data_4L28
# 
_entry.id   4L28 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4L28         
RCSB  RCSB080088   
WWPDB D_1000080088 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1JBQ . unspecified 
PDB 4L0D . unspecified 
PDB 4L27 . unspecified 
PDB 4L3V . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4L28 
_pdbx_database_status.recvd_initial_deposition_date   2013-06-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ereno, J.'      1 
'Majtan, T.'     2 
'Oyenarte, I.'   3 
'Kraus, J.P.'    4 
'Martinez, L.A.' 5 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis of regulation and oligomerization of human cystathionine beta-synthase, the central enzyme of transsulfuration.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            110 
_citation.page_first                E3790 
_citation.page_last                 E3799 
_citation.year                      2013 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24043838 
_citation.pdbx_database_id_DOI      10.1073/pnas.1313683110 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ereno-Orbea, J.'     1 
primary 'Majtan, T.'          2 
primary 'Oyenarte, I.'        3 
primary 'Kraus, J.P.'         4 
primary 'Martinez-Cruz, L.A.' 5 
# 
_cell.entry_id           4L28 
_cell.length_a           109.482 
_cell.length_b           131.074 
_cell.length_c           207.065 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4L28 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cystathionine beta-synthase'     61604.363 4 4.2.1.22 D444N ? ? 
2 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE"          247.142   4 ?        ?     ? ? 
3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   4 ?        ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Beta-thionase, Serine sulfhydrase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDIL
KKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVR
GYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEIL
QQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVD
KWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEED
LTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFNQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGK
VIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQKLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDIL
KKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVR
GYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEIL
QQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVD
KWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEED
LTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFNQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGK
VIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQKLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   SER n 
1 3   GLU n 
1 4   THR n 
1 5   PRO n 
1 6   GLN n 
1 7   ALA n 
1 8   GLU n 
1 9   VAL n 
1 10  GLY n 
1 11  PRO n 
1 12  THR n 
1 13  GLY n 
1 14  CYS n 
1 15  PRO n 
1 16  HIS n 
1 17  ARG n 
1 18  SER n 
1 19  GLY n 
1 20  PRO n 
1 21  HIS n 
1 22  SER n 
1 23  ALA n 
1 24  LYS n 
1 25  GLY n 
1 26  SER n 
1 27  LEU n 
1 28  GLU n 
1 29  LYS n 
1 30  GLY n 
1 31  SER n 
1 32  PRO n 
1 33  GLU n 
1 34  ASP n 
1 35  LYS n 
1 36  GLU n 
1 37  ALA n 
1 38  LYS n 
1 39  GLU n 
1 40  PRO n 
1 41  LEU n 
1 42  TRP n 
1 43  ILE n 
1 44  ARG n 
1 45  PRO n 
1 46  ASP n 
1 47  ALA n 
1 48  PRO n 
1 49  SER n 
1 50  ARG n 
1 51  CYS n 
1 52  THR n 
1 53  TRP n 
1 54  GLN n 
1 55  LEU n 
1 56  GLY n 
1 57  ARG n 
1 58  PRO n 
1 59  ALA n 
1 60  SER n 
1 61  GLU n 
1 62  SER n 
1 63  PRO n 
1 64  HIS n 
1 65  HIS n 
1 66  HIS n 
1 67  THR n 
1 68  ALA n 
1 69  PRO n 
1 70  ALA n 
1 71  LYS n 
1 72  SER n 
1 73  PRO n 
1 74  LYS n 
1 75  ILE n 
1 76  LEU n 
1 77  PRO n 
1 78  ASP n 
1 79  ILE n 
1 80  LEU n 
1 81  LYS n 
1 82  LYS n 
1 83  ILE n 
1 84  GLY n 
1 85  ASP n 
1 86  THR n 
1 87  PRO n 
1 88  MET n 
1 89  VAL n 
1 90  ARG n 
1 91  ILE n 
1 92  ASN n 
1 93  LYS n 
1 94  ILE n 
1 95  GLY n 
1 96  LYS n 
1 97  LYS n 
1 98  PHE n 
1 99  GLY n 
1 100 LEU n 
1 101 LYS n 
1 102 CYS n 
1 103 GLU n 
1 104 LEU n 
1 105 LEU n 
1 106 ALA n 
1 107 LYS n 
1 108 CYS n 
1 109 GLU n 
1 110 PHE n 
1 111 PHE n 
1 112 ASN n 
1 113 ALA n 
1 114 GLY n 
1 115 GLY n 
1 116 SER n 
1 117 VAL n 
1 118 LYS n 
1 119 ASP n 
1 120 ARG n 
1 121 ILE n 
1 122 SER n 
1 123 LEU n 
1 124 ARG n 
1 125 MET n 
1 126 ILE n 
1 127 GLU n 
1 128 ASP n 
1 129 ALA n 
1 130 GLU n 
1 131 ARG n 
1 132 ASP n 
1 133 GLY n 
1 134 THR n 
1 135 LEU n 
1 136 LYS n 
1 137 PRO n 
1 138 GLY n 
1 139 ASP n 
1 140 THR n 
1 141 ILE n 
1 142 ILE n 
1 143 GLU n 
1 144 PRO n 
1 145 THR n 
1 146 SER n 
1 147 GLY n 
1 148 ASN n 
1 149 THR n 
1 150 GLY n 
1 151 ILE n 
1 152 GLY n 
1 153 LEU n 
1 154 ALA n 
1 155 LEU n 
1 156 ALA n 
1 157 ALA n 
1 158 ALA n 
1 159 VAL n 
1 160 ARG n 
1 161 GLY n 
1 162 TYR n 
1 163 ARG n 
1 164 CYS n 
1 165 ILE n 
1 166 ILE n 
1 167 VAL n 
1 168 MET n 
1 169 PRO n 
1 170 GLU n 
1 171 LYS n 
1 172 MET n 
1 173 SER n 
1 174 SER n 
1 175 GLU n 
1 176 LYS n 
1 177 VAL n 
1 178 ASP n 
1 179 VAL n 
1 180 LEU n 
1 181 ARG n 
1 182 ALA n 
1 183 LEU n 
1 184 GLY n 
1 185 ALA n 
1 186 GLU n 
1 187 ILE n 
1 188 VAL n 
1 189 ARG n 
1 190 THR n 
1 191 PRO n 
1 192 THR n 
1 193 ASN n 
1 194 ALA n 
1 195 ARG n 
1 196 PHE n 
1 197 ASP n 
1 198 SER n 
1 199 PRO n 
1 200 GLU n 
1 201 SER n 
1 202 HIS n 
1 203 VAL n 
1 204 GLY n 
1 205 VAL n 
1 206 ALA n 
1 207 TRP n 
1 208 ARG n 
1 209 LEU n 
1 210 LYS n 
1 211 ASN n 
1 212 GLU n 
1 213 ILE n 
1 214 PRO n 
1 215 ASN n 
1 216 SER n 
1 217 HIS n 
1 218 ILE n 
1 219 LEU n 
1 220 ASP n 
1 221 GLN n 
1 222 TYR n 
1 223 ARG n 
1 224 ASN n 
1 225 ALA n 
1 226 SER n 
1 227 ASN n 
1 228 PRO n 
1 229 LEU n 
1 230 ALA n 
1 231 HIS n 
1 232 TYR n 
1 233 ASP n 
1 234 THR n 
1 235 THR n 
1 236 ALA n 
1 237 ASP n 
1 238 GLU n 
1 239 ILE n 
1 240 LEU n 
1 241 GLN n 
1 242 GLN n 
1 243 CYS n 
1 244 ASP n 
1 245 GLY n 
1 246 LYS n 
1 247 LEU n 
1 248 ASP n 
1 249 MET n 
1 250 LEU n 
1 251 VAL n 
1 252 ALA n 
1 253 SER n 
1 254 VAL n 
1 255 GLY n 
1 256 THR n 
1 257 GLY n 
1 258 GLY n 
1 259 THR n 
1 260 ILE n 
1 261 THR n 
1 262 GLY n 
1 263 ILE n 
1 264 ALA n 
1 265 ARG n 
1 266 LYS n 
1 267 LEU n 
1 268 LYS n 
1 269 GLU n 
1 270 LYS n 
1 271 CYS n 
1 272 PRO n 
1 273 GLY n 
1 274 CYS n 
1 275 ARG n 
1 276 ILE n 
1 277 ILE n 
1 278 GLY n 
1 279 VAL n 
1 280 ASP n 
1 281 PRO n 
1 282 GLU n 
1 283 GLY n 
1 284 SER n 
1 285 ILE n 
1 286 LEU n 
1 287 ALA n 
1 288 GLU n 
1 289 PRO n 
1 290 GLU n 
1 291 GLU n 
1 292 LEU n 
1 293 ASN n 
1 294 GLN n 
1 295 THR n 
1 296 GLU n 
1 297 GLN n 
1 298 THR n 
1 299 THR n 
1 300 TYR n 
1 301 GLU n 
1 302 VAL n 
1 303 GLU n 
1 304 GLY n 
1 305 ILE n 
1 306 GLY n 
1 307 TYR n 
1 308 ASP n 
1 309 PHE n 
1 310 ILE n 
1 311 PRO n 
1 312 THR n 
1 313 VAL n 
1 314 LEU n 
1 315 ASP n 
1 316 ARG n 
1 317 THR n 
1 318 VAL n 
1 319 VAL n 
1 320 ASP n 
1 321 LYS n 
1 322 TRP n 
1 323 PHE n 
1 324 LYS n 
1 325 SER n 
1 326 ASN n 
1 327 ASP n 
1 328 GLU n 
1 329 GLU n 
1 330 ALA n 
1 331 PHE n 
1 332 THR n 
1 333 PHE n 
1 334 ALA n 
1 335 ARG n 
1 336 MET n 
1 337 LEU n 
1 338 ILE n 
1 339 ALA n 
1 340 GLN n 
1 341 GLU n 
1 342 GLY n 
1 343 LEU n 
1 344 LEU n 
1 345 CYS n 
1 346 GLY n 
1 347 GLY n 
1 348 SER n 
1 349 ALA n 
1 350 GLY n 
1 351 SER n 
1 352 THR n 
1 353 VAL n 
1 354 ALA n 
1 355 VAL n 
1 356 ALA n 
1 357 VAL n 
1 358 LYS n 
1 359 ALA n 
1 360 ALA n 
1 361 GLN n 
1 362 GLU n 
1 363 LEU n 
1 364 GLN n 
1 365 GLU n 
1 366 GLY n 
1 367 GLN n 
1 368 ARG n 
1 369 CYS n 
1 370 VAL n 
1 371 VAL n 
1 372 ILE n 
1 373 LEU n 
1 374 PRO n 
1 375 ASP n 
1 376 SER n 
1 377 VAL n 
1 378 ARG n 
1 379 ASN n 
1 380 TYR n 
1 381 MET n 
1 382 THR n 
1 383 LYS n 
1 384 PHE n 
1 385 LEU n 
1 386 SER n 
1 387 ASP n 
1 388 ARG n 
1 389 TRP n 
1 390 MET n 
1 391 LEU n 
1 392 GLN n 
1 393 LYS n 
1 394 GLY n 
1 395 PHE n 
1 396 LEU n 
1 397 LYS n 
1 398 GLU n 
1 399 GLU n 
1 400 ASP n 
1 401 LEU n 
1 402 THR n 
1 403 GLU n 
1 404 LYS n 
1 405 LYS n 
1 406 PRO n 
1 407 TRP n 
1 408 TRP n 
1 409 TRP n 
1 410 HIS n 
1 411 LEU n 
1 412 ARG n 
1 413 VAL n 
1 414 GLN n 
1 415 GLU n 
1 416 LEU n 
1 417 GLY n 
1 418 LEU n 
1 419 SER n 
1 420 ALA n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 VAL n 
1 425 LEU n 
1 426 PRO n 
1 427 THR n 
1 428 ILE n 
1 429 THR n 
1 430 CYS n 
1 431 GLY n 
1 432 HIS n 
1 433 THR n 
1 434 ILE n 
1 435 GLU n 
1 436 ILE n 
1 437 LEU n 
1 438 ARG n 
1 439 GLU n 
1 440 LYS n 
1 441 GLY n 
1 442 PHE n 
1 443 ASN n 
1 444 GLN n 
1 445 ALA n 
1 446 PRO n 
1 447 VAL n 
1 448 VAL n 
1 449 ASP n 
1 450 GLU n 
1 451 ALA n 
1 452 GLY n 
1 453 VAL n 
1 454 ILE n 
1 455 LEU n 
1 456 GLY n 
1 457 MET n 
1 458 VAL n 
1 459 THR n 
1 460 LEU n 
1 461 GLY n 
1 462 ASN n 
1 463 MET n 
1 464 LEU n 
1 465 SER n 
1 466 SER n 
1 467 LEU n 
1 468 LEU n 
1 469 ALA n 
1 470 GLY n 
1 471 LYS n 
1 472 VAL n 
1 473 GLN n 
1 474 PRO n 
1 475 SER n 
1 476 ASP n 
1 477 GLN n 
1 478 VAL n 
1 479 GLY n 
1 480 LYS n 
1 481 VAL n 
1 482 ILE n 
1 483 TYR n 
1 484 LYS n 
1 485 GLN n 
1 486 PHE n 
1 487 LYS n 
1 488 GLN n 
1 489 ILE n 
1 490 ARG n 
1 491 LEU n 
1 492 THR n 
1 493 ASP n 
1 494 THR n 
1 495 LEU n 
1 496 GLY n 
1 497 ARG n 
1 498 LEU n 
1 499 SER n 
1 500 HIS n 
1 501 ILE n 
1 502 LEU n 
1 503 GLU n 
1 504 MET n 
1 505 ASP n 
1 506 HIS n 
1 507 PHE n 
1 508 ALA n 
1 509 LEU n 
1 510 VAL n 
1 511 VAL n 
1 512 HIS n 
1 513 GLU n 
1 514 GLN n 
1 515 ILE n 
1 516 GLN n 
1 517 TYR n 
1 518 HIS n 
1 519 SER n 
1 520 THR n 
1 521 GLY n 
1 522 LYS n 
1 523 SER n 
1 524 SER n 
1 525 GLN n 
1 526 ARG n 
1 527 GLN n 
1 528 MET n 
1 529 VAL n 
1 530 PHE n 
1 531 GLY n 
1 532 VAL n 
1 533 VAL n 
1 534 THR n 
1 535 ALA n 
1 536 ILE n 
1 537 ASP n 
1 538 LEU n 
1 539 LEU n 
1 540 ASN n 
1 541 PHE n 
1 542 VAL n 
1 543 ALA n 
1 544 ALA n 
1 545 GLN n 
1 546 GLU n 
1 547 ARG n 
1 548 ASP n 
1 549 GLN n 
1 550 LYS n 
1 551 LEU n 
1 552 GLU n 
1 553 HIS n 
1 554 HIS n 
1 555 HIS n 
1 556 HIS n 
1 557 HIS n 
1 558 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 CBS 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3) GOLD' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CBS_HUMAN 
_struct_ref.pdbx_db_accession          P35520 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDIL
KKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVR
GYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEIL
QQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVD
KWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEED
LTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGK
VIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4L28 A 1 ? 550 ? P35520 2 ? 551 ? 2 551 
2 1 4L28 B 1 ? 550 ? P35520 2 ? 551 ? 2 551 
3 1 4L28 C 1 ? 550 ? P35520 2 ? 551 ? 2 551 
4 1 4L28 D 1 ? 550 ? P35520 2 ? 551 ? 2 551 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4L28 ASN A 443 ? UNP P35520 ASP 444 'ENGINEERED MUTATION' 444 1  
1 4L28 LEU A 551 ? UNP P35520 ?   ?   'EXPRESSION TAG'      552 2  
1 4L28 GLU A 552 ? UNP P35520 ?   ?   'EXPRESSION TAG'      553 3  
1 4L28 HIS A 553 ? UNP P35520 ?   ?   'EXPRESSION TAG'      554 4  
1 4L28 HIS A 554 ? UNP P35520 ?   ?   'EXPRESSION TAG'      555 5  
1 4L28 HIS A 555 ? UNP P35520 ?   ?   'EXPRESSION TAG'      556 6  
1 4L28 HIS A 556 ? UNP P35520 ?   ?   'EXPRESSION TAG'      557 7  
1 4L28 HIS A 557 ? UNP P35520 ?   ?   'EXPRESSION TAG'      558 8  
1 4L28 HIS A 558 ? UNP P35520 ?   ?   'EXPRESSION TAG'      559 9  
2 4L28 ASN B 443 ? UNP P35520 ASP 444 'ENGINEERED MUTATION' 444 10 
2 4L28 LEU B 551 ? UNP P35520 ?   ?   'EXPRESSION TAG'      552 11 
2 4L28 GLU B 552 ? UNP P35520 ?   ?   'EXPRESSION TAG'      553 12 
2 4L28 HIS B 553 ? UNP P35520 ?   ?   'EXPRESSION TAG'      554 13 
2 4L28 HIS B 554 ? UNP P35520 ?   ?   'EXPRESSION TAG'      555 14 
2 4L28 HIS B 555 ? UNP P35520 ?   ?   'EXPRESSION TAG'      556 15 
2 4L28 HIS B 556 ? UNP P35520 ?   ?   'EXPRESSION TAG'      557 16 
2 4L28 HIS B 557 ? UNP P35520 ?   ?   'EXPRESSION TAG'      558 17 
2 4L28 HIS B 558 ? UNP P35520 ?   ?   'EXPRESSION TAG'      559 18 
3 4L28 ASN C 443 ? UNP P35520 ASP 444 'ENGINEERED MUTATION' 444 19 
3 4L28 LEU C 551 ? UNP P35520 ?   ?   'EXPRESSION TAG'      552 20 
3 4L28 GLU C 552 ? UNP P35520 ?   ?   'EXPRESSION TAG'      553 21 
3 4L28 HIS C 553 ? UNP P35520 ?   ?   'EXPRESSION TAG'      554 22 
