  ? 112 PHE B CZ  1 
ATOM   4378 N  N   . ASN B 1 113 ? -10.023 -18.462 -43.797 1.00 82.28  ? 113 ASN B N   1 
ATOM   4379 C  CA  . ASN B 1 113 ? -10.593 -17.285 -44.428 1.00 84.74  ? 113 ASN B CA  1 
ATOM   4380 C  C   . ASN B 1 113 ? -11.960 -17.029 -43.845 1.00 84.26  ? 113 ASN B C   1 
ATOM   4381 O  O   . ASN B 1 113 ? -12.553 -17.930 -43.245 1.00 84.18  ? 113 ASN B O   1 
ATOM   4382 C  CB  . ASN B 1 113 ? -10.709 -17.480 -45.932 1.00 86.72  ? 113 ASN B CB  1 
ATOM   4383 C  CG  . ASN B 1 113 ? -9.375  -17.425 -46.629 1.00 91.84  ? 113 ASN B CG  1 
ATOM   4384 O  OD1 . ASN B 1 113 ? -8.481  -16.680 -46.224 1.00 97.17  ? 113 ASN B OD1 1 
ATOM   4385 N  ND2 . ASN B 1 113 ? -9.226  -18.216 -47.683 1.00 96.96  ? 113 ASN B ND2 1 
ATOM   4386 N  N   . ALA B 1 114 ? -12.448 -15.801 -44.005 1.00 87.65  ? 114 ALA B N   1 
ATOM   4387 C  CA  . ALA B 1 114 ? -13.757 -15.408 -43.485 1.00 87.06  ? 114 ALA B CA  1 
ATOM   4388 C  C   . ALA B 1 114 ? -14.847 -16.430 -43.814 1.00 86.45  ? 114 ALA B C   1 
ATOM   4389 O  O   . ALA B 1 114 ? -15.395 -17.079 -42.916 1.00 88.23  ? 114 ALA B O   1 
ATOM   4390 C  CB  . ALA B 1 114 ? -14.145 -14.042 -44.015 1.00 85.74  ? 114 ALA B CB  1 
ATOM   4391 N  N   . GLY B 1 115 ? -15.146 -16.584 -45.097 1.00 69.79  ? 115 GLY B N   1 
ATOM   4392 C  CA  . GLY B 1 115 ? -16.170 -17.517 -45.528 1.00 66.05  ? 115 GLY B CA  1 
ATOM   4393 C  C   . GLY B 1 115 ? -15.783 -18.965 -45.278 1.00 62.75  ? 115 GLY B C   1 
ATOM   4394 O  O   . GLY B 1 115 ? -16.632 -19.857 -45.302 1.00 63.78  ? 115 GLY B O   1 
ATOM   4395 N  N   . GLY B 1 116 ? -14.493 -19.211 -45.057 1.00 68.01  ? 116 GLY B N   1 
ATOM   4396 C  CA  . GLY B 1 116 ? -14.057 -20.554 -44.717 1.00 63.15  ? 116 GLY B CA  1 
ATOM   4397 C  C   . GLY B 1 116 ? -13.688 -21.403 -45.904 1.00 61.05  ? 116 GLY B C   1 
ATOM   4398 O  O   . GLY B 1 116 ? -13.586 -22.637 -45.782 1.00 59.25  ? 116 GLY B O   1 
ATOM   4399 N  N   . SER B 1 117 ? -13.500 -20.780 -47.058 1.00 72.67  ? 117 SER B N   1 
ATOM   4400 C  CA  . SER B 1 117 ? -13.017 -21.476 -48.240 1.00 72.34  ? 117 SER B CA  1 
ATOM   4401 C  C   . SER B 1 117 ? -11.996 -20.637 -48.987 1.00 65.29  ? 117 SER B C   1 
ATOM   4402 O  O   . SER B 1 117 ? -11.864 -19.433 -48.734 1.00 65.15  ? 117 SER B O   1 
ATOM   4403 C  CB  . SER B 1 117 ? -14.162 -21.877 -49.170 1.00 75.78  ? 117 SER B CB  1 
ATOM   4404 O  OG  . SER B 1 117 ? -14.683 -20.740 -49.848 1.00 82.59  ? 117 SER B OG  1 
ATOM   4405 N  N   . VAL B 1 118 ? -11.296 -21.269 -49.923 1.00 70.03  ? 118 VAL B N   1 
ATOM   4406 C  CA  . VAL B 1 118 ? -10.324 -20.569 -50.741 1.00 69.68  ? 118 VAL B CA  1 
ATOM   4407 C  C   . VAL B 1 118 ? -11.052 -19.606 -51.684 1.00 70.81  ? 118 VAL B C   1 
ATOM   4408 O  O   . VAL B 1 118 ? -10.500 -18.563 -52.094 1.00 67.50  ? 118 VAL B O   1 
ATOM   4409 C  CB  . VAL B 1 118 ? -9.512  -21.604 -51.557 1.00 69.86  ? 118 VAL B CB  1 
ATOM   4410 C  CG1 . VAL B 1 118 ? -10.429 -22.545 -52.322 1.00 71.19  ? 118 VAL B CG1 1 
ATOM   4411 C  CG2 . VAL B 1 118 ? -8.532  -20.913 -52.474 1.00 60.99  ? 118 VAL B CG2 1 
ATOM   4412 N  N   . LYS B 1 119 ? -12.326 -19.901 -51.940 1.00 71.04  ? 119 LYS B N   1 
ATOM   4413 C  CA  . LYS B 1 119 ? -13.113 -19.127 -52.873 1.00 76.01  ? 119 LYS B CA  1 
ATOM   4414 C  C   . LYS B 1 119 ? -13.354 -17.726 -52.378 1.00 75.38  ? 119 LYS B C   1 
ATOM   4415 O  O   . LYS B 1 119 ? -13.712 -16.847 -53.164 1.00 82.11  ? 119 LYS B O   1 
ATOM   4416 C  CB  . LYS B 1 119 ? -14.448 -19.800 -53.084 1.00 77.71  ? 119 LYS B CB  1 
ATOM   4417 C  CG  . LYS B 1 119 ? -14.327 -21.072 -53.840 1.00 66.58  ? 119 LYS B CG  1 
ATOM   4418 C  CD  . LYS B 1 119 ? -13.766 -20.838 -55.192 1.00 72.74  ? 119 LYS B CD  1 
ATOM   4419 C  CE  . LYS B 1 119 ? -13.988 -22.090 -55.981 1.00 76.85  ? 119 LYS B CE  1 
ATOM   4420 N  NZ  . LYS B 1 119 ? -13.109 -23.111 -55.368 1.00 68.71  1 119 LYS B NZ  1 
ATOM   4421 N  N   . ASP B 1 120 ? -13.201 -17.518 -51.072 1.00 91.63  ? 120 ASP B N   1 
ATOM   4422 C  CA  . ASP B 1 120 ? -13.379 -16.187 -50.540 1.00 91.34  ? 120 ASP B CA  1 
ATOM   4423 C  C   . ASP B 1 120 ? -12.406 -15.257 -51.228 1.00 87.81  ? 120 ASP B C   1 
ATOM   4424 O  O   . ASP B 1 120 ? -12.785 -14.142 -51.621 1.00 96.47  ? 120 ASP B O   1 
ATOM   4425 C  CB  . ASP B 1 120 ? -13.163 -16.183 -49.031 1.00 96.94  ? 120 ASP B CB  1 
ATOM   4426 C  CG  . ASP B 1 120 ? -14.092 -17.148 -48.312 1.00 96.37  ? 120 ASP B CG  1 
ATOM   4427 O  OD1 . ASP B 1 120 ? -15.110 -17.570 -48.915 1.00 99.89  ? 120 ASP B OD1 1 
ATOM   4428 O  OD2 . ASP B 1 120 ? -13.801 -17.488 -47.145 1.00 106.05 1 120 ASP B OD2 1 
ATOM   4429 N  N   . ARG B 1 121 ? -11.195 -15.743 -51.517 1.00 78.39  ? 121 ARG B N   1 
ATOM   4430 C  CA  . ARG B 1 121 ? -10.202 -14.891 -52.163 1.00 84.12  ? 121 ARG B CA  1 
ATOM   4431 C  C   . ARG B 1 121 ? -10.738 -14.312 -53.457 1.00 86.47  ? 121 ARG B C   1 
ATOM   4432 O  O   . ARG B 1 121 ? -10.981 -13.098 -53.583 1.00 93.95  ? 121 ARG B O   1 
ATOM   4433 C  CB  . ARG B 1 121 ? -8.933  -15.645 -52.481 1.00 87.54  ? 121 ARG B CB  1 
ATOM   4434 C  CG  . ARG B 1 121 ? -8.059  -15.900 -51.300 1.00 92.49  ? 121 ARG B CG  1 
ATOM   4435 C  CD  . ARG B 1 121 ? -6.865  -16.687 -51.756 1.00 86.91  ? 121 ARG B CD  1 
ATOM   4436 N  NE  . ARG B 1 121 ? -6.030  -17.120 -50.648 1.00 89.86  ? 121 ARG B NE  1 
ATOM   4437 C  CZ  . ARG B 1 121 ? -4.973  -16.442 -50.210 1.00 85.67  ? 121 ARG B CZ  1 
ATOM   4438 N  NH1 . ARG B 1 121 ? -4.639  -15.292 -50.785 1.00 81.06  1 121 ARG B NH1 1 
ATOM   4439 N  NH2 . ARG B 1 121 ? -4.253  -16.909 -49.196 1.00 76.77  ? 121 ARG B NH2 1 
ATOM   4440 N  N   . ILE B 1 122 ? -10.973 -15.208 -54.387 1.00 65.90  ? 122 ILE B N   1 
ATOM   4441 C  CA  . ILE B 1 122 ? -11.366 -14.807 -55.718 1.00 66.77  ? 122 ILE B CA  1 
ATOM   4442 C  C   . ILE B 1 122 ? -12.694 -14.079 -55.635 1.00 71.28  ? 122 ILE B C   1 
ATOM   4443 O  O   . ILE B 1 122 ? -13.037 -13.329 -56.550 1.00 70.07  ? 122 ILE B O   1 
ATOM   4444 C  CB  . ILE B 1 122 ? -11.378 -15.982 -56.696 1.00 64.55  ? 122 ILE B CB  1 
ATOM   4445 C  CG1 . ILE B 1 122 ? -12.470 -16.974 -56.312 1.00 61.39  ? 122 ILE B CG1 1 
ATOM   4446 C  CG2 . ILE B 1 122 ? -10.059 -16.698 -56.644 1.00 60.86  ? 122 ILE B CG2 1 
ATOM   4447 C  CD1 . ILE B 1 122 ? -13.644 -16.923 -57.217 1.00 58.79  ? 122 ILE B CD1 1 
ATOM   4448 N  N   . SER B 1 123 ? -13.438 -14.284 -54.549 1.00 91.65  ? 123 SER B N   1 
ATOM   4449 C  CA  . SER B 1 123 ? -14.705 -13.583 -54.464 1.00 96.97  ? 123 SER B CA  1 
ATOM   4450 C  C   . SER B 1 123 ? -14.378 -12.111 -54.374 1.00 98.60  ? 123 SER B C   1 
ATOM   4451 O  O   . SER B 1 123 ? -14.727 -11.331 -55.279 1.00 102.00 ? 123 SER B O   1 
ATOM   4452 C  CB  . SER B 1 123 ? -15.488 -14.019 -53.231 1.00 97.77  ? 123 SER B CB  1 
ATOM   4453 O  OG  . SER B 1 123 ? -15.888 -15.370 -53.358 1.00 97.37  ? 123 SER B OG  1 
ATOM   4454 N  N   . LEU B 1 124 ? -13.608 -11.765 -53.349 1.00 88.31  ? 124 LEU B N   1 
ATOM   4455 C  CA  . LEU B 1 124 ? -13.367 -10.373 -53.026 1.00 84.82  ? 124 LEU B CA  1 
ATOM   4456 C  C   . LEU B 1 124 ? -12.781 -9.705  -54.248 1.00 84.25  ? 124 LEU B C   1 
ATOM   4457 O  O   . LEU B 1 124 ? -13.318 -8.705  -54.751 1.00 84.15  ? 124 LEU B O   1 
ATOM   4458 C  CB  . LEU B 1 124 ? -12.432 -10.246 -51.833 1.00 83.34  ? 124 LEU B CB  1 
ATOM   4459 C  CG  . LEU B 1 124 ? -12.140 -8.805  -51.432 1.00 78.15  ? 124 LEU B CG  1 
ATOM   4460 C  CD1 . LEU B 1 124 ? -13.431 -8.082  -51.117 1.00 71.71  ? 124 LEU B CD1 1 
ATOM   4461 C  CD2 . LEU B 1 124 ? -11.209 -8.782  -50.236 1.00 73.61  ? 124 LEU B CD2 1 
ATOM   4462 N  N   . ARG B 1 125 ? -11.714 -10.311 -54.752 1.00 97.63  ? 125 ARG B N   1 
ATOM   4463 C  CA  . ARG B 1 125 ? -11.024 -9.799  -55.917 1.00 97.13  ? 125 ARG B CA  1 
ATOM   4464 C  C   . ARG B 1 125 ? -12.011 -9.509  -57.039 1.00 94.81  ? 125 ARG B C   1 
ATOM   4465 O  O   . ARG B 1 125 ? -12.062 -8.375  -57.541 1.00 92.98  ? 125 ARG B O   1 
ATOM   4466 C  CB  . ARG B 1 125 ? -9.972  -10.793 -56.399 1.00 99.49  ? 125 ARG B CB  1 
ATOM   4467 C  CG  . ARG B 1 125 ? -9.189  -10.281 -57.582 1.00 105.62 ? 125 ARG B CG  1 
ATOM   4468 C  CD  . ARG B 1 125 ? -8.428  -9.029  -57.187 1.00 114.48 ? 125 ARG B CD  1 
ATOM   4469 N  NE  . ARG B 1 125 ? -7.588  -8.528  -58.269 1.00 120.53 ? 125 ARG B NE  1 
ATOM   4470 C  CZ  . ARG B 1 125 ? -6.300  -8.822  -58.411 1.00 122.56 ? 125 ARG B CZ  1 
ATOM   4471 N  NH1 . ARG B 1 125 ? -5.699  -9.622  -57.535 1.00 122.34 1 125 ARG B NH1 1 
ATOM   4472 N  NH2 . ARG B 1 125 ? -5.612  -8.319  -59.428 1.00 123.92 ? 125 ARG B NH2 1 
ATOM   4473 N  N   . MET B 1 126 ? -12.826 -10.507 -57.391 1.00 85.15  ? 126 MET B N   1 
ATOM   4474 C  CA  . MET B 1 126 ? -13.697 -10.365 -58.554 1.00 86.35  ? 126 MET B CA  1 
ATOM   4475 C  C   . MET B 1 126 ? -14.563 -9.144  -58.397 1.00 87.22  ? 126 MET B C   1 
ATOM   4476 O  O   . MET B 1 126 ? -14.814 -8.420  -59.357 1.00 85.58  ? 126 MET B O   1 
ATOM   4477 C  CB  . MET B 1 126 ? -14.564 -11.598 -58.781 1.00 85.88  ? 126 MET B CB  1 
ATOM   4478 C  CG  . MET B 1 126 ? -13.797 -12.739 -59.414 1.00 90.88  ? 126 MET B CG  1 
ATOM   4479 S  SD  . MET B 1 126 ? -14.691 -14.305 -59.391 1.00 98.93  ? 126 MET B SD  1 
ATOM   4480 C  CE  . MET B 1 126 ? -15.650 -14.159 -60.875 1.00 98.46  ? 126 MET B CE  1 
ATOM   4481 N  N   . ILE B 1 127 ? -14.997 -8.894  -57.172 1.00 90.85  ? 127 ILE B N   1 
ATOM   4482 C  CA  . ILE B 1 127 ? -15.863 -7.762  -56.952 1.00 94.12  ? 127 ILE B CA  1 
ATOM   4483 C  C   . ILE B 1 127 ? -15.082 -6.466  -57.072 1.00 96.34  ? 127 ILE B C   1 
ATOM   4484 O  O   . ILE B 1 127 ? -15.498 -5.549  -57.790 1.00 97.44  ? 127 ILE B O   1 
ATOM   4485 C  CB  . ILE B 1 127 ? -16.580 -7.862  -55.617 1.00 94.45  ? 127 ILE B CB  1 
ATOM   4486 C  CG1 . ILE B 1 127 ? -17.392 -9.155  -55.603 1.00 92.67  ? 127 ILE B CG1 1 
ATOM   4487 C  CG2 . ILE B 1 127 ? -17.471 -6.655  -55.409 1.00 94.05  ? 127 ILE B CG2 1 
ATOM   4488 C  CD1 . ILE B 1 127 ? -18.326 -9.278  -54.451 1.00 86.54  ? 127 ILE B CD1 1 
ATOM   4489 N  N   . GLU B 1 128 ? -13.928 -6.413  -56.413 1.00 94.51  ? 128 GLU B N   1 
ATOM   4490 C  CA  . GLU B 1 128 ? -13.161 -5.177  -56.352 1.00 96.33  ? 128 GLU B CA  1 
ATOM   4491 C  C   . GLU B 1 128 ? -12.773 -4.723  -57.746 1.00 96.13  ? 128 GLU B C   1 
ATOM   4492 O  O   . GLU B 1 128 ? -12.984 -3.563  -58.115 1.00 94.83  ? 128 GLU B O   1 
ATOM   4493 C  CB  . GLU B 1 128 ? -11.932 -5.350  -55.474 1.00 96.97  ? 128 GLU B CB  1 
ATOM   4494 C  CG  . GLU B 1 128 ? -12.282 -5.634  -54.029 1.00 104.73 ? 128 GLU B CG  1 
ATOM   4495 C  CD  . GLU B 1 128 ? -11.077 -5.571  -53.122 1.00 115.16 ? 128 GLU B CD  1 
ATOM   4496 O  OE1 . GLU B 1 128 ? -11.241 -5.161  -51.952 1.00 118.10 ? 128 GLU B OE1 1 
ATOM   4497 O  OE2 . GLU B 1 128 ? -9.968  -5.935  -53.577 1.00 119.20 1 128 GLU B OE2 1 
ATOM   4498 N  N   . ASP B 1 129 ? -12.225 -5.650  -58.522 1.00 103.74 ? 129 ASP B N   1 
ATOM   4499 C  CA  . ASP B 1 129 ? -11.910 -5.381  -59.914 1.00 105.50 ? 129 ASP B CA  1 
ATOM   4500 C  C   . ASP B 1 129 ? -13.142 -4.896  -60.651 1.00 102.50 ? 129 ASP B C   1 
ATOM   4501 O  O   . ASP B 1 129 ? -13.082 -3.914  -61.390 1.00 101.97 ? 129 ASP B O   1 
ATOM   4502 C  CB  . ASP B 1 129 ? -11.352 -6.627  -60.589 1.00 109.64 ? 129 ASP B CB  1 
ATOM   4503 C  CG  . ASP B 1 129 ? -9.918  -6.903  -60.195 1.00 119.43 ? 129 ASP B CG  1 
ATOM   4504 O  OD1 . ASP B 1 129 ? -9.489  -8.071  -60.301 1.00 129.49 ? 129 ASP B OD1 1 
ATOM   4505 O  OD2 . ASP B 1 129 ? -9.222  -5.952  -59.770 1.00 130.28 1 129 ASP B OD2 1 
ATOM   4506 N  N   . ALA B 1 130 ? -14.262 -5.580  -60.441 1.00 82.52  ? 130 ALA B N   1 
ATOM   4507 C  CA  . ALA B 1 130 ? -15.503 -5.219  -61.120 1.00 82.35  ? 130 ALA B CA  1 
ATOM   4508 C  C   . ALA B 1 130 ? -15.943 -3.816  -60.734 1.00 84.62  ? 130 ALA B C   1 
ATOM   4509 O  O   . ALA B 1 130 ? -16.664 -3.150  -61.477 1.00 82.96  ? 130 ALA B O   1 
ATOM   4510 C  CB  . ALA B 1 130 ? -16.600 -6.216  -60.816 1.00 79.75  ? 130 ALA B CB  1 
ATOM   4511 N  N   . GLU B 1 131 ? -15.511 -3.379  -59.557 1.00 120.12 ? 131 GLU B N   1 
ATOM   4512 C  CA  . GLU B 1 131 ? -15.827 -2.045  -59.077 1.00 125.60 ? 131 GLU B CA  1 
ATOM   4513 C  C   . GLU B 1 131 ? -14.926 -1.012  -59.737 1.00 131.04 ? 131 GLU B C   1 
ATOM   4514 O  O   . GLU B 1 131 ? -15.333 0.132   -59.946 1.00 131.79 ? 131 GLU B O   1 
ATOM   4515 C  CB  . GLU B 1 131 ? -15.710 -1.997  -57.561 1.00 121.67 ? 131 GLU B CB  1 
ATOM   4516 C  CG  . GLU B 1 131 ? -16.773 -2.832  -56.882 1.00 121.53 ? 131 GLU B CG  1 
ATOM   4517 C  CD  . GLU B 1 131 ? -16.430 -3.154  -55.446 1.00 123.09 ? 131 GLU B CD  1 
ATOM   4518 O  OE1 . GLU B 1 131 ? -17.364 -3.427  -54.662 1.00 124.00 ? 131 GLU B OE1 1 
ATOM   4519 O  OE2 . GLU B 1 131 ? -15.228 -3.143  -55.104 1.00 124.01 1 131 GLU B OE2 1 
ATOM   4520 N  N   . ARG B 1 132 ? -13.698 -1.410  -60.057 1.00 120.08 ? 132 ARG B N   1 
ATOM   4521 C  CA  . ARG B 1 132 ? -12.767 -0.505  -60.716 1.00 125.35 ? 132 ARG B CA  1 
ATOM   4522 C  C   . ARG B 1 132 ? -13.224 -0.196  -62.134 1.00 129.96 ? 132 ARG B C   1 
ATOM   4523 O  O   . ARG B 1 132 ? -13.177 0.955   -62.572 1.00 129.81 ? 132 ARG B O   1 
ATOM   4524 C  CB  . ARG B 1 132 ? -11.358 -1.087  -60.742 1.00 124.17 ? 132 ARG B CB  1 
ATOM   4525 C  CG  . ARG B 1 132 ? -10.766 -1.279  -59.371 1.00 122.82 ? 132 ARG B CG  1 
ATOM   4526 C  CD  . ARG B 1 132 ? -9.337  -1.772  -59.446 1.00 122.11 ? 132 ARG B CD  1 
ATOM   4527 N  NE  . ARG B 1 132 ? -8.814  -2.019  -58.108 1.00 122.33 ? 132 ARG B NE  1 
ATOM   4528 C  CZ  . ARG B 1 132 ? -8.819  -3.209  -57.516 1.00 122.49 ? 132 ARG B CZ  1 
ATOM   4529 N  NH1 . ARG B 1 132 ? -9.300  -4.267  -58.158 1.00 122.58 1 132 ARG B NH1 1 
ATOM   4530 N  NH2 . ARG B 1 132 ? -8.329  -3.346  -56.288 1.00 122.55 ? 132 ARG B NH2 1 
ATOM   4531 N  N   . ASP B 1 133 ? -13.681 -1.224  -62.843 1.00 125.21 ? 133 ASP B N   1 
ATOM   4532 C  CA  . ASP B 1 133 ? -14.144 -1.061  -64.216 1.00 128.29 ? 133 ASP B CA  1 
ATOM   4533 C  C   . ASP B 1 133 ? -15.396 -0.213  -64.285 1.00 125.68 ? 133 ASP B C   1 
ATOM   4534 O  O   . ASP B 1 133 ? -15.768 0.267   -65.358 1.00 129.12 ? 133 ASP B O   1 
ATOM   4535 C  CB  . ASP B 1 133 ? -14.447 -2.418  -64.841 1.00 132.40 ? 133 ASP B CB  1 
ATOM   4536 C  CG  . ASP B 1 133 ? -13.229 -3.292  -64.937 1.00 136.08 ? 133 ASP B CG  1 
ATOM   4537 O  OD1 . ASP B 1 133 ? -12.107 -2.748  -64.861 1.00 137.27 ? 133 ASP B OD1 1 
ATOM   4538 O  OD2 . ASP B 1 133 ? -13.391 -4.519  -65.090 1.00 138.17 1 133 ASP B OD2 1 
ATOM   4539 N  N   . GLY B 1 134 ? -16.055 -0.043  -63.144 1.00 146.81 ? 134 GLY B N   1 
ATOM   4540 C  CA  . GLY B 1 134 ? -17.310 0.678   -63.105 1.00 140.59 ? 134 GLY B CA  1 
ATOM   4541 C  C   . GLY B 1 134 ? -18.423 -0.232  -63.580 1.00 137.82 ? 134 GLY B C   1 
ATOM   4542 O  O   . GLY B 1 134 ? -19.587 0.170   -63.645 1.00 136.77 ? 134 GLY B O   1 
ATOM   4543 N  N   . THR B 1 135 ? -18.056 -1.465  -63.917 1.00 111.60 ? 135 THR B N   1 
ATOM   4544 C  CA  . THR B 1 135 ? -19.012 -2.471  -64.359 1.00 111.30 ? 135 THR B CA  1 
ATOM   4545 C  C   . THR B 1 135 ? -20.004 -2.792  -63.256 1.00 111.35 ? 135 THR B C   1 
ATOM   4546 O  O   . THR B 1 135 ? -21.172 -3.073  -63.531 1.00 110.98 ? 135 THR B O   1 
ATOM   4547 C  CB  . THR B 1 135 ? -18.317 -3.763  -64.816 1.00 111.20 ? 135 THR B CB  1 
ATOM   4548 O  OG1 . THR B 1 135 ? -17.166 -4.002  -63.997 1.00 110.80 ? 135 THR B OG1 1 
ATOM   4549 C  CG2 . THR B 1 135 ? -17.865 -3.627  -66.250 1.00 111.40 ? 135 THR B CG2 1 
ATOM   4550 N  N   . LEU B 1 136 ? -19.542 -2.780  -62.009 1.00 102.79 ? 136 LEU B N   1 
ATOM   4551 C  CA  . LEU B 1 136 ? -20.427 -3.108  -60.901 1.00 103.18 ? 136 LEU B CA  1 
ATOM   4552 C  C   . LEU B 1 136 ? -20.771 -1.865  -60.095 1.00 106.98 ? 136 LEU B C   1 
ATOM   4553 O  O   . LEU B 1 136 ? -19.944 -1.346  -59.339 1.00 106.02 ? 136 LEU B O   1 
ATOM   4554 C  CB  . LEU B 1 136 ? -19.766 -4.139  -59.992 1.00 100.48 ? 136 LEU B CB  1 
ATOM   4555 C  CG  . LEU B 1 136 ? -20.590 -4.552  -58.780 1.00 93.86  ? 136 LEU B CG  1 
ATOM   4556 C  CD1 . LEU B 1 136 ? -21.928 -5.071  -59.255 1.00 88.73  ? 136 LEU B CD1 1 
ATOM   4557 C  CD2 . LEU B 1 136 ? -19.858 -5.620  -58.001 1.00 87.30  ? 136 LEU B CD2 1 
ATOM   4558 N  N   . LYS B 1 137 ? -22.010 -1.412  -60.247 1.00 118.46 ? 137 LYS B N   1 
ATOM   4559 C  CA  . LYS B 1 137 ? -22.520 -0.271  -59.506 1.00 125.18 ? 137 LYS B CA  1 
ATOM   4560 C  C   . LYS B 1 137 ? -23.187 -0.737  -58.223 1.00 129.74 ? 137 LYS B C   1 
ATOM   4561 O  O   . LYS B 1 137 ? -23.765 -1.824  -58.188 1.00 129.39 ? 137 LYS B O   1 
ATOM   4562 C  CB  . LYS B 1 137 ? -23.505 0.514   -60.365 1.00 125.15 ? 137 LYS B CB  1 
ATOM   4563 C  CG  . LYS B 1 137 ? -22.912 1.008   -61.673 1.00 128.11 ? 137 LYS B CG  1 
ATOM   4564 C  CD  . LYS B 1 137 ? -24.001 1.251   -62.708 1.00 131.28 ? 137 LYS B CD  1 
ATOM   4565 C  CE  . LYS B 1 137 ? -24.520 -0.049  -63.307 1.00 132.35 ? 137 LYS B CE  1 
ATOM   4566 N  NZ  . LYS B 1 137 ? -23.564 -0.637  -64.285 1.00 132.84 1 137 LYS B NZ  1 
ATOM   4567 N  N   . PRO B 1 138 ? -23.123 0.086   -57.166 1.00 149.99 ? 138 PRO B N   1 
ATOM   4568 C  CA  . PRO B 1 138 ? -23.786 -0.257  -55.904 1.00 149.59 ? 138 PRO B CA  1 
ATOM   4569 C  C   . PRO B 1 138 ? -25.282 -0.458  -56.097 1.00 146.94 ? 138 PRO B C   1 
ATOM   4570 O  O   . PRO B 1 138 ? -25.920 0.345   -56.778 1.00 148.69 ? 138 PRO B O   1 
ATOM   4571 C  CB  . PRO B 1 138 ? -23.545 0.982   -55.042 1.00 151.04 ? 138 PRO B CB  1 
ATOM   4572 C  CG  . PRO B 1 138 ? -22.289 1.563   -55.578 1.00 151.87 ? 138 PRO B CG  1 
ATOM   4573 C  CD  . PRO B 1 138 ? -22.345 1.332   -57.060 1.00 151.41 ? 138 PRO B CD  1 
ATOM   4574 N  N   . GLY B 1 139 ? -25.833 -1.512  -55.507 1.00 120.13 ? 139 GLY B N   1 
ATOM   4575 C  CA  . GLY B 1 139 ? -27.252 -1.772  -55.638 1.00 110.79 ? 139 GLY B CA  1 
ATOM   4576 C  C   . GLY B 1 139 ? -27.580 -2.617  -56.853 1.00 106.30 ? 139 GLY B C   1 
ATOM   4577 O  O   . GLY B 1 139 ? -28.731 -2.661  -57.300 1.00 103.56 ? 139 GLY B O   1 
ATOM   4578 N  N   . ASP B 1 140 ? -26.572 -3.292  -57.393 1.00 111.05 ? 140 ASP B N   1 
ATOM   4579 C  CA  . ASP B 1 140 ? -26.773 -4.133  -58.566 1.00 110.85 ? 140 ASP B CA  1 
ATOM   4580 C  C   . ASP B 1 140 ? -26.791 -5.598  -58.178 1.00 107.08 ? 140 ASP B C   1 
ATOM   4581 O  O   . ASP B 1 140 ? -26.136 -6.013  -57.220 1.00 106.17 ? 140 ASP B O   1 
ATOM   4582 C  CB  . ASP B 1 140 ? -25.694 -3.894  -59.620 1.00 114.30 ? 140 ASP B CB  1 
ATOM   4583 C  CG  . ASP B 1 140 ? -25.907 -2.608  -60.399 1.00 123.25 ? 140 ASP B CG  1 
ATOM   4584 O  OD1 . ASP B 1 140 ? -27.036 -2.067  -60.373 1.00 131.70 ? 140 ASP B OD1 1 
ATOM   4585 O  OD2 . ASP B 1 140 ? -24.948 -2.151  -61.055 1.00 131.66 1 140 ASP B OD2 1 
ATOM   4586 N  N   . THR B 1 141 ? -27.568 -6.374  -58.920 1.00 100.27 ? 141 THR B N   1 
ATOM   4587 C  CA  . THR B 1 141 ? -27.688 -7.794  -58.667 1.00 97.70  ? 141 THR B CA  1 
ATOM   4588 C  C   . THR B 1 141 ? -26.502 -8.567  -59.224 1.00 95.62  ? 141 THR B C   1 
ATOM   4589 O  O   . THR B 1 141 ? -26.059 -8.341  -60.355 1.00 92.29  ? 141 THR B O   1 
ATOM   4590 C  CB  . THR B 1 141 ? -28.960 -8.341  -59.299 1.00 98.41  ? 141 THR B CB  1 
ATOM   4591 O  OG1 . THR B 1 141 ? -30.085 -7.618  -58.788 1.00 101.01 ? 141 THR B OG1 1 
ATOM   4592 C  CG2 . THR B 1 141 ? -29.118 -9.813  -58.982 1.00 100.01 ? 141 THR B CG2 1 
ATOM   4593 N  N   . ILE B 1 142 ? -26.001 -9.490  -58.415 1.00 80.58  ? 142 ILE B N   1 
ATOM   4594 C  CA  . ILE B 1 142 ? -24.941 -10.392 -58.812 1.00 82.13  ? 142 ILE B CA  1 
ATOM   4595 C  C   . ILE B 1 142 ? -25.530 -11.777 -58.971 1.00 78.06  ? 142 ILE B C   1 
ATOM   4596 O  O   . ILE B 1 142 ? -26.321 -12.216 -58.139 1.00 80.09  ? 142 ILE B O   1 
ATOM   4597 C  CB  . ILE B 1 142 ? -23.858 -10.449 -57.733 1.00 84.61  ? 142 ILE B CB  1 
ATOM   4598 C  CG1 . ILE B 1 142 ? -23.000 -9.191  -57.779 1.00 89.53  ? 142 ILE B CG1 1 
ATOM   4599 C  CG2 . ILE B 1 142 ? -22.978 -11.673 -57.905 1.00 88.70  ? 142 ILE B CG2 1 
ATOM   4600 C  CD1 . ILE B 1 142 ? -21.909 -9.194  -56.751 1.00 96.45  ? 142 ILE B CD1 1 
ATOM   4601 N  N   . ILE B 1 143 ? -25.148 -12.475 -60.030 1.00 86.62  ? 143 ILE B N   1 
ATOM   4602 C  CA  . ILE B 1 143 ? -25.589 -13.844 -60.205 1.00 79.09  ? 143 ILE B CA  1 
ATOM   4603 C  C   . ILE B 1 143 ? -24.381 -14.720 -60.415 1.00 78.37  ? 143 ILE B C   1 
ATOM   4604 O  O   . ILE B 1 143 ? -23.550 -14.421 -61.274 1.00 77.22  ? 143 ILE B O   1 
ATOM   4605 C  CB  . ILE B 1 143 ? -26.465 -13.984 -61.435 1.00 76.86  ? 143 ILE B CB  1 
ATOM   4606 C  CG1 . ILE B 1 143 ? -27.678 -13.069 -61.313 1.00 71.39  ? 143 ILE B CG1 1 
ATOM   4607 C  CG2 . ILE B 1 143 ? -26.884 -15.433 -61.614 1.00 72.37  ? 143 ILE B CG2 1 
ATOM   4608 C  CD1 . ILE B 1 143 ? -28.583 -13.121 -62.515 1.00 65.99  ? 143 ILE B CD1 1 
ATOM   4609 N  N   . GLU B 1 144 ? -24.257 -15.796 -59.646 1.00 85.73  ? 144 GLU B N   1 
ATOM   4610 C  CA  . GLU B 1 144 ? -23.145 -16.682 -59.913 1.00 86.29  ? 144 GLU B CA  1 
ATOM   4611 C  C   . GLU B 1 144 ? -23.496 -18.155 -59.855 1.00 83.27  ? 144 GLU B C   1 
ATOM   4612 O  O   . GLU B 1 144 ? -24.186 -18.596 -58.943 1.00 83.00  ? 144 GLU B O   1 
ATOM   4613 C  CB  . GLU B 1 144 ? -22.048 -16.405 -58.895 1.00 89.12  ? 144 GLU B CB  1 
ATOM   4614 C  CG  . GLU B 1 144 ? -20.774 -17.128 -59.197 1.00 96.53  ? 144 GLU B CG  1 
ATOM   4615 C  CD  . GLU B 1 144 ? -20.098 -16.551 -60.416 1.00 102.31 ? 144 GLU B CD  1 
ATOM   4616 O  OE1 . GLU B 1 144 ? -19.331 -17.286 -61.071 1.00 103.00 ? 144 GLU B OE1 1 
ATOM   4617 O  OE2 . GLU B 1 144 ? -20.349 -15.362 -60.722 1.00 102.12 1 144 GLU B OE2 1 
ATOM   4618 N  N   . PRO B 1 145 ? -22.979 -18.930 -60.818 1.00 78.91  ? 145 PRO B N   1 
ATOM   4619 C  CA  . PRO B 1 145 ? -22.921 -20.390 -60.721 1.00 77.16  ? 145 PRO B CA  1 
ATOM   4620 C  C   . PRO B 1 145 ? -21.798 -20.779 -59.783 1.00 75.89  ? 145 PRO B C   1 
ATOM   4621 O  O   . PRO B 1 145 ? -20.742 -20.150 -59.843 1.00 75.04  ? 145 PRO B O   1 
ATOM   4622 C  CB  . PRO B 1 145 ? -22.575 -20.822 -62.143 1.00 77.02  ? 145 PRO B CB  1 
ATOM   4623 C  CG  . PRO B 1 145 ? -21.870 -19.646 -62.720 1.00 77.73  ? 145 PRO B CG  1 
ATOM   4624 C  CD  . PRO B 1 145 ? -22.523 -18.441 -62.128 1.00 78.36  ? 145 PRO B CD  1 
ATOM   4625 N  N   . THR B 1 146 ? -21.993 -21.780 -58.936 1.00 78.77  ? 146 THR B N   1 
ATOM   4626 C  CA  . THR B 1 146 ? -20.904 -22.203 -58.075 1.00 79.23  ? 146 THR B CA  1 
ATOM   4627 C  C   . THR B 1 146 ? -21.073 -23.608 -57.525 1.00 80.89  ? 146 THR B C   1 
ATOM   4628 O  O   . THR B 1 146 ? -22.176 -24.154 -57.513 1.00 79.07  ? 146 THR B O   1 
ATOM   4629 C  CB  . THR B 1 146 ? -20.705 -21.237 -56.907 1.00 79.01  ? 146 THR B CB  1 
ATOM   4630 O  OG1 . THR B 1 146 ? -19.732 -21.782 -56.006 1.00 78.49  ? 146 THR B OG1 1 
ATOM   4631 C  CG2 . THR B 1 146 ? -22.018 -21.052 -56.181 1.00 77.62  ? 146 THR B CG2 1 
ATOM   4632 N  N   . SER B 1 147 ? -19.966 -24.181 -57.061 1.00 78.04  ? 147 SER B N   1 
ATOM   4633 C  CA  . SER B 1 147 ? -20.000 -25.381 -56.237 1.00 82.68  ? 147 SER B CA  1 
ATOM   4634 C  C   . SER B 1 147 ? -20.465 -24.974 -54.841 1.00 82.45  ? 147 SER B C   1 
ATOM   4635 O  O   . SER B 1 147 ? -20.749 -25.815 -53.984 1.00 83.00  ? 147 SER B O   1 
ATOM   4636 C  CB  . SER B 1 147 ? -18.616 -26.016 -56.161 1.00 84.70  ? 147 SER B CB  1 
ATOM   4637 O  OG  . SER B 1 147 ? -18.147 -26.348 -57.451 1.00 93.45  ? 147 SER B OG  1 
ATOM   4638 N  N   . GLY B 1 148 ? -20.536 -23.662 -54.636 1.00 83.32  ? 148 GLY B N   1 
ATOM   4639 C  CA  . GLY B 1 148 ? -21.038 -23.076 -53.413 1.00 82.12  ? 148 GLY B CA  1 
ATOM   4640 C  C   . GLY B 1 148 ? -20.053 -22.388 -52.501 1.00 80.72  ? 148 GLY B C   1 
ATOM   4641 O  O   . GLY B 1 148 ? -20.476 -21.612 -51.648 1.00 81.73  ? 148 GLY B O   1 
ATOM   4642 N  N   . ASN B 1 149 ? -18.760 -22.604 -52.674 1.00 79.02  ? 149 ASN B N   1 
ATOM   4643 C  CA  . ASN B 1 149 ? -17.828 -21.843 -51.858 1.00 76.80  ? 149 ASN B CA  1 
ATOM   4644 C  C   . ASN B 1 149 ? -17.716 -20.427 -52.399 1.00 75.16  ? 149 ASN B C   1 
ATOM   4645 O  O   . ASN B 1 149 ? -17.727 -19.444 -51.645 1.00 74.18  ? 149 ASN B O   1 
ATOM   4646 C  CB  . ASN B 1 149 ? -16.466 -22.513 -51.793 1.00 76.82  ? 149 ASN B CB  1 
ATOM   4647 C  CG  . ASN B 1 149 ? -16.500 -23.821 -51.046 1.00 78.99  ? 149 ASN B CG  1 
ATOM   4648 O  OD1 . ASN B 1 149 ? -16.417 -24.894 -51.649 1.00 82.41  ? 149 ASN B OD1 1 
ATOM   4649 N  ND2 . ASN B 1 149 ? -16.635 -23.748 -49.723 1.00 82.04  ? 149 ASN B ND2 1 
ATOM   4650 N  N   . THR B 1 150 ? -17.613 -20.335 -53.721 1.00 77.34  ? 150 THR B N   1 
ATOM   4651 C  CA  . THR B 1 150 ? -17.550 -19.051 -54.393 1.00 76.56  ? 150 THR B CA  1 
ATOM   4652 C  C   . THR B 1 150 ? -18.815 -18.294 -54.081 1.00 76.68  ? 150 THR B C   1 
ATOM   4653 O  O   . THR B 1 150 ? -18.800 -17.079 -53.856 1.00 76.69  ? 150 THR B O   1 
ATOM   4654 C  CB  . THR B 1 150 ? -17.513 -19.220 -55.905 1.00 76.42  ? 150 THR B CB  1 
ATOM   4655 O  OG1 . THR B 1 150 ? -16.541 -20.205 -56.261 1.00 75.37  ? 150 THR B OG1 1 
ATOM   4656 C  CG2 . THR B 1 150 ? -17.199 -17.897 -56.569 1.00 75.04  ? 150 THR B CG2 1 
ATOM   4657 N  N   . GLY B 1 151 ? -19.917 -19.034 -54.085 1.00 80.10  ? 151 GLY B N   1 
ATOM   4658 C  CA  . GLY B 1 151 ? -21.210 -18.475 -53.768 1.00 79.36  ? 151 GLY B CA  1 
ATOM   4659 C  C   . GLY B 1 151 ? -21.232 -17.921 -52.365 1.00 78.48  ? 151 GLY B C   1 
ATOM   4660 O  O   . GLY B 1 151 ? -21.818 -16.879 -52.118 1.00 78.79  ? 151 GLY B O   1 
ATOM   4661 N  N   . ILE B 1 152 ? -20.595 -18.619 -51.436 1.00 66.00  ? 152 ILE B N   1 
ATOM   4662 C  CA  . ILE B 1 152 ? -20.579 -18.165 -50.061 1.00 64.69  ? 152 ILE B CA  1 
ATOM   4663 C  C   . ILE B 1 152 ? -19.781 -16.883 -49.952 1.00 65.67  ? 152 ILE B C   1 
ATOM   4664 O  O   . ILE B 1 152 ? -20.225 -15.920 -49.314 1.00 65.11  ? 152 ILE B O   1 
ATOM   4665 C  CB  . ILE B 1 152 ? -20.025 -19.217 -49.125 1.00 63.92  ? 152 ILE B CB  1 
ATOM   4666 C  CG1 . ILE B 1 152 ? -21.078 -20.296 -48.920 1.00 62.63  ? 152 ILE B CG1 1 
ATOM   4667 C  CG2 . ILE B 1 152 ? -19.667 -18.595 -47.788 1.00 60.96  ? 152 ILE B CG2 1 
ATOM   4668 C  CD1 . ILE B 1 152 ? -20.590 -21.470 -48.137 1.00 60.91  ? 152 ILE B CD1 1 
ATOM   4669 N  N   . GLY B 1 153 ? -18.601 -16.874 -50.564 1.00 65.71  ? 153 GLY B N   1 
ATOM   4670 C  CA  . GLY B 1 153 ? -17.773 -15.683 -50.564 1.00 67.34  ? 153 GLY B CA  1 
ATOM   4671 C  C   . GLY B 1 153 ? -18.536 -14.490 -51.119 1.00 67.93  ? 153 GLY B C   1 
ATOM   4672 O  O   . GLY B 1 153 ? -18.530 -13.388 -50.545 1.00 68.73  ? 153 GLY B O   1 
ATOM   4673 N  N   . LEU B 1 154 ? -19.210 -14.711 -52.240 1.00 79.34  ? 154 LEU B N   1 
ATOM   4674 C  CA  . LEU B 1 154 ? -19.951 -13.646 -52.892 1.00 78.91  ? 154 LEU B CA  1 
ATOM   4675 C  C   . LEU B 1 154 ? -21.117 -13.167 -52.043 1.00 79.55  ? 154 LEU B C   1 
ATOM   4676 O  O   . LEU B 1 154 ? -21.383 -11.970 -51.957 1.00 79.95  ? 154 LEU B O   1 
ATOM   4677 C  CB  . LEU B 1 154 ? -20.443 -14.096 -54.262 1.00 77.95  ? 154 LEU B CB  1 
ATOM   4678 C  CG  . LEU B 1 154 ? -19.340 -14.132 -55.314 1.00 75.51  ? 154 LEU B CG  1 
ATOM   4679 C  CD1 . LEU B 1 154 ? -19.845 -14.805 -56.564 1.00 71.86  ? 154 LEU B CD1 1 
ATOM   4680 C  CD2 . LEU B 1 154 ? -18.876 -12.720 -55.631 1.00 71.30  ? 154 LEU B CD2 1 
ATOM   4681 N  N   . ALA B 1 155 ? -21.816 -14.109 -51.426 1.00 72.27  ? 155 ALA B N   1 
ATOM   4682 C  CA  . ALA B 1 155 ? -22.982 -13.796 -50.627 1.00 72.37  ? 155 ALA B CA  1 
ATOM   4683 C  C   . ALA B 1 155 ? -22.544 -12.948 -49.457 1.00 71.89  ? 155 ALA B C   1 
ATOM   4684 O  O   . ALA B 1 155 ? -23.228 -12.008 -49.059 1.00 72.44  ? 155 ALA B O   1 
ATOM   4685 C  CB  . ALA B 1 155 ? -23.630 -15.068 -50.136 1.00 73.59  ? 155 ALA B CB  1 
ATOM   4686 N  N   . LEU B 1 156 ? -21.378 -13.291 -48.930 1.00 79.27  ? 156 LEU B N   1 
ATOM   4687 C  CA  . LEU B 1 156 ? -20.787 -12.608 -47.797 1.00 79.57  ? 156 LEU B CA  1 
ATOM   4688 C  C   . LEU B 1 156 ? -20.455 -11.172 -48.179 1.00 81.98  ? 156 LEU B C   1 
ATOM   4689 O  O   . LEU B 1 156 ? -20.887 -10.207 -47.520 1.00 80.42  ? 156 LEU B O   1 
ATOM   4690 C  CB  . LEU B 1 156 ? -19.528 -13.370 -47.389 1.00 77.75  ? 156 LEU B CB  1 
ATOM   4691 C  CG  . LEU B 1 156 ? -18.576 -12.856 -46.321 1.00 74.95  ? 156 LEU B CG  1 
ATOM   4692 C  CD1 . LEU B 1 156 ? -19.334 -12.354 -45.141 1.00 71.96  ? 156 LEU B CD1 1 
ATOM   4693 C  CD2 . LEU B 1 156 ? -17.708 -14.017 -45.892 1.00 73.22  ? 156 LEU B CD2 1 
ATOM   4694 N  N   . ALA B 1 157 ? -19.695 -11.034 -49.258 1.00 84.54  ? 157 ALA B N   1 
ATOM   4695 C  CA  . ALA B 1 157 ? -19.302 -9.718  -49.740 1.00 87.93  ? 157 ALA B CA  1 
ATOM   4696 C  C   . ALA B 1 157 ? -20.514 -8.838  -50.061 1.00 89.25  ? 157 ALA B C   1 
ATOM   4697 O  O   . ALA B 1 157 ? -20.491 -7.624  -49.849 1.00 91.93  ? 157 ALA B O   1 
ATOM   4698 C  CB  . ALA B 1 157 ? -18.421 -9.858  -50.957 1.00 85.42  ? 157 ALA B CB  1 
ATOM   4699 N  N   . ALA B 1 158 ? -21.572 -9.463  -50.563 1.00 99.80  ? 158 ALA B N   1 
ATOM   4700 C  CA  . ALA B 1 158 ? -22.767 -8.745  -50.968 1.00 98.11  ? 158 ALA B CA  1 
ATOM   4701 C  C   . ALA B 1 158 ? -23.499 -8.284  -49.731 1.00 97.09  ? 158 ALA B C   1 
ATOM   4702 O  O   . ALA B 1 158 ? -24.023 -7.170  -49.674 1.00 96.60  ? 158 ALA B O   1 
ATOM   4703 C  CB  . ALA B 1 158 ? -23.658 -9.644  -51.789 1.00 98.53  ? 158 ALA B CB  1 
ATOM   4704 N  N   . ALA B 1 159 ? -23.533 -9.165  -48.742 1.00 83.36  ? 159 ALA B N   1 
ATOM   4705 C  CA  . ALA B 1 159 ? -24.174 -8.873  -47.481 1.00 83.57  ? 159 ALA B CA  1 
ATOM   4706 C  C   . ALA B 1 159 ? -23.506 -7.659  -46.872 1.00 83.78  ? 159 ALA B C   1 
ATOM   4707 O  O   . ALA B 1 159 ? -24.177 -6.739  -46.400 1.00 81.48  ? 159 ALA B O   1 
ATOM   4708 C  CB  . ALA B 1 159 ? -24.045 -10.051 -46.552 1.00 85.95  ? 159 ALA B CB  1 
ATOM   4709 N  N   . VAL B 1 160 ? -22.179 -7.639  -46.908 1.00 77.91  ? 160 VAL B N   1 
ATOM   4710 C  CA  . VAL B 1 160 ? -21.461 -6.496  -46.369 1.00 80.05  ? 160 VAL B CA  1 
ATOM   4711 C  C   . VAL B 1 160 ? -21.741 -5.228  -47.177 1.00 85.18  ? 160 VAL B C   1 
ATOM   4712 O  O   . VAL B 1 160 ? -22.052 -4.173  -46.612 1.00 86.32  ? 160 VAL B O   1 
ATOM   4713 C  CB  . VAL B 1 160 ? -19.952 -6.747  -46.323 1.00 79.03  ? 160 VAL B CB  1 
ATOM   4714 C  CG1 . VAL B 1 160 ? -19.217 -5.461  -45.992 1.00 73.52  ? 160 VAL B CG1 1 
ATOM   4715 C  CG2 . VAL B 1 160 ? -19.644 -7.808  -45.297 1.00 72.24  ? 160 VAL B CG2 1 
ATOM   4716 N  N   . ARG B 1 161 ? -21.634 -5.338  -48.497 1.00 106.33 ? 161 ARG B N   1 
ATOM   4717 C  CA  . ARG B 1 161 ? -21.633 -4.160  -49.356 1.00 111.20 ? 161 ARG B CA  1 
ATOM   4718 C  C   . ARG B 1 161 ? -22.984 -3.782  -49.943 1.00 114.07 ? 161 ARG B C   1 
ATOM   4719 O  O   . ARG B 1 161 ? -23.079 -2.826  -50.714 1.00 112.87 ? 161 ARG B O   1 
ATOM   4720 C  CB  . ARG B 1 161 ? -20.597 -4.313  -50.461 1.00 113.60 ? 161 ARG B CB  1 
ATOM   4721 C  CG  . ARG B 1 161 ? -19.226 -4.603  -49.911 1.00 116.65 ? 161 ARG B CG  1 
ATOM   4722 C  CD  . ARG B 1 161 ? -18.154 -4.199  -50.881 1.00 122.59 ? 161 ARG B CD  1 
ATOM   4723 N  NE  . ARG B 1 161 ? -16.850 -4.243  -50.236 1.00 124.55 ? 161 ARG B NE  1 
ATOM   4724 C  CZ  . ARG B 1 161 ? -15.724 -3.850  -50.814 1.00 126.52 ? 161 ARG B CZ  1 
ATOM   4725 N  NH1 . ARG B 1 161 ? -15.752 -3.373  -52.052 1.00 128.47 1 161 ARG B NH1 1 
ATOM   4726 N  NH2 . ARG B 1 161 ? -14.575 -3.925  -50.154 1.00 124.50 ? 161 ARG B NH2 1 
ATOM   4727 N  N   . GLY B 1 162 ? -24.019 -4.538  -49.604 1.00 129.60 ? 162 GLY B N   1 
ATOM   4728 C  CA  . GLY B 1 162 ? -25.367 -4.157  -49.980 1.00 132.77 ? 162 GLY B CA  1 
ATOM   4729 C  C   . GLY B 1 162 ? -25.796 -4.644  -51.348 1.00 133.54 ? 162 GLY B C   1 
ATOM   4730 O  O   . GLY B 1 162 ? -26.861 -4.268  -51.842 1.00 135.10 ? 162 GLY B O   1 
ATOM   4731 N  N   . TYR B 1 163 ? -24.971 -5.474  -51.973 1.00 109.60 ? 163 TYR B N   1 
ATOM   4732 C  CA  . TYR B 1 163 ? -25.353 -6.072  -53.241 1.00 105.63 ? 163 TYR B CA  1 
ATOM   4733 C  C   . TYR B 1 163 ? -26.393 -7.154  -52.999 1.00 101.62 ? 163 TYR B C   1 
ATOM   4734 O  O   . TYR B 1 163 ? -26.467 -7.740  -51.916 1.00 103.79 ? 163 TYR B O   1 
ATOM   4735 C  CB  . TYR B 1 163 ? -24.141 -6.667  -53.954 1.00 104.64 ? 163 TYR B CB  1 
ATOM   4736 C  CG  . TYR B 1 163 ? -23.126 -5.638  -54.384 1.00 105.42 ? 163 TYR B CG  1 
ATOM   4737 C  CD1 . TYR B 1 163 ? -21.769 -5.867  -54.221 1.00 104.65 ? 163 TYR B CD1 1 
ATOM   4738 C  CD2 . TYR B 1 163 ? -23.527 -4.444  -54.969 1.00 108.18 ? 163 TYR B CD2 1 
ATOM   4739 C  CE1 . TYR B 1 163 ? -20.836 -4.932  -54.615 1.00 107.58 ? 163 TYR B CE1 1 
ATOM   4740 C  CE2 . TYR B 1 163 ? -22.602 -3.503  -55.365 1.00 109.66 ? 163 TYR B CE2 1 
ATOM   4741 C  CZ  . TYR B 1 163 ? -21.260 -3.752  -55.187 1.00 109.38 ? 163 TYR B CZ  1 
ATOM   4742 O  OH  . TYR B 1 163 ? -20.338 -2.813  -55.583 1.00 109.18 ? 163 TYR B OH  1 
ATOM   4743 N  N   . ARG B 1 164 ? -27.198 -7.408  -54.019 1.00 98.85  ? 164 ARG B N   1 
ATOM   4744 C  CA  . ARG B 1 164 ? -28.178 -8.475  -53.982 1.00 90.33  ? 164 ARG B CA  1 
ATOM   4745 C  C   . ARG B 1 164 ? -27.564 -9.707  -54.618 1.00 86.94  ? 164 ARG B C   1 
ATOM   4746 O  O   . ARG B 1 164 ? -27.059 -9.645  -55.736 1.00 84.23  ? 164 ARG B O   1 
ATOM   4747 C  CB  . ARG B 1 164 ? -29.424 -8.051  -54.746 1.00 88.49  ? 164 ARG B CB  1 
ATOM   4748 C  CG  . ARG B 1 164 ? -30.329 -9.189  -55.161 1.00 86.54  ? 164 ARG B CG  1 
ATOM   4749 C  CD  . ARG B 1 164 ? -31.643 -8.640  -55.672 1.00 89.38  ? 164 ARG B CD  1 
ATOM   4750 N  NE  . ARG B 1 164 ? -32.508 -9.690  -56.195 1.00 93.44  ? 164 ARG B NE  1 
ATOM   4751 C  CZ  . ARG B 1 164 ? -33.166 -9.603  -57.345 1.00 95.55  ? 164 ARG B CZ  1 
ATOM   4752 N  NH1 . ARG B 1 164 ? -33.055 -8.506  -58.088 1.00 95.94  1 164 ARG B NH1 1 
ATOM   4753 N  NH2 . ARG B 1 164 ? -33.936 -10.606 -57.751 1.00 96.95  ? 164 ARG B NH2 1 
ATOM   4754 N  N   . CYS B 1 165 ? -27.598 -10.828 -53.913 1.00 92.28  ? 165 CYS B N   1 
ATOM   4755 C  CA  . CYS B 1 165 ? -26.872 -11.999 -54.369 1.00 91.54  ? 165 CYS B CA  1 
ATOM   4756 C  C   . CYS B 1 165 ? -27.787 -13.135 -54.794 1.00 89.07  ? 165 CYS B C   1 
ATOM   4757 O  O   . CYS B 1 165 ? -28.705 -13.511 -54.068 1.00 89.37  ? 165 CYS B O   1 
ATOM   4758 C  CB  . CYS B 1 165 ? -25.916 -12.480 -53.282 1.00 92.98  ? 165 CYS B CB  1 
ATOM   4759 S  SG  . CYS B 1 165 ? -24.615 -13.570 -53.886 1.00 97.35  ? 165 CYS B SG  1 
ATOM   4760 N  N   . ILE B 1 166 ? -27.518 -13.690 -55.969 1.00 70.50  ? 166 ILE B N   1 
ATOM   4761 C  CA  . ILE B 1 166 ? -28.267 -14.830 -56.472 1.00 67.70  ? 166 ILE B CA  1 
ATOM   4762 C  C   . ILE B 1 166 ? -27.326 -15.957 -56.847 1.00 65.77  ? 166 ILE B C   1 
ATOM   4763 O  O   . ILE B 1 166 ? -26.485 -15.819 -57.741 1.00 65.60  ? 166 ILE B O   1 
ATOM   4764 C  CB  . ILE B 1 166 ? -29.105 -14.476 -57.697 1.00 67.66  ? 166 ILE B CB  1 
ATOM   4765 C  CG1 . ILE B 1 166 ? -30.077 -13.350 -57.357 1.00 67.79  ? 166 ILE B CG1 1 
ATOM   4766 C  CG2 . ILE B 1 166 ? -29.867 -15.702 -58.180 1.00 67.94  ? 166 ILE B CG2 1 
ATOM   4767 C  CD1 . ILE B 1 166 ? -31.051 -13.040 -58.458 1.00 66.88  ? 166 ILE B CD1 1 
ATOM   4768 N  N   . ILE B 1 167 ? -27.486 -17.082 -56.170 1.00 68.25  ? 167 ILE B N   1 
ATOM   4769 C  CA  . ILE B 1 167 ? -26.584 -18.204 -56.310 1.00 66.03  ? 167 ILE B CA  1 
ATOM   4770 C  C   . ILE B 1 167 ? -27.258 -19.293 -57.116 1.00 64.15  ? 167 ILE B C   1 
ATOM   4771 O  O   . ILE B 1 167 ? -28.473 -19.479 -57.036 1.00 64.64  ? 167 ILE B O   1 
ATOM   4772 C  CB  . ILE B 1 167 ? -26.178 -18.752 -54.925 1.00 66.33  ? 167 ILE B CB  1 
ATOM   4773 C  CG1 . ILE B 1 167 ? -25.559 -17.639 -54.081 1.00 66.13  ? 167 ILE B CG1 1 
ATOM   4774 C  CG2 . ILE B 1 167 ? -25.234 -19.935 -55.045 1.00 66.27  ? 167 ILE B CG2 1 
ATOM   4775 C  CD1 . ILE B 1 167 ? -24.424 -16.929 -54.766 1.00 66.16  ? 167 ILE B CD1 1 
ATOM   4776 N  N   . VAL B 1 168 ? -26.477 -19.991 -57.925 1.00 66.29  ? 168 VAL B N   1 
ATOM   4777 C  CA  . VAL B 1 168 ? -26.981 -21.136 -58.645 1.00 64.16  ? 168 VAL B CA  1 
ATOM   4778 C  C   . VAL B 1 168 ? -26.033 -22.282 -58.399 1.00 64.01  ? 168 VAL B C   1 
ATOM   4779 O  O   . VAL B 1 168 ? -24.856 -22.189 -58.736 1.00 62.35  ? 168 VAL B O   1 
ATOM   4780 C  CB  . VAL B 1 168 ? -27.053 -20.872 -60.146 1.00 63.43  ? 168 VAL B CB  1 
ATOM   4781 C  CG1 . VAL B 1 168 ? -27.602 -22.084 -60.852 1.00 63.16  ? 168 VAL B CG1 1 
ATOM   4782 C  CG2 . VAL B 1 168 ? -27.922 -19.663 -60.425 1.00 63.07  ? 168 VAL B CG2 1 
ATOM   4783 N  N   . MET B 1 169 ? -26.510 -23.353 -57.786 1.00 58.16  ? 169 MET B N   1 
ATOM   4784 C  CA  . MET B 1 169 ? -25.627 -24.478 -57.527 1.00 60.90  ? 169 MET B CA  1 
ATOM   4785 C  C   . MET B 1 169 ? -26.308 -25.811 -57.791 1.00 59.46  ? 169 MET B C   1 
ATOM   4786 O  O   . MET B 1 169 ? -27.529 -25.926 -57.707 1.00 58.02  ? 169 MET B O   1 
ATOM   4787 C  CB  . MET B 1 169 ? -25.049 -24.397 -56.109 1.00 63.47  ? 169 MET B CB  1 
ATOM   4788 C  CG  . MET B 1 169 ? -26.095 -24.442 -55.012 1.00 74.40  ? 169 MET B CG  1 
ATOM   4789 S  SD  . MET B 1 169 ? -25.369 -24.075 -53.401 1.00 89.16  ? 169 MET B SD  1 
ATOM   4790 C  CE  . MET B 1 169 ? -23.882 -25.047 -53.514 1.00 89.20  ? 169 MET B CE  1 
ATOM   4791 N  N   . PRO B 1 170 ? -25.517 -26.819 -58.162 1.00 63.99  ? 170 PRO B N   1 
ATOM   4792 C  CA  . PRO B 1 170 ? -26.062 -28.152 -58.431 1.00 66.01  ? 170 PRO B CA  1 
ATOM   4793 C  C   . PRO B 1 170 ? -26.723 -28.752 -57.202 1.00 68.92  ? 170 PRO B C   1 
ATOM   4794 O  O   . PRO B 1 170 ? -26.454 -28.304 -56.082 1.00 68.93  ? 170 PRO B O   1 
ATOM   4795 C  CB  . PRO B 1 170 ? -24.824 -28.958 -58.810 1.00 65.38  ? 170 PRO B CB  1 
ATOM   4796 C  CG  . PRO B 1 170 ? -23.909 -27.946 -59.392 1.00 64.21  ? 170 PRO B CG  1 
ATOM   4797 C  CD  . PRO B 1 170 ? -24.114 -26.700 -58.588 1.00 63.44  ? 170 PRO B CD  1 
ATOM   4798 N  N   . GLU B 1 171 ? -27.568 -29.758 -57.409 1.00 82.04  ? 171 GLU B N   1 
ATOM   4799 C  CA  . GLU B 1 171 ? -28.331 -30.339 -56.314 1.00 87.48  ? 171 GLU B CA  1 
ATOM   4800 C  C   . GLU B 1 171 ? -27.546 -31.391 -55.529 1.00 85.76  ? 171 GLU B C   1 
ATOM   4801 O  O   . GLU B 1 171 ? -28.077 -32.018 -54.612 1.00 85.15  ? 171 GLU B O   1 
ATOM   4802 C  CB  . GLU B 1 171 ? -29.701 -30.862 -56.778 1.00 92.51  ? 171 GLU B CB  1 
ATOM   4803 C  CG  . GLU B 1 171 ? -29.726 -31.640 -58.091 1.00 105.61 ? 171 GLU B CG  1 
ATOM   4804 C  CD  . GLU B 1 171 ? -31.145 -31.769 -58.654 1.00 115.83 ? 171 GLU B CD  1 
ATOM   4805 O  OE1 . GLU B 1 171 ? -32.041 -31.017 -58.201 1.00 118.32 ? 171 GLU B OE1 1 
ATOM   4806 O  OE2 . GLU B 1 171 ? -31.365 -32.619 -59.546 1.00 117.41 1 171 GLU B OE2 1 
ATOM   4807 N  N   . LYS B 1 172 ? -26.289 -31.590 -55.908 1.00 68.32  ? 172 LYS B N   1 
ATOM   4808 C  CA  . LYS B 1 172 ? -25.398 -32.532 -55.247 1.00 68.27  ? 172 LYS B CA  1 
ATOM   4809 C  C   . LYS B 1 172 ? -24.907 -31.920 -53.966 1.00 70.17  ? 172 LYS B C   1 
ATOM   4810 O  O   . LYS B 1 172 ? -24.701 -32.607 -52.964 1.00 69.08  ? 172 LYS B O   1 
ATOM   4811 C  CB  . LYS B 1 172 ? -24.186 -32.810 -56.123 1.00 66.70  ? 172 LYS B CB  1 
ATOM   4812 C  CG  . LYS B 1 172 ? -23.299 -33.912 -55.617 1.00 64.48  ? 172 LYS B CG  1 
ATOM   4813 C  CD  . LYS B 1 172 ? -22.065 -34.062 -56.491 1.00 63.37  ? 172 LYS B CD  1 
ATOM   4814 C  CE  . LYS B 1 172 ? -21.101 -32.898 -56.287 1.00 63.73  ? 172 LYS B CE  1 
ATOM   4815 N  NZ  . LYS B 1 172 ? -19.779 -33.142 -56.961 1.00 65.87  1 172 LYS B NZ  1 
ATOM   4816 N  N   . MET B 1 173 ? -24.695 -30.613 -54.021 1.00 82.80  ? 173 MET B N   1 
ATOM   4817 C  CA  . MET B 1 173 ? -23.981 -29.907 -52.974 1.00 85.31  ? 173 MET B CA  1 
ATOM   4818 C  C   . MET B 1 173 ? -24.693 -29.970 -51.640 1.00 85.44  ? 173 MET B C   1 
ATOM   4819 O  O   . MET B 1 173 ? -25.921 -30.088 -51.569 1.00 87.78  ? 173 MET B O   1 
ATOM   4820 C  CB  . MET B 1 173 ? -23.755 -28.462 -53.382 1.00 86.40  ? 173 MET B CB  1 
ATOM   4821 C  CG  . MET B 1 173 ? -23.083 -28.328 -54.736 1.00 86.30  ? 173 MET B CG  1 
ATOM   4822 S  SD  . MET B 1 173 ? -21.458 -29.130 -54.743 1.00 87.18  ? 173 MET B SD  1 
ATOM   4823 C  CE  . MET B 1 173 ? -20.993 -28.915 -56.457 1.00 82.01  ? 173 MET B CE  1 
ATOM   4824 N  N   . SER B 1 174 ? -23.902 -29.902 -50.578 1.00 81.45  ? 174 SER B N   1 
ATOM   4825 C  CA  . SER B 1 174 ? -24.407 -30.126 -49.235 1.00 79.06  ? 174 SER B CA  1 
ATOM   4826 C  C   . SER B 1 174 ? -25.386 -29.058 -48.792 1.00 78.49  ? 174 SER B C   1 
ATOM   4827 O  O   . SER B 1 174 ? -25.286 -27.888 -49.179 1.00 76.60  ? 174 SER B O   1 
ATOM   4828 C  CB  . SER B 1 174 ? -23.262 -30.219 -48.237 1.00 78.26  ? 174 SER B CB  1 
ATOM   4829 O  OG  . SER B 1 174 ? -22.636 -28.956 -48.091 1.00 78.87  ? 174 SER B OG  1 
ATOM   4830 N  N   . SER B 1 175 ? -26.311 -29.467 -47.937 1.00 77.72  ? 175 SER B N   1 
ATOM   4831 C  CA  . SER B 1 175 ? -27.360 -28.582 -47.478 1.00 80.17  ? 175 SER B CA  1 
ATOM   4832 C  C   . SER B 1 175 ? -26.819 -27.546 -46.509 1.00 80.33  ? 175 SER B C   1 
ATOM   4833 O  O   . SER B 1 175 ? -27.431 -26.502 -46.304 1.00 80.58  ? 175 SER B O   1 
ATOM   4834 C  CB  . SER B 1 175 ? -28.467 -29.400 -46.824 1.00 80.80  ? 175 SER B CB  1 
ATOM   4835 O  OG  . SER B 1 175 ? -27.904 -30.439 -46.039 1.00 85.30  ? 175 SER B OG  1 
ATOM   4836 N  N   . GLU B 1 176 ? -25.667 -27.840 -45.915 1.00 63.21  ? 176 GLU B N   1 
ATOM   4837 C  CA  . GLU B 1 176 ? -25.026 -26.913 -44.994 1.00 63.02  ? 176 GLU B CA  1 
ATOM   4838 C  C   . GLU B 1 176 ? -24.686 -25.629 -45.729 1.00 60.71  ? 176 GLU B C   1 
ATOM   4839 O  O   . GLU B 1 176 ? -24.869 -24.518 -45.202 1.00 63.34  ? 176 GLU B O   1 
ATOM   4840 C  CB  . GLU B 1 176 ? -23.765 -27.532 -44.410 1.00 62.20  ? 176 GLU B CB  1 
ATOM   4841 C  CG  . GLU B 1 176 ? -24.038 -28.620 -43.391 1.00 65.28  ? 176 GLU B CG  1 
ATOM   4842 C  CD  . GLU B 1 176 ? -24.222 -29.984 -44.039 1.00 69.37  ? 176 GLU B CD  1 
ATOM   4843 O  OE1 . GLU B 1 176 ? -24.262 -30.053 -45.289 1.00 70.85  ? 176 GLU B OE1 1 
ATOM   4844 O  OE2 . GLU B 1 176 ? -24.316 -30.986 -43.296 1.00 70.82  1 176 GLU B OE2 1 
ATOM   4845 N  N   . LYS B 1 177 ? -24.194 -25.794 -46.952 1.00 71.98  ? 177 LYS B N   1 
ATOM   4846 C  CA  . LYS B 1 177 ? -23.881 -24.670 -47.814 1.00 65.36  ? 177 LYS B CA  1 
ATOM   4847 C  C   . LYS B 1 177 ? -25.114 -23.815 -48.000 1.00 66.39  ? 177 LYS B C   1 
ATOM   4848 O  O   . LYS B 1 177 ? -25.066 -22.583 -47.893 1.00 64.37  ? 177 LYS B O   1 
ATOM   4849 C  CB  . LYS B 1 177 ? -23.422 -25.165 -49.175 1.00 61.41  ? 177 LYS B CB  1 
ATOM   4850 C  CG  . LYS B 1 177 ? -22.118 -25.928 -49.160 1.00 54.12  ? 177 LYS B CG  1 
ATOM   4851 C  CD  . LYS B 1 177 ? -21.636 -26.190 -50.579 1.00 49.37  ? 177 LYS B CD  1 
ATOM   4852 C  CE  . LYS B 1 177 ? -20.331 -26.961 -50.579 1.00 48.72  ? 177 LYS B CE  1 
ATOM   4853 N  NZ  . LYS B 1 177 ? -19.863 -27.221 -51.972 1.00 51.94  1 177 LYS B NZ  1 
ATOM   4854 N  N   . VAL B 1 178 ? -26.221 -24.496 -48.280 1.00 81.93  ? 178 VAL B N   1 
ATOM   4855 C  CA  . VAL B 1 178 ? -27.497 -23.849 -48.519 1.00 85.92  ? 178 VAL B CA  1 
ATOM   4856 C  C   . VAL B 1 178 ? -27.886 -23.030 -47.313 1.00 88.52  ? 178 VAL B C   1 
ATOM   4857 O  O   . VAL B 1 178 ? -28.320 -21.886 -47.426 1.00 88.86  ? 178 VAL B O   1 
ATOM   4858 C  CB  . VAL B 1 178 ? -28.595 -24.889 -48.749 1.00 86.37  ? 178 VAL B CB  1 
ATOM   4859 C  CG1 . VAL B 1 178 ? -29.951 -24.223 -48.782 1.00 85.77  ? 178 VAL B CG1 1 
ATOM   4860 C  CG2 . VAL B 1 178 ? -28.336 -25.653 -50.032 1.00 86.66  ? 178 VAL B CG2 1 
ATOM   4861 N  N   . ASP B 1 179 ? -27.711 -23.643 -46.153 1.00 83.79  ? 179 ASP B N   1 
ATOM   4862 C  CA  . ASP B 1 179 ? -28.064 -23.037 -44.889 1.00 86.70  ? 179 ASP B CA  1 
ATOM   4863 C  C   . ASP B 1 179 ? -27.288 -21.747 -44.689 1.00 82.05  ? 179 ASP B C   1 
ATOM   4864 O  O   . ASP B 1 179 ? -27.877 -20.677 -44.487 1.00 81.92  ? 179 ASP B O   1 
ATOM   4865 C  CB  . ASP B 1 179 ? -27.798 -24.028 -43.762 1.00 92.17  ? 179 ASP B CB  1 
ATOM   4866 C  CG  . ASP B 1 179 ? -28.871 -25.099 -43.670 1.00 108.21 ? 179 ASP B CG  1 
ATOM   4867 O  OD1 . ASP B 1 179 ? -30.053 -24.780 -43.934 1.00 122.96 ? 179 ASP B OD1 1 
ATOM   4868 O  OD2 . ASP B 1 179 ? -28.535 -26.260 -43.350 1.00 122.96 1 179 ASP B OD2 1 