3 4L28 HIS C 554 ? UNP P35520 ?   ?   'EXPRESSION TAG'      555 23 
3 4L28 HIS C 555 ? UNP P35520 ?   ?   'EXPRESSION TAG'      556 24 
3 4L28 HIS C 556 ? UNP P35520 ?   ?   'EXPRESSION TAG'      557 25 
3 4L28 HIS C 557 ? UNP P35520 ?   ?   'EXPRESSION TAG'      558 26 
3 4L28 HIS C 558 ? UNP P35520 ?   ?   'EXPRESSION TAG'      559 27 
4 4L28 ASN D 443 ? UNP P35520 ASP 444 'ENGINEERED MUTATION' 444 28 
4 4L28 LEU D 551 ? UNP P35520 ?   ?   'EXPRESSION TAG'      552 29 
4 4L28 GLU D 552 ? UNP P35520 ?   ?   'EXPRESSION TAG'      553 30 
4 4L28 HIS D 553 ? UNP P35520 ?   ?   'EXPRESSION TAG'      554 31 
4 4L28 HIS D 554 ? UNP P35520 ?   ?   'EXPRESSION TAG'      555 32 
4 4L28 HIS D 555 ? UNP P35520 ?   ?   'EXPRESSION TAG'      556 33 
4 4L28 HIS D 556 ? UNP P35520 ?   ?   'EXPRESSION TAG'      557 34 
4 4L28 HIS D 557 ? UNP P35520 ?   ?   'EXPRESSION TAG'      558 35 
4 4L28 HIS D 558 ? UNP P35520 ?   ?   'EXPRESSION TAG'      559 36 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?                      'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?                      'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?                      'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?                      'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?                      'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ?                      'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?                      'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?                      'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME                   'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?                      'C6 H10 N3 O2 1'   156.162 
ILE 'L-peptide linking' y ISOLEUCINE                        ?                      'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?                      'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?                      'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?                      'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?                      'C9 H11 N O2'      165.189 
PLP non-polymer         . "PYRIDOXAL-5'-PHOSPHATE"          'VITAMIN B6 Phosphate' 'C8 H10 N O6 P'    247.142 
PRO 'L-peptide linking' y PROLINE                           ?                      'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?                      'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?                      'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?                      'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?                      'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?                      'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          4L28 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.01 
_exptl_crystal.density_percent_sol   59.20 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;0.085 M HEPES, pH 7.5, 8.5% isopropanol, 17% w/v PEG4000, 15% v/v Glycerol anhydrous, VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2012-11-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4L28 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             48.393 
_reflns.d_resolution_high            2.626 
_reflns.number_obs                   87797 
_reflns.number_all                   87797 
_reflns.percent_possible_obs         98.3 
_reflns.pdbx_Rmerge_I_obs            0.36 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        4.30 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              13.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.626 
_reflns_shell.d_res_low              2.7 
_reflns_shell.percent_possible_all   89.29 
_reflns_shell.Rmerge_I_obs           0.93 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.10 
_reflns_shell.pdbx_redundancy        12.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4L28 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     87796 
_refine.ls_number_reflns_all                     87797 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.393 
_refine.ls_d_res_high                            2.626 
_refine.ls_percent_reflns_obs                    98.07 
_refine.ls_R_factor_obs                          0.2575 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2562 
_refine.ls_R_factor_R_free                       0.2810 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.04 
_refine.ls_number_reflns_R_free                  4423 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.43 
_refine.pdbx_overall_phase_error                 37.79 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        15223 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         232 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               15455 
_refine_hist.d_res_high                       2.626 
_refine_hist.d_res_low                        48.393 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.014  ? ? 15774 'X-RAY DIFFRACTION' ? 
f_angle_d          1.062  ? ? 21434 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 12.914 ? ? 5842  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.090  ? ? 2415  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.007  ? ? 2734  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.6257 2.6556  2189 0.4561 79.00  0.4530 . . 133 . . . . 
'X-RAY DIFFRACTION' . 2.6556 2.6868  2617 0.4440 94.00  0.4837 . . 132 . . . . 
'X-RAY DIFFRACTION' . 2.6868 2.7196  2688 0.4567 95.00  0.4438 . . 123 . . . . 
'X-RAY DIFFRACTION' . 2.7196 2.7540  2697 0.4318 96.00  0.4264 . . 142 . . . . 
'X-RAY DIFFRACTION' . 2.7540 2.7902  2736 0.4209 97.00  0.4626 . . 152 . . . . 
'X-RAY DIFFRACTION' . 2.7902 2.8285  2701 0.4116 98.00  0.4471 . . 154 . . . . 
'X-RAY DIFFRACTION' . 2.8285 2.8689  2770 0.4051 99.00  0.3591 . . 153 . . . . 
'X-RAY DIFFRACTION' . 2.8689 2.9117  2787 0.4023 99.00  0.4129 . . 142 . . . . 
'X-RAY DIFFRACTION' . 2.9117 2.9572  2801 0.3927 99.00  0.3982 . . 128 . . . . 
'X-RAY DIFFRACTION' . 2.9572 3.0057  2765 0.3749 99.00  0.4096 . . 146 . . . . 
'X-RAY DIFFRACTION' . 3.0057 3.0575  2787 0.3459 99.00  0.3535 . . 145 . . . . 
'X-RAY DIFFRACTION' . 3.0575 3.1131  2791 0.3504 99.00  0.3822 . . 143 . . . . 
'X-RAY DIFFRACTION' . 3.1131 3.1729  2743 0.3409 99.00  0.3598 . . 164 . . . . 
'X-RAY DIFFRACTION' . 3.1729 3.2377  2821 0.3237 99.00  0.3100 . . 155 . . . . 
'X-RAY DIFFRACTION' . 3.2377 3.3081  2810 0.3071 99.00  0.3241 . . 137 . . . . 
'X-RAY DIFFRACTION' . 3.3081 3.3850  2785 0.2945 99.00  0.3928 . . 133 . . . . 
'X-RAY DIFFRACTION' . 3.3850 3.4696  2815 0.2749 99.00  0.3005 . . 137 . . . . 
'X-RAY DIFFRACTION' . 3.4696 3.5634  2849 0.2656 100.00 0.3233 . . 134 . . . . 
'X-RAY DIFFRACTION' . 3.5634 3.6682  2807 0.2493 100.00 0.2990 . . 144 . . . . 
'X-RAY DIFFRACTION' . 3.6682 3.7866  2839 0.2357 100.00 0.2692 . . 138 . . . . 
'X-RAY DIFFRACTION' . 3.7866 3.9219  2820 0.2195 100.00 0.2400 . . 147 . . . . 
'X-RAY DIFFRACTION' . 3.9219 4.0788  2833 0.2190 100.00 0.2565 . . 157 . . . . 
'X-RAY DIFFRACTION' . 4.0788 4.2643  2828 0.2117 100.00 0.2458 . . 151 . . . . 
'X-RAY DIFFRACTION' . 4.2643 4.4890  2823 0.1967 100.00 0.2185 . . 161 . . . . 
'X-RAY DIFFRACTION' . 4.4890 4.7700  2838 0.1954 100.00 0.1990 . . 171 . . . . 
'X-RAY DIFFRACTION' . 4.7700 5.1379  2841 0.1962 100.00 0.2528 . . 156 . . . . 
'X-RAY DIFFRACTION' . 5.1379 5.6543  2863 0.2084 100.00 0.2179 . . 155 . . . . 
'X-RAY DIFFRACTION' . 5.6543 6.4708  2877 0.2219 100.00 0.2422 . . 168 . . . . 
'X-RAY DIFFRACTION' . 6.4708 8.1463  2929 0.1975 100.00 0.2259 . . 153 . . . . 
'X-RAY DIFFRACTION' . 8.1463 48.4012 2923 0.1708 96.00  0.2143 . . 169 . . . . 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    4L28 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  4L28 
_struct.title                     
'Crystal structure of delta516-525 human cystathionine beta-synthase D444N mutant containing C-terminal 6xHis tag' 
_struct.pdbx_descriptor           'Cystathionine beta-synthase (E.C.4.2.1.22)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4L28 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            
;CBS domain, homocyteine, cysteine biosynthesis, heme, pyridoxal 5'-phosphate, S-adenosylmethionine, transsulfuration pathway, LYASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 3 ? 
I N N 2 ? 
J N N 3 ? 
K N N 2 ? 
L N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   PRO A 58  ? SER A 62  ? PRO A 59  SER A 63  5 ? 5  
HELX_P HELX_P2   2   ASP A 78  ? LYS A 82  ? ASP A 79  LYS A 83  5 ? 5  
HELX_P HELX_P3   3   LYS A 93  ? PHE A 98  ? LYS A 94  PHE A 99  1 ? 6  
HELX_P HELX_P4   4   PHE A 110 ? ASN A 112 ? PHE A 111 ASN A 113 5 ? 3  
HELX_P HELX_P5   5   VAL A 117 ? GLY A 133 ? VAL A 118 GLY A 134 1 ? 17 
HELX_P HELX_P6   6   GLY A 147 ? GLY A 161 ? GLY A 148 GLY A 162 1 ? 15 
HELX_P HELX_P7   7   SER A 173 ? LEU A 183 ? SER A 174 LEU A 184 1 ? 11 
HELX_P HELX_P8   8   SER A 201 ? ILE A 213 ? SER A 202 ILE A 214 1 ? 13 
HELX_P HELX_P9   9   ALA A 225 ? THR A 234 ? ALA A 226 THR A 235 1 ? 10 
HELX_P HELX_P10  10  THR A 234 ? CYS A 243 ? THR A 235 CYS A 244 1 ? 10 
HELX_P HELX_P11  11  GLY A 257 ? CYS A 271 ? GLY A 258 CYS A 272 1 ? 15 
HELX_P HELX_P12  12  PRO A 289 ? GLN A 294 ? PRO A 290 GLN A 295 5 ? 6  
HELX_P HELX_P13  13  ASP A 315 ? VAL A 319 ? ASP A 316 VAL A 320 5 ? 5  
HELX_P HELX_P14  14  ASN A 326 ? GLY A 342 ? ASN A 327 GLY A 343 1 ? 17 
HELX_P HELX_P15  15  GLY A 346 ? ALA A 360 ? GLY A 347 ALA A 361 1 ? 15 
HELX_P HELX_P16  16  GLN A 361 ? LEU A 363 ? GLN A 362 LEU A 364 5 ? 3  
HELX_P HELX_P17  17  SER A 376 ? MET A 381 ? SER A 377 MET A 382 5 ? 6  
HELX_P HELX_P18  18  SER A 386 ? LYS A 393 ? SER A 387 LYS A 394 1 ? 8  
HELX_P HELX_P19  19  GLU A 399 ? ASP A 400 ? GLU A 400 ASP A 401 5 ? 2  
HELX_P HELX_P20  20  THR A 402 ? LYS A 405 ? THR A 403 LYS A 406 5 ? 4  
HELX_P HELX_P21  21  PRO A 406 ? LEU A 411 ? PRO A 407 LEU A 412 5 ? 6  
HELX_P HELX_P22  22  ARG A 412 ? GLY A 417 ? ARG A 413 GLY A 418 5 ? 6  
HELX_P HELX_P23  23  THR A 429 ? GLY A 441 ? THR A 430 GLY A 442 1 ? 13 
HELX_P HELX_P24  24  LEU A 460 ? ALA A 469 ? LEU A 461 ALA A 470 1 ? 10 
HELX_P HELX_P25  25  GLN A 477 ? VAL A 481 ? GLN A 478 VAL A 482 5 ? 5  
HELX_P HELX_P26  26  THR A 494 ? LEU A 502 ? THR A 495 LEU A 503 1 ? 9  
HELX_P HELX_P27  27  THR A 534 ? ARG A 547 ? THR A 535 ARG A 548 1 ? 14 
HELX_P HELX_P28  28  PRO B 58  ? SER B 62  ? PRO B 59  SER B 63  5 ? 5  
HELX_P HELX_P29  29  ASP B 78  ? LYS B 82  ? ASP B 79  LYS B 83  5 ? 5  
HELX_P HELX_P30  30  LYS B 93  ? PHE B 98  ? LYS B 94  PHE B 99  1 ? 6  
HELX_P HELX_P31  31  PHE B 110 ? ASN B 112 ? PHE B 111 ASN B 113 5 ? 3  
HELX_P HELX_P32  32  VAL B 117 ? ASP B 132 ? VAL B 118 ASP B 133 1 ? 16 
HELX_P HELX_P33  33  GLY B 147 ? GLY B 161 ? GLY B 148 GLY B 162 1 ? 15 
HELX_P HELX_P34  34  SER B 173 ? LEU B 183 ? SER B 174 LEU B 184 1 ? 11 
HELX_P HELX_P35  35  SER B 201 ? ILE B 213 ? SER B 202 ILE B 214 1 ? 13 
HELX_P HELX_P36  36  ALA B 225 ? THR B 234 ? ALA B 226 THR B 235 1 ? 10 
HELX_P HELX_P37  37  THR B 234 ? CYS B 243 ? THR B 235 CYS B 244 1 ? 10 
HELX_P HELX_P38  38  GLY B 257 ? CYS B 271 ? GLY B 258 CYS B 272 1 ? 15 
HELX_P HELX_P39  39  PRO B 289 ? GLN B 294 ? PRO B 290 GLN B 295 5 ? 6  
HELX_P HELX_P40  40  ASP B 315 ? VAL B 319 ? ASP B 316 VAL B 320 5 ? 5  
HELX_P HELX_P41  41  ASN B 326 ? GLY B 342 ? ASN B 327 GLY B 343 1 ? 17 
HELX_P HELX_P42  42  GLY B 346 ? ALA B 360 ? GLY B 347 ALA B 361 1 ? 15 
HELX_P HELX_P43  43  GLN B 361 ? LEU B 363 ? GLN B 362 LEU B 364 5 ? 3  
HELX_P HELX_P44  44  SER B 376 ? MET B 381 ? SER B 377 MET B 382 5 ? 6  
HELX_P HELX_P45  45  SER B 386 ? LYS B 393 ? SER B 387 LYS B 394 1 ? 8  
HELX_P HELX_P46  46  PRO B 406 ? LEU B 411 ? PRO B 407 LEU B 412 5 ? 6  
HELX_P HELX_P47  47  ARG B 412 ? GLY B 417 ? ARG B 413 GLY B 418 5 ? 6  
HELX_P HELX_P48  48  THR B 429 ? GLY B 441 ? THR B 430 GLY B 442 1 ? 13 
HELX_P HELX_P49  49  LEU B 460 ? ALA B 469 ? LEU B 461 ALA B 470 1 ? 10 
HELX_P HELX_P50  50  GLN B 477 ? VAL B 481 ? GLN B 478 VAL B 482 5 ? 5  
HELX_P HELX_P51  51  THR B 494 ? LEU B 502 ? THR B 495 LEU B 503 1 ? 9  
HELX_P HELX_P52  52  THR B 534 ? ARG B 547 ? THR B 535 ARG B 548 1 ? 14 
HELX_P HELX_P53  53  PRO C 58  ? SER C 62  ? PRO C 59  SER C 63  5 ? 5  
HELX_P HELX_P54  54  ASP C 78  ? LYS C 82  ? ASP C 79  LYS C 83  5 ? 5  
HELX_P HELX_P55  55  LYS C 93  ? PHE C 98  ? LYS C 94  PHE C 99  1 ? 6  
HELX_P HELX_P56  56  PHE C 110 ? ASN C 112 ? PHE C 111 ASN C 113 5 ? 3  
HELX_P HELX_P57  57  VAL C 117 ? GLY C 133 ? VAL C 118 GLY C 134 1 ? 17 
HELX_P HELX_P58  58  GLY C 147 ? GLY C 161 ? GLY C 148 GLY C 162 1 ? 15 
HELX_P HELX_P59  59  SER C 173 ? LEU C 183 ? SER C 174 LEU C 184 1 ? 11 
HELX_P HELX_P60  60  SER C 201 ? ILE C 213 ? SER C 202 ILE C 214 1 ? 13 
HELX_P HELX_P61  61  ALA C 225 ? THR C 234 ? ALA C 226 THR C 235 1 ? 10 
HELX_P HELX_P62  62  THR C 234 ? CYS C 243 ? THR C 235 CYS C 244 1 ? 10 
HELX_P HELX_P63  63  GLY C 257 ? CYS C 271 ? GLY C 258 CYS C 272 1 ? 15 
HELX_P HELX_P64  64  PRO C 289 ? GLN C 294 ? PRO C 290 GLN C 295 5 ? 6  
HELX_P HELX_P65  65  ASP C 315 ? VAL C 319 ? ASP C 316 VAL C 320 5 ? 5  
HELX_P HELX_P66  66  ASN C 326 ? GLY C 342 ? ASN C 327 GLY C 343 1 ? 17 
HELX_P HELX_P67  67  GLY C 346 ? ALA C 360 ? GLY C 347 ALA C 361 1 ? 15 
HELX_P HELX_P68  68  GLN C 361 ? LEU C 363 ? GLN C 362 LEU C 364 5 ? 3  
HELX_P HELX_P69  69  SER C 376 ? MET C 381 ? SER C 377 MET C 382 5 ? 6  
HELX_P HELX_P70  70  SER C 386 ? LYS C 393 ? SER C 387 LYS C 394 1 ? 8  
HELX_P HELX_P71  71  PRO C 406 ? LEU C 411 ? PRO C 407 LEU C 412 5 ? 6  
HELX_P HELX_P72  72  ARG C 412 ? GLY C 417 ? ARG C 413 GLY C 418 5 ? 6  
HELX_P HELX_P73  73  THR C 429 ? GLY C 441 ? THR C 430 GLY C 442 1 ? 13 
HELX_P HELX_P74  74  LEU C 460 ? ALA C 469 ? LEU C 461 ALA C 470 1 ? 10 
HELX_P HELX_P75  75  GLN C 477 ? VAL C 481 ? GLN C 478 VAL C 482 5 ? 5  
HELX_P HELX_P76  76  THR C 494 ? LEU C 502 ? THR C 495 LEU C 503 1 ? 9  
HELX_P HELX_P77  77  THR C 534 ? ARG C 547 ? THR C 535 ARG C 548 1 ? 14 
HELX_P HELX_P78  78  PRO D 58  ? SER D 62  ? PRO D 59  SER D 63  5 ? 5  
HELX_P HELX_P79  79  ASP D 78  ? LYS D 82  ? ASP D 79  LYS D 83  5 ? 5  
HELX_P HELX_P80  80  LYS D 93  ? PHE D 98  ? LYS D 94  PHE D 99  1 ? 6  
HELX_P HELX_P81  81  PHE D 110 ? ASN D 112 ? PHE D 111 ASN D 113 5 ? 3  
HELX_P HELX_P82  82  VAL D 117 ? GLY D 133 ? VAL D 118 GLY D 134 1 ? 17 
HELX_P HELX_P83  83  GLY D 147 ? GLY D 161 ? GLY D 148 GLY D 162 1 ? 15 
HELX_P HELX_P84  84  SER D 173 ? LEU D 183 ? SER D 174 LEU D 184 1 ? 11 
HELX_P HELX_P85  85  SER D 201 ? ILE D 213 ? SER D 202 ILE D 214 1 ? 13 
HELX_P HELX_P86  86  ALA D 225 ? THR D 234 ? ALA D 226 THR D 235 1 ? 10 
HELX_P HELX_P87  87  THR D 234 ? CYS D 243 ? THR D 235 CYS D 244 1 ? 10 
HELX_P HELX_P88  88  GLY D 257 ? CYS D 271 ? GLY D 258 CYS D 272 1 ? 15 
HELX_P HELX_P89  89  PRO D 289 ? GLN D 294 ? PRO D 290 GLN D 295 5 ? 6  
HELX_P HELX_P90  90  ASP D 315 ? VAL D 319 ? ASP D 316 VAL D 320 5 ? 5  
HELX_P HELX_P91  91  ASN D 326 ? GLY D 342 ? ASN D 327 GLY D 343 1 ? 17 
HELX_P HELX_P92  92  GLY D 346 ? ALA D 360 ? GLY D 347 ALA D 361 1 ? 15 
HELX_P HELX_P93  93  GLN D 361 ? LEU D 363 ? GLN D 362 LEU D 364 5 ? 3  
HELX_P HELX_P94  94  SER D 376 ? MET D 381 ? SER D 377 MET D 382 5 ? 6  
HELX_P HELX_P95  95  SER D 386 ? LYS D 393 ? SER D 387 LYS D 394 1 ? 8  
HELX_P HELX_P96  96  PRO D 406 ? LEU D 411 ? PRO D 407 LEU D 412 5 ? 6  
HELX_P HELX_P97  97  ARG D 412 ? GLY D 417 ? ARG D 413 GLY D 418 5 ? 6  
HELX_P HELX_P98  98  THR D 429 ? GLY D 441 ? THR D 430 GLY D 442 1 ? 13 
HELX_P HELX_P99  99  LEU D 460 ? ALA D 469 ? LEU D 461 ALA D 470 1 ? 10 
HELX_P HELX_P100 100 GLN D 477 ? VAL D 481 ? GLN D 478 VAL D 482 5 ? 5  
HELX_P HELX_P101 101 THR D 494 ? LEU D 502 ? THR D 495 LEU D 503 1 ? 9  
HELX_P HELX_P102 102 THR D 534 ? ARG D 547 ? THR D 535 ARG D 548 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C HIS 64  NE2 ? ? ? 1_555 J HEM . FE  ? ? C HIS 65  C HEM 602 1_555 ? ? ? ? ? ? ? 2.067 ?    
metalc2 metalc ? ? A HIS 64  NE2 ? ? ? 1_555 F HEM . FE  ? ? A HIS 65  A HEM 602 1_555 ? ? ? ? ? ? ? 2.088 ?    
metalc3 metalc ? ? D HIS 64  NE2 ? ? ? 1_555 L HEM . FE  ? ? D HIS 65  D HEM 602 1_555 ? ? ? ? ? ? ? 2.093 ?    
metalc4 metalc ? ? B HIS 64  NE2 ? ? ? 1_555 H HEM . FE  ? ? B HIS 65  B HEM 602 1_555 ? ? ? ? ? ? ? 2.109 ?    
metalc5 metalc ? ? A CYS 51  SG  ? ? ? 1_555 F HEM . FE  ? ? A CYS 52  A HEM 602 1_555 ? ? ? ? ? ? ? 2.199 ?    
metalc6 metalc ? ? D CYS 51  SG  ? ? ? 1_555 L HEM . FE  ? ? D CYS 52  D HEM 602 1_555 ? ? ? ? ? ? ? 2.202 ?    
metalc7 metalc ? ? B CYS 51  SG  ? ? ? 1_555 H HEM . FE  ? ? B CYS 52  B HEM 602 1_555 ? ? ? ? ? ? ? 2.222 ?    
metalc8 metalc ? ? C CYS 51  SG  ? ? ? 1_555 J HEM . FE  ? ? C CYS 52  C HEM 602 1_555 ? ? ? ? ? ? ? 2.238 ?    
covale1 covale ? ? A LYS 118 NZ  ? ? ? 1_555 E PLP . C4A ? ? A LYS 119 A PLP 601 1_555 ? ? ? ? ? ? ? 1.352 doub 
covale2 covale ? ? B LYS 118 NZ  ? ? ? 1_555 G PLP . C4A ? ? B LYS 119 B PLP 601 1_555 ? ? ? ? ? ? ? 1.342 doub 
covale3 covale ? ? C LYS 118 NZ  ? ? ? 1_555 I PLP . C4A ? ? C LYS 119 C PLP 601 1_555 ? ? ? ? ? ? ? 1.342 doub 
covale4 covale ? ? D LYS 118 NZ  ? ? ? 1_555 K PLP . C4A ? ? D LYS 119 D PLP 601 1_555 ? ? ? ? ? ? ? 1.336 doub 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 288 A . ? GLU 289 A PRO 289 A ? PRO 290 A 1 -2.74 
2 GLU 288 B . ? GLU 289 B PRO 289 B ? PRO 290 B 1 -1.98 
3 GLU 288 C . ? GLU 289 C PRO 289 C ? PRO 290 C 1 -2.81 
4 GLU 288 D . ? GLU 289 D PRO 289 D ? PRO 290 D 1 -3.32 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 4 ? 
C ? 2 ? 
D ? 3 ? 
E ? 7 ? 
F ? 4 ? 
G ? 2 ? 
H ? 3 ? 
I ? 6 ? 
J ? 4 ? 
K ? 2 ? 
L ? 3 ? 
M ? 6 ? 
N ? 4 ? 
O ? 2 ? 
P ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? anti-parallel 
E 6 7 ? parallel      
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
G 1 2 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
I 5 6 ? parallel      
J 1 2 ? parallel      
J 2 3 ? parallel      
J 3 4 ? parallel      
K 1 2 ? anti-parallel 
L 1 2 ? parallel      
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? parallel      
M 3 4 ? parallel      
M 4 5 ? parallel      
M 5 6 ? parallel      
N 1 2 ? parallel      
N 2 3 ? parallel      
N 3 4 ? parallel      
O 1 2 ? anti-parallel 
P 1 2 ? parallel      
P 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 88  ? ARG A 90  ? MET A 89  ARG A 91  
A 2 GLU A 103 ? CYS A 108 ? GLU A 104 CYS A 109 
A 3 ARG A 368 ? LEU A 373 ? ARG A 369 LEU A 374 
A 4 MET A 249 ? SER A 253 ? MET A 250 SER A 254 
A 5 ARG A 275 ? PRO A 281 ? ARG A 276 PRO A 282 
A 6 LYS A 321 ? SER A 325 ? LYS A 322 SER A 326 
B 1 GLU A 186 ? THR A 190 ? GLU A 187 THR A 191 
B 2 ARG A 163 ? PRO A 169 ? ARG A 164 PRO A 170 
B 3 THR A 140 ? PRO A 144 ? THR A 141 PRO A 145 
B 4 SER A 216 ? ILE A 218 ? SER A 217 ILE A 219 
C 1 GLN A 444 ? VAL A 448 ? GLN A 445 VAL A 449 
C 2 ILE A 454 ? THR A 459 ? ILE A 455 THR A 460 
D 1 LYS A 487 ? ILE A 489 ? LYS A 488 ILE A 490 
D 2 ALA A 508 ? HIS A 512 ? ALA A 509 HIS A 513 
D 3 MET A 528 ? VAL A 533 ? MET A 529 VAL A 534 
E 1 LYS B 321 ? SER B 325 ? LYS B 322 SER B 326 
E 2 ARG B 275 ? PRO B 281 ? ARG B 276 PRO B 282 
E 3 MET B 249 ? SER B 253 ? MET B 250 SER B 254 
E 4 ARG B 368 ? LEU B 373 ? ARG B 369 LEU B 374 
E 5 GLU B 103 ? CYS B 108 ? GLU B 104 CYS B 109 
E 6 MET B 88  ? ARG B 90  ? MET B 89  ARG B 91  
E 7 ILE D 75  ? LEU D 76  ? ILE D 76  LEU D 77  
F 1 GLU B 186 ? THR B 190 ? GLU B 187 THR B 191 
F 2 ARG B 163 ? PRO B 169 ? ARG B 164 PRO B 170 
F 3 THR B 140 ? PRO B 144 ? THR B 141 PRO B 145 
F 4 SER B 216 ? ILE B 218 ? SER B 217 ILE B 219 
G 1 GLN B 444 ? VAL B 448 ? GLN B 445 VAL B 449 
G 2 ILE B 454 ? THR B 459 ? ILE B 455 THR B 460 
H 1 LYS B 487 ? ILE B 489 ? LYS B 488 ILE B 490 
H 2 ALA B 508 ? VAL B 511 ? ALA B 509 VAL B 512 
H 3 VAL B 529 ? VAL B 533 ? VAL B 530 VAL B 534 
I 1 MET C 88  ? ARG C 90  ? MET C 89  ARG C 91  
I 2 GLU C 103 ? CYS C 108 ? GLU C 104 CYS C 109 
I 3 ARG C 368 ? LEU C 373 ? ARG C 369 LEU C 374 
I 4 MET C 249 ? SER C 253 ? MET C 250 SER C 254 
I 5 ARG C 275 ? PRO C 281 ? ARG C 276 PRO C 282 
I 6 LYS C 321 ? SER C 325 ? LYS C 322 SER C 326 
J 1 GLU C 186 ? THR C 190 ? GLU C 187 THR C 191 
J 2 ARG C 163 ? PRO C 169 ? ARG C 164 PRO C 170 
J 3 THR C 140 ? PRO C 144 ? THR C 141 PRO C 145 
J 4 SER C 216 ? ILE C 218 ? SER C 217 ILE C 219 
K 1 GLN C 444 ? VAL C 448 ? GLN C 445 VAL C 449 
K 2 ILE C 454 ? THR C 459 ? ILE C 455 THR C 460 
L 1 LYS C 487 ? ILE C 489 ? LYS C 488 ILE C 490 
L 2 ALA C 508 ? VAL C 511 ? ALA C 509 VAL C 512 
L 3 VAL C 529 ? VAL C 533 ? VAL C 530 VAL C 534 
M 1 MET D 88  ? ARG D 90  ? MET D 89  ARG D 91  
M 2 GLU D 103 ? CYS D 108 ? GLU D 104 CYS D 109 
M 3 ARG D 368 ? LEU D 373 ? ARG D 369 LEU D 374 
M 4 MET D 249 ? SER D 253 ? MET D 250 SER D 254 
M 5 ARG D 275 ? PRO D 281 ? ARG D 276 PRO D 282 
M 6 LYS D 321 ? SER D 325 ? LYS D 322 SER D 326 
N 1 GLU D 186 ? THR D 190 ? GLU D 187 THR D 191 
N 2 ARG D 163 ? PRO D 169 ? ARG D 164 PRO D 170 
N 3 THR D 140 ? PRO D 144 ? THR D 141 PRO D 145 
N 4 SER D 216 ? ILE D 218 ? SER D 217 ILE D 219 
O 1 GLN D 444 ? VAL D 448 ? GLN D 445 VAL D 449 
O 2 ILE D 454 ? THR D 459 ? ILE D 455 THR D 460 
P 1 LYS D 487 ? ILE D 489 ? LYS D 488 ILE D 490 
P 2 ALA D 508 ? HIS D 512 ? ALA D 509 HIS D 513 
P 3 MET D 528 ? VAL D 533 ? MET D 529 VAL D 534 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 89  ? N VAL A 90  O ALA A 106 ? O ALA A 107 
A 2 3 N LEU A 105 ? N LEU A 106 O CYS A 369 ? O CYS A 370 
A 3 4 O VAL A 370 ? O VAL A 371 N MET A 249 ? N MET A 250 
A 4 5 N LEU A 250 ? N LEU A 251 O ILE A 277 ? O ILE A 278 
A 5 6 N ASP A 280 ? N ASP A 281 O PHE A 323 ? O PHE A 324 
B 1 2 O GLU A 186 ? O GLU A 187 N CYS A 164 ? N CYS A 165 
B 2 3 O ILE A 165 ? O ILE A 166 N ILE A 141 ? N ILE A 142 
B 3 4 N ILE A 142 ? N ILE A 143 O HIS A 217 ? O HIS A 218 
C 1 2 N VAL A 447 ? N VAL A 448 O LEU A 455 ? O LEU A 456 
D 1 2 N ILE A 489 ? N ILE A 490 O VAL A 511 ? O VAL A 512 
D 2 3 N VAL A 510 ? N VAL A 511 O GLY A 531 ? O GLY A 532 
E 1 2 O PHE B 323 ? O PHE B 324 N ASP B 280 ? N ASP B 281 
E 2 3 O ILE B 277 ? O ILE B 278 N LEU B 250 ? N LEU B 251 
E 3 4 N VAL B 251 ? N VAL B 252 O VAL B 370 ? O VAL B 371 
E 4 5 O CYS B 369 ? O CYS B 370 N LEU B 105 ? N LEU B 106 
E 5 6 O ALA B 106 ? O ALA B 107 N VAL B 89  ? N VAL B 90  
E 6 7 N ARG B 90  ? N ARG B 91  O LEU D 76  ? O LEU D 77  
F 1 2 O GLU B 186 ? O GLU B 187 N CYS B 164 ? N CYS B 165 
F 2 3 O ILE B 165 ? O ILE B 166 N ILE B 141 ? N ILE B 142 
F 3 4 N ILE B 142 ? N ILE B 143 O HIS B 217 ? O HIS B 218 
G 1 2 N VAL B 447 ? N VAL B 448 O LEU B 455 ? O LEU B 456 
H 1 2 N ILE B 489 ? N ILE B 490 O LEU B 509 ? O LEU B 510 
H 2 3 N ALA B 508 ? N ALA B 509 O VAL B 533 ? O VAL B 534 
I 1 2 N VAL C 89  ? N VAL C 90  O ALA C 106 ? O ALA C 107 
I 2 3 N LEU C 105 ? N LEU C 106 O CYS C 369 ? O CYS C 370 
I 3 4 O VAL C 370 ? O VAL C 371 N VAL C 251 ? N VAL C 252 
I 4 5 N LEU C 250 ? N LEU C 251 O ILE C 277 ? O ILE C 278 
I 5 6 N ASP C 280 ? N ASP C 281 O PHE C 323 ? O PHE C 324 
J 1 2 O GLU C 186 ? O GLU C 187 N ILE C 166 ? N ILE C 167 
J 2 3 O ILE C 165 ? O ILE C 166 N ILE C 141 ? N ILE C 142 
J 3 4 N ILE C 142 ? N ILE C 143 O HIS C 217 ? O HIS C 218 
K 1 2 N VAL C 447 ? N VAL C 448 O LEU C 455 ? O LEU C 456 
L 1 2 N ILE C 489 ? N ILE C 490 O VAL C 511 ? O VAL C 512 
L 2 3 N VAL C 510 ? N VAL C 511 O GLY C 531 ? O GLY C 532 
M 1 2 N VAL D 89  ? N VAL D 90  O ALA D 106 ? O ALA D 107 
M 2 3 N LEU D 105 ? N LEU D 106 O CYS D 369 ? O CYS D 370 
M 3 4 O VAL D 370 ? O VAL D 371 N MET D 249 ? N MET D 250 
M 4 5 N LEU D 250 ? N LEU D 251 O ILE D 277 ? O ILE D 278 
M 5 6 N ASP D 280 ? N ASP D 281 O PHE D 323 ? O PHE D 324 
N 1 2 O GLU D 186 ? O GLU D 187 N CYS D 164 ? N CYS D 165 
N 2 3 O ILE D 165 ? O ILE D 166 N ILE D 141 ? N ILE D 142 
N 3 4 N ILE D 142 ? N ILE D 143 O HIS D 217 ? O HIS D 218 
O 1 2 N VAL D 447 ? N VAL D 448 O LEU D 455 ? O LEU D 456 
P 1 2 N ILE D 489 ? N ILE D 490 O LEU D 509 ? O LEU D 510 
P 2 3 N VAL D 510 ? N VAL D 511 O GLY D 531 ? O GLY D 532 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE PLP A 601' 
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE HEM A 602' 
AC3 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE PLP B 601' 
AC4 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE HEM B 602' 
AC5 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE PLP C 601' 
AC6 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE HEM C 602' 
AC7 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE PLP D 601' 
AC8 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE HEM D 602' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 14 LYS A 118 ? LYS A 119 . ? 1_555 ? 