ATOM   4869 N  N   . VAL B 1 180 ? -25.968 -21.848 -44.772 1.00 69.52  ? 180 VAL B N   1 
ATOM   4870 C  CA  . VAL B 1 180 ? -25.113 -20.680 -44.613 1.00 64.89  ? 180 VAL B CA  1 
ATOM   4871 C  C   . VAL B 1 180 ? -25.524 -19.576 -45.584 1.00 65.02  ? 180 VAL B C   1 
ATOM   4872 O  O   . VAL B 1 180 ? -25.653 -18.402 -45.205 1.00 63.85  ? 180 VAL B O   1 
ATOM   4873 C  CB  . VAL B 1 180 ? -23.640 -21.029 -44.852 1.00 63.48  ? 180 VAL B CB  1 
ATOM   4874 C  CG1 . VAL B 1 180 ? -22.779 -19.791 -44.698 1.00 59.44  ? 180 VAL B CG1 1 
ATOM   4875 C  CG2 . VAL B 1 180 ? -23.197 -22.113 -43.885 1.00 60.26  ? 180 VAL B CG2 1 
ATOM   4876 N  N   . LEU B 1 181 ? -25.750 -19.969 -46.834 1.00 74.74  ? 181 LEU B N   1 
ATOM   4877 C  CA  . LEU B 1 181 ? -26.129 -19.035 -47.882 1.00 76.34  ? 181 LEU B CA  1 
ATOM   4878 C  C   . LEU B 1 181 ? -27.416 -18.299 -47.561 1.00 79.28  ? 181 LEU B C   1 
ATOM   4879 O  O   . LEU B 1 181 ? -27.520 -17.086 -47.770 1.00 80.03  ? 181 LEU B O   1 
ATOM   4880 C  CB  . LEU B 1 181 ? -26.296 -19.773 -49.204 1.00 74.40  ? 181 LEU B CB  1 
ATOM   4881 C  CG  . LEU B 1 181 ? -25.010 -20.095 -49.947 1.00 70.29  ? 181 LEU B CG  1 
ATOM   4882 C  CD1 . LEU B 1 181 ? -25.305 -21.031 -51.094 1.00 66.29  ? 181 LEU B CD1 1 
ATOM   4883 C  CD2 . LEU B 1 181 ? -24.428 -18.797 -50.476 1.00 67.14  ? 181 LEU B CD2 1 
ATOM   4884 N  N   . ARG B 1 182 ? -28.392 -19.038 -47.047 1.00 80.09  ? 182 ARG B N   1 
ATOM   4885 C  CA  . ARG B 1 182 ? -29.702 -18.484 -46.765 1.00 82.56  ? 182 ARG B CA  1 
ATOM   4886 C  C   . ARG B 1 182 ? -29.581 -17.538 -45.597 1.00 84.03  ? 182 ARG B C   1 
ATOM   4887 O  O   . ARG B 1 182 ? -30.248 -16.501 -45.543 1.00 84.42  ? 182 ARG B O   1 
ATOM   4888 C  CB  . ARG B 1 182 ? -30.685 -19.600 -46.443 1.00 82.60  ? 182 ARG B CB  1 
ATOM   4889 C  CG  . ARG B 1 182 ? -32.102 -19.126 -46.222 1.00 83.16  ? 182 ARG B CG  1 
ATOM   4890 C  CD  . ARG B 1 182 ? -33.048 -20.298 -46.342 1.00 87.84  ? 182 ARG B CD  1 
ATOM   4891 N  NE  . ARG B 1 182 ? -32.426 -21.532 -45.872 1.00 92.26  ? 182 ARG B NE  1 
ATOM   4892 C  CZ  . ARG B 1 182 ? -32.878 -22.750 -46.152 1.00 95.96  ? 182 ARG B CZ  1 
ATOM   4893 N  NH1 . ARG B 1 182 ? -33.960 -22.900 -46.917 1.00 97.63  1 182 ARG B NH1 1 
ATOM   4894 N  NH2 . ARG B 1 182 ? -32.245 -23.818 -45.676 1.00 97.58  ? 182 ARG B NH2 1 
ATOM   4895 N  N   . ALA B 1 183 ? -28.706 -17.894 -44.664 1.00 74.47  ? 183 ALA B N   1 
ATOM   4896 C  CA  . ALA B 1 183 ? -28.462 -17.050 -43.510 1.00 75.44  ? 183 ALA B CA  1 
ATOM   4897 C  C   . ALA B 1 183 ? -27.787 -15.764 -43.954 1.00 75.51  ? 183 ALA B C   1 
ATOM   4898 O  O   . ALA B 1 183 ? -27.923 -14.718 -43.306 1.00 75.16  ? 183 ALA B O   1 
ATOM   4899 C  CB  . ALA B 1 183 ? -27.608 -17.768 -42.496 1.00 77.05  ? 183 ALA B CB  1 
ATOM   4900 N  N   . LEU B 1 184 ? -27.060 -15.843 -45.064 1.00 81.89  ? 184 LEU B N   1 
ATOM   4901 C  CA  . LEU B 1 184 ? -26.341 -14.680 -45.564 1.00 82.05  ? 184 LEU B CA  1 
ATOM   4902 C  C   . LEU B 1 184 ? -27.229 -13.711 -46.334 1.00 82.52  ? 184 LEU B C   1 
ATOM   4903 O  O   . LEU B 1 184 ? -26.845 -12.561 -46.563 1.00 81.79  ? 184 LEU B O   1 
ATOM   4904 C  CB  . LEU B 1 184 ? -25.165 -15.113 -46.434 1.00 82.13  ? 184 LEU B CB  1 
ATOM   4905 C  CG  . LEU B 1 184 ? -23.945 -15.617 -45.667 1.00 82.12  ? 184 LEU B CG  1 
ATOM   4906 C  CD1 . LEU B 1 184 ? -23.085 -16.474 -46.566 1.00 83.93  ? 184 LEU B CD1 1 
ATOM   4907 C  CD2 . LEU B 1 184 ? -23.147 -14.433 -45.152 1.00 79.90  ? 184 LEU B CD2 1 
ATOM   4908 N  N   . GLY B 1 185 ? -28.421 -14.156 -46.707 1.00 73.35  ? 185 GLY B N   1 
ATOM   4909 C  CA  . GLY B 1 185 ? -29.345 -13.285 -47.408 1.00 75.94  ? 185 GLY B CA  1 
ATOM   4910 C  C   . GLY B 1 185 ? -29.308 -13.529 -48.902 1.00 76.38  ? 185 GLY B C   1 
ATOM   4911 O  O   . GLY B 1 185 ? -29.802 -12.719 -49.694 1.00 79.29  ? 185 GLY B O   1 
ATOM   4912 N  N   . ALA B 1 186 ? -28.699 -14.644 -49.291 1.00 81.17  ? 186 ALA B N   1 
ATOM   4913 C  CA  . ALA B 1 186 ? -28.600 -14.997 -50.698 1.00 77.99  ? 186 ALA B CA  1 
ATOM   4914 C  C   . ALA B 1 186 ? -29.825 -15.776 -51.152 1.00 76.00  ? 186 ALA B C   1 
ATOM   4915 O  O   . ALA B 1 186 ? -30.350 -16.624 -50.425 1.00 76.30  ? 186 ALA B O   1 
ATOM   4916 C  CB  . ALA B 1 186 ? -27.348 -15.802 -50.952 1.00 77.35  ? 186 ALA B CB  1 
ATOM   4917 N  N   . GLU B 1 187 ? -30.260 -15.495 -52.371 1.00 86.72  ? 187 GLU B N   1 
ATOM   4918 C  CA  . GLU B 1 187 ? -31.315 -16.261 -53.006 1.00 85.02  ? 187 GLU B CA  1 
ATOM   4919 C  C   . GLU B 1 187 ? -30.674 -17.452 -53.689 1.00 82.42  ? 187 GLU B C   1 
ATOM   4920 O  O   . GLU B 1 187 ? -29.578 -17.343 -54.232 1.00 81.42  ? 187 GLU B O   1 
ATOM   4921 C  CB  . GLU B 1 187 ? -32.056 -15.390 -54.012 1.00 85.64  ? 187 GLU B CB  1 
ATOM   4922 C  CG  . GLU B 1 187 ? -32.842 -14.264 -53.360 1.00 92.41  ? 187 GLU B CG  1 
ATOM   4923 C  CD  . GLU B 1 187 ? -32.981 -13.042 -54.255 1.00 100.58 ? 187 GLU B CD  1 
ATOM   4924 O  OE1 . GLU B 1 187 ? -32.314 -12.022 -53.968 1.00 103.46 ? 187 GLU B OE1 1 
ATOM   4925 O  OE2 . GLU B 1 187 ? -33.782 -13.090 -55.220 1.00 103.49 1 187 GLU B OE2 1 
ATOM   4926 N  N   . ILE B 1 188 ? -31.343 -18.594 -53.652 1.00 68.90  ? 188 ILE B N   1 
ATOM   4927 C  CA  . ILE B 1 188 ? -30.733 -19.835 -54.095 1.00 67.13  ? 188 ILE B CA  1 
ATOM   4928 C  C   . ILE B 1 188 ? -31.520 -20.526 -55.192 1.00 65.71  ? 188 ILE B C   1 
ATOM   4929 O  O   . ILE B 1 188 ? -32.744 -20.634 -55.122 1.00 66.47  ? 188 ILE B O   1 
ATOM   4930 C  CB  . ILE B 1 188 ? -30.558 -20.795 -52.922 1.00 67.17  ? 188 ILE B CB  1 
ATOM   4931 C  CG1 . ILE B 1 188 ? -29.692 -20.141 -51.855 1.00 66.18  ? 188 ILE B CG1 1 
ATOM   4932 C  CG2 . ILE B 1 188 ? -29.925 -22.097 -53.372 1.00 67.22  ? 188 ILE B CG2 1 
ATOM   4933 C  CD1 . ILE B 1 188 ? -29.843 -20.768 -50.504 1.00 63.87  ? 188 ILE B CD1 1 
ATOM   4934 N  N   . VAL B 1 189 ? -30.809 -21.004 -56.206 1.00 66.78  ? 189 VAL B N   1 
ATOM   4935 C  CA  . VAL B 1 189 ? -31.420 -21.758 -57.283 1.00 63.62  ? 189 VAL B CA  1 
ATOM   4936 C  C   . VAL B 1 189 ? -30.586 -22.998 -57.476 1.00 64.41  ? 189 VAL B C   1 
ATOM   4937 O  O   . VAL B 1 189 ? -29.361 -22.930 -57.443 1.00 63.68  ? 189 VAL B O   1 
ATOM   4938 C  CB  . VAL B 1 189 ? -31.426 -20.975 -58.599 1.00 62.26  ? 189 VAL B CB  1 
ATOM   4939 C  CG1 . VAL B 1 189 ? -31.991 -21.834 -59.713 1.00 59.19  ? 189 VAL B CG1 1 
ATOM   4940 C  CG2 . VAL B 1 189 ? -32.226 -19.701 -58.455 1.00 58.48  ? 189 VAL B CG2 1 
ATOM   4941 N  N   . ARG B 1 190 ? -31.224 -24.136 -57.686 1.00 61.00  ? 190 ARG B N   1 
ATOM   4942 C  CA  . ARG B 1 190 ? -30.461 -25.352 -57.846 1.00 63.22  ? 190 ARG B CA  1 
ATOM   4943 C  C   . ARG B 1 190 ? -30.613 -25.874 -59.251 1.00 62.76  ? 190 ARG B C   1 
ATOM   4944 O  O   . ARG B 1 190 ? -31.602 -25.587 -59.935 1.00 61.24  ? 190 ARG B O   1 
ATOM   4945 C  CB  . ARG B 1 190 ? -30.891 -26.420 -56.853 1.00 64.83  ? 190 ARG B CB  1 
ATOM   4946 C  CG  . ARG B 1 190 ? -30.880 -25.959 -55.415 1.00 72.22  ? 190 ARG B CG  1 
ATOM   4947 C  CD  . ARG B 1 190 ? -29.502 -25.509 -54.950 1.00 80.22  ? 190 ARG B CD  1 
ATOM   4948 N  NE  . ARG B 1 190 ? -28.580 -26.634 -54.799 1.00 82.58  ? 190 ARG B NE  1 
ATOM   4949 C  CZ  . ARG B 1 190 ? -28.534 -27.430 -53.734 1.00 83.42  ? 190 ARG B CZ  1 
ATOM   4950 N  NH1 . ARG B 1 190 ? -29.378 -27.238 -52.719 1.00 82.51  1 190 ARG B NH1 1 
ATOM   4951 N  NH2 . ARG B 1 190 ? -27.650 -28.424 -53.685 1.00 82.75  ? 190 ARG B NH2 1 
ATOM   4952 N  N   . THR B 1 191 ? -29.618 -26.627 -59.696 1.00 60.67  ? 191 THR B N   1 
ATOM   4953 C  CA  . THR B 1 191 ? -29.684 -27.226 -61.014 1.00 62.48  ? 191 THR B CA  1 
ATOM   4954 C  C   . THR B 1 191 ? -29.391 -28.698 -60.904 1.00 61.66  ? 191 THR B C   1 
ATOM   4955 O  O   . THR B 1 191 ? -28.703 -29.121 -59.982 1.00 61.79  ? 191 THR B O   1 
ATOM   4956 C  CB  . THR B 1 191 ? -28.656 -26.609 -61.952 1.00 63.47  ? 191 THR B CB  1 
ATOM   4957 O  OG1 . THR B 1 191 ? -27.334 -26.876 -61.461 1.00 66.47  ? 191 THR B OG1 1 
ATOM   4958 C  CG2 . THR B 1 191 ? -28.888 -25.125 -62.040 1.00 66.01  ? 191 THR B CG2 1 
ATOM   4959 N  N   . PRO B 1 192 ? -29.904 -29.493 -61.846 1.00 58.64  ? 192 PRO B N   1 
ATOM   4960 C  CA  . PRO B 1 192 ? -29.609 -30.923 -61.817 1.00 62.94  ? 192 PRO B CA  1 
ATOM   4961 C  C   . PRO B 1 192 ? -28.111 -31.117 -61.899 1.00 71.85  ? 192 PRO B C   1 
ATOM   4962 O  O   . PRO B 1 192 ? -27.423 -30.406 -62.638 1.00 71.39  ? 192 PRO B O   1 
ATOM   4963 C  CB  . PRO B 1 192 ? -30.239 -31.433 -63.114 1.00 58.74  ? 192 PRO B CB  1 
ATOM   4964 C  CG  . PRO B 1 192 ? -31.326 -30.473 -63.388 1.00 52.86  ? 192 PRO B CG  1 
ATOM   4965 C  CD  . PRO B 1 192 ? -30.795 -29.138 -62.962 1.00 55.34  ? 192 PRO B CD  1 
ATOM   4966 N  N   . THR B 1 193 ? -27.601 -32.055 -61.121 1.00 131.84 ? 193 THR B N   1 
ATOM   4967 C  CA  . THR B 1 193 ? -26.178 -32.324 -61.128 1.00 131.84 ? 193 THR B CA  1 
ATOM   4968 C  C   . THR B 1 193 ? -25.727 -33.039 -62.381 1.00 131.84 ? 193 THR B C   1 
ATOM   4969 O  O   . THR B 1 193 ? -24.590 -32.883 -62.820 1.00 131.84 ? 193 THR B O   1 
ATOM   4970 C  CB  . THR B 1 193 ? -25.810 -33.140 -59.918 1.00 121.84 ? 193 THR B CB  1 
ATOM   4971 O  OG1 . THR B 1 193 ? -26.525 -34.383 -59.962 1.00 121.84 ? 193 THR B OG1 1 
ATOM   4972 C  CG2 . THR B 1 193 ? -26.292 -32.422 -58.743 1.00 121.84 ? 193 THR B CG2 1 
ATOM   4973 N  N   . ASN B 1 194 ? -26.622 -33.825 -62.953 1.00 136.73 ? 194 ASN B N   1 
ATOM   4974 C  CA  . ASN B 1 194 ? -26.291 -34.646 -64.103 1.00 136.73 ? 194 ASN B CA  1 
ATOM   4975 C  C   . ASN B 1 194 ? -26.314 -33.832 -65.389 1.00 136.73 ? 194 ASN B C   1 
ATOM   4976 O  O   . ASN B 1 194 ? -25.980 -34.340 -66.458 1.00 136.73 ? 194 ASN B O   1 
ATOM   4977 C  CB  . ASN B 1 194 ? -27.221 -35.851 -64.199 1.00 41.00  ? 194 ASN B CB  1 
ATOM   4978 N  N   . ALA B 1 195 ? -26.742 -32.578 -65.282 1.00 74.88  ? 195 ALA B N   1 
ATOM   4979 C  CA  . ALA B 1 195 ? -26.906 -31.717 -66.447 1.00 67.09  ? 195 ALA B CA  1 
ATOM   4980 C  C   . ALA B 1 195 ? -25.575 -31.354 -67.068 1.00 65.99  ? 195 ALA B C   1 
ATOM   4981 O  O   . ALA B 1 195 ? -24.619 -31.002 -66.371 1.00 62.97  ? 195 ALA B O   1 
ATOM   4982 C  CB  . ALA B 1 195 ? -27.659 -30.461 -66.086 1.00 60.14  ? 195 ALA B CB  1 
ATOM   4983 N  N   . ARG B 1 196 ? -25.539 -31.411 -68.395 1.00 79.87  ? 196 ARG B N   1 
ATOM   4984 C  CA  . ARG B 1 196 ? -24.358 -31.068 -69.160 1.00 82.98  ? 196 ARG B CA  1 
ATOM   4985 C  C   . ARG B 1 196 ? -24.225 -29.565 -69.272 1.00 85.07  ? 196 ARG B C   1 
ATOM   4986 O  O   . ARG B 1 196 ? -25.211 -28.860 -69.460 1.00 87.50  ? 196 ARG B O   1 
ATOM   4987 C  CB  . ARG B 1 196 ? -24.498 -31.649 -70.551 1.00 83.30  ? 196 ARG B CB  1 
ATOM   4988 C  CG  . ARG B 1 196 ? -24.491 -33.151 -70.567 1.00 79.24  ? 196 ARG B CG  1 
ATOM   4989 C  CD  . ARG B 1 196 ? -23.092 -33.649 -70.751 1.00 74.50  ? 196 ARG B CD  1 
ATOM   4990 N  NE  . ARG B 1 196 ? -22.504 -33.101 -71.969 1.00 73.11  ? 196 ARG B NE  1 
ATOM   4991 C  CZ  . ARG B 1 196 ? -21.244 -33.297 -72.337 1.00 72.72  ? 196 ARG B CZ  1 
ATOM   4992 N  NH1 . ARG B 1 196 ? -20.450 -34.045 -71.578 1.00 68.82  1 196 ARG B NH1 1 
ATOM   4993 N  NH2 . ARG B 1 196 ? -20.787 -32.763 -73.465 1.00 75.02  ? 196 ARG B NH2 1 
ATOM   4994 N  N   . PHE B 1 197 ? -22.999 -29.074 -69.176 1.00 81.63  ? 197 PHE B N   1 
ATOM   4995 C  CA  . PHE B 1 197 ? -22.743 -27.642 -69.198 1.00 82.40  ? 197 PHE B CA  1 
ATOM   4996 C  C   . PHE B 1 197 ? -23.271 -26.992 -70.471 1.00 87.76  ? 197 PHE B C   1 
ATOM   4997 O  O   . PHE B 1 197 ? -23.518 -25.783 -70.504 1.00 86.95  ? 197 PHE B O   1 
ATOM   4998 C  CB  . PHE B 1 197 ? -21.256 -27.381 -69.034 1.00 77.37  ? 197 PHE B CB  1 
ATOM   4999 C  CG  . PHE B 1 197 ? -20.437 -27.858 -70.191 1.00 71.36  ? 197 PHE B CG  1 
ATOM   5000 C  CD1 . PHE B 1 197 ? -19.913 -26.960 -71.107 1.00 67.63  ? 197 PHE B CD1 1 
ATOM   5001 C  CD2 . PHE B 1 197 ? -20.181 -29.213 -70.358 1.00 67.59  ? 197 PHE B CD2 1 
ATOM   5002 C  CE1 . PHE B 1 197 ? -19.150 -27.408 -72.167 1.00 66.12  ? 197 PHE B CE1 1 
ATOM   5003 C  CE2 . PHE B 1 197 ? -19.420 -29.666 -71.421 1.00 65.55  ? 197 PHE B CE2 1 
ATOM   5004 C  CZ  . PHE B 1 197 ? -18.902 -28.763 -72.322 1.00 65.52  ? 197 PHE B CZ  1 
ATOM   5005 N  N   . ASP B 1 198 ? -23.414 -27.795 -71.523 1.00 98.29  ? 198 ASP B N   1 
ATOM   5006 C  CA  . ASP B 1 198 ? -24.067 -27.349 -72.743 1.00 103.58 ? 198 ASP B CA  1 
ATOM   5007 C  C   . ASP B 1 198 ? -25.503 -27.026 -72.431 1.00 102.02 ? 198 ASP B C   1 
ATOM   5008 O  O   . ASP B 1 198 ? -25.999 -25.935 -72.725 1.00 105.06 ? 198 ASP B O   1 
ATOM   5009 C  CB  . ASP B 1 198 ? -24.077 -28.470 -73.772 1.00 108.29 ? 198 ASP B CB  1 
ATOM   5010 C  CG  . ASP B 1 198 ? -22.698 -28.850 -74.230 1.00 115.43 ? 198 ASP B CG  1 
ATOM   5011 O  OD1 . ASP B 1 198 ? -21.815 -27.967 -74.235 1.00 120.22 ? 198 ASP B OD1 1 
ATOM   5012 O  OD2 . ASP B 1 198 ? -22.497 -30.029 -74.590 1.00 120.17 1 198 ASP B OD2 1 
ATOM   5013 N  N   . SER B 1 199 ? -26.151 -27.997 -71.799 1.00 82.13  ? 199 SER B N   1 
ATOM   5014 C  CA  . SER B 1 199 ? -27.594 -28.000 -71.625 1.00 75.48  ? 199 SER B CA  1 
ATOM   5015 C  C   . SER B 1 199 ? -28.116 -26.777 -70.889 1.00 69.23  ? 199 SER B C   1 
ATOM   5016 O  O   . SER B 1 199 ? -27.381 -26.122 -70.151 1.00 66.08  ? 199 SER B O   1 
ATOM   5017 C  CB  . SER B 1 199 ? -28.036 -29.281 -70.913 1.00 77.78  ? 199 SER B CB  1 
ATOM   5018 O  OG  . SER B 1 199 ? -27.301 -29.475 -69.729 1.00 81.45  ? 199 SER B OG  1 
ATOM   5019 N  N   . PRO B 1 200 ? -29.385 -26.438 -71.141 1.00 77.44  ? 200 PRO B N   1 
ATOM   5020 C  CA  . PRO B 1 200 ? -30.115 -25.375 -70.451 1.00 78.00  ? 200 PRO B CA  1 
ATOM   5021 C  C   . PRO B 1 200 ? -30.174 -25.588 -68.945 1.00 81.56  ? 200 PRO B C   1 
ATOM   5022 O  O   . PRO B 1 200 ? -30.349 -24.623 -68.194 1.00 82.58  ? 200 PRO B O   1 
ATOM   5023 C  CB  . PRO B 1 200 ? -31.530 -25.486 -71.033 1.00 75.36  ? 200 PRO B CB  1 
ATOM   5024 C  CG  . PRO B 1 200 ? -31.534 -26.727 -71.878 1.00 71.55  ? 200 PRO B CG  1 
ATOM   5025 C  CD  . PRO B 1 200 ? -30.140 -26.948 -72.296 1.00 74.40  ? 200 PRO B CD  1 
ATOM   5026 N  N   . GLU B 1 201 ? -30.062 -26.841 -68.514 1.00 80.56  ? 201 GLU B N   1 
ATOM   5027 C  CA  . GLU B 1 201 ? -30.288 -27.192 -67.117 1.00 83.89  ? 201 GLU B CA  1 
ATOM   5028 C  C   . GLU B 1 201 ? -29.065 -27.034 -66.208 1.00 84.27  ? 201 GLU B C   1 
ATOM   5029 O  O   . GLU B 1 201 ? -29.188 -27.114 -64.984 1.00 86.52  ? 201 GLU B O   1 
ATOM   5030 C  CB  . GLU B 1 201 ? -30.849 -28.611 -67.014 1.00 84.67  ? 201 GLU B CB  1 
ATOM   5031 C  CG  . GLU B 1 201 ? -32.268 -28.738 -67.542 1.00 87.48  ? 201 GLU B CG  1 
ATOM   5032 C  CD  . GLU B 1 201 ? -32.330 -28.713 -69.058 1.00 90.00  ? 201 GLU B CD  1 
ATOM   5033 O  OE1 . GLU B 1 201 ? -31.328 -29.108 -69.693 1.00 91.30  ? 201 GLU B OE1 1 
ATOM   5034 O  OE2 . GLU B 1 201 ? -33.376 -28.302 -69.609 1.00 90.02  1 201 GLU B OE2 1 
ATOM   5035 N  N   . SER B 1 202 ? -27.893 -26.828 -66.801 1.00 75.50  ? 202 SER B N   1 
ATOM   5036 C  CA  . SER B 1 202 ? -26.666 -26.664 -66.029 1.00 72.46  ? 202 SER B CA  1 
ATOM   5037 C  C   . SER B 1 202 ? -26.649 -25.340 -65.282 1.00 72.73  ? 202 SER B C   1 
ATOM   5038 O  O   . SER B 1 202 ? -27.321 -24.378 -65.679 1.00 74.64  ? 202 SER B O   1 
ATOM   5039 C  CB  . SER B 1 202 ? -25.453 -26.698 -66.941 1.00 67.15  ? 202 SER B CB  1 
ATOM   5040 O  OG  . SER B 1 202 ? -25.349 -25.459 -67.626 1.00 62.38  ? 202 SER B OG  1 
ATOM   5041 N  N   . HIS B 1 203 ? -25.844 -25.282 -64.225 1.00 79.81  ? 203 HIS B N   1 
ATOM   5042 C  CA  . HIS B 1 203 ? -25.770 -24.084 -63.401 1.00 79.38  ? 203 HIS B CA  1 
ATOM   5043 C  C   . HIS B 1 203 ? -25.365 -22.845 -64.186 1.00 79.73  ? 203 HIS B C   1 
ATOM   5044 O  O   . HIS B 1 203 ? -25.944 -21.773 -64.008 1.00 79.25  ? 203 HIS B O   1 
ATOM   5045 C  CB  . HIS B 1 203 ? -24.876 -24.292 -62.171 1.00 78.90  ? 203 HIS B CB  1 
ATOM   5046 C  CG  . HIS B 1 203 ? -23.497 -24.792 -62.480 1.00 77.20  ? 203 HIS B CG  1 
ATOM   5047 N  ND1 . HIS B 1 203 ? -23.242 -25.786 -63.405 1.00 77.11  ? 203 HIS B ND1 1 
ATOM   5048 C  CD2 . HIS B 1 203 ? -22.293 -24.451 -61.967 1.00 75.96  ? 203 HIS B CD2 1 
ATOM   5049 C  CE1 . HIS B 1 203 ? -21.948 -26.028 -63.449 1.00 76.17  ? 203 HIS B CE1 1 
ATOM   5050 N  NE2 . HIS B 1 203 ? -21.347 -25.231 -62.584 1.00 75.85  ? 203 HIS B NE2 1 
ATOM   5051 N  N   . VAL B 1 204 ? -24.381 -22.994 -65.059 1.00 85.62  ? 204 VAL B N   1 
ATOM   5052 C  CA  . VAL B 1 204 ? -23.943 -21.880 -65.886 1.00 84.04  ? 204 VAL B CA  1 
ATOM   5053 C  C   . VAL B 1 204 ? -25.091 -21.362 -66.758 1.00 83.71  ? 204 VAL B C   1 
ATOM   5054 O  O   . VAL B 1 204 ? -25.361 -20.151 -66.806 1.00 87.49  ? 204 VAL B O   1 
ATOM   5055 C  CB  . VAL B 1 204 ? -22.760 -22.283 -66.770 1.00 83.86  ? 204 VAL B CB  1 
ATOM   5056 C  CG1 . VAL B 1 204 ? -22.154 -21.057 -67.409 1.00 80.51  ? 204 VAL B CG1 1 
ATOM   5057 C  CG2 . VAL B 1 204 ? -21.727 -22.997 -65.930 1.00 78.71  ? 204 VAL B CG2 1 
ATOM   5058 N  N   . GLY B 1 205 ? -25.766 -22.279 -67.443 1.00 60.61  ? 205 GLY B N   1 
ATOM   5059 C  CA  . GLY B 1 205 ? -26.866 -21.890 -68.306 1.00 55.62  ? 205 GLY B CA  1 
ATOM   5060 C  C   . GLY B 1 205 ? -27.954 -21.146 -67.546 1.00 53.91  ? 205 GLY B C   1 
ATOM   5061 O  O   . GLY B 1 205 ? -28.316 -20.012 -67.903 1.00 51.84  ? 205 GLY B O   1 
ATOM   5062 N  N   . VAL B 1 206 ? -28.439 -21.771 -66.474 1.00 71.46  ? 206 VAL B N   1 
ATOM   5063 C  CA  . VAL B 1 206 ? -29.497 -21.202 -65.649 1.00 73.35  ? 206 VAL B CA  1 
ATOM   5064 C  C   . VAL B 1 206 ? -29.092 -19.825 -65.176 1.00 76.77  ? 206 VAL B C   1 
ATOM   5065 O  O   . VAL B 1 206 ? -29.895 -18.884 -65.174 1.00 75.91  ? 206 VAL B O   1 
ATOM   5066 C  CB  . VAL B 1 206 ? -29.771 -22.072 -64.430 1.00 72.34  ? 206 VAL B CB  1 
ATOM   5067 C  CG1 . VAL B 1 206 ? -30.844 -21.439 -63.573 1.00 70.78  ? 206 VAL B CG1 1 
ATOM   5068 C  CG2 . VAL B 1 206 ? -30.200 -23.452 -64.873 1.00 70.19  ? 206 VAL B CG2 1 
ATOM   5069 N  N   . ALA B 1 207 ? -27.828 -19.714 -64.792 1.00 71.55  ? 207 ALA B N   1 
ATOM   5070 C  CA  . ALA B 1 207 ? -27.277 -18.446 -64.356 1.00 76.45  ? 207 ALA B CA  1 
ATOM   5071 C  C   . ALA B 1 207 ? -27.453 -17.408 -65.455 1.00 79.03  ? 207 ALA B C   1 
ATOM   5072 O  O   . ALA B 1 207 ? -27.973 -16.308 -65.211 1.00 77.90  ? 207 ALA B O   1 
ATOM   5073 C  CB  . ALA B 1 207 ? -25.810 -18.602 -64.013 1.00 79.56  ? 207 ALA B CB  1 
ATOM   5074 N  N   . TRP B 1 208 ? -27.033 -17.757 -66.669 1.00 82.41  ? 208 TRP B N   1 
ATOM   5075 C  CA  . TRP B 1 208 ? -27.096 -16.796 -67.760 1.00 86.10  ? 208 TRP B CA  1 
ATOM   5076 C  C   . TRP B 1 208 ? -28.528 -16.391 -68.083 1.00 85.90  ? 208 TRP B C   1 
ATOM   5077 O  O   . TRP B 1 208 ? -28.805 -15.215 -68.323 1.00 85.58  ? 208 TRP B O   1 
ATOM   5078 C  CB  . TRP B 1 208 ? -26.373 -17.309 -69.002 1.00 88.68  ? 208 TRP B CB  1 
ATOM   5079 C  CG  . TRP B 1 208 ? -24.897 -17.071 -68.941 1.00 95.47  ? 208 TRP B CG  1 
ATOM   5080 C  CD1 . TRP B 1 208 ? -23.922 -17.991 -68.666 1.00 98.89  ? 208 TRP B CD1 1 
ATOM   5081 C  CD2 . TRP B 1 208 ? -24.225 -15.819 -69.131 1.00 101.00 ? 208 TRP B CD2 1 
ATOM   5082 N  NE1 . TRP B 1 208 ? -22.683 -17.391 -68.693 1.00 101.00 ? 208 TRP B NE1 1 
ATOM   5083 C  CE2 . TRP B 1 208 ? -22.842 -16.059 -68.973 1.00 101.89 ? 208 TRP B CE2 1 
ATOM   5084 C  CE3 . TRP B 1 208 ? -24.658 -14.520 -69.426 1.00 102.68 ? 208 TRP B CE3 1 
ATOM   5085 C  CZ2 . TRP B 1 208 ? -21.890 -15.048 -69.102 1.00 102.49 ? 208 TRP B CZ2 1 
ATOM   5086 C  CZ3 . TRP B 1 208 ? -23.716 -13.521 -69.552 1.00 103.37 ? 208 TRP B CZ3 1 
ATOM   5087 C  CH2 . TRP B 1 208 ? -22.345 -13.790 -69.391 1.00 103.15 ? 208 TRP B CH2 1 
ATOM   5088 N  N   . ARG B 1 209 ? -29.444 -17.353 -68.063 1.00 71.40  ? 209 ARG B N   1 
ATOM   5089 C  CA  A ARG B 1 209 ? -30.844 -17.062 -68.336 0.51 72.74  ? 209 ARG B CA  1 
ATOM   5090 C  CA  B ARG B 1 209 ? -30.847 -17.064 -68.321 0.49 72.74  ? 209 ARG B CA  1 
ATOM   5091 C  C   . ARG B 1 209 ? -31.381 -16.089 -67.297 1.00 69.27  ? 209 ARG B C   1 
ATOM   5092 O  O   . ARG B 1 209 ? -32.072 -15.118 -67.640 1.00 67.77  ? 209 ARG B O   1 
ATOM   5093 C  CB  A ARG B 1 209 ? -31.685 -18.338 -68.344 0.51 76.41  ? 209 ARG B CB  1 
ATOM   5094 C  CB  B ARG B 1 209 ? -31.671 -18.339 -68.276 0.49 76.41  ? 209 ARG B CB  1 
ATOM   5095 C  CG  A ARG B 1 209 ? -31.307 -19.327 -69.432 0.51 89.90  ? 209 ARG B CG  1 
ATOM   5096 C  CG  B ARG B 1 209 ? -31.257 -19.303 -69.334 0.49 89.90  ? 209 ARG B CG  1 
ATOM   5097 C  CD  A ARG B 1 209 ? -32.376 -20.402 -69.578 0.51 105.03 ? 209 ARG B CD  1 
ATOM   5098 C  CD  B ARG B 1 209 ? -32.185 -20.480 -69.425 0.49 105.03 ? 209 ARG B CD  1 
ATOM   5099 N  NE  A ARG B 1 209 ? -33.343 -20.076 -70.623 0.51 110.11 ? 209 ARG B NE  1 
ATOM   5100 N  NE  B ARG B 1 209 ? -31.904 -21.176 -70.668 0.49 110.11 ? 209 ARG B NE  1 
ATOM   5101 C  CZ  A ARG B 1 209 ? -34.632 -20.399 -70.580 0.51 112.26 ? 209 ARG B CZ  1 
ATOM   5102 C  CZ  B ARG B 1 209 ? -30.936 -22.071 -70.811 0.49 112.26 ? 209 ARG B CZ  1 
ATOM   5103 N  NH1 A ARG B 1 209 ? -35.122 -21.050 -69.534 0.51 112.93 1 209 ARG B NH1 1 
ATOM   5104 N  NH1 B ARG B 1 209 ? -30.176 -22.402 -69.774 0.49 112.93 1 209 ARG B NH1 1 
ATOM   5105 N  NH2 A ARG B 1 209 ? -35.432 -20.063 -71.582 0.51 112.88 ? 209 ARG B NH2 1 
ATOM   5106 N  NH2 B ARG B 1 209 ? -30.737 -22.639 -71.991 0.49 112.88 ? 209 ARG B NH2 1 
ATOM   5107 N  N   . LEU B 1 210 ? -31.060 -16.349 -66.035 1.00 81.17  ? 210 LEU B N   1 
ATOM   5108 C  CA  . LEU B 1 210 ? -31.467 -15.449 -64.976 1.00 81.30  ? 210 LEU B CA  1 
ATOM   5109 C  C   . LEU B 1 210 ? -30.942 -14.064 -65.308 1.00 82.58  ? 210 LEU B C   1 
ATOM   5110 O  O   . LEU B 1 210 ? -31.669 -13.076 -65.186 1.00 80.55  ? 210 LEU B O   1 
ATOM   5111 C  CB  . LEU B 1 210 ? -30.926 -15.905 -63.629 1.00 80.55  ? 210 LEU B CB  1 
ATOM   5112 C  CG  . LEU B 1 210 ? -31.487 -17.240 -63.158 1.00 82.38  ? 210 LEU B CG  1 
ATOM   5113 C  CD1 . LEU B 1 210 ? -30.861 -17.623 -61.839 1.00 83.91  ? 210 LEU B CD1 1 
ATOM   5114 C  CD2 . LEU B 1 210 ? -32.997 -17.167 -63.046 1.00 85.55  ? 210 LEU B CD2 1 
ATOM   5115 N  N   . LYS B 1 211 ? -29.685 -13.997 -65.741 1.00 89.30  ? 211 LYS B N   1 
ATOM   5116 C  CA  . LYS B 1 211 ? -29.096 -12.718 -66.110 1.00 94.56  ? 211 LYS B CA  1 
ATOM   5117 C  C   . LYS B 1 211 ? -29.937 -12.046 -67.188 1.00 98.63  ? 211 LYS B C   1 
ATOM   5118 O  O   . LYS B 1 211 ? -30.100 -10.824 -67.189 1.00 99.28  ? 211 LYS B O   1 
ATOM   5119 C  CB  . LYS B 1 211 ? -27.657 -12.894 -66.596 1.00 94.19  ? 211 LYS B CB  1 
ATOM   5120 C  CG  . LYS B 1 211 ? -26.892 -11.592 -66.789 1.00 93.09  ? 211 LYS B CG  1 
ATOM   5121 C  CD  . LYS B 1 211 ? -26.978 -11.106 -68.238 1.00 92.18  ? 211 LYS B CD  1 
ATOM   5122 C  CE  . LYS B 1 211 ? -26.211 -9.808  -68.442 1.00 91.67  ? 211 LYS B CE  1 
ATOM   5123 N  NZ  . LYS B 1 211 ? -24.739 -10.017 -68.354 1.00 90.23  1 211 LYS B NZ  1 
ATOM   5124 N  N   . ASN B 1 212 ? -30.474 -12.846 -68.103 1.00 120.73 ? 212 ASN B N   1 
ATOM   5125 C  CA  . ASN B 1 212 ? -31.336 -12.302 -69.143 1.00 123.51 ? 212 ASN B CA  1 
ATOM   5126 C  C   . ASN B 1 212 ? -32.640 -11.754 -68.590 1.00 124.27 ? 212 ASN B C   1 
ATOM   5127 O  O   . ASN B 1 212 ? -33.143 -10.740 -69.069 1.00 124.59 ? 212 ASN B O   1 
ATOM   5128 C  CB  . ASN B 1 212 ? -31.631 -13.343 -70.223 1.00 124.43 ? 212 ASN B CB  1 
ATOM   5129 C  CG  . ASN B 1 212 ? -30.425 -13.641 -71.086 1.00 126.43 ? 212 ASN B CG  1 
ATOM   5130 O  OD1 . ASN B 1 212 ? -29.473 -12.857 -71.139 1.00 129.42 ? 212 ASN B OD1 1 
ATOM   5131 N  ND2 . ASN B 1 212 ? -30.464 -14.769 -71.783 1.00 129.46 ? 212 ASN B ND2 1 
ATOM   5132 N  N   . GLU B 1 213 ? -33.184 -12.412 -67.574 1.00 124.39 ? 213 GLU B N   1 
ATOM   5133 C  CA  . GLU B 1 213 ? -34.470 -11.975 -67.040 1.00 124.20 ? 213 GLU B CA  1 
ATOM   5134 C  C   . GLU B 1 213 ? -34.404 -10.878 -65.978 1.00 121.43 ? 213 GLU B C   1 
ATOM   5135 O  O   . GLU B 1 213 ? -35.427 -10.280 -65.646 1.00 119.96 ? 213 GLU B O   1 
ATOM   5136 C  CB  . GLU B 1 213 ? -35.278 -13.168 -66.528 1.00 126.31 ? 213 GLU B CB  1 
ATOM   5137 C  CG  . GLU B 1 213 ? -35.509 -14.245 -67.570 1.00 135.16 ? 213 GLU B CG  1 
ATOM   5138 C  CD  . GLU B 1 213 ? -36.216 -13.722 -68.808 1.00 144.03 ? 213 GLU B CD  1 
ATOM   5139 O  OE1 . GLU B 1 213 ? -37.060 -12.805 -68.679 1.00 146.65 ? 213 GLU B OE1 1 
ATOM   5140 O  OE2 . GLU B 1 213 ? -35.929 -14.235 -69.912 1.00 146.64 1 213 GLU B OE2 1 
ATOM   5141 N  N   . ILE B 1 214 ? -33.214 -10.608 -65.449 1.00 97.09  ? 214 ILE B N   1 
ATOM   5142 C  CA  . ILE B 1 214 ? -33.058 -9.559  -64.444 1.00 96.94  ? 214 ILE B CA  1 
ATOM   5143 C  C   . ILE B 1 214 ? -32.358 -8.312  -64.961 1.00 99.73  ? 214 ILE B C   1 
ATOM   5144 O  O   . ILE B 1 214 ? -31.261 -8.393  -65.514 1.00 97.63  ? 214 ILE B O   1 
ATOM   5145 C  CB  . ILE B 1 214 ? -32.333 -10.050 -63.183 1.00 95.60  ? 214 ILE B CB  1 
ATOM   5146 C  CG1 . ILE B 1 214 ? -33.212 -11.038 -62.422 1.00 94.39  ? 214 ILE B CG1 1 
ATOM   5147 C  CG2 . ILE B 1 214 ? -31.994 -8.877  -62.271 1.00 94.10  ? 214 ILE B CG2 1 
ATOM   5148 C  CD1 . ILE B 1 214 ? -32.542 -12.359 -62.167 1.00 92.70  ? 214 ILE B CD1 1 
ATOM   5149 N  N   . PRO B 1 215 ? -33.006 -7.153  -64.795 1.00 100.27 ? 215 PRO B N   1 
ATOM   5150 C  CA  . PRO B 1 215 ? -32.438 -5.846  -65.136 1.00 104.13 ? 215 PRO B CA  1 
ATOM   5151 C  C   . PRO B 1 215 ? -31.224 -5.525  -64.274 1.00 107.21 ? 215 PRO B C   1 
ATOM   5152 O  O   . PRO B 1 215 ? -31.246 -5.802  -63.070 1.00 107.12 ? 215 PRO B O   1 
ATOM   5153 C  CB  . PRO B 1 215 ? -33.568 -4.874  -64.792 1.00 104.45 ? 215 PRO B CB  1 
ATOM   5154 C  CG  . PRO B 1 215 ? -34.804 -5.706  -64.789 1.00 103.75 ? 215 PRO B CG  1 
ATOM   5155 C  CD  . PRO B 1 215 ? -34.384 -7.041  -64.291 1.00 101.55 ? 215 PRO B CD  1 
ATOM   5156 N  N   . ASN B 1 216 ? -30.194 -4.941  -64.884 1.00 130.96 ? 216 ASN B N   1 
ATOM   5157 C  CA  . ASN B 1 216 ? -28.993 -4.507  -64.167 1.00 133.32 ? 216 ASN B CA  1 
ATOM   5158 C  C   . ASN B 1 216 ? -28.324 -5.596  -63.340 1.00 129.40 ? 216 ASN B C   1 
ATOM   5159 O  O   . ASN B 1 216 ? -27.924 -5.366  -62.199 1.00 132.80 ? 216 ASN B O   1 
ATOM   5160 C  CB  . ASN B 1 216 ? -29.298 -3.298  -63.279 1.00 137.60 ? 216 ASN B CB  1 
ATOM   5161 C  CG  . ASN B 1 216 ? -29.582 -2.047  -64.080 1.00 143.95 ? 216 ASN B CG  1 
ATOM   5162 O  OD1 . ASN B 1 216 ? -29.337 -2.000  -65.289 1.00 148.48 ? 216 ASN B OD1 1 
ATOM   5163 N  ND2 . ASN B 1 216 ? -30.094 -1.020  -63.411 1.00 148.42 ? 216 ASN B ND2 1 
ATOM   5164 N  N   . SER B 1 217 ? -28.199 -6.783  -63.918 1.00 114.59 ? 217 SER B N   1 
ATOM   5165 C  CA  . SER B 1 217 ? -27.578 -7.896  -63.223 1.00 104.44 ? 217 SER B CA  1 
ATOM   5166 C  C   . SER B 1 217 ? -26.307 -8.288  -63.940 1.00 98.71  ? 217 SER B C   1 
ATOM   5167 O  O   . SER B 1 217 ? -26.224 -8.195  -65.171 1.00 97.51  ? 217 SER B O   1 
ATOM   5168 C  CB  . SER B 1 217 ? -28.511 -9.100  -63.199 1.00 103.54 ? 217 SER B CB  1 
ATOM   5169 O  OG  . SER B 1 217 ? -28.878 -9.459  -64.522 1.00 101.34 ? 217 SER B OG  1 
ATOM   5170 N  N   . HIS B 1 218 ? -25.316 -8.740  -63.177 1.00 94.25  ? 218 HIS B N   1 
ATOM   5171 C  CA  . HIS B 1 218 ? -24.055 -9.154  -63.771 1.00 89.55  ? 218 HIS B CA  1 
ATOM   5172 C  C   . HIS B 1 218 ? -23.700 -10.574 -63.392 1.00 85.11  ? 218 HIS B C   1 
ATOM   5173 O  O   . HIS B 1 218 ? -24.150 -11.090 -62.369 1.00 84.15  ? 218 HIS B O   1 
ATOM   5174 C  CB  . HIS B 1 218 ? -22.930 -8.237  -63.317 1.00 90.28  ? 218 HIS B CB  1 
ATOM   5175 C  CG  . HIS B 1 218 ? -23.190 -6.790  -63.592 1.00 97.22  ? 218 HIS B CG  1 
ATOM   5176 N  ND1 . HIS B 1 218 ? -23.979 -6.012  -62.772 1.00 104.17 ? 218 HIS B ND1 1 
ATOM   5177 C  CD2 . HIS B 1 218 ? -22.771 -5.989  -64.590 1.00 104.09 ? 218 HIS B CD2 1 
ATOM   5178 C  CE1 . HIS B 1 218 ? -24.030 -4.786  -63.261 1.00 106.70 ? 218 HIS B CE1 1 
ATOM   5179 N  NE2 . HIS B 1 218 ? -23.308 -4.740  -64.361 1.00 106.70 ? 218 HIS B NE2 1 
ATOM   5180 N  N   . ILE B 1 219 ? -22.887 -11.204 -64.227 1.00 85.56  ? 219 ILE B N   1 
ATOM   5181 C  CA  . ILE B 1 219 ? -22.299 -12.482 -63.882 1.00 82.21  ? 219 ILE B CA  1 
ATOM   5182 C  C   . ILE B 1 219 ? -20.789 -12.354 -63.909 1.00 84.01  ? 219 ILE B C   1 
ATOM   5183 O  O   . ILE B 1 219 ? -20.189 -12.150 -64.970 1.00 83.67  ? 219 ILE B O   1 
ATOM   5184 C  CB  . ILE B 1 219 ? -22.689 -13.559 -64.868 1.00 80.01  ? 219 ILE B CB  1 
ATOM   5185 C  CG1 . ILE B 1 219 ? -24.184 -13.818 -64.781 1.00 75.97  ? 219 ILE B CG1 1 
ATOM   5186 C  CG2 . ILE B 1 219 ? -21.930 -14.838 -64.565 1.00 75.03  ? 219 ILE B CG2 1 
ATOM   5187 C  CD1 . ILE B 1 219 ? -24.620 -14.972 -65.639 1.00 74.36  ? 219 ILE B CD1 1 
ATOM   5188 N  N   . LEU B 1 220 ? -20.174 -12.480 -62.742 1.00 75.76  ? 220 LEU B N   1 
ATOM   5189 C  CA  . LEU B 1 220 ? -18.737 -12.307 -62.628 1.00 76.88  ? 220 LEU B CA  1 
ATOM   5190 C  C   . LEU B 1 220 ? -17.989 -13.439 -63.332 1.00 77.21  ? 220 LEU B C   1 
ATOM   5191 O  O   . LEU B 1 220 ? -16.871 -13.243 -63.824 1.00 80.06  ? 220 LEU B O   1 
ATOM   5192 C  CB  . LEU B 1 220 ? -18.336 -12.186 -61.164 1.00 76.75  ? 220 LEU B CB  1 
ATOM   5193 C  CG  . LEU B 1 220 ? -18.880 -10.964 -60.430 1.00 73.95  ? 220 LEU B CG  1 
ATOM   5194 C  CD1 . LEU B 1 220 ? -18.173 -10.792 -59.100 1.00 70.97  ? 220 LEU B CD1 1 
ATOM   5195 C  CD2 . LEU B 1 220 ? -18.700 -9.723  -61.283 1.00 69.12  ? 220 LEU B CD2 1 
ATOM   5196 N  N   . ASP B 1 221 ? -18.624 -14.608 -63.385 1.00 80.46  ? 221 ASP B N   1 
ATOM   5197 C  CA  . ASP B 1 221 ? -18.121 -15.737 -64.166 1.00 79.07  ? 221 ASP B CA  1 
ATOM   5198 C  C   . ASP B 1 221 ? -16.725 -16.241 -63.796 1.00 78.51  ? 221 ASP B C   1 
ATOM   5199 O  O   . ASP B 1 221 ? -15.752 -16.026 -64.531 1.00 75.47  ? 221 ASP B O   1 
ATOM   5200 C  CB  . ASP B 1 221 ? -18.197 -15.450 -65.660 1.00 78.71  ? 221 ASP B CB  1 
ATOM   5201 C  CG  . ASP B 1 221 ? -18.307 -16.716 -66.474 1.00 84.29  ? 221 ASP B CG  1 
ATOM   5202 O  OD1 . ASP B 1 221 ? -18.723 -16.636 -67.651 1.00 92.29  ? 221 ASP B OD1 1 
ATOM   5203 O  OD2 . ASP B 1 221 ? -18.003 -17.800 -65.917 1.00 92.25  1 221 ASP B OD2 1 
ATOM   5204 N  N   . GLN B 1 222 ? -16.639 -16.919 -62.656 1.00 93.46  ? 222 GLN B N   1 
ATOM   5205 C  CA  . GLN B 1 222 ? -15.375 -17.422 -62.132 1.00 96.53  ? 222 GLN B CA  1 
ATOM   5206 C  C   . GLN B 1 222 ? -14.624 -18.290 -63.139 1.00 96.17  ? 222 GLN B C   1 
ATOM   5207 O  O   . GLN B 1 222 ? -13.422 -18.521 -62.988 1.00 98.04  ? 222 GLN B O   1 
ATOM   5208 C  CB  . GLN B 1 222 ? -15.629 -18.236 -60.866 1.00 98.26  ? 222 GLN B CB  1 
ATOM   5209 C  CG  . GLN B 1 222 ? -16.716 -19.288 -61.036 1.00 101.71 ? 222 GLN B CG  1 
ATOM   5210 C  CD  . GLN B 1 222 ? -16.859 -20.177 -59.818 1.00 106.53 ? 222 GLN B CD  1 
ATOM   5211 O  OE1 . GLN B 1 222 ? -16.033 -20.134 -58.902 1.00 109.12 ? 222 GLN B OE1 1 
ATOM   5212 N  NE2 . GLN B 1 222 ? -17.897 -21.005 -59.810 1.00 107.92 ? 222 GLN B NE2 1 
ATOM   5213 N  N   . TYR B 1 223 ? -15.330 -18.790 -64.148 1.00 84.77  ? 223 TYR B N   1 
ATOM   5214 C  CA  . TYR B 1 223 ? -14.702 -19.620 -65.168 1.00 82.08  ? 223 TYR B CA  1 
ATOM   5215 C  C   . TYR B 1 223 ? -13.919 -18.822 -66.205 1.00 80.90  ? 223 TYR B C   1 
ATOM   5216 O  O   . TYR B 1 223 ? -12.845 -19.241 -66.637 1.00 79.69  ? 223 TYR B O   1 
ATOM   5217 C  CB  . TYR B 1 223 ? -15.754 -20.482 -65.854 1.00 81.73  ? 223 TYR B CB  1 
ATOM   5218 C  CG  . TYR B 1 223 ? -16.511 -21.338 -64.883 1.00 81.66  ? 223 TYR B CG  1 
ATOM   5219 C  CD1 . TYR B 1 223 ? -15.997 -22.561 -64.468 1.00 81.15  ? 223 TYR B CD1 1 
ATOM   5220 C  CD2 . TYR B 1 223 ? -17.720 -20.911 -64.344 1.00 82.52  ? 223 TYR B CD2 1 
ATOM   5221 C  CE1 . TYR B 1 223 ? -16.674 -23.351 -63.568 1.00 80.11  ? 223 TYR B CE1 1 
ATOM   5222 C  CE2 . TYR B 1 223 ? -18.408 -21.693 -63.440 1.00 81.09  ? 223 TYR B CE2 1 
ATOM   5223 C  CZ  . TYR B 1 223 ? -17.878 -22.913 -63.056 1.00 80.11  ? 223 TYR B CZ  1 
ATOM   5224 O  OH  . TYR B 1 223 ? -18.556 -23.698 -62.159 1.00 79.92  ? 223 TYR B OH  1 
ATOM   5225 N  N   . ARG B 1 224 ? -14.477 -17.707 -66.653 1.00 82.72  ? 224 ARG B N   1 
ATOM   5226 C  CA  . ARG B 1 224 ? -13.759 -16.860 -67.594 1.00 83.31  ? 224 ARG B CA  1 
ATOM   5227 C  C   . ARG B 1 224 ? -13.050 -15.645 -67.013 1.00 82.06  ? 224 ARG B C   1 
ATOM   5228 O  O   . ARG B 1 224 ? -12.358 -14.935 -67.740 1.00 81.56  ? 224 ARG B O   1 
ATOM   5229 C  CB  . ARG B 1 224 ? -14.697 -16.394 -68.698 1.00 84.44  ? 224 ARG B CB  1 
ATOM   5230 C  CG  . ARG B 1 224 ? -15.316 -17.513 -69.498 1.00 90.81  ? 224 ARG B CG  1 
ATOM   5231 C  CD  . ARG B 1 224 ? -16.351 -16.957 -70.452 1.00 101.25 ? 224 ARG B CD  1 
ATOM   5232 N  NE  . ARG B 1 224 ? -17.323 -16.119 -69.750 1.00 106.18 ? 224 ARG B NE  1 
ATOM   5233 C  CZ  . ARG B 1 224 ? -17.376 -14.793 -69.839 1.00 108.60 ? 224 ARG B CZ  1 
ATOM   5234 N  NH1 . ARG B 1 224 ? -16.511 -14.144 -70.612 1.00 109.52 1 224 ARG B NH1 1 
ATOM   5235 N  NH2 . ARG B 1 224 ? -18.297 -14.115 -69.159 1.00 109.47 ? 224 ARG B NH2 1 
ATOM   5236 N  N   . ASN B 1 225 ? -13.208 -15.390 -65.723 1.00 78.59  ? 225 ASN B N   1 
ATOM   5237 C  CA  . ASN B 1 225 ? -12.763 -14.104 -65.202 1.00 79.31  ? 225 ASN B CA  1 
ATOM   5238 C  C   . ASN B 1 225 ? -11.301 -14.118 -64.789 1.00 81.67  ? 225 ASN B C   1 
ATOM   5239 O  O   . ASN B 1 225 ? -10.864 -14.976 -64.009 1.00 80.87  ? 225 ASN B O   1 
ATOM   5240 C  CB  . ASN B 1 225 ? -13.647 -13.631 -64.048 1.00 77.75  ? 225 ASN B CB  1 
ATOM   5241 C  CG  . ASN B 1 225 ? -13.444 -12.157 -63.716 1.00 75.84  ? 225 ASN B CG  1 
ATOM   5242 O  OD1 . ASN B 1 225 ? -12.353 -11.599 -63.900 1.00 74.72  ? 225 ASN B OD1 1 
ATOM   5243 N  ND2 . ASN B 1 225 ? -14.496 -11.522 -63.216 1.00 72.88  ? 225 ASN B ND2 1 
ATOM   5244 N  N   . ALA B 1 226 ? -10.557 -13.142 -65.299 1.00 104.19 ? 226 ALA B N   1 
ATOM   5245 C  CA  . ALA B 1 226 ? -9.127  -13.062 -65.049 1.00 107.45 ? 226 ALA B CA  1 
ATOM   5246 C  C   . ALA B 1 226 ? -8.854  -12.910 -63.573 1.00 107.64 ? 226 ALA B C   1 
ATOM   5247 O  O   . ALA B 1 226 ? -7.826  -13.363 -63.063 1.00 108.44 ? 226 ALA B O   1 
ATOM   5248 C  CB  . ALA B 1 226 ? -8.531  -11.905 -65.806 1.00 110.83 ? 226 ALA B CB  1 
ATOM   5249 N  N   . SER B 1 227 ? -9.791  -12.267 -62.893 1.00 89.71  ? 227 SER B N   1 
ATOM   5250 C  CA  . SER B 1 227 ? -9.610  -11.917 -61.500 1.00 86.69  ? 227 SER B CA  1 
ATOM   5251 C  C   . SER B 1 227 ? -9.412  -13.137 -60.605 1.00 85.39  ? 227 SER B C   1 
ATOM   5252 O  O   . SER B 1 227 ? -8.767  -13.036 -59.569 1.00 85.85  ? 227 SER B O   1 
ATOM   5253 C  CB  . SER B 1 227 ? -10.777 -11.063 -61.017 1.00 86.64  ? 227 SER B CB  1 
ATOM   5254 O  OG  . SER B 1 227 ? -10.980 -9.979  -61.908 1.00 81.85  ? 227 SER B OG  1 
ATOM   5255 N  N   . ASN B 1 228 ? -9.987  -14.274 -60.976 1.00 72.82  ? 228 ASN B N   1 
ATOM   5256 C  CA  . ASN B 1 228 ? -9.785  -15.486 -60.190 1.00 70.13  ? 228 ASN B CA  1 
ATOM   5257 C  C   . ASN B 1 228 ? -8.319  -15.997 -60.165 1.00 68.03  ? 228 ASN B C   1 
ATOM   5258 O  O   . ASN B 1 228 ? -7.645  -16.002 -59.092 1.00 68.89  ? 228 ASN B O   1 
ATOM   5259 C  CB  . ASN B 1 228 ? -10.826 -16.541 -60.639 1.00 70.01  ? 228 ASN B CB  1 
ATOM   5260 C  CG  . ASN B 1 228 ? -10.403 -17.977 -60.374 1.00 69.74  ? 228 ASN B CG  1 
ATOM   5261 O  OD1 . ASN B 1 228 ? -9.626  -18.272 -59.463 1.00 71.97  ? 228 ASN B OD1 1 
ATOM   5262 N  ND2 . ASN B 1 228 ? -10.962 -18.892 -61.157 1.00 66.98  ? 228 ASN B ND2 1 
ATOM   5263 N  N   . PRO B 1 229 ? -7.778  -16.351 -61.344 1.00 73.63  ? 229 PRO B N   1 
ATOM   5264 C  CA  . PRO B 1 229 ? -6.406  -16.849 -61.285 1.00 73.56  ? 229 PRO B CA  1 
ATOM   5265 C  C   . PRO B 1 229 ? -5.460  -15.722 -60.937 1.00 75.30  ? 229 PRO B C   1 
ATOM   5266 O  O   . PRO B 1 229 ? -4.398  -15.980 -60.386 1.00 75.53  ? 229 PRO B O   1 
ATOM   5267 C  CB  . PRO B 1 229 ? -6.150  -17.343 -62.707 1.00 71.51  ? 229 PRO B CB  1 
ATOM   5268 C  CG  . PRO B 1 229 ? -7.054  -16.534 -63.538 1.00 70.06  ? 229 PRO B CG  1 
ATOM   5269 C  CD  . PRO B 1 229 ? -8.292  -16.355 -62.725 1.00 71.70  ? 229 PRO B CD  1 
ATOM   5270 N  N   . LEU B 1 230 ? -5.842  -14.491 -61.250 1.00 78.14  ? 230 LEU B N   1 
ATOM   5271 C  CA  . LEU B 1 230 ? -5.011  -13.360 -60.882 1.00 81.14  ? 230 LEU B CA  1 
ATOM   5272 C  C   . LEU B 1 230 ? -4.927  -13.257 -59.378 1.00 80.44  ? 230 LEU B C   1 
ATOM   5273 O  O   . LEU B 1 230 ? -3.876  -12.953 -58.827 1.00 80.16  ? 230 LEU B O   1 
ATOM   5274 C  CB  . LEU B 1 230 ? -5.568  -12.061 -61.438 1.00 83.54  ? 230 LEU B CB  1 
ATOM   5275 C  CG  . LEU B 1 230 ? -5.136  -11.754 -62.863 1.00 90.34  ? 230 LEU B CG  1 
ATOM   5276 C  CD1 . LEU B 1 230 ? -5.552  -10.342 -63.204 1.00 97.92  ? 230 LEU B CD1 1 
ATOM   5277 C  CD2 . LEU B 1 230 ? -3.641  -11.938 -62.993 1.00 96.93  ? 230 LEU B CD2 1 
ATOM   5278 N  N   . ALA B 1 231 ? -6.051  -13.484 -58.715 1.00 89.31  ? 231 ALA B N   1 
ATOM   5279 C  CA  . ALA B 1 231 ? -6.088  -13.404 -57.265 1.00 89.05  ? 231 ALA B CA  1 
ATOM   5280 C  C   . ALA B 1 231 ? -5.215  -14.502 -56.697 1.00 89.54  ? 231 ALA B C   1 
ATOM   5281 O  O   . ALA B 1 231 ? -4.504  -14.291 -55.710 1.00 88.89  ? 231 ALA B O   1 
ATOM   5282 C  CB  . ALA B 1 231 ? -7.499  -13.536 -56.748 1.00 88.34  ? 231 ALA B CB  1 
ATOM   5283 N  N   . HIS B 1 232 ? -5.233  -15.676 -57.316 1.00 79.29  ? 232 HIS B N   1 
ATOM   5284 C  CA  . HIS B 1 232 ? -4.305  -16.686 -56.809 1.00 81.52  ? 232 HIS B CA  1 
ATOM   5285 C  C   . HIS B 1 232 ? -2.842  -16.366 -57.110 1.00 84.03  ? 232 HIS B C   1 
ATOM   5286 O  O   . HIS B 1 232 ? -1.938  -16.828 -56.410 1.00 84.37  ? 232 HIS B O   1 
ATOM   5287 C  CB  . HIS B 1 232 ? -4.666  -18.076 -57.301 1.00 80.78  ? 232 HIS B CB  1 
ATOM   5288 C  CG  . HIS B 1 232 ? -5.792  -18.705 -56.545 1.00 80.40  ? 232 HIS B CG  1 
ATOM   5289 N  ND1 . HIS B 1 232 ? -7.104  -18.573 -56.920 1.00 80.99  ? 232 HIS B ND1 1 
ATOM   5290 C  CD2 . HIS B 1 232 ? -5.793  -19.466 -55.425 1.00 79.52  ? 232 HIS B CD2 1 
ATOM   5291 C  CE1 . HIS B 1 232 ? -7.872  -19.234 -56.071 1.00 80.91  ? 232 HIS B CE1 1 
ATOM   5292 N  NE2 . HIS B 1 232 ? -7.098  -19.782 -55.158 1.00 80.88  ? 232 HIS B NE2 1 
ATOM   5293 N  N   . TYR B 1 233 ? -2.621  -15.585 -58.161 1.00 78.65  ? 233 TYR B N   1 
ATOM   5294 C  CA  . TYR B 1 233 ? -1.287  -15.231 -58.627 1.00 82.58  ? 233 TYR B CA  1 
ATOM   5295 C  C   . TYR B 1 233 ? -0.630  -14.187 -57.727 1.00 83.20  ? 233 TYR B C   1 
ATOM   5296 O  O   . TYR B 1 233 ? 0.496   -14.370 -57.266 1.00 83.72  ? 233 TYR B O   1 
ATOM   5297 C  CB  . TYR B 1 233 ? -1.400  -14.695 -60.055 1.00 84.32  ? 233 TYR B CB  1 
ATOM   5298 C  CG  . TYR B 1 233 ? -0.115  -14.263 -60.724 1.00 89.58  ? 233 TYR B CG  1 
ATOM   5299 C  CD1 . TYR B 1 233 ? 0.725   -15.190 -61.330 1.00 93.24  ? 233 TYR B CD1 1 
ATOM   5300 C  CD2 . TYR B 1 233 ? 0.238   -12.917 -60.781 1.00 93.25  ? 233 TYR B CD2 1 
ATOM   5301 C  CE1 . TYR B 1 233 ? 1.888   -14.793 -61.959 1.00 94.44  ? 233 TYR B CE1 1 
ATOM   5302 C  CE2 . TYR B 1 233 ? 1.399   -12.510 -61.405 1.00 94.46  ? 233 TYR B CE2 1 
ATOM   5303 C  CZ  . TYR B 1 233 ? 2.220   -13.453 -61.991 1.00 94.80  ? 233 TYR B CZ  1 
ATOM   5304 O  OH  . TYR B 1 233 ? 3.379   -13.055 -62.616 1.00 95.11  ? 233 TYR B OH  1 
ATOM   5305 N  N   . ASP B 1 234 ? -1.354  -13.107 -57.454 1.00 89.07  ? 234 ASP B N   1 
ATOM   5306 C  CA  . ASP B 1 234 ? -0.800  -11.968 -56.734 1.00 89.36  ? 234 ASP B CA  1 
ATOM   5307 C  C   . ASP B 1 234 ? -0.558  -12.250 -55.268 1.00 87.41  ? 234 ASP B C   1 
ATOM   5308 O  O   . ASP B 1 234 ? 0.426   -11.792 -54.686 1.00 87.35  ? 234 ASP B O   1 
ATOM   5309 C  CB  . ASP B 1 234 ? -1.730  -10.762 -56.837 1.00 92.93  ? 234 ASP B CB  1 
ATOM   5310 C  CG  . ASP B 1 234 ? -1.812  -10.210 -58.235 1.00 96.14  ? 234 ASP B CG  1 
ATOM   5311 O  OD1 . ASP B 1 234 ? -0.807  -10.306 -58.973 1.00 98.19  ? 234 ASP B OD1 1 
ATOM   5312 O  OD2 . ASP B 1 234 ? -2.877  -9.664  -58.591 1.00 97.25  1 234 ASP B OD2 1 
ATOM   5313 N  N   . THR B 1 235 ? -1.482  -12.980 -54.663 1.00 88.34  ? 235 THR B N   1 
ATOM   5314 C  CA  . THR B 1 235 ? -1.503  -13.105 -53.218 1.00 87.53  ? 235 THR B CA  1 
ATOM   5315 C  C   . THR B 1 235 ? -1.077  -14.471 -52.749 1.00 84.47  ? 235 THR B C   1 
ATOM   5316 O  O   . THR B 1 235 ? -0.042  -14.618 -52.109 1.00 85.35  ? 235 THR B O   1 
ATOM   5317 C  CB  . THR B 1 235 ? -2.898  -12.851 -52.665 1.00 89.24  ? 235 THR B CB  1 
ATOM   5318 O  OG1 . THR B 1 235 ? -3.736  -13.966 -52.998 1.00 91.12  ? 235 THR B OG1 1 
ATOM   5319 C  CG2 . THR B 1 235 ? -3.477  -11.587 -53.273 1.00 91.33  ? 235 THR B CG2 1 
ATOM   5320 N  N   . THR B 1 236 ? -1.898  -15.462 -53.056 1.00 65.05  ? 236 THR B N   1 
ATOM   5321 C  CA  . THR B 1 236 ? -1.707  -16.804 -52.542 1.00 63.81  ? 236 THR B CA  1 
ATOM   5322 C  C   . THR B 1 236 ? -0.287  -17.283 -52.778 1.00 63.40  ? 236 THR B C   1 
ATOM   5323 O  O   . THR B 1 236 ? 0.407   -17.686 -51.839 1.00 61.82  ? 236 THR B O   1 
ATOM   5324 C  CB  . THR B 1 236 ? -2.684  -17.783 -53.193 1.00 64.23  ? 236 THR B CB  1 
ATOM   5325 O  OG1 . THR B 1 236 ? -4.009  -17.244 -53.132 1.00 66.46  ? 236 THR B OG1 1 
ATOM   5326 C  CG2 . THR B 1 236 ? -2.638  -19.123 -52.486 1.00 64.78  ? 236 THR B CG2 1 
ATOM   5327 N  N   . ALA B 1 237 ? 0.151   -17.199 -54.031 1.00 66.44  ? 237 ALA B N   1 
ATOM   5328 C  CA  . ALA B 1 237 ? 1.497   -17.624 -54.401 1.00 69.92  ? 237 ALA B CA  1 
ATOM   5329 C  C   . ALA B 1 237 ? 2.558   -16.846 -53.634 1.00 73.90  ? 237 ALA B C   1 
ATOM   5330 O  O   . ALA B 1 237 ? 3.463   -17.446 -53.059 1.00 73.55  ? 237 ALA B O   1 
ATOM   5331 C  CB  . ALA B 1 237 ? 1.708   -17.476 -55.875 1.00 65.78  ? 237 ALA B CB  1 
ATOM   5332 N  N   . ASP B 1 238 ? 2.440   -15.519 -53.621 1.00 68.70  ? 238 ASP B N   1 
ATOM   5333 C  CA  . ASP B 1 238 ? 3.361   -14.678 -52.857 1.00 74.16  ? 238 ASP B CA  1 
ATOM   5334 C  C   . ASP B 1 238 ? 3.468   -15.159 -51.429 1.00 70.77  ? 238 ASP B C   1 
ATOM   5335 O  O   . ASP B 1 238 ? 4.568   -15.298 -50.892 1.00 71.02  ? 238 ASP B O   1 
ATOM   5336 C  CB  . ASP B 1 238 ? 2.910   -13.218 -52.851 1.00 82.91  ? 238 ASP B CB  1 
ATOM   5337 C  CG  . ASP B 1 238 ? 3.436   -12.438 -54.037 1.00 95.87  ? 238 ASP B CG  1 
ATOM   5338 O  OD1 . ASP B 1 238 ? 3.705   -13.063 -55.088 1.00 105.59 ? 238 ASP B OD1 1 
ATOM   5339 O  OD2 . ASP B 1 238 ? 3.584   -11.202 -53.918 1.00 105.61 1 238 ASP B OD2 1 
ATOM   5340 N  N   . GLU B 1 239 ? 2.315   -15.430 -50.828 1.00 81.53  ? 239 GLU B N   1 
ATOM   5341 C  CA  . GLU B 1 239 ? 2.259   -15.911 -49.460 1.00 77.91  ? 239 GLU B CA  1 
ATOM   5342 C  C   . GLU B 1 239 ? 3.029   -17.210 -49.328 1.00 78.20  ? 239 GLU B C   1 
ATOM   5343 O  O   . GLU B 1 239 ? 3.793   -17.386 -48.381 1.00 77.55  ? 239 GLU B O   1 
ATOM   5344 C  CB  . GLU B 1 239 ? 0.816   -16.117 -49.018 1.00 74.23  ? 239 GLU B CB  1 
ATOM   5345 C  CG  . GLU B 1 239 ? 0.005   -14.841 -48.990 1.00 72.27  ? 239 GLU B CG  1 
ATOM   5346 C  CD  . GLU B 1 239 ? -1.406  -15.066 -48.467 1.00 70.59  ? 239 GLU B CD  1 
ATOM   5347 O  OE1 . GLU B 1 239 ? -2.275  -14.190 -48.696 1.00 68.42  ? 239 GLU B OE1 1 
ATOM   5348 O  OE2 . GLU B 1 239 ? -1.641  -16.128 -47.838 1.00 70.57  1 239 GLU B OE2 1 
ATOM   5349 N  N   . ILE B 1 240 ? 2.835   -18.115 -50.282 1.00 59.93  ? 240 ILE B N   1 
ATOM   5350 C  CA  . ILE B 1 240 ? 3.508   -19.406 -50.229 1.00 60.99  ? 240 ILE B CA  1 
ATOM   5351 C  C   . ILE B 1 240 ? 5.021   -19.253 -50.312 1.00 61.90  ? 240 ILE B C   1 
ATOM   5352 O  O   . ILE B 1 240 ? 5.770   -19.908 -49.574 1.00 62.37  ? 240 ILE B O   1 
ATOM   5353 C  CB  . ILE B 1 240 ? 3.056   -20.328 -51.355 1.00 60.54  ? 240 ILE B CB  1 
ATOM   5354 C  CG1 . ILE B 1 240 ? 1.539   -20.462 -51.339 1.00 59.65  ? 240 ILE B CG1 1 
ATOM   5355 C  CG2 . ILE B 1 240 ? 3.694   -21.693 -51.198 1.00 59.97  ? 240 ILE B CG2 1 
ATOM   5356 C  CD1 . ILE B 1 240 ? 0.995   -21.312 -52.450 1.00 56.89  ? 240 ILE B CD1 1 
ATOM   5357 N  N   . LEU B 1 241 ? 5.470   -18.387 -51.211 1.00 83.48  ? 241 LEU B N   1 
ATOM   5358 C  CA  . LEU B 1 241 ? 6.892   -18.150 -51.379 1.00 83.09  ? 241 LEU B CA  1 
ATOM   5359 C  C   . LEU B 1 241 ? 7.471   -17.591 -50.095 1.00 85.92  ? 241 LEU B C   1 
ATOM   5360 O  O   . LEU B 1 241 ? 8.464   -18.098 -49.577 1.00 86.86  ? 241 LEU B O   1 