2   AC1 14 ASN A 148 ? ASN A 149 . ? 1_555 ? 
3   AC1 14 SER A 253 ? SER A 254 . ? 1_555 ? 
4   AC1 14 VAL A 254 ? VAL A 255 . ? 1_555 ? 
5   AC1 14 GLY A 255 ? GLY A 256 . ? 1_555 ? 
6   AC1 14 THR A 256 ? THR A 257 . ? 1_555 ? 
7   AC1 14 GLY A 257 ? GLY A 258 . ? 1_555 ? 
8   AC1 14 GLY A 258 ? GLY A 259 . ? 1_555 ? 
9   AC1 14 THR A 259 ? THR A 260 . ? 1_555 ? 
10  AC1 14 GLY A 304 ? GLY A 305 . ? 1_555 ? 
11  AC1 14 ILE A 305 ? ILE A 306 . ? 1_555 ? 
12  AC1 14 SER A 348 ? SER A 349 . ? 1_555 ? 
13  AC1 14 PRO A 374 ? PRO A 375 . ? 1_555 ? 
14  AC1 14 ASP A 375 ? ASP A 376 . ? 1_555 ? 
15  AC2 17 SER A 49  ? SER A 50  . ? 1_555 ? 
16  AC2 17 ARG A 50  ? ARG A 51  . ? 1_555 ? 
17  AC2 17 CYS A 51  ? CYS A 52  . ? 1_555 ? 
18  AC2 17 THR A 52  ? THR A 53  . ? 1_555 ? 
19  AC2 17 TRP A 53  ? TRP A 54  . ? 1_555 ? 
20  AC2 17 ARG A 57  ? ARG A 58  . ? 1_555 ? 
21  AC2 17 PRO A 58  ? PRO A 59  . ? 1_555 ? 
22  AC2 17 GLU A 61  ? GLU A 62  . ? 1_555 ? 
23  AC2 17 SER A 62  ? SER A 63  . ? 1_555 ? 
24  AC2 17 PRO A 63  ? PRO A 64  . ? 1_555 ? 
25  AC2 17 HIS A 64  ? HIS A 65  . ? 1_555 ? 
26  AC2 17 ALA A 225 ? ALA A 226 . ? 1_555 ? 
27  AC2 17 LEU A 229 ? LEU A 230 . ? 1_555 ? 
28  AC2 17 ARG A 265 ? ARG A 266 . ? 1_555 ? 
29  AC2 17 THR D 52  ? THR D 53  . ? 2_674 ? 
30  AC2 17 ARG D 57  ? ARG D 58  . ? 2_674 ? 
31  AC2 17 HEM L .   ? HEM D 602 . ? 2_674 ? 
32  AC3 14 LYS B 118 ? LYS B 119 . ? 1_555 ? 
33  AC3 14 ASN B 148 ? ASN B 149 . ? 1_555 ? 
34  AC3 14 SER B 253 ? SER B 254 . ? 1_555 ? 
35  AC3 14 VAL B 254 ? VAL B 255 . ? 1_555 ? 
36  AC3 14 GLY B 255 ? GLY B 256 . ? 1_555 ? 
37  AC3 14 THR B 256 ? THR B 257 . ? 1_555 ? 
38  AC3 14 GLY B 257 ? GLY B 258 . ? 1_555 ? 
39  AC3 14 GLY B 258 ? GLY B 259 . ? 1_555 ? 
40  AC3 14 THR B 259 ? THR B 260 . ? 1_555 ? 
41  AC3 14 GLY B 304 ? GLY B 305 . ? 1_555 ? 
42  AC3 14 ILE B 305 ? ILE B 306 . ? 1_555 ? 
43  AC3 14 SER B 348 ? SER B 349 . ? 1_555 ? 
44  AC3 14 PRO B 374 ? PRO B 375 . ? 1_555 ? 
45  AC3 14 ASP B 375 ? ASP B 376 . ? 1_555 ? 
46  AC4 14 SER B 49  ? SER B 50  . ? 1_555 ? 
47  AC4 14 ARG B 50  ? ARG B 51  . ? 1_555 ? 
48  AC4 14 CYS B 51  ? CYS B 52  . ? 1_555 ? 
49  AC4 14 THR B 52  ? THR B 53  . ? 1_555 ? 
50  AC4 14 TRP B 53  ? TRP B 54  . ? 1_555 ? 
51  AC4 14 ARG B 57  ? ARG B 58  . ? 1_555 ? 
52  AC4 14 PRO B 58  ? PRO B 59  . ? 1_555 ? 
53  AC4 14 GLU B 61  ? GLU B 62  . ? 1_555 ? 
54  AC4 14 SER B 62  ? SER B 63  . ? 1_555 ? 
55  AC4 14 PRO B 63  ? PRO B 64  . ? 1_555 ? 
56  AC4 14 HIS B 64  ? HIS B 65  . ? 1_555 ? 
57  AC4 14 ALA B 225 ? ALA B 226 . ? 1_555 ? 
58  AC4 14 LEU B 229 ? LEU B 230 . ? 1_555 ? 
59  AC4 14 ARG B 265 ? ARG B 266 . ? 1_555 ? 
60  AC5 14 LYS C 118 ? LYS C 119 . ? 1_555 ? 
61  AC5 14 ASN C 148 ? ASN C 149 . ? 1_555 ? 
62  AC5 14 SER C 253 ? SER C 254 . ? 1_555 ? 
63  AC5 14 VAL C 254 ? VAL C 255 . ? 1_555 ? 
64  AC5 14 GLY C 255 ? GLY C 256 . ? 1_555 ? 
65  AC5 14 THR C 256 ? THR C 257 . ? 1_555 ? 
66  AC5 14 GLY C 257 ? GLY C 258 . ? 1_555 ? 
67  AC5 14 GLY C 258 ? GLY C 259 . ? 1_555 ? 
68  AC5 14 THR C 259 ? THR C 260 . ? 1_555 ? 
69  AC5 14 GLY C 304 ? GLY C 305 . ? 1_555 ? 
70  AC5 14 ILE C 305 ? ILE C 306 . ? 1_555 ? 
71  AC5 14 SER C 348 ? SER C 349 . ? 1_555 ? 
72  AC5 14 PRO C 374 ? PRO C 375 . ? 1_555 ? 
73  AC5 14 ASP C 375 ? ASP C 376 . ? 1_555 ? 
74  AC6 15 SER C 49  ? SER C 50  . ? 1_555 ? 
75  AC6 15 ARG C 50  ? ARG C 51  . ? 1_555 ? 
76  AC6 15 CYS C 51  ? CYS C 52  . ? 1_555 ? 
77  AC6 15 THR C 52  ? THR C 53  . ? 1_555 ? 
78  AC6 15 TRP C 53  ? TRP C 54  . ? 1_555 ? 
79  AC6 15 ARG C 57  ? ARG C 58  . ? 1_555 ? 
80  AC6 15 PRO C 58  ? PRO C 59  . ? 1_555 ? 
81  AC6 15 GLU C 61  ? GLU C 62  . ? 1_555 ? 
82  AC6 15 SER C 62  ? SER C 63  . ? 1_555 ? 
83  AC6 15 PRO C 63  ? PRO C 64  . ? 1_555 ? 
84  AC6 15 HIS C 64  ? HIS C 65  . ? 1_555 ? 
85  AC6 15 ALA C 225 ? ALA C 226 . ? 1_555 ? 
86  AC6 15 TYR C 232 ? TYR C 233 . ? 1_555 ? 
87  AC6 15 GLY C 262 ? GLY C 263 . ? 1_555 ? 
88  AC6 15 ARG C 265 ? ARG C 266 . ? 1_555 ? 
89  AC7 13 LYS D 118 ? LYS D 119 . ? 1_555 ? 
90  AC7 13 ASN D 148 ? ASN D 149 . ? 1_555 ? 
91  AC7 13 SER D 253 ? SER D 254 . ? 1_555 ? 
92  AC7 13 VAL D 254 ? VAL D 255 . ? 1_555 ? 
93  AC7 13 GLY D 255 ? GLY D 256 . ? 1_555 ? 
94  AC7 13 THR D 256 ? THR D 257 . ? 1_555 ? 
95  AC7 13 GLY D 257 ? GLY D 258 . ? 1_555 ? 
96  AC7 13 THR D 259 ? THR D 260 . ? 1_555 ? 
97  AC7 13 GLY D 304 ? GLY D 305 . ? 1_555 ? 
98  AC7 13 ILE D 305 ? ILE D 306 . ? 1_555 ? 
99  AC7 13 SER D 348 ? SER D 349 . ? 1_555 ? 
100 AC7 13 PRO D 374 ? PRO D 375 . ? 1_555 ? 
101 AC7 13 ASP D 375 ? ASP D 376 . ? 1_555 ? 
102 AC8 18 THR A 52  ? THR A 53  . ? 2_675 ? 
103 AC8 18 ARG A 57  ? ARG A 58  . ? 2_675 ? 
104 AC8 18 HEM F .   ? HEM A 602 . ? 2_675 ? 
105 AC8 18 SER D 49  ? SER D 50  . ? 1_555 ? 
106 AC8 18 ARG D 50  ? ARG D 51  . ? 1_555 ? 
107 AC8 18 CYS D 51  ? CYS D 52  . ? 1_555 ? 
108 AC8 18 THR D 52  ? THR D 53  . ? 1_555 ? 
109 AC8 18 TRP D 53  ? TRP D 54  . ? 1_555 ? 
110 AC8 18 ARG D 57  ? ARG D 58  . ? 1_555 ? 
111 AC8 18 PRO D 58  ? PRO D 59  . ? 1_555 ? 
112 AC8 18 GLU D 61  ? GLU D 62  . ? 1_555 ? 
113 AC8 18 SER D 62  ? SER D 63  . ? 1_555 ? 
114 AC8 18 PRO D 63  ? PRO D 64  . ? 1_555 ? 
115 AC8 18 HIS D 64  ? HIS D 65  . ? 1_555 ? 
116 AC8 18 ALA D 225 ? ALA D 226 . ? 1_555 ? 
117 AC8 18 LEU D 229 ? LEU D 230 . ? 1_555 ? 
118 AC8 18 TYR D 232 ? TYR D 233 . ? 1_555 ? 
119 AC8 18 ARG D 265 ? ARG D 266 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4L28 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4L28 
_atom_sites.fract_transf_matrix[1][1]   0.009134 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007629 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004829 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . LEU A 1 41  ? 80.754  114.747 178.771 1.00 153.95 ? 42  LEU A N   1 
ATOM   2     C  CA  . LEU A 1 41  ? 81.795  115.466 178.047 1.00 150.76 ? 42  LEU A CA  1 
ATOM   3     C  C   . LEU A 1 41  ? 83.136  114.728 178.044 1.00 144.67 ? 42  LEU A C   1 
ATOM   4     O  O   . LEU A 1 41  ? 83.960  114.899 178.938 1.00 144.41 ? 42  LEU A O   1 
ATOM   5     C  CB  . LEU A 1 41  ? 81.955  116.886 178.598 1.00 152.90 ? 42  LEU A CB  1 
ATOM   6     C  CG  . LEU A 1 41  ? 81.364  118.000 177.731 1.00 154.73 ? 42  LEU A CG  1 
ATOM   7     C  CD1 . LEU A 1 41  ? 81.434  119.347 178.433 1.00 155.36 ? 42  LEU A CD1 1 
ATOM   8     C  CD2 . LEU A 1 41  ? 82.066  118.064 176.384 1.00 155.19 ? 42  LEU A CD2 1 
ATOM   9     N  N   . TRP A 1 42  ? 83.332  113.892 177.033 1.00 131.86 ? 43  TRP A N   1 
ATOM   10    C  CA  . TRP A 1 42  ? 84.626  113.292 176.760 1.00 126.16 ? 43  TRP A CA  1 
ATOM   11    C  C   . TRP A 1 42  ? 84.732  112.968 175.286 1.00 121.23 ? 43  TRP A C   1 
ATOM   12    O  O   . TRP A 1 42  ? 84.122  112.018 174.815 1.00 120.92 ? 43  TRP A O   1 
ATOM   13    C  CB  . TRP A 1 42  ? 84.830  112.013 177.552 1.00 125.79 ? 43  TRP A CB  1 
ATOM   14    C  CG  . TRP A 1 42  ? 86.048  111.282 177.112 1.00 125.37 ? 43  TRP A CG  1 
ATOM   15    C  CD1 . TRP A 1 42  ? 87.328  111.687 177.254 1.00 125.20 ? 43  TRP A CD1 1 
ATOM   16    C  CD2 . TRP A 1 42  ? 86.100  110.020 176.453 1.00 125.17 ? 43  TRP A CD2 1 
ATOM   17    N  NE1 . TRP A 1 42  ? 88.184  110.759 176.729 1.00 125.11 ? 43  TRP A NE1 1 
ATOM   18    C  CE2 . TRP A 1 42  ? 87.451  109.722 176.229 1.00 125.09 ? 43  TRP A CE2 1 
ATOM   19    C  CE3 . TRP A 1 42  ? 85.136  109.109 176.035 1.00 125.08 ? 43  TRP A CE3 1 
ATOM   20    C  CZ2 . TRP A 1 42  ? 87.865  108.559 175.610 1.00 125.02 ? 43  TRP A CZ2 1 
ATOM   21    C  CZ3 . TRP A 1 42  ? 85.548  107.952 175.421 1.00 125.01 ? 43  TRP A CZ3 1 
ATOM   22    C  CH2 . TRP A 1 42  ? 86.902  107.687 175.213 1.00 124.96 ? 43  TRP A CH2 1 
ATOM   23    N  N   . ILE A 1 43  ? 85.501  113.757 174.555 1.00 104.13 ? 44  ILE A N   1 
ATOM   24    C  CA  . ILE A 1 43  ? 85.674  113.508 173.140 1.00 99.80  ? 44  ILE A CA  1 
ATOM   25    C  C   . ILE A 1 43  ? 86.769  112.483 172.899 1.00 97.60  ? 44  ILE A C   1 
ATOM   26    O  O   . ILE A 1 43  ? 87.845  112.576 173.458 1.00 97.34  ? 44  ILE A O   1 
ATOM   27    C  CB  . ILE A 1 43  ? 85.997  114.795 172.397 1.00 98.22  ? 44  ILE A CB  1 
ATOM   28    C  CG1 . ILE A 1 43  ? 84.945  115.851 172.706 1.00 97.39  ? 44  ILE A CG1 1 
ATOM   29    C  CG2 . ILE A 1 43  ? 86.040  114.544 170.919 1.00 97.83  ? 44  ILE A CG2 1 
ATOM   30    C  CD1 . ILE A 1 43  ? 85.172  117.154 171.998 1.00 96.94  ? 44  ILE A CD1 1 
ATOM   31    N  N   . ARG A 1 44  ? 86.479  111.503 172.055 1.00 104.53 ? 45  ARG A N   1 
ATOM   32    C  CA  . ARG A 1 44  ? 87.435  110.456 171.730 1.00 102.66 ? 45  ARG A CA  1 
ATOM   33    C  C   . ARG A 1 44  ? 88.577  110.939 170.846 1.00 100.20 ? 45  ARG A C   1 
ATOM   34    O  O   . ARG A 1 44  ? 88.353  111.546 169.811 1.00 99.82  ? 45  ARG A O   1 
ATOM   35    C  CB  . ARG A 1 44  ? 86.727  109.289 171.046 1.00 103.31 ? 45  ARG A CB  1 
ATOM   36    C  CG  . ARG A 1 44  ? 86.034  108.342 171.983 1.00 103.97 ? 45  ARG A CG  1 