ATOM   5361 C  CB  . LEU B 1 241 ? 7.136   -17.160 -52.510 1.00 79.23  ? 241 LEU B CB  1 
ATOM   5362 C  CG  . LEU B 1 241 ? 6.851   -17.709 -53.903 1.00 72.23  ? 241 LEU B CG  1 
ATOM   5363 C  CD1 . LEU B 1 241 ? 7.072   -16.625 -54.944 1.00 65.47  ? 241 LEU B CD1 1 
ATOM   5364 C  CD2 . LEU B 1 241 ? 7.733   -18.915 -54.181 1.00 61.93  ? 241 LEU B CD2 1 
ATOM   5365 N  N   . GLN B 1 242 ? 6.831   -16.551 -49.578 1.00 89.58  ? 242 GLN B N   1 
ATOM   5366 C  CA  . GLN B 1 242 ? 7.309   -15.892 -48.381 1.00 91.86  ? 242 GLN B CA  1 
ATOM   5367 C  C   . GLN B 1 242 ? 7.362   -16.870 -47.215 1.00 88.72  ? 242 GLN B C   1 
ATOM   5368 O  O   . GLN B 1 242 ? 8.291   -16.831 -46.404 1.00 88.59  ? 242 GLN B O   1 
ATOM   5369 C  CB  . GLN B 1 242 ? 6.406   -14.719 -48.029 1.00 97.57  ? 242 GLN B CB  1 
ATOM   5370 C  CG  . GLN B 1 242 ? 7.033   -13.747 -47.055 1.00 107.11 ? 242 GLN B CG  1 
ATOM   5371 C  CD  . GLN B 1 242 ? 6.296   -12.428 -47.021 1.00 114.08 ? 242 GLN B CD  1 
ATOM   5372 O  OE1 . GLN B 1 242 ? 5.446   -12.155 -47.876 1.00 115.62 ? 242 GLN B OE1 1 
ATOM   5373 N  NE2 . GLN B 1 242 ? 6.610   -11.600 -46.030 1.00 115.60 ? 242 GLN B NE2 1 
ATOM   5374 N  N   . GLN B 1 243 ? 6.371   -17.748 -47.127 1.00 79.78  ? 243 GLN B N   1 
ATOM   5375 C  CA  . GLN B 1 243 ? 6.350   -18.720 -46.045 1.00 78.48  ? 243 GLN B CA  1 
ATOM   5376 C  C   . GLN B 1 243 ? 7.430   -19.778 -46.225 1.00 79.24  ? 243 GLN B C   1 
ATOM   5377 O  O   . GLN B 1 243 ? 7.958   -20.307 -45.244 1.00 76.55  ? 243 GLN B O   1 
ATOM   5378 C  CB  . GLN B 1 243 ? 4.975   -19.371 -45.909 1.00 77.93  ? 243 GLN B CB  1 
ATOM   5379 C  CG  . GLN B 1 243 ? 3.964   -18.485 -45.190 1.00 79.40  ? 243 GLN B CG  1 
ATOM   5380 C  CD  . GLN B 1 243 ? 2.544   -19.041 -45.233 1.00 81.13  ? 243 GLN B CD  1 
ATOM   5381 O  OE1 . GLN B 1 243 ? 2.202   -19.841 -46.106 1.00 81.62  ? 243 GLN B OE1 1 
ATOM   5382 N  NE2 . GLN B 1 243 ? 1.711   -18.612 -44.289 1.00 81.61  ? 243 GLN B NE2 1 
ATOM   5383 N  N   . CYS B 1 244 ? 7.759   -20.091 -47.471 1.00 70.55  ? 244 CYS B N   1 
ATOM   5384 C  CA  . CYS B 1 244 ? 8.806   -21.071 -47.737 1.00 76.51  ? 244 CYS B CA  1 
ATOM   5385 C  C   . CYS B 1 244 ? 10.168  -20.442 -47.988 1.00 76.11  ? 244 CYS B C   1 
ATOM   5386 O  O   . CYS B 1 244 ? 11.120  -21.156 -48.326 1.00 74.43  ? 244 CYS B O   1 
ATOM   5387 C  CB  . CYS B 1 244 ? 8.424   -21.977 -48.902 1.00 83.61  ? 244 CYS B CB  1 
ATOM   5388 S  SG  . CYS B 1 244 ? 7.048   -23.061 -48.512 1.00 92.54  ? 244 CYS B SG  1 
ATOM   5389 N  N   . ASP B 1 245 ? 10.238  -19.115 -47.870 1.00 137.16 ? 245 ASP B N   1 
ATOM   5390 C  CA  . ASP B 1 245 ? 11.455  -18.347 -48.163 1.00 138.61 ? 245 ASP B CA  1 
ATOM   5391 C  C   . ASP B 1 245 ? 11.760  -18.311 -49.655 1.00 137.60 ? 245 ASP B C   1 
ATOM   5392 O  O   . ASP B 1 245 ? 12.698  -17.643 -50.088 1.00 139.09 ? 245 ASP B O   1 
ATOM   5393 C  CB  . ASP B 1 245 ? 12.660  -18.870 -47.377 1.00 140.68 ? 245 ASP B CB  1 
ATOM   5394 C  CG  . ASP B 1 245 ? 12.457  -18.781 -45.884 1.00 145.94 ? 245 ASP B CG  1 
ATOM   5395 O  OD1 . ASP B 1 245 ? 12.001  -17.719 -45.413 1.00 149.91 ? 245 ASP B OD1 1 
ATOM   5396 O  OD2 . ASP B 1 245 ? 12.733  -19.778 -45.184 1.00 149.92 1 245 ASP B OD2 1 
ATOM   5397 N  N   . GLY B 1 246 ? 10.959  -19.028 -50.434 1.00 98.26  ? 246 GLY B N   1 
ATOM   5398 C  CA  . GLY B 1 246 ? 11.175  -19.144 -51.860 1.00 96.87  ? 246 GLY B CA  1 
ATOM   5399 C  C   . GLY B 1 246 ? 11.718  -20.506 -52.234 1.00 97.84  ? 246 GLY B C   1 
ATOM   5400 O  O   . GLY B 1 246 ? 11.948  -20.785 -53.413 1.00 94.83  ? 246 GLY B O   1 
ATOM   5401 N  N   . LYS B 1 247 ? 11.912  -21.366 -51.241 1.00 82.60  ? 247 LYS B N   1 
ATOM   5402 C  CA  . LYS B 1 247 ? 12.454  -22.694 -51.504 1.00 87.29  ? 247 LYS B CA  1 
ATOM   5403 C  C   . LYS B 1 247 ? 11.361  -23.750 -51.435 1.00 86.76  ? 247 LYS B C   1 
ATOM   5404 O  O   . LYS B 1 247 ? 10.789  -24.009 -50.376 1.00 86.66  ? 247 LYS B O   1 
ATOM   5405 C  CB  . LYS B 1 247 ? 13.579  -23.021 -50.523 1.00 91.40  ? 247 LYS B CB  1 
ATOM   5406 C  CG  . LYS B 1 247 ? 14.484  -21.835 -50.221 1.00 99.27  ? 247 LYS B CG  1 
ATOM   5407 C  CD  . LYS B 1 247 ? 15.123  -21.289 -51.495 1.00 106.06 ? 247 LYS B CD  1 
ATOM   5408 C  CE  . LYS B 1 247 ? 15.974  -20.061 -51.209 1.00 107.77 ? 247 LYS B CE  1 
ATOM   5409 N  NZ  . LYS B 1 247 ? 16.497  -19.459 -52.472 1.00 108.53 1 247 LYS B NZ  1 
ATOM   5410 N  N   . LEU B 1 248 ? 11.061  -24.346 -52.580 1.00 95.48  ? 248 LEU B N   1 
ATOM   5411 C  CA  . LEU B 1 248 ? 9.981   -25.308 -52.672 1.00 92.90  ? 248 LEU B CA  1 
ATOM   5412 C  C   . LEU B 1 248 ? 10.258  -26.355 -53.747 1.00 93.23  ? 248 LEU B C   1 
ATOM   5413 O  O   . LEU B 1 248 ? 10.829  -26.045 -54.798 1.00 97.25  ? 248 LEU B O   1 
ATOM   5414 C  CB  . LEU B 1 248 ? 8.680   -24.574 -52.969 1.00 88.01  ? 248 LEU B CB  1 
ATOM   5415 C  CG  . LEU B 1 248 ? 7.441   -25.427 -53.186 1.00 81.37  ? 248 LEU B CG  1 
ATOM   5416 C  CD1 . LEU B 1 248 ? 7.269   -26.359 -52.010 1.00 76.58  ? 248 LEU B CD1 1 
ATOM   5417 C  CD2 . LEU B 1 248 ? 6.236   -24.529 -53.347 1.00 76.56  ? 248 LEU B CD2 1 
ATOM   5418 N  N   . ASP B 1 249 ? 9.842   -27.588 -53.483 1.00 81.70  ? 249 ASP B N   1 
ATOM   5419 C  CA  . ASP B 1 249 ? 10.086  -28.701 -54.394 1.00 78.07  ? 249 ASP B CA  1 
ATOM   5420 C  C   . ASP B 1 249 ? 8.840   -29.120 -55.178 1.00 73.48  ? 249 ASP B C   1 
ATOM   5421 O  O   . ASP B 1 249 ? 8.831   -29.087 -56.411 1.00 71.46  ? 249 ASP B O   1 
ATOM   5422 C  CB  . ASP B 1 249 ? 10.704  -29.883 -53.649 1.00 82.46  ? 249 ASP B CB  1 
ATOM   5423 C  CG  . ASP B 1 249 ? 12.111  -29.579 -53.145 1.00 87.77  ? 249 ASP B CG  1 
ATOM   5424 O  OD1 . ASP B 1 249 ? 13.077  -29.733 -53.931 1.00 91.73  ? 249 ASP B OD1 1 
ATOM   5425 O  OD2 . ASP B 1 249 ? 12.248  -29.180 -51.965 1.00 91.80  1 249 ASP B OD2 1 
ATOM   5426 N  N   . MET B 1 250 ? 7.810   -29.564 -54.469 1.00 71.01  ? 250 MET B N   1 
ATOM   5427 C  CA  . MET B 1 250 ? 6.585   -30.024 -55.114 1.00 67.90  ? 250 MET B CA  1 
ATOM   5428 C  C   . MET B 1 250 ? 5.349   -29.289 -54.600 1.00 65.58  ? 250 MET B C   1 
ATOM   5429 O  O   . MET B 1 250 ? 5.288   -28.922 -53.433 1.00 66.88  ? 250 MET B O   1 
ATOM   5430 C  CB  . MET B 1 250 ? 6.432   -31.521 -54.888 1.00 67.87  ? 250 MET B CB  1 
ATOM   5431 C  CG  . MET B 1 250 ? 5.076   -32.064 -55.222 1.00 66.84  ? 250 MET B CG  1 
ATOM   5432 S  SD  . MET B 1 250 ? 5.149   -33.852 -55.213 1.00 68.18  ? 250 MET B SD  1 
ATOM   5433 C  CE  . MET B 1 250 ? 6.328   -34.112 -56.532 1.00 68.88  ? 250 MET B CE  1 
ATOM   5434 N  N   . LEU B 1 251 ? 4.368   -29.057 -55.463 1.00 68.77  ? 251 LEU B N   1 
ATOM   5435 C  CA  . LEU B 1 251 ? 3.119   -28.450 -55.023 1.00 64.71  ? 251 LEU B CA  1 
ATOM   5436 C  C   . LEU B 1 251 ? 1.922   -29.249 -55.505 1.00 65.35  ? 251 LEU B C   1 
ATOM   5437 O  O   . LEU B 1 251 ? 1.753   -29.460 -56.702 1.00 65.51  ? 251 LEU B O   1 
ATOM   5438 C  CB  . LEU B 1 251 ? 2.985   -27.027 -55.551 1.00 60.06  ? 251 LEU B CB  1 
ATOM   5439 C  CG  . LEU B 1 251 ? 1.610   -26.431 -55.242 1.00 54.41  ? 251 LEU B CG  1 
ATOM   5440 C  CD1 . LEU B 1 251 ? 1.708   -25.551 -54.020 1.00 50.42  ? 251 LEU B CD1 1 
ATOM   5441 C  CD2 . LEU B 1 251 ? 1.057   -25.645 -56.403 1.00 51.01  ? 251 LEU B CD2 1 
ATOM   5442 N  N   . VAL B 1 252 ? 1.060   -29.657 -54.585 1.00 58.93  ? 252 VAL B N   1 
ATOM   5443 C  CA  . VAL B 1 252 ? -0.116  -30.413 -54.964 1.00 58.29  ? 252 VAL B CA  1 
ATOM   5444 C  C   . VAL B 1 252 ? -1.392  -29.606 -54.758 1.00 56.93  ? 252 VAL B C   1 
ATOM   5445 O  O   . VAL B 1 252 ? -1.661  -29.059 -53.659 1.00 58.91  ? 252 VAL B O   1 
ATOM   5446 C  CB  . VAL B 1 252 ? -0.218  -31.750 -54.211 1.00 59.62  ? 252 VAL B CB  1 
ATOM   5447 C  CG1 . VAL B 1 252 ? -1.275  -32.636 -54.852 1.00 58.13  ? 252 VAL B CG1 1 
ATOM   5448 C  CG2 . VAL B 1 252 ? 1.117   -32.451 -54.221 1.00 58.19  ? 252 VAL B CG2 1 
ATOM   5449 N  N   . ALA B 1 253 ? -2.174  -29.533 -55.831 1.00 63.05  ? 253 ALA B N   1 
ATOM   5450 C  CA  . ALA B 1 253 ? -3.443  -28.828 -55.811 1.00 61.78  ? 253 ALA B CA  1 
ATOM   5451 C  C   . ALA B 1 253 ? -4.503  -29.568 -56.608 1.00 64.95  ? 253 ALA B C   1 
ATOM   5452 O  O   . ALA B 1 253 ? -4.260  -30.022 -57.733 1.00 61.73  ? 253 ALA B O   1 
ATOM   5453 C  CB  . ALA B 1 253 ? -3.285  -27.414 -56.335 1.00 56.55  ? 253 ALA B CB  1 
ATOM   5454 N  N   . SER B 1 254 ? -5.675  -29.699 -56.002 1.00 80.76  ? 254 SER B N   1 
ATOM   5455 C  CA  . SER B 1 254 ? -6.847  -30.190 -56.694 1.00 88.73  ? 254 SER B CA  1 
ATOM   5456 C  C   . SER B 1 254 ? -7.422  -29.040 -57.495 1.00 87.46  ? 254 SER B C   1 
ATOM   5457 O  O   . SER B 1 254 ? -7.317  -27.879 -57.092 1.00 89.06  ? 254 SER B O   1 
ATOM   5458 C  CB  . SER B 1 254 ? -7.867  -30.676 -55.681 1.00 94.10  ? 254 SER B CB  1 
ATOM   5459 O  OG  . SER B 1 254 ? -8.110  -29.650 -54.734 1.00 106.48 ? 254 SER B OG  1 
ATOM   5460 N  N   . VAL B 1 255 ? -8.022  -29.349 -58.634 1.00 83.02  ? 255 VAL B N   1 
ATOM   5461 C  CA  . VAL B 1 255 ? -8.508  -28.294 -59.500 1.00 78.70  ? 255 VAL B CA  1 
ATOM   5462 C  C   . VAL B 1 255 ? -10.005 -28.384 -59.740 1.00 74.55  ? 255 VAL B C   1 
ATOM   5463 O  O   . VAL B 1 255 ? -10.455 -29.305 -60.424 1.00 74.61  ? 255 VAL B O   1 
ATOM   5464 C  CB  . VAL B 1 255 ? -7.867  -28.484 -60.875 1.00 79.73  ? 255 VAL B CB  1 
ATOM   5465 C  CG1 . VAL B 1 255 ? -8.317  -27.414 -61.822 1.00 79.37  ? 255 VAL B CG1 1 
ATOM   5466 C  CG2 . VAL B 1 255 ? -6.356  -28.509 -60.752 1.00 81.30  ? 255 VAL B CG2 1 
ATOM   5467 N  N   . GLY B 1 256 ? -10.806 -27.494 -59.159 1.00 59.97  ? 256 GLY B N   1 
ATOM   5468 C  CA  . GLY B 1 256 ? -12.112 -27.238 -59.737 1.00 57.21  ? 256 GLY B CA  1 
ATOM   5469 C  C   . GLY B 1 256 ? -12.233 -26.319 -60.948 1.00 56.56  ? 256 GLY B C   1 
ATOM   5470 O  O   . GLY B 1 256 ? -12.596 -26.751 -62.034 1.00 55.38  ? 256 GLY B O   1 
ATOM   5471 N  N   . THR B 1 257 ? -11.885 -25.045 -60.772 1.00 67.34  ? 257 THR B N   1 
ATOM   5472 C  CA  . THR B 1 257 ? -11.929 -24.096 -61.881 1.00 69.75  ? 257 THR B CA  1 
ATOM   5473 C  C   . THR B 1 257 ? -10.567 -23.807 -62.475 1.00 72.71  ? 257 THR B C   1 
ATOM   5474 O  O   . THR B 1 257 ? -10.467 -23.067 -63.458 1.00 74.28  ? 257 THR B O   1 
ATOM   5475 C  CB  . THR B 1 257 ? -12.562 -22.765 -61.479 1.00 69.60  ? 257 THR B CB  1 
ATOM   5476 O  OG1 . THR B 1 257 ? -11.635 -22.011 -60.692 1.00 66.23  ? 257 THR B OG1 1 
ATOM   5477 C  CG2 . THR B 1 257 ? -13.828 -23.017 -60.705 1.00 66.71  ? 257 THR B CG2 1 
ATOM   5478 N  N   . GLY B 1 258 ? -9.521  -24.360 -61.866 1.00 81.45  ? 258 GLY B N   1 
ATOM   5479 C  CA  . GLY B 1 258 ? -8.169  -24.127 -62.334 1.00 82.57  ? 258 GLY B CA  1 
ATOM   5480 C  C   . GLY B 1 258 ? -7.508  -22.852 -61.856 1.00 82.65  ? 258 GLY B C   1 
ATOM   5481 O  O   . GLY B 1 258 ? -6.280  -22.755 -61.918 1.00 83.67  ? 258 GLY B O   1 
ATOM   5482 N  N   . GLY B 1 259 ? -8.299  -21.892 -61.375 1.00 66.59  ? 259 GLY B N   1 
ATOM   5483 C  CA  . GLY B 1 259 ? -7.777  -20.590 -60.980 1.00 66.34  ? 259 GLY B CA  1 
ATOM   5484 C  C   . GLY B 1 259 ? -6.607  -20.695 -60.012 1.00 66.30  ? 259 GLY B C   1 
ATOM   5485 O  O   . GLY B 1 259 ? -5.565  -20.050 -60.189 1.00 65.97  ? 259 GLY B O   1 
ATOM   5486 N  N   . THR B 1 260 ? -6.793  -21.511 -58.978 1.00 82.23  ? 260 THR B N   1 
ATOM   5487 C  CA  . THR B 1 260 ? -5.779  -21.733 -57.963 1.00 83.11  ? 260 THR B CA  1 
ATOM   5488 C  C   . THR B 1 260 ? -4.494  -22.239 -58.576 1.00 78.70  ? 260 THR B C   1 
ATOM   5489 O  O   . THR B 1 260 ? -3.451  -21.558 -58.544 1.00 78.37  ? 260 THR B O   1 
ATOM   5490 C  CB  . THR B 1 260 ? -6.259  -22.759 -56.924 1.00 85.20  ? 260 THR B CB  1 
ATOM   5491 O  OG1 . THR B 1 260 ? -7.390  -22.232 -56.223 1.00 91.87  ? 260 THR B OG1 1 
ATOM   5492 C  CG2 . THR B 1 260 ? -5.159  -23.055 -55.921 1.00 92.45  ? 260 THR B CG2 1 
ATOM   5493 N  N   . ILE B 1 261 ? -4.582  -23.427 -59.163 1.00 78.22  ? 261 ILE B N   1 
ATOM   5494 C  CA  . ILE B 1 261 ? -3.394  -24.069 -59.681 1.00 74.05  ? 261 ILE B CA  1 
ATOM   5495 C  C   . ILE B 1 261 ? -2.782  -23.238 -60.798 1.00 75.02  ? 261 ILE B C   1 
ATOM   5496 O  O   . ILE B 1 261 ? -1.575  -23.237 -60.971 1.00 75.25  ? 261 ILE B O   1 
ATOM   5497 C  CB  . ILE B 1 261 ? -3.662  -25.511 -60.153 1.00 71.78  ? 261 ILE B CB  1 
ATOM   5498 C  CG1 . ILE B 1 261 ? -2.371  -26.322 -60.128 1.00 67.03  ? 261 ILE B CG1 1 
ATOM   5499 C  CG2 . ILE B 1 261 ? -4.277  -25.528 -61.548 1.00 67.49  ? 261 ILE B CG2 1 
ATOM   5500 C  CD1 . ILE B 1 261 ? -2.569  -27.751 -60.543 1.00 62.20  ? 261 ILE B CD1 1 
ATOM   5501 N  N   . THR B 1 262 ? -3.598  -22.495 -61.531 1.00 77.22  ? 262 THR B N   1 
ATOM   5502 C  CA  . THR B 1 262 ? -3.052  -21.686 -62.599 1.00 77.16  ? 262 THR B CA  1 
ATOM   5503 C  C   . THR B 1 262 ? -2.266  -20.488 -62.074 1.00 78.95  ? 262 THR B C   1 
ATOM   5504 O  O   . THR B 1 262 ? -1.090  -20.336 -62.407 1.00 78.97  ? 262 THR B O   1 
ATOM   5505 C  CB  . THR B 1 262 ? -4.137  -21.217 -63.557 1.00 76.94  ? 262 THR B CB  1 
ATOM   5506 O  OG1 . THR B 1 262 ? -4.601  -22.341 -64.309 1.00 73.68  ? 262 THR B OG1 1 
ATOM   5507 C  CG2 . THR B 1 262 ? -3.574  -20.186 -64.516 1.00 73.55  ? 262 THR B CG2 1 
ATOM   5508 N  N   . GLY B 1 263 ? -2.900  -19.643 -61.266 1.00 68.24  ? 263 GLY B N   1 
ATOM   5509 C  CA  . GLY B 1 263 ? -2.221  -18.472 -60.736 1.00 70.94  ? 263 GLY B CA  1 
ATOM   5510 C  C   . GLY B 1 263 ? -0.958  -18.870 -59.993 1.00 73.35  ? 263 GLY B C   1 
ATOM   5511 O  O   . GLY B 1 263 ? 0.164   -18.364 -60.259 1.00 72.63  ? 263 GLY B O   1 
ATOM   5512 N  N   . ILE B 1 264 ? -1.139  -19.813 -59.074 1.00 73.14  ? 264 ILE B N   1 
ATOM   5513 C  CA  . ILE B 1 264 ? -0.026  -20.303 -58.282 1.00 75.50  ? 264 ILE B CA  1 
ATOM   5514 C  C   . ILE B 1 264 ? 1.091   -20.861 -59.158 1.00 74.68  ? 264 ILE B C   1 
ATOM   5515 O  O   . ILE B 1 264 ? 2.239   -20.434 -59.031 1.00 76.78  ? 264 ILE B O   1 
ATOM   5516 C  CB  . ILE B 1 264 ? -0.473  -21.343 -57.264 1.00 76.96  ? 264 ILE B CB  1 
ATOM   5517 C  CG1 . ILE B 1 264 ? -1.274  -20.655 -56.162 1.00 78.22  ? 264 ILE B CG1 1 
ATOM   5518 C  CG2 . ILE B 1 264 ? 0.723   -22.018 -56.646 1.00 77.76  ? 264 ILE B CG2 1 
ATOM   5519 C  CD1 . ILE B 1 264 ? -1.714  -21.585 -55.069 1.00 76.57  ? 264 ILE B CD1 1 
ATOM   5520 N  N   . ALA B 1 265 ? 0.762   -21.787 -60.057 1.00 70.51  ? 265 ALA B N   1 
ATOM   5521 C  CA  . ALA B 1 265 ? 1.794   -22.411 -60.888 1.00 66.91  ? 265 ALA B CA  1 
ATOM   5522 C  C   . ALA B 1 265 ? 2.503   -21.417 -61.794 1.00 65.47  ? 265 ALA B C   1 
ATOM   5523 O  O   . ALA B 1 265 ? 3.684   -21.586 -62.092 1.00 65.98  ? 265 ALA B O   1 
ATOM   5524 C  CB  . ALA B 1 265 ? 1.245   -23.560 -61.705 1.00 65.06  ? 265 ALA B CB  1 
ATOM   5525 N  N   . ARG B 1 266 ? 1.792   -20.399 -62.259 1.00 68.81  ? 266 ARG B N   1 
ATOM   5526 C  CA  . ARG B 1 266 ? 2.443   -19.392 -63.078 1.00 68.02  ? 266 ARG B CA  1 
ATOM   5527 C  C   . ARG B 1 266 ? 3.452   -18.623 -62.251 1.00 68.76  ? 266 ARG B C   1 
ATOM   5528 O  O   . ARG B 1 266 ? 4.651   -18.579 -62.596 1.00 67.98  ? 266 ARG B O   1 
ATOM   5529 C  CB  . ARG B 1 266 ? 1.434   -18.447 -63.718 1.00 67.36  ? 266 ARG B CB  1 
ATOM   5530 C  CG  . ARG B 1 266 ? 0.707   -19.087 -64.874 1.00 68.24  ? 266 ARG B CG  1 
ATOM   5531 C  CD  . ARG B 1 266 ? -0.081  -18.073 -65.663 1.00 68.18  ? 266 ARG B CD  1 
ATOM   5532 N  NE  . ARG B 1 266 ? -0.762  -18.700 -66.791 1.00 72.04  ? 266 ARG B NE  1 
ATOM   5533 C  CZ  . ARG B 1 266 ? -1.519  -18.048 -67.665 1.00 74.59  ? 266 ARG B CZ  1 
ATOM   5534 N  NH1 . ARG B 1 266 ? -1.702  -16.736 -67.539 1.00 73.92  1 266 ARG B NH1 1 
ATOM   5535 N  NH2 . ARG B 1 266 ? -2.100  -18.707 -68.664 1.00 72.04  ? 266 ARG B NH2 1 
ATOM   5536 N  N   . LYS B 1 267 ? 2.990   -18.043 -61.144 1.00 68.29  ? 267 LYS B N   1 
ATOM   5537 C  CA  . LYS B 1 267 ? 3.914   -17.241 -60.345 1.00 71.50  ? 267 LYS B CA  1 
ATOM   5538 C  C   . LYS B 1 267 ? 5.075   -18.094 -59.830 1.00 73.80  ? 267 LYS B C   1 
ATOM   5539 O  O   . LYS B 1 267 ? 6.167   -17.595 -59.548 1.00 73.90  ? 267 LYS B O   1 
ATOM   5540 C  CB  . LYS B 1 267 ? 3.213   -16.518 -59.198 1.00 72.71  ? 267 LYS B CB  1 
ATOM   5541 C  CG  . LYS B 1 267 ? 4.167   -15.676 -58.374 1.00 72.50  ? 267 LYS B CG  1 
ATOM   5542 C  CD  . LYS B 1 267 ? 3.508   -14.423 -57.863 1.00 73.13  ? 267 LYS B CD  1 
ATOM   5543 C  CE  . LYS B 1 267 ? 3.769   -13.244 -58.782 1.00 73.49  ? 267 LYS B CE  1 
ATOM   5544 N  NZ  . LYS B 1 267 ? 3.282   -11.964 -58.182 1.00 75.88  1 267 LYS B NZ  1 
ATOM   5545 N  N   . LEU B 1 268 ? 4.837   -19.392 -59.736 1.00 71.31  ? 268 LEU B N   1 
ATOM   5546 C  CA  . LEU B 1 268 ? 5.847   -20.312 -59.266 1.00 76.14  ? 268 LEU B CA  1 
ATOM   5547 C  C   . LEU B 1 268 ? 6.873   -20.602 -60.348 1.00 80.25  ? 268 LEU B C   1 
ATOM   5548 O  O   . LEU B 1 268 ? 8.067   -20.645 -60.074 1.00 80.11  ? 268 LEU B O   1 
ATOM   5549 C  CB  . LEU B 1 268 ? 5.201   -21.611 -58.818 1.00 75.08  ? 268 LEU B CB  1 
ATOM   5550 C  CG  . LEU B 1 268 ? 5.710   -22.099 -57.473 1.00 75.91  ? 268 LEU B CG  1 
ATOM   5551 C  CD1 . LEU B 1 268 ? 5.690   -20.947 -56.484 1.00 76.58  ? 268 LEU B CD1 1 
ATOM   5552 C  CD2 . LEU B 1 268 ? 4.840   -23.234 -57.001 1.00 76.52  ? 268 LEU B CD2 1 
ATOM   5553 N  N   . LYS B 1 269 ? 6.408   -20.820 -61.575 1.00 77.38  ? 269 LYS B N   1 
ATOM   5554 C  CA  . LYS B 1 269 ? 7.314   -21.037 -62.692 1.00 81.70  ? 269 LYS B CA  1 
ATOM   5555 C  C   . LYS B 1 269 ? 8.172   -19.805 -62.867 1.00 81.13  ? 269 LYS B C   1 
ATOM   5556 O  O   . LYS B 1 269 ? 9.348   -19.905 -63.223 1.00 82.41  ? 269 LYS B O   1 
ATOM   5557 C  CB  . LYS B 1 269 ? 6.550   -21.323 -63.981 1.00 85.47  ? 269 LYS B CB  1 
ATOM   5558 C  CG  . LYS B 1 269 ? 5.920   -22.696 -64.021 1.00 89.62  ? 269 LYS B CG  1 
ATOM   5559 C  CD  . LYS B 1 269 ? 6.983   -23.777 -64.138 1.00 92.30  ? 269 LYS B CD  1 
ATOM   5560 C  CE  . LYS B 1 269 ? 6.386   -25.160 -63.917 1.00 92.82  ? 269 LYS B CE  1 
ATOM   5561 N  NZ  . LYS B 1 269 ? 5.188   -25.419 -64.764 1.00 93.02  1 269 LYS B NZ  1 
ATOM   5562 N  N   . GLU B 1 270 ? 7.593   -18.638 -62.610 1.00 94.23  ? 270 GLU B N   1 
ATOM   5563 C  CA  . GLU B 1 270 ? 8.394   -17.427 -62.662 1.00 92.79  ? 270 GLU B CA  1 
ATOM   5564 C  C   . GLU B 1 270 ? 9.424   -17.349 -61.528 1.00 92.00  ? 270 GLU B C   1 
ATOM   5565 O  O   . GLU B 1 270 ? 10.625  -17.255 -61.782 1.00 89.56  ? 270 GLU B O   1 
ATOM   5566 C  CB  . GLU B 1 270 ? 7.497   -16.197 -62.657 1.00 92.61  ? 270 GLU B CB  1 
ATOM   5567 C  CG  . GLU B 1 270 ? 6.540   -16.165 -63.832 1.00 96.76  ? 270 GLU B CG  1 
ATOM   5568 C  CD  . GLU B 1 270 ? 5.739   -14.879 -63.892 1.00 101.20 ? 270 GLU B CD  1 
ATOM   5569 O  OE1 . GLU B 1 270 ? 5.980   -13.989 -63.040 1.00 102.51 ? 270 GLU B OE1 1 
ATOM   5570 O  OE2 . GLU B 1 270 ? 4.877   -14.758 -64.795 1.00 102.50 1 270 GLU B OE2 1 
ATOM   5571 N  N   . LYS B 1 271 ? 8.958   -17.385 -60.280 1.00 77.74  ? 271 LYS B N   1 
ATOM   5572 C  CA  . LYS B 1 271 ? 9.835   -17.191 -59.115 1.00 81.57  ? 271 LYS B CA  1 
ATOM   5573 C  C   . LYS B 1 271 ? 10.645  -18.397 -58.623 1.00 82.89  ? 271 LYS B C   1 
ATOM   5574 O  O   . LYS B 1 271 ? 11.806  -18.252 -58.244 1.00 80.01  ? 271 LYS B O   1 
ATOM   5575 C  CB  . LYS B 1 271 ? 9.065   -16.571 -57.945 1.00 84.82  ? 271 LYS B CB  1 
ATOM   5576 C  CG  . LYS B 1 271 ? 8.604   -15.156 -58.225 1.00 89.81  ? 271 LYS B CG  1 
ATOM   5577 C  CD  . LYS B 1 271 ? 9.799   -14.230 -58.383 1.00 93.68  ? 271 LYS B CD  1 
ATOM   5578 C  CE  . LYS B 1 271 ? 9.376   -12.880 -58.930 1.00 94.51  ? 271 LYS B CE  1 
ATOM   5579 N  NZ  . LYS B 1 271 ? 8.339   -12.236 -58.079 1.00 94.87  1 271 LYS B NZ  1 
ATOM   5580 N  N   . CYS B 1 272 ? 10.031  -19.574 -58.601 1.00 83.08  ? 272 CYS B N   1 
ATOM   5581 C  CA  . CYS B 1 272 ? 10.712  -20.782 -58.141 1.00 86.25  ? 272 CYS B CA  1 
ATOM   5582 C  C   . CYS B 1 272 ? 10.517  -21.893 -59.160 1.00 83.90  ? 272 CYS B C   1 
ATOM   5583 O  O   . CYS B 1 272 ? 9.776   -22.847 -58.921 1.00 87.27  ? 272 CYS B O   1 
ATOM   5584 C  CB  . CYS B 1 272 ? 10.169  -21.202 -56.776 1.00 89.55  ? 272 CYS B CB  1 
ATOM   5585 S  SG  . CYS B 1 272 ? 10.926  -22.676 -56.062 1.00 90.60  ? 272 CYS B SG  1 
ATOM   5586 N  N   . PRO B 1 273 ? 11.183  -21.763 -60.314 1.00 89.91  ? 273 PRO B N   1 
ATOM   5587 C  CA  . PRO B 1 273 ? 10.932  -22.571 -61.514 1.00 86.50  ? 273 PRO B CA  1 
ATOM   5588 C  C   . PRO B 1 273 ? 11.177  -24.067 -61.357 1.00 84.80  ? 273 PRO B C   1 
ATOM   5589 O  O   . PRO B 1 273 ? 10.709  -24.832 -62.201 1.00 86.96  ? 273 PRO B O   1 
ATOM   5590 C  CB  . PRO B 1 273 ? 11.923  -21.998 -62.530 1.00 83.56  ? 273 PRO B CB  1 
ATOM   5591 C  CG  . PRO B 1 273 ? 13.001  -21.401 -61.699 1.00 82.35  ? 273 PRO B CG  1 
ATOM   5592 C  CD  . PRO B 1 273 ? 12.315  -20.840 -60.500 1.00 85.38  ? 273 PRO B CD  1 
ATOM   5593 N  N   . GLY B 1 274 ? 11.901  -24.481 -60.325 1.00 84.24  ? 274 GLY B N   1 
ATOM   5594 C  CA  . GLY B 1 274 ? 12.218  -25.889 -60.175 1.00 80.62  ? 274 GLY B CA  1 
ATOM   5595 C  C   . GLY B 1 274 ? 11.130  -26.690 -59.490 1.00 79.36  ? 274 GLY B C   1 
ATOM   5596 O  O   . GLY B 1 274 ? 11.326  -27.864 -59.164 1.00 78.05  ? 274 GLY B O   1 
ATOM   5597 N  N   . CYS B 1 275 ? 9.972   -26.071 -59.297 1.00 82.02  ? 275 CYS B N   1 
ATOM   5598 C  CA  . CYS B 1 275 ? 8.895   -26.690 -58.543 1.00 84.78  ? 275 CYS B CA  1 
ATOM   5599 C  C   . CYS B 1 275 ? 7.945   -27.464 -59.445 1.00 86.20  ? 275 CYS B C   1 
ATOM   5600 O  O   . CYS B 1 275 ? 7.443   -26.919 -60.430 1.00 83.97  ? 275 CYS B O   1 
ATOM   5601 C  CB  . CYS B 1 275 ? 8.125   -25.618 -57.774 1.00 86.17  ? 275 CYS B CB  1 
ATOM   5602 S  SG  . CYS B 1 275 ? 6.767   -26.241 -56.748 1.00 91.37  ? 275 CYS B SG  1 
ATOM   5603 N  N   . ARG B 1 276 ? 7.715   -28.734 -59.119 1.00 85.23  ? 276 ARG B N   1 
ATOM   5604 C  CA  . ARG B 1 276 ? 6.750   -29.538 -59.861 1.00 88.54  ? 276 ARG B CA  1 
ATOM   5605 C  C   . ARG B 1 276 ? 5.333   -29.179 -59.451 1.00 85.84  ? 276 ARG B C   1 
ATOM   5606 O  O   . ARG B 1 276 ? 5.035   -29.047 -58.266 1.00 89.56  ? 276 ARG B O   1 
ATOM   5607 C  CB  . ARG B 1 276 ? 6.963   -31.026 -59.618 1.00 92.31  ? 276 ARG B CB  1 
ATOM   5608 C  CG  . ARG B 1 276 ? 8.280   -31.554 -60.111 1.00 96.86  ? 276 ARG B CG  1 
ATOM   5609 C  CD  . ARG B 1 276 ? 8.170   -33.021 -60.470 1.00 99.64  ? 276 ARG B CD  1 
ATOM   5610 N  NE  . ARG B 1 276 ? 7.693   -33.206 -61.838 1.00 100.23 ? 276 ARG B NE  1 
ATOM   5611 C  CZ  . ARG B 1 276 ? 7.148   -34.328 -62.300 1.00 100.44 ? 276 ARG B CZ  1 
ATOM   5612 N  NH1 . ARG B 1 276 ? 6.997   -35.381 -61.500 1.00 100.47 1 276 ARG B NH1 1 
ATOM   5613 N  NH2 . ARG B 1 276 ? 6.753   -34.398 -63.566 1.00 100.47 ? 276 ARG B NH2 1 
ATOM   5614 N  N   . ILE B 1 277 ? 4.451   -29.049 -60.433 1.00 69.57  ? 277 ILE B N   1 
ATOM   5615 C  CA  . ILE B 1 277 ? 3.062   -28.721 -60.171 1.00 61.59  ? 277 ILE B CA  1 
ATOM   5616 C  C   . ILE B 1 277 ? 2.179   -29.925 -60.427 1.00 59.46  ? 277 ILE B C   1 
ATOM   5617 O  O   . ILE B 1 277 ? 2.149   -30.457 -61.538 1.00 58.56  ? 277 ILE B O   1 
ATOM   5618 C  CB  . ILE B 1 277 ? 2.598   -27.578 -61.072 1.00 59.45  ? 277 ILE B CB  1 
ATOM   5619 C  CG1 . ILE B 1 277 ? 3.582   -26.408 -60.976 1.00 56.30  ? 277 ILE B CG1 1 
ATOM   5620 C  CG2 . ILE B 1 277 ? 1.193   -27.148 -60.705 1.00 55.72  ? 277 ILE B CG2 1 
ATOM   5621 C  CD1 . ILE B 1 277 ? 3.653   -25.805 -59.592 1.00 53.23  ? 277 ILE B CD1 1 
ATOM   5622 N  N   . ILE B 1 278 ? 1.451   -30.357 -59.408 1.00 75.15  ? 278 ILE B N   1 
ATOM   5623 C  CA  . ILE B 1 278 ? 0.629   -31.545 -59.529 1.00 72.47  ? 278 ILE B CA  1 
ATOM   5624 C  C   . ILE B 1 278 ? -0.849  -31.222 -59.407 1.00 73.36  ? 278 ILE B C   1 
ATOM   5625 O  O   . ILE B 1 278 ? -1.289  -30.638 -58.411 1.00 74.54  ? 278 ILE B O   1 
ATOM   5626 C  CB  . ILE B 1 278 ? 0.980   -32.569 -58.457 1.00 70.98  ? 278 ILE B CB  1 
ATOM   5627 C  CG1 . ILE B 1 278 ? 2.489   -32.805 -58.438 1.00 66.95  ? 278 ILE B CG1 1 
ATOM   5628 C  CG2 . ILE B 1 278 ? 0.234   -33.864 -58.711 1.00 66.10  ? 278 ILE B CG2 1 
ATOM   5629 C  CD1 . ILE B 1 278 ? 3.048   -33.205 -59.775 1.00 64.83  ? 278 ILE B CD1 1 
ATOM   5630 N  N   . GLY B 1 279 ? -1.610  -31.574 -60.434 1.00 61.73  ? 279 GLY B N   1 
ATOM   5631 C  CA  . GLY B 1 279 ? -3.043  -31.397 -60.386 1.00 60.81  ? 279 GLY B CA  1 
ATOM   5632 C  C   . GLY B 1 279 ? -3.741  -32.633 -59.848 1.00 60.51  ? 279 GLY B C   1 
ATOM   5633 O  O   . GLY B 1 279 ? -3.257  -33.764 -60.008 1.00 60.44  ? 279 GLY B O   1 
ATOM   5634 N  N   . VAL B 1 280 ? -4.904  -32.419 -59.237 1.00 66.30  ? 280 VAL B N   1 
ATOM   5635 C  CA  . VAL B 1 280 ? -5.721  -33.514 -58.736 1.00 67.18  ? 280 VAL B CA  1 
ATOM   5636 C  C   . VAL B 1 280 ? -7.110  -33.403 -59.336 1.00 68.85  ? 280 VAL B C   1 
ATOM   5637 O  O   . VAL B 1 280 ? -7.766  -32.364 -59.220 1.00 68.96  ? 280 VAL B O   1 
ATOM   5638 C  CB  . VAL B 1 280 ? -5.848  -33.488 -57.208 1.00 65.83  ? 280 VAL B CB  1 
ATOM   5639 C  CG1 . VAL B 1 280 ? -6.666  -34.668 -56.735 1.00 65.86  ? 280 VAL B CG1 1 
ATOM   5640 C  CG2 . VAL B 1 280 ? -4.483  -33.505 -56.560 1.00 65.84  ? 280 VAL B CG2 1 
ATOM   5641 N  N   . ASP B 1 281 ? -7.545  -34.464 -60.006 1.00 68.44  ? 281 ASP B N   1 
ATOM   5642 C  CA  . ASP B 1 281 ? -8.849  -34.464 -60.631 1.00 69.97  ? 281 ASP B CA  1 
ATOM   5643 C  C   . ASP B 1 281 ? -9.580  -35.690 -60.136 1.00 67.57  ? 281 ASP B C   1 
ATOM   5644 O  O   . ASP B 1 281 ? -8.986  -36.758 -60.016 1.00 67.87  ? 281 ASP B O   1 
ATOM   5645 C  CB  . ASP B 1 281 ? -8.695  -34.529 -62.147 1.00 73.43  ? 281 ASP B CB  1 
ATOM   5646 C  CG  . ASP B 1 281 ? -10.011 -34.328 -62.890 1.00 78.73  ? 281 ASP B CG  1 
ATOM   5647 O  OD1 . ASP B 1 281 ? -10.326 -35.154 -63.775 1.00 83.01  ? 281 ASP B OD1 1 
ATOM   5648 O  OD2 . ASP B 1 281 ? -10.718 -33.331 -62.611 1.00 83.04  1 281 ASP B OD2 1 
ATOM   5649 N  N   . PRO B 1 282 ? -10.880 -35.550 -59.858 1.00 70.19  ? 282 PRO B N   1 
ATOM   5650 C  CA  . PRO B 1 282 ? -11.693 -36.692 -59.436 1.00 69.69  ? 282 PRO B CA  1 
ATOM   5651 C  C   . PRO B 1 282 ? -12.003 -37.603 -60.614 1.00 70.40  ? 282 PRO B C   1 
ATOM   5652 O  O   . PRO B 1 282 ? -12.099 -37.129 -61.754 1.00 69.30  ? 282 PRO B O   1 
ATOM   5653 C  CB  . PRO B 1 282 ? -12.979 -36.036 -58.920 1.00 68.95  ? 282 PRO B CB  1 
ATOM   5654 C  CG  . PRO B 1 282 ? -13.043 -34.727 -59.623 1.00 68.53  ? 282 PRO B CG  1 
ATOM   5655 C  CD  . PRO B 1 282 ? -11.620 -34.280 -59.791 1.00 69.55  ? 282 PRO B CD  1 
ATOM   5656 N  N   . GLU B 1 283 ? -12.153 -38.894 -60.357 1.00 79.25  ? 283 GLU B N   1 
ATOM   5657 C  CA  . GLU B 1 283 ? -12.557 -39.791 -61.420 1.00 82.56  ? 283 GLU B CA  1 
ATOM   5658 C  C   . GLU B 1 283 ? -13.952 -39.410 -61.869 1.00 83.67  ? 283 GLU B C   1 
ATOM   5659 O  O   . GLU B 1 283 ? -14.846 -39.215 -61.040 1.00 82.78  ? 283 GLU B O   1 
ATOM   5660 C  CB  . GLU B 1 283 ? -12.522 -41.237 -60.961 1.00 83.09  ? 283 GLU B CB  1 
ATOM   5661 C  CG  . GLU B 1 283 ? -11.118 -41.736 -60.720 1.00 89.25  ? 283 GLU B CG  1 
ATOM   5662 C  CD  . GLU B 1 283 ? -11.098 -43.142 -60.161 1.00 97.54  ? 283 GLU B CD  1 
ATOM   5663 O  OE1 . GLU B 1 283 ? -9.991  -43.653 -59.887 1.00 100.62 ? 283 GLU B OE1 1 
ATOM   5664 O  OE2 . GLU B 1 283 ? -12.190 -43.733 -59.986 1.00 100.61 1 283 GLU B OE2 1 
ATOM   5665 N  N   . GLY B 1 284 ? -14.134 -39.290 -63.180 1.00 97.89  ? 284 GLY B N   1 
ATOM   5666 C  CA  . GLY B 1 284 ? -15.394 -38.838 -63.731 1.00 99.57  ? 284 GLY B CA  1 
ATOM   5667 C  C   . GLY B 1 284 ? -15.289 -37.416 -64.234 1.00 99.55  ? 284 GLY B C   1 
ATOM   5668 O  O   . GLY B 1 284 ? -16.237 -36.873 -64.794 1.00 101.32 ? 284 GLY B O   1 
ATOM   5669 N  N   . SER B 1 285 ? -14.125 -36.812 -64.046 1.00 88.45  ? 285 SER B N   1 
ATOM   5670 C  CA  . SER B 1 285 ? -13.876 -35.484 -64.575 1.00 83.98  ? 285 SER B CA  1 
ATOM   5671 C  C   . SER B 1 285 ? -12.895 -35.573 -65.738 1.00 80.75  ? 285 SER B C   1 
ATOM   5672 O  O   . SER B 1 285 ? -12.005 -36.429 -65.748 1.00 80.89  ? 285 SER B O   1 
ATOM   5673 C  CB  . SER B 1 285 ? -13.337 -34.571 -63.480 1.00 83.89  ? 285 SER B CB  1 
ATOM   5674 O  OG  . SER B 1 285 ? -12.815 -33.376 -64.033 1.00 84.02  ? 285 SER B OG  1 
ATOM   5675 N  N   . ILE B 1 286 ? -13.064 -34.700 -66.726 1.00 71.09  ? 286 ILE B N   1 
ATOM   5676 C  CA  . ILE B 1 286 ? -12.243 -34.756 -67.940 1.00 67.79  ? 286 ILE B CA  1 
ATOM   5677 C  C   . ILE B 1 286 ? -11.002 -33.859 -67.905 1.00 72.48  ? 286 ILE B C   1 
ATOM   5678 O  O   . ILE B 1 286 ? -10.307 -33.716 -68.916 1.00 73.99  ? 286 ILE B O   1 
ATOM   5679 C  CB  . ILE B 1 286 ? -13.079 -34.496 -69.232 1.00 63.45  ? 286 ILE B CB  1 
ATOM   5680 C  CG1 . ILE B 1 286 ? -13.937 -33.233 -69.103 1.00 53.05  ? 286 ILE B CG1 1 
ATOM   5681 C  CG2 . ILE B 1 286 ? -13.950 -35.693 -69.542 1.00 56.23  ? 286 ILE B CG2 1 
ATOM   5682 C  CD1 . ILE B 1 286 ? -13.319 -32.010 -69.756 1.00 39.51  ? 286 ILE B CD1 1 
ATOM   5683 N  N   . LEU B 1 287 ? -10.749 -33.236 -66.761 1.00 66.49  ? 287 LEU B N   1 
ATOM   5684 C  CA  . LEU B 1 287 ? -9.689  -32.240 -66.642 1.00 68.77  ? 287 LEU B CA  1 
ATOM   5685 C  C   . LEU B 1 287 ? -8.265  -32.747 -66.858 1.00 69.68  ? 287 LEU B C   1 
ATOM   5686 O  O   . LEU B 1 287 ? -7.410  -32.009 -67.362 1.00 70.51  ? 287 LEU B O   1 
ATOM   5687 C  CB  . LEU B 1 287 ? -9.760  -31.567 -65.282 1.00 69.49  ? 287 LEU B CB  1 
ATOM   5688 C  CG  . LEU B 1 287 ? -11.012 -30.735 -65.083 1.00 68.58  ? 287 LEU B CG  1 
ATOM   5689 C  CD1 . LEU B 1 287 ? -11.072 -30.227 -63.654 1.00 63.40  ? 287 LEU B CD1 1 
ATOM   5690 C  CD2 . LEU B 1 287 ? -10.968 -29.578 -66.076 1.00 63.63  ? 287 LEU B CD2 1 
ATOM   5691 N  N   . ALA B 1 288 ? -8.002  -33.994 -66.487 1.00 95.18  ? 288 ALA B N   1 
ATOM   5692 C  CA  . ALA B 1 288 ? -6.622  -34.451 -66.414 1.00 97.29  ? 288 ALA B CA  1 
ATOM   5693 C  C   . ALA B 1 288 ? -5.981  -34.655 -67.781 1.00 100.77 ? 288 ALA B C   1 
ATOM   5694 O  O   . ALA B 1 288 ? -6.621  -34.483 -68.821 1.00 100.93 ? 288 ALA B O   1 
ATOM   5695 C  CB  . ALA B 1 288 ? -6.537  -35.724 -65.606 1.00 93.25  ? 288 ALA B CB  1 
ATOM   5696 N  N   . GLU B 1 289 ? -4.701  -35.015 -67.757 1.00 89.17  ? 289 GLU B N   1 
ATOM   5697 C  CA  . GLU B 1 289 ? -3.944  -35.352 -68.951 1.00 96.22  ? 289 GLU B CA  1 
ATOM   5698 C  C   . GLU B 1 289 ? -2.963  -36.450 -68.598 1.00 97.58  ? 289 GLU B C   1 
ATOM   5699 O  O   . GLU B 1 289 ? -2.440  -36.476 -67.486 1.00 97.94  ? 289 GLU B O   1 
ATOM   5700 C  CB  . GLU B 1 289 ? -3.177  -34.140 -69.453 1.00 99.50  ? 289 GLU B CB  1 
ATOM   5701 C  CG  . GLU B 1 289 ? -4.034  -33.100 -70.116 1.00 107.71 ? 289 GLU B CG  1 
ATOM   5702 C  CD  . GLU B 1 289 ? -3.279  -31.811 -70.325 1.00 113.93 ? 289 GLU B CD  1 
ATOM   5703 O  OE1 . GLU B 1 289 ? -2.531  -31.411 -69.402 1.00 115.41 ? 289 GLU B OE1 1 
ATOM   5704 O  OE2 . GLU B 1 289 ? -3.418  -31.208 -71.412 1.00 115.42 1 289 GLU B OE2 1 
ATOM   5705 N  N   . PRO B 1 290 ? -2.690  -37.361 -69.537 1.00 104.73 ? 290 PRO B N   1 
ATOM   5706 C  CA  . PRO B 1 290 ? -3.257  -37.480 -70.880 1.00 106.52 ? 290 PRO B CA  1 
ATOM   5707 C  C   . PRO B 1 290 ? -4.680  -37.987 -70.772 1.00 109.03 ? 290 PRO B C   1 
ATOM   5708 O  O   . PRO B 1 290 ? -5.061  -38.490 -69.709 1.00 111.75 ? 290 PRO B O   1 
ATOM   5709 C  CB  . PRO B 1 290 ? -2.390  -38.557 -71.518 1.00 104.11 ? 290 PRO B CB  1 
ATOM   5710 C  CG  . PRO B 1 290 ? -2.024  -39.427 -70.373 1.00 102.01 ? 290 PRO B CG  1 
ATOM   5711 C  CD  . PRO B 1 290 ? -1.788  -38.482 -69.231 1.00 102.65 ? 290 PRO B CD  1 
ATOM   5712 N  N   . GLU B 1 291 ? -5.455  -37.853 -71.840 1.00 101.98 ? 291 GLU B N   1 
ATOM   5713 C  CA  . GLU B 1 291 ? -6.856  -38.238 -71.810 1.00 102.26 ? 291 GLU B CA  1 
ATOM   5714 C  C   . GLU B 1 291 ? -7.057  -39.713 -71.429 1.00 100.27 ? 291 GLU B C   1 
ATOM   5715 O  O   . GLU B 1 291 ? -8.137  -40.102 -70.979 1.00 100.85 ? 291 GLU B O   1 
ATOM   5716 C  CB  . GLU B 1 291 ? -7.517  -37.921 -73.152 1.00 104.36 ? 291 GLU B CB  1 
ATOM   5717 C  CG  . GLU B 1 291 ? -9.036  -38.055 -73.172 1.00 110.12 ? 291 GLU B CG  1 
ATOM   5718 C  CD  . GLU B 1 291 ? -9.744  -37.050 -72.266 1.00 115.04 ? 291 GLU B CD  1 
ATOM   5719 O  OE1 . GLU B 1 291 ? -9.151  -35.988 -71.959 1.00 116.35 ? 291 GLU B OE1 1 
ATOM   5720 O  OE2 . GLU B 1 291 ? -10.905 -37.320 -71.880 1.00 116.31 1 291 GLU B OE2 1 
ATOM   5721 N  N   . GLU B 1 292 ? -6.012  -40.522 -71.584 1.00 112.95 ? 292 GLU B N   1 
ATOM   5722 C  CA  . GLU B 1 292 ? -6.076  -41.931 -71.207 1.00 110.92 ? 292 GLU B CA  1 
ATOM   5723 C  C   . GLU B 1 292 ? -6.482  -42.130 -69.749 1.00 109.55 ? 292 GLU B C   1 
ATOM   5724 O  O   . GLU B 1 292 ? -7.033  -43.173 -69.391 1.00 108.37 ? 292 GLU B O   1 
ATOM   5725 C  CB  . GLU B 1 292 ? -4.731  -42.623 -71.439 1.00 110.83 ? 292 GLU B CB  1 
ATOM   5726 C  CG  . GLU B 1 292 ? -4.511  -43.169 -72.841 1.00 113.29 ? 292 GLU B CG  1 
ATOM   5727 C  CD  . GLU B 1 292 ? -4.149  -42.094 -73.848 1.00 116.04 ? 292 GLU B CD  1 
ATOM   5728 O  OE1 . GLU B 1 292 ? -3.738  -40.991 -73.426 1.00 116.87 ? 292 GLU B OE1 1 
ATOM   5729 O  OE2 . GLU B 1 292 ? -4.268  -42.358 -75.063 1.00 116.85 1 292 GLU B OE2 1 
ATOM   5730 N  N   . LEU B 1 293 ? -6.207  -41.133 -68.912 1.00 93.75  ? 293 LEU B N   1 
ATOM   5731 C  CA  . LEU B 1 293 ? -6.535  -41.207 -67.491 1.00 92.90  ? 293 LEU B CA  1 
ATOM   5732 C  C   . LEU B 1 293 ? -8.019  -41.014 -67.229 1.00 94.39  ? 293 LEU B C   1 
ATOM   5733 O  O   . LEU B 1 293 ? -8.548  -41.474 -66.213 1.00 95.47  ? 293 LEU B O   1 
ATOM   5734 C  CB  . LEU B 1 293 ? -5.758  -40.159 -66.703 1.00 91.08  ? 293 LEU B CB  1 
ATOM   5735 C  CG  . LEU B 1 293 ? -4.256  -40.372 -66.571 1.00 84.09  ? 293 LEU B CG  1 
ATOM   5736 C  CD1 . LEU B 1 293 ? -3.656  -39.212 -65.798 1.00 77.68  ? 293 LEU B CD1 1 
ATOM   5737 C  CD2 . LEU B 1 293 ? -3.980  -41.687 -65.861 1.00 75.46  ? 293 LEU B CD2 1 
ATOM   5738 N  N   . ASN B 1 294 ? -8.689  -40.315 -68.135 1.00 93.06  ? 294 ASN B N   1 
ATOM   5739 C  CA  . ASN B 1 294 ? -10.076 -39.952 -67.909 1.00 94.23  ? 294 ASN B CA  1 
ATOM   5740 C  C   . ASN B 1 294 ? -11.033 -41.047 -68.328 1.00 97.71  ? 294 ASN B C   1 
ATOM   5741 O  O   . ASN B 1 294 ? -12.251 -40.883 -68.227 1.00 95.88  ? 294 ASN B O   1 
ATOM   5742 C  CB  . ASN B 1 294 ? -10.415 -38.655 -68.629 1.00 91.88  ? 294 ASN B CB  1 
ATOM   5743 C  CG  . ASN B 1 294 ? -9.470  -37.538 -68.266 1.00 89.45  ? 294 ASN B CG  1 
ATOM   5744 O  OD1 . ASN B 1 294 ? -8.703  -37.644 -67.304 1.00 88.40  ? 294 ASN B OD1 1 
ATOM   5745 N  ND2 . ASN B 1 294 ? -9.519  -36.454 -69.027 1.00 88.39  ? 294 ASN B ND2 1 
ATOM   5746 N  N   . GLN B 1 295 ? -10.498 -42.169 -68.796 1.00 116.99 ? 295 GLN B N   1 
ATOM   5747 C  CA  . GLN B 1 295 ? -11.375 -43.223 -69.266 1.00 121.13 ? 295 GLN B CA  1 
ATOM   5748 C  C   . GLN B 1 295 ? -11.903 -43.921 -68.040 1.00 121.16 ? 295 GLN B C   1 
ATOM   5749 O  O   . GLN B 1 295 ? -11.144 -44.501 -67.260 1.00 120.65 ? 295 GLN B O   1 
ATOM   5750 C  CB  . GLN B 1 295 ? -10.603 -44.216 -70.129 1.00 123.69 ? 295 GLN B CB  1 
ATOM   5751 C  CG  . GLN B 1 295 ? -9.859  -43.562 -71.272 1.00 130.90 ? 295 GLN B CG  1 
ATOM   5752 C  CD  . GLN B 1 295 ? -10.800 -43.067 -72.354 1.00 137.29 ? 295 GLN B CD  1 
ATOM   5753 O  OE1 . GLN B 1 295 ? -11.537 -43.850 -72.957 1.00 139.04 ? 295 GLN B OE1 1 
ATOM   5754 N  NE2 . GLN B 1 295 ? -10.794 -41.760 -72.593 1.00 139.02 ? 295 GLN B NE2 1 
ATOM   5755 N  N   . THR B 1 296 ? -13.216 -43.858 -67.874 1.00 128.98 ? 296 THR B N   1 
ATOM   5756 C  CA  . THR B 1 296 ? -13.851 -44.411 -66.699 1.00 131.07 ? 296 THR B CA  1 
ATOM   5757 C  C   . THR B 1 296 ? -15.320 -44.661 -66.974 1.00 137.12 ? 296 THR B C   1 
ATOM   5758 O  O   . THR B 1 296 ? -15.888 -44.111 -67.918 1.00 135.16 ? 296 THR B O   1 
ATOM   5759 C  CB  . THR B 1 296 ? -13.718 -43.468 -65.501 1.00 127.68 ? 296 THR B CB  1 
ATOM   5760 O  OG1 . THR B 1 296 ? -14.377 -44.046 -64.369 1.00 125.20 ? 296 THR B OG1 1 
ATOM   5761 C  CG2 . THR B 1 296 ? -14.352 -42.125 -65.822 1.00 125.19 ? 296 THR B CG2 1 
ATOM   5762 N  N   . GLU B 1 297 ? -15.937 -45.488 -66.144 1.00 141.82 ? 297 GLU B N   1 
ATOM   5763 C  CA  . GLU B 1 297 ? -17.346 -45.795 -66.313 1.00 148.98 ? 297 GLU B CA  1 
ATOM   5764 C  C   . GLU B 1 297 ? -18.223 -44.698 -65.714 1.00 149.11 ? 297 GLU B C   1 
ATOM   5765 O  O   . GLU B 1 297 ? -18.936 -43.997 -66.437 1.00 151.66 ? 297 GLU B O   1 
ATOM   5766 C  CB  . GLU B 1 297 ? -17.677 -47.151 -65.687 1.00 153.73 ? 297 GLU B CB  1 
ATOM   5767 C  CG  . GLU B 1 297 ? -16.976 -48.329 -66.348 1.00 160.49 ? 297 GLU B CG  1 
ATOM   5768 C  CD  . GLU B 1 297 ? -17.267 -48.425 -67.835 1.00 164.84 ? 297 GLU B CD  1 
ATOM   5769 O  OE1 . GLU B 1 297 ? -18.452 -48.303 -68.219 1.00 165.81 ? 297 GLU B OE1 1 
ATOM   5770 O  OE2 . GLU B 1 297 ? -16.312 -48.617 -68.619 1.00 165.80 1 297 GLU B OE2 1 
ATOM   5771 N  N   . GLN B 1 298 ? -18.160 -44.553 -64.392 1.00 128.41 ? 298 GLN B N   1 
ATOM   5772 C  CA  . GLN B 1 298 ? -19.036 -43.639 -63.658 1.00 126.84 ? 298 GLN B CA  1 
ATOM   5773 C  C   . GLN B 1 298 ? -18.820 -42.163 -63.985 1.00 126.76 ? 298 GLN B C   1 
ATOM   5774 O  O   . GLN B 1 298 ? -17.685 -41.686 -64.061 1.00 126.11 ? 298 GLN B O   1 
ATOM   5775 C  CB  . GLN B 1 298 ? -18.897 -43.868 -62.153 1.00 125.81 ? 298 GLN B CB  1 
ATOM   5776 C  CG  . GLN B 1 298 ? -19.632 -45.097 -61.655 1.00 125.27 ? 298 GLN B CG  1 
ATOM   5777 C  CD  . GLN B 1 298 ? -21.119 -45.044 -61.956 1.00 125.08 ? 298 GLN B CD  1 
ATOM   5778 O  OE1 . GLN B 1 298 ? -21.749 -43.987 -61.859 1.00 125.07 ? 298 GLN B OE1 1 
ATOM   5779 N  NE2 . GLN B 1 298 ? -21.688 -46.186 -62.329 1.00 125.05 ? 298 GLN B NE2 1 
ATOM   5780 N  N   . THR B 1 299 ? -19.922 -41.451 -64.193 1.00 115.02 ? 299 THR B N   1 
ATOM   5781 C  CA  . THR B 1 299 ? -19.873 -40.036 -64.538 1.00 114.20 ? 299 THR B CA  1 
ATOM   5782 C  C   . THR B 1 299 ? -19.967 -39.066 -63.359 1.00 109.03 ? 299 THR B C   1 
ATOM   5783 O  O   . THR B 1 299 ? -19.768 -37.861 -63.536 1.00 112.27 ? 299 THR B O   1 
ATOM   5784 C  CB  . THR B 1 299 ? -21.007 -39.680 -65.501 1.00 117.02 ? 299 THR B CB  1 
ATOM   5785 O  OG1 . THR B 1 299 ? -21.164 -38.258 -65.538 1.00 119.33 ? 299 THR B OG1 1 
ATOM   5786 C  CG2 . THR B 1 299 ? -22.307 -40.308 -65.014 1.00 119.32 ? 299 THR B CG2 1 
ATOM   5787 N  N   . THR B 1 300 ? -20.281 -39.574 -62.170 1.00 128.06 ? 300 THR B N   1 
ATOM   5788 C  CA  . THR B 1 300 ? -20.503 -38.699 -61.016 1.00 116.10 ? 300 THR B CA  1 
ATOM   5789 C  C   . THR B 1 300 ? -19.791 -39.133 -59.742 1.00 107.28 ? 300 THR B C   1 
ATOM   5790 O  O   . THR B 1 300 ? -19.486 -40.312 -59.544 1.00 107.96 ? 300 THR B O   1 
ATOM   5791 C  CB  . THR B 1 300 ? -21.998 -38.526 -60.711 1.00 116.10 ? 300 THR B CB  1 
ATOM   5792 O  OG1 . THR B 1 300 ? -22.634 -39.811 -60.705 1.00 116.34 ? 300 THR B OG1 1 
ATOM   5793 C  CG2 . THR B 1 300 ? -22.649 -37.653 -61.766 1.00 115.83 ? 300 THR B CG2 1 
ATOM   5794 N  N   . TYR B 1 301 ? -19.554 -38.166 -58.866 1.00 84.01  ? 301 TYR B N   1 
ATOM   5795 C  CA  . TYR B 1 301 ? -18.817 -38.423 -57.638 1.00 73.03  ? 301 TYR B CA  1 
ATOM   5796 C  C   . TYR B 1 301 ? -19.309 -37.556 -56.478 1.00 69.20  ? 301 TYR B C   1 
ATOM   5797 O  O   . TYR B 1 301 ? -19.948 -36.518 -56.681 1.00 66.65  ? 301 TYR B O   1 
ATOM   5798 C  CB  . TYR B 1 301 ? -17.328 -38.193 -57.884 1.00 70.23  ? 301 TYR B CB  1 
ATOM   5799 C  CG  . TYR B 1 301 ? -17.039 -36.903 -58.618 1.00 64.34  ? 301 TYR B CG  1 
ATOM   5800 C  CD1 . TYR B 1 301 ? -17.000 -35.690 -57.939 1.00 61.90  ? 301 TYR B CD1 1 
ATOM   5801 C  CD2 . TYR B 1 301 ? -16.810 -36.900 -59.993 1.00 60.87  ? 301 TYR B CD2 1 
ATOM   5802 C  CE1 . TYR B 1 301 ? -16.736 -34.515 -58.602 1.00 61.34  ? 301 TYR B CE1 1 
ATOM   5803 C  CE2 . TYR B 1 301 ? -16.547 -35.728 -60.665 1.00 60.78  ? 301 TYR B CE2 1 
ATOM   5804 C  CZ  . TYR B 1 301 ? -16.508 -34.538 -59.961 1.00 61.52  ? 301 TYR B CZ  1 
ATOM   5805 O  OH  . TYR B 1 301 ? -16.250 -33.358 -60.614 1.00 64.27  ? 301 TYR B OH  1 
ATOM   5806 N  N   . GLU B 1 302 ? -19.009 -37.992 -55.258 1.00 81.41  ? 302 GLU B N   1 
ATOM   5807 C  CA  . GLU B 1 302 ? -19.495 -37.318 -54.059 1.00 79.84  ? 302 GLU B CA  1 
ATOM   5808 C  C   . GLU B 1 302 ? -18.714 -36.069 -53.653 1.00 77.21  ? 302 GLU B C   1 
ATOM   5809 O  O   . GLU B 1 302 ? -19.276 -35.152 -53.040 1.00 77.08  ? 302 GLU B O   1 
ATOM   5810 C  CB  . GLU B 1 302 ? -19.595 -38.294 -52.887 1.00 80.82  ? 302 GLU B CB  1 
ATOM   5811 C  CG  . GLU B 1 302 ? -20.646 -39.385 -53.063 1.00 85.39  ? 302 GLU B CG  1 
ATOM   5812 C  CD  . GLU B 1 302 ? -22.079 -38.855 -53.061 1.00 90.87  ? 302 GLU B CD  1 
ATOM   5813 O  OE1 . GLU B 1 302 ? -22.304 -37.691 -52.651 1.00 91.23  ? 302 GLU B OE1 1 
ATOM   5814 O  OE2 . GLU B 1 302 ? -22.984 -39.620 -53.456 1.00 94.18  1 302 GLU B OE2 1 
ATOM   5815 N  N   . VAL B 1 303 ? -17.424 -36.047 -53.967 1.00 70.74  ? 303 VAL B N   1 
ATOM   5816 C  CA  . VAL B 1 303 ? -16.578 -34.920 -53.606 1.00 68.77  ? 303 VAL B CA  1 
ATOM   5817 C  C   . VAL B 1 303 ? -17.069 -33.607 -54.195 1.00 69.85  ? 303 VAL B C   1 
ATOM   5818 O  O   . VAL B 1 303 ? -17.341 -33.512 -55.388 1.00 67.52  ? 303 VAL B O   1 
ATOM   5819 C  CB  . VAL B 1 303 ? -15.151 -35.147 -54.057 1.00 67.69  ? 303 VAL B CB  1 
ATOM   5820 C  CG1 . VAL B 1 303 ? -14.289 -33.948 -53.701 1.00 64.97  ? 303 VAL B CG1 1 
ATOM   5821 C  CG2 . VAL B 1 303 ? -14.616 -36.389 -53.393 1.00 67.42  ? 303 VAL B CG2 1 
ATOM   5822 N  N   . GLU B 1 304 ? -17.161 -32.583 -53.361 1.00 61.69  ? 304 GLU B N   1 
ATOM   5823 C  CA  . GLU B 1 304 ? -17.664 -31.302 -53.815 1.00 66.30  ? 304 GLU B CA  1 
ATOM   5824 C  C   . GLU B 1 304 ? -16.531 -30.347 -54.132 1.00 67.42  ? 304 GLU B C   1 
ATOM   5825 O  O   . GLU B 1 304 ? -15.503 -30.334 -53.439 1.00 67.73  ? 304 GLU B O   1 
ATOM   5826 C  CB  . GLU B 1 304 ? -18.563 -30.688 -52.746 1.00 67.77  ? 304 GLU B CB  1 
ATOM   5827 C  CG  . GLU B 1 304 ? -19.711 -31.591 -52.340 1.00 73.27  ? 304 GLU B CG  1 
ATOM   5828 C  CD  . GLU B 1 304 ? -20.593 -30.962 -51.281 1.00 77.81  ? 304 GLU B CD  1 
ATOM   5829 O  OE1 . GLU B 1 304 ? -21.206 -31.718 -50.504 1.00 77.09  ? 304 GLU B OE1 1 
ATOM   5830 O  OE2 . GLU B 1 304 ? -20.692 -29.715 -51.241 1.00 80.88  1 304 GLU B OE2 1 
ATOM   5831 N  N   . GLY B 1 305 ? -16.712 -29.553 -55.184 1.00 73.90  ? 305 GLY B N   1 
ATOM   5832 C  CA  . GLY B 1 305 ? -15.805 -28.455 -55.453 1.00 75.09  ? 305 GLY B CA  1 
ATOM   5833 C  C   . GLY B 1 305 ? -14.759 -28.712 -56.518 1.00 75.42  ? 305 GLY B C   1 
ATOM   5834 O  O   . GLY B 1 305 ? -14.189 -27.768 -57.076 1.00 76.33  ? 305 GLY B O   1 
ATOM   5835 N  N   . ILE B 1 306 ? -14.491 -29.980 -56.806 1.00 63.71  ? 306 ILE B N   1 
ATOM   5836 C  CA  . ILE B 1 306 ? -13.498 -30.298 -57.825 1.00 62.36  ? 306 ILE B CA  1 
ATOM   5837 C  C   . ILE B 1 306 ? -14.041 -31.099 -59.006 1.00 65.81  ? 306 ILE B C   1 
ATOM   5838 O  O   . ILE B 1 306 ? -14.964 -31.914 -58.865 1.00 66.41  ? 306 ILE B O   1 
ATOM   5839 C  CB  . ILE B 1 306 ? -12.289 -31.037 -57.228 1.00 60.37  ? 306 ILE B CB  1 
ATOM   5840 C  CG1 . ILE B 1 306 ? -12.719 -32.384 -56.649 1.00 52.29  ? 306 ILE B CG1 1 
ATOM   5841 C  CG2 . ILE B 1 306 ? -11.634 -30.190 -56.163 1.00 55.71  ? 306 ILE B CG2 1 
ATOM   5842 C  CD1 . ILE B 1 306 ? -11.558 -33.196 -56.148 1.00 40.11  ? 306 ILE B CD1 1 
ATOM   5843 N  N   . GLY B 1 307 ? -13.441 -30.866 -60.168 1.00 94.66  ? 307 GLY B N   1 
ATOM   5844 C  CA  . GLY B 1 307 ? -13.786 -31.599 -61.367 1.00 96.32  ? 307 GLY B CA  1 
ATOM   5845 C  C   . GLY B 1 307 ? -14.924 -30.966 -62.140 1.00 95.61  ? 307 GLY B C   1 
ATOM   5846 O  O   . GLY B 1 307 ? -15.818 -30.332 -61.571 1.00 98.48  ? 307 GLY B O   1 
ATOM   5847 N  N   . TYR B 1 308 ? -14.895 -31.153 -63.452 1.00 75.74  ? 308 TYR B N   1 
ATOM   5848 C  CA  . TYR B 1 308 ? -15.908 -30.582 -64.319 1.00 72.34  ? 308 TYR B CA  1 
ATOM   5849 C  C   . TYR B 1 308 ? -16.002 -31.354 -65.617 1.00 72.33  ? 308 TYR B C   1 
ATOM   5850 O  O   . TYR B 1 308 ? -15.095 -32.117 -65.968 1.00 70.36  ? 308 TYR B O   1 
ATOM   5851 C  CB  . TYR B 1 308 ? -15.610 -29.119 -64.620 1.00 70.31  ? 308 TYR B CB  1 
ATOM   5852 C  CG  . TYR B 1 308 ? -16.174 -28.161 -63.604 1.00 68.91  ? 308 TYR B CG  1 
ATOM   5853 C  CD1 . TYR B 1 308 ? -15.345 -27.513 -62.710 1.00 68.43  ? 308 TYR B CD1 1 
ATOM   5854 C  CD2 . TYR B 1 308 ? -17.539 -27.895 -63.553 1.00 69.35  ? 308 TYR B CD2 1 
ATOM   5855 C  CE1 . TYR B 1 308 ? -15.844 -26.634 -61.792 1.00 70.45  ? 308 TYR B CE1 1 
ATOM   5856 C  CE2 . TYR B 1 308 ? -18.052 -27.016 -62.638 1.00 70.64  ? 308 TYR B CE2 1 
ATOM   5857 C  CZ  . TYR B 1 308 ? -17.198 -26.387 -61.754 1.00 71.23  ? 308 TYR B CZ  1 
ATOM   5858 O  OH  . TYR B 1 308 ? -17.694 -25.502 -60.825 1.00 72.20  ? 308 TYR B OH  1 
ATOM   5859 N  N   . ASP B 1 309 ? -17.102 -31.148 -66.331 1.00 94.97  ? 309 ASP B N   1 
ATOM   5860 C  CA  . ASP B 1 309 ? -17.307 -31.808 -67.611 1.00 96.89  ? 309 ASP B CA  1 
ATOM   5861 C  C   . ASP B 1 309 ? -16.746 -30.972 -68.765 1.00 96.47  ? 309 ASP B C   1 
ATOM   5862 O  O   . ASP B 1 309 ? -16.876 -31.343 -69.933 1.00 98.10  ? 309 ASP B O   1 
ATOM   5863 C  CB  . ASP B 1 309 ? -18.791 -32.109 -67.821 1.00 98.13  ? 309 ASP B CB  1 
ATOM   5864 C  CG  . ASP B 1 309 ? -19.663 -30.880 -67.640 1.00 98.92  ? 309 ASP B CG  1 
ATOM   5865 O  OD1 . ASP B 1 309 ? -19.178 -29.884 -67.055 1.00 99.87  ? 309 ASP B OD1 1 
ATOM   5866 O  OD2 . ASP B 1 309 ? -20.831 -30.910 -68.082 1.00 95.66  1 309 ASP B OD2 1 
ATOM   5867 N  N   . PHE B 1 310 ? -16.135 -29.839 -68.435 1.00 79.53  ? 310 PHE B N   1 
ATOM   5868 C  CA  . PHE B 1 310 ? -15.544 -28.987 -69.450 1.00 76.08  ? 310 PHE B CA  1 
ATOM   5869 C  C   . PHE B 1 310 ? -14.233 -28.403 -68.958 1.00 75.19  ? 310 PHE B C   1 
ATOM   5870 O  O   . PHE B 1 310 ? -13.877 -28.557 -67.790 1.00 74.70  ? 310 PHE B O   1 
ATOM   5871 C  CB  . PHE B 1 310 ? -16.507 -27.861 -69.801 1.00 75.02  ? 310 PHE B CB  1 
ATOM   5872 C  CG  . PHE B 1 310 ? -16.707 -26.875 -68.695 1.00 71.12  ? 310 PHE B CG  1 
ATOM   5873 C  CD1 . PHE B 1 310 ? -16.023 -25.672 -68.688 1.00 68.60  ? 310 PHE B CD1 1 
ATOM   5874 C  CD2 . PHE B 1 310 ? -17.595 -27.149 -67.658 1.00 68.38  ? 310 PHE B CD2 1 
ATOM   5875 C  CE1 . PHE B 1 310 ? -16.217 -24.763 -67.667 1.00 67.87  ? 310 PHE B CE1 1 
ATOM   5876 C  CE2 . PHE B 1 310 ? -17.792 -26.243 -66.636 1.00 67.50  ? 310 PHE B CE2 1 
ATOM   5877 C  CZ  . PHE B 1 310 ? -17.106 -25.047 -66.644 1.00 67.40  ? 310 PHE B CZ  1 
ATOM   5878 N  N   . ILE B 1 311 ? -13.538 -27.695 -69.840 1.00 47.53  ? 311 ILE B N   1 
ATOM   5879 C  CA  . ILE B 1 311 ? -12.267 -27.084 -69.497 1.00 47.69  ? 311 ILE B CA  1 
ATOM   5880 C  C   . ILE B 1 311 ? -12.427 -25.587 -69.353 1.00 50.86  ? 311 ILE B C   1 
ATOM   5881 O  O   . ILE B 1 311 ? -12.585 -24.877 -70.344 1.00 50.36  ? 311 ILE B O   1 
ATOM   5882 C  CB  . ILE B 1 311 ? -11.238 -27.320 -70.583 1.00 46.06  ? 311 ILE B CB  1 
ATOM   5883 C  CG1 . ILE B 1 311 ? -11.101 -28.814 -70.851 1.00 42.93  ? 311 ILE B CG1 1 
ATOM   5884 C  CG2 . ILE B 1 311 ? -9.887  -26.719 -70.175 1.00 42.42  ? 311 ILE B CG2 1 
ATOM   5885 C  CD1 . ILE B 1 311 ? -10.229 -29.523 -69.858 1.00 43.13  ? 311 ILE B CD1 1 
ATOM   5886 N  N   . PRO B 1 312 ? -12.360 -25.094 -68.116 1.00 52.04  ? 312 PRO B N   1 
ATOM   5887 C  CA  . PRO B 1 312 ? -12.560 -23.665 -67.851 1.00 55.10  ? 312 PRO B CA  1 
ATOM   5888 C  C   . PRO B 1 312 ? -11.474 -22.828 -68.504 1.00 58.24  ? 312 PRO B C   1 
ATOM   5889 O  O   . PRO B 1 312 ? -10.312 -23.258 -68.549 1.00 59.69  ? 312 PRO B O   1 
ATOM   5890 C  CB  . PRO B 1 312 ? -12.466 -23.572 -66.322 1.00 54.89  ? 312 PRO B CB  1 
ATOM   5891 C  CG  . PRO B 1 312 ? -12.759 -24.968 -65.839 1.00 52.41  ? 312 PRO B CG  1 
ATOM   5892 C  CD  . PRO B 1 312 ? -12.173 -25.875 -66.884 1.00 51.60  ? 312 PRO B CD  1 
ATOM   5893 N  N   . THR B 1 313 ? -11.846 -21.653 -69.003 1.00 89.54  ? 313 THR B N   1 
ATOM   5894 C  CA  . THR B 1 313 ? -10.901 -20.820 -69.736 1.00 92.83  ? 313 THR B CA  1 
ATOM   5895 C  C   . THR B 1 313 ? -9.739  -20.379 -68.855 1.00 88.89  ? 313 THR B C   1 
ATOM   5896 O  O   . THR B 1 313 ? -8.613  -20.217 -69.335 1.00 92.05  ? 313 THR B O   1 
ATOM   5897 C  CB  . THR B 1 313 ? -11.567 -19.559 -70.315 1.00 95.93  ? 313 THR B CB  1 
ATOM   5898 O  OG1 . THR B 1 313 ? -11.684 -18.565 -69.292 1.00 102.33 ? 313 THR B OG1 1 
ATOM   5899 C  CG2 . THR B 1 313 ? -12.944 -19.884 -70.853 1.00 100.55 ? 313 THR B CG2 1 
ATOM   5900 N  N   . VAL B 1 314 ? -10.009 -20.176 -67.570 1.00 73.83  ? 314 VAL B N   1 
ATOM   5901 C  CA  . VAL B 1 314 ? -8.970  -19.695 -66.668 1.00 65.91  ? 314 VAL B CA  1 
ATOM   5902 C  C   . VAL B 1 314 ? -7.970  -20.787 -66.348 1.00 64.08  ? 314 VAL B C   1 
ATOM   5903 O  O   . VAL B 1 314 ? -6.906  -20.522 -65.782 1.00 61.77  ? 314 VAL B O   1 
ATOM   5904 C  CB  . VAL B 1 314 ? -9.542  -19.158 -65.353 1.00 64.15  ? 314 VAL B CB  1 
ATOM   5905 C  CG1 . VAL B 1 314 ? -10.207 -17.810 -65.578 1.00 61.03  ? 314 VAL B CG1 1 
ATOM   5906 C  CG2 . VAL B 1 314 ? -10.523 -20.163 -64.761 1.00 60.97  ? 314 VAL B CG2 1 
ATOM   5907 N  N   . LEU B 1 315 ? -8.296  -22.013 -66.729 1.00 67.46  ? 315 LEU B N   1 
ATOM   5908 C  CA  . LEU B 1 315 ? -7.402  -23.118 -66.460 1.00 68.37  ? 315 LEU B CA  1 
ATOM   5909 C  C   . LEU B 1 315 ? -6.348  -23.245 -67.552 1.00 72.68  ? 315 LEU B C   1 
ATOM   5910 O  O   . LEU B 1 315 ? -6.666  -23.381 -68.733 1.00 73.22  ? 315 LEU B O   1 
ATOM   5911 C  CB  . LEU B 1 315 ? -8.183  -24.413 -66.326 1.00 65.01  ? 315 LEU B CB  1 
ATOM   5912 C  CG  . LEU B 1 315 ? -7.339  -25.675 -66.170 1.00 57.07  ? 315 LEU B CG  1 
ATOM   5913 C  CD1 . LEU B 1 315 ? -6.336  -25.545 -65.035 1.00 49.10  ? 315 LEU B CD1 1 
ATOM   5914 C  CD2 . LEU B 1 315 ? -8.255  -26.849 -65.914 1.00 49.38  ? 315 LEU B CD2 1 
ATOM   5915 N  N   . ASP B 1 316 ? -5.088  -23.196 -67.146 1.00 69.65  ? 316 ASP B N   1 
ATOM   5916 C  CA  . ASP B 1 316 ? -3.994  -23.441 -68.057 1.00 74.12  ? 316 ASP B CA  1 
ATOM   5917 C  C   . ASP B 1 316 ? -3.431  -24.799 -67.711 1.00 73.27  ? 316 ASP B C   1 
ATOM   5918 O  O   . ASP B 1 316 ? -2.799  -24.970 -66.667 1.00 76.38  ? 316 ASP B O   1 
ATOM   5919 C  CB  . ASP B 1 316 ? -2.918  -22.390 -67.861 1.00 76.80  ? 316 ASP B CB  1 
ATOM   5920 C  CG  . ASP B 1 316 ? -1.830  -22.484 -68.893 1.00 81.52  ? 316 ASP B CG  1 
ATOM   5921 O  OD1 . ASP B 1 316 ? -1.270  -21.424 -69.240 1.00 85.17  ? 316 ASP B OD1 1 
ATOM   5922 O  OD2 . ASP B 1 316 ? -1.547  -23.611 -69.361 1.00 85.14  1 316 ASP B OD2 1 
ATOM   5923 N  N   . ARG B 1 317 ? -3.644  -25.769 -68.586 1.00 68.93  ? 317 ARG B N   1 
ATOM   5924 C  CA  . ARG B 1 317 ? -3.276  -27.131 -68.267 1.00 67.37  ? 317 ARG B CA  1 
ATOM   5925 C  C   . ARG B 1 317 ? -1.822  -27.352 -68.601 1.00 65.47  ? 317 ARG B C   1 
ATOM   5926 O  O   . ARG B 1 317 ? -1.232  -28.379 -68.245 1.00 60.72  ? 317 ARG B O   1 
ATOM   5927 C  CB  . ARG B 1 317 ? -4.153  -28.100 -69.035 1.00 70.93  ? 317 ARG B CB  1 
ATOM   5928 C  CG  . ARG B 1 317 ? -5.615  -27.802 -68.838 1.00 79.99  ? 317 ARG B CG  1 
ATOM   5929 C  CD  . ARG B 1 317 ? -6.441  -28.400 -69.948 1.00 89.33  ? 317 ARG B CD  1 
ATOM   5930 N  NE  . ARG B 1 317 ? -6.575  -29.846 -69.802 1.00 92.90  ? 317 ARG B NE  1 
ATOM   5931 C  CZ  . ARG B 1 317 ? -7.161  -30.627 -70.703 1.00 96.12  ? 317 ARG B CZ  1 
ATOM   5932 N  NH1 . ARG B 1 317 ? -7.658  -30.090 -71.813 1.00 94.98  1 317 ARG B NH1 1 
ATOM   5933 N  NH2 . ARG B 1 317 ? -7.253  -31.937 -70.498 1.00 97.56  ? 317 ARG B NH2 1 
ATOM   5934 N  N   . THR B 1 318 ? -1.250  -26.381 -69.302 1.00 87.42  ? 318 THR B N   1 
ATOM   5935 C  CA  . THR B 1 318 ? 0.117   -26.491 -69.781 1.00 92.26  ? 318 THR B CA  1 
ATOM   5936 C  C   . THR B 1 318 ? 1.119   -26.286 -68.663 1.00 96.40  ? 318 THR B C   1 
ATOM   5937 O  O   . THR B 1 318 ? 2.293   -26.632 -68.808 1.00 97.62  ? 318 THR B O   1 
ATOM   5938 C  CB  . THR B 1 318 ? 0.393   -25.452 -70.864 1.00 91.30  ? 318 THR B CB  1 
ATOM   5939 O  OG1 . THR B 1 318 ? 0.377   -24.144 -70.278 1.00 91.79  ? 318 THR B OG1 1 
ATOM   5940 C  CG2 . THR B 1 318 ? -0.681  -25.529 -71.933 1.00 89.83  ? 318 THR B CG2 1 
ATOM   5941 N  N   . VAL B 1 319 ? 0.667   -25.710 -67.553 1.00 55.85  ? 319 VAL B N   1 
ATOM   5942 C  CA  . VAL B 1 319 ? 1.563   -25.443 -66.432 1.00 56.98  ? 319 VAL B CA  1 
ATOM   5943 C  C   . VAL B 1 319 ? 1.512   -26.571 -65.426 1.00 53.74  ? 319 VAL B C   1 
ATOM   5944 O  O   . VAL B 1 319 ? 2.170   -26.515 -64.392 1.00 56.03  ? 319 VAL B O   1 
ATOM   5945 C  CB  . VAL B 1 319 ? 1.233   -24.120 -65.717 1.00 59.59  ? 319 VAL B CB  1 
ATOM   5946 C  CG1 . VAL B 1 319 ? 1.348   -22.953 -66.683 1.00 61.89  ? 319 VAL B CG1 1 
ATOM   5947 C  CG2 . VAL B 1 319 ? -0.153  -24.191 -65.122 1.00 61.92  ? 319 VAL B CG2 1 
ATOM   5948 N  N   . VAL B 1 320 ? 0.726   -27.592 -65.725 1.00 78.79  ? 320 VAL B N   1 
ATOM   5949 C  CA  . VAL B 1 320 ? 0.603   -28.715 -64.817 1.00 74.71  ? 320 VAL B CA  1 
ATOM   5950 C  C   . VAL B 1 320 ? 1.552   -29.815 -65.226 1.00 73.78  ? 320 VAL B C   1 
ATOM   5951 O  O   . VAL B 1 320 ? 1.365   -30.445 -66.267 1.00 71.28  ? 320 VAL B O   1 
ATOM   5952 C  CB  . VAL B 1 320 ? -0.814  -29.283 -64.838 1.00 73.92  ? 320 VAL B CB  1 
ATOM   5953 C  CG1 . VAL B 1 320 ? -0.917  -30.465 -63.892 1.00 73.98  ? 320 VAL B CG1 1 
ATOM   5954 C  CG2 . VAL B 1 320 ? -1.820  -28.197 -64.489 1.00 74.09  ? 320 VAL B CG2 1 
ATOM   5955 N  N   . ASP B 1 321 ? 2.561   -30.057 -64.402 1.00 66.69  ? 321 ASP B N   1 
ATOM   5956 C  CA  . ASP B 1 321 ? 3.580   -31.039 -64.735 1.00 72.29  ? 321 ASP B CA  1 
ATOM   5957 C  C   . ASP B 1 321 ? 3.025   -32.458 -64.757 1.00 71.67  ? 321 ASP B C   1 
ATOM   5958 O  O   . ASP B 1 321 ? 3.444   -33.284 -65.567 1.00 69.92  ? 321 ASP B O   1 
ATOM   5959 C  CB  . ASP B 1 321 ? 4.768   -30.922 -63.790 1.00 78.76  ? 321 ASP B CB  1 
ATOM   5960 C  CG  . ASP B 1 321 ? 5.571   -29.655 -64.032 1.00 91.20  ? 321 ASP B CG  1 
ATOM   5961 O  OD1 . ASP B 1 321 ? 4.993   -28.677 -64.566 1.00 100.44 ? 321 ASP B OD1 1 
ATOM   5962 O  OD2 . ASP B 1 321 ? 6.777   -29.639 -63.697 1.00 100.50 1 321 ASP B OD2 1 
ATOM   5963 N  N   . LYS B 1 322 ? 2.105   -32.759 -63.852 1.00 74.59  ? 322 LYS B N   1 
ATOM   5964 C  CA  . LYS B 1 322 ? 1.471   -34.066 -63.868 1.00 75.27  ? 322 LYS B CA  1 
ATOM   5965 C  C   . LYS B 1 322 ? 0.080   -34.019 -63.244 1.00 76.39  ? 322 LYS B C   1 
ATOM   5966 O  O   . LYS B 1 322 ? -0.195  -33.192 -62.373 1.00 78.75  ? 322 LYS B O   1 
ATOM   5967 C  CB  . LYS B 1 322 ? 2.342   -35.092 -63.141 1.00 74.38  ? 322 LYS B CB  1 
ATOM   5968 C  CG  . LYS B 1 322 ? 1.838   -36.517 -63.262 1.00 68.92  ? 322 LYS B CG  1 
ATOM   5969 C  CD  . LYS B 1 322 ? 2.743   -37.495 -62.545 1.00 66.05  ? 322 LYS B CD  1 
ATOM   5970 C  CE  . LYS B 1 322 ? 2.184   -38.903 -62.662 1.00 69.08  ? 322 LYS B CE  1 
ATOM   5971 N  NZ  . LYS B 1 322 ? 3.033   -39.907 -61.966 1.00 70.44  1 322 LYS B NZ  1 
ATOM   5972 N  N   . TRP B 1 323 ? -0.788  -34.926 -63.682 1.00 84.08  ? 323 TRP B N   1 
ATOM   5973 C  CA  . TRP B 1 323 ? -2.128  -35.039 -63.137 1.00 82.34  ? 323 TRP B CA  1 
ATOM   5974 C  C   . TRP B 1 323 ? -2.283  -36.344 -62.388 1.00 81.62  ? 323 TRP B C   1 
ATOM   5975 O  O   . TRP B 1 323 ? -1.657  -37.352 -62.738 1.00 82.68  ? 323 TRP B O   1 
ATOM   5976 C  CB  . TRP B 1 323 ? -3.165  -34.969 -64.249 1.00 81.29  ? 323 TRP B CB  1 
ATOM   5977 C  CG  . TRP B 1 323 ? -3.273  -33.621 -64.825 1.00 79.97  ? 323 TRP B CG  1 
ATOM   5978 C  CD1 . TRP B 1 323 ? -2.521  -33.092 -65.833 1.00 80.23  ? 323 TRP B CD1 1 
ATOM   5979 C  CD2 . TRP B 1 323 ? -4.168  -32.593 -64.406 1.00 78.78  ? 323 TRP B CD2 1 
ATOM   5980 N  NE1 . TRP B 1 323 ? -2.906  -31.796 -66.081 1.00 79.83  ? 323 TRP B NE1 1 
ATOM   5981 C  CE2 . TRP B 1 323 ? -3.918  -31.465 -65.218 1.00 78.57  ? 323 TRP B CE2 1 
ATOM   5982 C  CE3 . TRP B 1 323 ? -5.165  -32.516 -63.425 1.00 78.05  ? 323 TRP B CE3 1 
ATOM   5983 C  CZ2 . TRP B 1 323 ? -4.628  -30.276 -65.083 1.00 77.12  ? 323 TRP B CZ2 1 
ATOM   5984 C  CZ3 . TRP B 1 323 ? -5.868  -31.340 -63.291 1.00 77.29  ? 323 TRP B CZ3 1 
ATOM   5985 C  CH2 . TRP B 1 323 ? -5.596  -30.232 -64.120 1.00 76.57  ? 323 TRP B CH2 1 
ATOM   5986 N  N   . PHE B 1 324 ? -3.124  -36.330 -61.361 1.00 73.41  ? 324 PHE B N   1 
ATOM   5987 C  CA  . PHE B 1 324 ? -3.446  -37.549 -60.643 1.00 71.46  ? 324 PHE B CA  1 
ATOM   5988 C  C   . PHE B 1 324 ? -4.943  -37.667 -60.472 1.00 70.75  ? 324 PHE B C   1 
ATOM   5989 O  O   . PHE B 1 324 ? -5.640  -36.672 -60.212 1.00 71.24  ? 324 PHE B O   1 
ATOM   5990 C  CB  . PHE B 1 324 ? -2.787  -37.564 -59.276 1.00 70.96  ? 324 PHE B CB  1 
ATOM   5991 C  CG  . PHE B 1 324 ? -1.399  -38.103 -59.276 1.00 69.11  ? 324 PHE B CG  1 
ATOM   5992 C  CD1 . PHE B 1 324 ? -1.177  -39.471 -59.240 1.00 66.58  ? 324 PHE B CD1 1 
ATOM   5993 C  CD2 . PHE B 1 324 ? -0.311  -37.246 -59.287 1.00 69.57  ? 324 PHE B CD2 1 
ATOM   5994 C  CE1 . PHE B 1 324 ? 0.111   -39.972 -59.225 1.00 66.79  ? 324 PHE B CE1 1 
ATOM   5995 C  CE2 . PHE B 1 324 ? 0.972   -37.740 -59.272 1.00 69.91  ? 324 PHE B CE2 1 
ATOM   5996 C  CZ  . PHE B 1 324 ? 1.184   -39.104 -59.241 1.00 69.63  ? 324 PHE B CZ  1 
ATOM   5997 N  N   . LYS B 1 325 ? -5.441  -38.889 -60.600 1.00 84.01  ? 325 LYS B N   1 
ATOM   5998 C  CA  . LYS B 1 325 ? -6.859  -39.124 -60.428 1.00 84.70  ? 325 LYS B CA  1 
ATOM   5999 C  C   . LYS B 1 325 ? -7.159  -39.621 -59.027 1.00 87.04  ? 325 LYS B C   1 
ATOM   6000 O  O   . LYS B 1 325 ? -6.548  -40.579 -58.548 1.00 84.18  ? 325 LYS B O   1 
ATOM   6001 C  CB  . LYS B 1 325 ? -7.364  -40.125 -61.463 1.00 83.70  ? 325 LYS B CB  1 
ATOM   6002 C  CG  . LYS B 1 325 ? -7.546  -39.537 -62.851 1.00 83.91  ? 325 LYS B CG  1 
ATOM   6003 C  CD  . LYS B 1 325 ? -8.321  -38.235 -62.790 1.00 84.29  ? 325 LYS B CD  1 
ATOM   6004 C  CE  . LYS B 1 325 ? -9.037  -37.980 -64.098 1.00 84.09  ? 325 LYS B CE  1 
ATOM   6005 N  NZ  . LYS B 1 325 ? -10.311 -38.748 -64.181 1.00 85.06  1 325 LYS B NZ  1 
ATOM   6006 N  N   . SER B 1 326 ? -8.133  -38.989 -58.386 1.00 68.24  ? 326 SER B N   1 
ATOM   6007 C  CA  . SER B 1 326 ? -8.542  -39.367 -57.046 1.00 74.85  ? 326 SER B CA  1 
ATOM   6008 C  C   . SER B 1 326 ? -9.992  -39.789 -57.074 1.00 73.99  ? 326 SER B C   1 
ATOM   6009 O  O   . SER B 1 326 ? -10.763 -39.341 -57.925 1.00 75.84  ? 326 SER B O   1 
ATOM   6010 C  CB  . SER B 1 326 ? -8.403  -38.188 -56.092 1.00 80.39  ? 326 SER B CB  1 
ATOM   6011 O  OG  . SER B 1 326 ? -9.395  -37.213 -56.383 1.00 87.47  ? 326 SER B OG  1 
ATOM   6012 N  N   . ASN B 1 327 ? -10.368 -40.634 -56.127 1.00 99.14  ? 327 ASN B N   1 
ATOM   6013 C  CA  . ASN B 1 327 ? -11.749 -41.056 -55.997 1.00 94.24  ? 327 ASN B CA  1 
ATOM   6014 C  C   . ASN B 1 327 ? -12.333 -40.570 -54.687 1.00 92.38  ? 327 ASN B C   1 
ATOM   6015 O  O   . ASN B 1 327 ? -11.677 -39.837 -53.940 1.00 92.97  ? 327 ASN B O   1 
ATOM   6016 C  CB  . ASN B 1 327 ? -11.857 -42.566 -56.099 1.00 90.39  ? 327 ASN B CB  1 
ATOM   6017 C  CG  . ASN B 1 327 ? -11.060 -43.256 -55.039 1.00 87.82  ? 327 ASN B CG  1 
ATOM   6018 O  OD1 . ASN B 1 327 ? -9.834  -43.189 -55.033 1.00 87.13  ? 327 ASN B OD1 1 
ATOM   6019 N  ND2 . ASN B 1 327 ? -11.745 -43.913 -54.118 1.00 87.14  ? 327 ASN B ND2 1 
ATOM   6020 N  N   . ASP B 1 328 ? -13.573 -40.963 -54.421 1.00 103.16 ? 328 ASP B N   1 
ATOM   6021 C  CA  . ASP B 1 328 ? -14.266 -40.535 -53.214 1.00 101.26 ? 328 ASP B CA  1 
ATOM   6022 C  C   . ASP B 1 328 ? -13.730 -41.174 -51.929 1.00 102.27 ? 328 ASP B C   1 
ATOM   6023 O  O   . ASP B 1 328 ? -13.451 -40.476 -50.952 1.00 100.68 ? 328 ASP B O   1 
ATOM   6024 C  CB  . ASP B 1 328 ? -15.764 -40.803 -53.349 1.00 99.54  ? 328 ASP B CB  1 
ATOM   6025 C  CG  . ASP B 1 328 ? -16.442 -39.848 -54.309 1.00 96.33  ? 328 ASP B CG  1 
ATOM   6026 O  OD1 . ASP B 1 328 ? -17.465 -40.242 -54.912 1.00 95.10  ? 328 ASP B OD1 1 
ATOM   6027 O  OD2 . ASP B 1 328 ? -15.944 -38.710 -54.472 1.00 93.64  1 328 ASP B OD2 1 
ATOM   6028 N  N   . GLU B 1 329 ? -13.594 -42.495 -51.937 1.00 83.75  ? 329 GLU B N   1 
ATOM   6029 C  CA  . GLU B 1 329 ? -13.143 -43.226 -50.761 1.00 87.54  ? 329 GLU B CA  1 
ATOM   6030 C  C   . GLU B 1 329 ? -11.803 -42.723 -50.258 1.00 85.65  ? 329 GLU B C   1 
ATOM   6031 O  O   . GLU B 1 329 ? -11.634 -42.487 -49.059 1.00 84.51  ? 329 GLU B O   1 
ATOM   6032 C  CB  . GLU B 1 329 ? -13.049 -44.717 -51.055 1.00 91.31  ? 329 GLU B CB  1 
ATOM   6033 C  CG  . GLU B 1 329 ? -12.448 -45.517 -49.911 1.00 104.08 ? 329 GLU B CG  1 
ATOM   6034 C  CD  . GLU B 1 329 ? -13.110 -46.868 -49.738 1.00 115.41 ? 329 GLU B CD  1 
ATOM   6035 O  OE1 . GLU B 1 329 ? -12.559 -47.708 -48.992 1.00 118.72 ? 329 GLU B OE1 1 
ATOM   6036 O  OE2 . GLU B 1 329 ? -14.177 -47.092 -50.353 1.00 118.72 1 329 GLU B OE2 1 
ATOM   6037 N  N   . GLU B 1 330 ? -10.855 -42.582 -51.178 1.00 81.90  ? 330 GLU B N   1 
ATOM   6038 C  CA  . GLU B 1 330 ? -9.553  -42.015 -50.868 1.00 82.14  ? 330 GLU B CA  1 
ATOM   6039 C  C   . GLU B 1 330 ? -9.768  -40.697 -50.155 1.00 77.73  ? 330 GLU B C   1 
ATOM   6040 O  O   . GLU B 1 330 ? -9.258  -40.472 -49.055 1.00 75.54  ? 330 GLU B O   1 
ATOM   6041 C  CB  . GLU B 1 330 ? -8.787  -41.724 -52.157 1.00 86.07  ? 330 GLU B CB  1 
ATOM   6042 C  CG  . GLU B 1 330 ? -7.677  -42.694 -52.516 1.00 100.11 ? 330 GLU B CG  1 
ATOM   6043 C  CD  . GLU B 1 330 ? -6.965  -42.278 -53.795 1.00 113.96 ? 330 GLU B CD  1 
ATOM   6044 O  OE1 . GLU B 1 330 ? -7.531  -41.458 -54.554 1.00 117.86 ? 330 GLU B OE1 1 
ATOM   6045 O  OE2 . GLU B 1 330 ? -5.839  -42.762 -54.041 1.00 117.91 1 330 GLU B OE2 1 
ATOM   6046 N  N   . ALA B 1 331 ? -10.550 -39.840 -50.801 1.00 95.64  ? 331 ALA B N   1 
ATOM   6047 C  CA  . ALA B 1 331 ? -10.751 -38.469 -50.366 1.00 94.00  ? 331 ALA B CA  1 
ATOM   6048 C  C   . ALA B 1 331 ? -11.232 -38.408 -48.935 1.00 93.41  ? 331 ALA B C   1 
ATOM   6049 O  O   . ALA B 1 331 ? -10.629 -37.747 -48.091 1.00 94.01  ? 331 ALA B O   1 
ATOM   6050 C  CB  . ALA B 1 331 ? -11.747 -37.781 -51.269 1.00 92.80  ? 331 ALA B CB  1 
ATOM   6051 N  N   . PHE B 1 332 ? -12.333 -39.093 -48.668 1.00 65.78  ? 332 PHE B N   1 
ATOM   6052 C  CA  . PHE B 1 332 ? -12.955 -39.041 -47.359 1.00 65.07  ? 332 PHE B CA  1 
ATOM   6053 C  C   . PHE B 1 332 ? -12.112 -39.734 -46.300 1.00 65.87  ? 332 PHE B C   1 
ATOM   6054 O  O   . PHE B 1 332 ? -12.043 -39.279 -45.159 1.00 66.39  ? 332 PHE B O   1 
ATOM   6055 C  CB  . PHE B 1 332 ? -14.364 -39.606 -47.437 1.00 63.74  ? 332 PHE B CB  1 
ATOM   6056 C  CG  . PHE B 1 332 ? -15.247 -38.829 -48.347 1.00 59.86  ? 332 PHE B CG  1 
ATOM   6057 C  CD1 . PHE B 1 332 ? -15.121 -37.445 -48.422 1.00 55.74  ? 332 PHE B CD1 1 
ATOM   6058 C  CD2 . PHE B 1 332 ? -16.158 -39.469 -49.178 1.00 57.43  ? 332 PHE B CD2 1 
ATOM   6059 C  CE1 . PHE B 1 332 ? -15.919 -36.713 -49.281 1.00 53.85  ? 332 PHE B CE1 1 
ATOM   6060 C  CE2 . PHE B 1 332 ? -16.961 -38.743 -50.033 1.00 56.24  ? 332 PHE B CE2 1 
ATOM   6061 C  CZ  . PHE B 1 332 ? -16.840 -37.365 -50.087 1.00 54.57  ? 332 PHE B CZ  1 
ATOM   6062 N  N   . THR B 1 333 ? -11.466 -40.826 -46.685 1.00 72.30  ? 333 THR B N   1 
ATOM   6063 C  CA  . THR B 1 333 ? -10.611 -41.555 -45.770 1.00 71.57  ? 333 THR B CA  1 
ATOM   6064 C  C   . THR B 1 333 ? -9.494  -40.646 -45.301 1.00 71.45  ? 333 THR B C   1 
ATOM   6065 O  O   . THR B 1 333 ? -9.149  -40.611 -44.116 1.00 71.67  ? 333 THR B O   1 
ATOM   6066 C  CB  . THR B 1 333 ? -10.018 -42.801 -46.425 1.00 71.93  ? 333 THR B CB  1 
ATOM   6067 O  OG1 . THR B 1 333 ? -11.074 -43.706 -46.753 1.00 71.23  ? 333 THR B OG1 1 
ATOM   6068 C  CG2 . THR B 1 333 ? -9.064  -43.487 -45.484 1.00 69.70  ? 333 THR B CG2 1 
ATOM   6069 N  N   . PHE B 1 334 ? -8.934  -39.898 -46.238 1.00 66.46  ? 334 PHE B N   1 
ATOM   6070 C  CA  . PHE B 1 334 ? -7.830  -39.004 -45.921 1.00 66.24  ? 334 PHE B CA  1 
ATOM   6071 C  C   . PHE B 1 334 ? -8.277  -37.717 -45.254 1.00 64.12  ? 334 PHE B C   1 
ATOM   6072 O  O   . PHE B 1 334 ? -7.489  -37.054 -44.592 1.00 63.49  ? 334 PHE B O   1 
ATOM   6073 C  CB  . PHE B 1 334 ? -7.007  -38.699 -47.163 1.00 68.32  ? 334 PHE B CB  1 
ATOM   6074 C  CG  . PHE B 1 334 ? -5.932  -39.685 -47.403 1.00 74.55  ? 334 PHE B CG  1 
ATOM   6075 C  CD1 . PHE B 1 334 ? -6.211  -40.890 -48.023 1.00 79.20  ? 334 PHE B CD1 1 
ATOM   6076 C  CD2 . PHE B 1 334 ? -4.641  -39.423 -46.988 1.00 79.45  ? 334 PHE B CD2 1 
ATOM   6077 C  CE1 . PHE B 1 334 ? -5.219  -41.811 -48.233 1.00 82.90  ? 334 PHE B CE1 1 
ATOM   6078 C  CE2 . PHE B 1 334 ? -3.644  -40.339 -47.200 1.00 82.74  ? 334 PHE B CE2 1 
ATOM   6079 C  CZ  . PHE B 1 334 ? -3.934  -41.534 -47.825 1.00 83.69  ? 334 PHE B CZ  1 
ATOM   6080 N  N   . ALA B 1 335 ? -9.531  -37.348 -45.460 1.00 55.42  ? 335 ALA B N   1 
ATOM   6081 C  CA  . ALA B 1 335 ? -10.076 -36.161 -44.825 1.00 55.67  ? 335 ALA B CA  1 
ATOM   6082 C  C   . ALA B 1 335 ? -10.286 -36.457 -43.346 1.00 57.49  ? 335 ALA B C   1 
ATOM   6083 O  O   . ALA B 1 335 ? -9.912  -35.671 -42.469 1.00 56.80  ? 335 ALA B O   1 
ATOM   6084 C  CB  . ALA B 1 335 ? -11.385 -35.774 -45.478 1.00 53.05  ? 335 ALA B CB  1 
ATOM   6085 N  N   . ARG B 1 336 ? -10.906 -37.599 -43.082 1.00 71.00  ? 336 ARG B N   1 
ATOM   6086 C  CA  . ARG B 1 336 ? -11.121 -38.064 -41.725 1.00 75.46  ? 336 ARG B CA  1 
ATOM   6087 C  C   . ARG B 1 336 ? -9.785  -38.312 -41.043 1.00 75.45  ? 336 ARG B C   1 
ATOM   6088 O  O   . ARG B 1 336 ? -9.580  -37.957 -39.874 1.00 74.72  ? 336 ARG B O   1 
ATOM   6089 C  CB  . ARG B 1 336 ? -11.966 -39.334 -41.740 1.00 79.09  ? 336 ARG B CB  1 
ATOM   6090 C  CG  . ARG B 1 336 ? -13.387 -39.073 -42.177 1.00 86.43  ? 336 ARG B CG  1 
ATOM   6091 C  CD  . ARG B 1 336 ? -14.139 -40.358 -42.414 1.00 94.83  ? 336 ARG B CD  1 
ATOM   6092 N  NE  . ARG B 1 336 ? -15.248 -40.512 -41.479 1.00 99.97  ? 336 ARG B NE  1 
ATOM   6093 C  CZ  . ARG B 1 336 ? -15.327 -41.475 -40.569 1.00 101.62 ? 336 ARG B CZ  1 
ATOM   6094 N  NH1 . ARG B 1 336 ? -16.376 -41.543 -39.757 1.00 102.24 1 336 ARG B NH1 1 
ATOM   6095 N  NH2 . ARG B 1 336 ? -14.356 -42.379 -40.480 1.00 102.28 ? 336 ARG B NH2 1 
ATOM   6096 N  N   . MET B 1 337 ? -8.870  -38.921 -41.780 1.00 75.60  ? 337 MET B N   1 
ATOM   6097 C  CA  . MET B 1 337 ? -7.546  -39.160 -41.252 1.00 78.44  ? 337 MET B CA  1 
ATOM   6098 C  C   . MET B 1 337 ? -6.881  -37.826 -40.948 1.00 74.04  ? 337 MET B C   1 
ATOM   6099 O  O   . MET B 1 337 ? -6.117  -37.705 -39.998 1.00 74.85  ? 337 MET B O   1 
ATOM   6100 C  CB  . MET B 1 337 ? -6.713  -39.951 -42.245 1.00 84.38  ? 337 MET B CB  1 
ATOM   6101 C  CG  . MET B 1 337 ? -5.400  -40.430 -41.687 1.00 97.09  ? 337 MET B CG  1 
ATOM   6102 S  SD  . MET B 1 337 ? -4.568  -41.491 -42.876 1.00 107.73 ? 337 MET B SD  1 
ATOM   6103 C  CE  . MET B 1 337 ? -5.923  -42.587 -43.320 1.00 110.53 ? 337 MET B CE  1 
ATOM   6104 N  N   . LEU B 1 338 ? -7.193  -36.822 -41.753 1.00 73.08  ? 338 LEU B N   1 
ATOM   6105 C  CA  . LEU B 1 338 ? -6.572  -35.514 -41.628 1.00 67.50  ? 338 LEU B CA  1 
ATOM   6106 C  C   . LEU B 1 338 ? -7.051  -34.809 -40.383 1.00 62.81  ? 338 LEU B C   1 
ATOM   6107 O  O   . LEU B 1 338 ? -6.250  -34.230 -39.645 1.00 62.19  ? 338 LEU B O   1 
ATOM   6108 C  CB  . LEU B 1 338 ? -6.894  -34.655 -42.839 1.00 68.44  ? 338 LEU B CB  1 
ATOM   6109 C  CG  . LEU B 1 338 ? -5.810  -33.671 -43.259 1.00 70.51  ? 338 LEU B CG  1 
ATOM   6110 C  CD1 . LEU B 1 338 ? -4.472  -34.381 -43.399 1.00 72.63  ? 338 LEU B CD1 1 
ATOM   6111 C  CD2 . LEU B 1 338 ? -6.197  -33.014 -44.566 1.00 73.10  ? 338 LEU B CD2 1 
ATOM   6112 N  N   . ILE B 1 339 ? -8.359  -34.842 -40.160 1.00 66.40  ? 339 ILE B N   1 
ATOM   6113 C  CA  . ILE B 1 339 ? -8.927  -34.276 -38.949 1.00 62.74  ? 339 ILE B CA  1 
ATOM   6114 C  C   . ILE B 1 339 ? -8.396  -35.000 -37.721 1.00 66.14  ? 339 ILE B C   1 
ATOM   6115 O  O   . ILE B 1 339 ? -7.834  -34.379 -36.813 1.00 63.48  ? 339 ILE B O   1 
ATOM   6116 C  CB  . ILE B 1 339 ? -10.440 -34.389 -38.940 1.00 59.55  ? 339 ILE B CB  1 
ATOM   6117 C  CG1 . ILE B 1 339 ? -11.030 -33.565 -40.071 1.00 54.23  ? 339 ILE B CG1 1 
ATOM   6118 C  CG2 . ILE B 1 339 ? -10.993 -33.897 -37.627 1.00 54.71  ? 339 ILE B CG2 1 
ATOM   6119 C  CD1 . ILE B 1 339 ? -12.491 -33.828 -40.274 1.00 48.96  ? 339 ILE B CD1 1 
ATOM   6120 N  N   . ALA B 1 340 ? -8.571  -36.317 -37.702 1.00 68.14  ? 340 ALA B N   1 
ATOM   6121 C  CA  . ALA B 1 340 ? -8.237  -37.110 -36.526 1.00 74.68  ? 340 ALA B CA  1 
ATOM   6122 C  C   . ALA B 1 340 ? -6.751  -37.048 -36.163 1.00 77.88  ? 340 ALA B C   1 
ATOM   6123 O  O   . ALA B 1 340 ? -6.398  -36.821 -35.004 1.00 80.86  ? 340 ALA B O   1 
ATOM   6124 C  CB  . ALA B 1 340 ? -8.671  -38.542 -36.715 1.00 74.80  ? 340 ALA B CB  1 
ATOM   6125 N  N   . GLN B 1 341 ? -5.884  -37.260 -37.148 1.00 86.57  ? 341 GLN B N   1 
ATOM   6126 C  CA  . GLN B 1 341 ? -4.445  -37.239 -36.913 1.00 86.41  ? 341 GLN B CA  1 
ATOM   6127 C  C   . GLN B 1 341 ? -3.860  -35.844 -36.795 1.00 83.14  ? 341 GLN B C   1 
ATOM   6128 O  O   . GLN B 1 341 ? -3.076  -35.563 -35.893 1.00 82.93  ? 341 GLN B O   1 
ATOM   6129 C  CB  . GLN B 1 341 ? -3.713  -37.968 -38.035 1.00 88.90  ? 341 GLN B CB  1 
ATOM   6130 C  CG  . GLN B 1 341 ? -4.120  -39.404 -38.210 1.00 97.68  ? 341 GLN B CG  1 
ATOM   6131 C  CD  . GLN B 1 341 ? -3.308  -40.324 -37.338 1.00 108.24 ? 341 GLN B CD  1 
ATOM   6132 O  OE1 . GLN B 1 341 ? -2.767  -39.911 -36.308 1.00 111.81 ? 341 GLN B OE1 1 
ATOM   6133 N  NE2 . GLN B 1 341 ? -3.195  -41.579 -37.753 1.00 111.83 ? 341 GLN B NE2 1 
ATOM   6134 N  N   . GLU B 1 342 ? -4.196  -34.980 -37.739 1.00 65.86  ? 342 GLU B N   1 
ATOM   6135 C  CA  . GLU B 1 342 ? -3.553  -33.677 -37.786 1.00 65.10  ? 342 GLU B CA  1 
ATOM   6136 C  C   . GLU B 1 342 ? -4.318  -32.538 -37.125 1.00 62.04  ? 342 GLU B C   1 
ATOM   6137 O  O   . GLU B 1 342 ? -3.799  -31.421 -37.009 1.00 58.23  ? 342 GLU B O   1 
ATOM   6138 C  CB  . GLU B 1 342 ? -3.203  -33.319 -39.229 1.00 67.55  ? 342 GLU B CB  1 
ATOM   6139 C  CG  . GLU B 1 342 ? -2.187  -34.268 -39.836 1.00 82.23  ? 342 GLU B CG  1 
ATOM   6140 C  CD  . GLU B 1 342 ? -0.806  -34.109 -39.216 1.00 95.05  ? 342 GLU B CD  1 
ATOM   6141 O  OE1 . GLU B 1 342 ? -0.568  -33.089 -38.525 1.00 98.73  ? 342 GLU B OE1 1 
ATOM   6142 O  OE2 . GLU B 1 342 ? 0.043   -35.002 -39.432 1.00 98.73  1 342 GLU B OE2 1 
ATOM   6143 N  N   . GLY B 1 343 ? -5.540  -32.809 -36.687 1.00 63.96  ? 343 GLY B N   1 
ATOM   6144 C  CA  . GLY B 1 343 ? -6.353  -31.765 -36.093 1.00 66.10  ? 343 GLY B CA  1 
ATOM   6145 C  C   . GLY B 1 343 ? -6.727  -30.665 -37.072 1.00 67.16  ? 343 GLY B C   1 
ATOM   6146 O  O   . GLY B 1 343 ? -7.060  -29.545 -36.679 1.00 67.62  ? 343 GLY B O   1 
ATOM   6147 N  N   . LEU B 1 344 ? -6.672  -30.977 -38.359 1.00 73.26  ? 344 LEU B N   1 
ATOM   6148 C  CA  . LEU B 1 344 ? -7.069  -30.018 -39.373 1.00 74.99  ? 344 LEU B CA  1 
ATOM   6149 C  C   . LEU B 1 344 ? -8.514  -30.253 -39.729 1.00 78.18  ? 344 LEU B C   1 
ATOM   6150 O  O   . LEU B 1 344 ? -8.861  -31.312 -40.255 1.00 78.86  ? 344 LEU B O   1 
ATOM   6151 C  CB  . LEU B 1 344 ? -6.218  -30.184 -40.621 1.00 73.09  ? 344 LEU B CB  1 
ATOM   6152 C  CG  . LEU B 1 344 ? -4.727  -29.956 -40.401 1.00 68.24  ? 344 LEU B CG  1 
ATOM   6153 C  CD1 . LEU B 1 344 ? -3.971  -30.446 -41.609 1.00 64.18  ? 344 LEU B CD1 1 
ATOM   6154 C  CD2 . LEU B 1 344 ? -4.457  -28.479 -40.170 1.00 62.59  ? 344 LEU B CD2 1 
ATOM   6155 N  N   . LEU B 1 345 ? -9.362  -29.269 -39.454 1.00 76.20  ? 345 LEU B N   1 
ATOM   6156 C  CA  . LEU B 1 345 ? -10.774 -29.424 -39.743 1.00 77.63  ? 345 LEU B CA  1 
ATOM   6157 C  C   . LEU B 1 345 ? -10.959 -28.891 -41.137 1.00 77.97  ? 345 LEU B C   1 
ATOM   6158 O  O   . LEU B 1 345 ? -10.873 -27.680 -41.367 1.00 81.17  ? 345 LEU B O   1 
ATOM   6159 C  CB  . LEU B 1 345 ? -11.604 -28.603 -38.767 1.00 78.04  ? 345 LEU B CB  1 
ATOM   6160 C  CG  . LEU B 1 345 ? -11.371 -28.940 -37.301 1.00 74.15  ? 345 LEU B CG  1 
ATOM   6161 C  CD1 . LEU B 1 345 ? -12.245 -28.075 -36.434 1.00 69.23  ? 345 LEU B CD1 1 
ATOM   6162 C  CD2 . LEU B 1 345 ? -11.709 -30.399 -37.088 1.00 66.43  ? 345 LEU B CD2 1 
ATOM   6163 N  N   . CYS B 1 346 ? -11.241 -29.793 -42.068 1.00 77.26  ? 346 CYS B N   1 
ATOM   6164 C  CA  . CYS B 1 346 ? -11.125 -29.446 -43.472 1.00 75.86  ? 346 CYS B CA  1 
ATOM   6165 C  C   . CYS B 1 346 ? -12.065 -30.274 -44.320 1.00 77.74  ? 346 CYS B C   1 
ATOM   6166 O  O   . CYS B 1 346 ? -12.579 -31.305 -43.871 1.00 78.89  ? 346 CYS B O   1 
ATOM   6167 C  CB  . CYS B 1 346 ? -9.687  -29.653 -43.958 1.00 71.83  ? 346 CYS B CB  1 
ATOM   6168 S  SG  . CYS B 1 346 ? -9.190  -31.400 -43.952 1.00 67.83  ? 346 CYS B SG  1 
ATOM   6169 N  N   . GLY B 1 347 ? -12.288 -29.815 -45.545 1.00 68.88  ? 347 GLY B N   1 
ATOM   6170 C  CA  . GLY B 1 347 ? -13.187 -30.493 -46.456 1.00 68.55  ? 347 GLY B CA  1 
ATOM   6171 C  C   . GLY B 1 347 ? -12.617 -31.735 -47.122 1.00 66.75  ? 347 GLY B C   1 
ATOM   6172 O  O   . GLY B 1 347 ? -11.446 -32.092 -46.918 1.00 69.00  ? 347 GLY B O   1 
ATOM   6173 N  N   . GLY B 1 348 ? -13.449 -32.400 -47.920 1.00 78.19  ? 348 GLY B N   1 
ATOM   6174 C  CA  . GLY B 1 348 ? -13.058 -33.635 -48.578 1.00 73.76  ? 348 GLY B CA  1 
ATOM   6175 C  C   . GLY B 1 348 ? -12.147 -33.383 -49.763 1.00 71.48  ? 348 GLY B C   1 
ATOM   6176 O  O   . GLY B 1 348 ? -11.412 -34.275 -50.213 1.00 70.32  ? 348 GLY B O   1 
ATOM   6177 N  N   . SER B 1 349 ? -12.235 -32.168 -50.291 1.00 63.62  ? 349 SER B N   1 
ATOM   6178 C  CA  . SER B 1 349 ? -11.383 -31.721 -51.376 1.00 64.15  ? 349 SER B CA  1 
ATOM   6179 C  C   . SER B 1 349 ? -9.934  -31.870 -50.932 1.00 67.02  ? 349 SER B C   1 
ATOM   6180 O  O   . SER B 1 349 ? -9.087  -32.480 -51.619 1.00 67.41  ? 349 SER B O   1 
ATOM   6181 C  CB  . SER B 1 349 ? -11.688 -30.257 -51.653 1.00 61.85  ? 349 SER B CB  1 
ATOM   6182 O  OG  . SER B 1 349 ? -11.195 -29.867 -52.910 1.00 58.02  ? 349 SER B OG  1 
ATOM   6183 N  N   . ALA B 1 350 ? -9.673  -31.320 -49.752 1.00 75.34  ? 350 ALA B N   1 
ATOM   6184 C  CA  . ALA B 1 350 ? -8.373  -31.404 -49.122 1.00 77.24  ? 350 ALA B CA  1 
ATOM   6185 C  C   . ALA B 1 350 ? -7.968  -32.863 -49.003 1.00 77.46  ? 350 ALA B C   1 
ATOM   6186 O  O   . ALA B 1 350 ? -6.807  -33.224 -49.241 1.00 80.57  ? 350 ALA B O   1 
ATOM   6187 C  CB  . ALA B 1 350 ? -8.434  -30.776 -47.765 1.00 74.51  ? 350 ALA B CB  1 
ATOM   6188 N  N   . GLY B 1 351 ? -8.940  -33.697 -48.651 1.00 79.33  ? 351 GLY B N   1 
ATOM   6189 C  CA  . GLY B 1 351 ? -8.716  -35.122 -48.525 1.00 75.41  ? 351 GLY B CA  1 
ATOM   6190 C  C   . GLY B 1 351 ? -8.164  -35.685 -49.816 1.00 72.79  ? 351 GLY B C   1 
ATOM   6191 O  O   . GLY B 1 351 ? -7.167  -36.414 -49.798 1.00 72.89  ? 351 GLY B O   1 
ATOM   6192 N  N   . SER B 1 352 ? -8.797  -35.345 -50.936 1.00 71.93  ? 352 SER B N   1 
ATOM   6193 C  CA  . SER B 1 352 ? -8.304  -35.783 -52.237 1.00 70.86  ? 352 SER B CA  1 
ATOM   6194 C  C   . SER B 1 352 ? -6.878  -35.319 -52.411 1.00 71.03  ? 352 SER B C   1 
ATOM   6195 O  O   . SER B 1 352 ? -5.986  -36.114 -52.732 1.00 68.23  ? 352 SER B O   1 
ATOM   6196 C  CB  . SER B 1 352 ? -9.141  -35.187 -53.363 1.00 71.04  ? 352 SER B CB  1 
ATOM   6197 O  OG  . SER B 1 352 ? -10.512 -35.502 -53.207 1.00 73.33  ? 352 SER B OG  1 
ATOM   6198 N  N   . THR B 1 353 ? -6.660  -34.031 -52.175 1.00 56.59  ? 353 THR B N   1 
ATOM   6199 C  CA  . THR B 1 353 ? -5.348  -33.451 -52.420 1.00 60.55  ? 353 THR B CA  1 
ATOM   6200 C  C   . THR B 1 353 ? -4.229  -34.177 -51.670 1.00 60.25  ? 353 THR B C   1 
ATOM   6201 O  O   . THR B 1 353 ? -3.199  -34.513 -52.262 1.00 62.24  ? 353 THR B O   1 
ATOM   6202 C  CB  . THR B 1 353 ? -5.319  -31.965 -52.078 1.00 61.82  ? 353 THR B CB  1 
ATOM   6203 O  OG1 . THR B 1 353 ? -6.330  -31.293 -52.836 1.00 64.82  ? 353 THR B OG1 1 
ATOM   6204 C  CG2 . THR B 1 353 ? -3.987  -31.388 -52.452 1.00 64.90  ? 353 THR B CG2 1 
ATOM   6205 N  N   . VAL B 1 354 ? -4.423  -34.436 -50.382 1.00 62.35  ? 354 VAL B N   1 
ATOM   6206 C  CA  . VAL B 1 354 ? -3.405  -35.155 -49.624 1.00 61.01  ? 354 VAL B CA  1 
ATOM   6207 C  C   . VAL B 1 354 ? -3.290  -36.609 -50.066 1.00 60.94  ? 354 VAL B C   1 
ATOM   6208 O  O   . VAL B 1 354 ? -2.183  -37.160 -50.163 1.00 58.88  ? 354 VAL B O   1 
ATOM   6209 C  CB  . VAL B 1 354 ? -3.675  -35.083 -48.115 1.00 60.71  ? 354 VAL B CB  1 
ATOM   6210 C  CG1 . VAL B 1 354 ? -2.915  -36.171 -47.366 1.00 61.62  ? 354 VAL B CG1 1 
ATOM   6211 C  CG2 . VAL B 1 354 ? -3.304  -33.703 -47.600 1.00 61.92  ? 354 VAL B CG2 1 
ATOM   6212 N  N   . ALA B 1 355 ? -4.436  -37.223 -50.343 1.00 64.78  ? 355 ALA B N   1 
ATOM   6213 C  CA  . ALA B 1 355 ? -4.473  -38.593 -50.843 1.00 67.32  ? 355 ALA B CA  1 
ATOM   6214 C  C   . ALA B 1 355 ? -3.569  -38.736 -52.062 1.00 69.05  ? 355 ALA B C   1 
ATOM   6215 O  O   . ALA B 1 355 ? -2.939  -39.779 -52.270 1.00 70.85  ? 355 ALA B O   1 
ATOM   6216 C  CB  . ALA B 1 355 ? -5.886  -38.998 -51.194 1.00 64.19  ? 355 ALA B CB  1 
ATOM   6217 N  N   . VAL B 1 356 ? -3.527  -37.693 -52.881 1.00 88.09  ? 356 VAL B N   1 
ATOM   6218 C  CA  . VAL B 1 356 ? -2.596  -37.669 -53.994 1.00 87.14  ? 356 VAL B CA  1 
ATOM   6219 C  C   . VAL B 1 356 ? -1.176  -37.387 -53.512 1.00 92.46  ? 356 VAL B C   1 
ATOM   6220 O  O   . VAL B 1 356 ? -0.220  -38.044 -53.934 1.00 93.78  ? 356 VAL B O   1 
ATOM   6221 C  CB  . VAL B 1 356 ? -3.004  -36.622 -55.039 1.00 83.48  ? 356 VAL B CB  1 
ATOM   6222 C  CG1 . VAL B 1 356 ? -1.807  -36.192 -55.862 1.00 75.49  ? 356 VAL B CG1 1 
ATOM   6223 C  CG2 . VAL B 1 356 ? -4.100  -37.174 -55.930 1.00 76.18  ? 356 VAL B CG2 1 
ATOM   6224 N  N   . ALA B 1 357 ? -1.052  -36.414 -52.618 1.00 61.02  ? 357 ALA B N   1 
ATOM   6225 C  CA  . ALA B 1 357 ? 0.246   -35.978 -52.108 1.00 64.60  ? 357 ALA B CA  1 
ATOM   6226 C  C   . ALA B 1 357 ? 1.115   -37.127 -51.614 1.00 66.80  ? 357 ALA B C   1 
ATOM   6227 O  O   . ALA B 1 357 ? 2.312   -37.182 -51.912 1.00 65.78  ? 357 ALA B O   1 
ATOM   6228 C  CB  . ALA B 1 357 ? 0.065   -34.964 -51.008 1.00 66.23  ? 357 ALA B CB  1 
ATOM   6229 N  N   . VAL B 1 358 ? 0.524   -38.036 -50.846 1.00 71.10  ? 358 VAL B N   1 
ATOM   6230 C  CA  . VAL B 1 358 ? 1.297   -39.141 -50.279 1.00 73.27  ? 358 VAL B CA  1 
ATOM   6231 C  C   . VAL B 1 358 ? 1.872   -40.046 -51.356 1.00 73.67  ? 358 VAL B C   1 
ATOM   6232 O  O   . VAL B 1 358 ? 2.815   -40.800 -51.107 1.00 75.16  ? 358 VAL B O   1 
ATOM   6233 C  CB  . VAL B 1 358 ? 0.475   -39.992 -49.310 1.00 73.49  ? 358 VAL B CB  1 
ATOM   6234 C  CG1 . VAL B 1 358 ? 0.228   -39.223 -48.035 1.00 73.68  ? 358 VAL B CG1 1 
ATOM   6235 C  CG2 . VAL B 1 358 ? -0.835  -40.402 -49.963 1.00 73.67  ? 358 VAL B CG2 1 
ATOM   6236 N  N   . LYS B 1 359 ? 1.287   -39.977 -52.545 1.00 88.65  ? 359 LYS B N   1 
ATOM   6237 C  CA  . LYS B 1 359 ? 1.772   -40.722 -53.696 1.00 88.19  ? 359 LYS B CA  1 
ATOM   6238 C  C   . LYS B 1 359 ? 2.821   -39.914 -54.438 1.00 83.51  ? 359 LYS B C   1 
ATOM   6239 O  O   . LYS B 1 359 ? 3.970   -40.330 -54.566 1.00 83.82  ? 359 LYS B O   1 
ATOM   6240 C  CB  . LYS B 1 359 ? 0.618   -41.068 -54.634 1.00 92.07  ? 359 LYS B CB  1 
ATOM   6241 C  CG  . LYS B 1 359 ? -0.301  -42.146 -54.095 1.00 101.50 ? 359 LYS B CG  1 
ATOM   6242 C  CD  . LYS B 1 359 ? 0.473   -43.443 -53.880 1.00 111.09 ? 359 LYS B CD  1 
ATOM   6243 C  CE  . LYS B 1 359 ? -0.415  -44.546 -53.318 1.00 114.08 ? 359 LYS B CE  1 
ATOM   6244 N  NZ  . LYS B 1 359 ? -0.935  -44.231 -51.955 1.00 115.59 1 359 LYS B NZ  1 
ATOM   6245 N  N   . ALA B 1 360 ? 2.401   -38.769 -54.957 1.00 63.42  ? 360 ALA B N   1 
ATOM   6246 C  CA  . ALA B 1 360 ? 3.269   -37.912 -55.751 1.00 63.44  ? 360 ALA B CA  1 
ATOM   6247 C  C   . ALA B 1 360 ? 4.571   -37.499 -55.064 1.00 65.72  ? 360 ALA B C   1 
ATOM   6248 O  O   . ALA B 1 360 ? 5.584   -37.270 -55.735 1.00 61.56  ? 360 ALA B O   1 
ATOM   6249 C  CB  . ALA B 1 360 ? 2.513   -36.685 -56.208 1.00 66.37  ? 360 ALA B CB  1 
ATOM   6250 N  N   . ALA B 1 361 ? 4.555   -37.377 -53.741 1.00 72.27  ? 361 ALA B N   1 
ATOM   6251 C  CA  . ALA B 1 361 ? 5.742   -36.894 -53.035 1.00 78.98  ? 361 ALA B CA  1 
ATOM   6252 C  C   . ALA B 1 361 ? 6.758   -37.999 -52.733 1.00 81.34  ? 361 ALA B C   1 
ATOM   6253 O  O   . ALA B 1 361 ? 7.826   -37.732 -52.180 1.00 84.27  ? 361 ALA B O   1 
ATOM   6254 C  CB  . ALA B 1 361 ? 5.353   -36.165 -51.762 1.00 80.92  ? 361 ALA B CB  1 
ATOM   6255 N  N   . GLN B 1 362 ? 6.420   -39.231 -53.103 1.00 86.70  ? 362 GLN B N   1 
ATOM   6256 C  CA  . GLN B 1 362 ? 7.261   -40.390 -52.822 1.00 88.03  ? 362 GLN B CA  1 
ATOM   6257 C  C   . GLN B 1 362 ? 8.662   -40.280 -53.413 1.00 89.92  ? 362 GLN B C   1 
ATOM   6258 O  O   . GLN B 1 362 ? 9.638   -40.766 -52.831 1.00 85.44  ? 362 GLN B O   1 
ATOM   6259 C  CB  . GLN B 1 362 ? 6.603   -41.659 -53.352 1.00 89.54  ? 362 GLN B CB  1 
ATOM   6260 C  CG  . GLN B 1 362 ? 5.608   -42.279 -52.410 1.00 93.28  ? 362 GLN B CG  1 
ATOM   6261 C  CD  . GLN B 1 362 ? 6.279   -43.013 -51.267 1.00 96.32  ? 362 GLN B CD  1 
ATOM   6262 O  OE1 . GLN B 1 362 ? 7.510   -43.146 -51.227 1.00 96.97  ? 362 GLN B OE1 1 
ATOM   6263 N  NE2 . GLN B 1 362 ? 5.473   -43.497 -50.327 1.00 96.97  ? 362 GLN B NE2 1 
ATOM   6264 N  N   . GLU B 1 363 ? 8.754   -39.652 -54.580 1.00 117.04 ? 363 GLU B N   1 
ATOM   6265 C  CA  . GLU B 1 363 ? 10.021  -39.563 -55.288 1.00 123.60 ? 363 GLU B CA  1 
ATOM   6266 C  C   . GLU B 1 363 ? 10.978  -38.623 -54.574 1.00 122.30 ? 363 GLU B C   1 
ATOM   6267 O  O   . GLU B 1 363 ? 12.192  -38.695 -54.765 1.00 126.02 ? 363 GLU B O   1 
ATOM   6268 C  CB  . GLU B 1 363 ? 9.806   -39.111 -56.734 1.00 128.48 ? 363 GLU B CB  1 
ATOM   6269 C  CG  . GLU B 1 363 ? 9.210   -37.712 -56.881 1.00 134.52 ? 363 GLU B CG  1 
ATOM   6270 C  CD  . GLU B 1 363 ? 9.028   -37.303 -58.338 1.00 138.07 ? 363 GLU B CD  1 
ATOM   6271 O  OE1 . GLU B 1 363 ? 8.908   -38.199 -59.205 1.00 138.81 ? 363 GLU B OE1 1 
ATOM   6272 O  OE2 . GLU B 1 363 ? 9.007   -36.085 -58.619 1.00 138.78 1 363 GLU B OE2 1 
ATOM   6273 N  N   . LEU B 1 364 ? 10.429  -37.737 -53.752 1.00 108.12 ? 364 LEU B N   1 
ATOM   6274 C  CA  . LEU B 1 364 ? 11.249  -36.764 -53.050 1.00 101.23 ? 364 LEU B CA  1 
ATOM   6275 C  C   . LEU B 1 364 ? 12.089  -37.426 -51.976 1.00 102.25 ? 364 LEU B C   1 
ATOM   6276 O  O   . LEU B 1 364 ? 11.775  -38.522 -51.503 1.00 101.44 ? 364 LEU B O   1 
ATOM   6277 C  CB  . LEU B 1 364 ? 10.399  -35.669 -52.414 1.00 95.69  ? 364 LEU B CB  1 
ATOM   6278 C  CG  . LEU B 1 364 ? 9.909   -34.569 -53.342 1.00 86.95  ? 364 LEU B CG  1 
ATOM   6279 C  CD1 . LEU B 1 364 ? 8.730   -35.068 -54.132 1.00 79.11  ? 364 LEU B CD1 1 
ATOM   6280 C  CD2 . LEU B 1 364 ? 9.526   -33.351 -52.534 1.00 79.09  ? 364 LEU B CD2 1 
ATOM   6281 N  N   . GLN B 1 365 ? 13.158  -36.745 -51.587 1.00 89.42  ? 365 GLN B N   1 
ATOM   6282 C  CA  . GLN B 1 365 ? 14.027  -37.238 -50.538 1.00 93.56  ? 365 GLN B CA  1 
ATOM   6283 C  C   . GLN B 1 365 ? 14.106  -36.183 -49.455 1.00 93.60  ? 365 GLN B C   1 
ATOM   6284 O  O   . GLN B 1 365 ? 13.726  -35.024 -49.673 1.00 91.98  ? 365 GLN B O   1 
ATOM   6285 C  CB  . GLN B 1 365 ? 15.422  -37.564 -51.077 1.00 98.04  ? 365 GLN B CB  1 
ATOM   6286 C  CG  . GLN B 1 365 ? 16.058  -36.444 -51.890 1.00 104.76 ? 365 GLN B CG  1 
ATOM   6287 C  CD  . GLN B 1 365 ? 17.475  -36.774 -52.320 1.00 109.56 ? 365 GLN B CD  1 
ATOM   6288 O  OE1 . GLN B 1 365 ? 17.868  -37.942 -52.359 1.00 110.58 ? 365 GLN B OE1 1 
ATOM   6289 N  NE2 . GLN B 1 365 ? 18.256  -35.742 -52.628 1.00 110.55 ? 365 GLN B NE2 1 
ATOM   6290 N  N   . GLU B 1 366 ? 14.575  -36.594 -48.282 1.00 106.09 ? 366 GLU B N   1 
ATOM   6291 C  CA  . GLU B 1 366 ? 14.627  -35.709 -47.131 1.00 106.56 ? 366 GLU B CA  1 
ATOM   6292 C  C   . GLU B 1 366 ? 15.429  -34.448 -47.424 1.00 102.64 ? 366 GLU B C   1 
ATOM   6293 O  O   . GLU B 1 366 ? 16.438  -34.485 -48.135 1.00 104.95 ? 366 GLU B O   1 
ATOM   6294 C  CB  . GLU B 1 366 ? 15.179  -36.436 -45.909 1.00 110.71 ? 366 GLU B CB  1 
ATOM   6295 C  CG  . GLU B 1 366 ? 16.588  -36.967 -46.077 1.00 115.83 ? 366 GLU B CG  1 
ATOM   6296 C  CD  . GLU B 1 366 ? 17.126  -37.537 -44.783 1.00 119.13 ? 366 GLU B CD  1 
ATOM   6297 O  OE1 . GLU B 1 366 ? 16.309  -37.786 -43.869 1.00 119.79 ? 366 GLU B OE1 1 
ATOM   6298 O  OE2 . GLU B 1 366 ? 18.357  -37.723 -44.672 1.00 119.81 1 366 GLU B OE2 1 
ATOM   6299 N  N   . GLY B 1 367 ? 14.961  -33.330 -46.882 1.00 81.82  ? 367 GLY B N   1 
ATOM   6300 C  CA  . GLY B 1 367 ? 15.545  -32.038 -47.172 1.00 76.37  ? 367 GLY B CA  1 
ATOM   6301 C  C   . GLY B 1 367 ? 14.663  -31.263 -48.133 1.00 75.71  ? 367 GLY B C   1 
ATOM   6302 O  O   . GLY B 1 367 ? 14.767  -30.038 -48.239 1.00 72.29  ? 367 GLY B O   1 
ATOM   6303 N  N   . GLN B 1 368 ? 13.777  -31.972 -48.825 1.00 79.30  ? 368 GLN B N   1 
ATOM   6304 C  CA  . GLN B 1 368 ? 12.869  -31.323 -49.756 1.00 83.52  ? 368 GLN B CA  1 
ATOM   6305 C  C   . GLN B 1 368 ? 11.506  -31.126 -49.108 1.00 82.53  ? 368 GLN B C   1 
ATOM   6306 O  O   . GLN B 1 368 ? 11.280  -31.574 -47.982 1.00 83.17  ? 368 GLN B O   1 
ATOM   6307 C  CB  . GLN B 1 368 ? 12.732  -32.164 -51.016 1.00 87.59  ? 368 GLN B CB  1 
ATOM   6308 C  CG  . GLN B 1 368 ? 14.047  -32.381 -51.734 1.00 93.91  ? 368 GLN B CG  1 
ATOM   6309 C  CD  . GLN B 1 368 ? 13.879  -33.173 -53.011 1.00 98.21  ? 368 GLN B CD  1 
ATOM   6310 O  OE1 . GLN B 1 368 ? 13.762  -34.399 -52.984 1.00 99.09  ? 368 GLN B OE1 1 
ATOM   6311 N  NE2 . GLN B 1 368 ? 13.864  -32.474 -54.143 1.00 99.13  ? 368 GLN B NE2 1 
ATOM   6312 N  N   . ARG B 1 369 ? 10.582  -30.489 -49.822 1.00 85.72  ? 369 ARG B N   1 
ATOM   6313 C  CA  . ARG B 1 369 ? 9.268   -30.219 -49.250 1.00 82.92  ? 369 ARG B CA  1 
ATOM   6314 C  C   . ARG B 1 369 ? 8.177   -30.198 -50.299 1.00 80.17  ? 369 ARG B C   1 
ATOM   6315 O  O   . ARG B 1 369 ? 8.413   -29.851 -51.459 1.00 80.10  ? 369 ARG B O   1 
ATOM   6316 C  CB  . ARG B 1 369 ? 9.254   -28.898 -48.472 1.00 84.20  ? 369 ARG B CB  1 
ATOM   6317 C  CG  . ARG B 1 369 ? 9.361   -27.663 -49.353 1.00 84.99  ? 369 ARG B CG  1 
ATOM   6318 C  CD  . ARG B 1 369 ? 9.309   -26.388 -48.532 1.00 85.69  ? 369 ARG B CD  1 
ATOM   6319 N  NE  . ARG B 1 369 ? 10.266  -26.402 -47.428 1.00 85.82  ? 369 ARG B NE  1 
ATOM   6320 C  CZ  . ARG B 1 369 ? 10.514  -25.358 -46.642 1.00 85.86  ? 369 ARG B CZ  1 
ATOM   6321 N  NH1 . ARG B 1 369 ? 9.894   -24.202 -46.861 1.00 85.86  1 369 ARG B NH1 1 
ATOM   6322 N  NH2 . ARG B 1 369 ? 11.397  -25.457 -45.655 1.00 85.89  ? 369 ARG B NH2 1 
ATOM   6323 N  N   . CYS B 1 370 ? 6.975   -30.565 -49.872 1.00 73.01  ? 370 CYS B N   1 
ATOM   6324 C  CA  . CYS B 1 370 ? 5.814   -30.591 -50.742 1.00 68.56  ? 370 CYS B CA  1 
ATOM   6325 C  C   . CYS B 1 370 ? 4.669   -29.831 -50.105 1.00 65.35  ? 370 CYS B C   1 
ATOM   6326 O  O   . CYS B 1 370 ? 4.203   -30.195 -49.026 1.00 65.54  ? 370 CYS B O   1 
ATOM   6327 C  CB  . CYS B 1 370 ? 5.380   -32.029 -50.999 1.00 68.64  ? 370 CYS B CB  1 
ATOM   6328 S  SG  . CYS B 1 370 ? 3.787   -32.156 -51.839 1.00 68.09  ? 370 CYS B SG  1 
ATOM   6329 N  N   . VAL B 1 371 ? 4.205   -28.783 -50.770 1.00 70.93  ? 371 VAL B N   1 
ATOM   6330 C  CA  . VAL B 1 371 ? 3.124   -27.985 -50.227 1.00 67.77  ? 371 VAL B CA  1 
ATOM   6331 C  C   . VAL B 1 371 ? 1.793   -28.414 -50.816 1.00 63.78  ? 371 VAL B C   1 
ATOM   6332 O  O   . VAL B 1 371 ? 1.650   -28.534 -52.029 1.00 62.20  ? 371 VAL B O   1 
ATOM   6333 C  CB  . VAL B 1 371 ? 3.349   -26.497 -50.475 1.00 69.73  ? 371 VAL B CB  1 
ATOM   6334 C  CG1 . VAL B 1 371 ? 2.148   -25.699 -50.016 1.00 72.68  ? 371 VAL B CG1 1 
ATOM   6335 C  CG2 . VAL B 1 371 ? 4.573   -26.052 -49.734 1.00 72.23  ? 371 VAL B CG2 1 
ATOM   6336 N  N   . VAL B 1 372 ? 0.814   -28.624 -49.947 1.00 68.09  ? 372 VAL B N   1 
ATOM   6337 C  CA  . VAL B 1 372 ? -0.487  -29.113 -50.355 1.00 66.25  ? 372 VAL B CA  1 
ATOM   6338 C  C   . VAL B 1 372 ? -1.533  -28.054 -50.081 1.00 65.01  ? 372 VAL B C   1 
ATOM   6339 O  O   . VAL B 1 372 ? -1.496  -27.413 -49.027 1.00 64.91  ? 372 VAL B O   1 
ATOM   6340 C  CB  . VAL B 1 372 ? -0.826  -30.384 -49.569 1.00 66.10  ? 372 VAL B CB  1 
ATOM   6341 C  CG1 . VAL B 1 372 ? -2.310  -30.584 -49.462 1.00 66.65  ? 372 VAL B CG1 1 
ATOM   6342 C  CG2 . VAL B 1 372 ? -0.166  -31.576 -50.213 1.00 67.00  ? 372 VAL B CG2 1 
ATOM   6343 N  N   . ILE B 1 373 ? -2.467  -27.850 -51.007 1.00 65.02  ? 373 ILE B N   1 