ATOM   37    C  CD  . ARG A 1 44  ? 85.497  107.131 171.251 1.00 104.46 ? 45  ARG A CD  1 
ATOM   38    N  NE  . ARG A 1 44  ? 85.259  106.014 172.157 1.00 104.86 ? 45  ARG A NE  1 
ATOM   39    C  CZ  . ARG A 1 44  ? 86.054  104.958 172.260 1.00 105.17 ? 45  ARG A CZ  1 
ATOM   40    N  NH1 . ARG A 1 44  ? 85.762  103.985 173.108 1.00 105.32 1 45  ARG A NH1 1 
ATOM   41    N  NH2 . ARG A 1 44  ? 87.135  104.872 171.505 1.00 105.25 ? 45  ARG A NH2 1 
ATOM   42    N  N   . PRO A 1 45  ? 89.812  110.673 171.266 1.00 83.30  ? 46  PRO A N   1 
ATOM   43    C  CA  . PRO A 1 45  ? 91.011  110.911 170.473 1.00 81.80  ? 46  PRO A CA  1 
ATOM   44    C  C   . PRO A 1 45  ? 91.073  110.044 169.225 1.00 80.22  ? 46  PRO A C   1 
ATOM   45    O  O   . PRO A 1 45  ? 91.794  110.367 168.296 1.00 79.96  ? 46  PRO A O   1 
ATOM   46    C  CB  . PRO A 1 45  ? 92.128  110.545 171.437 1.00 82.02  ? 46  PRO A CB  1 
ATOM   47    C  CG  . PRO A 1 45  ? 91.543  109.558 172.308 1.00 82.35  ? 46  PRO A CG  1 
ATOM   48    C  CD  . PRO A 1 45  ? 90.133  109.976 172.516 1.00 82.80  ? 46  PRO A CD  1 
ATOM   49    N  N   . ASP A 1 46  ? 90.364  108.926 169.226 1.00 84.70  ? 47  ASP A N   1 
ATOM   50    C  CA  . ASP A 1 46  ? 90.451  107.982 168.128 1.00 83.35  ? 47  ASP A CA  1 
ATOM   51    C  C   . ASP A 1 46  ? 89.262  108.032 167.209 1.00 82.36  ? 47  ASP A C   1 
ATOM   52    O  O   . ASP A 1 46  ? 89.024  107.100 166.465 1.00 82.28  ? 47  ASP A O   1 
ATOM   53    C  CB  . ASP A 1 46  ? 90.611  106.568 168.652 1.00 83.23  ? 47  ASP A CB  1 
ATOM   54    C  CG  . ASP A 1 46  ? 89.388  106.073 169.356 1.00 83.25  ? 47  ASP A CG  1 
ATOM   55    O  OD1 . ASP A 1 46  ? 88.698  106.891 169.980 1.00 83.25  ? 47  ASP A OD1 1 
ATOM   56    O  OD2 . ASP A 1 46  ? 89.109  104.862 169.287 1.00 83.22  1 47  ASP A OD2 1 
ATOM   57    N  N   . ALA A 1 47  ? 88.502  109.111 167.270 1.00 84.33  ? 48  ALA A N   1 
ATOM   58    C  CA  . ALA A 1 47  ? 87.337  109.240 166.419 1.00 83.46  ? 48  ALA A CA  1 
ATOM   59    C  C   . ALA A 1 47  ? 87.814  109.341 165.003 1.00 82.75  ? 48  ALA A C   1 
ATOM   60    O  O   . ALA A 1 47  ? 88.822  109.971 164.747 1.00 82.62  ? 48  ALA A O   1 
ATOM   61    C  CB  . ALA A 1 47  ? 86.562  110.466 166.781 1.00 83.40  ? 48  ALA A CB  1 
ATOM   62    N  N   . PRO A 1 48  ? 87.105  108.702 164.075 1.00 79.55  ? 49  PRO A N   1 
ATOM   63    C  CA  . PRO A 1 48  ? 87.525  108.791 162.684 1.00 79.09  ? 49  PRO A CA  1 
ATOM   64    C  C   . PRO A 1 48  ? 87.495  110.227 162.207 1.00 78.57  ? 49  PRO A C   1 
ATOM   65    O  O   . PRO A 1 48  ? 86.639  110.992 162.615 1.00 78.52  ? 49  PRO A O   1 
ATOM   66    C  CB  . PRO A 1 48  ? 86.487  107.943 161.955 1.00 79.17  ? 49  PRO A CB  1 
ATOM   67    C  CG  . PRO A 1 48  ? 85.348  107.860 162.865 1.00 79.27  ? 49  PRO A CG  1 
ATOM   68    C  CD  . PRO A 1 48  ? 85.909  107.870 164.231 1.00 79.41  ? 49  PRO A CD  1 
ATOM   69    N  N   . SER A 1 49  ? 88.451  110.586 161.368 1.00 71.69  ? 50  SER A N   1 
ATOM   70    C  CA  . SER A 1 49  ? 88.611  111.959 160.943 1.00 71.21  ? 50  SER A CA  1 
ATOM   71    C  C   . SER A 1 49  ? 87.484  112.408 160.055 1.00 70.85  ? 50  SER A C   1 
ATOM   72    O  O   . SER A 1 49  ? 86.978  111.642 159.258 1.00 70.84  ? 50  SER A O   1 
ATOM   73    C  CB  . SER A 1 49  ? 89.931  112.133 160.212 1.00 71.15  ? 50  SER A CB  1 
ATOM   74    O  OG  . SER A 1 49  ? 90.074  113.459 159.762 1.00 71.13  ? 50  SER A OG  1 
ATOM   75    N  N   . ARG A 1 50  ? 87.089  113.661 160.202 1.00 86.38  ? 51  ARG A N   1 
ATOM   76    C  CA  . ARG A 1 50  ? 86.078  114.244 159.341 1.00 86.01  ? 51  ARG A CA  1 
ATOM   77    C  C   . ARG A 1 50  ? 86.658  114.922 158.112 1.00 85.15  ? 51  ARG A C   1 
ATOM   78    O  O   . ARG A 1 50  ? 85.916  115.372 157.264 1.00 85.10  ? 51  ARG A O   1 
ATOM   79    C  CB  . ARG A 1 50  ? 85.233  115.258 160.113 1.00 86.43  ? 51  ARG A CB  1 
ATOM   80    C  CG  . ARG A 1 50  ? 84.336  114.679 161.185 1.00 86.93  ? 51  ARG A CG  1 
ATOM   81    C  CD  . ARG A 1 50  ? 83.469  115.754 161.806 1.00 87.28  ? 51  ARG A CD  1 
ATOM   82    N  NE  . ARG A 1 50  ? 84.270  116.832 162.356 1.00 87.71  ? 51  ARG A NE  1 
ATOM   83    C  CZ  . ARG A 1 50  ? 84.629  116.907 163.626 1.00 88.05  ? 51  ARG A CZ  1 
ATOM   84    N  NH1 . ARG A 1 50  ? 84.236  115.973 164.462 1.00 88.13  1 51  ARG A NH1 1 
ATOM   85    N  NH2 . ARG A 1 50  ? 85.377  117.913 164.054 1.00 88.21  ? 51  ARG A NH2 1 
ATOM   86    N  N   . CYS A 1 51  ? 87.977  115.003 158.012 1.00 69.33  ? 52  CYS A N   1 
ATOM   87    C  CA  . CYS A 1 51  ? 88.600  115.774 156.942 1.00 68.46  ? 52  CYS A CA  1 
ATOM   88    C  C   . CYS A 1 51  ? 88.257  115.220 155.576 1.00 67.72  ? 52  CYS A C   1 
ATOM   89    O  O   . CYS A 1 51  ? 88.225  114.018 155.383 1.00 67.65  ? 52  CYS A O   1 
ATOM   90    C  CB  . CYS A 1 51  ? 90.117  115.823 157.117 1.00 68.40  ? 52  CYS A CB  1 
ATOM   91    S  SG  . CYS A 1 51  ? 90.959  117.028 156.096 1.00 68.29  ? 52  CYS A SG  1 
ATOM   92    N  N   . THR A 1 52  ? 87.995  116.113 154.632 1.00 77.76  ? 53  THR A N   1 
ATOM   93    C  CA  . THR A 1 52  ? 87.604  115.716 153.289 1.00 77.09  ? 53  THR A CA  1 
ATOM   94    C  C   . THR A 1 52  ? 88.694  115.972 152.271 1.00 76.34  ? 53  THR A C   1 
ATOM   95    O  O   . THR A 1 52  ? 88.427  116.055 151.085 1.00 76.30  ? 53  THR A O   1 
ATOM   96    C  CB  . THR A 1 52  ? 86.319  116.398 152.835 1.00 77.16  ? 53  THR A CB  1 
ATOM   97    O  OG1 . THR A 1 52  ? 86.501  117.812 152.833 1.00 77.17  ? 53  THR A OG1 1 
ATOM   98    C  CG2 . THR A 1 52  ? 85.201  116.056 153.759 1.00 77.22  ? 53  THR A CG2 1 
ATOM   99    N  N   . TRP A 1 53  ? 89.920  116.113 152.747 1.00 62.87  ? 54  TRP A N   1 
ATOM   100   C  CA  . TRP A 1 53  ? 91.067  116.189 151.869 1.00 62.11  ? 54  TRP A CA  1 
ATOM   101   C  C   . TRP A 1 53  ? 91.224  114.885 151.145 1.00 63.86  ? 54  TRP A C   1 
ATOM   102   O  O   . TRP A 1 53  ? 90.967  113.832 151.696 1.00 63.97  ? 54  TRP A O   1 
ATOM   103   C  CB  . TRP A 1 53  ? 92.341  116.446 152.666 1.00 60.29  ? 54  TRP A CB  1 
ATOM   104   C  CG  . TRP A 1 53  ? 93.596  116.467 151.830 1.00 58.43  ? 54  TRP A CG  1 
ATOM   105   C  CD1 . TRP A 1 53  ? 94.174  117.551 151.271 1.00 57.75  ? 54  TRP A CD1 1 
ATOM   106   C  CD2 . TRP A 1 53  ? 94.414  115.355 151.478 1.00 57.25  ? 54  TRP A CD2 1 
ATOM   107   N  NE1 . TRP A 1 53  ? 95.296  117.193 150.588 1.00 57.16  ? 54  TRP A NE1 1 
ATOM   108   C  CE2 . TRP A 1 53  ? 95.465  115.844 150.700 1.00 56.87  ? 54  TRP A CE2 1 
ATOM   109   C  CE3 . TRP A 1 53  ? 94.362  113.995 151.748 1.00 56.71  ? 54  TRP A CE3 1 
ATOM   110   C  CZ2 . TRP A 1 53  ? 96.445  115.029 150.189 1.00 56.43  ? 54  TRP A CZ2 1 
ATOM   111   C  CZ3 . TRP A 1 53  ? 95.329  113.192 151.237 1.00 56.34  ? 54  TRP A CZ3 1 
ATOM   112   C  CH2 . TRP A 1 53  ? 96.360  113.707 150.468 1.00 56.26  ? 54  TRP A CH2 1 
ATOM   113   N  N   . GLN A 1 54  ? 91.641  114.961 149.896 1.00 90.18  ? 55  GLN A N   1 
ATOM   114   C  CA  . GLN A 1 54  ? 92.086  113.790 149.172 1.00 91.96  ? 55  GLN A CA  1 
ATOM   115   C  C   . GLN A 1 54  ? 93.066  114.257 148.125 1.00 92.60  ? 55  GLN A C   1 
ATOM   116   O  O   . GLN A 1 54  ? 92.993  115.389 147.679 1.00 92.71  ? 55  GLN A O   1 
ATOM   117   C  CB  . GLN A 1 54  ? 90.914  113.015 148.568 1.00 92.92  ? 55  GLN A CB  1 
ATOM   118   C  CG  . GLN A 1 54  ? 89.838  113.862 147.932 1.00 93.61  ? 55  GLN A CG  1 
ATOM   119   C  CD  . GLN A 1 54  ? 88.598  113.063 147.577 1.00 94.21  ? 55  GLN A CD  1 
ATOM   120   O  OE1 . GLN A 1 54  ? 88.611  111.835 147.591 1.00 94.29  ? 55  GLN A OE1 1 
ATOM   121   N  NE2 . GLN A 1 54  ? 87.516  113.762 147.256 1.00 94.55  ? 55  GLN A NE2 1 
ATOM   122   N  N   . LEU A 1 55  ? 94.007  113.399 147.761 1.00 66.84  ? 56  LEU A N   1 
ATOM   123   C  CA  . LEU A 1 55  ? 95.078  113.823 146.891 1.00 67.39  ? 56  LEU A CA  1 
ATOM   124   C  C   . LEU A 1 55  ? 94.492  114.278 145.582 1.00 68.46  ? 56  LEU A C   1 
ATOM   125   O  O   . LEU A 1 55  ? 93.761  113.552 144.934 1.00 68.54  ? 56  LEU A O   1 
ATOM   126   C  CB  . LEU A 1 55  ? 96.064  112.680 146.673 1.00 66.97  ? 56  LEU A CB  1 
ATOM   127   C  CG  . LEU A 1 55  ? 97.290  112.938 145.805 1.00 66.60  ? 56  LEU A CG  1 
ATOM   128   C  CD1 . LEU A 1 55  ? 97.993  114.176 146.261 1.00 66.48  ? 56  LEU A CD1 1 
ATOM   129   C  CD2 . LEU A 1 55  ? 98.223  111.759 145.865 1.00 66.48  ? 56  LEU A CD2 1 
ATOM   130   N  N   . GLY A 1 56  ? 94.848  115.484 145.179 1.00 71.50  ? 57  GLY A N   1 
ATOM   131   C  CA  . GLY A 1 56  ? 94.326  116.055 143.961 1.00 72.66  ? 57  GLY A CA  1 
ATOM   132   C  C   . GLY A 1 56  ? 93.466  117.279 144.150 1.00 73.88  ? 57  GLY A C   1 
ATOM   133   O  O   . GLY A 1 56  ? 93.322  118.073 143.234 1.00 73.97  ? 57  GLY A O   1 
ATOM   134   N  N   . ARG A 1 57  ? 92.907  117.452 145.338 1.00 82.08  ? 58  ARG A N   1 
ATOM   135   C  CA  . ARG A 1 57  ? 92.100  118.629 145.607 1.00 83.30  ? 58  ARG A CA  1 
ATOM   136   C  C   . ARG A 1 57  ? 92.975  119.854 145.564 1.00 84.20  ? 58  ARG A C   1 
ATOM   137   O  O   . ARG A 1 57  ? 94.072  119.852 146.100 1.00 84.24  ? 58  ARG A O   1 
ATOM   138   C  CB  . ARG A 1 57  ? 91.444  118.543 146.976 1.00 83.52  ? 58  ARG A CB  1 
ATOM   139   C  CG  . ARG A 1 57  ? 90.464  117.418 147.140 1.00 83.68  ? 58  ARG A CG  1 
ATOM   140   C  CD  . ARG A 1 57  ? 89.116  117.770 146.584 1.00 83.83  ? 58  ARG A CD  1 
ATOM   141   N  NE  . ARG A 1 57  ? 88.409  118.753 147.390 1.00 83.95  ? 58  ARG A NE  1 
ATOM   142   C  CZ  . ARG A 1 57  ? 87.583  118.447 148.378 1.00 84.04  ? 58  ARG A CZ  1 
ATOM   143   N  NH1 . ARG A 1 57  ? 86.978  119.398 149.053 1.00 84.07  1 58  ARG A NH1 1 
ATOM   144   N  NH2 . ARG A 1 57  ? 87.365  117.189 148.691 1.00 84.06  ? 58  ARG A NH2 1 
ATOM   145   N  N   . PRO A 1 58  ? 92.492  120.909 144.912 1.00 90.29  ? 59  PRO A N   1 
ATOM   146   C  CA  . PRO A 1 58  ? 93.205  122.180 144.862 1.00 90.79  ? 59  PRO A CA  1 
ATOM   147   C  C   . PRO A 1 58  ? 93.327  122.759 146.250 1.00 91.14  ? 59  PRO A C   1 
ATOM   148   O  O   . PRO A 1 58  ? 92.434  122.585 147.062 1.00 91.05  ? 59  PRO A O   1 
ATOM   149   C  CB  . PRO A 1 58  ? 92.276  123.057 144.031 1.00 90.86  ? 59  PRO A CB  1 
ATOM   150   C  CG  . PRO A 1 58  ? 91.481  122.115 143.244 1.00 90.80  ? 59  PRO A CG  1 
ATOM   151   C  CD  . PRO A 1 58  ? 91.264  120.940 144.113 1.00 90.60  ? 59  PRO A CD  1 
ATOM   152   N  N   . ALA A 1 59  ? 94.424  123.446 146.515 1.00 85.98  ? 60  ALA A N   1 
ATOM   153   C  CA  . ALA A 1 59  ? 94.638  124.037 147.819 1.00 86.26  ? 60  ALA A CA  1 
ATOM   154   C  C   . ALA A 1 59  ? 93.579  125.076 148.113 1.00 86.36  ? 60  ALA A C   1 
ATOM   155   O  O   . ALA A 1 59  ? 93.258  125.340 149.260 1.00 86.36  ? 60  ALA A O   1 
ATOM   156   C  CB  . ALA A 1 59  ? 96.005  124.653 147.884 1.00 86.32  ? 60  ALA A CB  1 
ATOM   157   N  N   . SER A 1 60  ? 93.038  125.666 147.061 1.00 103.70 ? 61  SER A N   1 
ATOM   158   C  CA  . SER A 1 60  ? 92.033  126.703 147.203 1.00 103.65 ? 61  SER A CA  1 
ATOM   159   C  C   . SER A 1 60  ? 90.771  126.184 147.866 1.00 103.14 ? 61  SER A C   1 
ATOM   160   O  O   . SER A 1 60  ? 90.052  126.935 148.513 1.00 103.14 ? 61  SER A O   1 
ATOM   161   C  CB  . SER A 1 60  ? 91.694  127.302 145.842 1.00 103.87 ? 61  SER A CB  1 
ATOM   162   O  OG  . SER A 1 60  ? 91.316  126.296 144.923 1.00 103.94 ? 61  SER A OG  1 
ATOM   163   N  N   . GLU A 1 61  ? 90.508  124.895 147.707 1.00 96.80  ? 62  GLU A N   1 
ATOM   164   C  CA  . GLU A 1 61  ? 89.310  124.287 148.266 1.00 96.09  ? 62  GLU A CA  1 
ATOM   165   C  C   . GLU A 1 61  ? 89.409  124.057 149.770 1.00 94.68  ? 62  GLU A C   1 
ATOM   166   O  O   . GLU A 1 61  ? 88.416  123.771 150.420 1.00 94.59  ? 62  GLU A O   1 
ATOM   167   C  CB  . GLU A 1 61  ? 88.984  122.974 147.552 1.00 96.59  ? 62  GLU A CB  1 
ATOM   168   C  CG  . GLU A 1 61  ? 88.492  123.121 146.125 1.00 96.91  ? 62  GLU A CG  1 
ATOM   169   C  CD  . GLU A 1 61  ? 88.100  121.796 145.497 1.00 97.06  ? 62  GLU A CD  1 
ATOM   170   O  OE1 . GLU A 1 61  ? 87.858  120.831 146.242 1.00 97.10  ? 62  GLU A OE1 1 
ATOM   171   O  OE2 . GLU A 1 61  ? 88.036  121.715 144.257 1.00 97.13  1 62  GLU A OE2 1 
ATOM   172   N  N   . SER A 1 62  ? 90.607  124.176 150.319 1.00 95.31  ? 63  SER A N   1 
ATOM   173   C  CA  . SER A 1 62  ? 90.811  123.965 151.745 1.00 93.85  ? 63  SER A CA  1 
ATOM   174   C  C   . SER A 1 62  ? 90.168  125.055 152.586 1.00 92.53  ? 63  SER A C   1 
ATOM   175   O  O   . SER A 1 62  ? 90.307  126.229 152.288 1.00 92.41  ? 63  SER A O   1 
ATOM   176   C  CB  . SER A 1 62  ? 92.299  123.905 152.053 1.00 93.82  ? 63  SER A CB  1 
ATOM   177   O  OG  . SER A 1 62  ? 92.525  123.643 153.420 1.00 93.81  ? 63  SER A OG  1 
ATOM   178   N  N   . PRO A 1 63  ? 89.463  124.664 153.646 1.00 65.59  ? 64  PRO A N   1 
ATOM   179   C  CA  . PRO A 1 63  ? 88.782  125.557 154.568 1.00 65.29  ? 64  PRO A CA  1 
ATOM   180   C  C   . PRO A 1 63  ? 89.694  126.057 155.663 1.00 65.85  ? 64  PRO A C   1 
ATOM   181   O  O   . PRO A 1 63  ? 89.351  127.005 156.349 1.00 65.84  ? 64  PRO A O   1 
ATOM   182   C  CB  . PRO A 1 63  ? 87.740  124.644 155.183 1.00 64.78  ? 64  PRO A CB  1 
ATOM   183   C  CG  . PRO A 1 63  ? 88.401  123.360 155.235 1.00 64.63  ? 64  PRO A CG  1 
ATOM   184   C  CD  . PRO A 1 63  ? 89.235  123.264 154.009 1.00 64.87  ? 64  PRO A CD  1 
ATOM   185   N  N   . HIS A 1 64  ? 90.831  125.404 155.839 1.00 66.26  ? 65  HIS A N   1 
ATOM   186   C  CA  . HIS A 1 64  ? 91.741  125.724 156.920 1.00 67.29  ? 65  HIS A CA  1 
ATOM   187   C  C   . HIS A 1 64  ? 92.508  127.006 156.649 1.00 70.88  ? 65  HIS A C   1 
ATOM   188   O  O   . HIS A 1 64  ? 92.786  127.342 155.510 1.00 71.05  ? 65  HIS A O   1 
ATOM   189   C  CB  . HIS A 1 64  ? 92.713  124.572 157.153 1.00 65.56  ? 65  HIS A CB  1 
ATOM   190   C  CG  . HIS A 1 64  ? 92.054  123.233 157.292 1.00 63.94  ? 65  HIS A CG  1 
ATOM   191   N  ND1 . HIS A 1 64  ? 91.286  122.895 158.377 1.00 63.24  ? 65  HIS A ND1 1 
ATOM   192   C  CD2 . HIS A 1 64  ? 92.067  122.149 156.487 1.00 63.05  ? 65  HIS A CD2 1 
ATOM   193   C  CE1 . HIS A 1 64  ? 90.844  121.657 158.235 1.00 62.72  ? 65  HIS A CE1 1 
ATOM   194   N  NE2 . HIS A 1 64  ? 91.301  121.184 157.091 1.00 62.59  ? 65  HIS A NE2 1 
ATOM   195   N  N   . HIS A 1 65  ? 92.844  127.724 157.709 1.00 119.31 ? 66  HIS A N   1 
ATOM   196   C  CA  . HIS A 1 65  ? 93.700  128.892 157.593 1.00 123.47 ? 66  HIS A CA  1 
ATOM   197   C  C   . HIS A 1 65  ? 95.149  128.457 157.570 1.00 125.59 ? 66  HIS A C   1 
ATOM   198   O  O   . HIS A 1 65  ? 95.622  127.815 158.494 1.00 125.80 ? 66  HIS A O   1 
ATOM   199   C  CB  . HIS A 1 65  ? 93.487  129.830 158.773 1.00 125.09 ? 66  HIS A CB  1 
ATOM   200   C  CG  . HIS A 1 65  ? 94.375  131.031 158.748 1.00 126.64 ? 66  HIS A CG  1 
ATOM   201   N  ND1 . HIS A 1 65  ? 95.665  131.015 159.230 1.00 127.36 ? 66  HIS A ND1 1 
ATOM   202   C  CD2 . HIS A 1 65  ? 94.161  132.286 158.289 1.00 127.35 ? 66  HIS A CD2 1 
ATOM   203   C  CE1 . HIS A 1 65  ? 96.208  132.207 159.067 1.00 127.82 ? 66  HIS A CE1 1 
ATOM   204   N  NE2 . HIS A 1 65  ? 95.314  132.999 158.504 1.00 127.73 ? 66  HIS A NE2 1 
ATOM   205   N  N   . HIS A 1 66  ? 95.859  128.813 156.514 1.00 88.89  ? 67  HIS A N   1 
ATOM   206   C  CA  . HIS A 1 66  ? 97.250  128.420 156.385 1.00 91.08  ? 67  HIS A CA  1 
ATOM   207   C  C   . HIS A 1 66  ? 98.206  129.556 156.711 1.00 94.28  ? 67  HIS A C   1 
ATOM   208   O  O   . HIS A 1 66  ? 97.907  130.714 156.458 1.00 94.48  ? 67  HIS A O   1 
ATOM   209   C  CB  . HIS A 1 66  ? 97.514  127.870 154.988 1.00 90.39  ? 67  HIS A CB  1 
ATOM   210   C  CG  . HIS A 1 66  ? 96.786  126.599 154.699 1.00 89.64  ? 67  HIS A CG  1 
ATOM   211   N  ND1 . HIS A 1 66  ? 97.319  125.362 154.971 1.00 89.32  ? 67  HIS A ND1 1 
ATOM   212   C  CD2 . HIS A 1 66  ? 95.564  126.375 154.167 1.00 89.32  ? 67  HIS A CD2 1 
ATOM   213   C  CE1 . HIS A 1 66  ? 96.456  124.428 154.617 1.00 89.14  ? 67  HIS A CE1 1 
ATOM   214   N  NE2 . HIS A 1 66  ? 95.385  125.016 154.124 1.00 89.15  ? 67  HIS A NE2 1 
ATOM   215   N  N   . THR A 1 67  ? 99.358  129.209 157.275 1.00 123.96 ? 68  THR A N   1 
ATOM   216   C  CA  . THR A 1 67  ? 100.365 130.194 157.650 1.00 127.14 ? 68  THR A CA  1 
ATOM   217   C  C   . THR A 1 67  ? 101.648 130.023 156.855 1.00 129.94 ? 68  THR A C   1 
ATOM   218   O  O   . THR A 1 67  ? 102.208 128.940 156.803 1.00 129.90 ? 68  THR A O   1 
ATOM   219   C  CB  . THR A 1 67  ? 100.702 130.116 159.148 1.00 127.45 ? 68  THR A CB  1 
ATOM   220   O  OG1 . THR A 1 67  ? 101.155 128.798 159.467 1.00 127.52 ? 68  THR A OG1 1 
ATOM   221   C  CG2 . THR A 1 67  ? 99.486  130.439 159.995 1.00 127.45 ? 68  THR A CG2 1 
ATOM   222   N  N   . ALA A 1 68  ? 102.101 131.099 156.225 1.00 132.67 ? 69  ALA A N   1 
ATOM   223   C  CA  . ALA A 1 68  ? 103.359 131.090 155.491 1.00 135.40 ? 69  ALA A CA  1 
ATOM   224   C  C   . ALA A 1 68  ? 104.554 131.187 156.422 1.00 137.40 ? 69  ALA A C   1 
ATOM   225   O  O   . ALA A 1 68  ? 104.522 131.940 157.388 1.00 137.60 ? 69  ALA A O   1 
ATOM   226   C  CB  . ALA A 1 68  ? 103.384 132.232 154.494 1.00 135.75 ? 69  ALA A CB  1 
ATOM   227   N  N   . PRO A 1 69  ? 105.620 130.425 156.132 1.00 124.02 ? 70  PRO A N   1 
ATOM   228   C  CA  . PRO A 1 69  ? 106.874 130.628 156.858 1.00 124.97 ? 70  PRO A CA  1 
ATOM   229   C  C   . PRO A 1 69  ? 107.398 132.034 156.624 1.00 125.46 ? 70  PRO A C   1 
ATOM   230   O  O   . PRO A 1 69  ? 107.284 132.547 155.519 1.00 125.57 ? 70  PRO A O   1 
ATOM   231   C  CB  . PRO A 1 69  ? 107.816 129.619 156.203 1.00 125.11 ? 70  PRO A CB  1 
ATOM   232   C  CG  . PRO A 1 69  ? 106.932 128.566 155.677 1.00 124.97 ? 70  PRO A CG  1 
ATOM   233   C  CD  . PRO A 1 69  ? 105.681 129.261 155.239 1.00 124.62 ? 70  PRO A CD  1 
ATOM   234   N  N   . ALA A 1 70  ? 107.986 132.641 157.647 1.00 152.23 ? 71  ALA A N   1 
ATOM   235   C  CA  . ALA A 1 70  ? 108.493 134.004 157.539 1.00 152.22 ? 71  ALA A CA  1 