ATOM   6344 C  CA  . ILE B 1 373 ? -3.513  -26.859 -50.738 1.00 64.16  ? 373 ILE B CA  1 
ATOM   6345 C  C   . ILE B 1 373 ? -4.803  -27.435 -50.156 1.00 64.41  ? 373 ILE B C   1 
ATOM   6346 O  O   . ILE B 1 373 ? -5.407  -28.328 -50.756 1.00 66.19  ? 373 ILE B O   1 
ATOM   6347 C  CB  . ILE B 1 373 ? -3.870  -26.052 -51.986 1.00 64.11  ? 373 ILE B CB  1 
ATOM   6348 C  CG1 . ILE B 1 373 ? -2.606  -25.457 -52.603 1.00 61.32  ? 373 ILE B CG1 1 
ATOM   6349 C  CG2 . ILE B 1 373 ? -4.820  -24.925 -51.613 1.00 60.92  ? 373 ILE B CG2 1 
ATOM   6350 C  CD1 . ILE B 1 373 ? -1.856  -24.576 -51.649 1.00 57.35  ? 373 ILE B CD1 1 
ATOM   6351 N  N   . LEU B 1 374 ? -5.216  -26.921 -48.994 1.00 71.60  ? 374 LEU B N   1 
ATOM   6352 C  CA  . LEU B 1 374 ? -6.478  -27.321 -48.368 1.00 69.09  ? 374 LEU B CA  1 
ATOM   6353 C  C   . LEU B 1 374 ? -7.553  -26.240 -48.517 1.00 69.50  ? 374 LEU B C   1 
ATOM   6354 O  O   . LEU B 1 374 ? -7.481  -25.187 -47.879 1.00 69.03  ? 374 LEU B O   1 
ATOM   6355 C  CB  . LEU B 1 374 ? -6.255  -27.595 -46.889 1.00 67.28  ? 374 LEU B CB  1 
ATOM   6356 C  CG  . LEU B 1 374 ? -5.032  -28.444 -46.570 1.00 63.09  ? 374 LEU B CG  1 
ATOM   6357 C  CD1 . LEU B 1 374 ? -4.922  -28.609 -45.074 1.00 61.18  ? 374 LEU B CD1 1 
ATOM   6358 C  CD2 . LEU B 1 374 ? -5.167  -29.796 -47.231 1.00 58.64  ? 374 LEU B CD2 1 
ATOM   6359 N  N   . PRO B 1 375 ? -8.540  -26.494 -49.388 1.00 77.52  ? 375 PRO B N   1 
ATOM   6360 C  CA  . PRO B 1 375 ? -9.597  -25.568 -49.832 1.00 77.69  ? 375 PRO B CA  1 
ATOM   6361 C  C   . PRO B 1 375 ? -10.676 -25.106 -48.833 1.00 77.37  ? 375 PRO B C   1 
ATOM   6362 O  O   . PRO B 1 375 ? -10.987 -23.912 -48.838 1.00 78.56  ? 375 PRO B O   1 
ATOM   6363 C  CB  . PRO B 1 375 ? -10.268 -26.334 -50.978 1.00 77.94  ? 375 PRO B CB  1 
ATOM   6364 C  CG  . PRO B 1 375 ? -9.266  -27.364 -51.388 1.00 77.43  ? 375 PRO B CG  1 
ATOM   6365 C  CD  . PRO B 1 375 ? -8.581  -27.761 -50.129 1.00 77.62  ? 375 PRO B CD  1 
ATOM   6366 N  N   . ASP B 1 376 ? -11.235 -25.992 -48.008 1.00 85.12  ? 376 ASP B N   1 
ATOM   6367 C  CA  . ASP B 1 376 ? -12.354 -25.579 -47.146 1.00 85.15  ? 376 ASP B CA  1 
ATOM   6368 C  C   . ASP B 1 376 ? -12.495 -26.382 -45.854 1.00 84.60  ? 376 ASP B C   1 
ATOM   6369 O  O   . ASP B 1 376 ? -11.753 -27.334 -45.616 1.00 82.54  ? 376 ASP B O   1 
ATOM   6370 C  CB  . ASP B 1 376 ? -13.681 -25.597 -47.917 1.00 85.85  ? 376 ASP B CB  1 
ATOM   6371 C  CG  . ASP B 1 376 ? -14.132 -27.013 -48.275 1.00 93.26  ? 376 ASP B CG  1 
ATOM   6372 O  OD1 . ASP B 1 376 ? -13.276 -27.932 -48.272 1.00 100.90 ? 376 ASP B OD1 1 
ATOM   6373 O  OD2 . ASP B 1 376 ? -15.334 -27.200 -48.577 1.00 100.88 1 376 ASP B OD2 1 
ATOM   6374 N  N   . SER B 1 377 ? -13.481 -26.012 -45.040 1.00 64.65  ? 377 SER B N   1 
ATOM   6375 C  CA  . SER B 1 377 ? -13.627 -26.589 -43.706 1.00 66.91  ? 377 SER B CA  1 
ATOM   6376 C  C   . SER B 1 377 ? -14.736 -27.617 -43.636 1.00 66.86  ? 377 SER B C   1 
ATOM   6377 O  O   . SER B 1 377 ? -15.463 -27.837 -44.601 1.00 68.96  ? 377 SER B O   1 
ATOM   6378 C  CB  . SER B 1 377 ? -13.918 -25.485 -42.691 1.00 67.54  ? 377 SER B CB  1 
ATOM   6379 O  OG  . SER B 1 377 ? -15.151 -24.865 -43.005 1.00 69.37  ? 377 SER B OG  1 
ATOM   6380 N  N   . VAL B 1 378 ? -14.890 -28.221 -42.466 1.00 53.65  ? 378 VAL B N   1 
ATOM   6381 C  CA  . VAL B 1 378 ? -15.906 -29.245 -42.266 1.00 51.90  ? 378 VAL B CA  1 
ATOM   6382 C  C   . VAL B 1 378 ? -17.303 -28.661 -42.156 1.00 55.19  ? 378 VAL B C   1 
ATOM   6383 O  O   . VAL B 1 378 ? -18.294 -29.391 -42.225 1.00 52.96  ? 378 VAL B O   1 
ATOM   6384 C  CB  . VAL B 1 378 ? -15.632 -30.065 -40.999 1.00 49.69  ? 378 VAL B CB  1 
ATOM   6385 C  CG1 . VAL B 1 378 ? -14.544 -31.072 -41.258 1.00 47.15  ? 378 VAL B CG1 1 
ATOM   6386 C  CG2 . VAL B 1 378 ? -15.261 -29.128 -39.840 1.00 45.00  ? 378 VAL B CG2 1 
ATOM   6387 N  N   . ARG B 1 379 ? -17.375 -27.349 -41.969 1.00 76.04  ? 379 ARG B N   1 
ATOM   6388 C  CA  . ARG B 1 379 ? -18.646 -26.668 -41.798 1.00 83.10  ? 379 ARG B CA  1 
ATOM   6389 C  C   . ARG B 1 379 ? -19.630 -26.987 -42.927 1.00 88.84  ? 379 ARG B C   1 
ATOM   6390 O  O   . ARG B 1 379 ? -20.840 -27.075 -42.703 1.00 91.45  ? 379 ARG B O   1 
ATOM   6391 C  CB  . ARG B 1 379 ? -18.419 -25.167 -41.683 1.00 81.18  ? 379 ARG B CB  1 
ATOM   6392 C  CG  . ARG B 1 379 ? -19.689 -24.371 -41.535 1.00 77.85  ? 379 ARG B CG  1 
ATOM   6393 C  CD  . ARG B 1 379 ? -19.392 -22.894 -41.359 1.00 73.98  ? 379 ARG B CD  1 
ATOM   6394 N  NE  . ARG B 1 379 ? -18.550 -22.371 -42.427 1.00 72.91  ? 379 ARG B NE  1 
ATOM   6395 C  CZ  . ARG B 1 379 ? -18.961 -22.208 -43.681 1.00 72.51  ? 379 ARG B CZ  1 
ATOM   6396 N  NH1 . ARG B 1 379 ? -20.205 -22.542 -44.025 1.00 72.36  1 379 ARG B NH1 1 
ATOM   6397 N  NH2 . ARG B 1 379 ? -18.129 -21.723 -44.597 1.00 72.42  ? 379 ARG B NH2 1 
ATOM   6398 N  N   . ASN B 1 380 ? -19.108 -27.163 -44.137 1.00 72.01  ? 380 ASN B N   1 
ATOM   6399 C  CA  . ASN B 1 380 ? -19.940 -27.472 -45.295 1.00 73.32  ? 380 ASN B CA  1 
ATOM   6400 C  C   . ASN B 1 380 ? -20.340 -28.931 -45.360 1.00 70.55  ? 380 ASN B C   1 
ATOM   6401 O  O   . ASN B 1 380 ? -21.387 -29.278 -45.896 1.00 75.19  ? 380 ASN B O   1 
ATOM   6402 C  CB  . ASN B 1 380 ? -19.197 -27.116 -46.570 1.00 74.15  ? 380 ASN B CB  1 
ATOM   6403 C  CG  . ASN B 1 380 ? -18.968 -25.638 -46.704 1.00 76.06  ? 380 ASN B CG  1 
ATOM   6404 O  OD1 . ASN B 1 380 ? -19.712 -24.830 -46.135 1.00 78.66  ? 380 ASN B OD1 1 
ATOM   6405 N  ND2 . ASN B 1 380 ? -17.932 -25.263 -47.451 1.00 77.14  ? 380 ASN B ND2 1 
ATOM   6406 N  N   . TYR B 1 381 ? -19.466 -29.788 -44.861 1.00 89.64  ? 381 TYR B N   1 
ATOM   6407 C  CA  . TYR B 1 381 ? -19.640 -31.231 -44.970 1.00 81.46  ? 381 TYR B CA  1 
ATOM   6408 C  C   . TYR B 1 381 ? -20.245 -31.940 -43.757 1.00 77.41  ? 381 TYR B C   1 
ATOM   6409 O  O   . TYR B 1 381 ? -20.295 -33.177 -43.731 1.00 74.71  ? 381 TYR B O   1 
ATOM   6410 C  CB  . TYR B 1 381 ? -18.347 -31.878 -45.443 1.00 80.48  ? 381 TYR B CB  1 
ATOM   6411 C  CG  . TYR B 1 381 ? -17.817 -31.194 -46.676 1.00 81.22  ? 381 TYR B CG  1 
ATOM   6412 C  CD1 . TYR B 1 381 ? -16.603 -30.534 -46.652 1.00 82.70  ? 381 TYR B CD1 1 
ATOM   6413 C  CD2 . TYR B 1 381 ? -18.580 -31.127 -47.837 1.00 83.66  ? 381 TYR B CD2 1 
ATOM   6414 C  CE1 . TYR B 1 381 ? -16.131 -29.882 -47.760 1.00 86.30  ? 381 TYR B CE1 1 
ATOM   6415 C  CE2 . TYR B 1 381 ? -18.110 -30.480 -48.961 1.00 86.93  ? 381 TYR B CE2 1 
ATOM   6416 C  CZ  . TYR B 1 381 ? -16.881 -29.856 -48.911 1.00 88.22  ? 381 TYR B CZ  1 
ATOM   6417 O  OH  . TYR B 1 381 ? -16.381 -29.198 -50.012 1.00 90.90  ? 381 TYR B OH  1 
ATOM   6418 N  N   . MET B 1 382 ? -20.687 -31.160 -42.767 1.00 70.75  ? 382 MET B N   1 
ATOM   6419 C  CA  . MET B 1 382 ? -21.014 -31.655 -41.421 1.00 70.81  ? 382 MET B CA  1 
ATOM   6420 C  C   . MET B 1 382 ? -21.834 -32.935 -41.374 1.00 71.94  ? 382 MET B C   1 
ATOM   6421 O  O   . MET B 1 382 ? -21.545 -33.841 -40.590 1.00 70.47  ? 382 MET B O   1 
ATOM   6422 C  CB  . MET B 1 382 ? -21.815 -30.591 -40.674 1.00 69.87  ? 382 MET B CB  1 
ATOM   6423 C  CG  . MET B 1 382 ? -21.034 -29.354 -40.305 1.00 70.86  ? 382 MET B CG  1 
ATOM   6424 S  SD  . MET B 1 382 ? -20.416 -29.419 -38.611 1.00 74.96  ? 382 MET B SD  1 
ATOM   6425 C  CE  . MET B 1 382 ? -18.902 -30.342 -38.828 1.00 73.43  ? 382 MET B CE  1 
ATOM   6426 N  N   . THR B 1 383 ? -22.864 -33.009 -42.203 1.00 82.44  ? 383 THR B N   1 
ATOM   6427 C  CA  . THR B 1 383 ? -23.756 -34.156 -42.178 1.00 85.37  ? 383 THR B CA  1 
ATOM   6428 C  C   . THR B 1 383 ? -23.355 -35.241 -43.167 1.00 88.86  ? 383 THR B C   1 
ATOM   6429 O  O   . THR B 1 383 ? -24.061 -36.250 -43.297 1.00 90.88  ? 383 THR B O   1 
ATOM   6430 C  CB  . THR B 1 383 ? -25.197 -33.735 -42.463 1.00 84.82  ? 383 THR B CB  1 
ATOM   6431 O  OG1 . THR B 1 383 ? -25.236 -33.045 -43.714 1.00 82.15  ? 383 THR B OG1 1 
ATOM   6432 C  CG2 . THR B 1 383 ? -25.684 -32.794 -41.384 1.00 80.55  ? 383 THR B CG2 1 
ATOM   6433 N  N   . LYS B 1 384 ? -22.234 -35.057 -43.866 1.00 90.31  ? 384 LYS B N   1 
ATOM   6434 C  CA  . LYS B 1 384 ? -21.902 -36.031 -44.894 1.00 89.70  ? 384 LYS B CA  1 
ATOM   6435 C  C   . LYS B 1 384 ? -20.752 -36.982 -44.579 1.00 91.10  ? 384 LYS B C   1 
ATOM   6436 O  O   . LYS B 1 384 ? -20.997 -38.089 -44.109 1.00 93.71  ? 384 LYS B O   1 
ATOM   6437 C  CB  . LYS B 1 384 ? -21.628 -35.299 -46.205 1.00 88.28  ? 384 LYS B CB  1 
ATOM   6438 C  CG  . LYS B 1 384 ? -22.714 -34.296 -46.542 1.00 78.45  ? 384 LYS B CG  1 
ATOM   6439 C  CD  . LYS B 1 384 ? -22.446 -33.606 -47.865 1.00 65.99  ? 384 LYS B CD  1 
ATOM   6440 C  CE  . LYS B 1 384 ? -23.092 -34.352 -49.021 1.00 59.20  ? 384 LYS B CE  1 
ATOM   6441 N  NZ  . LYS B 1 384 ? -23.133 -33.523 -50.271 1.00 53.92  1 384 LYS B NZ  1 
ATOM   6442 N  N   . PHE B 1 385 ? -19.504 -36.558 -44.723 1.00 77.14  ? 385 PHE B N   1 
ATOM   6443 C  CA  . PHE B 1 385 ? -18.443 -37.559 -44.589 1.00 76.72  ? 385 PHE B CA  1 
ATOM   6444 C  C   . PHE B 1 385 ? -17.968 -37.677 -43.161 1.00 82.13  ? 385 PHE B C   1 
ATOM   6445 O  O   . PHE B 1 385 ? -17.243 -38.607 -42.806 1.00 79.35  ? 385 PHE B O   1 
ATOM   6446 C  CB  . PHE B 1 385 ? -17.275 -37.321 -45.551 1.00 71.80  ? 385 PHE B CB  1 
ATOM   6447 C  CG  . PHE B 1 385 ? -16.353 -36.219 -45.136 1.00 63.92  ? 385 PHE B CG  1 
ATOM   6448 C  CD1 . PHE B 1 385 ? -15.298 -36.460 -44.261 1.00 59.16  ? 385 PHE B CD1 1 
ATOM   6449 C  CD2 . PHE B 1 385 ? -16.511 -34.944 -45.659 1.00 58.18  ? 385 PHE B CD2 1 
ATOM   6450 C  CE1 . PHE B 1 385 ? -14.445 -35.447 -43.887 1.00 57.91  ? 385 PHE B CE1 1 
ATOM   6451 C  CE2 . PHE B 1 385 ? -15.652 -33.926 -45.296 1.00 56.71  ? 385 PHE B CE2 1 
ATOM   6452 C  CZ  . PHE B 1 385 ? -14.620 -34.177 -44.405 1.00 57.15  ? 385 PHE B CZ  1 
ATOM   6453 N  N   . LEU B 1 386 ? -18.405 -36.728 -42.346 1.00 74.96  ? 386 LEU B N   1 
ATOM   6454 C  CA  . LEU B 1 386 ? -18.071 -36.709 -40.942 1.00 82.15  ? 386 LEU B CA  1 
ATOM   6455 C  C   . LEU B 1 386 ? -18.944 -37.723 -40.233 1.00 80.73  ? 386 LEU B C   1 
ATOM   6456 O  O   . LEU B 1 386 ? -18.521 -38.372 -39.282 1.00 86.09  ? 386 LEU B O   1 
ATOM   6457 C  CB  . LEU B 1 386 ? -18.314 -35.315 -40.388 1.00 87.53  ? 386 LEU B CB  1 
ATOM   6458 C  CG  . LEU B 1 386 ? -17.501 -34.970 -39.153 1.00 92.09  ? 386 LEU B CG  1 
ATOM   6459 C  CD1 . LEU B 1 386 ? -17.320 -33.474 -39.075 1.00 89.13  ? 386 LEU B CD1 1 
ATOM   6460 C  CD2 . LEU B 1 386 ? -18.217 -35.478 -37.925 1.00 92.87  ? 386 LEU B CD2 1 
ATOM   6461 N  N   . SER B 1 387 ? -20.173 -37.850 -40.707 1.00 76.07  ? 387 SER B N   1 
ATOM   6462 C  CA  . SER B 1 387 ? -21.106 -38.814 -40.157 1.00 69.33  ? 387 SER B CA  1 
ATOM   6463 C  C   . SER B 1 387 ? -20.785 -40.225 -40.616 1.00 66.41  ? 387 SER B C   1 
ATOM   6464 O  O   . SER B 1 387 ? -20.740 -40.497 -41.817 1.00 63.45  ? 387 SER B O   1 
ATOM   6465 C  CB  . SER B 1 387 ? -22.526 -38.478 -40.576 1.00 71.05  ? 387 SER B CB  1 
ATOM   6466 O  OG  . SER B 1 387 ? -23.335 -39.628 -40.432 1.00 71.20  ? 387 SER B OG  1 
ATOM   6467 N  N   . ASP B 1 388 ? -20.584 -41.125 -39.660 1.00 90.12  ? 388 ASP B N   1 
ATOM   6468 C  CA  . ASP B 1 388 ? -20.235 -42.504 -39.966 1.00 93.90  ? 388 ASP B CA  1 
ATOM   6469 C  C   . ASP B 1 388 ? -21.352 -43.229 -40.710 1.00 95.63  ? 388 ASP B C   1 
ATOM   6470 O  O   . ASP B 1 388 ? -21.084 -44.101 -41.539 1.00 94.66  ? 388 ASP B O   1 
ATOM   6471 C  CB  . ASP B 1 388 ? -19.891 -43.264 -38.685 1.00 94.85  ? 388 ASP B CB  1 
ATOM   6472 C  CG  . ASP B 1 388 ? -18.611 -42.763 -38.023 1.00 99.34  ? 388 ASP B CG  1 
ATOM   6473 O  OD1 . ASP B 1 388 ? -17.604 -43.507 -38.036 1.00 104.12 ? 388 ASP B OD1 1 
ATOM   6474 O  OD2 . ASP B 1 388 ? -18.613 -41.632 -37.482 1.00 104.12 1 388 ASP B OD2 1 
ATOM   6475 N  N   . ARG B 1 389 ? -22.600 -42.881 -40.415 1.00 94.42  ? 389 ARG B N   1 
ATOM   6476 C  CA  . ARG B 1 389 ? -23.724 -43.584 -41.024 1.00 97.60  ? 389 ARG B CA  1 
ATOM   6477 C  C   . ARG B 1 389 ? -23.850 -43.243 -42.497 1.00 94.17  ? 389 ARG B C   1 
ATOM   6478 O  O   . ARG B 1 389 ? -24.354 -44.040 -43.283 1.00 94.84  ? 389 ARG B O   1 
ATOM   6479 C  CB  . ARG B 1 389 ? -25.039 -43.304 -40.282 1.00 101.82 ? 389 ARG B CB  1 
ATOM   6480 C  CG  . ARG B 1 389 ? -25.512 -41.852 -40.318 1.00 113.74 ? 389 ARG B CG  1 
ATOM   6481 C  CD  . ARG B 1 389 ? -26.505 -41.602 -41.446 1.00 125.49 ? 389 ARG B CD  1 
ATOM   6482 N  NE  . ARG B 1 389 ? -26.623 -40.183 -41.774 1.00 129.26 ? 389 ARG B NE  1 
ATOM   6483 C  CZ  . ARG B 1 389 ? -27.165 -39.718 -42.896 1.00 130.80 ? 389 ARG B CZ  1 
ATOM   6484 N  NH1 . ARG B 1 389 ? -27.641 -40.562 -43.805 1.00 131.27 1 389 ARG B NH1 1 
ATOM   6485 N  NH2 . ARG B 1 389 ? -27.229 -38.410 -43.114 1.00 131.25 ? 389 ARG B NH2 1 
ATOM   6486 N  N   . TRP B 1 390 ? -23.388 -42.058 -42.867 1.00 104.70 ? 390 TRP B N   1 
ATOM   6487 C  CA  . TRP B 1 390 ? -23.424 -41.619 -44.251 1.00 99.44  ? 390 TRP B CA  1 
ATOM   6488 C  C   . TRP B 1 390 ? -22.304 -42.301 -45.021 1.00 97.87  ? 390 TRP B C   1 
ATOM   6489 O  O   . TRP B 1 390 ? -22.458 -42.644 -46.197 1.00 95.94  ? 390 TRP B O   1 
ATOM   6490 C  CB  . TRP B 1 390 ? -23.256 -40.109 -44.292 1.00 98.53  ? 390 TRP B CB  1 
ATOM   6491 C  CG  . TRP B 1 390 ? -23.292 -39.464 -45.640 1.00 93.96  ? 390 TRP B CG  1 
ATOM   6492 C  CD1 . TRP B 1 390 ? -24.371 -38.877 -46.230 1.00 91.99  ? 390 TRP B CD1 1 
ATOM   6493 C  CD2 . TRP B 1 390 ? -22.191 -39.277 -46.541 1.00 88.83  ? 390 TRP B CD2 1 
ATOM   6494 N  NE1 . TRP B 1 390 ? -24.020 -38.354 -47.450 1.00 89.03  ? 390 TRP B NE1 1 
ATOM   6495 C  CE2 . TRP B 1 390 ? -22.686 -38.585 -47.666 1.00 87.49  ? 390 TRP B CE2 1 
ATOM   6496 C  CE3 . TRP B 1 390 ? -20.835 -39.641 -46.513 1.00 86.47  ? 390 TRP B CE3 1 
ATOM   6497 C  CZ2 . TRP B 1 390 ? -21.881 -38.249 -48.749 1.00 85.28  ? 390 TRP B CZ2 1 
ATOM   6498 C  CZ3 . TRP B 1 390 ? -20.037 -39.300 -47.581 1.00 84.87  ? 390 TRP B CZ3 1 
ATOM   6499 C  CH2 . TRP B 1 390 ? -20.562 -38.614 -48.689 1.00 84.69  ? 390 TRP B CH2 1 
ATOM   6500 N  N   . MET B 1 391 ? -21.179 -42.494 -44.344 1.00 93.35  ? 391 MET B N   1 
ATOM   6501 C  CA  . MET B 1 391 ? -20.032 -43.159 -44.935 1.00 94.73  ? 391 MET B CA  1 
ATOM   6502 C  C   . MET B 1 391 ? -20.328 -44.641 -45.129 1.00 98.05  ? 391 MET B C   1 
ATOM   6503 O  O   . MET B 1 391 ? -19.837 -45.265 -46.069 1.00 96.83  ? 391 MET B O   1 
ATOM   6504 C  CB  . MET B 1 391 ? -18.808 -42.991 -44.046 1.00 92.90  ? 391 MET B CB  1 
ATOM   6505 C  CG  . MET B 1 391 ? -18.330 -41.557 -43.887 1.00 90.37  ? 391 MET B CG  1 
ATOM   6506 S  SD  . MET B 1 391 ? -17.317 -40.996 -45.268 1.00 88.92  ? 391 MET B SD  1 
ATOM   6507 C  CE  . MET B 1 391 ? -16.039 -42.247 -45.224 1.00 83.07  ? 391 MET B CE  1 
ATOM   6508 N  N   . LEU B 1 392 ? -21.119 -45.206 -44.227 1.00 103.63 ? 392 LEU B N   1 
ATOM   6509 C  CA  . LEU B 1 392 ? -21.541 -46.596 -44.354 1.00 109.58 ? 392 LEU B CA  1 
ATOM   6510 C  C   . LEU B 1 392 ? -22.608 -46.731 -45.423 1.00 110.43 ? 392 LEU B C   1 
ATOM   6511 O  O   . LEU B 1 392 ? -22.625 -47.698 -46.187 1.00 111.31 ? 392 LEU B O   1 
ATOM   6512 C  CB  . LEU B 1 392 ? -22.085 -47.112 -43.030 1.00 112.56 ? 392 LEU B CB  1 
ATOM   6513 C  CG  . LEU B 1 392 ? -21.008 -47.451 -42.010 1.00 118.78 ? 392 LEU B CG  1 
ATOM   6514 C  CD1 . LEU B 1 392 ? -21.625 -47.524 -40.634 1.00 120.00 ? 392 LEU B CD1 1 
ATOM   6515 C  CD2 . LEU B 1 392 ? -20.361 -48.775 -42.381 1.00 125.28 ? 392 LEU B CD2 1 
ATOM   6516 N  N   . GLN B 1 393 ? -23.519 -45.770 -45.441 1.00 118.43 ? 393 GLN B N   1 
ATOM   6517 C  CA  . GLN B 1 393 ? -24.614 -45.760 -46.394 1.00 119.23 ? 393 GLN B CA  1 
ATOM   6518 C  C   . GLN B 1 393 ? -24.079 -45.690 -47.817 1.00 118.33 ? 393 GLN B C   1 
ATOM   6519 O  O   . GLN B 1 393 ? -24.636 -46.299 -48.732 1.00 117.79 ? 393 GLN B O   1 
ATOM   6520 C  CB  . GLN B 1 393 ? -25.523 -44.561 -46.126 1.00 120.24 ? 393 GLN B CB  1 
ATOM   6521 C  CG  . GLN B 1 393 ? -26.646 -44.377 -47.125 1.00 126.14 ? 393 GLN B CG  1 
ATOM   6522 C  CD  . GLN B 1 393 ? -27.321 -43.030 -46.974 1.00 132.78 ? 393 GLN B CD  1 
ATOM   6523 O  OE1 . GLN B 1 393 ? -27.351 -42.455 -45.882 1.00 134.93 ? 393 GLN B OE1 1 
ATOM   6524 N  NE2 . GLN B 1 393 ? -27.855 -42.509 -48.075 1.00 134.93 ? 393 GLN B NE2 1 
ATOM   6525 N  N   . LYS B 1 394 ? -22.985 -44.959 -47.997 1.00 97.06  ? 394 LYS B N   1 
ATOM   6526 C  CA  . LYS B 1 394 ? -22.441 -44.722 -49.327 1.00 97.78  ? 394 LYS B CA  1 
ATOM   6527 C  C   . LYS B 1 394 ? -21.388 -45.746 -49.727 1.00 99.22  ? 394 LYS B C   1 
ATOM   6528 O  O   . LYS B 1 394 ? -20.853 -45.692 -50.835 1.00 98.85  ? 394 LYS B O   1 
ATOM   6529 C  CB  . LYS B 1 394 ? -21.856 -43.316 -49.415 1.00 96.98  ? 394 LYS B CB  1 
ATOM   6530 C  CG  . LYS B 1 394 ? -22.901 -42.235 -49.449 1.00 95.96  ? 394 LYS B CG  1 
ATOM   6531 C  CD  . LYS B 1 394 ? -23.587 -42.215 -50.792 1.00 93.82  ? 394 LYS B CD  1 
ATOM   6532 C  CE  . LYS B 1 394 ? -24.912 -41.494 -50.692 1.00 94.37  ? 394 LYS B CE  1 
ATOM   6533 N  NZ  . LYS B 1 394 ? -24.727 -40.063 -50.310 1.00 93.97  1 394 LYS B NZ  1 
ATOM   6534 N  N   . GLY B 1 395 ? -21.079 -46.665 -48.822 1.00 95.47  ? 395 GLY B N   1 
ATOM   6535 C  CA  . GLY B 1 395 ? -20.166 -47.746 -49.137 1.00 97.70  ? 395 GLY B CA  1 
ATOM   6536 C  C   . GLY B 1 395 ? -18.704 -47.345 -49.093 1.00 98.49  ? 395 GLY B C   1 
ATOM   6537 O  O   . GLY B 1 395 ? -17.863 -47.974 -49.733 1.00 99.49  ? 395 GLY B O   1 
ATOM   6538 N  N   . PHE B 1 396 ? -18.387 -46.307 -48.328 1.00 99.03  ? 396 PHE B N   1 
ATOM   6539 C  CA  . PHE B 1 396 ? -16.999 -45.906 -48.161 1.00 98.22  ? 396 PHE B CA  1 
ATOM   6540 C  C   . PHE B 1 396 ? -16.415 -46.564 -46.924 1.00 101.51 ? 396 PHE B C   1 
ATOM   6541 O  O   . PHE B 1 396 ? -15.228 -46.405 -46.624 1.00 102.12 ? 396 PHE B O   1 
ATOM   6542 C  CB  . PHE B 1 396 ? -16.886 -44.395 -48.036 1.00 94.94  ? 396 PHE B CB  1 
ATOM   6543 C  CG  . PHE B 1 396 ? -17.405 -43.654 -49.218 1.00 85.17  ? 396 PHE B CG  1 
ATOM   6544 C  CD1 . PHE B 1 396 ? -17.080 -44.060 -50.502 1.00 76.23  ? 396 PHE B CD1 1 
ATOM   6545 C  CD2 . PHE B 1 396 ? -18.226 -42.554 -49.050 1.00 77.40  ? 396 PHE B CD2 1 
ATOM   6546 C  CE1 . PHE B 1 396 ? -17.557 -43.372 -51.595 1.00 71.79  ? 396 PHE B CE1 1 
ATOM   6547 C  CE2 . PHE B 1 396 ? -18.708 -41.864 -50.137 1.00 73.88  ? 396 PHE B CE2 1 
ATOM   6548 C  CZ  . PHE B 1 396 ? -18.373 -42.273 -51.411 1.00 71.31  ? 396 PHE B CZ  1 
ATOM   6549 N  N   . LEU B 1 397 ? -17.256 -47.301 -46.206 1.00 126.62 ? 397 LEU B N   1 
ATOM   6550 C  CA  . LEU B 1 397 ? -16.822 -48.001 -45.008 1.00 131.20 ? 397 LEU B CA  1 
ATOM   6551 C  C   . LEU B 1 397 ? -17.380 -49.411 -44.952 1.00 140.41 ? 397 LEU B C   1 
ATOM   6552 O  O   . LEU B 1 397 ? -18.595 -49.607 -45.019 1.00 139.00 ? 397 LEU B O   1 
ATOM   6553 C  CB  . LEU B 1 397 ? -17.255 -47.235 -43.762 1.00 125.78 ? 397 LEU B CB  1 
ATOM   6554 C  CG  . LEU B 1 397 ? -16.475 -45.962 -43.456 1.00 115.22 ? 397 LEU B CG  1 
ATOM   6555 C  CD1 . LEU B 1 397 ? -16.979 -45.358 -42.163 1.00 106.05 ? 397 LEU B CD1 1 
ATOM   6556 C  CD2 . LEU B 1 397 ? -15.007 -46.290 -43.333 1.00 106.08 ? 397 LEU B CD2 1 
ATOM   6557 N  N   . LYS B 1 398 ? -16.493 -50.391 -44.825 1.00 161.77 ? 398 LYS B N   1 
ATOM   6558 C  CA  . LYS B 1 398 ? -16.912 -51.763 -44.604 1.00 169.52 ? 398 LYS B CA  1 
ATOM   6559 C  C   . LYS B 1 398 ? -17.015 -51.991 -43.107 1.00 169.28 ? 398 LYS B C   1 
ATOM   6560 O  O   . LYS B 1 398 ? -16.078 -51.687 -42.366 1.00 174.74 ? 398 LYS B O   1 
ATOM   6561 C  CB  . LYS B 1 398 ? -15.908 -52.737 -45.216 1.00 176.27 ? 398 LYS B CB  1 
ATOM   6562 N  N   . GLU B 1 399 ? -18.154 -52.516 -42.662 1.00 132.16 ? 399 GLU B N   1 
ATOM   6563 C  CA  . GLU B 1 399 ? -18.388 -52.756 -41.241 1.00 127.69 ? 399 GLU B CA  1 
ATOM   6564 C  C   . GLU B 1 399 ? -17.284 -53.604 -40.620 1.00 127.92 ? 399 GLU B C   1 
ATOM   6565 O  O   . GLU B 1 399 ? -16.976 -53.457 -39.438 1.00 125.09 ? 399 GLU B O   1 
ATOM   6566 C  CB  . GLU B 1 399 ? -19.742 -53.432 -41.026 1.00 123.79 ? 399 GLU B CB  1 
ATOM   6567 N  N   . GLU B 1 400 ? -16.695 -54.484 -41.426 1.00 162.59 ? 400 GLU B N   1 
ATOM   6568 C  CA  . GLU B 1 400 ? -15.614 -55.349 -40.974 1.00 166.65 ? 400 GLU B CA  1 
ATOM   6569 C  C   . GLU B 1 400 ? -14.471 -54.525 -40.390 1.00 172.92 ? 400 GLU B C   1 
ATOM   6570 O  O   . GLU B 1 400 ? -13.903 -54.874 -39.350 1.00 180.53 ? 400 GLU B O   1 
ATOM   6571 C  CB  . GLU B 1 400 ? -15.113 -56.203 -42.121 1.00 129.50 ? 400 GLU B CB  1 
ATOM   6572 N  N   . ASP B 1 401 ? -14.150 -53.422 -41.057 1.00 171.63 ? 401 ASP B N   1 
ATOM   6573 C  CA  . ASP B 1 401 ? -13.071 -52.549 -40.614 1.00 171.52 ? 401 ASP B CA  1 
ATOM   6574 C  C   . ASP B 1 401 ? -13.421 -51.883 -39.286 1.00 173.35 ? 401 ASP B C   1 
ATOM   6575 O  O   . ASP B 1 401 ? -12.573 -51.768 -38.397 1.00 178.47 ? 401 ASP B O   1 
ATOM   6576 C  CB  . ASP B 1 401 ? -12.771 -51.502 -41.671 1.00 150.48 ? 401 ASP B CB  1 
ATOM   6577 N  N   . LEU B 1 402 ? -14.671 -51.449 -39.155 1.00 170.33 ? 402 LEU B N   1 
ATOM   6578 C  CA  . LEU B 1 402 ? -15.132 -50.813 -37.927 1.00 166.97 ? 402 LEU B CA  1 
ATOM   6579 C  C   . LEU B 1 402 ? -15.069 -51.795 -36.761 1.00 170.25 ? 402 LEU B C   1 
ATOM   6580 O  O   . LEU B 1 402 ? -14.694 -51.429 -35.646 1.00 176.76 ? 402 LEU B O   1 
ATOM   6581 C  CB  . LEU B 1 402 ? -16.542 -50.282 -38.099 1.00 129.37 ? 402 LEU B CB  1 
ATOM   6582 N  N   . THR B 1 403 ? -15.434 -53.045 -37.032 1.00 182.07 ? 403 THR B N   1 
ATOM   6583 C  CA  . THR B 1 403 ? -15.384 -54.104 -36.033 1.00 181.03 ? 403 THR B CA  1 
ATOM   6584 C  C   . THR B 1 403 ? -13.939 -54.453 -35.687 1.00 183.03 ? 403 THR B C   1 
ATOM   6585 O  O   . THR B 1 403 ? -13.651 -54.919 -34.582 1.00 187.98 ? 403 THR B O   1 
ATOM   6586 C  CB  . THR B 1 403 ? -16.126 -55.335 -36.531 1.00 155.85 ? 403 THR B CB  1 
ATOM   6587 N  N   . GLU B 1 404 ? -13.036 -54.236 -36.640 1.00 156.78 ? 404 GLU B N   1 
ATOM   6588 C  CA  . GLU B 1 404 ? -11.615 -54.475 -36.410 1.00 154.18 ? 404 GLU B CA  1 
ATOM   6589 C  C   . GLU B 1 404 ? -11.015 -53.390 -35.520 1.00 155.69 ? 404 GLU B C   1 
ATOM   6590 O  O   . GLU B 1 404 ? -10.208 -53.676 -34.636 1.00 160.10 ? 404 GLU B O   1 
ATOM   6591 C  CB  . GLU B 1 404 ? -10.866 -54.549 -37.729 1.00 131.88 ? 404 GLU B CB  1 
ATOM   6592 N  N   . LYS B 1 405 ? -11.410 -52.144 -35.758 1.00 130.92 ? 405 LYS B N   1 
ATOM   6593 C  CA  . LYS B 1 405 ? -10.863 -51.019 -35.007 1.00 131.28 ? 405 LYS B CA  1 
ATOM   6594 C  C   . LYS B 1 405 ? -11.317 -51.023 -33.550 1.00 131.60 ? 405 LYS B C   1 
ATOM   6595 O  O   . LYS B 1 405 ? -10.601 -50.556 -32.663 1.00 131.60 ? 405 LYS B O   1 
ATOM   6596 C  CB  . LYS B 1 405 ? -11.240 -49.708 -35.671 1.00 131.48 ? 405 LYS B CB  1 
ATOM   6597 N  N   . LYS B 1 406 ? -12.508 -51.558 -33.312 1.00 142.38 ? 406 LYS B N   1 
ATOM   6598 C  CA  . LYS B 1 406 ? -13.149 -51.477 -32.005 1.00 143.57 ? 406 LYS B CA  1 
ATOM   6599 C  C   . LYS B 1 406 ? -12.442 -52.284 -30.917 1.00 142.35 ? 406 LYS B C   1 
ATOM   6600 O  O   . LYS B 1 406 ? -11.817 -53.310 -31.197 1.00 144.38 ? 406 LYS B O   1 
ATOM   6601 C  CB  . LYS B 1 406 ? -14.602 -51.897 -32.117 1.00 145.91 ? 406 LYS B CB  1 
ATOM   6602 N  N   . PRO B 1 407 ? -12.549 -51.819 -29.661 1.00 119.14 ? 407 PRO B N   1 
ATOM   6603 C  CA  . PRO B 1 407 ? -12.039 -52.528 -28.483 1.00 117.09 ? 407 PRO B CA  1 
ATOM   6604 C  C   . PRO B 1 407 ? -12.777 -53.838 -28.245 1.00 113.66 ? 407 PRO B C   1 
ATOM   6605 O  O   . PRO B 1 407 ? -13.847 -54.065 -28.815 1.00 115.57 ? 407 PRO B O   1 
ATOM   6606 C  CB  . PRO B 1 407 ? -12.324 -51.556 -27.336 1.00 118.47 ? 407 PRO B CB  1 
ATOM   6607 C  CG  . PRO B 1 407 ? -12.380 -50.228 -27.986 1.00 119.31 ? 407 PRO B CG  1 
ATOM   6608 C  CD  . PRO B 1 407 ? -13.010 -50.463 -29.322 1.00 119.38 ? 407 PRO B CD  1 
ATOM   6609 N  N   . TRP B 1 408 ? -12.187 -54.692 -27.416 1.00 130.72 ? 408 TRP B N   1 
ATOM   6610 C  CA  . TRP B 1 408 ? -12.671 -56.053 -27.211 1.00 124.24 ? 408 TRP B CA  1 
ATOM   6611 C  C   . TRP B 1 408 ? -14.125 -56.177 -26.745 1.00 119.95 ? 408 TRP B C   1 
ATOM   6612 O  O   . TRP B 1 408 ? -14.833 -57.098 -27.162 1.00 120.04 ? 408 TRP B O   1 
ATOM   6613 C  CB  . TRP B 1 408 ? -11.752 -56.780 -26.235 1.00 123.97 ? 408 TRP B CB  1 
ATOM   6614 C  CG  . TRP B 1 408 ? -11.710 -56.158 -24.887 1.00 124.27 ? 408 TRP B CG  1 
ATOM   6615 C  CD1 . TRP B 1 408 ? -10.919 -55.120 -24.483 1.00 124.63 ? 408 TRP B CD1 1 
ATOM   6616 C  CD2 . TRP B 1 408 ? -12.471 -56.552 -23.744 1.00 124.66 ? 408 TRP B CD2 1 
ATOM   6617 N  NE1 . TRP B 1 408 ? -11.153 -54.835 -23.159 1.00 124.74 ? 408 TRP B NE1 1 
ATOM   6618 C  CE2 . TRP B 1 408 ? -12.101 -55.703 -22.681 1.00 124.75 ? 408 TRP B CE2 1 
ATOM   6619 C  CE3 . TRP B 1 408 ? -13.436 -57.540 -23.516 1.00 124.76 ? 408 TRP B CE3 1 
ATOM   6620 C  CZ2 . TRP B 1 408 ? -12.661 -55.810 -21.414 1.00 124.81 ? 408 TRP B CZ2 1 
ATOM   6621 C  CZ3 . TRP B 1 408 ? -13.989 -57.645 -22.260 1.00 124.81 ? 408 TRP B CZ3 1 
ATOM   6622 C  CH2 . TRP B 1 408 ? -13.602 -56.785 -21.224 1.00 124.83 ? 408 TRP B CH2 1 
ATOM   6623 N  N   . TRP B 1 409 ? -14.572 -55.268 -25.880 1.00 106.11 ? 409 TRP B N   1 
ATOM   6624 C  CA  . TRP B 1 409 ? -15.911 -55.380 -25.304 1.00 102.35 ? 409 TRP B CA  1 
ATOM   6625 C  C   . TRP B 1 409 ? -17.002 -55.024 -26.306 1.00 100.27 ? 409 TRP B C   1 
ATOM   6626 O  O   . TRP B 1 409 ? -18.189 -55.232 -26.034 1.00 101.06 ? 409 TRP B O   1 
ATOM   6627 C  CB  . TRP B 1 409 ? -16.053 -54.513 -24.050 1.00 101.37 ? 409 TRP B CB  1 
ATOM   6628 C  CG  . TRP B 1 409 ? -16.273 -53.052 -24.315 1.00 99.54  ? 409 TRP B CG  1 
ATOM   6629 C  CD1 . TRP B 1 409 ? -17.427 -52.450 -24.754 1.00 98.62  ? 409 TRP B CD1 1 
ATOM   6630 C  CD2 . TRP B 1 409 ? -15.328 -52.003 -24.126 1.00 98.11  ? 409 TRP B CD2 1 
ATOM   6631 N  NE1 . TRP B 1 409 ? -17.246 -51.095 -24.863 1.00 97.97  ? 409 TRP B NE1 1 
ATOM   6632 C  CE2 . TRP B 1 409 ? -15.961 -50.791 -24.478 1.00 97.42  ? 409 TRP B CE2 1 
ATOM   6633 C  CE3 . TRP B 1 409 ? -13.995 -51.965 -23.696 1.00 97.70  ? 409 TRP B CE3 1 
ATOM   6634 C  CZ2 . TRP B 1 409 ? -15.318 -49.563 -24.416 1.00 95.45  ? 409 TRP B CZ2 1 
ATOM   6635 C  CZ3 . TRP B 1 409 ? -13.355 -50.747 -23.632 1.00 96.92  ? 409 TRP B CZ3 1 
ATOM   6636 C  CH2 . TRP B 1 409 ? -14.016 -49.560 -23.991 1.00 94.73  ? 409 TRP B CH2 1 
ATOM   6637 N  N   . TRP B 1 410 ? -16.593 -54.462 -27.441 1.00 111.78 ? 410 TRP B N   1 
ATOM   6638 C  CA  . TRP B 1 410 ? -17.521 -53.856 -28.386 1.00 110.57 ? 410 TRP B CA  1 
ATOM   6639 C  C   . TRP B 1 410 ? -18.684 -54.756 -28.762 1.00 115.16 ? 410 TRP B C   1 
ATOM   6640 O  O   . TRP B 1 410 ? -19.830 -54.306 -28.794 1.00 113.18 ? 410 TRP B O   1 
ATOM   6641 C  CB  . TRP B 1 410 ? -16.799 -53.400 -29.643 1.00 106.05 ? 410 TRP B CB  1 
ATOM   6642 C  CG  . TRP B 1 410 ? -17.534 -52.338 -30.347 1.00 97.45  ? 410 TRP B CG  1 
ATOM   6643 C  CD1 . TRP B 1 410 ? -18.216 -52.447 -31.522 1.00 92.22  ? 410 TRP B CD1 1 
ATOM   6644 C  CD2 . TRP B 1 410 ? -17.693 -50.988 -29.908 1.00 91.81  ? 410 TRP B CD2 1 
ATOM   6645 N  NE1 . TRP B 1 410 ? -18.777 -51.237 -31.854 1.00 90.69  ? 410 TRP B NE1 1 
ATOM   6646 C  CE2 . TRP B 1 410 ? -18.472 -50.325 -30.878 1.00 90.54  ? 410 TRP B CE2 1 
ATOM   6647 C  CE3 . TRP B 1 410 ? -17.244 -50.272 -28.791 1.00 90.41  ? 410 TRP B CE3 1 
ATOM   6648 C  CZ2 . TRP B 1 410 ? -18.815 -48.979 -30.765 1.00 89.82  ? 410 TRP B CZ2 1 
ATOM   6649 C  CZ3 . TRP B 1 410 ? -17.581 -48.940 -28.681 1.00 89.73  ? 410 TRP B CZ3 1 
ATOM   6650 C  CH2 . TRP B 1 410 ? -18.361 -48.304 -29.663 1.00 89.62  ? 410 TRP B CH2 1 
ATOM   6651 N  N   . HIS B 1 411 ? -18.404 -56.024 -29.048 1.00 145.78 ? 411 HIS B N   1 
ATOM   6652 C  CA  . HIS B 1 411 ? -19.496 -56.967 -29.185 1.00 152.00 ? 411 HIS B CA  1 
ATOM   6653 C  C   . HIS B 1 411 ? -19.557 -57.787 -27.920 1.00 149.59 ? 411 HIS B C   1 
ATOM   6654 O  O   . HIS B 1 411 ? -18.734 -58.674 -27.694 1.00 152.85 ? 411 HIS B O   1 
ATOM   6655 C  CB  . HIS B 1 411 ? -19.291 -57.883 -30.389 1.00 157.57 ? 411 HIS B CB  1 
ATOM   6656 C  CG  . HIS B 1 411 ? -19.486 -57.202 -31.706 1.00 166.58 ? 411 HIS B CG  1 
ATOM   6657 N  ND1 . HIS B 1 411 ? -18.479 -56.515 -32.344 1.00 172.03 ? 411 HIS B ND1 1 
ATOM   6658 C  CD2 . HIS B 1 411 ? -20.578 -57.100 -32.500 1.00 172.02 ? 411 HIS B CD2 1 
ATOM   6659 C  CE1 . HIS B 1 411 ? -18.940 -56.018 -33.480 1.00 173.42 ? 411 HIS B CE1 1 
ATOM   6660 N  NE2 . HIS B 1 411 ? -20.209 -56.359 -33.597 1.00 173.41 ? 411 HIS B NE2 1 
ATOM   6661 N  N   . LEU B 1 412 ? -20.557 -57.475 -27.107 1.00 112.79 ? 412 LEU B N   1 
ATOM   6662 C  CA  . LEU B 1 412 ? -20.923 -58.256 -25.944 1.00 107.02 ? 412 LEU B CA  1 
ATOM   6663 C  C   . LEU B 1 412 ? -22.339 -57.853 -25.627 1.00 111.61 ? 412 LEU B C   1 
ATOM   6664 O  O   . LEU B 1 412 ? -22.772 -56.762 -25.995 1.00 108.34 ? 412 LEU B O   1 
ATOM   6665 C  CB  . LEU B 1 412 ? -20.014 -57.927 -24.765 1.00 99.47  ? 412 LEU B CB  1 
ATOM   6666 C  CG  . LEU B 1 412 ? -18.827 -58.872 -24.585 1.00 86.17  ? 412 LEU B CG  1 
ATOM   6667 C  CD1 . LEU B 1 412 ? -17.784 -58.268 -23.662 1.00 75.43  ? 412 LEU B CD1 1 
ATOM   6668 C  CD2 . LEU B 1 412 ? -19.331 -60.198 -24.032 1.00 75.80  ? 412 LEU B CD2 1 
ATOM   6669 N  N   . ARG B 1 413 ? -23.062 -58.710 -24.925 1.00 167.53 ? 413 ARG B N   1 
ATOM   6670 C  CA  . ARG B 1 413 ? -24.414 -58.367 -24.537 1.00 175.36 ? 413 ARG B CA  1 
ATOM   6671 C  C   . ARG B 1 413 ? -24.438 -57.454 -23.325 1.00 178.80 ? 413 ARG B C   1 
ATOM   6672 O  O   . ARG B 1 413 ? -23.502 -57.437 -22.523 1.00 179.18 ? 413 ARG B O   1 
ATOM   6673 C  CB  . ARG B 1 413 ? -25.248 -59.622 -24.307 1.00 176.14 ? 413 ARG B CB  1 
ATOM   6674 C  CG  . ARG B 1 413 ? -25.505 -60.397 -25.584 1.00 177.19 ? 413 ARG B CG  1 
ATOM   6675 C  CD  . ARG B 1 413 ? -25.993 -59.452 -26.668 1.00 177.57 ? 413 ARG B CD  1 
ATOM   6676 N  NE  . ARG B 1 413 ? -26.434 -60.143 -27.875 1.00 177.65 ? 413 ARG B NE  1 
ATOM   6677 C  CZ  . ARG B 1 413 ? -25.886 -59.976 -29.074 1.00 177.68 ? 413 ARG B CZ  1 
ATOM   6678 N  NH1 . ARG B 1 413 ? -24.867 -59.137 -29.227 1.00 177.70 1 413 ARG B NH1 1 
ATOM   6679 N  NH2 . ARG B 1 413 ? -26.355 -60.642 -30.120 1.00 177.67 ? 413 ARG B NH2 1 
ATOM   6680 N  N   . VAL B 1 414 ? -25.506 -56.676 -23.213 1.00 91.61  ? 414 VAL B N   1 
ATOM   6681 C  CA  . VAL B 1 414 ? -25.747 -55.889 -22.021 1.00 94.51  ? 414 VAL B CA  1 
ATOM   6682 C  C   . VAL B 1 414 ? -25.920 -56.834 -20.843 1.00 93.73  ? 414 VAL B C   1 
ATOM   6683 O  O   . VAL B 1 414 ? -25.545 -56.515 -19.715 1.00 92.39  ? 414 VAL B O   1 
ATOM   6684 C  CB  . VAL B 1 414 ? -27.018 -55.062 -22.179 1.00 100.04 ? 414 VAL B CB  1 
ATOM   6685 C  CG1 . VAL B 1 414 ? -27.297 -54.270 -20.920 1.00 104.02 ? 414 VAL B CG1 1 
ATOM   6686 C  CG2 . VAL B 1 414 ? -26.882 -54.143 -23.376 1.00 104.02 ? 414 VAL B CG2 1 
ATOM   6687 N  N   . GLN B 1 415 ? -26.490 -58.004 -21.119 1.00 127.50 ? 415 GLN B N   1 
ATOM   6688 C  CA  . GLN B 1 415 ? -26.734 -59.005 -20.093 1.00 127.34 ? 415 GLN B CA  1 
ATOM   6689 C  C   . GLN B 1 415 ? -25.462 -59.348 -19.323 1.00 129.00 ? 415 GLN B C   1 
ATOM   6690 O  O   . GLN B 1 415 ? -25.510 -59.629 -18.122 1.00 127.74 ? 415 GLN B O   1 
ATOM   6691 C  CB  . GLN B 1 415 ? -27.323 -60.268 -20.715 1.00 125.57 ? 415 GLN B CB  1 
ATOM   6692 C  CG  . GLN B 1 415 ? -27.741 -61.303 -19.691 1.00 126.45 ? 415 GLN B CG  1 
ATOM   6693 C  CD  . GLN B 1 415 ? -28.978 -62.068 -20.110 1.00 127.80 ? 415 GLN B CD  1 
ATOM   6694 O  OE1 . GLN B 1 415 ? -29.530 -61.842 -21.192 1.00 128.28 ? 415 GLN B OE1 1 
ATOM   6695 N  NE2 . GLN B 1 415 ? -29.427 -62.979 -19.250 1.00 128.27 ? 415 GLN B NE2 1 
ATOM   6696 N  N   . GLU B 1 416 ? -24.326 -59.301 -20.015 1.00 159.60 ? 416 GLU B N   1 
ATOM   6697 C  CA  . GLU B 1 416 ? -23.041 -59.662 -19.424 1.00 162.27 ? 416 GLU B CA  1 
ATOM   6698 C  C   . GLU B 1 416 ? -22.666 -58.725 -18.279 1.00 158.23 ? 416 GLU B C   1 
ATOM   6699 O  O   . GLU B 1 416 ? -21.840 -59.065 -17.432 1.00 161.04 ? 416 GLU B O   1 
ATOM   6700 C  CB  . GLU B 1 416 ? -21.940 -59.669 -20.490 1.00 167.20 ? 416 GLU B CB  1 
ATOM   6701 C  CG  . GLU B 1 416 ? -20.621 -60.296 -20.041 1.00 175.04 ? 416 GLU B CG  1 
ATOM   6702 C  CD  . GLU B 1 416 ? -20.602 -61.807 -20.178 1.00 180.35 ? 416 GLU B CD  1 
ATOM   6703 O  OE1 . GLU B 1 416 ? -21.416 -62.347 -20.957 1.00 181.52 ? 416 GLU B OE1 1 
ATOM   6704 O  OE2 . GLU B 1 416 ? -19.766 -62.455 -19.510 1.00 181.52 1 416 GLU B OE2 1 
ATOM   6705 N  N   . LEU B 1 417 ? -23.276 -57.546 -18.252 1.00 112.22 ? 417 LEU B N   1 
ATOM   6706 C  CA  . LEU B 1 417 ? -23.050 -56.609 -17.162 1.00 107.34 ? 417 LEU B CA  1 
ATOM   6707 C  C   . LEU B 1 417 ? -23.608 -57.209 -15.880 1.00 111.98 ? 417 LEU B C   1 
ATOM   6708 O  O   . LEU B 1 417 ? -23.036 -57.044 -14.800 1.00 112.12 ? 417 LEU B O   1 
ATOM   6709 C  CB  . LEU B 1 417 ? -23.746 -55.280 -17.444 1.00 97.73  ? 417 LEU B CB  1 
ATOM   6710 C  CG  . LEU B 1 417 ? -23.199 -54.461 -18.611 1.00 84.69  ? 417 LEU B CG  1 
ATOM   6711 C  CD1 . LEU B 1 417 ? -24.118 -53.288 -18.905 1.00 78.28  ? 417 LEU B CD1 1 
ATOM   6712 C  CD2 . LEU B 1 417 ? -21.806 -53.963 -18.284 1.00 68.80  ? 417 LEU B CD2 1 
ATOM   6713 N  N   . GLY B 1 418 ? -24.742 -57.891 -16.010 1.00 124.10 ? 418 GLY B N   1 
ATOM   6714 C  CA  . GLY B 1 418 ? -25.362 -58.609 -14.911 1.00 128.07 ? 418 GLY B CA  1 
ATOM   6715 C  C   . GLY B 1 418 ? -26.311 -57.711 -14.150 1.00 128.70 ? 418 GLY B C   1 
ATOM   6716 O  O   . GLY B 1 418 ? -27.255 -58.186 -13.516 1.00 130.81 ? 418 GLY B O   1 
ATOM   6717 N  N   . LEU B 1 419 ? -26.061 -56.408 -14.237 1.00 155.26 ? 419 LEU B N   1 
ATOM   6718 C  CA  . LEU B 1 419 ? -27.009 -55.380 -13.824 1.00 151.87 ? 419 LEU B CA  1 
ATOM   6719 C  C   . LEU B 1 419 ? -27.605 -55.522 -12.427 1.00 150.89 ? 419 LEU B C   1 
ATOM   6720 O  O   . LEU B 1 419 ? -26.924 -55.891 -11.467 1.00 150.10 ? 419 LEU B O   1 
ATOM   6721 C  CB  . LEU B 1 419 ? -28.156 -55.344 -14.829 1.00 150.61 ? 419 LEU B CB  1 
ATOM   6722 C  CG  . LEU B 1 419 ? -27.888 -54.455 -16.034 1.00 149.22 ? 419 LEU B CG  1 
ATOM   6723 C  CD1 . LEU B 1 419 ? -29.065 -54.505 -16.986 1.00 148.46 ? 419 LEU B CD1 1 
ATOM   6724 C  CD2 . LEU B 1 419 ? -27.625 -53.038 -15.559 1.00 148.49 ? 419 LEU B CD2 1 
ATOM   6725 N  N   . SER B 1 420 ? -28.903 -55.235 -12.359 1.00 169.40 ? 420 SER B N   1 
ATOM   6726 C  CA  . SER B 1 420 ? -29.724 -55.332 -11.160 1.00 168.63 ? 420 SER B CA  1 
ATOM   6727 C  C   . SER B 1 420 ? -31.105 -54.834 -11.553 1.00 166.68 ? 420 SER B C   1 
ATOM   6728 O  O   . SER B 1 420 ? -31.246 -54.133 -12.553 1.00 169.51 ? 420 SER B O   1 
ATOM   6729 C  CB  . SER B 1 420 ? -29.173 -54.450 -10.040 1.00 169.75 ? 420 SER B CB  1 
ATOM   6730 O  OG  . SER B 1 420 ? -30.097 -54.358 -8.970  1.00 170.02 ? 420 SER B OG  1 
ATOM   6731 N  N   . ALA B 1 421 ? -32.122 -55.150 -10.761 1.00 122.38 ? 421 ALA B N   1 
ATOM   6732 C  CA  . ALA B 1 421 ? -33.464 -54.673 -11.068 1.00 114.87 ? 421 ALA B CA  1 
ATOM   6733 C  C   . ALA B 1 421 ? -33.781 -53.467 -10.205 1.00 112.08 ? 421 ALA B C   1 
ATOM   6734 O  O   . ALA B 1 421 ? -33.703 -53.534 -8.976  1.00 115.45 ? 421 ALA B O   1 
ATOM   6735 C  CB  . ALA B 1 421 ? -34.484 -55.765 -10.856 1.00 106.60 ? 421 ALA B CB  1 
ATOM   6736 N  N   . PRO B 1 422 ? -34.149 -52.354 -10.845 1.00 97.77  ? 422 PRO B N   1 
ATOM   6737 C  CA  . PRO B 1 422 ? -34.328 -51.116 -10.090 1.00 95.23  ? 422 PRO B CA  1 
ATOM   6738 C  C   . PRO B 1 422 ? -35.692 -51.025 -9.430  1.00 94.58  ? 422 PRO B C   1 
ATOM   6739 O  O   . PRO B 1 422 ? -36.542 -51.911 -9.584  1.00 93.62  ? 422 PRO B O   1 
ATOM   6740 C  CB  . PRO B 1 422 ? -34.213 -50.044 -11.170 1.00 93.68  ? 422 PRO B CB  1 
ATOM   6741 C  CG  . PRO B 1 422 ? -34.765 -50.702 -12.370 1.00 93.56  ? 422 PRO B CG  1 
ATOM   6742 C  CD  . PRO B 1 422 ? -34.340 -52.149 -12.290 1.00 95.65  ? 422 PRO B CD  1 
ATOM   6743 N  N   . LEU B 1 423 ? -35.894 -49.926 -8.714  1.00 88.02  ? 423 LEU B N   1 
ATOM   6744 C  CA  . LEU B 1 423 ? -37.127 -49.687 -8.001  1.00 87.50  ? 423 LEU B CA  1 
ATOM   6745 C  C   . LEU B 1 423 ? -37.857 -48.545 -8.675  1.00 82.74  ? 423 LEU B C   1 
ATOM   6746 O  O   . LEU B 1 423 ? -37.262 -47.511 -8.978  1.00 83.16  ? 423 LEU B O   1 
ATOM   6747 C  CB  . LEU B 1 423 ? -36.828 -49.319 -6.554  1.00 91.66  ? 423 LEU B CB  1 
ATOM   6748 C  CG  . LEU B 1 423 ? -38.051 -48.913 -5.736  1.00 98.68  ? 423 LEU B CG  1 
ATOM   6749 C  CD1 . LEU B 1 423 ? -38.965 -50.117 -5.524  1.00 105.62 ? 423 LEU B CD1 1 
ATOM   6750 C  CD2 . LEU B 1 423 ? -37.631 -48.296 -4.418  1.00 104.50 ? 423 LEU B CD2 1 
ATOM   6751 N  N   . THR B 1 424 ? -39.153 -48.723 -8.889  1.00 101.58 ? 424 THR B N   1 
ATOM   6752 C  CA  . THR B 1 424 ? -39.931 -47.773 -9.660  1.00 96.02  ? 424 THR B CA  1 
ATOM   6753 C  C   . THR B 1 424 ? -40.923 -47.017 -8.799  1.00 91.57  ? 424 THR B C   1 
ATOM   6754 O  O   . THR B 1 424 ? -41.447 -47.566 -7.833  1.00 89.08  ? 424 THR B O   1 
ATOM   6755 C  CB  . THR B 1 424 ? -40.722 -48.512 -10.722 1.00 95.56  ? 424 THR B CB  1 
ATOM   6756 O  OG1 . THR B 1 424 ? -41.796 -49.212 -10.083 1.00 99.62  ? 424 THR B OG1 1 
ATOM   6757 C  CG2 . THR B 1 424 ? -39.822 -49.521 -11.411 1.00 99.60  ? 424 THR B CG2 1 
ATOM   6758 N  N   . VAL B 1 425 ? -41.205 -45.769 -9.161  1.00 85.18  ? 425 VAL B N   1 
ATOM   6759 C  CA  . VAL B 1 425 ? -42.182 -44.986 -8.407  1.00 83.95  ? 425 VAL B CA  1 
ATOM   6760 C  C   . VAL B 1 425 ? -43.250 -44.362 -9.298  1.00 87.46  ? 425 VAL B C   1 
ATOM   6761 O  O   . VAL B 1 425 ? -43.057 -44.227 -10.507 1.00 87.12  ? 425 VAL B O   1 
ATOM   6762 C  CB  . VAL B 1 425 ? -41.511 -43.862 -7.600  1.00 80.64  ? 425 VAL B CB  1 
ATOM   6763 C  CG1 . VAL B 1 425 ? -40.432 -44.419 -6.700  1.00 76.85  ? 425 VAL B CG1 1 
ATOM   6764 C  CG2 . VAL B 1 425 ? -40.931 -42.826 -8.536  1.00 77.43  ? 425 VAL B CG2 1 
ATOM   6765 N  N   . LEU B 1 426 ? -44.382 -43.996 -8.700  1.00 79.65  ? 426 LEU B N   1 
ATOM   6766 C  CA  . LEU B 1 426 ? -45.443 -43.309 -9.433  1.00 84.34  ? 426 LEU B CA  1 
ATOM   6767 C  C   . LEU B 1 426 ? -45.151 -41.817 -9.501  1.00 89.09  ? 426 LEU B C   1 
ATOM   6768 O  O   . LEU B 1 426 ? -44.546 -41.261 -8.590  1.00 88.71  ? 426 LEU B O   1 
ATOM   6769 C  CB  . LEU B 1 426 ? -46.804 -43.526 -8.778  1.00 82.63  ? 426 LEU B CB  1 
ATOM   6770 C  CG  . LEU B 1 426 ? -47.375 -44.942 -8.733  1.00 82.21  ? 426 LEU B CG  1 
ATOM   6771 C  CD1 . LEU B 1 426 ? -48.893 -44.857 -8.739  1.00 82.06  ? 426 LEU B CD1 1 
ATOM   6772 C  CD2 . LEU B 1 426 ? -46.873 -45.807 -9.883  1.00 82.05  ? 426 LEU B CD2 1 
ATOM   6773 N  N   . PRO B 1 427 ? -45.593 -41.157 -10.577 1.00 87.47  ? 427 PRO B N   1 
ATOM   6774 C  CA  . PRO B 1 427 ? -45.306 -39.730 -10.755 1.00 89.61  ? 427 PRO B CA  1 
ATOM   6775 C  C   . PRO B 1 427 ? -46.025 -38.810 -9.767  1.00 89.53  ? 427 PRO B C   1 
ATOM   6776 O  O   . PRO B 1 427 ? -45.606 -37.659 -9.615  1.00 92.38  ? 427 PRO B O   1 
ATOM   6777 C  CB  . PRO B 1 427 ? -45.797 -39.456 -12.180 1.00 90.49  ? 427 PRO B CB  1 
ATOM   6778 C  CG  . PRO B 1 427 ? -46.840 -40.475 -12.410 1.00 90.19  ? 427 PRO B CG  1 
ATOM   6779 C  CD  . PRO B 1 427 ? -46.362 -41.705 -11.706 1.00 88.53  ? 427 PRO B CD  1 
ATOM   6780 N  N   . THR B 1 428 ? -47.079 -39.288 -9.116  1.00 97.98  ? 428 THR B N   1 
ATOM   6781 C  CA  . THR B 1 428 ? -47.834 -38.430 -8.210  1.00 95.40  ? 428 THR B CA  1 
ATOM   6782 C  C   . THR B 1 428 ? -47.173 -38.338 -6.847  1.00 91.90  ? 428 THR B C   1 
ATOM   6783 O  O   . THR B 1 428 ? -47.588 -37.539 -6.002  1.00 89.64  ? 428 THR B O   1 
ATOM   6784 C  CB  . THR B 1 428 ? -49.258 -38.949 -8.005  1.00 96.65  ? 428 THR B CB  1 
ATOM   6785 O  OG1 . THR B 1 428 ? -49.234 -40.381 -7.936  1.00 101.24 ? 428 THR B OG1 1 
ATOM   6786 C  CG2 . THR B 1 428 ? -50.153 -38.511 -9.154  1.00 101.23 ? 428 THR B CG2 1 
ATOM   6787 N  N   . ILE B 1 429 ? -46.138 -39.151 -6.644  1.00 100.54 ? 429 ILE B N   1 
ATOM   6788 C  CA  . ILE B 1 429 ? -45.429 -39.198 -5.373  1.00 101.55 ? 429 ILE B CA  1 
ATOM   6789 C  C   . ILE B 1 429 ? -44.722 -37.866 -5.173  1.00 101.67 ? 429 ILE B C   1 
ATOM   6790 O  O   . ILE B 1 429 ? -44.457 -37.137 -6.135  1.00 102.49 ? 429 ILE B O   1 
ATOM   6791 C  CB  . ILE B 1 429 ? -44.410 -40.361 -5.338  1.00 102.05 ? 429 ILE B CB  1 
ATOM   6792 C  CG1 . ILE B 1 429 ? -43.975 -40.677 -3.914  1.00 102.25 ? 429 ILE B CG1 1 
ATOM   6793 C  CG2 . ILE B 1 429 ? -43.173 -40.021 -6.122  1.00 102.31 ? 429 ILE B CG2 1 
ATOM   6794 C  CD1 . ILE B 1 429 ? -42.862 -41.701 -3.864  1.00 101.76 ? 429 ILE B CD1 1 
ATOM   6795 N  N   . THR B 1 430 ? -44.446 -37.531 -3.922  1.00 110.76 ? 430 THR B N   1 
ATOM   6796 C  CA  . THR B 1 430 ? -43.843 -36.250 -3.632  1.00 111.74 ? 430 THR B CA  1 
ATOM   6797 C  C   . THR B 1 430 ? -42.329 -36.397 -3.539  1.00 112.89 ? 430 THR B C   1 
ATOM   6798 O  O   . THR B 1 430 ? -41.797 -37.503 -3.660  1.00 110.65 ? 430 THR B O   1 
ATOM   6799 C  CB  . THR B 1 430 ? -44.412 -35.655 -2.332  1.00 111.49 ? 430 THR B CB  1 
ATOM   6800 O  OG1 . THR B 1 430 ? -43.854 -34.357 -2.116  1.00 113.06 ? 430 THR B OG1 1 
ATOM   6801 C  CG2 . THR B 1 430 ? -44.085 -36.547 -1.146  1.00 113.03 ? 430 THR B CG2 1 
ATOM   6802 N  N   . CYS B 1 431 ? -41.639 -35.284 -3.322  1.00 100.76 ? 431 CYS B N   1 
ATOM   6803 C  CA  . CYS B 1 431 ? -40.184 -35.293 -3.248  1.00 106.57 ? 431 CYS B CA  1 
ATOM   6804 C  C   . CYS B 1 431 ? -39.698 -35.928 -1.956  1.00 107.77 ? 431 CYS B C   1 
ATOM   6805 O  O   . CYS B 1 431 ? -38.825 -36.811 -1.965  1.00 107.59 ? 431 CYS B O   1 
ATOM   6806 C  CB  . CYS B 1 431 ? -39.645 -33.864 -3.332  1.00 108.27 ? 431 CYS B CB  1 
ATOM   6807 S  SG  . CYS B 1 431 ? -40.065 -32.980 -4.855  1.00 115.39 ? 431 CYS B SG  1 
ATOM   6808 N  N   . GLY B 1 432 ? -40.262 -35.458 -0.846  1.00 92.23  ? 432 GLY B N   1 
ATOM   6809 C  CA  . GLY B 1 432 ? -39.885 -35.935 0.467   1.00 91.14  ? 432 GLY B CA  1 
ATOM   6810 C  C   . GLY B 1 432 ? -39.988 -37.441 0.515   1.00 88.84  ? 432 GLY B C   1 
ATOM   6811 O  O   . GLY B 1 432 ? -39.043 -38.135 0.914   1.00 89.42  ? 432 GLY B O   1 
ATOM   6812 N  N   . HIS B 1 433 ? -41.138 -37.951 0.093   1.00 104.38 ? 433 HIS B N   1 
ATOM   6813 C  CA  . HIS B 1 433 ? -41.356 -39.381 0.108   1.00 100.59 ? 433 HIS B CA  1 
ATOM   6814 C  C   . HIS B 1 433 ? -40.320 -40.063 -0.777  1.00 95.95  ? 433 HIS B C   1 
ATOM   6815 O  O   . HIS B 1 433 ? -39.872 -41.155 -0.472  1.00 92.85  ? 433 HIS B O   1 
ATOM   6816 C  CB  . HIS B 1 433 ? -42.764 -39.728 -0.349  1.00 102.51 ? 433 HIS B CB  1 
ATOM   6817 C  CG  . HIS B 1 433 ? -43.219 -41.084 0.084   1.00 112.94 ? 433 HIS B CG  1 
ATOM   6818 N  ND1 . HIS B 1 433 ? -44.388 -41.654 -0.365  1.00 122.17 ? 433 HIS B ND1 1 
ATOM   6819 C  CD2 . HIS B 1 433 ? -42.669 -41.977 0.941   1.00 122.18 ? 433 HIS B CD2 1 
ATOM   6820 C  CE1 . HIS B 1 433 ? -44.536 -42.845 0.187   1.00 125.38 ? 433 HIS B CE1 1 
ATOM   6821 N  NE2 . HIS B 1 433 ? -43.506 -43.064 0.984   1.00 125.39 ? 433 HIS B NE2 1 
ATOM   6822 N  N   . THR B 1 434 ? -39.916 -39.408 -1.857  1.00 80.82  ? 434 THR B N   1 
ATOM   6823 C  CA  . THR B 1 434 ? -38.915 -39.993 -2.737  1.00 80.59  ? 434 THR B CA  1 
ATOM   6824 C  C   . THR B 1 434 ? -37.614 -40.190 -1.986  1.00 75.07  ? 434 THR B C   1 
ATOM   6825 O  O   . THR B 1 434 ? -37.018 -41.273 -2.026  1.00 74.32  ? 434 THR B O   1 
ATOM   6826 C  CB  . THR B 1 434 ? -38.649 -39.115 -3.964  1.00 82.80  ? 434 THR B CB  1 
ATOM   6827 O  OG1 . THR B 1 434 ? -39.864 -38.956 -4.705  1.00 90.56  ? 434 THR B OG1 1 
ATOM   6828 C  CG2 . THR B 1 434 ? -37.602 -39.758 -4.855  1.00 90.52  ? 434 THR B CG2 1 
ATOM   6829 N  N   . ILE B 1 435 ? -37.174 -39.143 -1.297  1.00 81.12  ? 435 ILE B N   1 
ATOM   6830 C  CA  . ILE B 1 435 ? -35.960 -39.249 -0.492  1.00 76.84  ? 435 ILE B CA  1 
ATOM   6831 C  C   . ILE B 1 435 ? -36.070 -40.347 0.558   1.00 78.03  ? 435 ILE B C   1 
ATOM   6832 O  O   . ILE B 1 435 ? -35.177 -41.203 0.676   1.00 76.04  ? 435 ILE B O   1 
ATOM   6833 C  CB  . ILE B 1 435 ? -35.640 -37.938 0.219   1.00 74.84  ? 435 ILE B CB  1 
ATOM   6834 C  CG1 . ILE B 1 435 ? -35.061 -36.946 -0.778  1.00 70.69  ? 435 ILE B CG1 1 
ATOM   6835 C  CG2 . ILE B 1 435 ? -34.627 -38.168 1.313   1.00 71.36  ? 435 ILE B CG2 1 