ATOM   236   C  C   . ALA A 1 70  ? 109.978 134.053 157.854 1.00 151.24 ? 71  ALA A C   1 
ATOM   237   O  O   . ALA A 1 70  ? 110.489 133.228 158.608 1.00 151.25 ? 71  ALA A O   1 
ATOM   238   C  CB  . ALA A 1 70  ? 107.732 134.926 158.472 1.00 152.66 ? 71  ALA A CB  1 
ATOM   239   N  N   . LYS A 1 71  ? 110.671 135.018 157.266 1.00 129.49 ? 72  LYS A N   1 
ATOM   240   C  CA  . LYS A 1 71  ? 112.077 135.208 157.570 1.00 127.99 ? 72  LYS A CA  1 
ATOM   241   C  C   . LYS A 1 71  ? 112.248 135.650 159.013 1.00 124.27 ? 72  LYS A C   1 
ATOM   242   O  O   . LYS A 1 71  ? 111.506 136.492 159.504 1.00 124.05 ? 72  LYS A O   1 
ATOM   243   C  CB  . LYS A 1 71  ? 112.703 136.225 156.618 1.00 129.73 ? 72  LYS A CB  1 
ATOM   244   C  CG  . LYS A 1 71  ? 112.706 135.784 155.169 1.00 131.13 ? 72  LYS A CG  1 
ATOM   245   C  CD  . LYS A 1 71  ? 113.232 136.876 154.254 1.00 132.22 ? 72  LYS A CD  1 
ATOM   246   C  CE  . LYS A 1 71  ? 113.035 136.521 152.781 1.00 132.94 ? 72  LYS A CE  1 
ATOM   247   N  NZ  . LYS A 1 71  ? 113.520 137.597 151.860 1.00 133.29 1 72  LYS A NZ  1 
ATOM   248   N  N   . SER A 1 72  ? 113.233 135.070 159.685 1.00 140.81 ? 73  SER A N   1 
ATOM   249   C  CA  . SER A 1 72  ? 113.565 135.470 161.038 1.00 137.06 ? 73  SER A CA  1 
ATOM   250   C  C   . SER A 1 72  ? 114.262 136.826 161.023 1.00 132.71 ? 73  SER A C   1 
ATOM   251   O  O   . SER A 1 72  ? 115.221 137.022 160.287 1.00 132.45 ? 73  SER A O   1 
ATOM   252   C  CB  . SER A 1 72  ? 114.456 134.415 161.701 1.00 137.48 ? 73  SER A CB  1 
ATOM   253   O  OG  . SER A 1 72  ? 113.805 133.156 161.778 1.00 137.76 ? 73  SER A OG  1 
ATOM   254   N  N   . PRO A 1 73  ? 113.777 137.764 161.839 1.00 91.89  ? 74  PRO A N   1 
ATOM   255   C  CA  . PRO A 1 73  ? 114.343 139.096 162.051 1.00 88.86  ? 74  PRO A CA  1 
ATOM   256   C  C   . PRO A 1 73  ? 115.671 139.043 162.786 1.00 85.45  ? 74  PRO A C   1 
ATOM   257   O  O   . PRO A 1 73  ? 115.981 138.031 163.397 1.00 85.22  ? 74  PRO A O   1 
ATOM   258   C  CB  . PRO A 1 73  ? 113.292 139.781 162.912 1.00 89.40  ? 74  PRO A CB  1 
ATOM   259   C  CG  . PRO A 1 73  ? 112.627 138.694 163.606 1.00 90.13  ? 74  PRO A CG  1 
ATOM   260   C  CD  . PRO A 1 73  ? 112.564 137.569 162.640 1.00 91.01  ? 74  PRO A CD  1 
ATOM   261   N  N   . LYS A 1 74  ? 116.459 140.106 162.686 1.00 87.68  ? 75  LYS A N   1 
ATOM   262   C  CA  . LYS A 1 74  ? 117.778 140.140 163.299 1.00 84.77  ? 75  LYS A CA  1 
ATOM   263   C  C   . LYS A 1 74  ? 117.719 139.916 164.800 1.00 82.25  ? 75  LYS A C   1 
ATOM   264   O  O   . LYS A 1 74  ? 118.507 139.159 165.346 1.00 82.03  ? 75  LYS A O   1 
ATOM   265   C  CB  . LYS A 1 74  ? 118.459 141.476 163.017 1.00 84.56  ? 75  LYS A CB  1 
ATOM   266   C  CG  . LYS A 1 74  ? 118.873 141.695 161.583 1.00 84.50  ? 75  LYS A CG  1 
ATOM   267   C  CD  . LYS A 1 74  ? 119.855 142.843 161.494 1.00 84.38  ? 75  LYS A CD  1 
ATOM   268   C  CE  . LYS A 1 74  ? 120.408 143.024 160.099 1.00 84.34  ? 75  LYS A CE  1 
ATOM   269   N  NZ  . LYS A 1 74  ? 119.548 143.888 159.257 1.00 84.31  1 75  LYS A NZ  1 
ATOM   270   N  N   . ILE A 1 75  ? 116.766 140.554 165.459 1.00 81.15  ? 76  ILE A N   1 
ATOM   271   C  CA  . ILE A 1 75  ? 116.563 140.336 166.876 1.00 78.89  ? 76  ILE A CA  1 
ATOM   272   C  C   . ILE A 1 75  ? 115.206 139.719 167.117 1.00 77.47  ? 76  ILE A C   1 
ATOM   273   O  O   . ILE A 1 75  ? 114.209 140.215 166.633 1.00 77.34  ? 76  ILE A O   1 
ATOM   274   C  CB  . ILE A 1 75  ? 116.649 141.632 167.659 1.00 78.30  ? 76  ILE A CB  1 
ATOM   275   C  CG1 . ILE A 1 75  ? 118.031 142.244 167.513 1.00 78.01  ? 76  ILE A CG1 1 
ATOM   276   C  CG2 . ILE A 1 75  ? 116.377 141.377 169.106 1.00 78.15  ? 76  ILE A CG2 1 
ATOM   277   C  CD1 . ILE A 1 75  ? 118.149 143.597 168.126 1.00 77.86  ? 76  ILE A CD1 1 
ATOM   278   N  N   . LEU A 1 76  ? 115.177 138.634 167.871 1.00 72.87  ? 77  LEU A N   1 
ATOM   279   C  CA  . LEU A 1 76  ? 113.945 137.918 168.136 1.00 71.80  ? 77  LEU A CA  1 
ATOM   280   C  C   . LEU A 1 76  ? 113.233 138.510 169.329 1.00 71.74  ? 77  LEU A C   1 
ATOM   281   O  O   . LEU A 1 76  ? 113.822 138.662 170.380 1.00 71.73  ? 77  LEU A O   1 
ATOM   282   C  CB  . LEU A 1 76  ? 114.234 136.443 168.381 1.00 71.00  ? 77  LEU A CB  1 
ATOM   283   C  CG  . LEU A 1 76  ? 114.384 135.504 167.188 1.00 70.38  ? 77  LEU A CG  1 
ATOM   284   C  CD1 . LEU A 1 76  ? 115.401 135.997 166.207 1.00 70.16  ? 77  LEU A CD1 1 
ATOM   285   C  CD2 . LEU A 1 76  ? 114.774 134.134 167.659 1.00 70.14  ? 77  LEU A CD2 1 
ATOM   286   N  N   . PRO A 1 77  ? 111.967 138.890 169.150 1.00 81.90  ? 78  PRO A N   1 
ATOM   287   C  CA  . PRO A 1 77  ? 111.107 139.416 170.209 1.00 81.91  ? 78  PRO A CA  1 
ATOM   288   C  C   . PRO A 1 77  ? 110.929 138.466 171.373 1.00 81.91  ? 78  PRO A C   1 
ATOM   289   O  O   . PRO A 1 77  ? 110.815 138.905 172.502 1.00 81.96  ? 78  PRO A O   1 
ATOM   290   C  CB  . PRO A 1 77  ? 109.779 139.638 169.500 1.00 81.91  ? 78  PRO A CB  1 
ATOM   291   C  CG  . PRO A 1 77  ? 109.834 138.803 168.311 1.00 81.91  ? 78  PRO A CG  1 
ATOM   292   C  CD  . PRO A 1 77  ? 111.244 138.773 167.881 1.00 81.90  ? 78  PRO A CD  1 
ATOM   293   N  N   . ASP A 1 78  ? 110.895 137.173 171.090 1.00 79.66  ? 79  ASP A N   1 
ATOM   294   C  CA  . ASP A 1 78  ? 110.906 136.163 172.133 1.00 79.54  ? 79  ASP A CA  1 
ATOM   295   C  C   . ASP A 1 78  ? 111.326 134.816 171.582 1.00 79.10  ? 79  ASP A C   1 
ATOM   296   O  O   . ASP A 1 78  ? 111.416 134.634 170.382 1.00 79.10  ? 79  ASP A O   1 
ATOM   297   C  CB  . ASP A 1 78  ? 109.583 136.093 172.903 1.00 79.74  ? 79  ASP A CB  1 
ATOM   298   C  CG  . ASP A 1 78  ? 108.406 135.735 172.034 1.00 79.85  ? 79  ASP A CG  1 
ATOM   299   O  OD1 . ASP A 1 78  ? 108.485 134.751 171.285 1.00 79.88  ? 79  ASP A OD1 1 
ATOM   300   O  OD2 . ASP A 1 78  ? 107.383 136.438 172.112 1.00 79.93  1 79  ASP A OD2 1 
ATOM   301   N  N   . ILE A 1 79  ? 111.588 133.877 172.475 1.00 75.30  ? 80  ILE A N   1 
ATOM   302   C  CA  . ILE A 1 79  ? 112.187 132.611 172.103 1.00 74.85  ? 80  ILE A CA  1 
ATOM   303   C  C   . ILE A 1 79  ? 111.294 131.769 171.204 1.00 74.54  ? 80  ILE A C   1 
ATOM   304   O  O   . ILE A 1 79  ? 111.770 130.895 170.499 1.00 74.51  ? 80  ILE A O   1 
ATOM   305   C  CB  . ILE A 1 79  ? 112.614 131.814 173.342 1.00 74.74  ? 80  ILE A CB  1 
ATOM   306   C  CG1 . ILE A 1 79  ? 113.656 130.766 172.981 1.00 74.65  ? 80  ILE A CG1 1 
ATOM   307   C  CG2 . ILE A 1 79  ? 111.439 131.164 173.981 1.00 74.74  ? 80  ILE A CG2 1 
ATOM   308   C  CD1 . ILE A 1 79  ? 114.919 131.336 172.437 1.00 74.61  ? 80  ILE A CD1 1 
ATOM   309   N  N   . LEU A 1 80  ? 110.001 132.043 171.210 1.00 70.10  ? 81  LEU A N   1 
ATOM   310   C  CA  . LEU A 1 80  ? 109.066 131.258 170.422 1.00 69.88  ? 81  LEU A CA  1 
ATOM   311   C  C   . LEU A 1 80  ? 109.323 131.415 168.939 1.00 70.84  ? 81  LEU A C   1 
ATOM   312   O  O   . LEU A 1 80  ? 108.921 130.586 168.139 1.00 70.89  ? 81  LEU A O   1 
ATOM   313   C  CB  . LEU A 1 80  ? 107.632 131.644 170.753 1.00 69.03  ? 81  LEU A CB  1 
ATOM   314   C  CG  . LEU A 1 80  ? 107.195 131.444 172.196 1.00 68.34  ? 81  LEU A CG  1 
ATOM   315   C  CD1 . LEU A 1 80  ? 105.782 131.900 172.383 1.00 68.07  ? 81  LEU A CD1 1 
ATOM   316   C  CD2 . LEU A 1 80  ? 107.334 130.005 172.586 1.00 68.15  ? 81  LEU A CD2 1 
ATOM   317   N  N   . LYS A 1 81  ? 109.995 132.494 168.571 1.00 88.16  ? 82  LYS A N   1 
ATOM   318   C  CA  . LYS A 1 81  ? 110.330 132.715 167.176 1.00 89.08  ? 82  LYS A CA  1 
ATOM   319   C  C   . LYS A 1 81  ? 111.477 131.823 166.743 1.00 88.71  ? 82  LYS A C   1 
ATOM   320   O  O   . LYS A 1 81  ? 111.745 131.680 165.562 1.00 88.71  ? 82  LYS A O   1 
ATOM   321   C  CB  . LYS A 1 81  ? 110.646 134.183 166.906 1.00 90.07  ? 82  LYS A CB  1 
ATOM   322   C  CG  . LYS A 1 81  ? 109.433 135.010 166.528 1.00 90.95  ? 82  LYS A CG  1 
ATOM   323   C  CD  . LYS A 1 81  ? 108.427 135.067 167.667 1.00 91.72  ? 82  LYS A CD  1 
ATOM   324   C  CE  . LYS A 1 81  ? 107.027 135.436 167.201 1.00 92.35  ? 82  LYS A CE  1 
ATOM   325   N  NZ  . LYS A 1 81  ? 106.019 135.225 168.280 1.00 92.66  1 82  LYS A NZ  1 
ATOM   326   N  N   . LYS A 1 82  ? 112.146 131.214 167.708 1.00 75.29  ? 83  LYS A N   1 
ATOM   327   C  CA  . LYS A 1 82  ? 113.213 130.278 167.408 1.00 74.91  ? 83  LYS A CA  1 
ATOM   328   C  C   . LYS A 1 82  ? 112.625 128.886 167.278 1.00 75.14  ? 83  LYS A C   1 
ATOM   329   O  O   . LYS A 1 82  ? 113.072 127.939 167.899 1.00 75.10  ? 83  LYS A O   1 
ATOM   330   C  CB  . LYS A 1 82  ? 114.296 130.343 168.483 1.00 74.46  ? 83  LYS A CB  1 
ATOM   331   C  CG  . LYS A 1 82  ? 115.552 129.543 168.207 1.00 74.05  ? 83  LYS A CG  1 
ATOM   332   C  CD  . LYS A 1 82  ? 116.150 129.847 166.869 1.00 73.76  ? 83  LYS A CD  1 
ATOM   333   C  CE  . LYS A 1 82  ? 117.331 128.943 166.591 1.00 73.53  ? 83  LYS A CE  1 
ATOM   334   N  NZ  . LYS A 1 82  ? 116.942 127.514 166.538 1.00 73.43  1 83  LYS A NZ  1 
ATOM   335   N  N   . ILE A 1 83  ? 111.596 128.778 166.454 1.00 77.22  ? 84  ILE A N   1 