ATOM   6836 C  CD1 . ILE B 1 435 ? -35.953 -35.779 -1.026  1.00 66.62  ? 435 ILE B CD1 1 
ATOM   6837 N  N   . GLU B 1 436 ? -37.174 -40.325 1.302   1.00 78.94  ? 436 GLU B N   1 
ATOM   6838 C  CA  . GLU B 1 436 ? -37.423 -41.321 2.331   1.00 82.97  ? 436 GLU B CA  1 
ATOM   6839 C  C   . GLU B 1 436 ? -37.277 -42.725 1.765   1.00 81.31  ? 436 GLU B C   1 
ATOM   6840 O  O   . GLU B 1 436 ? -36.486 -43.521 2.274   1.00 81.31  ? 436 GLU B O   1 
ATOM   6841 C  CB  . GLU B 1 436 ? -38.819 -41.157 2.930   1.00 86.02  ? 436 GLU B CB  1 
ATOM   6842 C  CG  . GLU B 1 436 ? -38.949 -40.004 3.903   1.00 97.70  ? 436 GLU B CG  1 
ATOM   6843 C  CD  . GLU B 1 436 ? -40.362 -39.862 4.447   1.00 108.86 ? 436 GLU B CD  1 
ATOM   6844 O  OE1 . GLU B 1 436 ? -41.240 -40.658 4.042   1.00 112.21 ? 436 GLU B OE1 1 
ATOM   6845 O  OE2 . GLU B 1 436 ? -40.596 -38.961 5.283   1.00 112.22 1 436 GLU B OE2 1 
ATOM   6846 N  N   . ILE B 1 437 ? -38.025 -43.015 0.705   1.00 104.05 ? 437 ILE B N   1 
ATOM   6847 C  CA  . ILE B 1 437 ? -38.028 -44.346 0.123   1.00 102.10 ? 437 ILE B CA  1 
ATOM   6848 C  C   . ILE B 1 437 ? -36.636 -44.717 -0.312  1.00 103.61 ? 437 ILE B C   1 
ATOM   6849 O  O   . ILE B 1 437 ? -36.145 -45.787 0.018   1.00 103.38 ? 437 ILE B O   1 
ATOM   6850 C  CB  . ILE B 1 437 ? -38.910 -44.460 -1.122  1.00 100.83 ? 437 ILE B CB  1 
ATOM   6851 C  CG1 . ILE B 1 437 ? -40.341 -44.025 -0.829  1.00 97.19  ? 437 ILE B CG1 1 
ATOM   6852 C  CG2 . ILE B 1 437 ? -38.880 -45.890 -1.634  1.00 97.24  ? 437 ILE B CG2 1 
ATOM   6853 C  CD1 . ILE B 1 437 ? -41.331 -45.161 -0.672  1.00 91.16  ? 437 ILE B CD1 1 
ATOM   6854 N  N   . LEU B 1 438 ? -36.001 -43.825 -1.063  1.00 84.18  ? 438 LEU B N   1 
ATOM   6855 C  CA  . LEU B 1 438 ? -34.685 -44.117 -1.609  1.00 86.32  ? 438 LEU B CA  1 
ATOM   6856 C  C   . LEU B 1 438 ? -33.644 -44.442 -0.538  1.00 87.15  ? 438 LEU B C   1 
ATOM   6857 O  O   . LEU B 1 438 ? -32.898 -45.416 -0.666  1.00 89.90  ? 438 LEU B O   1 
ATOM   6858 C  CB  . LEU B 1 438 ? -34.209 -42.974 -2.500  1.00 86.35  ? 438 LEU B CB  1 
ATOM   6859 C  CG  . LEU B 1 438 ? -34.865 -42.991 -3.881  1.00 84.26  ? 438 LEU B CG  1 
ATOM   6860 C  CD1 . LEU B 1 438 ? -34.524 -41.737 -4.657  1.00 79.80  ? 438 LEU B CD1 1 
ATOM   6861 C  CD2 . LEU B 1 438 ? -34.425 -44.223 -4.648  1.00 79.84  ? 438 LEU B CD2 1 
ATOM   6862 N  N   . ARG B 1 439 ? -33.600 -43.653 0.526   1.00 78.68  ? 439 ARG B N   1 
ATOM   6863 C  CA  . ARG B 1 439 ? -32.621 -43.917 1.574   1.00 76.99  ? 439 ARG B CA  1 
ATOM   6864 C  C   . ARG B 1 439 ? -32.977 -45.180 2.345   1.00 76.58  ? 439 ARG B C   1 
ATOM   6865 O  O   . ARG B 1 439 ? -32.109 -46.004 2.645   1.00 74.70  ? 439 ARG B O   1 
ATOM   6866 C  CB  . ARG B 1 439 ? -32.491 -42.733 2.519   1.00 76.38  ? 439 ARG B CB  1 
ATOM   6867 C  CG  . ARG B 1 439 ? -32.281 -41.421 1.797   1.00 78.75  ? 439 ARG B CG  1 
ATOM   6868 C  CD  . ARG B 1 439 ? -31.534 -40.435 2.667   1.00 81.71  ? 439 ARG B CD  1 
ATOM   6869 N  NE  . ARG B 1 439 ? -31.810 -40.625 4.089   1.00 81.99  ? 439 ARG B NE  1 
ATOM   6870 C  CZ  . ARG B 1 439 ? -30.874 -40.598 5.032   1.00 80.23  ? 439 ARG B CZ  1 
ATOM   6871 N  NH1 . ARG B 1 439 ? -29.607 -40.385 4.699   1.00 79.39  1 439 ARG B NH1 1 
ATOM   6872 N  NH2 . ARG B 1 439 ? -31.202 -40.779 6.305   1.00 75.18  ? 439 ARG B NH2 1 
ATOM   6873 N  N   . GLU B 1 440 ? -34.259 -45.318 2.664   1.00 73.92  ? 440 GLU B N   1 
ATOM   6874 C  CA  . GLU B 1 440 ? -34.756 -46.459 3.417   1.00 77.62  ? 440 GLU B CA  1 
ATOM   6875 C  C   . GLU B 1 440 ? -34.406 -47.761 2.709   1.00 78.60  ? 440 GLU B C   1 
ATOM   6876 O  O   . GLU B 1 440 ? -33.996 -48.737 3.343   1.00 76.54  ? 440 GLU B O   1 
ATOM   6877 C  CB  . GLU B 1 440 ? -36.268 -46.361 3.574   1.00 78.77  ? 440 GLU B CB  1 
ATOM   6878 C  CG  . GLU B 1 440 ? -36.887 -47.444 4.430   1.00 86.88  ? 440 GLU B CG  1 
ATOM   6879 C  CD  . GLU B 1 440 ? -38.397 -47.265 4.577   1.00 95.07  ? 440 GLU B CD  1 
ATOM   6880 O  OE1 . GLU B 1 440 ? -39.060 -46.928 3.566   1.00 97.56  ? 440 GLU B OE1 1 
ATOM   6881 O  OE2 . GLU B 1 440 ? -38.915 -47.442 5.706   1.00 97.61  1 440 GLU B OE2 1 
ATOM   6882 N  N   . LYS B 1 441 ? -34.585 -47.767 1.391   1.00 85.58  ? 441 LYS B N   1 
ATOM   6883 C  CA  . LYS B 1 441 ? -34.346 -48.942 0.561   1.00 90.51  ? 441 LYS B CA  1 
ATOM   6884 C  C   . LYS B 1 441 ? -32.895 -49.082 0.115   1.00 90.78  ? 441 LYS B C   1 
ATOM   6885 O  O   . LYS B 1 441 ? -32.479 -50.160 -0.316  1.00 91.06  ? 441 LYS B O   1 
ATOM   6886 C  CB  . LYS B 1 441 ? -35.245 -48.899 -0.673  1.00 94.82  ? 441 LYS B CB  1 
ATOM   6887 C  CG  . LYS B 1 441 ? -36.730 -48.772 -0.362  1.00 100.93 ? 441 LYS B CG  1 
ATOM   6888 C  CD  . LYS B 1 441 ? -37.366 -50.124 -0.089  1.00 108.60 ? 441 LYS B CD  1 
ATOM   6889 C  CE  . LYS B 1 441 ? -38.882 -50.011 0.021   1.00 110.68 ? 441 LYS B CE  1 
ATOM   6890 N  NZ  . LYS B 1 441 ? -39.327 -49.214 1.204   1.00 111.86 1 441 LYS B NZ  1 
ATOM   6891 N  N   . GLY B 1 442 ? -32.127 -48.002 0.233   1.00 83.81  ? 442 GLY B N   1 
ATOM   6892 C  CA  . GLY B 1 442 ? -30.726 -48.022 -0.154  1.00 85.44  ? 442 GLY B CA  1 
ATOM   6893 C  C   . GLY B 1 442 ? -30.494 -47.962 -1.655  1.00 87.09  ? 442 GLY B C   1 
ATOM   6894 O  O   . GLY B 1 442 ? -29.647 -48.673 -2.195  1.00 87.05  ? 442 GLY B O   1 
ATOM   6895 N  N   . PHE B 1 443 ? -31.255 -47.115 -2.338  1.00 97.26  ? 443 PHE B N   1 
ATOM   6896 C  CA  . PHE B 1 443 ? -31.101 -46.928 -3.775  1.00 98.90  ? 443 PHE B CA  1 
ATOM   6897 C  C   . PHE B 1 443 ? -30.810 -45.470 -4.095  1.00 95.96  ? 443 PHE B C   1 
ATOM   6898 O  O   . PHE B 1 443 ? -31.392 -44.567 -3.493  1.00 95.68  ? 443 PHE B O   1 
ATOM   6899 C  CB  . PHE B 1 443 ? -32.354 -47.385 -4.514  1.00 103.04 ? 443 PHE B CB  1 
ATOM   6900 C  CG  . PHE B 1 443 ? -32.489 -48.868 -4.609  1.00 110.81 ? 443 PHE B CG  1 
ATOM   6901 C  CD1 . PHE B 1 443 ? -31.719 -49.584 -5.512  1.00 116.11 ? 443 PHE B CD1 1 
ATOM   6902 C  CD2 . PHE B 1 443 ? -33.374 -49.553 -3.797  1.00 116.09 ? 443 PHE B CD2 1 
ATOM   6903 C  CE1 . PHE B 1 443 ? -31.839 -50.954 -5.608  1.00 117.58 ? 443 PHE B CE1 1 
ATOM   6904 C  CE2 . PHE B 1 443 ? -33.495 -50.924 -3.887  1.00 117.59 ? 443 PHE B CE2 1 
ATOM   6905 C  CZ  . PHE B 1 443 ? -32.728 -51.623 -4.793  1.00 118.01 ? 443 PHE B CZ  1 
ATOM   6906 N  N   . ASP B 1 444 ? -29.900 -45.238 -5.034  1.00 100.05 ? 444 ASP B N   1 
ATOM   6907 C  CA  . ASP B 1 444 ? -29.562 -43.878 -5.430  1.00 96.73  ? 444 ASP B CA  1 
ATOM   6908 C  C   . ASP B 1 444 ? -30.566 -43.264 -6.407  1.00 91.66  ? 444 ASP B C   1 
ATOM   6909 O  O   . ASP B 1 444 ? -30.883 -42.073 -6.330  1.00 90.14  ? 444 ASP B O   1 
ATOM   6910 C  CB  . ASP B 1 444 ? -28.155 -43.842 -6.033  1.00 99.50  ? 444 ASP B CB  1 
ATOM   6911 C  CG  . ASP B 1 444 ? -27.695 -42.432 -6.354  1.00 107.37 ? 444 ASP B CG  1 
ATOM   6912 O  OD1 . ASP B 1 444 ? -27.947 -41.524 -5.530  1.00 114.90 ? 444 ASP B OD1 1 
ATOM   6913 O  OD2 . ASP B 1 444 ? -27.090 -42.230 -7.432  1.00 114.94 1 444 ASP B OD2 1 
ATOM   6914 N  N   . GLN B 1 445 ? -31.066 -44.088 -7.321  1.00 91.43  ? 445 GLN B N   1 
ATOM   6915 C  CA  . GLN B 1 445 ? -31.875 -43.601 -8.432  1.00 88.77  ? 445 GLN B CA  1 
ATOM   6916 C  C   . GLN B 1 445 ? -33.093 -44.482 -8.695  1.00 86.57  ? 445 GLN B C   1 
ATOM   6917 O  O   . GLN B 1 445 ? -33.011 -45.713 -8.643  1.00 84.49  ? 445 GLN B O   1 
ATOM   6918 C  CB  . GLN B 1 445 ? -31.026 -43.499 -9.699  1.00 88.85  ? 445 GLN B CB  1 
ATOM   6919 C  CG  . GLN B 1 445 ? -30.399 -44.823 -10.109 1.00 94.21  ? 445 GLN B CG  1 
ATOM   6920 C  CD  . GLN B 1 445 ? -29.126 -44.642 -10.906 1.00 100.16 ? 445 GLN B CD  1 
ATOM   6921 O  OE1 . GLN B 1 445 ? -28.632 -43.523 -11.070 1.00 102.01 ? 445 GLN B OE1 1 
ATOM   6922 N  NE2 . GLN B 1 445 ? -28.589 -45.746 -11.418 1.00 101.95 ? 445 GLN B NE2 1 
ATOM   6923 N  N   . ALA B 1 446 ? -34.235 -43.852 -8.942  1.00 67.50  ? 446 ALA B N   1 
ATOM   6924 C  CA  . ALA B 1 446 ? -35.424 -44.596 -9.326  1.00 67.02  ? 446 ALA B CA  1 
ATOM   6925 C  C   . ALA B 1 446 ? -36.013 -44.129 -10.656 1.00 65.44  ? 446 ALA B C   1 
ATOM   6926 O  O   . ALA B 1 446 ? -36.082 -42.927 -10.929 1.00 66.46  ? 446 ALA B O   1 
ATOM   6927 C  CB  . ALA B 1 446 ? -36.473 -44.511 -8.232  1.00 68.09  ? 446 ALA B CB  1 
ATOM   6928 N  N   . PRO B 1 447 ? -36.412 -45.089 -11.504 1.00 68.81  ? 447 PRO B N   1 
ATOM   6929 C  CA  . PRO B 1 447 ? -37.279 -44.794 -12.647 1.00 66.97  ? 447 PRO B CA  1 
ATOM   6930 C  C   . PRO B 1 447 ? -38.691 -44.445 -12.209 1.00 66.15  ? 447 PRO B C   1 
ATOM   6931 O  O   . PRO B 1 447 ? -39.266 -45.066 -11.302 1.00 65.09  ? 447 PRO B O   1 
ATOM   6932 C  CB  . PRO B 1 447 ? -37.292 -46.106 -13.440 1.00 66.13  ? 447 PRO B CB  1 
ATOM   6933 C  CG  . PRO B 1 447 ? -36.740 -47.135 -12.522 1.00 66.36  ? 447 PRO B CG  1 
ATOM   6934 C  CD  . PRO B 1 447 ? -35.800 -46.421 -11.611 1.00 68.18  ? 447 PRO B CD  1 
ATOM   6935 N  N   . VAL B 1 448 ? -39.251 -43.443 -12.868 1.00 65.69  ? 448 VAL B N   1 
ATOM   6936 C  CA  . VAL B 1 448 ? -40.625 -43.059 -12.636 1.00 66.87  ? 448 VAL B CA  1 
ATOM   6937 C  C   . VAL B 1 448 ? -41.470 -43.748 -13.677 1.00 72.02  ? 448 VAL B C   1 
ATOM   6938 O  O   . VAL B 1 448 ? -41.365 -43.434 -14.862 1.00 71.33  ? 448 VAL B O   1 
ATOM   6939 C  CB  . VAL B 1 448 ? -40.804 -41.557 -12.808 1.00 64.94  ? 448 VAL B CB  1 
ATOM   6940 C  CG1 . VAL B 1 448 ? -42.254 -41.166 -12.578 1.00 59.10  ? 448 VAL B CG1 1 
ATOM   6941 C  CG2 . VAL B 1 448 ? -39.878 -40.821 -11.865 1.00 61.22  ? 448 VAL B CG2 1 
ATOM   6942 N  N   . VAL B 1 449 ? -42.288 -44.703 -13.256 1.00 86.01  ? 449 VAL B N   1 
ATOM   6943 C  CA  . VAL B 1 449 ? -43.209 -45.358 -14.177 1.00 92.20  ? 449 VAL B CA  1 
ATOM   6944 C  C   . VAL B 1 449 ? -44.638 -44.895 -13.971 1.00 101.98 ? 449 VAL B C   1 
ATOM   6945 O  O   . VAL B 1 449 ? -44.912 -43.982 -13.190 1.00 104.03 ? 449 VAL B O   1 
ATOM   6946 C  CB  . VAL B 1 449 ? -43.142 -46.888 -14.108 1.00 89.55  ? 449 VAL B CB  1 
ATOM   6947 C  CG1 . VAL B 1 449 ? -41.718 -47.351 -14.318 1.00 80.21  ? 449 VAL B CG1 1 
ATOM   6948 C  CG2 . VAL B 1 449 ? -43.685 -47.378 -12.775 1.00 82.38  ? 449 VAL B CG2 1 
ATOM   6949 N  N   . ASP B 1 450 ? -45.541 -45.532 -14.696 1.00 132.22 ? 450 ASP B N   1 
ATOM   6950 C  CA  . ASP B 1 450 ? -46.942 -45.188 -14.657 1.00 141.74 ? 450 ASP B CA  1 
ATOM   6951 C  C   . ASP B 1 450 ? -47.735 -46.422 -14.285 1.00 147.18 ? 450 ASP B C   1 
ATOM   6952 O  O   . ASP B 1 450 ? -47.222 -47.541 -14.352 1.00 147.10 ? 450 ASP B O   1 
ATOM   6953 C  CB  . ASP B 1 450 ? -47.377 -44.708 -16.032 1.00 142.24 ? 450 ASP B CB  1 
ATOM   6954 C  CG  . ASP B 1 450 ? -48.717 -44.037 -16.014 1.00 145.91 ? 450 ASP B CG  1 
ATOM   6955 O  OD1 . ASP B 1 450 ? -49.319 -43.962 -14.925 1.00 148.66 ? 450 ASP B OD1 1 
ATOM   6956 O  OD2 . ASP B 1 450 ? -49.180 -43.609 -17.092 1.00 148.67 1 450 ASP B OD2 1 
ATOM   6957 N  N   . GLU B 1 451 ? -48.982 -46.221 -13.875 1.00 111.39 ? 451 GLU B N   1 
ATOM   6958 C  CA  . GLU B 1 451 ? -49.872 -47.349 -13.668 1.00 115.01 ? 451 GLU B CA  1 
ATOM   6959 C  C   . GLU B 1 451 ? -50.070 -47.970 -15.036 1.00 113.59 ? 451 GLU B C   1 
ATOM   6960 O  O   . GLU B 1 451 ? -50.163 -49.191 -15.180 1.00 117.09 ? 451 GLU B O   1 
ATOM   6961 C  CB  . GLU B 1 451 ? -51.216 -46.897 -13.101 1.00 118.86 ? 451 GLU B CB  1 
ATOM   6962 C  CG  . GLU B 1 451 ? -51.111 -46.003 -11.878 1.00 116.36 ? 451 GLU B CG  1 
ATOM   6963 C  CD  . GLU B 1 451 ? -51.297 -44.533 -12.218 1.00 116.77 ? 451 GLU B CD  1 
ATOM   6964 O  OE1 . GLU B 1 451 ? -51.472 -43.720 -11.282 1.00 116.57 ? 451 GLU B OE1 1 
ATOM   6965 O  OE2 . GLU B 1 451 ? -51.274 -44.194 -13.422 1.00 116.55 1 451 GLU B OE2 1 
ATOM   6966 N  N   . ALA B 1 452 ? -50.090 -47.105 -16.045 1.00 132.97 ? 452 ALA B N   1 
ATOM   6967 C  CA  . ALA B 1 452 ? -50.229 -47.526 -17.428 1.00 124.50 ? 452 ALA B CA  1 
ATOM   6968 C  C   . ALA B 1 452 ? -48.985 -48.274 -17.884 1.00 118.26 ? 452 ALA B C   1 
ATOM   6969 O  O   . ALA B 1 452 ? -49.054 -49.135 -18.762 1.00 118.64 ? 452 ALA B O   1 
ATOM   6970 C  CB  . ALA B 1 452 ? -50.478 -46.324 -18.315 1.00 125.26 ? 452 ALA B CB  1 
ATOM   6971 N  N   . GLY B 1 453 ? -47.850 -47.958 -17.271 1.00 77.06  ? 453 GLY B N   1 
ATOM   6972 C  CA  . GLY B 1 453 ? -46.612 -48.639 -17.595 1.00 71.76  ? 453 GLY B CA  1 
ATOM   6973 C  C   . GLY B 1 453 ? -45.658 -47.811 -18.436 1.00 68.66  ? 453 GLY B C   1 
ATOM   6974 O  O   . GLY B 1 453 ? -44.592 -48.293 -18.838 1.00 68.55  ? 453 GLY B O   1 
ATOM   6975 N  N   . VAL B 1 454 ? -46.042 -46.570 -18.718 1.00 102.85 ? 454 VAL B N   1 
ATOM   6976 C  CA  . VAL B 1 454 ? -45.186 -45.680 -19.486 1.00 102.54 ? 454 VAL B CA  1 
ATOM   6977 C  C   . VAL B 1 454 ? -44.149 -45.009 -18.589 1.00 98.01  ? 454 VAL B C   1 
ATOM   6978 O  O   . VAL B 1 454 ? -44.483 -44.328 -17.614 1.00 98.33  ? 454 VAL B O   1 
ATOM   6979 C  CB  . VAL B 1 454 ? -46.001 -44.626 -20.257 1.00 104.68 ? 454 VAL B CB  1 
ATOM   6980 C  CG1 . VAL B 1 454 ? -47.152 -44.115 -19.413 1.00 109.39 ? 454 VAL B CG1 1 
ATOM   6981 C  CG2 . VAL B 1 454 ? -45.106 -43.489 -20.707 1.00 110.38 ? 454 VAL B CG2 1 
ATOM   6982 N  N   . ILE B 1 455 ? -42.882 -45.195 -18.938 1.00 70.58  ? 455 ILE B N   1 
ATOM   6983 C  CA  . ILE B 1 455 ? -41.799 -44.652 -18.147 1.00 65.28  ? 455 ILE B CA  1 
ATOM   6984 C  C   . ILE B 1 455 ? -41.686 -43.187 -18.462 1.00 65.71  ? 455 ILE B C   1 
ATOM   6985 O  O   . ILE B 1 455 ? -41.450 -42.815 -19.611 1.00 64.73  ? 455 ILE B O   1 
ATOM   6986 C  CB  . ILE B 1 455 ? -40.483 -45.292 -18.545 1.00 63.32  ? 455 ILE B CB  1 
ATOM   6987 C  CG1 . ILE B 1 455 ? -40.555 -46.801 -18.343 1.00 59.10  ? 455 ILE B CG1 1 
ATOM   6988 C  CG2 . ILE B 1 455 ? -39.346 -44.694 -17.751 1.00 57.96  ? 455 ILE B CG2 1 
ATOM   6989 C  CD1 . ILE B 1 455 ? -39.385 -47.535 -18.941 1.00 53.61  ? 455 ILE B CD1 1 
ATOM   6990 N  N   . LEU B 1 456 ? -41.856 -42.345 -17.452 1.00 90.61  ? 456 LEU B N   1 
ATOM   6991 C  CA  . LEU B 1 456 ? -41.810 -40.916 -17.689 1.00 91.15  ? 456 LEU B CA  1 
ATOM   6992 C  C   . LEU B 1 456 ? -40.416 -40.332 -17.576 1.00 90.77  ? 456 LEU B C   1 
ATOM   6993 O  O   . LEU B 1 456 ? -40.181 -39.202 -18.004 1.00 91.97  ? 456 LEU B O   1 
ATOM   6994 C  CB  . LEU B 1 456 ? -42.720 -40.189 -16.710 1.00 91.66  ? 456 LEU B CB  1 
ATOM   6995 C  CG  . LEU B 1 456 ? -44.183 -40.592 -16.771 1.00 91.04  ? 456 LEU B CG  1 
ATOM   6996 C  CD1 . LEU B 1 456 ? -44.977 -39.692 -15.854 1.00 87.42  ? 456 LEU B CD1 1 
ATOM   6997 C  CD2 . LEU B 1 456 ? -44.677 -40.493 -18.197 1.00 90.00  ? 456 LEU B CD2 1 
ATOM   6998 N  N   . GLY B 1 457 ? -39.484 -41.080 -17.001 1.00 92.03  ? 457 GLY B N   1 
ATOM   6999 C  CA  . GLY B 1 457 ? -38.200 -40.476 -16.724 1.00 90.49  ? 457 GLY B CA  1 
ATOM   7000 C  C   . GLY B 1 457 ? -37.426 -41.057 -15.563 1.00 90.34  ? 457 GLY B C   1 
ATOM   7001 O  O   . GLY B 1 457 ? -37.566 -42.231 -15.204 1.00 89.30  ? 457 GLY B O   1 
ATOM   7002 N  N   . MET B 1 458 ? -36.574 -40.217 -14.990 1.00 81.05  ? 458 MET B N   1 
ATOM   7003 C  CA  . MET B 1 458 ? -35.738 -40.624 -13.884 1.00 81.76  ? 458 MET B CA  1 
ATOM   7004 C  C   . MET B 1 458 ? -35.743 -39.618 -12.756 1.00 81.35  ? 458 MET B C   1 
ATOM   7005 O  O   . MET B 1 458 ? -35.824 -38.410 -12.988 1.00 81.10  ? 458 MET B O   1 
ATOM   7006 C  CB  . MET B 1 458 ? -34.315 -40.798 -14.372 1.00 82.71  ? 458 MET B CB  1 
ATOM   7007 C  CG  . MET B 1 458 ? -34.061 -42.163 -14.897 1.00 85.59  ? 458 MET B CG  1 
ATOM   7008 S  SD  . MET B 1 458 ? -34.082 -43.295 -13.509 1.00 92.04  ? 458 MET B SD  1 
ATOM   7009 C  CE  . MET B 1 458 ? -33.897 -44.833 -14.389 1.00 89.71  ? 458 MET B CE  1 
ATOM   7010 N  N   . VAL B 1 459 ? -35.649 -40.125 -11.530 1.00 75.16  ? 459 VAL B N   1 
ATOM   7011 C  CA  . VAL B 1 459 ? -35.325 -39.288 -10.379 1.00 72.64  ? 459 VAL B CA  1 
ATOM   7012 C  C   . VAL B 1 459 ? -34.155 -39.872 -9.633  1.00 75.10  ? 459 VAL B C   1 
ATOM   7013 O  O   . VAL B 1 459 ? -33.938 -41.083 -9.627  1.00 77.88  ? 459 VAL B O   1 
ATOM   7014 C  CB  . VAL B 1 459 ? -36.496 -39.121 -9.400  1.00 70.50  ? 459 VAL B CB  1 
ATOM   7015 C  CG1 . VAL B 1 459 ? -37.438 -38.042 -9.891  1.00 62.44  ? 459 VAL B CG1 1 
ATOM   7016 C  CG2 . VAL B 1 459 ? -37.213 -40.447 -9.195  1.00 63.17  ? 459 VAL B CG2 1 
ATOM   7017 N  N   . THR B 1 460 ? -33.396 -38.999 -8.997  1.00 85.18  ? 460 THR B N   1 
ATOM   7018 C  CA  . THR B 1 460 ? -32.213 -39.439 -8.299  1.00 83.21  ? 460 THR B CA  1 
ATOM   7019 C  C   . THR B 1 460 ? -32.106 -38.742 -6.953  1.00 80.56  ? 460 THR B C   1 
ATOM   7020 O  O   . THR B 1 460 ? -32.555 -37.601 -6.790  1.00 80.73  ? 460 THR B O   1 
ATOM   7021 C  CB  . THR B 1 460 ? -30.956 -39.193 -9.144  1.00 83.84  ? 460 THR B CB  1 
ATOM   7022 O  OG1 . THR B 1 460 ? -29.794 -39.391 -8.333  1.00 85.54  ? 460 THR B OG1 1 
ATOM   7023 C  CG2 . THR B 1 460 ? -30.957 -37.774 -9.665  1.00 84.95  ? 460 THR B CG2 1 
ATOM   7024 N  N   . LEU B 1 461 ? -31.502 -39.431 -5.994  1.00 73.30  ? 461 LEU B N   1 
ATOM   7025 C  CA  . LEU B 1 461 ? -31.419 -38.929 -4.638  1.00 71.05  ? 461 LEU B CA  1 
ATOM   7026 C  C   . LEU B 1 461 ? -30.638 -37.627 -4.579  1.00 70.90  ? 461 LEU B C   1 
ATOM   7027 O  O   . LEU B 1 461 ? -31.051 -36.670 -3.901  1.00 69.14  ? 461 LEU B O   1 
ATOM   7028 C  CB  . LEU B 1 461 ? -30.762 -39.976 -3.743  1.00 70.40  ? 461 LEU B CB  1 
ATOM   7029 C  CG  . LEU B 1 461 ? -30.563 -39.619 -2.271  1.00 69.51  ? 461 LEU B CG  1 
ATOM   7030 C  CD1 . LEU B 1 461 ? -31.875 -39.166 -1.665  1.00 67.62  ? 461 LEU B CD1 1 
ATOM   7031 C  CD2 . LEU B 1 461 ? -30.042 -40.837 -1.528  1.00 65.78  ? 461 LEU B CD2 1 
ATOM   7032 N  N   . GLY B 1 462 ? -29.521 -37.592 -5.302  1.00 66.61  ? 462 GLY B N   1 
ATOM   7033 C  CA  . GLY B 1 462 ? -28.649 -36.434 -5.289  1.00 70.16  ? 462 GLY B CA  1 
ATOM   7034 C  C   . GLY B 1 462 ? -29.316 -35.175 -5.805  1.00 73.51  ? 462 GLY B C   1 
ATOM   7035 O  O   . GLY B 1 462 ? -29.182 -34.097 -5.224  1.00 71.48  ? 462 GLY B O   1 
ATOM   7036 N  N   . ASN B 1 463 ? -30.046 -35.306 -6.901  1.00 79.82  ? 463 ASN B N   1 
ATOM   7037 C  CA  . ASN B 1 463 ? -30.653 -34.140 -7.507  1.00 84.61  ? 463 ASN B CA  1 
ATOM   7038 C  C   . ASN B 1 463 ? -31.878 -33.688 -6.750  1.00 84.41  ? 463 ASN B C   1 
ATOM   7039 O  O   . ASN B 1 463 ? -32.183 -32.499 -6.709  1.00 85.69  ? 463 ASN B O   1 
ATOM   7040 C  CB  . ASN B 1 463 ? -31.021 -34.399 -8.954  1.00 87.56  ? 463 ASN B CB  1 
ATOM   7041 C  CG  . ASN B 1 463 ? -31.389 -33.136 -9.675  1.00 91.99  ? 463 ASN B CG  1 
ATOM   7042 O  OD1 . ASN B 1 463 ? -30.722 -32.107 -9.515  1.00 94.26  ? 463 ASN B OD1 1 
ATOM   7043 N  ND2 . ASN B 1 463 ? -32.471 -33.185 -10.452 1.00 93.00  ? 463 ASN B ND2 1 
ATOM   7044 N  N   . MET B 1 464 ? -32.593 -34.646 -6.175  1.00 91.56  ? 464 MET B N   1 
ATOM   7045 C  CA  . MET B 1 464 ? -33.728 -34.337 -5.319  1.00 91.95  ? 464 MET B CA  1 
ATOM   7046 C  C   . MET B 1 464 ? -33.238 -33.513 -4.138  1.00 92.80  ? 464 MET B C   1 
ATOM   7047 O  O   . MET B 1 464 ? -33.738 -32.413 -3.865  1.00 91.56  ? 464 MET B O   1 
ATOM   7048 C  CB  . MET B 1 464 ? -34.362 -35.626 -4.801  1.00 91.56  ? 464 MET B CB  1 
ATOM   7049 C  CG  . MET B 1 464 ? -35.624 -36.054 -5.510  1.00 92.74  ? 464 MET B CG  1 
ATOM   7050 S  SD  . MET B 1 464 ? -36.950 -34.848 -5.353  1.00 95.06  ? 464 MET B SD  1 
ATOM   7051 C  CE  . MET B 1 464 ? -38.229 -35.655 -6.318  1.00 99.12  ? 464 MET B CE  1 
ATOM   7052 N  N   . LEU B 1 465 ? -32.238 -34.058 -3.454  1.00 94.01  ? 465 LEU B N   1 
ATOM   7053 C  CA  . LEU B 1 465 ? -31.656 -33.418 -2.289  1.00 96.45  ? 465 LEU B CA  1 
ATOM   7054 C  C   . LEU B 1 465 ? -31.128 -32.035 -2.603  1.00 93.33  ? 465 LEU B C   1 
ATOM   7055 O  O   . LEU B 1 465 ? -31.464 -31.067 -1.919  1.00 92.18  ? 465 LEU B O   1 
ATOM   7056 C  CB  . LEU B 1 465 ? -30.544 -34.285 -1.714  1.00 102.78 ? 465 LEU B CB  1 
ATOM   7057 C  CG  . LEU B 1 465 ? -31.054 -35.271 -0.672  1.00 111.43 ? 465 LEU B CG  1 
ATOM   7058 C  CD1 . LEU B 1 465 ? -29.907 -36.088 -0.133  1.00 115.50 ? 465 LEU B CD1 1 
ATOM   7059 C  CD2 . LEU B 1 465 ? -31.740 -34.509 0.448   1.00 115.42 ? 465 LEU B CD2 1 
ATOM   7060 N  N   . SER B 1 466 ? -30.295 -31.954 -3.634  1.00 81.49  ? 466 SER B N   1 
ATOM   7061 C  CA  . SER B 1 466 ? -29.741 -30.686 -4.079  1.00 78.22  ? 466 SER B CA  1 
ATOM   7062 C  C   . SER B 1 466 ? -30.865 -29.696 -4.331  1.00 79.50  ? 466 SER B C   1 
ATOM   7063 O  O   . SER B 1 466 ? -30.802 -28.536 -3.920  1.00 78.90  ? 466 SER B O   1 
ATOM   7064 C  CB  . SER B 1 466 ? -28.904 -30.868 -5.350  1.00 74.32  ? 466 SER B CB  1 
ATOM   7065 O  OG  . SER B 1 466 ? -28.371 -29.631 -5.807  1.00 72.71  ? 466 SER B OG  1 
ATOM   7066 N  N   . SER B 1 467 ? -31.901 -30.174 -5.007  1.00 83.73  ? 467 SER B N   1 
ATOM   7067 C  CA  . SER B 1 467 ? -33.026 -29.333 -5.378  1.00 83.07  ? 467 SER B CA  1 
ATOM   7068 C  C   . SER B 1 467 ? -33.687 -28.728 -4.154  1.00 82.67  ? 467 SER B C   1 
ATOM   7069 O  O   . SER B 1 467 ? -33.817 -27.504 -4.048  1.00 82.63  ? 467 SER B O   1 
ATOM   7070 C  CB  . SER B 1 467 ? -34.052 -30.134 -6.175  1.00 82.96  ? 467 SER B CB  1 
ATOM   7071 O  OG  . SER B 1 467 ? -33.451 -30.730 -7.311  1.00 82.96  ? 467 SER B OG  1 
ATOM   7072 N  N   . LEU B 1 468 ? -34.098 -29.597 -3.234  1.00 83.92  ? 468 LEU B N   1 
ATOM   7073 C  CA  . LEU B 1 468 ? -34.766 -29.179 -2.005  1.00 83.67  ? 468 LEU B CA  1 
ATOM   7074 C  C   . LEU B 1 468 ? -33.915 -28.198 -1.222  1.00 83.72  ? 468 LEU B C   1 
ATOM   7075 O  O   . LEU B 1 468 ? -34.355 -27.107 -0.847  1.00 83.70  ? 468 LEU B O   1 
ATOM   7076 C  CB  . LEU B 1 468 ? -35.028 -30.388 -1.115  1.00 83.50  ? 468 LEU B CB  1 
ATOM   7077 C  CG  . LEU B 1 468 ? -36.311 -31.168 -1.359  1.00 83.41  ? 468 LEU B CG  1 
ATOM   7078 C  CD1 . LEU B 1 468 ? -36.359 -32.337 -0.409  1.00 83.42  ? 468 LEU B CD1 1 
ATOM   7079 C  CD2 . LEU B 1 468 ? -37.505 -30.268 -1.151  1.00 83.41  ? 468 LEU B CD2 1 
ATOM   7080 N  N   . LEU B 1 469 ? -32.682 -28.618 -0.990  1.00 69.06  ? 469 LEU B N   1 
ATOM   7081 C  CA  . LEU B 1 469 ? -31.736 -27.879 -0.186  1.00 69.18  ? 469 LEU B CA  1 
ATOM   7082 C  C   . LEU B 1 469 ? -31.457 -26.505 -0.768  1.00 69.52  ? 469 LEU B C   1 
ATOM   7083 O  O   . LEU B 1 469 ? -31.094 -25.572 -0.045  1.00 69.53  ? 469 LEU B O   1 
ATOM   7084 C  CB  . LEU B 1 469 ? -30.440 -28.661 -0.123  1.00 69.04  ? 469 LEU B CB  1 
ATOM   7085 C  CG  . LEU B 1 469 ? -29.936 -28.812 1.293   1.00 68.94  ? 469 LEU B CG  1 
ATOM   7086 C  CD1 . LEU B 1 469 ? -31.045 -29.409 2.136   1.00 68.91  ? 469 LEU B CD1 1 
ATOM   7087 C  CD2 . LEU B 1 469 ? -28.746 -29.719 1.288   1.00 68.92  ? 469 LEU B CD2 1 
ATOM   7088 N  N   . ALA B 1 470 ? -31.612 -26.379 -2.080  1.00 110.13 ? 470 ALA B N   1 
ATOM   7089 C  CA  . ALA B 1 470 ? -31.361 -25.107 -2.727  1.00 110.52 ? 470 ALA B CA  1 
ATOM   7090 C  C   . ALA B 1 470 ? -32.659 -24.326 -2.771  1.00 111.07 ? 470 ALA B C   1 
ATOM   7091 O  O   . ALA B 1 470 ? -32.701 -23.195 -3.252  1.00 111.09 ? 470 ALA B O   1 
ATOM   7092 C  CB  . ALA B 1 470 ? -30.820 -25.319 -4.117  1.00 110.43 ? 470 ALA B CB  1 
ATOM   7093 N  N   . GLY B 1 471 ? -33.715 -24.936 -2.244  1.00 113.74 ? 471 GLY B N   1 
ATOM   7094 C  CA  . GLY B 1 471 ? -34.998 -24.272 -2.130  1.00 114.37 ? 471 GLY B CA  1 
ATOM   7095 C  C   . GLY B 1 471 ? -35.752 -24.135 -3.438  1.00 115.10 ? 471 GLY B C   1 
ATOM   7096 O  O   . GLY B 1 471 ? -36.652 -23.302 -3.550  1.00 115.13 ? 471 GLY B O   1 
ATOM   7097 N  N   . LYS B 1 472 ? -35.391 -24.941 -4.431  1.00 119.44 ? 472 LYS B N   1 
ATOM   7098 C  CA  . LYS B 1 472 ? -36.081 -24.897 -5.717  1.00 120.19 ? 472 LYS B CA  1 
ATOM   7099 C  C   . LYS B 1 472 ? -37.422 -25.609 -5.631  1.00 120.80 ? 472 LYS B C   1 
ATOM   7100 O  O   . LYS B 1 472 ? -38.384 -25.232 -6.303  1.00 120.87 ? 472 LYS B O   1 
ATOM   7101 C  CB  . LYS B 1 472 ? -35.226 -25.518 -6.822  1.00 120.30 ? 472 LYS B CB  1 
ATOM   7102 C  CG  . LYS B 1 472 ? -33.870 -24.856 -7.002  1.00 120.39 ? 472 LYS B CG  1 
ATOM   7103 C  CD  . LYS B 1 472 ? -34.014 -23.409 -7.474  1.00 120.45 ? 472 LYS B CD  1 
ATOM   7104 C  CE  . LYS B 1 472 ? -32.662 -22.700 -7.491  1.00 120.49 ? 472 LYS B CE  1 
ATOM   7105 N  NZ  . LYS B 1 472 ? -32.775 -21.274 -7.913  1.00 120.54 1 472 LYS B NZ  1 
ATOM   7106 N  N   . VAL B 1 473 ? -37.485 -26.646 -4.809  1.00 102.65 ? 473 VAL B N   1 
ATOM   7107 C  CA  . VAL B 1 473 ? -38.719 -27.401 -4.651  1.00 103.21 ? 473 VAL B CA  1 
ATOM   7108 C  C   . VAL B 1 473 ? -39.024 -27.607 -3.175  1.00 103.58 ? 473 VAL B C   1 
ATOM   7109 O  O   . VAL B 1 473 ? -38.191 -27.333 -2.306  1.00 103.58 ? 473 VAL B O   1 
ATOM   7110 C  CB  . VAL B 1 473 ? -38.668 -28.767 -5.358  1.00 103.34 ? 473 VAL B CB  1 
ATOM   7111 C  CG1 . VAL B 1 473 ? -38.476 -28.577 -6.844  1.00 103.39 ? 473 VAL B CG1 1 
ATOM   7112 C  CG2 . VAL B 1 473 ? -37.556 -29.620 -4.779  1.00 103.35 ? 473 VAL B CG2 1 
ATOM   7113 N  N   . GLN B 1 474 ? -40.235 -28.076 -2.905  1.00 103.19 ? 474 GLN B N   1 
ATOM   7114 C  CA  . GLN B 1 474 ? -40.694 -28.305 -1.548  1.00 103.47 ? 474 GLN B CA  1 
ATOM   7115 C  C   . GLN B 1 474 ? -40.910 -29.791 -1.331  1.00 102.99 ? 474 GLN B C   1 
ATOM   7116 O  O   . GLN B 1 474 ? -41.116 -30.536 -2.288  1.00 103.04 ? 474 GLN B O   1 
ATOM   7117 C  CB  . GLN B 1 474 ? -41.982 -27.529 -1.306  1.00 104.04 ? 474 GLN B CB  1 
ATOM   7118 C  CG  . GLN B 1 474 ? -41.777 -26.037 -1.375  1.00 104.44 ? 474 GLN B CG  1 
ATOM   7119 C  CD  . GLN B 1 474 ? -40.779 -25.557 -0.340  1.00 104.73 ? 474 GLN B CD  1 
ATOM   7120 O  OE1 . GLN B 1 474 ? -39.627 -25.249 -0.658  1.00 104.79 ? 474 GLN B OE1 1 
ATOM   7121 N  NE2 . GLN B 1 474 ? -41.218 -25.494 0.914   1.00 104.92 ? 474 GLN B NE2 1 
ATOM   7122 N  N   . PRO B 1 475 ? -40.829 -30.237 -0.068  1.00 77.83  ? 475 PRO B N   1 
ATOM   7123 C  CA  . PRO B 1 475 ? -40.950 -31.666 0.237   1.00 78.05  ? 475 PRO B CA  1 
ATOM   7124 C  C   . PRO B 1 475 ? -42.316 -32.215 -0.136  1.00 79.24  ? 475 PRO B C   1 
ATOM   7125 O  O   . PRO B 1 475 ? -42.465 -33.417 -0.376  1.00 79.27  ? 475 PRO B O   1 
ATOM   7126 C  CB  . PRO B 1 475 ? -40.788 -31.711 1.756   1.00 77.44  ? 475 PRO B CB  1 
ATOM   7127 C  CG  . PRO B 1 475 ? -40.091 -30.441 2.099   1.00 77.18  ? 475 PRO B CG  1 
ATOM   7128 C  CD  . PRO B 1 475 ? -40.609 -29.433 1.142   1.00 77.32  ? 475 PRO B CD  1 
ATOM   7129 N  N   . SER B 1 476 ? -43.304 -31.329 -0.176  1.00 104.23 ? 476 SER B N   1 
ATOM   7130 C  CA  . SER B 1 476 ? -44.670 -31.703 -0.501  1.00 105.59 ? 476 SER B CA  1 
ATOM   7131 C  C   . SER B 1 476 ? -44.962 -31.613 -2.001  1.00 107.01 ? 476 SER B C   1 
ATOM   7132 O  O   . SER B 1 476 ? -46.052 -31.978 -2.447  1.00 107.13 ? 476 SER B O   1 
ATOM   7133 C  CB  . SER B 1 476 ? -45.638 -30.823 0.284   1.00 105.58 ? 476 SER B CB  1 
ATOM   7134 O  OG  . SER B 1 476 ? -45.318 -29.451 0.117   1.00 105.52 ? 476 SER B OG  1 
ATOM   7135 N  N   . ASP B 1 477 ? -43.993 -31.118 -2.771  1.00 89.83  ? 477 ASP B N   1 
ATOM   7136 C  CA  . ASP B 1 477 ? -44.145 -30.957 -4.221  1.00 91.10  ? 477 ASP B CA  1 
ATOM   7137 C  C   . ASP B 1 477 ? -44.114 -32.264 -4.987  1.00 91.72  ? 477 ASP B C   1 
ATOM   7138 O  O   . ASP B 1 477 ? -43.566 -33.263 -4.519  1.00 91.79  ? 477 ASP B O   1 
ATOM   7139 C  CB  . ASP B 1 477 ? -43.071 -30.033 -4.790  1.00 91.45  ? 477 ASP B CB  1 
ATOM   7140 C  CG  . ASP B 1 477 ? -43.400 -28.577 -4.598  1.00 91.58  ? 477 ASP B CG  1 
ATOM   7141 O  OD1 . ASP B 1 477 ? -42.459 -27.756 -4.558  1.00 91.70  ? 477 ASP B OD1 1 
ATOM   7142 O  OD2 . ASP B 1 477 ? -44.605 -28.261 -4.470  1.00 91.68  1 477 ASP B OD2 1 
ATOM   7143 N  N   . GLN B 1 478 ? -44.694 -32.236 -6.181  1.00 109.70 ? 478 GLN B N   1 
ATOM   7144 C  CA  . GLN B 1 478 ? -44.717 -33.399 -7.048  1.00 110.08 ? 478 GLN B CA  1 
ATOM   7145 C  C   . GLN B 1 478 ? -43.365 -33.586 -7.713  1.00 110.07 ? 478 GLN B C   1 
ATOM   7146 O  O   . GLN B 1 478 ? -42.679 -32.620 -8.059  1.00 110.11 ? 478 GLN B O   1 
ATOM   7147 C  CB  . GLN B 1 478 ? -45.804 -33.259 -8.102  1.00 110.29 ? 478 GLN B CB  1 
ATOM   7148 C  CG  . GLN B 1 478 ? -47.206 -33.336 -7.535  1.00 110.40 ? 478 GLN B CG  1 
ATOM   7149 C  CD  . GLN B 1 478 ? -48.139 -34.136 -8.423  1.00 110.45 ? 478 GLN B CD  1 
ATOM   7150 O  OE1 . GLN B 1 478 ? -47.694 -34.866 -9.314  1.00 110.41 ? 478 GLN B OE1 1 
ATOM   7151 N  NE2 . GLN B 1 478 ? -49.439 -34.002 -8.189  1.00 110.48 ? 478 GLN B NE2 1 
ATOM   7152 N  N   . VAL B 1 479 ? -43.016 -34.847 -7.914  1.00 97.99  ? 479 VAL B N   1 
ATOM   7153 C  CA  . VAL B 1 479 ? -41.731 -35.255 -8.455  1.00 97.76  ? 479 VAL B CA  1 
ATOM   7154 C  C   . VAL B 1 479 ? -41.317 -34.610 -9.774  1.00 96.89  ? 479 VAL B C   1 
ATOM   7155 O  O   . VAL B 1 479 ? -40.136 -34.282 -9.965  1.00 96.89  ? 479 VAL B O   1 
ATOM   7156 C  CB  . VAL B 1 479 ? -41.720 -36.783 -8.614  1.00 98.17  ? 479 VAL B CB  1 
ATOM   7157 C  CG1 . VAL B 1 479 ? -40.824 -37.222 -9.754  1.00 98.18  ? 479 VAL B CG1 1 
ATOM   7158 C  CG2 . VAL B 1 479 ? -41.300 -37.418 -7.315  1.00 98.34  ? 479 VAL B CG2 1 
ATOM   7159 N  N   . GLY B 1 480 ? -42.283 -34.404 -10.663 1.00 124.33 ? 480 GLY B N   1 
ATOM   7160 C  CA  . GLY B 1 480 ? -41.989 -33.996 -12.025 1.00 123.20 ? 480 GLY B CA  1 
ATOM   7161 C  C   . GLY B 1 480 ? -41.059 -32.809 -12.191 1.00 121.88 ? 480 GLY B C   1 
ATOM   7162 O  O   . GLY B 1 480 ? -40.301 -32.747 -13.155 1.00 121.76 ? 480 GLY B O   1 
ATOM   7163 N  N   . LYS B 1 481 ? -41.093 -31.871 -11.257 1.00 118.65 ? 481 LYS B N   1 
ATOM   7164 C  CA  . LYS B 1 481 ? -40.248 -30.691 -11.366 1.00 108.48 ? 481 LYS B CA  1 
ATOM   7165 C  C   . LYS B 1 481 ? -38.769 -31.071 -11.334 1.00 104.02 ? 481 LYS B C   1 
ATOM   7166 O  O   . LYS B 1 481 ? -37.937 -30.437 -11.981 1.00 101.31 ? 481 LYS B O   1 
ATOM   7167 C  CB  . LYS B 1 481 ? -40.575 -29.718 -10.242 1.00 106.36 ? 481 LYS B CB  1 
ATOM   7168 C  CG  . LYS B 1 481 ? -42.071 -29.506 -10.070 1.00 104.52 ? 481 LYS B CG  1 
ATOM   7169 C  CD  . LYS B 1 481 ? -42.386 -28.718 -8.814  1.00 104.86 ? 481 LYS B CD  1 
ATOM   7170 C  CE  . LYS B 1 481 ? -43.876 -28.425 -8.727  1.00 105.24 ? 481 LYS B CE  1 
ATOM   7171 N  NZ  . LYS B 1 481 ? -44.705 -29.662 -8.853  1.00 105.50 1 481 LYS B NZ  1 
ATOM   7172 N  N   . VAL B 1 482 ? -38.443 -32.099 -10.565 1.00 109.79 ? 482 VAL B N   1 
ATOM   7173 C  CA  . VAL B 1 482 ? -37.069 -32.561 -10.475 1.00 107.21 ? 482 VAL B CA  1 
ATOM   7174 C  C   . VAL B 1 482 ? -36.736 -33.610 -11.530 1.00 100.72 ? 482 VAL B C   1 
ATOM   7175 O  O   . VAL B 1 482 ? -35.568 -33.843 -11.848 1.00 98.27  ? 482 VAL B O   1 
ATOM   7176 C  CB  . VAL B 1 482 ? -36.786 -33.078 -9.041  1.00 110.49 ? 482 VAL B CB  1 
ATOM   7177 C  CG1 . VAL B 1 482 ? -35.739 -34.188 -9.004  1.00 119.18 ? 482 VAL B CG1 1 
ATOM   7178 C  CG2 . VAL B 1 482 ? -36.393 -31.921 -8.154  1.00 117.21 ? 482 VAL B CG2 1 
ATOM   7179 N  N   . ILE B 1 483 ? -37.768 -34.171 -12.143 1.00 91.05  ? 483 ILE B N   1 
ATOM   7180 C  CA  . ILE B 1 483 ? -37.585 -35.383 -12.924 1.00 87.21  ? 483 ILE B CA  1 
ATOM   7181 C  C   . ILE B 1 483 ? -36.688 -35.197 -14.152 1.00 86.26  ? 483 ILE B C   1 
ATOM   7182 O  O   . ILE B 1 483 ? -36.668 -34.128 -14.775 1.00 85.73  ? 483 ILE B O   1 
ATOM   7183 C  CB  . ILE B 1 483 ? -38.925 -35.992 -13.346 1.00 86.04  ? 483 ILE B CB  1 
ATOM   7184 C  CG1 . ILE B 1 483 ? -38.756 -37.481 -13.618 1.00 83.43  ? 483 ILE B CG1 1 
ATOM   7185 C  CG2 . ILE B 1 483 ? -39.470 -35.291 -14.576 1.00 85.62  ? 483 ILE B CG2 1 
ATOM   7186 C  CD1 . ILE B 1 483 ? -39.951 -38.107 -14.247 1.00 80.51  ? 483 ILE B CD1 1 
ATOM   7187 N  N   . TYR B 1 484 ? -35.932 -36.245 -14.478 1.00 87.65  ? 484 TYR B N   1 
ATOM   7188 C  CA  . TYR B 1 484 ? -35.107 -36.269 -15.679 1.00 86.09  ? 484 TYR B CA  1 
ATOM   7189 C  C   . TYR B 1 484 ? -35.888 -36.911 -16.809 1.00 86.48  ? 484 TYR B C   1 
ATOM   7190 O  O   . TYR B 1 484 ? -36.162 -38.111 -16.778 1.00 87.47  ? 484 TYR B O   1 
ATOM   7191 C  CB  . TYR B 1 484 ? -33.850 -37.096 -15.450 1.00 84.49  ? 484 TYR B CB  1 
ATOM   7192 C  CG  . TYR B 1 484 ? -32.850 -36.500 -14.496 1.00 80.61  ? 484 TYR B CG  1 
ATOM   7193 C  CD1 . TYR B 1 484 ? -32.837 -35.135 -14.221 1.00 79.09  ? 484 TYR B CD1 1 
ATOM   7194 C  CD2 . TYR B 1 484 ? -31.909 -37.308 -13.872 1.00 76.78  ? 484 TYR B CD2 1 
ATOM   7195 C  CE1 . TYR B 1 484 ? -31.906 -34.597 -13.348 1.00 79.50  ? 484 TYR B CE1 1 
ATOM   7196 C  CE2 . TYR B 1 484 ? -30.985 -36.786 -13.010 1.00 76.57  ? 484 TYR B CE2 1 
ATOM   7197 C  CZ  . TYR B 1 484 ? -30.983 -35.433 -12.747 1.00 78.61  ? 484 TYR B CZ  1 
ATOM   7198 O  OH  . TYR B 1 484 ? -30.045 -34.929 -11.875 1.00 79.99  ? 484 TYR B OH  1 
ATOM   7199 N  N   . LYS B 1 485 ? -36.232 -36.111 -17.811 1.00 95.22  ? 485 LYS B N   1 
ATOM   7200 C  CA  . LYS B 1 485 ? -37.110 -36.560 -18.882 1.00 93.48  ? 485 LYS B CA  1 
ATOM   7201 C  C   . LYS B 1 485 ? -36.430 -37.414 -19.962 1.00 90.31  ? 485 LYS B C   1 
ATOM   7202 O  O   . LYS B 1 485 ? -37.051 -38.321 -20.518 1.00 91.66  ? 485 LYS B O   1 
ATOM   7203 C  CB  . LYS B 1 485 ? -37.783 -35.351 -19.527 1.00 95.05  ? 485 LYS B CB  1 
ATOM   7204 C  CG  . LYS B 1 485 ? -38.845 -34.689 -18.660 1.00 96.93  ? 485 LYS B CG  1 
ATOM   7205 C  CD  . LYS B 1 485 ? -40.128 -35.510 -18.604 1.00 99.55  ? 485 LYS B CD  1 
ATOM   7206 C  CE  . LYS B 1 485 ? -41.248 -34.725 -17.927 1.00 101.34 ? 485 LYS B CE  1 
ATOM   7207 N  NZ  . LYS B 1 485 ? -42.529 -35.493 -17.858 1.00 102.45 1 485 LYS B NZ  1 
ATOM   7208 N  N   . GLN B 1 486 ? -35.163 -37.128 -20.252 1.00 80.06  ? 486 GLN B N   1 
ATOM   7209 C  CA  . GLN B 1 486 ? -34.494 -37.694 -21.421 1.00 75.56  ? 486 GLN B CA  1 
ATOM   7210 C  C   . GLN B 1 486 ? -33.730 -38.991 -21.161 1.00 75.72  ? 486 GLN B C   1 
ATOM   7211 O  O   . GLN B 1 486 ? -32.792 -39.017 -20.362 1.00 73.79  ? 486 GLN B O   1 
ATOM   7212 C  CB  . GLN B 1 486 ? -33.554 -36.662 -22.032 1.00 73.46  ? 486 GLN B CB  1 
ATOM   7213 C  CG  . GLN B 1 486 ? -32.831 -37.147 -23.273 1.00 70.65  ? 486 GLN B CG  1 
ATOM   7214 C  CD  . GLN B 1 486 ? -31.986 -36.055 -23.914 1.00 69.79  ? 486 GLN B CD  1 
ATOM   7215 O  OE1 . GLN B 1 486 ? -32.355 -34.874 -23.909 1.00 72.50  ? 486 GLN B OE1 1 
ATOM   7216 N  NE2 . GLN B 1 486 ? -30.841 -36.447 -24.467 1.00 67.11  ? 486 GLN B NE2 1 
ATOM   7217 N  N   . PHE B 1 487 ? -34.110 -40.058 -21.856 1.00 72.80  ? 487 PHE B N   1 
ATOM   7218 C  CA  . PHE B 1 487 ? -33.435 -41.344 -21.713 1.00 77.29  ? 487 PHE B CA  1 
ATOM   7219 C  C   . PHE B 1 487 ? -33.620 -42.186 -22.972 1.00 82.16  ? 487 PHE B C   1 
ATOM   7220 O  O   . PHE B 1 487 ? -34.310 -41.773 -23.913 1.00 80.80  ? 487 PHE B O   1 
ATOM   7221 C  CB  . PHE B 1 487 ? -33.989 -42.089 -20.507 1.00 76.08  ? 487 PHE B CB  1 
ATOM   7222 C  CG  . PHE B 1 487 ? -35.427 -42.480 -20.655 1.00 74.63  ? 487 PHE B CG  1 
ATOM   7223 C  CD1 . PHE B 1 487 ? -36.435 -41.541 -20.477 1.00 72.99  ? 487 PHE B CD1 1 
ATOM   7224 C  CD2 . PHE B 1 487 ? -35.776 -43.789 -20.951 1.00 74.20  ? 487 PHE B CD2 1 
ATOM   7225 C  CE1 . PHE B 1 487 ? -37.763 -41.897 -20.610 1.00 71.72  ? 487 PHE B CE1 1 
ATOM   7226 C  CE2 . PHE B 1 487 ? -37.101 -44.153 -21.083 1.00 73.78  ? 487 PHE B CE2 1 
ATOM   7227 C  CZ  . PHE B 1 487 ? -38.097 -43.208 -20.911 1.00 72.57  ? 487 PHE B CZ  1 
ATOM   7228 N  N   . LYS B 1 488 ? -33.031 -43.377 -22.986 1.00 71.85  ? 488 LYS B N   1 
ATOM   7229 C  CA  . LYS B 1 488 ? -33.124 -44.234 -24.164 1.00 79.85  ? 488 LYS B CA  1 
ATOM   7230 C  C   . LYS B 1 488 ? -33.218 -45.717 -23.806 1.00 79.92  ? 488 LYS B C   1 
ATOM   7231 O  O   . LYS B 1 488 ? -32.508 -46.199 -22.922 1.00 80.11  ? 488 LYS B O   1 
ATOM   7232 C  CB  . LYS B 1 488 ? -31.927 -43.983 -25.089 1.00 84.95  ? 488 LYS B CB  1 
ATOM   7233 C  CG  . LYS B 1 488 ? -32.073 -44.512 -26.510 1.00 97.54  ? 488 LYS B CG  1 
ATOM   7234 C  CD  . LYS B 1 488 ? -33.206 -43.825 -27.258 1.00 109.17 ? 488 LYS B CD  1 
ATOM   7235 C  CE  . LYS B 1 488 ? -33.326 -44.358 -28.684 1.00 112.25 ? 488 LYS B CE  1 
ATOM   7236 N  NZ  . LYS B 1 488 ? -33.687 -45.803 -28.738 1.00 113.65 1 488 LYS B NZ  1 
ATOM   7237 N  N   . GLN B 1 489 ? -34.076 -46.440 -24.519 1.00 95.30  ? 489 GLN B N   1 
ATOM   7238 C  CA  . GLN B 1 489 ? -34.321 -47.855 -24.253 1.00 95.90  ? 489 GLN B CA  1 
ATOM   7239 C  C   . GLN B 1 489 ? -33.234 -48.789 -24.793 1.00 97.79  ? 489 GLN B C   1 
ATOM   7240 O  O   . GLN B 1 489 ? -32.505 -48.438 -25.722 1.00 97.76  ? 489 GLN B O   1 
ATOM   7241 C  CB  . GLN B 1 489 ? -35.688 -48.259 -24.800 1.00 94.79  ? 489 GLN B CB  1 
ATOM   7242 C  CG  . GLN B 1 489 ? -36.774 -47.208 -24.578 1.00 92.44  ? 489 GLN B CG  1 
ATOM   7243 C  CD  . GLN B 1 489 ? -38.016 -47.769 -23.887 1.00 90.36  ? 489 GLN B CD  1 
ATOM   7244 O  OE1 . GLN B 1 489 ? -37.932 -48.410 -22.833 1.00 89.39  ? 489 GLN B OE1 1 
ATOM   7245 N  NE2 . GLN B 1 489 ? -39.179 -47.527 -24.488 1.00 90.33  ? 489 GLN B NE2 1 
ATOM   7246 N  N   . ILE B 1 490 ? -33.139 -49.978 -24.199 1.00 104.82 ? 490 ILE B N   1 
ATOM   7247 C  CA  . ILE B 1 490 ? -32.151 -50.984 -24.577 1.00 109.60 ? 490 ILE B CA  1 
ATOM   7248 C  C   . ILE B 1 490 ? -32.679 -52.393 -24.312 1.00 112.49 ? 490 ILE B C   1 
ATOM   7249 O  O   . ILE B 1 490 ? -33.463 -52.596 -23.384 1.00 110.05 ? 490 ILE B O   1 
ATOM   7250 C  CB  . ILE B 1 490 ? -30.835 -50.754 -23.808 1.00 109.23 ? 490 ILE B CB  1 
ATOM   7251 C  CG1 . ILE B 1 490 ? -29.922 -49.843 -24.615 1.00 113.05 ? 490 ILE B CG1 1 
ATOM   7252 C  CG2 . ILE B 1 490 ? -30.088 -52.055 -23.551 1.00 112.12 ? 490 ILE B CG2 1 
ATOM   7253 C  CD1 . ILE B 1 490 ? -29.378 -50.513 -25.848 1.00 118.38 ? 490 ILE B CD1 1 
ATOM   7254 N  N   . ARG B 1 491 ? -32.256 -53.364 -25.118 1.00 102.54 ? 491 ARG B N   1 
ATOM   7255 C  CA  . ARG B 1 491 ? -32.585 -54.760 -24.858 1.00 107.86 ? 491 ARG B CA  1 
ATOM   7256 C  C   . ARG B 1 491 ? -31.351 -55.485 -24.327 1.00 105.43 ? 491 ARG B C   1 
ATOM   7257 O  O   . ARG B 1 491 ? -30.226 -55.127 -24.670 1.00 108.95 ? 491 ARG B O   1 
ATOM   7258 C  CB  . ARG B 1 491 ? -33.080 -55.444 -26.135 1.00 113.06 ? 491 ARG B CB  1 
ATOM   7259 C  CG  . ARG B 1 491 ? -34.099 -54.635 -26.931 1.00 119.60 ? 491 ARG B CG  1 
ATOM   7260 C  CD  . ARG B 1 491 ? -34.561 -55.396 -28.170 1.00 124.06 ? 491 ARG B CD  1 
ATOM   7261 N  NE  . ARG B 1 491 ? -35.164 -54.516 -29.171 1.00 125.12 ? 491 ARG B NE  1 
ATOM   7262 C  CZ  . ARG B 1 491 ? -34.494 -53.955 -30.176 1.00 125.50 ? 491 ARG B CZ  1 
ATOM   7263 N  NH1 . ARG B 1 491 ? -33.192 -54.181 -30.317 1.00 125.59 1 491 ARG B NH1 1 
ATOM   7264 N  NH2 . ARG B 1 491 ? -35.122 -53.168 -31.042 1.00 125.60 ? 491 ARG B NH2 1 
ATOM   7265 N  N   . LEU B 1 492 ? -31.559 -56.480 -23.468 1.00 119.23 ? 492 LEU B N   1 
ATOM   7266 C  CA  . LEU B 1 492 ? -30.453 -57.278 -22.940 1.00 114.50 ? 492 LEU B CA  1 
ATOM   7267 C  C   . LEU B 1 492 ? -29.605 -57.883 -24.046 1.00 116.24 ? 492 LEU B C   1 
ATOM   7268 O  O   . LEU B 1 492 ? -28.416 -58.152 -23.860 1.00 114.53 ? 492 LEU B O   1 
ATOM   7269 C  CB  . LEU B 1 492 ? -30.969 -58.410 -22.063 1.00 110.15 ? 492 LEU B CB  1 
ATOM   7270 C  CG  . LEU B 1 492 ? -31.293 -58.057 -20.618 1.00 102.55 ? 492 LEU B CG  1 
ATOM   7271 C  CD1 . LEU B 1 492 ? -32.719 -57.592 -20.544 1.00 97.38  ? 492 LEU B CD1 1 
ATOM   7272 C  CD2 . LEU B 1 492 ? -31.081 -59.258 -19.721 1.00 94.84  ? 492 LEU B CD2 1 
ATOM   7273 N  N   . THR B 1 493 ? -30.234 -58.114 -25.192 1.00 156.99 ? 493 THR B N   1 
ATOM   7274 C  CA  . THR B 1 493 ? -29.574 -58.759 -26.314 1.00 158.54 ? 493 THR B CA  1 
ATOM   7275 C  C   . THR B 1 493 ? -28.904 -57.734 -27.211 1.00 160.87 ? 493 THR B C   1 
ATOM   7276 O  O   . THR B 1 493 ? -28.377 -58.075 -28.270 1.00 162.12 ? 493 THR B O   1 
ATOM   7277 C  CB  . THR B 1 493 ? -30.564 -59.569 -27.150 1.00 156.86 ? 493 THR B CB  1 
ATOM   7278 O  OG1 . THR B 1 493 ? -31.579 -58.694 -27.658 1.00 154.63 ? 493 THR B OG1 1 
ATOM   7279 C  CG2 . THR B 1 493 ? -31.208 -60.647 -26.296 1.00 154.60 ? 493 THR B CG2 1 
ATOM   7280 N  N   . ASP B 1 494 ? -28.949 -56.474 -26.801 1.00 124.25 ? 494 ASP B N   1 
ATOM   7281 C  CA  . ASP B 1 494 ? -28.223 -55.438 -27.514 1.00 122.66 ? 494 ASP B CA  1 
ATOM   7282 C  C   . ASP B 1 494 ? -26.739 -55.552 -27.225 1.00 116.73 ? 494 ASP B C   1 
ATOM   7283 O  O   . ASP B 1 494 ? -26.325 -56.170 -26.241 1.00 116.52 ? 494 ASP B O   1 
ATOM   7284 C  CB  . ASP B 1 494 ? -28.732 -54.047 -27.155 1.00 127.06 ? 494 ASP B CB  1 
ATOM   7285 C  CG  . ASP B 1 494 ? -30.073 -53.744 -27.782 1.00 136.22 ? 494 ASP B CG  1 
ATOM   7286 O  OD1 . ASP B 1 494 ? -30.419 -54.409 -28.784 1.00 144.72 ? 494 ASP B OD1 1 
ATOM   7287 O  OD2 . ASP B 1 494 ? -30.778 -52.843 -27.282 1.00 144.72 1 494 ASP B OD2 1 
ATOM   7288 N  N   . THR B 1 495 ? -25.942 -54.962 -28.104 1.00 119.35 ? 495 THR B N   1 
ATOM   7289 C  CA  . THR B 1 495 ? -24.495 -54.981 -27.970 1.00 112.93 ? 495 THR B CA  1 
ATOM   7290 C  C   . THR B 1 495 ? -23.961 -53.777 -27.209 1.00 110.27 ? 495 THR B C   1 
ATOM   7291 O  O   . THR B 1 495 ? -24.496 -52.670 -27.315 1.00 108.01 ? 495 THR B O   1 
ATOM   7292 C  CB  . THR B 1 495 ? -23.811 -55.034 -29.327 1.00 111.89 ? 495 THR B CB  1 
ATOM   7293 O  OG1 . THR B 1 495 ? -22.404 -54.847 -29.142 1.00 111.49 ? 495 THR B OG1 1 
ATOM   7294 C  CG2 . THR B 1 495 ? -24.338 -53.918 -30.211 1.00 111.49 ? 495 THR B CG2 1 
ATOM   7295 N  N   . LEU B 1 496 ? -22.904 -54.003 -26.437 1.00 113.53 ? 496 LEU B N   1 
ATOM   7296 C  CA  . LEU B 1 496 ? -22.286 -52.950 -25.643 1.00 114.17 ? 496 LEU B CA  1 
ATOM   7297 C  C   . LEU B 1 496 ? -21.870 -51.742 -26.477 1.00 113.02 ? 496 LEU B C   1 
ATOM   7298 O  O   . LEU B 1 496 ? -21.828 -50.618 -25.972 1.00 112.29 ? 496 LEU B O   1 
ATOM   7299 C  CB  . LEU B 1 496 ? -21.071 -53.493 -24.893 1.00 115.41 ? 496 LEU B CB  1 
ATOM   7300 C  CG  . LEU B 1 496 ? -21.379 -54.495 -23.784 1.00 120.61 ? 496 LEU B CG  1 
ATOM   7301 C  CD1 . LEU B 1 496 ? -20.136 -54.769 -22.960 1.00 125.82 ? 496 LEU B CD1 1 
ATOM   7302 C  CD2 . LEU B 1 496 ? -22.491 -53.966 -22.902 1.00 125.81 ? 496 LEU B CD2 1 
ATOM   7303 N  N   . GLY B 1 497 ? -21.553 -51.971 -27.746 1.00 114.96 ? 497 GLY B N   1 
ATOM   7304 C  CA  . GLY B 1 497 ? -21.160 -50.886 -28.625 1.00 113.52 ? 497 GLY B CA  1 
ATOM   7305 C  C   . GLY B 1 497 ? -22.314 -49.927 -28.837 1.00 111.72 ? 497 GLY B C   1 
ATOM   7306 O  O   . GLY B 1 497 ? -22.159 -48.696 -28.729 1.00 112.53 ? 497 GLY B O   1 
ATOM   7307 N  N   . ARG B 1 498 ? -23.476 -50.501 -29.141 1.00 108.95 ? 498 ARG B N   1 
ATOM   7308 C  CA  . ARG B 1 498 ? -24.694 -49.728 -29.301 1.00 106.16 ? 498 ARG B CA  1 
ATOM   7309 C  C   . ARG B 1 498 ? -24.861 -48.864 -28.064 1.00 105.07 ? 498 ARG B C   1 
ATOM   7310 O  O   . ARG B 1 498 ? -25.179 -47.675 -28.155 1.00 104.26 ? 498 ARG B O   1 
ATOM   7311 C  CB  . ARG B 1 498 ? -25.906 -50.646 -29.453 1.00 105.50 ? 498 ARG B CB  1 
ATOM   7312 C  CG  . ARG B 1 498 ? -27.209 -49.890 -29.602 1.00 105.48 ? 498 ARG B CG  1 
ATOM   7313 C  CD  . ARG B 1 498 ? -27.452 -49.559 -31.061 1.00 108.57 ? 498 ARG B CD  1 
ATOM   7314 N  NE  . ARG B 1 498 ? -28.536 -48.600 -31.243 1.00 113.15 ? 498 ARG B NE  1 
ATOM   7315 C  CZ  . ARG B 1 498 ? -28.346 -47.348 -31.646 1.00 115.38 ? 498 ARG B CZ  1 
ATOM   7316 N  NH1 . ARG B 1 498 ? -27.117 -46.926 -31.932 1.00 116.71 1 498 ARG B NH1 1 
ATOM   7317 N  NH2 . ARG B 1 498 ? -29.378 -46.524 -31.788 1.00 115.85 ? 498 ARG B NH2 1 
ATOM   7318 N  N   . LEU B 1 499 ? -24.608 -49.470 -26.907 1.00 93.35  ? 499 LEU B N   1 
ATOM   7319 C  CA  . LEU B 1 499 ? -24.646 -48.750 -25.647 1.00 93.87  ? 499 LEU B CA  1 
ATOM   7320 C  C   . LEU B 1 499 ? -23.690 -47.578 -25.660 1.00 93.37  ? 499 LEU B C   1 
ATOM   7321 O  O   . LEU B 1 499 ? -24.057 -46.496 -25.245 1.00 92.12  ? 499 LEU B O   1 
ATOM   7322 C  CB  . LEU B 1 499 ? -24.324 -49.664 -24.471 1.00 94.82  ? 499 LEU B CB  1 
ATOM   7323 C  CG  . LEU B 1 499 ? -24.228 -48.933 -23.131 1.00 98.57  ? 499 LEU B CG  1 
ATOM   7324 C  CD1 . LEU B 1 499 ? -25.576 -48.358 -22.725 1.00 101.98 ? 499 LEU B CD1 1 
ATOM   7325 C  CD2 . LEU B 1 499 ? -23.700 -49.866 -22.062 1.00 103.59 ? 499 LEU B CD2 1 
ATOM   7326 N  N   . SER B 1 500 ? -22.468 -47.787 -26.134 1.00 102.15 ? 500 SER B N   1 
ATOM   7327 C  CA  . SER B 1 500 ? -21.500 -46.696 -26.195 1.00 103.33 ? 500 SER B CA  1 
ATOM   7328 C  C   . SER B 1 500 ? -22.015 -45.529 -27.033 1.00 103.00 ? 500 SER B C   1 
ATOM   7329 O  O   . SER B 1 500 ? -21.884 -44.361 -26.640 1.00 103.52 ? 500 SER B O   1 
ATOM   7330 C  CB  . SER B 1 500 ? -20.165 -47.186 -26.735 1.00 103.98 ? 500 SER B CB  1 
ATOM   7331 O  OG  . SER B 1 500 ? -19.607 -48.136 -25.848 1.00 106.96 ? 500 SER B OG  1 
ATOM   7332 N  N   . HIS B 1 501 ? -22.608 -45.847 -28.178 1.00 91.47  ? 501 HIS B N   1 
ATOM   7333 C  CA  . HIS B 1 501 ? -23.197 -44.811 -29.022 1.00 91.30  ? 501 HIS B CA  1 
ATOM   7334 C  C   . HIS B 1 501 ? -24.301 -44.051 -28.282 1.00 86.31  ? 501 HIS B C   1 
ATOM   7335 O  O   . HIS B 1 501 ? -24.300 -42.810 -28.207 1.00 85.25  ? 501 HIS B O   1 
ATOM   7336 C  CB  . HIS B 1 501 ? -23.762 -45.427 -30.300 1.00 95.89  ? 501 HIS B CB  1 
ATOM   7337 C  CG  . HIS B 1 501 ? -22.715 -45.913 -31.256 1.00 109.30 ? 501 HIS B CG  1 
ATOM   7338 N  ND1 . HIS B 1 501 ? -21.407 -45.485 -31.208 1.00 119.22 ? 501 HIS B ND1 1 
ATOM   7339 C  CD2 . HIS B 1 501 ? -22.784 -46.811 -32.262 1.00 119.22 ? 501 HIS B CD2 1 
ATOM   7340 C  CE1 . HIS B 1 501 ? -20.718 -46.087 -32.161 1.00 122.15 ? 501 HIS B CE1 1 
ATOM   7341 N  NE2 . HIS B 1 501 ? -21.525 -46.898 -32.813 1.00 122.17 ? 501 HIS B NE2 1 
ATOM   7342 N  N   . ILE B 1 502 ? -25.254 -44.800 -27.741 1.00 77.57  ? 502 ILE B N   1 
ATOM   7343 C  CA  . ILE B 1 502 ? -26.364 -44.198 -27.020 1.00 74.58  ? 502 ILE B CA  1 
ATOM   7344 C  C   . ILE B 1 502 ? -25.864 -43.288 -25.914 1.00 73.42  ? 502 ILE B C   1 
ATOM   7345 O  O   . ILE B 1 502 ? -26.380 -42.189 -25.707 1.00 71.26  ? 502 ILE B O   1 
ATOM   7346 C  CB  . ILE B 1 502 ? -27.261 -45.269 -26.428 1.00 74.06  ? 502 ILE B CB  1 
ATOM   7347 C  CG1 . ILE B 1 502 ? -27.796 -46.142 -27.559 1.00 75.86  ? 502 ILE B CG1 1 
ATOM   7348 C  CG2 . ILE B 1 502 ? -28.408 -44.632 -25.676 1.00 73.42  ? 502 ILE B CG2 1 
ATOM   7349 C  CD1 . ILE B 1 502 ? -28.702 -47.237 -27.094 1.00 80.02  ? 502 ILE B CD1 1 
ATOM   7350 N  N   . LEU B 1 503 ? -24.817 -43.742 -25.241 1.00 76.77  ? 503 LEU B N   1 
ATOM   7351 C  CA  . LEU B 1 503 ? -24.210 -43.003 -24.154 1.00 77.28  ? 503 LEU B CA  1 
ATOM   7352 C  C   . LEU B 1 503 ? -23.509 -41.786 -24.708 1.00 79.82  ? 503 LEU B C   1 
ATOM   7353 O  O   . LEU B 1 503 ? -23.259 -40.823 -23.979 1.00 81.45  ? 503 LEU B O   1 
ATOM   7354 C  CB  . LEU B 1 503 ? -23.232 -43.880 -23.383 1.00 75.53  ? 503 LEU B CB  1 
ATOM   7355 C  CG  . LEU B 1 503 ? -23.945 -45.018 -22.663 1.00 67.01  ? 503 LEU B CG  1 
ATOM   7356 C  CD1 . LEU B 1 503 ? -22.975 -45.834 -21.843 1.00 56.85  ? 503 LEU B CD1 1 
ATOM   7357 C  CD2 . LEU B 1 503 ? -25.045 -44.446 -21.794 1.00 57.27  ? 503 LEU B CD2 1 
ATOM   7358 N  N   . GLU B 1 504 ? -23.184 -41.828 -25.997 1.00 78.56  ? 504 GLU B N   1 
ATOM   7359 C  CA  . GLU B 1 504 ? -22.705 -40.624 -26.649 1.00 79.62  ? 504 GLU B CA  1 
ATOM   7360 C  C   . GLU B 1 504 ? -23.872 -39.670 -26.810 1.00 75.71  ? 504 GLU B C   1 
ATOM   7361 O  O   . GLU B 1 504 ? -23.692 -38.453 -26.758 1.00 74.46  ? 504 GLU B O   1 
ATOM   7362 C  CB  . GLU B 1 504 ? -22.074 -40.928 -28.003 1.00 83.28  ? 504 GLU B CB  1 
ATOM   7363 C  CG  . GLU B 1 504 ? -20.749 -41.651 -27.894 1.00 97.80  ? 504 GLU B CG  1 
ATOM   7364 C  CD  . GLU B 1 504 ? -20.056 -41.807 -29.235 1.00 112.03 ? 504 GLU B CD  1 
ATOM   7365 O  OE1 . GLU B 1 504 ? -20.677 -41.467 -30.268 1.00 116.24 ? 504 GLU B OE1 1 
ATOM   7366 O  OE2 . GLU B 1 504 ? -18.893 -42.267 -29.255 1.00 116.22 1 504 GLU B OE2 1 
ATOM   7367 N  N   . MET B 1 505 ? -25.069 -40.198 -27.058 1.00 72.51  ? 505 MET B N   1 
ATOM   7368 C  CA  . MET B 1 505 ? -26.235 -39.298 -27.096 1.00 72.76  ? 505 MET B CA  1 
ATOM   7369 C  C   . MET B 1 505 ? -27.104 -39.112 -25.836 1.00 73.40  ? 505 MET B C   1 
ATOM   7370 O  O   . MET B 1 505 ? -27.928 -38.192 -25.786 1.00 71.72  ? 505 MET B O   1 
ATOM   7371 C  CB  . MET B 1 505 ? -27.127 -39.604 -28.304 1.00 73.20  ? 505 MET B CB  1 
ATOM   7372 C  CG  . MET B 1 505 ? -26.627 -38.958 -29.588 1.00 75.58  ? 505 MET B CG  1 
ATOM   7373 S  SD  . MET B 1 505 ? -26.625 -37.143 -29.488 1.00 77.93  ? 505 MET B SD  1 
ATOM   7374 C  CE  . MET B 1 505 ? -26.535 -36.722 -31.229 1.00 78.41  ? 505 MET B CE  1 
ATOM   7375 N  N   . ASP B 1 506 ? -26.912 -39.939 -24.815 1.00 70.93  ? 506 ASP B N   1 
ATOM   7376 C  CA  . ASP B 1 506 ? -27.837 -39.937 -23.676 1.00 76.49  ? 506 ASP B CA  1 
ATOM   7377 C  C   . ASP B 1 506 ? -27.182 -40.311 -22.357 1.00 76.60  ? 506 ASP B C   1 
ATOM   7378 O  O   . ASP B 1 506 ? -26.205 -41.066 -22.330 1.00 76.35  ? 506 ASP B O   1 
ATOM   7379 C  CB  . ASP B 1 506 ? -29.005 -40.890 -23.935 1.00 79.86  ? 506 ASP B CB  1 
ATOM   7380 C  CG  . ASP B 1 506 ? -30.121 -40.245 -24.720 1.00 88.11  ? 506 ASP B CG  1 
ATOM   7381 O  OD1 . ASP B 1 506 ? -30.512 -39.110 -24.370 1.00 94.91  ? 506 ASP B OD1 1 
ATOM   7382 O  OD2 . ASP B 1 506 ? -30.607 -40.873 -25.683 1.00 95.84  1 506 ASP B OD2 1 
ATOM   7383 N  N   . HIS B 1 507 ? -27.725 -39.796 -21.258 1.00 72.19  ? 507 HIS B N   1 
ATOM   7384 C  CA  . HIS B 1 507 ? -27.201 -40.164 -19.948 1.00 71.35  ? 507 HIS B CA  1 
ATOM   7385 C  C   . HIS B 1 507 ? -27.702 -41.513 -19.433 1.00 69.97  ? 507 HIS B C   1 
ATOM   7386 O  O   . HIS B 1 507 ? -26.931 -42.314 -18.899 1.00 70.47  ? 507 HIS B O   1 
ATOM   7387 C  CB  . HIS B 1 507 ? -27.463 -39.085 -18.906 1.00 73.25  ? 507 HIS B CB  1 
ATOM   7388 C  CG  . HIS B 1 507 ? -26.787 -39.350 -17.600 1.00 70.38  ? 507 HIS B CG  1 
ATOM   7389 N  ND1 . HIS B 1 507 ? -27.470 -39.702 -16.465 1.00 66.79  ? 507 HIS B ND1 1 
ATOM   7390 C  CD2 . HIS B 1 507 ? -25.473 -39.336 -17.258 1.00 66.70  ? 507 HIS B CD2 1 
ATOM   7391 C  CE1 . HIS B 1 507 ? -26.616 -39.888 -15.472 1.00 64.49  ? 507 HIS B CE1 1 
ATOM   7392 N  NE2 . HIS B 1 507 ? -25.400 -39.669 -15.934 1.00 64.48  ? 507 HIS B NE2 1 
ATOM   7393 N  N   . PHE B 1 508 ? -28.993 -41.766 -19.602 1.00 75.39  ? 508 PHE B N   1 
ATOM   7394 C  CA  . PHE B 1 508 ? -29.591 -42.986 -19.083 1.00 75.52  ? 508 PHE B CA  1 
ATOM   7395 C  C   . PHE B 1 508 ? -29.947 -43.940 -20.198 1.00 73.63  ? 508 PHE B C   1 
ATOM   7396 O  O   . PHE B 1 508 ? -30.551 -43.543 -21.201 1.00 72.37  ? 508 PHE B O   1 
ATOM   7397 C  CB  . PHE B 1 508 ? -30.845 -42.678 -18.269 1.00 79.61  ? 508 PHE B CB  1 
ATOM   7398 C  CG  . PHE B 1 508 ? -30.577 -41.944 -17.003 1.00 82.66  ? 508 PHE B CG  1 
ATOM   7399 C  CD1 . PHE B 1 508 ? -29.981 -42.587 -15.930 1.00 80.10  ? 508 PHE B CD1 1 
ATOM   7400 C  CD2 . PHE B 1 508 ? -30.904 -40.603 -16.885 1.00 80.09  ? 508 PHE B CD2 1 
ATOM   7401 C  CE1 . PHE B 1 508 ? -29.733 -41.908 -14.754 1.00 78.03  ? 508 PHE B CE1 1 
ATOM   7402 C  CE2 . PHE B 1 508 ? -30.653 -39.917 -15.713 1.00 78.12  ? 508 PHE B CE2 1 
ATOM   7403 C  CZ  . PHE B 1 508 ? -30.069 -40.570 -14.647 1.00 77.33  ? 508 PHE B CZ  1 
ATOM   7404 N  N   . ALA B 1 509 ? -29.582 -45.202 -20.030 1.00 68.58  ? 509 ALA B N   1 
ATOM   7405 C  CA  . ALA B 1 509 ? -30.073 -46.219 -20.940 1.00 70.78  ? 509 ALA B CA  1 
ATOM   7406 C  C   . ALA B 1 509 ? -30.791 -47.253 -20.102 1.00 73.14  ? 509 ALA B C   1 
ATOM   7407 O  O   . ALA B 1 509 ? -30.169 -47.897 -19.258 1.00 72.61  ? 509 ALA B O   1 
ATOM   7408 C  CB  . ALA B 1 509 ? -28.949 -46.844 -21.699 1.00 69.50  ? 509 ALA B CB  1 
ATOM   7409 N  N   . LEU B 1 510 ? -32.094 -47.415 -20.321 1.00 88.69  ? 510 LEU B N   1 
ATOM   7410 C  CA  . LEU B 1 510 ? -32.859 -48.364 -19.531 1.00 91.48  ? 510 LEU B CA  1 
ATOM   7411 C  C   . LEU B 1 510 ? -33.021 -49.667 -20.276 1.00 90.89  ? 510 LEU B C   1 
ATOM   7412 O  O   . LEU B 1 510 ? -33.600 -49.705 -21.366 1.00 92.16  ? 510 LEU B O   1 
ATOM   7413 C  CB  . LEU B 1 510 ? -34.244 -47.814 -19.226 1.00 94.78  ? 510 LEU B CB  1 
ATOM   7414 C  CG  . LEU B 1 510 ? -34.331 -46.369 -18.755 1.00 94.97  ? 510 LEU B CG  1 
ATOM   7415 C  CD1 . LEU B 1 510 ? -35.741 -46.094 -18.275 1.00 91.05  ? 510 LEU B CD1 1 
ATOM   7416 C  CD2 . LEU B 1 510 ? -33.329 -46.104 -17.647 1.00 91.05  ? 510 LEU B CD2 1 
ATOM   7417 N  N   . VAL B 1 511 ? -32.533 -50.743 -19.677 1.00 67.94  ? 511 VAL B N   1 
ATOM   7418 C  CA  . VAL B 1 511 ? -32.698 -52.060 -20.253 1.00 70.14  ? 511 VAL B CA  1 
ATOM   7419 C  C   . VAL B 1 511 ? -34.086 -52.564 -19.907 1.00 73.18  ? 511 VAL B C   1 
ATOM   7420 O  O   . VAL B 1 511 ? -34.407 -52.709 -18.702 1.00 73.39  ? 511 VAL B O   1 
ATOM   7421 C  CB  . VAL B 1 511 ? -31.652 -53.034 -19.726 1.00 69.59  ? 511 VAL B CB  1 
ATOM   7422 C  CG1 . VAL B 1 511 ? -31.626 -54.277 -20.573 1.00 69.44  ? 511 VAL B CG1 1 
ATOM   7423 C  CG2 . VAL B 1 511 ? -30.297 -52.373 -19.738 1.00 69.37  ? 511 VAL B CG2 1 
ATOM   7424 N  N   . VAL B 1 512 ? -34.867 -52.877 -20.953 1.00 100.72 ? 512 VAL B N   1 
ATOM   7425 C  CA  . VAL B 1 512 ? -36.285 -53.228 -20.839 1.00 103.93 ? 512 VAL B CA  1 
ATOM   7426 C  C   . VAL B 1 512 ? -36.725 -54.415 -21.700 1.00 107.28 ? 512 VAL B C   1 
ATOM   7427 O  O   . VAL B 1 512 ? -36.032 -54.825 -22.636 1.00 107.53 ? 512 VAL B O   1 
ATOM   7428 C  CB  . VAL B 1 512 ? -37.195 -52.044 -21.237 1.00 103.89 ? 512 VAL B CB  1 
ATOM   7429 C  CG1 . VAL B 1 512 ? -36.977 -50.865 -20.317 1.00 103.87 ? 512 VAL B CG1 1 
ATOM   7430 C  CG2 . VAL B 1 512 ? -36.941 -51.651 -22.684 1.00 103.78 ? 512 VAL B CG2 1 
ATOM   7431 N  N   . HIS B 1 513 ? -37.898 -54.947 -21.359 1.00 178.65 ? 513 HIS B N   1 
ATOM   7432 C  CA  . HIS B 1 513 ? -38.555 -56.026 -22.090 1.00 182.02 ? 513 HIS B CA  1 
ATOM   7433 C  C   . HIS B 1 513 ? -39.743 -55.479 -22.884 1.00 182.67 ? 513 HIS B C   1 
ATOM   7434 O  O   . HIS B 1 513 ? -40.065 -54.294 -22.787 1.00 182.80 ? 513 HIS B O   1 
ATOM   7435 C  CB  . HIS B 1 513 ? -38.995 -57.085 -21.069 1.00 183.87 ? 513 HIS B CB  1 
ATOM   7436 C  CG  . HIS B 1 513 ? -39.941 -58.120 -21.589 1.00 185.86 ? 513 HIS B CG  1 
ATOM   7437 N  ND1 . HIS B 1 513 ? -39.568 -59.083 -22.502 1.00 186.68 ? 513 HIS B ND1 1 
ATOM   7438 C  CD2 . HIS B 1 513 ? -41.245 -58.352 -21.310 1.00 186.78 ? 513 HIS B CD2 1 
ATOM   7439 C  CE1 . HIS B 1 513 ? -40.602 -59.860 -22.766 1.00 187.23 ? 513 HIS B CE1 1 
ATOM   7440 N  NE2 . HIS B 1 513 ? -41.633 -59.438 -22.056 1.00 187.25 ? 513 HIS B NE2 1 
ATOM   7441 N  N   . GLU B 1 514 ? -40.405 -56.341 -23.648 1.00 156.40 ? 514 GLU B N   1 
ATOM   7442 C  CA  . GLU B 1 514 ? -41.640 -55.977 -24.321 1.00 156.66 ? 514 GLU B CA  1 
ATOM   7443 C  C   . GLU B 1 514 ? -42.822 -56.631 -23.611 1.00 156.75 ? 514 GLU B C   1 
ATOM   7444 O  O   . GLU B 1 514 ? -43.882 -56.831 -24.202 1.00 156.77 ? 514 GLU B O   1 
ATOM   7445 C  CB  . GLU B 1 514 ? -41.597 -56.410 -25.785 1.00 156.74 ? 514 GLU B CB  1 
ATOM   7446 N  N   . GLN B 1 518 ? -43.533 -53.191 -19.465 1.00 163.62 ? 528 GLN B N   1 
ATOM   7447 C  CA  . GLN B 1 518 ? -43.665 -52.411 -18.239 1.00 163.70 ? 528 GLN B CA  1 
ATOM   7448 C  C   . GLN B 1 518 ? -42.492 -52.671 -17.301 1.00 162.96 ? 528 GLN B C   1 
ATOM   7449 O  O   . GLN B 1 518 ? -42.402 -52.094 -16.215 1.00 163.01 ? 528 GLN B O   1 
ATOM   7450 C  CB  . GLN B 1 518 ? -44.990 -52.716 -17.531 1.00 164.23 ? 528 GLN B CB  1 
ATOM   7451 C  CG  . GLN B 1 518 ? -45.310 -51.763 -16.376 1.00 164.58 ? 528 GLN B CG  1 
ATOM   7452 C  CD  . GLN B 1 518 ? -46.678 -51.986 -15.772 1.00 164.84 ? 528 GLN B CD  1 
ATOM   7453 O  OE1 . GLN B 1 518 ? -47.515 -52.689 -16.338 1.00 164.87 ? 528 GLN B OE1 1 
ATOM   7454 N  NE2 . GLN B 1 518 ? -46.916 -51.380 -14.614 1.00 164.98 ? 528 GLN B NE2 1 
ATOM   7455 N  N   . MET B 1 519 ? -41.576 -53.536 -17.713 1.00 177.32 ? 529 MET B N   1 
ATOM   7456 C  CA  . MET B 1 519 ? -40.526 -53.926 -16.793 1.00 175.78 ? 529 MET B CA  1 
ATOM   7457 C  C   . MET B 1 519 ? -39.160 -53.443 -17.252 1.00 170.62 ? 529 MET B C   1 
ATOM   7458 O  O   . MET B 1 519 ? -38.804 -53.512 -18.431 1.00 170.58 ? 529 MET B O   1 
ATOM   7459 C  CB  . MET B 1 519 ? -40.525 -55.444 -16.605 1.00 178.31 ? 529 MET B CB  1 
ATOM   7460 C  CG  . MET B 1 519 ? -40.295 -56.217 -17.892 1.00 179.84 ? 529 MET B CG  1 
ATOM   7461 S  SD  . MET B 1 519 ? -41.040 -57.858 -17.886 1.00 181.37 ? 529 MET B SD  1 
ATOM   7462 C  CE  . MET B 1 519 ? -42.740 -57.467 -18.300 1.00 182.22 ? 529 MET B CE  1 
ATOM   7463 N  N   . VAL B 1 520 ? -38.407 -52.931 -16.291 1.00 86.16  ? 530 VAL B N   1 
ATOM   7464 C  CA  . VAL B 1 520 ? -37.070 -52.438 -16.537 1.00 81.59  ? 530 VAL B CA  1 
ATOM   7465 C  C   . VAL B 1 520 ? -36.115 -53.447 -15.938 1.00 79.83  ? 530 VAL B C   1 
ATOM   7466 O  O   . VAL B 1 520 ? -36.168 -53.708 -14.737 1.00 79.62  ? 530 VAL B O   1 
ATOM   7467 C  CB  . VAL B 1 520 ? -36.852 -51.066 -15.888 1.00 79.41  ? 530 VAL B CB  1 
ATOM   7468 C  CG1 . VAL B 1 520 ? -35.384 -50.710 -15.888 1.00 78.62  ? 530 VAL B CG1 1 
ATOM   7469 C  CG2 . VAL B 1 520 ? -37.659 -50.014 -16.624 1.00 78.87  ? 530 VAL B CG2 1 
ATOM   7470 N  N   . PHE B 1 521 ? -35.246 -54.029 -16.751 1.00 109.20 ? 531 PHE B N   1 
ATOM   7471 C  CA  . PHE B 1 521 ? -34.320 -54.993 -16.199 1.00 107.94 ? 531 PHE B CA  1 
ATOM   7472 C  C   . PHE B 1 521 ? -33.129 -54.294 -15.639 1.00 106.71 ? 531 PHE B C   1 
ATOM   7473 O  O   . PHE B 1 521 ? -32.361 -54.886 -14.882 1.00 106.66 ? 531 PHE B O   1 
ATOM   7474 C  CB  . PHE B 1 521 ? -33.864 -56.002 -17.228 1.00 107.99 ? 531 PHE B CB  1 
ATOM   7475 C  CG  . PHE B 1 521 ? -34.920 -56.949 -17.637 1.00 108.13 ? 531 PHE B CG  1 
ATOM   7476 C  CD1 . PHE B 1 521 ? -35.267 -58.002 -16.809 1.00 108.16 ? 531 PHE B CD1 1 
ATOM   7477 C  CD2 . PHE B 1 521 ? -35.567 -56.804 -18.845 1.00 108.23 ? 531 PHE B CD2 1 
ATOM   7478 C  CE1 . PHE B 1 521 ? -36.243 -58.895 -17.182 1.00 108.22 ? 531 PHE B CE1 1 
ATOM   7479 C  CE2 . PHE B 1 521 ? -36.529 -57.695 -19.221 1.00 108.38 ? 531 PHE B CE2 1 
ATOM   7480 C  CZ  . PHE B 1 521 ? -36.879 -58.738 -18.392 1.00 108.28 ? 531 PHE B CZ  1 
ATOM   7481 N  N   . GLY B 1 522 ? -32.960 -53.031 -16.000 1.00 102.54 ? 532 GLY B N   1 
ATOM   7482 C  CA  . GLY B 1 522 ? -31.820 -52.331 -15.449 1.00 101.26 ? 532 GLY B CA  1 
ATOM   7483 C  C   . GLY B 1 522 ? -31.637 -50.923 -15.943 1.00 99.98  ? 532 GLY B C   1 
ATOM   7484 O  O   . GLY B 1 522 ? -32.337 -50.466 -16.840 1.00 99.90  ? 532 GLY B O   1 
ATOM   7485 N  N   . VAL B 1 523 ? -30.713 -50.215 -15.312 1.00 110.02 ? 533 VAL B N   1 
ATOM   7486 C  CA  . VAL B 1 523 ? -30.418 -48.846 -15.684 1.00 101.45 ? 533 VAL B CA  1 
ATOM   7487 C  C   . VAL B 1 523 ? -28.921 -48.711 -15.826 1.00 100.67 ? 533 VAL B C   1 
ATOM   7488 O  O   . VAL B 1 523 ? -28.168 -49.073 -14.920 1.00 99.75  ? 533 VAL B O   1 
ATOM   7489 C  CB  . VAL B 1 523 ? -30.917 -47.857 -14.637 1.00 99.29  ? 533 VAL B CB  1 
ATOM   7490 C  CG1 . VAL B 1 523 ? -30.499 -46.448 -15.005 1.00 92.72  ? 533 VAL B CG1 1 
ATOM   7491 C  CG2 . VAL B 1 523 ? -32.413 -47.958 -14.524 1.00 92.35  ? 533 VAL B CG2 1 
ATOM   7492 N  N   . VAL B 1 524 ? -28.482 -48.211 -16.973 1.00 86.87  ? 534 VAL B N   1 
ATOM   7493 C  CA  . VAL B 1 524 ? -27.065 -48.158 -17.261 1.00 86.38  ? 534 VAL B CA  1 
ATOM   7494 C  C   . VAL B 1 524 ? -26.625 -46.765 -17.640 1.00 85.40  ? 534 VAL B C   1 
ATOM   7495 O  O   . VAL B 1 524 ? -27.296 -46.069 -18.411 1.00 86.24  ? 534 VAL B O   1 
ATOM   7496 C  CB  . VAL B 1 524 ? -26.683 -49.089 -18.403 1.00 86.52  ? 534 VAL B CB  1 
ATOM   7497 C  CG1 . VAL B 1 524 ? -25.223 -49.454 -18.285 1.00 87.15  ? 534 VAL B CG1 1 
ATOM   7498 C  CG2 . VAL B 1 524 ? -27.539 -50.334 -18.373 1.00 86.33  ? 534 VAL B CG2 1 
ATOM   7499 N  N   . THR B 1 525 ? -25.488 -46.367 -17.089 1.00 78.30  ? 535 THR B N   1 
ATOM   7500 C  CA  . THR B 1 525 ? -24.851 -45.116 -17.442 1.00 74.80  ? 535 THR B CA  1 
ATOM   7501 C  C   . THR B 1 525 ? -23.469 -45.436 -17.953 1.00 74.84  ? 535 THR B C   1 
ATOM   7502 O  O   . THR B 1 525 ? -23.084 -46.608 -18.051 1.00 75.46  ? 535 THR B O   1 
ATOM   7503 C  CB  . THR B 1 525 ? -24.692 -44.196 -16.227 1.00 74.02  ? 535 THR B CB  1 
ATOM   7504 O  OG1 . THR B 1 525 ? -23.880 -44.855 -15.244 1.00 68.87  ? 535 THR B OG1 1 
ATOM   7505 C  CG2 . THR B 1 525 ? -26.045 -43.880 -15.629 1.00 69.87  ? 535 THR B CG2 1 
ATOM   7506 N  N   . ALA B 1 526 ? -22.718 -44.392 -18.272 1.00 72.01  ? 536 ALA B N   1 
ATOM   7507 C  CA  . ALA B 1 526 ? -21.359 -44.571 -18.744 1.00 71.72  ? 536 ALA B CA  1 
ATOM   7508 C  C   . ALA B 1 526 ? -20.557 -45.248 -17.656 1.00 73.47  ? 536 ALA B C   1 
ATOM   7509 O  O   . ALA B 1 526 ? -19.733 -46.125 -17.923 1.00 73.21  ? 536 ALA B O   1 
ATOM   7510 C  CB  . ALA B 1 526 ? -20.745 -43.237 -19.077 1.00 67.83  ? 536 ALA B CB  1 
ATOM   7511 N  N   . ILE B 1 527 ? -20.831 -44.838 -16.423 1.00 76.21  ? 537 ILE B N   1 
ATOM   7512 C  CA  . ILE B 1 527 ? -20.054 -45.265 -15.275 1.00 80.26  ? 537 ILE B CA  1 
ATOM   7513 C  C   . ILE B 1 527 ? -20.203 -46.746 -15.013 1.00 82.97  ? 537 ILE B C   1 
ATOM   7514 O  O   . ILE B 1 527 ? -19.265 -47.383 -14.566 1.00 82.99  ? 537 ILE B O   1 
ATOM   7515 C  CB  . ILE B 1 527 ? -20.478 -44.509 -14.029 1.00 80.45  ? 537 ILE B CB  1 
ATOM   7516 C  CG1 . ILE B 1 527 ? -20.588 -43.024 -14.354 1.00 82.15  ? 537 ILE B CG1 1 
ATOM   7517 C  CG2 . ILE B 1 527 ? -19.472 -44.716 -12.923 1.00 79.63  ? 537 ILE B CG2 1 
ATOM   7518 C  CD1 . ILE B 1 527 ? -21.151 -42.215 -13.233 1.00 85.06  ? 537 ILE B CD1 1 
ATOM   7519 N  N   . ASP B 1 528 ? -21.385 -47.291 -15.267 1.00 89.36  ? 538 ASP B N   1 
ATOM   7520 C  CA  . ASP B 1 528 ? -21.604 -48.714 -15.053 1.00 93.31  ? 538 ASP B CA  1 
ATOM   7521 C  C   . ASP B 1 528 ? -20.773 -49.511 -16.047 1.00 92.36  ? 538 ASP B C   1 
ATOM   7522 O  O   . ASP B 1 528 ? -20.065 -50.465 -15.676 1.00 91.18  ? 538 ASP B O   1 
ATOM   7523 C  CB  . ASP B 1 528 ? -23.086 -49.044 -15.187 1.00 96.67  ? 538 ASP B CB  1 
ATOM   7524 C  CG  . ASP B 1 528 ? -23.903 -48.506 -14.024 1.00 106.68 ? 538 ASP B CG  1 
ATOM   7525 O  OD1 . ASP B 1 528 ? -25.122 -48.776 -13.974 1.00 116.08 ? 538 ASP B OD1 1 
ATOM   7526 O  OD2 . ASP B 1 528 ? -23.318 -47.827 -13.147 1.00 116.04 1 538 ASP B OD2 1 
ATOM   7527 N  N   . LEU B 1 529 ? -20.858 -49.100 -17.307 1.00 94.77  ? 539 LEU B N   1 
ATOM   7528 C  CA  . LEU B 1 529 ? -20.077 -49.697 -18.375 1.00 95.74  ? 539 LEU B CA  1 
ATOM   7529 C  C   . LEU B 1 529 ? -18.602 -49.655 -17.998 1.00 99.91  ? 539 LEU B C   1 
ATOM   7530 O  O   . LEU B 1 529 ? -17.854 -50.624 -18.184 1.00 99.42  ? 539 LEU B O   1 
ATOM   7531 C  CB  . LEU B 1 529 ? -20.289 -48.903 -19.660 1.00 92.86  ? 539 LEU B CB  1 
ATOM   7532 C  CG  . LEU B 1 529 ? -19.512 -49.333 -20.904 1.00 86.62  ? 539 LEU B CG  1 
ATOM   7533 C  CD1 . LEU B 1 529 ? -19.914 -50.736 -21.329 1.00 82.32  ? 539 LEU B CD1 1 
ATOM   7534 C  CD2 . LEU B 1 529 ? -19.748 -48.337 -22.028 1.00 80.35  ? 539 LEU B CD2 1 
ATOM   7535 N  N   . LEU B 1 530 ? -18.204 -48.523 -17.439 1.00 105.40 ? 540 LEU B N   1 
ATOM   7536 C  CA  . LEU B 1 530 ? -16.827 -48.312 -17.045 1.00 111.82 ? 540 LEU B CA  1 
ATOM   7537 C  C   . LEU B 1 530 ? -16.415 -49.214 -15.886 1.00 112.82 ? 540 LEU B C   1 
ATOM   7538 O  O   . LEU B 1 530 ? -15.286 -49.682 -15.827 1.00 113.09 ? 540 LEU B O   1 
ATOM   7539 C  CB  . LEU B 1 530 ? -16.597 -46.849 -16.693 1.00 114.72 ? 540 LEU B CB  1 
ATOM   7540 C  CG  . LEU B 1 530 ? -15.153 -46.525 -16.338 1.00 123.02 ? 540 LEU B CG  1 
ATOM   7541 C  CD1 . LEU B 1 530 ? -14.243 -46.921 -17.477 1.00 130.41 ? 540 LEU B CD1 1 
ATOM   7542 C  CD2 . LEU B 1 530 ? -15.039 -45.049 -16.079 1.00 130.41 ? 540 LEU B CD2 1 
ATOM   7543 N  N   . ASN B 1 531 ? -17.320 -49.423 -14.940 1.00 112.73 ? 541 ASN B N   1 
ATOM   7544 C  CA  . ASN B 1 531 ? -17.061 -50.303 -13.820 1.00 113.54 ? 541 ASN B CA  1 
ATOM   7545 C  C   . ASN B 1 531 ? -16.806 -51.695 -14.352 1.00 110.99 ? 541 ASN B C   1 
ATOM   7546 O  O   . ASN B 1 531 ? -15.872 -52.385 -13.925 1.00 111.72 ? 541 ASN B O   1 
ATOM   7547 C  CB  . ASN B 1 531 ? -18.239 -50.303 -12.858 1.00 116.22 ? 541 ASN B CB  1 
ATOM   7548 C  CG  . ASN B 1 531 ? -18.116 -49.230 -11.810 1.00 122.03 ? 541 ASN B CG  1 
ATOM   7549 O  OD1 . ASN B 1 531 ? -17.007 -48.851 -11.432 1.00 127.04 ? 541 ASN B OD1 1 
ATOM   7550 N  ND2 . ASN B 1 531 ? -19.250 -48.718 -11.344 1.00 127.00 ? 541 ASN B ND2 1 
ATOM   7551 N  N   . PHE B 1 532 ? -17.643 -52.095 -15.301 1.00 105.39 ? 542 PHE B N   1 
ATOM   7552 C  CA  . PHE B 1 532 ? -17.489 -53.392 -15.938 1.00 102.45 ? 542 PHE B CA  1 
ATOM   7553 C  C   . PHE B 1 532 ? -16.116 -53.538 -16.597 1.00 101.48 ? 542 PHE B C   1 
ATOM   7554 O  O   . PHE B 1 532 ? -15.332 -54.462 -16.270 1.00 99.26  ? 542 PHE B O   1 
ATOM   7555 C  CB  . PHE B 1 532 ? -18.577 -53.569 -16.987 1.00 101.76 ? 542 PHE B CB  1 
ATOM   7556 C  CG  . PHE B 1 532 ? -18.379 -54.755 -17.868 1.00 103.16 ? 542 PHE B CG  1 
ATOM   7557 C  CD1 . PHE B 1 532 ? -18.766 -56.014 -17.447 1.00 105.05 ? 542 PHE B CD1 1 
ATOM   7558 C  CD2 . PHE B 1 532 ? -17.813 -54.613 -19.127 1.00 105.03 ? 542 PHE B CD2 1 
ATOM   7559 C  CE1 . PHE B 1 532 ? -18.587 -57.111 -18.262 1.00 105.91 ? 542 PHE B CE1 1 
ATOM   7560 C  CE2 . PHE B 1 532 ? -17.631 -55.705 -19.942 1.00 105.89 ? 542 PHE B CE2 1 
ATOM   7561 C  CZ  . PHE B 1 532 ? -18.020 -56.956 -19.510 1.00 106.19 ? 542 PHE B CZ  1 
ATOM   7562 N  N   . VAL B 1 533 ? -15.825 -52.624 -17.519 1.00 110.09 ? 543 VAL B N   1 
ATOM   7563 C  CA  . VAL B 1 533 ? -14.580 -52.712 -18.269 1.00 112.18 ? 543 VAL B CA  1 
ATOM   7564 C  C   . VAL B 1 533 ? -13.388 -52.695 -17.325 1.00 109.73 ? 543 VAL B C   1 
ATOM   7565 O  O   . VAL B 1 533 ? -12.485 -53.508 -17.469 1.00 109.98 ? 543 VAL B O   1 
ATOM   7566 C  CB  . VAL B 1 533 ? -14.430 -51.595 -19.323 1.00 114.21 ? 543 VAL B CB  1 
ATOM   7567 C  CG1 . VAL B 1 533 ? -15.425 -51.788 -20.438 1.00 119.60 ? 543 VAL B CG1 1 
ATOM   7568 C  CG2 . VAL B 1 533 ? -14.615 -50.246 -18.710 1.00 119.23 ? 543 VAL B CG2 1 
ATOM   7569 N  N   . ALA B 1 534 ? -13.407 -51.796 -16.346 1.00 101.08 ? 544 ALA B N   1 
ATOM   7570 C  CA  . ALA B 1 534 ? -12.311 -51.664 -15.400 1.00 101.38 ? 544 ALA B CA  1 
ATOM   7571 C  C   . ALA B 1 534 ? -12.118 -52.957 -14.638 1.00 105.31 ? 544 ALA B C   1 
ATOM   7572 O  O   . ALA B 1 534 ? -10.986 -53.402 -14.440 1.00 103.23 ? 544 ALA B O   1 
ATOM   7573 C  CB  . ALA B 1 534 ? -12.582 -50.535 -14.433 1.00 95.86  ? 544 ALA B CB  1 
ATOM   7574 N  N   . ALA B 1 535 ? -13.223 -53.571 -14.227 1.00 103.54 ? 545 ALA B N   1 
ATOM   7575 C  CA  . ALA B 1 535 ? -13.123 -54.819 -13.497 1.00 109.89 ? 545 ALA B CA  1 
ATOM   7576 C  C   . ALA B 1 535 ? -12.474 -55.862 -14.387 1.00 111.74 ? 545 ALA B C   1 
ATOM   7577 O  O   . ALA B 1 535 ? -11.677 -56.674 -13.915 1.00 114.04 ? 545 ALA B O   1 
ATOM   7578 C  CB  . ALA B 1 535 ? -14.481 -55.290 -13.055 1.00 112.91 ? 545 ALA B CB  1 
ATOM   7579 N  N   . GLN B 1 536 ? -12.762 -55.822 -15.683 1.00 176.23 ? 546 GLN B N   1 
ATOM   7580 C  CA  . GLN B 1 536 ? -12.113 -56.795 -16.558 1.00 174.95 ? 546 GLN B CA  1 
ATOM   7581 C  C   . GLN B 1 536 ? -10.647 -56.512 -16.850 1.00 176.21 ? 546 GLN B C   1 
ATOM   7582 O  O   . GLN B 1 536 ? -9.860  -57.436 -17.067 1.00 174.70 ? 546 GLN B O   1 
ATOM   7583 C  CB  . GLN B 1 536 ? -12.896 -56.949 -17.854 1.00 173.13 ? 546 GLN B CB  1 
ATOM   7584 C  CG  . GLN B 1 536 ? -14.178 -57.692 -17.634 1.00 171.38 ? 546 GLN B CG  1 
ATOM   7585 C  CD  . GLN B 1 536 ? -13.910 -59.095 -17.116 1.00 170.48 ? 546 GLN B CD  1 
ATOM   7586 O  OE1 . GLN B 1 536 ? -12.831 -59.654 -17.331 1.00 170.35 ? 546 GLN B OE1 1 
ATOM   7587 N  NE2 . GLN B 1 536 ? -14.872 -59.653 -16.397 1.00 170.34 ? 546 GLN B NE2 1 
ATOM   7588 N  N   . GLU B 1 537 ? -10.278 -55.242 -16.820 1.00 134.87 ? 547 GLU B N   1 
ATOM   7589 C  CA  . GLU B 1 537 ? -8.899  -54.838 -17.013 1.00 138.78 ? 547 GLU B CA  1 
ATOM   7590 C  C   . GLU B 1 537 ? -8.108  -55.283 -15.800 1.00 142.54 ? 547 GLU B C   1 
ATOM   7591 O  O   . GLU B 1 537 ? -6.943  -55.672 -15.902 1.00 142.09 ? 547 GLU B O   1 
ATOM   7592 C  CB  . GLU B 1 537 ? -8.814  -53.325 -17.175 1.00 138.08 ? 547 GLU B CB  1 
ATOM   7593 C  CG  . GLU B 1 537 ? -9.641  -52.782 -18.327 1.00 136.80 ? 547 GLU B CG  1 
ATOM   7594 C  CD  . GLU B 1 537 ? -8.792  -52.342 -19.495 1.00 135.46 ? 547 GLU B CD  1 
ATOM   7595 O  OE1 . GLU B 1 537 ? -9.320  -52.256 -20.625 1.00 135.07 ? 547 GLU B OE1 1 
ATOM   7596 O  OE2 . GLU B 1 537 ? -7.589  -52.084 -19.278 1.00 135.09 1 547 GLU B OE2 1 
ATOM   7597 N  N   . ARG B 1 538 ? -8.780  -55.274 -14.655 1.00 137.66 ? 548 ARG B N   1 
ATOM   7598 C  CA  . ARG B 1 538 ? -8.132  -55.564 -13.389 1.00 141.43 ? 548 ARG B CA  1 
ATOM   7599 C  C   . ARG B 1 538 ? -7.805  -57.044 -13.296 1.00 143.41 ? 548 ARG B C   1 
ATOM   7600 O  O   . ARG B 1 538 ? -6.803  -57.430 -12.696 1.00 143.38 ? 548 ARG B O   1 
ATOM   7601 C  CB  . ARG B 1 538 ? -9.079  -55.181 -12.252 1.00 142.02 ? 548 ARG B CB  1 
ATOM   7602 C  CG  . ARG B 1 538 ? -8.487  -54.345 -11.142 1.00 142.60 ? 548 ARG B CG  1 
ATOM   7603 C  CD  . ARG B 1 538 ? -9.595  -53.888 -10.199 1.00 142.85 ? 548 ARG B CD  1 
ATOM   7604 N  NE  . ARG B 1 538 ? -10.154 -52.591 -10.579 1.00 142.90 ? 548 ARG B NE  1 
ATOM   7605 C  CZ  . ARG B 1 538 ? -11.348 -52.145 -10.195 1.00 142.91 ? 548 ARG B CZ  1 
ATOM   7606 N  NH1 . ARG B 1 538 ? -11.768 -50.947 -10.583 1.00 142.91 1 548 ARG B NH1 1 
ATOM   7607 N  NH2 . ARG B 1 538 ? -12.127 -52.899 -9.431  1.00 142.91 ? 548 ARG B NH2 1 
ATOM   7608 N  N   . ASP B 1 539 ? -8.634  -57.868 -13.923 1.00 145.22 ? 549 ASP B N   1 
ATOM   7609 C  CA  . ASP B 1 539 ? -8.422  -59.308 -13.919 1.00 147.41 ? 549 ASP B CA  1 
ATOM   7610 C  C   . ASP B 1 539 ? -7.634  -59.745 -15.155 1.00 147.18 ? 549 ASP B C   1 
ATOM   7611 O  O   . ASP B 1 539 ? -6.407  -59.655 -15.195 1.00 148.86 ? 549 ASP B O   1 
ATOM   7612 C  CB  . ASP B 1 539 ? -9.753  -60.055 -13.822 1.00 149.66 ? 549 ASP B CB  1 
HETATM 7613 N  N1  . PLP C 2 .   ? -19.680 -18.707 -25.387 1.00 73.76  ? 601 PLP A N1  1 
HETATM 7614 C  C2  . PLP C 2 .   ? -19.222 -19.964 -25.723 1.00 66.86  ? 601 PLP A C2  1 
HETATM 7615 C  C2A . PLP C 2 .   ? -19.674 -20.612 -26.997 1.00 58.71  ? 601 PLP A C2A 1 
HETATM 7616 C  C3  . PLP C 2 .   ? -18.346 -20.635 -24.876 1.00 69.99  ? 601 PLP A C3  1 
HETATM 7617 O  O3  . PLP C 2 .   ? -17.896 -21.886 -25.207 1.00 69.49  ? 601 PLP A O3  1 
HETATM 7618 C  C4  . PLP C 2 .   ? -17.933 -20.040 -23.696 1.00 86.22  ? 601 PLP A C4  1 
HETATM 7619 C  C4A . PLP C 2 .   ? -17.259 -20.881 -22.663 1.00 79.04  ? 601 PLP A C4A 1 
HETATM 7620 C  C5  . PLP C 2 .   ? -18.395 -18.773 -23.367 1.00 75.42  ? 601 PLP A C5  1 
HETATM 7621 C  C6  . PLP C 2 .   ? -19.263 -18.116 -24.215 1.00 75.50  ? 601 PLP A C6  1 
HETATM 7622 C  C5A . PLP C 2 .   ? -18.002 -18.075 -22.092 1.00 81.87  ? 601 PLP A C5A 1 
HETATM 7623 O  O4P . PLP C 2 .   ? -16.623 -17.843 -21.935 1.00 83.28  ? 601 PLP A O4P 1 
HETATM 7624 P  P   . PLP C 2 .   ? -16.084 -17.740 -20.409 1.00 82.93  ? 601 PLP A P   1 
HETATM 7625 O  O1P . PLP C 2 .   ? -14.614 -17.400 -20.424 1.00 80.98  ? 601 PLP A O1P 1 
HETATM 7626 O  O2P . PLP C 2 .   ? -16.867 -16.684 -19.639 1.00 85.50  1 601 PLP A O2P 1 
HETATM 7627 O  O3P . PLP C 2 .   ? -16.247 -19.098 -19.758 1.00 77.83  ? 601 PLP A O3P 1 
HETATM 7628 C  CHA . HEM D 3 .   ? -4.698  -18.698 -6.686  1.00 108.89 ? 602 HEM A CHA 1 
HETATM 7629 C  CHB . HEM D 3 .   ? -1.525  -15.022 -5.631  1.00 108.85 ? 602 HEM A CHB 1 
HETATM 7630 C  CHC . HEM D 3 .   ? -2.858  -12.750 -9.848  1.00 108.70 ? 602 HEM A CHC 1 
HETATM 7631 C  CHD . HEM D 3 .   ? -6.057  -16.422 -10.955 1.00 108.89 ? 602 HEM A CHD 1 
HETATM 7632 C  C1A . HEM D 3 .   ? -3.727  -17.896 -6.050  1.00 108.77 ? 602 HEM A C1A 1 
HETATM 7633 C  C2A . HEM D 3 .   ? -3.126  -18.214 -4.830  1.00 108.94 ? 602 HEM A C2A 1 
HETATM 7634 C  C3A . HEM D 3 .   ? -2.214  -17.167 -4.523  1.00 108.93 ? 602 HEM A C3A 1 
HETATM 7635 C  C4A . HEM D 3 .   ? -2.297  -16.245 -5.560  1.00 108.74 ? 602 HEM A C4A 1 
HETATM 7636 C  CMA . HEM D 3 .   ? -1.333  -17.062 -3.325  1.00 109.03 ? 602 HEM A CMA 1 
HETATM 7637 C  CAA . HEM D 3 .   ? -3.369  -19.426 -4.005  1.00 109.02 ? 602 HEM A CAA 1 
HETATM 7638 C  CBA . HEM D 3 .   ? -2.374  -20.454 -4.418  1.00 109.09 ? 602 HEM A CBA 1 
HETATM 7639 C  CGA . HEM D 3 .   ? -2.915  -21.796 -4.059  1.00 109.15 ? 602 HEM A CGA 1 
HETATM 7640 O  O1A . HEM D 3 .   ? -3.514  -21.961 -2.960  1.00 109.15 ? 602 HEM A O1A 1 
HETATM 7641 O  O2A . HEM D 3 .   ? -2.778  -22.760 -4.860  1.00 109.19 ? 602 HEM A O2A 1 
HETATM 7642 C  C1B . HEM D 3 .   ? -1.647  -14.124 -6.689  1.00 108.76 ? 602 HEM A C1B 1 
HETATM 7643 C  C2B . HEM D 3 .   ? -0.995  -12.911 -6.927  1.00 108.90 ? 602 HEM A C2B 1 
HETATM 7644 C  C3B . HEM D 3 .   ? -1.307  -12.369 -7.925  1.00 108.88 ? 602 HEM A C3B 1 
HETATM 7645 C  C4B . HEM D 3 .   ? -2.264  -13.068 -8.657  1.00 108.69 ? 602 HEM A C4B 1 
HETATM 7646 C  CMB . HEM D 3 .   ? -0.011  -12.529 -5.850  1.00 109.02 ? 602 HEM A CMB 1 
HETATM 7647 C  CAB . HEM D 3 .   ? -0.885  -11.069 -8.603  1.00 108.98 ? 602 HEM A CAB 1 
HETATM 7648 C  CBB . HEM D 3 .   ? -0.036  -10.045 -7.910  1.00 109.02 ? 602 HEM A CBB 1 
HETATM 7649 C  C1C . HEM D 3 .   ? -3.838  -13.578 -10.485 1.00 108.64 ? 602 HEM A C1C 1 
HETATM 7650 C  C2C . HEM D 3 .   ? -4.406  -13.215 -11.687 1.00 108.84 ? 602 HEM A C2C 1 
HETATM 7651 C  C3C . HEM D 3 .   ? -5.321  -14.262 -12.003 1.00 108.92 ? 602 HEM A C3C 1 
HETATM 7652 C  C4C . HEM D 3 .   ? -5.280  -15.222 -10.989 1.00 108.76 ? 602 HEM A C4C 1 
HETATM 7653 C  CMC . HEM D 3 .   ? -4.088  -11.967 -12.447 1.00 108.91 ? 602 HEM A CMC 1 
HETATM 7654 C  CAC . HEM D 3 .   ? -6.224  -14.420 -13.178 1.00 109.07 ? 602 HEM A CAC 1 
HETATM 7655 C  CBC . HEM D 3 .   ? -6.261  -13.560 -14.233 1.00 109.15 ? 602 HEM A CBC 1 
HETATM 7656 C  C1D . HEM D 3 .   ? -5.948  -17.320 -9.899  1.00 108.76 ? 602 HEM A C1D 1 
HETATM 7657 C  C2D . HEM D 3 .   ? -6.573  -18.542 -9.617  1.00 108.91 ? 602 HEM A C2D 1 
HETATM 7658 C  C3D . HEM D 3 .   ? -6.250  -19.062 -8.622  1.00 108.92 ? 602 HEM A C3D 1 
HETATM 7659 C  C4D . HEM D 3 .   ? -5.291  -18.375 -7.893  1.00 108.76 ? 602 HEM A C4D 1 
HETATM 7660 C  CMD . HEM D 3 .   ? -7.584  -19.053 -10.600 1.00 109.00 ? 602 HEM A CMD 1 
HETATM 7661 C  CAD . HEM D 3 .   ? -6.760  -20.378 -8.084  1.00 108.98 ? 602 HEM A CAD 1 
HETATM 7662 C  CBD . HEM D 3 .   ? -7.808  -20.175 -7.036  1.00 109.03 ? 602 HEM A CBD 1 
HETATM 7663 C  CGD . HEM D 3 .   ? -7.948  -21.413 -6.209  1.00 109.10 ? 602 HEM A CGD 1 
HETATM 7664 O  O1D . HEM D 3 .   ? -7.302  -22.459 -6.499  1.00 109.10 ? 602 HEM A O1D 1 
HETATM 7665 O  O2D . HEM D 3 .   ? -8.721  -21.409 -5.212  1.00 109.13 ? 602 HEM A O2D 1 
HETATM 7666 N  NA  . HEM D 3 .   ? -3.221  -16.716 -6.463  1.00 108.55 ? 602 HEM A NA  1 
HETATM 7667 N  NB  . HEM D 3 .   ? -2.507  -14.251 -7.864  1.00 108.55 ? 602 HEM A NB  1 
HETATM 7668 N  NC  . HEM D 3 .   ? -4.368  -14.774 -10.086 1.00 108.51 ? 602 HEM A NC  1 
HETATM 7669 N  ND  . HEM D 3 .   ? -5.069  -17.190 -8.724  1.00 108.55 ? 602 HEM A ND  1 
HETATM 7670 FE FE  . HEM D 3 .   ? -3.772  -15.715 -8.274  1.00 107.67 ? 602 HEM A FE  1 
HETATM 7671 N  N1  . PLP E 2 .   ? -12.122 -27.529 -53.249 1.00 64.45  ? 601 PLP B N1  1 
HETATM 7672 C  C2  . PLP E 2 .   ? -13.218 -26.756 -52.956 1.00 66.80  ? 601 PLP B C2  1 
HETATM 7673 C  C2A . PLP E 2 .   ? -14.019 -27.066 -51.735 1.00 53.06  ? 601 PLP B C2A 1 
HETATM 7674 C  C3  . PLP E 2 .   ? -13.587 -25.703 -53.781 1.00 66.06  ? 601 PLP B C3  1 
HETATM 7675 O  O3  . PLP E 2 .   ? -14.682 -24.941 -53.486 1.00 75.77  ? 601 PLP B O3  1 
HETATM 7676 C  C4  . PLP E 2 .   ? -12.847 -25.422 -54.912 1.00 63.96  ? 601 PLP B C4  1 
HETATM 7677 C  C4A . PLP E 2 .   ? -13.352 -24.408 -55.886 1.00 67.19  ? 601 PLP B C4A 1 
HETATM 7678 C  C5  . PLP E 2 .   ? -11.737 -26.206 -55.206 1.00 62.86  ? 601 PLP B C5  1 
HETATM 7679 C  C6  . PLP E 2 .   ? -11.381 -27.255 -54.376 1.00 68.05  ? 601 PLP B C6  1 
HETATM 7680 C  C5A . PLP E 2 .   ? -10.893 -25.982 -56.434 1.00 66.16  ? 601 PLP B C5A 1 
HETATM 7681 O  O4P . PLP E 2 .   ? -10.286 -24.719 -56.522 1.00 76.89  ? 601 PLP B O4P 1 
HETATM 7682 P  P   . PLP E 2 .   ? -10.030 -24.167 -58.019 1.00 73.56  ? 601 PLP B P   1 
HETATM 7683 O  O1P . PLP E 2 .   ? -9.361  -22.812 -57.932 1.00 58.83  ? 601 PLP B O1P 1 
HETATM 7684 O  O2P . PLP E 2 .   ? -9.209  -25.182 -58.806 1.00 67.30  1 601 PLP B O2P 1 
HETATM 7685 O  O3P . PLP E 2 .   ? -11.364 -23.976 -58.692 1.00 61.08  ? 601 PLP B O3P 1 
HETATM 7686 C  CHA . HEM F 3 .   ? -6.761  -12.490 -71.018 1.00 104.24 ? 602 HEM B CHA 1 
HETATM 7687 C  CHB . HEM F 3 .   ? -2.279  -10.499 -71.849 1.00 104.18 ? 602 HEM B CHB 1 
HETATM 7688 C  CHC . HEM F 3 .   ? -0.624  -12.680 -67.690 1.00 104.04 ? 602 HEM B CHC 1 
HETATM 7689 C  CHD . HEM F 3 .   ? -5.111  -14.704 -66.816 1.00 104.22 ? 602 HEM B CHD 1 
HETATM 7690 C  C1A . HEM F 3 .   ? -5.697  -11.770 -71.590 1.00 104.05 ? 602 HEM B C1A 1 
HETATM 7691 C  C2A . HEM F 3 .   ? -5.812  -11.038 -72.774 1.00 104.28 ? 602 HEM B C2A 1 
HETATM 7692 C  C3A . HEM F 3 .   ? -4.529  -10.459 -73.017 1.00 104.27 ? 602 HEM B C3A 1 
HETATM 7693 C  C4A . HEM F 3 .   ? -3.686  -10.864 -71.980 1.00 104.03 ? 602 HEM B C4A 1 
HETATM 7694 C  CMA . HEM F 3 .   ? -4.136  -9.584  -74.160 1.00 104.38 ? 602 HEM B CMA 1 
HETATM 7695 C  CAA . HEM F 3 .   ? -7.052  -10.884 -73.598 1.00 104.38 ? 602 HEM B CAA 1 
HETATM 7696 C  CBA . HEM F 3 .   ? -7.904  -9.839  -72.940 1.00 104.46 ? 602 HEM B CBA 1 
HETATM 7697 C  CGA . HEM F 3 .   ? -9.318  -9.867  -73.440 1.00 104.52 ? 602 HEM B CGA 1 
HETATM 7698 O  O1A . HEM F 3 .   ? -9.546  -10.024 -74.673 1.00 104.51 ? 602 HEM B O1A 1 
HETATM 7699 O  O2A . HEM F 3 .   ? -10.284 -9.727  -72.631 1.00 104.57 ? 602 HEM B O2A 1 
HETATM 7700 C  C1B . HEM F 3 .   ? -1.485  -10.936 -70.784 1.00 104.03 ? 602 HEM B C1B 1 
HETATM 7701 C  C2B . HEM F 3 .   ? -0.135  -10.699 -70.483 1.00 104.24 ? 602 HEM B C2B 1 
HETATM 7702 C  C3B . HEM F 3 .   ? 0.245   -11.212 -69.493 1.00 104.23 ? 602 HEM B C3B 1 
HETATM 7703 C  C4B . HEM F 3 .   ? -0.727  -11.955 -68.842 1.00 103.97 ? 602 HEM B C4B 1 
HETATM 7704 C  CMB . HEM F 3 .   ? 0.576   -9.821  -71.482 1.00 104.37 ? 602 HEM B CMB 1 
HETATM 7705 C  CAB . HEM F 3 .   ? 1.572   -11.277 -68.749 1.00 104.34 ? 602 HEM B CAB 1 
HETATM 7706 C  CBB . HEM F 3 .   ? 2.776   -10.515 -69.208 1.00 104.39 ? 602 HEM B CBB 1 
HETATM 7707 C  C1C . HEM F 3 .   ? -1.722  -13.410 -67.117 1.00 103.94 ? 602 HEM B C1C 1 
HETATM 7708 C  C2C . HEM F 3 .   ? -1.579  -14.128 -65.947 1.00 104.19 ? 602 HEM B C2C 1 
HETATM 7709 C  C3C . HEM F 3 .   ? -2.855  -14.708 -65.701 1.00 104.25 ? 602 HEM B C3C 1 
HETATM 7710 C  C4C . HEM F 3 .   ? -3.735  -14.322 -66.722 1.00 104.03 ? 602 HEM B C4C 1 
HETATM 7711 C  CMC . HEM F 3 .   ? -0.330  -14.256 -65.133 1.00 104.27 ? 602 HEM B CMC 1 
HETATM 7712 C  CAC . HEM F 3 .   ? -3.282  -15.573 -64.564 1.00 104.41 ? 602 HEM B CAC 1 
HETATM 7713 C  CBC . HEM F 3 .   ? -2.451  -16.445 -63.930 1.00 104.51 ? 602 HEM B CBC 1 
HETATM 7714 C  C1D . HEM F 3 .   ? -5.911  -14.274 -67.873 1.00 104.03 ? 602 HEM B C1D 1 
HETATM 7715 C  C2D . HEM F 3 .   ? -7.257  -14.491 -68.210 1.00 104.26 ? 602 HEM B C2D 1 
HETATM 7716 C  C3D . HEM F 3 .   ? -7.626  -13.967 -69.192 1.00 104.27 ? 602 HEM B C3D 1 
HETATM 7717 C  C4D . HEM F 3 .   ? -6.662  -13.223 -69.848 1.00 104.05 ? 602 HEM B C4D 1 
HETATM 7718 C  CMD . HEM F 3 .   ? -8.071  -15.362 -67.299 1.00 104.36 ? 602 HEM B CMD 1 
HETATM 7719 C  CAD . HEM F 3 .   ? -9.005  -14.016 -69.803 1.00 104.34 ? 602 HEM B CAD 1 
HETATM 7720 C  CBD . HEM F 3 .   ? -9.041  -15.032 -70.903 1.00 104.40 ? 602 HEM B CBD 1 
HETATM 7721 C  CGD . HEM F 3 .   ? -10.020 -14.638 -71.964 1.00 104.46 ? 602 HEM B CGD 1 
HETATM 7722 O  O1D . HEM F 3 .   ? -10.604 -13.518 -71.925 1.00 104.47 ? 602 HEM B O1D 1 
HETATM 7723 O  O2D . HEM F 3 .   ? -10.266 -15.438 -72.908 1.00 104.50 ? 602 HEM B O2D 1 
HETATM 7724 N  NA  . HEM F 3 .   ? -4.430  -11.659 -71.136 1.00 103.77 ? 602 HEM B NA  1 
HETATM 7725 N  NB  . HEM F 3 .   ? -1.898  -11.797 -69.672 1.00 103.76 ? 602 HEM B NB  1 
HETATM 7726 N  NC  . HEM F 3 .   ? -3.014  -13.528 -67.558 1.00 103.72 ? 602 HEM B NC  1 
HETATM 7727 N  ND  . HEM F 3 .   ? -5.493  -13.403 -68.984 1.00 103.75 ? 602 HEM B ND  1 
HETATM 7728 FE FE  . HEM F 3 .   ? -3.688  -12.585 -69.347 1.00 101.74 ? 602 HEM B FE  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLY 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   ?   ?   ?   A . n 
A 1 4   GLU 4   4   ?   ?   ?   A . n 
A 1 5   THR 5   5   ?   ?   ?   A . n 
A 1 6   PRO 6   6   ?   ?   ?   A . n 
A 1 7   GLN 7   7   ?   ?   ?   A . n 
A 1 8   ALA 8   8   ?   ?   ?   A . n 
A 1 9   GLU 9   9   ?   ?   ?   A . n 
A 1 10  VAL 10  10  ?   ?   ?   A . n 
A 1 11  GLY 11  11  ?   ?   ?   A . n 
A 1 12  PRO 12  12  ?   ?   ?   A . n 
A 1 13  THR 13  13  ?   ?   ?   A . n 
A 1 14  GLY 14  14  ?   ?   ?   A . n 
A 1 15  CYS 15  15  ?   ?   ?   A . n 
A 1 16  PRO 16  16  ?   ?   ?   A . n 
A 1 17  HIS 17  17  ?   ?   ?   A . n 
A 1 18  ARG 18  18  ?   ?   ?   A . n 
A 1 19  SER 19  19  ?   ?   ?   A . n 
A 1 20  GLY 20  20  ?   ?   ?   A . n 
A 1 21  PRO 21  21  ?   ?   ?   A . n 
A 1 22  HIS 22  22  ?   ?   ?   A . n 
A 1 23  SER 23  23  ?   ?   ?   A . n 
A 1 24  ALA 24  24  ?   ?   ?   A . n 
A 1 25  LYS 25  25  ?   ?   ?   A . n 
A 1 26  GLY 26  26  ?   ?   ?   A . n 
A 1 27  SER 27  27  ?   ?   ?   A . n 
A 1 28  LEU 28  28  ?   ?   ?   A . n 
A 1 29  GLU 29  29  ?   ?   ?   A . n 
A 1 30  LYS 30  30  ?   ?   ?   A . n 
A 1 31  GLY 31  31  ?   ?   ?   A . n 
A 1 32  SER 32  32  ?   ?   ?   A . n 
A 1 33  PRO 33  33  ?   ?   ?   A . n 
A 1 34  GLU 34  34  ?   ?   ?   A . n 
A 1 35  ASP 35  35  ?   ?   ?   A . n 
A 1 36  LYS 36  36  ?   ?   ?   A . n 
A 1 37  GLU 37  37  ?   ?   ?   A . n 
A 1 38  ALA 38  38  ?   ?   ?   A . n 
A 1 39  LYS 39  39  ?   ?   ?   A . n 
A 1 40  GLU 40  40  ?   ?   ?   A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  TRP 43  43  43  TRP TRP A . n 
A 1 44  ILE 44  44  44  ILE ILE A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  PRO 46  46  46  PRO PRO A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  ARG 51  51  51  ARG ARG A . n 
A 1 52  CYS 52  52  52  CYS CYS A . n 
A 1 53  THR 53  53  53  THR THR A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  GLN 55  55  55  GLN GLN A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  ARG 58  58  58  ARG ARG A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  HIS 65  65  65  HIS HIS A . n 
A 1 66  HIS 66  66  66  HIS HIS A . n 
A 1 67  HIS 67  67  67  HIS HIS A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  LYS 72  72  72  LYS LYS A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  PRO 74  74  74  PRO PRO A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  ILE 76  76  76  ILE ILE A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  ASP 79  79  79  ASP ASP A . n 
A 1 80  ILE 80  80  80  ILE ILE A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  LYS 83  83  83  LYS LYS A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  MET 89  89  89  MET MET A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  ARG 91  91  91  ARG ARG A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  ILE 95  95  95  ILE ILE A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 CYS 103 103 103 CYS CYS A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 LYS 108 108 108 LYS LYS A . n 
A 1 109 CYS 109 109 109 CYS CYS A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 PHE 111 111 111 PHE PHE A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 ASP 120 120 120 ASP ASP A . n 
A 1 121 ARG 121 121 121 ARG ARG A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 ARG 125 125 125 ARG ARG A . n 
A 1 126 MET 126 126 126 MET MET A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
A 1 132 ARG 132 132 132 ARG ARG A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 THR 135 135 135 THR THR A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 PRO 138 138 138 PRO PRO A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 ASP 140 140 140 ASP ASP A . n 
A 1 141 THR 141 141 141 THR THR A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 THR 146 146 146 THR THR A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 THR 150 150 150 THR THR A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 GLY 153 153 153 GLY GLY A . n 
A 1 154 LEU 154 154 154 LEU LEU A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 ALA 159 159 159 ALA ALA A . n 
A 1 160 VAL 160 160 160 VAL VAL A . n 
A 1 161 ARG 161 161 161 ARG ARG A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 TYR 163 163 163 TYR TYR A . n 
A 1 164 ARG 164 164 164 ARG ARG A . n 
A 1 165 CYS 165 165 165 CYS CYS A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 MET 169 169 169 MET MET A . n 
A 1 170 PRO 170 170 170 PRO PRO A . n 
A 1 171 GLU 171 171 171 GLU GLU A . n 
A 1 172 LYS 172 172 172 LYS LYS A . n 
A 1 173 MET 173 173 173 MET MET A . n 
A 1 174 SER 174 174 174 SER SER A . n 
A 1 175 SER 175 175 175 SER SER A . n 
A 1 176 GLU 176 176 176 GLU GLU A . n 
A 1 177 LYS 177 177 177 LYS LYS A . n 
A 1 178 VAL 178 178 178 VAL VAL A . n 
A 1 179 ASP 179 179 179 ASP ASP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 ARG 182 182 182 ARG ARG A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 GLY 185 185 185 GLY GLY A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 ILE 188 188 188 ILE ILE A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 ARG 190 190 190 ARG ARG A . n 
A 1 191 THR 191 191 191 THR THR A . n 
A 1 192 PRO 192 192 192 PRO PRO A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 ASN 194 194 194 ASN ASN A . n 
A 1 195 ALA 195 195 195 ALA ALA A . n 
A 1 196 ARG 196 196 196 ARG ARG A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 ASP 198 198 198 ASP ASP A . n 
A 1 199 SER 199 199 199 SER SER A . n 
A 1 200 PRO 200 200 200 PRO PRO A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 SER 202 202 202 SER SER A . n 
A 1 203 HIS 203 203 203 HIS HIS A . n 
A 1 204 VAL 204 204 204 VAL VAL A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 TRP 208 208 208 TRP TRP A . n 
A 1 209 ARG 209 209 209 ARG ARG A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 LYS 211 211 211 LYS LYS A . n 
A 1 212 ASN 212 212 212 ASN ASN A . n 
A 1 213 GLU 213 213 213 GLU GLU A . n 
A 1 214 ILE 214 214 214 ILE ILE A . n 
A 1 215 PRO 215 215 215 PRO PRO A . n 
A 1 216 ASN 216 216 216 ASN ASN A . n 
A 1 217 SER 217 217 217 SER SER A . n 
A 1 218 HIS 218 218 218 HIS HIS A . n 
A 1 219 ILE 219 219 219 ILE ILE A . n 
A 1 220 LEU 220 220 220 LEU LEU A . n 
A 1 221 ASP 221 221 221 ASP ASP A . n 
A 1 222 GLN 222 222 222 GLN GLN A . n 
A 1 223 TYR 223 223 223 TYR TYR A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ASN 225 225 225 ASN ASN A . n 
A 1 226 ALA 226 226 226 ALA ALA A . n 
A 1 227 SER 227 227 227 SER SER A . n 
A 1 228 ASN 228 228 228 ASN ASN A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 HIS 232 232 232 HIS HIS A . n 
A 1 233 TYR 233 233 233 TYR TYR A . n 
A 1 234 ASP 234 234 234 ASP ASP A . n 
A 1 235 THR 235 235 235 THR THR A . n 
A 1 236 THR 236 236 236 THR THR A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 ASP 238 238 238 ASP ASP A . n 
A 1 239 GLU 239 239 239 GLU GLU A . n 
A 1 240 ILE 240 240 240 ILE ILE A . n 
A 1 241 LEU 241 241 241 LEU LEU A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 GLN 243 243 243 GLN GLN A . n 
A 1 244 CYS 244 244 244 CYS CYS A . n 
A 1 245 ASP 245 245 245 ASP ASP A . n 
A 1 246 GLY 246 246 246 GLY GLY A . n 
A 1 247 LYS 247 247 247 LYS LYS A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 ASP 249 249 249 ASP ASP A . n 
A 1 250 MET 250 250 250 MET MET A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 ALA 253 253 253 ALA ALA A . n 
A 1 254 SER 254 254 254 SER SER A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 THR 257 257 257 THR THR A . n 
A 1 258 GLY 258 258 258 GLY GLY A . n 
A 1 259 GLY 259 259 259 GLY GLY A . n 
A 1 260 THR 260 260 260 THR THR A . n 
A 1 261 ILE 261 261 261 ILE ILE A . n 
A 1 262 THR 262 262 262 THR THR A . n 
A 1 263 GLY 263 263 263 GLY GLY A . n 
A 1 264 ILE 264 264 264 ILE ILE A . n 
A 1 265 ALA 265 265 265 ALA ALA A . n 
A 1 266 ARG 266 266 266 ARG ARG A . n 
A 1 267 LYS 267 267 267 LYS LYS A . n 
A 1 268 LEU 268 268 268 LEU LEU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 GLU 270 270 270 GLU GLU A . n 
A 1 271 LYS 271 271 271 LYS LYS A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 PRO 273 273 273 PRO PRO A . n 
A 1 274 GLY 274 274 274 GLY GLY A . n 
A 1 275 CYS 275 275 275 CYS CYS A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 ILE 277 277 277 ILE ILE A . n 
A 1 278 ILE 278 278 278 ILE ILE A . n 
A 1 279 GLY 279 279 279 GLY GLY A . n 
A 1 280 VAL 280 280 280 VAL VAL A . n 
A 1 281 ASP 281 281 281 ASP ASP A . n 
A 1 282 PRO 282 282 282 PRO PRO A . n 
A 1 283 GLU 283 283 283 GLU GLU A . n 
A 1 284 GLY 284 284 284 GLY GLY A . n 
A 1 285 SER 285 285 285 SER SER A . n 
A 1 286 ILE 286 286 286 ILE ILE A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 GLU 289 289 289 GLU GLU A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 LEU 293 293 293 LEU LEU A . n 
A 1 294 ASN 294 294 294 ASN ASN A . n 
A 1 295 GLN 295 295 295 GLN GLN A . n 
A 1 296 THR 296 296 296 THR THR A . n 
A 1 297 GLU 297 297 297 GLU GLU A . n 
A 1 298 GLN 298 298 298 GLN GLN A . n 
A 1 299 THR 299 299 299 THR THR A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 TYR 301 301 301 TYR TYR A . n 
A 1 302 GLU 302 302 302 GLU GLU A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 GLU 304 304 304 GLU GLU A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ILE 306 306 306 ILE ILE A . n 
A 1 307 GLY 307 307 307 GLY GLY A . n 
A 1 308 TYR 308 308 308 TYR TYR A . n 
A 1 309 ASP 309 309 309 ASP ASP A . n 
A 1 310 PHE 310 310 310 PHE PHE A . n 
A 1 311 ILE 311 311 311 ILE ILE A . n 
A 1 312 PRO 312 312 312 PRO PRO A . n 
A 1 313 THR 313 313 313 THR THR A . n 
A 1 314 VAL 314 314 314 VAL VAL A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ASP 316 316 316 ASP ASP A . n 
A 1 317 ARG 317 317 317 ARG ARG A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 VAL 319 319 319 VAL VAL A . n 
A 1 320 VAL 320 320 320 VAL VAL A . n 
A 1 321 ASP 321 321 321 ASP ASP A . n 
A 1 322 LYS 322 322 322 LYS LYS A . n 
A 1 323 TRP 323 323 323 TRP TRP A . n 
A 1 324 PHE 324 324 324 PHE PHE A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 SER 326 326 326 SER SER A . n 
A 1 327 ASN 327 327 327 ASN ASN A . n 
A 1 328 ASP 328 328 328 ASP ASP A . n 
A 1 329 GLU 329 329 329 GLU GLU A . n 
A 1 330 GLU 330 330 330 GLU GLU A . n 
A 1 331 ALA 331 331 331 ALA ALA A . n 
A 1 332 PHE 332 332 332 PHE PHE A . n 
A 1 333 THR 333 333 333 THR THR A . n 
A 1 334 PHE 334 334 334 PHE PHE A . n 
A 1 335 ALA 335 335 335 ALA ALA A . n 
A 1 336 ARG 336 336 336 ARG ARG A . n 
A 1 337 MET 337 337 337 MET MET A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 ILE 339 339 339 ILE ILE A . n 
A 1 340 ALA 340 340 340 ALA ALA A . n 
A 1 341 GLN 341 341 341 GLN GLN A . n 
A 1 342 GLU 342 342 342 GLU GLU A . n 
A 1 343 GLY 343 343 343 GLY GLY A . n 
A 1 344 LEU 344 344 344 LEU LEU A . n 
A 1 345 LEU 345 345 345 LEU LEU A . n 
A 1 346 CYS 346 346 346 CYS CYS A . n 
A 1 347 GLY 347 347 347 GLY GLY A . n 
A 1 348 GLY 348 348 348 GLY GLY A . n 
A 1 349 SER 349 349 349 SER SER A . n 
A 1 350 ALA 350 350 350 ALA ALA A . n 
A 1 351 GLY 351 351 351 GLY GLY A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 THR 353 353 353 THR THR A . n 
A 1 354 VAL 354 354 354 VAL VAL A . n 
A 1 355 ALA 355 355 355 ALA ALA A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 VAL 358 358 358 VAL VAL A . n 
A 1 359 LYS 359 359 359 LYS LYS A . n 
A 1 360 ALA 360 360 360 ALA ALA A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLN 362 362 362 GLN GLN A . n 
A 1 363 GLU 363 363 363 GLU GLU A . n 
A 1 364 LEU 364 364 364 LEU LEU A . n 
A 1 365 GLN 365 365 365 GLN GLN A . n 
A 1 366 GLU 366 366 366 GLU GLU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 GLN 368 368 368 GLN GLN A . n 
A 1 369 ARG 369 369 369 ARG ARG A . n 
A 1 370 CYS 370 370 370 CYS CYS A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 VAL 372 372 372 VAL VAL A . n 
A 1 373 ILE 373 373 373 ILE ILE A . n 
A 1 374 LEU 374 374 374 LEU LEU A . n 
A 1 375 PRO 375 375 375 PRO PRO A . n 
A 1 376 ASP 376 376 376 ASP ASP A . n 
A 1 377 SER 377 377 377 SER SER A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 ARG 379 379 379 ARG ARG A . n 
A 1 380 ASN 380 380 380 ASN ASN A . n 
A 1 381 TYR 381 381 381 TYR TYR A . n 
A 1 382 MET 382 382 382 MET MET A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 LYS 384 384 384 LYS LYS A . n 
A 1 385 PHE 385 385 385 PHE PHE A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 SER 387 387 387 SER SER A . n 
A 1 388 ASP 388 388 388 ASP ASP A . n 
A 1 389 ARG 389 389 389 ARG ARG A . n 
A 1 390 TRP 390 390 390 TRP TRP A . n 
A 1 391 MET 391 391 391 MET MET A . n 
A 1 392 LEU 392 392 392 LEU LEU A . n 
A 1 393 GLN 393 393 393 GLN GLN A . n 
A 1 394 LYS 394 394 394 LYS LYS A . n 
A 1 395 GLY 395 395 395 GLY GLY A . n 
A 1 396 PHE 396 396 396 PHE PHE A . n 
A 1 397 LEU 397 397 397 LEU LEU A . n 
A 1 398 LYS 398 398 398 LYS LYS A . n 
A 1 399 GLU 399 399 399 GLU GLU A . n 
A 1 400 GLU 400 400 400 GLU ALA A . n 
A 1 401 ASP 401 401 401 ASP ALA A . n 
A 1 402 LEU 402 402 ?   ?   ?   A . n 
A 1 403 THR 403 403 403 THR ALA A . n 
A 1 404 GLU 404 404 404 GLU ALA A . n 
A 1 405 LYS 405 405 405 LYS ALA A . n 
A 1 406 LYS 406 406 406 LYS ALA A . n 
A 1 407 PRO 407 407 407 PRO PRO A . n 
A 1 408 TRP 408 408 408 TRP TRP A . n 
A 1 409 TRP 409 409 409 TRP TRP A . n 
A 1 410 TRP 410 410 410 TRP TRP A . n 
A 1 411 HIS 411 411 411 HIS HIS A . n 
A 1 412 LEU 412 412 412 LEU LEU A . n 
A 1 413 ARG 413 413 413 ARG ARG A . n 
A 1 414 VAL 414 414 414 VAL VAL A . n 
A 1 415 GLN 415 415 415 GLN GLN A . n 
A 1 416 GLU 416 416 416 GLU GLU A . n 
A 1 417 LEU 417 417 417 LEU LEU A . n 
A 1 418 GLY 418 418 418 GLY GLY A . n 
A 1 419 LEU 419 419 419 LEU LEU A . n 
A 1 420 SER 420 420 420 SER SER A . n 
A 1 421 ALA 421 421 421 ALA ALA A . n 
A 1 422 PRO 422 422 422 PRO PRO A . n 
A 1 423 LEU 423 423 423 LEU LEU A . n 
A 1 424 THR 424 424 424 THR THR A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 LEU 426 426 426 LEU LEU A . n 
A 1 427 PRO 427 427 427 PRO PRO A . n 
A 1 428 THR 428 428 428 THR THR A . n 
A 1 429 ILE 429 429 429 ILE ILE A . n 
A 1 430 THR 430 430 430 THR THR A . n 
A 1 431 CYS 431 431 431 CYS CYS A . n 
A 1 432 GLY 432 432 432 GLY GLY A . n 
A 1 433 HIS 433 433 433 HIS HIS A . n 
A 1 434 THR 434 434 434 THR THR A . n 
A 1 435 ILE 435 435 435 ILE ILE A . n 
A 1 436 GLU 436 436 436 GLU GLU A . n 
A 1 437 ILE 437 437 437 ILE ILE A . n 
A 1 438 LEU 438 438 438 LEU LEU A . n 
A 1 439 ARG 439 439 439 ARG ARG A . n 
A 1 440 GLU 440 440 440 GLU GLU A . n 
A 1 441 LYS 441 441 441 LYS LYS A . n 
A 1 442 GLY 442 442 442 GLY GLY A . n 
A 1 443 PHE 443 443 443 PHE PHE A . n 
A 1 444 ASP 444 444 444 ASP ASP A . n 
A 1 445 GLN 445 445 445 GLN GLN A . n 
A 1 446 ALA 446 446 446 ALA ALA A . n 
A 1 447 PRO 447 447 447 PRO PRO A . n 
A 1 448 VAL 448 448 448 VAL VAL A . n 
A 1 449 VAL 449 449 449 VAL VAL A . n 
A 1 450 ASP 450 450 450 ASP ASP A . n 
A 1 451 GLU 451 451 451 GLU GLU A . n 
A 1 452 ALA 452 452 452 ALA ALA A . n 
A 1 453 GLY 453 453 453 GLY GLY A . n 
A 1 454 VAL 454 454 454 VAL VAL A . n 
A 1 455 ILE 455 455 455 ILE ILE A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 GLY 457 457 457 GLY GLY A . n 
A 1 458 MET 458 458 458 MET MET A . n 
A 1 459 VAL 459 459 459 VAL VAL A . n 
A 1 460 THR 460 460 460 THR THR A . n 
A 1 461 LEU 461 461 461 LEU LEU A . n 
A 1 462 GLY 462 462 462 GLY GLY A . n 
A 1 463 ASN 463 463 463 ASN ASN A . n 
A 1 464 MET 464 464 464 MET MET A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 SER 467 467 467 SER SER A . n 
A 1 468 LEU 468 468 468 LEU LEU A . n 
A 1 469 LEU 469 469 469 LEU LEU A . n 
A 1 470 ALA 470 470 470 ALA ALA A . n 
A 1 471 GLY 471 471 471 GLY GLY A . n 
A 1 472 LYS 472 472 472 LYS LYS A . n 
A 1 473 VAL 473 473 473 VAL VAL A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 PRO 475 475 475 PRO PRO A . n 
A 1 476 SER 476 476 476 SER SER A . n 
A 1 477 ASP 477 477 477 ASP ASP A . n 
A 1 478 GLN 478 478 478 GLN GLN A . n 
A 1 479 VAL 479 479 479 VAL VAL A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 LYS 481 481 481 LYS LYS A . n 
A 1 482 VAL 482 482 482 VAL VAL A . n 
A 1 483 ILE 483 483 483 ILE ILE A . n 
A 1 484 TYR 484 484 484 TYR TYR A . n 
A 1 485 LYS 485 485 485 LYS LYS A . n 
A 1 486 GLN 486 486 486 GLN GLN A . n 
A 1 487 PHE 487 487 487 PHE PHE A . n 
A 1 488 LYS 488 488 488 LYS LYS A . n 
A 1 489 GLN 489 489 489 GLN GLN A . n 
A 1 490 ILE 490 490 490 ILE ILE A . n 
A 1 491 ARG 491 491 491 ARG ARG A . n 
A 1 492 LEU 492 492 492 LEU LEU A . n 
A 1 493 THR 493 493 493 THR THR A . n 
A 1 494 ASP 494 494 494 ASP ASP A . n 
A 1 495 THR 495 495 495 THR THR A . n 
A 1 496 LEU 496 496 496 LEU LEU A . n 
A 1 497 GLY 497 497 497 GLY GLY A . n 
A 1 498 ARG 498 498 498 ARG ARG A . n 
A 1 499 LEU 499 499 499 LEU LEU A . n 
A 1 500 SER 500 500 500 SER SER A . n 
A 1 501 HIS 501 501 501 HIS HIS A . n 
A 1 502 ILE 502 502 502 ILE ILE A . n 
A 1 503 LEU 503 503 503 LEU LEU A . n 
A 1 504 GLU 504 504 504 GLU GLU A . n 
A 1 505 MET 505 505 505 MET MET A . n 
A 1 506 ASP 506 506 506 ASP ASP A . n 
A 1 507 HIS 507 507 507 HIS HIS A . n 
A 1 508 PHE 508 508 508 PHE PHE A . n 
A 1 509 ALA 509 509 509 ALA ALA A . n 
A 1 510 LEU 510 510 510 LEU LEU A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLU 514 514 514 GLU GLU A . n 
A 1 515 GLN 515 525 ?   ?   ?   A . n 
A 1 516 GLN 516 526 ?   ?   ?   A . n 
A 1 517 ARG 517 527 ?   ?   ?   A . n 
A 1 518 GLN 518 528 528 GLN GLN A . n 
A 1 519 MET 519 529 529 MET MET A . n 
A 1 520 VAL 520 530 530 VAL VAL A . n 
A 1 521 PHE 521 531 531 PHE PHE A . n 
A 1 522 GLY 522 532 532 GLY GLY A . n 
A 1 523 VAL 523 533 533 VAL VAL A . n 
A 1 524 VAL 524 534 534 VAL VAL A . n 
A 1 525 THR 525 535 535 THR THR A . n 
A 1 526 ALA 526 536 536 ALA ALA A . n 
A 1 527 ILE 527 537 537 ILE ILE A . n 
A 1 528 ASP 528 538 538 ASP ASP A . n 
A 1 529 LEU 529 539 539 LEU LEU A . n 
A 1 530 LEU 530 540 540 LEU LEU A . n 
A 1 531 ASN 531 541 541 ASN ASN A . n 
A 1 532 PHE 532 542 542 PHE PHE A . n 
A 1 533 VAL 533 543 543 VAL VAL A . n 
A 1 534 ALA 534 544 544 ALA ALA A . n 
A 1 535 ALA 535 545 545 ALA ALA A . n 
A 1 536 GLN 536 546 546 GLN GLN A . n 
A 1 537 GLU 537 547 547 GLU GLU A . n 
A 1 538 ARG 538 548 548 ARG ARG A . n 
A 1 539 ASP 539 549 549 ASP ASP A . n 
A 1 540 GLN 540 550 550 GLN GLN A . n 
A 1 541 LYS 541 551 ?   ?   ?   A . n 
A 1 542 GLU 542 552 ?   ?   ?   A . n 
A 1 543 LEU 543 553 ?   ?   ?   A . n 
A 1 544 HIS 544 554 ?   ?   ?   A . n 
A 1 545 HIS 545 555 ?   ?   ?   A . n 
A 1 546 HIS 546 556 ?   ?   ?   A . n 
A 1 547 HIS 547 557 ?   ?   ?   A . n 
A 1 548 HIS 548 558 ?   ?   ?   A . n 
A 1 549 HIS 549 559 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   SER 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   ?   ?   ?   B . n 
B 1 5   THR 5   5   ?   ?   ?   B . n 
B 1 6   PRO 6   6   ?   ?   ?   B . n 
B 1 7   GLN 7   7   ?   ?   ?   B . n 
B 1 8   ALA 8   8   ?   ?   ?   B . n 
B 1 9   GLU 9   9   ?   ?   ?   B . n 
B 1 10  VAL 10  10  ?   ?   ?   B . n 
B 1 11  GLY 11  11  ?   ?   ?   B . n 
B 1 12  PRO 12  12  ?   ?   ?   B . n 
B 1 13  THR 13  13  ?   ?   ?   B . n 
B 1 14  GLY 14  14  ?   ?   ?   B . n 
B 1 15  CYS 15  15  ?   ?   ?   B . n 
B 1 16  PRO 16  16  ?   ?   ?   B . n 
B 1 17  HIS 17  17  ?   ?   ?   B . n 
B 1 18  ARG 18  18  ?   ?   ?   B . n 
B 1 19  SER 19  19  ?   ?   ?   B . n 
B 1 20  GLY 20  20  ?   ?   ?   B . n 
B 1 21  PRO 21  21  ?   ?   ?   B . n 
B 1 22  HIS 22  22  ?   ?   ?   B . n 
B 1 23  SER 23  23  ?   ?   ?   B . n 
B 1 24  ALA 24  24  ?   ?   ?   B . n 
B 1 25  LYS 25  25  ?   ?   ?   B . n 
B 1 26  GLY 26  26  ?   ?   ?   B . n 
B 1 27  SER 27  27  ?   ?   ?   B . n 
B 1 28  LEU 28  28  ?   ?   ?   B . n 
B 1 29  GLU 29  29  ?   ?   ?   B . n 
B 1 30  LYS 30  30  ?   ?   ?   B . n 
B 1 31  GLY 31  31  ?   ?   ?   B . n 
B 1 32  SER 32  32  ?   ?   ?   B . n 
B 1 33  PRO 33  33  ?   ?   ?   B . n 
B 1 34  GLU 34  34  ?   ?   ?   B . n 
B 1 35  ASP 35  35  ?   ?   ?   B . n 
B 1 36  LYS 36  36  ?   ?   ?   B . n 
B 1 37  GLU 37  37  ?   ?   ?   B . n 
B 1 38  ALA 38  38  ?   ?   ?   B . n 
B 1 39  LYS 39  39  ?   ?   ?   B . n 
B 1 40  GLU 40  40  ?   ?   ?   B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  LEU 42  42  42  LEU LEU B . n 
B 1 43  TRP 43  43  43  TRP TRP B . n 
B 1 44  ILE 44  44  44  ILE ILE B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  PRO 46  46  46  PRO PRO B . n 
B 1 47  ASP 47  47  47  ASP ASP B . n 
B 1 48  ALA 48  48  48  ALA ALA B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  SER 50  50  50  SER SER B . n 
B 1 51  ARG 51  51  51  ARG ARG B . n 
B 1 52  CYS 52  52  52  CYS CYS B . n 
B 1 53  THR 53  53  53  THR THR B . n 
B 1 54  TRP 54  54  54  TRP TRP B . n 
B 1 55  GLN 55  55  55  GLN GLN B . n 
B 1 56  LEU 56  56  56  LEU LEU B . n 
B 1 57  GLY 57  57  57  GLY GLY B . n 
B 1 58  ARG 58  58  58  ARG ARG B . n 
B 1 59  PRO 59  59  59  PRO PRO B . n 
B 1 60  ALA 60  60  60  ALA ALA B . n 
B 1 61  SER 61  61  61  SER SER B . n 
B 1 62  GLU 62  62  62  GLU GLU B . n 
B 1 63  SER 63  63  63  SER SER B . n 
B 1 64  PRO 64  64  64  PRO PRO B . n 
B 1 65  HIS 65  65  65  HIS HIS B . n 
B 1 66  HIS 66  66  66  HIS HIS B . n 
B 1 67  HIS 67  67  67  HIS HIS B . n 
B 1 68  THR 68  68  68  THR THR B . n 
B 1 69  ALA 69  69  69  ALA ALA B . n 
B 1 70  PRO 70  70  70  PRO PRO B . n 
B 1 71  ALA 71  71  71  ALA ALA B . n 
B 1 72  LYS 72  72  72  LYS LYS B . n 
B 1 73  SER 73  73  73  SER SER B . n 
B 1 74  PRO 74  74  74  PRO PRO B . n 
B 1 75  LYS 75  75  75  LYS LYS B . n 
B 1 76  ILE 76  76  76  ILE ILE B . n 
B 1 77  LEU 77  77  77  LEU LEU B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  ASP 79  79  79  ASP ASP B . n 
B 1 80  ILE 80  80  80  ILE ILE B . n 
B 1 81  LEU 81  81  81  LEU LEU B . n 
B 1 82  LYS 82  82  82  LYS LYS B . n 
B 1 83  LYS 83  83  83  LYS LYS B . n 
B 1 84  ILE 84  84  84  ILE ILE B . n 
B 1 85  GLY 85  85  85  GLY GLY B . n 
B 1 86  ASP 86  86  86  ASP ASP B . n 
B 1 87  THR 87  87  87  THR THR B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  MET 89  89  89  MET MET B . n 
B 1 90  VAL 90  90  90  VAL VAL B . n 
B 1 91  ARG 91  91  91  ARG ARG B . n 
B 1 92  ILE 92  92  92  ILE ILE B . n 
B 1 93  ASN 93  93  93  ASN ASN B . n 
B 1 94  LYS 94  94  94  LYS LYS B . n 
B 1 95  ILE 95  95  95  ILE ILE B . n 
B 1 96  GLY 96  96  96  GLY GLY B . n 
B 1 97  LYS 97  97  97  LYS LYS B . n 
B 1 98  LYS 98  98  98  LYS LYS B . n 
B 1 99  PHE 99  99  99  PHE PHE B . n 
B 1 100 GLY 100 100 100 GLY GLY B . n 
B 1 101 LEU 101 101 101 LEU LEU B . n 
B 1 102 LYS 102 102 102 LYS LYS B . n 
B 1 103 CYS 103 103 103 CYS CYS B . n 
B 1 104 GLU 104 104 104 GLU GLU B . n 
B 1 105 LEU 105 105 105 LEU LEU B . n 
B 1 106 LEU 106 106 106 LEU LEU B . n 
B 1 107 ALA 107 107 107 ALA ALA B . n 
B 1 108 LYS 108 108 108 LYS LYS B . n 
B 1 109 CYS 109 109 109 CYS CYS B . n 
B 1 110 GLU 110 110 110 GLU GLU B . n 
B 1 111 PHE 111 111 111 PHE PHE B . n 
B 1 112 PHE 112 112 112 PHE PHE B . n 
B 1 113 ASN 113 113 113 ASN ASN B . n 
B 1 114 ALA 114 114 114 ALA ALA B . n 
B 1 115 GLY 115 115 115 GLY GLY B . n 
B 1 116 GLY 116 116 116 GLY GLY B . n 
B 1 117 SER 117 117 117 SER SER B . n 
B 1 118 VAL 118 118 118 VAL VAL B . n 
B 1 119 LYS 119 119 119 LYS LYS B . n 
B 1 120 ASP 120 120 120 ASP ASP B . n 
B 1 121 ARG 121 121 121 ARG ARG B . n 
B 1 122 ILE 122 122 122 ILE ILE B . n 
B 1 123 SER 123 123 123 SER SER B . n 
B 1 124 LEU 124 124 124 LEU LEU B . n 
B 1 125 ARG 125 125 125 ARG ARG B . n 
B 1 126 MET 126 126 126 MET MET B . n 
B 1 127 ILE 127 127 127 ILE ILE B . n 
B 1 128 GLU 128 128 128 GLU GLU B . n 
B 1 129 ASP 129 129 129 ASP ASP B . n 
B 1 130 ALA 130 130 130 ALA ALA B . n 
B 1 131 GLU 131 131 131 GLU GLU B . n 
B 1 132 ARG 132 132 132 ARG ARG B . n 
B 1 133 ASP 133 133 133 ASP ASP B . n 
B 1 134 GLY 134 134 134 GLY GLY B . n 
B 1 135 THR 135 135 135 THR THR B . n 
B 1 136 LEU 136 136 136 LEU LEU B . n 
B 1 137 LYS 137 137 137 LYS LYS B . n 
B 1 138 PRO 138 138 138 PRO PRO B . n 
B 1 139 GLY 139 139 139 GLY GLY B . n 
B 1 140 ASP 140 140 140 ASP ASP B . n 
B 1 141 THR 141 141 141 THR THR B . n 
B 1 142 ILE 142 142 142 ILE ILE B . n 
B 1 143 ILE 143 143 143 ILE ILE B . n 
B 1 144 GLU 144 144 144 GLU GLU B . n 
B 1 145 PRO 145 145 145 PRO PRO B . n 
B 1 146 THR 146 146 146 THR THR B . n 
B 1 147 SER 147 147 147 SER SER B . n 
B 1 148 GLY 148 148 148 GLY GLY B . n 
B 1 149 ASN 149 149 149 ASN ASN B . n 
B 1 150 THR 150 150 150 THR THR B . n 
B 1 151 GLY 151 151 151 GLY GLY B . n 
B 1 152 ILE 152 152 152 ILE ILE B . n 
B 1 153 GLY 153 153 153 GLY GLY B . n 
B 1 154 LEU 154 154 154 LEU LEU B . n 
B 1 155 ALA 155 155 155 ALA ALA B . n 
B 1 156 LEU 156 156 156 LEU LEU B . n 
B 1 157 ALA 157 157 157 ALA ALA B . n 
B 1 158 ALA 158 158 158 ALA ALA B . n 
B 1 159 ALA 159 159 159 ALA ALA B . n 
B 1 160 VAL 160 160 160 VAL VAL B . n 
B 1 161 ARG 161 161 161 ARG ARG B . n 
B 1 162 GLY 162 162 162 GLY GLY B . n 
B 1 163 TYR 163 163 163 TYR TYR B . n 
B 1 164 ARG 164 164 164 ARG ARG B . n 
B 1 165 CYS 165 165 165 CYS CYS B . n 
B 1 166 ILE 166 166 166 ILE ILE B . n 
B 1 167 ILE 167 167 167 ILE ILE B . n 
B 1 168 VAL 168 168 168 VAL VAL B . n 
B 1 169 MET 169 169 169 MET MET B . n 
B 1 170 PRO 170 170 170 PRO PRO B . n 
B 1 171 GLU 171 171 171 GLU GLU B . n 
B 1 172 LYS 172 172 172 LYS LYS B . n 
B 1 173 MET 173 173 173 MET MET B . n 
B 1 174 SER 174 174 174 SER SER B . n 
B 1 175 SER 175 175 175 SER SER B . n 
B 1 176 GLU 176 176 176 GLU GLU B . n 
B 1 177 LYS 177 177 177 LYS LYS B . n 
B 1 178 VAL 178 178 178 VAL VAL B . n 
B 1 179 ASP 179 179 179 ASP ASP B . n 
B 1 180 VAL 180 180 180 VAL VAL B . n 
B 1 181 LEU 181 181 181 LEU LEU B . n 
B 1 182 ARG 182 182 182 ARG ARG B . n 
B 1 183 ALA 183 183 183 ALA ALA B . n 
B 1 184 LEU 184 184 184 LEU LEU B . n 
B 1 185 GLY 185 185 185 GLY GLY B . n 
B 1 186 ALA 186 186 186 ALA ALA B . n 
B 1 187 GLU 187 187 187 GLU GLU B . n 
B 1 188 ILE 188 188 188 ILE ILE B . n 
B 1 189 VAL 189 189 189 VAL VAL B . n 
B 1 190 ARG 190 190 190 ARG ARG B . n 
B 1 191 THR 191 191 191 THR THR B . n 
B 1 192 PRO 192 192 192 PRO PRO B . n 
B 1 193 THR 193 193 193 THR THR B . n 
B 1 194 ASN 194 194 194 ASN ASN B . n 
B 1 195 ALA 195 195 195 ALA ALA B . n 
B 1 196 ARG 196 196 196 ARG ARG B . n 
B 1 197 PHE 197 197 197 PHE PHE B . n 
B 1 198 ASP 198 198 198 ASP ASP B . n 
B 1 199 SER 199 199 199 SER SER B . n 
B 1 200 PRO 200 200 200 PRO PRO B . n 
B 1 201 GLU 201 201 201 GLU GLU B . n 
B 1 202 SER 202 202 202 SER SER B . n 
B 1 203 HIS 203 203 203 HIS HIS B . n 
B 1 204 VAL 204 204 204 VAL VAL B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 VAL 206 206 206 VAL VAL B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 TRP 208 208 208 TRP TRP B . n 
B 1 209 ARG 209 209 209 ARG ARG B . n 
B 1 210 LEU 210 210 210 LEU LEU B . n 
B 1 211 LYS 211 211 211 LYS LYS B . n 
B 1 212 ASN 212 212 212 ASN ASN B . n 
B 1 213 GLU 213 213 213 GLU GLU B . n 
B 1 214 ILE 214 214 214 ILE ILE B . n 
B 1 215 PRO 215 215 215 PRO PRO B . n 
B 1 216 ASN 216 216 216 ASN ASN B . n 
B 1 217 SER 217 217 217 SER SER B . n 
B 1 218 HIS 218 218 218 HIS HIS B . n 
B 1 219 ILE 219 219 219 ILE ILE B . n 
B 1 220 LEU 220 220 220 LEU LEU B . n 
B 1 221 ASP 221 221 221 ASP ASP B . n 
B 1 222 GLN 222 222 222 GLN GLN B . n 
B 1 223 TYR 223 223 223 TYR TYR B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 ASN 225 225 225 ASN ASN B . n 
B 1 226 ALA 226 226 226 ALA ALA B . n 
B 1 227 SER 227 227 227 SER SER B . n 
B 1 228 ASN 228 228 228 ASN ASN B . n 
B 1 229 PRO 229 229 229 PRO PRO B . n 
B 1 230 LEU 230 230 230 LEU LEU B . n 
B 1 231 ALA 231 231 231 ALA ALA B . n 
B 1 232 HIS 232 232 232 HIS HIS B . n 
B 1 233 TYR 233 233 233 TYR TYR B . n 
B 1 234 ASP 234 234 234 ASP ASP B . n 
B 1 235 THR 235 235 235 THR THR B . n 
B 1 236 THR 236 236 236 THR THR B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 ASP 238 238 238 ASP ASP B . n 
B 1 239 GLU 239 239 239 GLU GLU B . n 
B 1 240 ILE 240 240 240 ILE ILE B . n 
B 1 241 LEU 241 241 241 LEU LEU B . n 
B 1 242 GLN 242 242 242 GLN GLN B . n 
B 1 243 GLN 243 243 243 GLN GLN B . n 
B 1 244 CYS 244 244 244 CYS CYS B . n 
B 1 245 ASP 245 245 245 ASP ASP B . n 
B 1 246 GLY 246 246 246 GLY GLY B . n 
B 1 247 LYS 247 247 247 LYS LYS B . n 
B 1 248 LEU 248 248 248 LEU LEU B . n 
B 1 249 ASP 249 249 249 ASP ASP B . n 
B 1 250 MET 250 250 250 MET MET B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 VAL 252 252 252 VAL VAL B . n 
B 1 253 ALA 253 253 253 ALA ALA B . n 
B 1 254 SER 254 254 254 SER SER B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 THR 257 257 257 THR THR B . n 
B 1 258 GLY 258 258 258 GLY GLY B . n 
B 1 259 GLY 259 259 259 GLY GLY B . n 
B 1 260 THR 260 260 260 THR THR B . n 
B 1 261 ILE 261 261 261 ILE ILE B . n 
B 1 262 THR 262 262 262 THR THR B . n 
B 1 263 GLY 263 263 263 GLY GLY B . n 
B 1 264 ILE 264 264 264 ILE ILE B . n 
B 1 265 ALA 265 265 265 ALA ALA B . n 
B 1 266 ARG 266 266 266 ARG ARG B . n 
B 1 267 LYS 267 267 267 LYS LYS B . n 
B 1 268 LEU 268 268 268 LEU LEU B . n 
B 1 269 LYS 269 269 269 LYS LYS B . n 
B 1 270 GLU 270 270 270 GLU GLU B . n 
B 1 271 LYS 271 271 271 LYS LYS B . n 
B 1 272 CYS 272 272 272 CYS CYS B . n 
B 1 273 PRO 273 273 273 PRO PRO B . n 
B 1 274 GLY 274 274 274 GLY GLY B . n 
B 1 275 CYS 275 275 275 CYS CYS B . n 
B 1 276 ARG 276 276 276 ARG ARG B . n 
B 1 277 ILE 277 277 277 ILE ILE B . n 
B 1 278 ILE 278 278 278 ILE ILE B . n 
B 1 279 GLY 279 279 279 GLY GLY B . n 
B 1 280 VAL 280 280 280 VAL VAL B . n 
B 1 281 ASP 281 281 281 ASP ASP B . n 
B 1 282 PRO 282 282 282 PRO PRO B . n 
B 1 283 GLU 283 283 283 GLU GLU B . n 
B 1 284 GLY 284 284 284 GLY GLY B . n 
B 1 285 SER 285 285 285 SER SER B . n 
B 1 286 ILE 286 286 286 ILE ILE B . n 
B 1 287 LEU 287 287 287 LEU LEU B . n 
B 1 288 ALA 288 288 288 ALA ALA B . n 
B 1 289 GLU 289 289 289 GLU GLU B . n 
B 1 290 PRO 290 290 290 PRO PRO B . n 
B 1 291 GLU 291 291 291 GLU GLU B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 LEU 293 293 293 LEU LEU B . n 
B 1 294 ASN 294 294 294 ASN ASN B . n 
B 1 295 GLN 295 295 295 GLN GLN B . n 
B 1 296 THR 296 296 296 THR THR B . n 
B 1 297 GLU 297 297 297 GLU GLU B . n 
B 1 298 GLN 298 298 298 GLN GLN B . n 
B 1 299 THR 299 299 299 THR THR B . n 
B 1 300 THR 300 300 300 THR THR B . n 
B 1 301 TYR 301 301 301 TYR TYR B . n 
B 1 302 GLU 302 302 302 GLU GLU B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 GLU 304 304 304 GLU GLU B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 ILE 306 306 306 ILE ILE B . n 
B 1 307 GLY 307 307 307 GLY GLY B . n 
B 1 308 TYR 308 308 308 TYR TYR B . n 
B 1 309 ASP 309 309 309 ASP ASP B . n 
B 1 310 PHE 310 310 310 PHE PHE B . n 
B 1 311 ILE 311 311 311 ILE ILE B . n 
B 1 312 PRO 312 312 312 PRO PRO B . n 
B 1 313 THR 313 313 313 THR THR B . n 
B 1 314 VAL 314 314 314 VAL VAL B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 ASP 316 316 316 ASP ASP B . n 
B 1 317 ARG 317 317 317 ARG ARG B . n 
B 1 318 THR 318 318 318 THR THR B . n 
B 1 319 VAL 319 319 319 VAL VAL B . n 
B 1 320 VAL 320 320 320 VAL VAL B . n 
B 1 321 ASP 321 321 321 ASP ASP B . n 
B 1 322 LYS 322 322 322 LYS LYS B . n 
B 1 323 TRP 323 323 323 TRP TRP B . n 
B 1 324 PHE 324 324 324 PHE PHE B . n 
B 1 325 LYS 325 325 325 LYS LYS B . n 
B 1 326 SER 326 326 326 SER SER B . n 
B 1 327 ASN 327 327 327 ASN ASN B . n 
B 1 328 ASP 328 328 328 ASP ASP B . n 
B 1 329 GLU 329 329 329 GLU GLU B . n 
B 1 330 GLU 330 330 330 GLU GLU B . n 
B 1 331 ALA 331 331 331 ALA ALA B . n 
B 1 332 PHE 332 332 332 PHE PHE B . n 
B 1 333 THR 333 333 333 THR THR B . n 
B 1 334 PHE 334 334 334 PHE PHE B . n 
B 1 335 ALA 335 335 335 ALA ALA B . n 
B 1 336 ARG 336 336 336 ARG ARG B . n 
B 1 337 MET 337 337 337 MET MET B . n 
B 1 338 LEU 338 338 338 LEU LEU B . n 
B 1 339 ILE 339 339 339 ILE ILE B . n 
B 1 340 ALA 340 340 340 ALA ALA B . n 
B 1 341 GLN 341 341 341 GLN GLN B . n 
B 1 342 GLU 342 342 342 GLU GLU B . n 
B 1 343 GLY 343 343 343 GLY GLY B . n 
B 1 344 LEU 344 344 344 LEU LEU B . n 
B 1 345 LEU 345 345 345 LEU LEU B . n 
B 1 346 CYS 346 346 346 CYS CYS B . n 
B 1 347 GLY 347 347 347 GLY GLY B . n 
B 1 348 GLY 348 348 348 GLY GLY B . n 
B 1 349 SER 349 349 349 SER SER B . n 
B 1 350 ALA 350 350 350 ALA ALA B . n 
B 1 351 GLY 351 351 351 GLY GLY B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 THR 353 353 353 THR THR B . n 
B 1 354 VAL 354 354 354 VAL VAL B . n 
B 1 355 ALA 355 355 355 ALA ALA B . n 
B 1 356 VAL 356 356 356 VAL VAL B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 VAL 358 358 358 VAL VAL B . n 
B 1 359 LYS 359 359 359 LYS LYS B . n 
B 1 360 ALA 360 360 360 ALA ALA B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLN 362 362 362 GLN GLN B . n 
B 1 363 GLU 363 363 363 GLU GLU B . n 
B 1 364 LEU 364 364 364 LEU LEU B . n 
B 1 365 GLN 365 365 365 GLN GLN B . n 
B 1 366 GLU 366 366 366 GLU GLU B . n 
B 1 367 GLY 367 367 367 GLY GLY B . n 
B 1 368 GLN 368 368 368 GLN GLN B . n 
B 1 369 ARG 369 369 369 ARG ARG B . n 
B 1 370 CYS 370 370 370 CYS CYS B . n 
B 1 371 VAL 371 371 371 VAL VAL B . n 
B 1 372 VAL 372 372 372 VAL VAL B . n 
B 1 373 ILE 373 373 373 ILE ILE B . n 
B 1 374 LEU 374 374 374 LEU LEU B . n 
B 1 375 PRO 375 375 375 PRO PRO B . n 
B 1 376 ASP 376 376 376 ASP ASP B . n 
B 1 377 SER 377 377 377 SER SER B . n 
B 1 378 VAL 378 378 378 VAL VAL B . n 
B 1 379 ARG 379 379 379 ARG ARG B . n 
B 1 380 ASN 380 380 380 ASN ASN B . n 
B 1 381 TYR 381 381 381 TYR TYR B . n 
B 1 382 MET 382 382 382 MET MET B . n 
B 1 383 THR 383 383 383 THR THR B . n 
B 1 384 LYS 384 384 384 LYS LYS B . n 
B 1 385 PHE 385 385 385 PHE PHE B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 SER 387 387 387 SER SER B . n 
B 1 388 ASP 388 388 388 ASP ASP B . n 
B 1 389 ARG 389 389 389 ARG ARG B . n 
B 1 390 TRP 390 390 390 TRP TRP B . n 
B 1 391 MET 391 391 391 MET MET B . n 
B 1 392 LEU 392 392 392 LEU LEU B . n 
B 1 393 GLN 393 393 393 GLN GLN B . n 
B 1 394 LYS 394 394 394 LYS LYS B . n 
B 1 395 GLY 395 395 395 GLY GLY B . n 
B 1 396 PHE 396 396 396 PHE PHE B . n 
B 1 397 LEU 397 397 397 LEU LEU B . n 
B 1 398 LYS 398 398 398 LYS LYS B . n 
B 1 399 GLU 399 399 399 GLU GLU B . n 
B 1 400 GLU 400 400 400 GLU ALA B . n 
B 1 401 ASP 401 401 401 ASP ALA B . n 
B 1 402 LEU 402 402 402 LEU ALA B . n 
B 1 403 THR 403 403 403 THR ALA B . n 
B 1 404 GLU 404 404 404 GLU ALA B . n 
B 1 405 LYS 405 405 405 LYS ALA B . n 
B 1 406 LYS 406 406 406 LYS ALA B . n 
B 1 407 PRO 407 407 407 PRO PRO B . n 
B 1 408 TRP 408 408 408 TRP TRP B . n 
B 1 409 TRP 409 409 409 TRP TRP B . n 
B 1 410 TRP 410 410 410 TRP TRP B . n 
B 1 411 HIS 411 411 411 HIS HIS B . n 
B 1 412 LEU 412 412 412 LEU LEU B . n 
B 1 413 ARG 413 413 413 ARG ARG B . n 
B 1 414 VAL 414 414 414 VAL VAL B . n 
B 1 415 GLN 415 415 415 GLN GLN B . n 
B 1 416 GLU 416 416 416 GLU GLU B . n 
B 1 417 LEU 417 417 417 LEU LEU B . n 
B 1 418 GLY 418 418 418 GLY GLY B . n 
B 1 419 LEU 419 419 419 LEU LEU B . n 
B 1 420 SER 420 420 420 SER SER B . n 
B 1 421 ALA 421 421 421 ALA ALA B . n 
B 1 422 PRO 422 422 422 PRO PRO B . n 
B 1 423 LEU 423 423 423 LEU LEU B . n 
B 1 424 THR 424 424 424 THR THR B . n 
B 1 425 VAL 425 425 425 VAL VAL B . n 
B 1 426 LEU 426 426 426 LEU LEU B . n 
B 1 427 PRO 427 427 427 PRO PRO B . n 
B 1 428 THR 428 428 428 THR THR B . n 
B 1 429 ILE 429 429 429 ILE ILE B . n 
B 1 430 THR 430 430 430 THR THR B . n 
B 1 431 CYS 431 431 431 CYS CYS B . n 
B 1 432 GLY 432 432 432 GLY GLY B . n 
B 1 433 HIS 433 433 433 HIS HIS B . n 
B 1 434 THR 434 434 434 THR THR B . n 
B 1 435 ILE 435 435 435 ILE ILE B . n 
B 1 436 GLU 436 436 436 GLU GLU B . n 
B 1 437 ILE 437 437 437 ILE ILE B . n 
B 1 438 LEU 438 438 438 LEU LEU B . n 
B 1 439 ARG 439 439 439 ARG ARG B . n 
B 1 440 GLU 440 440 440 GLU GLU B . n 
B 1 441 LYS 441 441 441 LYS LYS B . n 
B 1 442 GLY 442 442 442 GLY GLY B . n 
B 1 443 PHE 443 443 443 PHE PHE B . n 
B 1 444 ASP 444 444 444 ASP ASP B . n 
B 1 445 GLN 445 445 445 GLN GLN B . n 
B 1 446 ALA 446 446 446 ALA ALA B . n 
B 1 447 PRO 447 447 447 PRO PRO B . n 
B 1 448 VAL 448 448 448 VAL VAL B . n 
B 1 449 VAL 449 449 449 VAL VAL B . n 
B 1 450 ASP 450 450 450 ASP ASP B . n 
B 1 451 GLU 451 451 451 GLU GLU B . n 
B 1 452 ALA 452 452 452 ALA ALA B . n 
B 1 453 GLY 453 453 453 GLY GLY B . n 
B 1 454 VAL 454 454 454 VAL VAL B . n 
B 1 455 ILE 455 455 455 ILE ILE B . n 
B 1 456 LEU 456 456 456 LEU LEU B . n 
B 1 457 GLY 457 457 457 GLY GLY B . n 
B 1 458 MET 458 458 458 MET MET B . n 
B 1 459 VAL 459 459 459 VAL VAL B . n 
B 1 460 THR 460 460 460 THR THR B . n 
B 1 461 LEU 461 461 461 LEU LEU B . n 
B 1 462 GLY 462 462 462 GLY GLY B . n 
B 1 463 ASN 463 463 463 ASN ASN B . n 
B 1 464 MET 464 464 464 MET MET B . n 
B 1 465 LEU 465 465 465 LEU LEU B . n 
B 1 466 SER 466 466 466 SER SER B . n 
B 1 467 SER 467 467 467 SER SER B . n 
B 1 468 LEU 468 468 468 LEU LEU B . n 
B 1 469 LEU 469 469 469 LEU LEU B . n 
B 1 470 ALA 470 470 470 ALA ALA B . n 
B 1 471 GLY 471 471 471 GLY GLY B . n 
B 1 472 LYS 472 472 472 LYS LYS B . n 
B 1 473 VAL 473 473 473 VAL VAL B . n 
B 1 474 GLN 474 474 474 GLN GLN B . n 
B 1 475 PRO 475 475 475 PRO PRO B . n 
B 1 476 SER 476 476 476 SER SER B . n 
B 1 477 ASP 477 477 477 ASP ASP B . n 
B 1 478 GLN 478 478 478 GLN GLN B . n 
B 1 479 VAL 479 479 479 VAL VAL B . n 
B 1 480 GLY 480 480 480 GLY GLY B . n 
B 1 481 LYS 481 481 481 LYS LYS B . n 
B 1 482 VAL 482 482 482 VAL VAL B . n 
B 1 483 ILE 483 483 483 ILE ILE B . n 
B 1 484 TYR 484 484 484 TYR TYR B . n 
B 1 485 LYS 485 485 485 LYS LYS B . n 
B 1 486 GLN 486 486 486 GLN GLN B . n 
B 1 487 PHE 487 487 487 PHE PHE B . n 
B 1 488 LYS 488 488 488 LYS LYS B . n 
B 1 489 GLN 489 489 489 GLN GLN B . n 
B 1 490 ILE 490 490 490 ILE ILE B . n 
B 1 491 ARG 491 491 491 ARG ARG B . n 
B 1 492 LEU 492 492 492 LEU LEU B . n 
B 1 493 THR 493 493 493 THR THR B . n 
B 1 494 ASP 494 494 494 ASP ASP B . n 
B 1 495 THR 495 495 495 THR THR B . n 
B 1 496 LEU 496 496 496 LEU LEU B . n 
B 1 497 GLY 497 497 497 GLY GLY B . n 
B 1 498 ARG 498 498 498 ARG ARG B . n 
B 1 499 LEU 499 499 499 LEU LEU B . n 
B 1 500 SER 500 500 500 SER SER B . n 
B 1 501 HIS 501 501 501 HIS HIS B . n 
B 1 502 ILE 502 502 502 ILE ILE B . n 
B 1 503 LEU 503 503 503 LEU LEU B . n 
B 1 504 GLU 504 504 504 GLU GLU B . n 
B 1 505 MET 505 505 505 MET MET B . n 
B 1 506 ASP 506 506 506 ASP ASP B . n 
B 1 507 HIS 507 507 507 HIS HIS B . n 
B 1 508 PHE 508 508 508 PHE PHE B . n 
B 1 509 ALA 509 509 509 ALA ALA B . n 
B 1 510 LEU 510 510 510 LEU LEU B . n 
B 1 511 VAL 511 511 511 VAL VAL B . n 
B 1 512 VAL 512 512 512 VAL VAL B . n 
B 1 513 HIS 513 513 513 HIS HIS B . n 
B 1 514 GLU 514 514 514 GLU GLU B . n 
B 1 515 GLN 515 525 ?   ?   ?   B . n 
B 1 516 GLN 516 526 ?   ?   ?   B . n 
B 1 517 ARG 517 527 ?   ?   ?   B . n 
B 1 518 GLN 518 528 528 GLN GLN B . n 
B 1 519 MET 519 529 529 MET MET B . n 
B 1 520 VAL 520 530 530 VAL VAL B . n 
B 1 521 PHE 521 531 531 PHE PHE B . n 
B 1 522 GLY 522 532 532 GLY GLY B . n 
B 1 523 VAL 523 533 533 VAL VAL B . n 
B 1 524 VAL 524 534 534 VAL VAL B . n 
B 1 525 THR 525 535 535 THR THR B . n 
B 1 526 ALA 526 536 536 ALA ALA B . n 
B 1 527 ILE 527 537 537 ILE ILE B . n 
B 1 528 ASP 528 538 538 ASP ASP B . n 
B 1 529 LEU 529 539 539 LEU LEU B . n 
B 1 530 LEU 530 540 540 LEU LEU B . n 
B 1 531 ASN 531 541 541 ASN ASN B . n 
B 1 532 PHE 532 542 542 PHE PHE B . n 
B 1 533 VAL 533 543 543 VAL VAL B . n 
B 1 534 ALA 534 544 544 ALA ALA B . n 
B 1 535 ALA 535 545 545 ALA ALA B . n 
B 1 536 GLN 536 546 546 GLN GLN B . n 
B 1 537 GLU 537 547 547 GLU GLU B . n 
B 1 538 ARG 538 548 548 ARG ARG B . n 
B 1 539 ASP 539 549 549 ASP ASP B . n 
B 1 540 GLN 540 550 ?   ?   ?   B . n 
B 1 541 LYS 541 551 ?   ?   ?   B . n 
B 1 542 GLU 542 552 ?   ?   ?   B . n 
B 1 543 LEU 543 553 ?   ?   ?   B . n 
B 1 544 HIS 544 554 ?   ?   ?   B . n 
B 1 545 HIS 545 555 ?   ?   ?   B . n 
B 1 546 HIS 546 556 ?   ?   ?   B . n 
B 1 547 HIS 547 557 ?   ?   ?   B . n 
B 1 548 HIS 548 558 ?   ?   ?   B . n 
B 1 549 HIS 549 559 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 10670 ? 
1 MORE         -79   ? 
1 'SSA (A^2)'  39030 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? B HIS 65 ? B HIS 65  ? 1_555 FE ? F HEM . ? B HEM 602 ? 1_555 NA ? F HEM .  ? B HEM 602 ? 1_555 90.0  ? 
2  NE2 ? B HIS 65 ? B HIS 65  ? 1_555 FE ? F HEM . ? B HEM 602 ? 1_555 NB ? F HEM .  ? B HEM 602 ? 1_555 90.0  ? 
3  NA  ? F HEM .  ? B HEM 602 ? 1_555 FE ? F HEM . ? B HEM 602 ? 1_555 NB ? F HEM .  ? B HEM 602 ? 1_555 90.2  ? 
4  NE2 ? B HIS 65 ? B HIS 65  ? 1_555 FE ? F HEM . ? B HEM 602 ? 1_555 NC ? F HEM .  ? B HEM 602 ? 1_555 89.9  ? 
5  NA  ? F HEM .  ? B HEM 602 ? 1_555 FE ? F HEM . ? B HEM 602 ? 1_555 NC ? F HEM .  ? B HEM 602 ? 1_555 178.2 ? 
6  NB  ? F HEM .  ? B HEM 602 ? 1_555 FE ? F HEM . ? B HEM 602 ? 1_555 NC ? F HEM .  ? B HEM 602 ? 1_555 91.6  ? 
7  NE2 ? B HIS 65 ? B HIS 65  ? 1_555 FE ? F HEM . ? B HEM 602 ? 1_555 ND ? F HEM .  ? B HEM 602 ? 1_555 90.0  ? 
8  NA  ? F HEM .  ? B HEM 602 ? 1_555 FE ? F HEM . ? B HEM 602 ? 1_555 ND ? F HEM .  ? B HEM 602 ? 1_555 90.9  ? 
9  NB  ? F HEM .  ? B HEM 602 ? 1_555 FE ? F HEM . ? B HEM 602 ? 1_555 ND ? F HEM .  ? B HEM 602 ? 1_555 178.9 ? 
10 NC  ? F HEM .  ? B HEM 602 ? 1_555 FE ? F HEM . ? B HEM 602 ? 1_555 ND ? F HEM .  ? B HEM 602 ? 1_555 87.3  ? 
11 NE2 ? B HIS 65 ? B HIS 65  ? 1_555 FE ? F HEM . ? B HEM 602 ? 1_555 SG ? B CYS 52 ? B CYS 52  ? 1_555 179.9 ? 
12 NA  ? F HEM .  ? B HEM 602 ? 1_555 FE ? F HEM . ? B HEM 602 ? 1_555 SG ? B CYS 52 ? B CYS 52  ? 1_555 90.1  ? 
13 NB  ? F HEM .  ? B HEM 602 ? 1_555 FE ? F HEM . ? B HEM 602 ? 1_555 SG ? B CYS 52 ? B CYS 52  ? 1_555 90.0  ? 
14 NC  ? F HEM .  ? B HEM 602 ? 1_555 FE ? F HEM . ? B HEM 602 ? 1_555 SG ? B CYS 52 ? B CYS 52  ? 1_555 90.0  ? 
15 ND  ? F HEM .  ? B HEM 602 ? 1_555 FE ? F HEM . ? B HEM 602 ? 1_555 SG ? B CYS 52 ? B CYS 52  ? 1_555 90.0  ? 
16 NE2 ? A HIS 65 ? A HIS 65  ? 1_555 FE ? D HEM . ? A HEM 602 ? 1_555 NA ? D HEM .  ? A HEM 602 ? 1_555 90.0  ? 
17 NE2 ? A HIS 65 ? A HIS 65  ? 1_555 FE ? D HEM . ? A HEM 602 ? 1_555 NB ? D HEM .  ? A HEM 602 ? 1_555 90.0  ? 
18 NA  ? D HEM .  ? A HEM 602 ? 1_555 FE ? D HEM . ? A HEM 602 ? 1_555 NB ? D HEM .  ? A HEM 602 ? 1_555 90.4  ? 
19 NE2 ? A HIS 65 ? A HIS 65  ? 1_555 FE ? D HEM . ? A HEM 602 ? 1_555 NC ? D HEM .  ? A HEM 602 ? 1_555 90.0  ? 
20 NA  ? D HEM .  ? A HEM 602 ? 1_555 FE ? D HEM . ? A HEM 602 ? 1_555 NC ? D HEM .  ? A HEM 602 ? 1_555 178.0 ? 
21 NB  ? D HEM .  ? A HEM 602 ? 1_555 FE ? D HEM . ? A HEM 602 ? 1_555 NC ? D HEM .  ? A HEM 602 ? 1_555 91.6  ? 
22 NE2 ? A HIS 65 ? A HIS 65  ? 1_555 FE ? D HEM . ? A HEM 602 ? 1_555 ND ? D HEM .  ? A HEM 602 ? 1_555 90.0  ? 
23 NA  ? D HEM .  ? A HEM 602 ? 1_555 FE ? D HEM . ? A HEM 602 ? 1_555 ND ? D HEM .  ? A HEM 602 ? 1_555 90.7  ? 
24 NB  ? D HEM .  ? A HEM 602 ? 1_555 FE ? D HEM . ? A HEM 602 ? 1_555 ND ? D HEM .  ? A HEM 602 ? 1_555 178.9 ? 
25 NC  ? D HEM .  ? A HEM 602 ? 1_555 FE ? D HEM . ? A HEM 602 ? 1_555 ND ? D HEM .  ? A HEM 602 ? 1_555 87.3  ? 
26 NE2 ? A HIS 65 ? A HIS 65  ? 1_555 FE ? D HEM . ? A HEM 602 ? 1_555 SG ? A CYS 52 ? A CYS 52  ? 1_555 180.0 ? 
27 NA  ? D HEM .  ? A HEM 602 ? 1_555 FE ? D HEM . ? A HEM 602 ? 1_555 SG ? A CYS 52 ? A CYS 52  ? 1_555 90.0  ? 
28 NB  ? D HEM .  ? A HEM 602 ? 1_555 FE ? D HEM . ? A HEM 602 ? 1_555 SG ? A CYS 52 ? A CYS 52  ? 1_555 90.0  ? 
29 NC  ? D HEM .  ? A HEM 602 ? 1_555 FE ? D HEM . ? A HEM 602 ? 1_555 SG ? A CYS 52 ? A CYS 52  ? 1_555 89.9  ? 
30 ND  ? D HEM .  ? A HEM 602 ? 1_555 FE ? D HEM . ? A HEM 602 ? 1_555 SG ? A CYS 52 ? A CYS 52  ? 1_555 90.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-09-18 
2 'Structure model' 1 1 2013-10-02 
3 'Structure model' 1 2 2013-10-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC     'data collection' Quantum                       ? 1 
PHASER   phasing           .                             ? 2 
PHENIX   refinement        '(phenix.refine: 1.8.1_1168)' ? 3 
HKL-2000 'data reduction'  .                             ? 4 
HKL-2000 'data scaling'    .                             ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NH1 A ARG 413 ? ? O   A THR 493 ? ? 1.89 
2 1 OE2 B GLU 110 ? ? NE  B ARG 121 ? ? 2.14 
3 1 NE  A ARG 58  ? ? OE1 A GLU 62  ? ? 2.16 
4 1 O   A ARG 196 ? ? OG  A SER 199 ? ? 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 221 ? ? 59.38   72.16   
2  1 THR A 235 ? ? -108.01 -67.35  
3  1 ASP A 245 ? ? 70.46   -4.91   
4  1 ASP A 249 ? ? -104.38 -63.10  
5  1 LYS A 384 ? ? -106.91 -79.53  
6  1 LEU A 419 ? ? 50.59   -139.50 
7  1 SER A 420 ? ? 176.18  163.30  
8  1 ASP B 221 ? ? 59.02   73.27   
9  1 THR B 235 ? ? -108.23 -67.14  
10 1 ASP B 245 ? ? 70.71   -4.18   
11 1 ASP B 249 ? ? -104.77 -62.07  
12 1 LYS B 384 ? ? -106.98 -79.77  
13 1 LEU B 419 ? ? 50.90   -139.19 
14 1 SER B 420 ? ? 177.00  162.21  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASN 194 ? CG  ? A ASN 194 CG  
2  1 Y 1 A ASN 194 ? OD1 ? A ASN 194 OD1 
3  1 Y 1 A ASN 194 ? ND2 ? A ASN 194 ND2 
4  1 Y 1 A LYS 398 ? CG  ? A LYS 398 CG  
5  1 Y 1 A LYS 398 ? CD  ? A LYS 398 CD  
6  1 Y 1 A LYS 398 ? CE  ? A LYS 398 CE  
7  1 Y 1 A LYS 398 ? NZ  ? A LYS 398 NZ  
8  1 Y 1 A GLU 399 ? CG  ? A GLU 399 CG  
9  1 Y 1 A GLU 399 ? CD  ? A GLU 399 CD  
10 1 Y 1 A GLU 399 ? OE1 ? A GLU 399 OE1 
11 1 Y 1 A GLU 399 ? OE2 ? A GLU 399 OE2 
12 1 Y 1 A GLU 400 ? CG  ? A GLU 400 CG  
13 1 Y 1 A GLU 400 ? CD  ? A GLU 400 CD  
14 1 Y 1 A GLU 400 ? OE1 ? A GLU 400 OE1 
15 1 Y 1 A GLU 400 ? OE2 ? A GLU 400 OE2 
16 1 Y 1 A ASP 401 ? CG  ? A ASP 401 CG  
17 1 Y 1 A ASP 401 ? OD1 ? A ASP 401 OD1 
18 1 Y 1 A ASP 401 ? OD2 ? A ASP 401 OD2 
19 1 Y 1 A THR 403 ? OG1 ? A THR 403 OG1 
20 1 Y 1 A THR 403 ? CG2 ? A THR 403 CG2 
21 1 Y 1 A GLU 404 ? CG  ? A GLU 404 CG  
22 1 Y 1 A GLU 404 ? CD  ? A GLU 404 CD  
23 1 Y 1 A GLU 404 ? OE1 ? A GLU 404 OE1 
24 1 Y 1 A GLU 404 ? OE2 ? A GLU 404 OE2 
25 1 Y 1 A LYS 405 ? CG  ? A LYS 405 CG  
26 1 Y 1 A LYS 405 ? CD  ? A LYS 405 CD  
27 1 Y 1 A LYS 405 ? CE  ? A LYS 405 CE  
28 1 Y 1 A LYS 405 ? NZ  ? A LYS 405 NZ  
29 1 Y 1 A LYS 406 ? CG  ? A LYS 406 CG  
30 1 Y 1 A LYS 406 ? CD  ? A LYS 406 CD  
31 1 Y 1 A LYS 406 ? CE  ? A LYS 406 CE  
32 1 Y 1 A LYS 406 ? NZ  ? A LYS 406 NZ  
33 1 Y 1 A GLU 451 ? CG  ? A GLU 451 CG  
34 1 Y 1 A GLU 451 ? CD  ? A GLU 451 CD  
35 1 Y 1 A GLU 451 ? OE1 ? A GLU 451 OE1 
36 1 Y 1 A GLU 451 ? OE2 ? A GLU 451 OE2 
37 1 Y 1 A LYS 481 ? N   ? A LYS 481 N   
38 1 Y 1 A GLU 514 ? CG  ? A GLU 514 CG  
39 1 Y 1 A GLU 514 ? CD  ? A GLU 514 CD  
40 1 Y 1 A GLU 514 ? OE1 ? A GLU 514 OE1 
41 1 Y 1 A GLU 514 ? OE2 ? A GLU 514 OE2 
42 1 Y 1 A ASP 549 ? CG  ? A ASP 539 CG  
43 1 Y 1 A ASP 549 ? OD1 ? A ASP 539 OD1 
44 1 Y 1 A ASP 549 ? OD2 ? A ASP 539 OD2 
45 1 Y 1 B ASN 194 ? CG  ? B ASN 194 CG  
46 1 Y 1 B ASN 194 ? OD1 ? B ASN 194 OD1 
47 1 Y 1 B ASN 194 ? ND2 ? B ASN 194 ND2 
48 1 Y 1 B LYS 398 ? CG  ? B LYS 398 CG  
49 1 Y 1 B LYS 398 ? CD  ? B LYS 398 CD  
50 1 Y 1 B LYS 398 ? CE  ? B LYS 398 CE  
51 1 Y 1 B LYS 398 ? NZ  ? B LYS 398 NZ  
52 1 Y 1 B GLU 399 ? CG  ? B GLU 399 CG  
53 1 Y 1 B GLU 399 ? CD  ? B GLU 399 CD  
54 1 Y 1 B GLU 399 ? OE1 ? B GLU 399 OE1 
55 1 Y 1 B GLU 399 ? OE2 ? B GLU 399 OE2 
56 1 Y 1 B GLU 400 ? CG  ? B GLU 400 CG  
57 1 Y 1 B GLU 400 ? CD  ? B GLU 400 CD  
58 1 Y 1 B GLU 400 ? OE1 ? B GLU 400 OE1 
59 1 Y 1 B GLU 400 ? OE2 ? B GLU 400 OE2 
60 1 Y 1 B ASP 401 ? CG  ? B ASP 401 CG  
61 1 Y 1 B ASP 401 ? OD1 ? B ASP 401 OD1 
62 1 Y 1 B ASP 401 ? OD2 ? B ASP 401 OD2 
63 1 Y 1 B LEU 402 ? CG  ? B LEU 402 CG  
64 1 Y 1 B LEU 402 ? CD1 ? B LEU 402 CD1 
65 1 Y 1 B LEU 402 ? CD2 ? B LEU 402 CD2 
66 1 Y 1 B THR 403 ? OG1 ? B THR 403 OG1 
67 1 Y 1 B THR 403 ? CG2 ? B THR 403 CG2 
68 1 Y 1 B GLU 404 ? CG  ? B GLU 404 CG  
69 1 Y 1 B GLU 404 ? CD  ? B GLU 404 CD  
70 1 Y 1 B GLU 404 ? OE1 ? B GLU 404 OE1 
71 1 Y 1 B GLU 404 ? OE2 ? B GLU 404 OE2 
72 1 Y 1 B LYS 405 ? CG  ? B LYS 405 CG  
73 1 Y 1 B LYS 405 ? CD  ? B LYS 405 CD  
74 1 Y 1 B LYS 405 ? CE  ? B LYS 405 CE  
75 1 Y 1 B LYS 405 ? NZ  ? B LYS 405 NZ  
76 1 Y 1 B LYS 406 ? CG  ? B LYS 406 CG  
77 1 Y 1 B LYS 406 ? CD  ? B LYS 406 CD  
78 1 Y 1 B LYS 406 ? CE  ? B LYS 406 CE  
79 1 Y 1 B LYS 406 ? NZ  ? B LYS 406 NZ  
80 1 Y 1 B GLU 514 ? CG  ? B GLU 514 CG  
81 1 Y 1 B GLU 514 ? CD  ? B GLU 514 CD  
82 1 Y 1 B GLU 514 ? OE1 ? B GLU 514 OE1 
83 1 Y 1 B GLU 514 ? OE2 ? B GLU 514 OE2 
84 1 Y 1 B ASP 549 ? CG  ? B ASP 539 CG  
85 1 Y 1 B ASP 549 ? OD1 ? B ASP 539 OD1 
86 1 Y 1 B ASP 549 ? OD2 ? B ASP 539 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A GLY 2   ? A GLY 2   
3   1 Y 1 A SER 3   ? A SER 3   
4   1 Y 1 A GLU 4   ? A GLU 4   
5   1 Y 1 A THR 5   ? A THR 5   
6   1 Y 1 A PRO 6   ? A PRO 6   
7   1 Y 1 A GLN 7   ? A GLN 7   
8   1 Y 1 A ALA 8   ? A ALA 8   
9   1 Y 1 A GLU 9   ? A GLU 9   
10  1 Y 1 A VAL 10  ? A VAL 10  
11  1 Y 1 A GLY 11  ? A GLY 11  
12  1 Y 1 A PRO 12  ? A PRO 12  
13  1 Y 1 A THR 13  ? A THR 13  
14  1 Y 1 A GLY 14  ? A GLY 14  
15  1 Y 1 A CYS 15  ? A CYS 15  
16  1 Y 1 A PRO 16  ? A PRO 16  
17  1 Y 1 A HIS 17  ? A HIS 17  
18  1 Y 1 A ARG 18  ? A ARG 18  
19  1 Y 1 A SER 19  ? A SER 19  
20  1 Y 1 A GLY 20  ? A GLY 20  
21  1 Y 1 A PRO 21  ? A PRO 21  
22  1 Y 1 A HIS 22  ? A HIS 22  
23  1 Y 1 A SER 23  ? A SER 23  
24  1 Y 1 A ALA 24  ? A ALA 24  
25  1 Y 1 A LYS 25  ? A LYS 25  
26  1 Y 1 A GLY 26  ? A GLY 26  
27  1 Y 1 A SER 27  ? A SER 27  
28  1 Y 1 A LEU 28  ? A LEU 28  
29  1 Y 1 A GLU 29  ? A GLU 29  
30  1 Y 1 A LYS 30  ? A LYS 30  
31  1 Y 1 A GLY 31  ? A GLY 31  
32  1 Y 1 A SER 32  ? A SER 32  
33  1 Y 1 A PRO 33  ? A PRO 33  
34  1 Y 1 A GLU 34  ? A GLU 34  
35  1 Y 1 A ASP 35  ? A ASP 35  
36  1 Y 1 A LYS 36  ? A LYS 36  
37  1 Y 1 A GLU 37  ? A GLU 37  
38  1 Y 1 A ALA 38  ? A ALA 38  
39  1 Y 1 A LYS 39  ? A LYS 39  
40  1 Y 1 A GLU 40  ? A GLU 40  
41  1 Y 1 A LEU 402 ? A LEU 402 
42  1 Y 1 A GLN 525 ? A GLN 515 
43  1 Y 1 A GLN 526 ? A GLN 516 
44  1 Y 1 A ARG 527 ? A ARG 517 
45  1 Y 1 A LYS 551 ? A LYS 541 
46  1 Y 1 A GLU 552 ? A GLU 542 
47  1 Y 1 A LEU 553 ? A LEU 543 
48  1 Y 1 A HIS 554 ? A HIS 544 
49  1 Y 1 A HIS 555 ? A HIS 545 
50  1 Y 1 A HIS 556 ? A HIS 546 
51  1 Y 1 A HIS 557 ? A HIS 547 
52  1 Y 1 A HIS 558 ? A HIS 548 
53  1 Y 1 A HIS 559 ? A HIS 549 
54  1 Y 1 B MET 1   ? B MET 1   
55  1 Y 1 B GLY 2   ? B GLY 2   
56  1 Y 1 B SER 3   ? B SER 3   
57  1 Y 1 B GLU 4   ? B GLU 4   
58  1 Y 1 B THR 5   ? B THR 5   
59  1 Y 1 B PRO 6   ? B PRO 6   
60  1 Y 1 B GLN 7   ? B GLN 7   
61  1 Y 1 B ALA 8   ? B ALA 8   
62  1 Y 1 B GLU 9   ? B GLU 9   
63  1 Y 1 B VAL 10  ? B VAL 10  
64  1 Y 1 B GLY 11  ? B GLY 11  
65  1 Y 1 B PRO 12  ? B PRO 12  
66  1 Y 1 B THR 13  ? B THR 13  
67  1 Y 1 B GLY 14  ? B GLY 14  
68  1 Y 1 B CYS 15  ? B CYS 15  
69  1 Y 1 B PRO 16  ? B PRO 16  
70  1 Y 1 B HIS 17  ? B HIS 17  
71  1 Y 1 B ARG 18  ? B ARG 18  
72  1 Y 1 B SER 19  ? B SER 19  
73  1 Y 1 B GLY 20  ? B GLY 20  
74  1 Y 1 B PRO 21  ? B PRO 21  
75  1 Y 1 B HIS 22  ? B HIS 22  
76  1 Y 1 B SER 23  ? B SER 23  
77  1 Y 1 B ALA 24  ? B ALA 24  
78  1 Y 1 B LYS 25  ? B LYS 25  
79  1 Y 1 B GLY 26  ? B GLY 26  
80  1 Y 1 B SER 27  ? B SER 27  
81  1 Y 1 B LEU 28  ? B LEU 28  
82  1 Y 1 B GLU 29  ? B GLU 29  
83  1 Y 1 B LYS 30  ? B LYS 30  
84  1 Y 1 B GLY 31  ? B GLY 31  
85  1 Y 1 B SER 32  ? B SER 32  
86  1 Y 1 B PRO 33  ? B PRO 33  
87  1 Y 1 B GLU 34  ? B GLU 34  
88  1 Y 1 B ASP 35  ? B ASP 35  
89  1 Y 1 B LYS 36  ? B LYS 36  
90  1 Y 1 B GLU 37  ? B GLU 37  
91  1 Y 1 B ALA 38  ? B ALA 38  
92  1 Y 1 B LYS 39  ? B LYS 39  
93  1 Y 1 B GLU 40  ? B GLU 40  
94  1 Y 1 B GLN 525 ? B GLN 515 
95  1 Y 1 B GLN 526 ? B GLN 516 
96  1 Y 1 B ARG 527 ? B ARG 517 
97  1 Y 1 B GLN 550 ? B GLN 540 
98  1 Y 1 B LYS 551 ? B LYS 541 
99  1 Y 1 B GLU 552 ? B GLU 542 
100 1 Y 1 B LEU 553 ? B LEU 543 
101 1 Y 1 B HIS 554 ? B HIS 544 
102 1 Y 1 B HIS 555 ? B HIS 545 
103 1 Y 1 B HIS 556 ? B HIS 546 
104 1 Y 1 B HIS 557 ? B HIS 547 
105 1 Y 1 B HIS 558 ? B HIS 548 
106 1 Y 1 B HIS 559 ? B HIS 549 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "PYRIDOXAL-5'-PHOSPHATE"          PLP 
3 'PROTOPORPHYRIN IX CONTAINING FE' HEM 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 PLP 1 601 1000 PLP PLP A . 
D 3 HEM 1 602 2000 HEM HEM A . 
E 2 PLP 1 601 1000 PLP PLP B . 
F 3 HEM 1 602 2000 HEM HEM B . 
#