ATOM   336   C  CA  . ILE A 1 83  ? 110.981 127.497 166.165 1.00 77.45  ? 84  ILE A CA  1 
ATOM   337   C  C   . ILE A 1 83  ? 110.808 127.369 164.666 1.00 77.53  ? 84  ILE A C   1 
ATOM   338   O  O   . ILE A 1 83  ? 110.312 128.275 164.017 1.00 77.55  ? 84  ILE A O   1 
ATOM   339   C  CB  . ILE A 1 83  ? 109.629 127.370 166.854 1.00 77.56  ? 84  ILE A CB  1 
ATOM   340   C  CG1 . ILE A 1 83  ? 109.815 127.337 168.364 1.00 77.61  ? 84  ILE A CG1 1 
ATOM   341   C  CG2 . ILE A 1 83  ? 108.936 126.123 166.415 1.00 77.59  ? 84  ILE A CG2 1 
ATOM   342   C  CD1 . ILE A 1 83  ? 108.539 127.451 169.130 1.00 77.63  ? 84  ILE A CD1 1 
ATOM   343   N  N   . GLY A 1 84  ? 111.209 126.229 164.122 1.00 78.51  ? 85  GLY A N   1 
ATOM   344   C  CA  . GLY A 1 84  ? 111.253 126.045 162.688 1.00 78.49  ? 85  GLY A CA  1 
ATOM   345   C  C   . GLY A 1 84  ? 112.594 126.438 162.125 1.00 78.38  ? 85  GLY A C   1 
ATOM   346   O  O   . GLY A 1 84  ? 113.474 126.837 162.866 1.00 78.40  ? 85  GLY A O   1 
ATOM   347   N  N   . ASP A 1 85  ? 112.739 126.321 160.811 1.00 86.67  ? 86  ASP A N   1 
ATOM   348   C  CA  . ASP A 1 85  ? 114.013 126.521 160.123 1.00 86.43  ? 86  ASP A CA  1 
ATOM   349   C  C   . ASP A 1 85  ? 115.102 125.638 160.689 1.00 85.76  ? 86  ASP A C   1 
ATOM   350   O  O   . ASP A 1 85  ? 116.228 126.068 160.866 1.00 85.72  ? 86  ASP A O   1 
ATOM   351   C  CB  . ASP A 1 85  ? 114.458 127.980 160.170 1.00 86.68  ? 86  ASP A CB  1 
ATOM   352   C  CG  . ASP A 1 85  ? 113.478 128.911 159.504 1.00 86.83  ? 86  ASP A CG  1 
ATOM   353   O  OD1 . ASP A 1 85  ? 113.453 130.107 159.863 1.00 86.89  ? 86  ASP A OD1 1 
ATOM   354   O  OD2 . ASP A 1 85  ? 112.729 128.450 158.626 1.00 86.87  1 86  ASP A OD2 1 
ATOM   355   N  N   . THR A 1 86  ? 114.749 124.401 160.987 1.00 69.98  ? 87  THR A N   1 
ATOM   356   C  CA  . THR A 1 86  ? 115.685 123.455 161.554 1.00 69.32  ? 87  THR A CA  1 
ATOM   357   C  C   . THR A 1 86  ? 116.634 122.916 160.494 1.00 69.00  ? 87  THR A C   1 
ATOM   358   O  O   . THR A 1 86  ? 116.240 122.722 159.356 1.00 68.97  ? 87  THR A O   1 
ATOM   359   C  CB  . THR A 1 86  ? 114.944 122.321 162.237 1.00 69.08  ? 87  THR A CB  1 
ATOM   360   O  OG1 . THR A 1 86  ? 114.105 121.669 161.289 1.00 69.00  ? 87  THR A OG1 1 
ATOM   361   C  CG2 . THR A 1 86  ? 114.082 122.862 163.328 1.00 68.97  ? 87  THR A CG2 1 
ATOM   362   N  N   . PRO A 1 87  ? 117.902 122.693 160.865 1.00 77.06  ? 88  PRO A N   1 
ATOM   363   C  CA  . PRO A 1 87  ? 118.927 122.227 159.935 1.00 77.01  ? 88  PRO A CA  1 
ATOM   364   C  C   . PRO A 1 87  ? 118.695 120.851 159.335 1.00 77.18  ? 88  PRO A C   1 
ATOM   365   O  O   . PRO A 1 87  ? 118.177 119.967 159.985 1.00 77.18  ? 88  PRO A O   1 
ATOM   366   C  CB  . PRO A 1 87  ? 120.193 122.220 160.797 1.00 76.89  ? 88  PRO A CB  1 
ATOM   367   C  CG  . PRO A 1 87  ? 119.725 122.148 162.153 1.00 76.85  ? 88  PRO A CG  1 
ATOM   368   C  CD  . PRO A 1 87  ? 118.467 122.926 162.198 1.00 76.90  ? 88  PRO A CD  1 
ATOM   369   N  N   . MET A 1 88  ? 119.105 120.698 158.082 1.00 79.24  ? 89  MET A N   1 
ATOM   370   C  CA  . MET A 1 88  ? 119.123 119.417 157.402 1.00 79.47  ? 89  MET A CA  1 
ATOM   371   C  C   . MET A 1 88  ? 120.566 118.979 157.242 1.00 79.45  ? 89  MET A C   1 
ATOM   372   O  O   . MET A 1 88  ? 121.287 119.518 156.423 1.00 79.44  ? 89  MET A O   1 
ATOM   373   C  CB  . MET A 1 88  ? 118.471 119.549 156.036 1.00 79.69  ? 89  MET A CB  1 
ATOM   374   C  CG  . MET A 1 88  ? 118.483 118.288 155.213 1.00 79.86  ? 89  MET A CG  1 
ATOM   375   S  SD  . MET A 1 88  ? 117.149 117.148 155.569 1.00 80.01  ? 89  MET A SD  1 
ATOM   376   C  CE  . MET A 1 88  ? 115.794 117.983 154.781 1.00 80.12  ? 89  MET A CE  1 
ATOM   377   N  N   . VAL A 1 89  ? 120.988 118.009 158.040 1.00 67.89  ? 90  VAL A N   1 
ATOM   378   C  CA  . VAL A 1 89  ? 122.377 117.583 158.069 1.00 67.96  ? 90  VAL A CA  1 
ATOM   379   C  C   . VAL A 1 89  ? 122.569 116.221 157.433 1.00 68.65  ? 90  VAL A C   1 
ATOM   380   O  O   . VAL A 1 89  ? 121.751 115.347 157.591 1.00 68.66  ? 90  VAL A O   1 
ATOM   381   C  CB  . VAL A 1 89  ? 122.886 117.523 159.504 1.00 67.47  ? 90  VAL A CB  1 
ATOM   382   C  CG1 . VAL A 1 89  ? 124.368 117.343 159.525 1.00 67.33  ? 90  VAL A CG1 1 
ATOM   383   C  CG2 . VAL A 1 89  ? 122.521 118.777 160.233 1.00 67.31  ? 90  VAL A CG2 1 
ATOM   384   N  N   . ARG A 1 90  ? 123.666 116.042 156.717 1.00 73.59  ? 91  ARG A N   1 
ATOM   385   C  CA  . ARG A 1 90  ? 123.952 114.781 156.050 1.00 74.42  ? 91  ARG A CA  1 
ATOM   386   C  C   . ARG A 1 90  ? 124.576 113.744 156.969 1.00 74.26  ? 91  ARG A C   1 
ATOM   387   O  O   . ARG A 1 90  ? 125.479 114.051 157.728 1.00 74.26  ? 91  ARG A O   1 
ATOM   388   C  CB  . ARG A 1 90  ? 124.881 115.047 154.875 1.00 75.26  ? 91  ARG A CB  1 
ATOM   389   C  CG  . ARG A 1 90  ? 125.428 113.831 154.188 1.00 75.96  ? 91  ARG A CG  1 
ATOM   390   C  CD  . ARG A 1 90  ? 126.354 114.248 153.072 1.00 76.54  ? 91  ARG A CD  1 
ATOM   391   N  NE  . ARG A 1 90  ? 125.689 115.158 152.156 1.00 77.01  ? 91  ARG A NE  1 
ATOM   392   C  CZ  . ARG A 1 90  ? 126.285 116.169 151.544 1.00 77.50  ? 91  ARG A CZ  1 
ATOM   393   N  NH1 . ARG A 1 90  ? 127.565 116.401 151.752 1.00 77.64  1 91  ARG A NH1 1 
ATOM   394   N  NH2 . ARG A 1 90  ? 125.598 116.946 150.728 1.00 77.66  ? 91  ARG A NH2 1 
ATOM   395   N  N   . ILE A 1 91  ? 124.099 112.508 156.883 1.00 74.99  ? 92  ILE A N   1 
ATOM   396   C  CA  . ILE A 1 91  ? 124.685 111.405 157.629 1.00 74.75  ? 92  ILE A CA  1 
ATOM   397   C  C   . ILE A 1 91  ? 125.863 110.837 156.871 1.00 74.23  ? 92  ILE A C   1 
ATOM   398   O  O   . ILE A 1 91  ? 125.713 110.366 155.758 1.00 74.22  ? 92  ILE A O   1 
ATOM   399   C  CB  . ILE A 1 91  ? 123.685 110.280 157.835 1.00 74.95  ? 92  ILE A CB  1 
ATOM   400   C  CG1 . ILE A 1 91  ? 122.447 110.793 158.548 1.00 75.07  ? 92  ILE A CG1 1 
ATOM   401   C  CG2 . ILE A 1 91  ? 124.302 109.178 158.642 1.00 74.99  ? 92  ILE A CG2 1 
ATOM   402   C  CD1 . ILE A 1 91  ? 122.730 111.302 159.899 1.00 75.11  ? 92  ILE A CD1 1 
ATOM   403   N  N   . ASN A 1 92  ? 127.035 110.860 157.486 1.00 66.32  ? 93  ASN A N   1 
ATOM   404   C  CA  . ASN A 1 92  ? 128.256 110.518 156.778 1.00 65.82  ? 93  ASN A CA  1 
ATOM   405   C  C   . ASN A 1 92  ? 128.773 109.105 156.972 1.00 65.46  ? 93  ASN A C   1 
ATOM   406   O  O   . ASN A 1 92  ? 129.465 108.587 156.116 1.00 65.42  ? 93  ASN A O   1 
ATOM   407   C  CB  . ASN A 1 92  ? 129.353 111.519 157.120 1.00 65.73  ? 93  ASN A CB  1 
ATOM   408   C  CG  . ASN A 1 92  ? 129.091 112.882 156.543 1.00 65.66  ? 93  ASN A CG  1 
ATOM   409   O  OD1 . ASN A 1 92  ? 128.904 113.028 155.348 1.00 65.64  ? 93  ASN A OD1 1 
ATOM   410   N  ND2 . ASN A 1 92  ? 129.074 113.888 157.391 1.00 65.59  ? 93  ASN A ND2 1 
ATOM   411   N  N   . LYS A 1 93  ? 128.441 108.475 158.089 1.00 73.27  ? 94  LYS A N   1 
ATOM   412   C  CA  . LYS A 1 93  ? 129.014 107.172 158.397 1.00 73.00  ? 94  LYS A CA  1 
ATOM   413   C  C   . LYS A 1 93  ? 128.019 106.036 158.464 1.00 73.08  ? 94  LYS A C   1 
ATOM   414   O  O   . LYS A 1 93  ? 128.259 104.973 157.926 1.00 73.08  ? 94  LYS A O   1 
ATOM   415   C  CB  . LYS A 1 93  ? 129.787 107.223 159.708 1.00 72.74  ? 94  LYS A CB  1 
ATOM   416   C  CG  . LYS A 1 93  ? 130.995 108.110 159.681 1.00 72.54  ? 94  LYS A CG  1 
ATOM   417   C  CD  . LYS A 1 93  ? 131.650 108.157 161.029 1.00 72.37  ? 94  LYS A CD  1 
ATOM   418   C  CE  . LYS A 1 93  ? 132.596 109.316 161.133 1.00 72.26  ? 94  LYS A CE  1 
ATOM   419   N  NZ  . LYS A 1 93  ? 132.902 109.621 162.548 1.00 72.21  1 94  LYS A NZ  1 
ATOM   420   N  N   . ILE A 1 94  ? 126.902 106.255 159.128 1.00 75.60  ? 95  ILE A N   1 
ATOM   421   C  CA  . ILE A 1 94  ? 125.983 105.170 159.419 1.00 75.74  ? 95  ILE A CA  1 
ATOM   422   C  C   . ILE A 1 94  ? 125.364 104.507 158.189 1.00 76.44  ? 95  ILE A C   1 
ATOM   423   O  O   . ILE A 1 94  ? 125.201 103.312 158.133 1.00 76.51  ? 95  ILE A O   1 
ATOM   424   C  CB  . ILE A 1 94  ? 124.902 105.676 160.370 1.00 75.33  ? 95  ILE A CB  1 
ATOM   425   C  CG1 . ILE A 1 94  ? 125.520 105.956 161.733 1.00 75.11  ? 95  ILE A CG1 1 
ATOM   426   C  CG2 . ILE A 1 94  ? 123.815 104.672 160.517 1.00 75.24  ? 95  ILE A CG2 1 
ATOM   427   C  CD1 . ILE A 1 94  ? 124.563 106.499 162.729 1.00 74.99  ? 95  ILE A CD1 1 
ATOM   428   N  N   . GLY A 1 95  ? 125.066 105.291 157.178 1.00 72.98  ? 96  GLY A N   1 
ATOM   429   C  CA  . GLY A 1 95  ? 124.447 104.751 155.996 1.00 73.75  ? 96  GLY A CA  1 
ATOM   430   C  C   . GLY A 1 95  ? 125.407 103.851 155.275 1.00 74.56  ? 96  GLY A C   1 
ATOM   431   O  O   . GLY A 1 95  ? 125.063 102.759 154.855 1.00 74.63  ? 96  GLY A O   1 
ATOM   432   N  N   . LYS A 1 96  ? 126.638 104.313 155.160 1.00 79.35  ? 97  LYS A N   1 
ATOM   433   C  CA  . LYS A 1 96  ? 127.667 103.556 154.486 1.00 80.11  ? 97  LYS A CA  1 
ATOM   434   C  C   . LYS A 1 96  ? 128.074 102.331 155.270 1.00 80.46  ? 97  LYS A C   1 
ATOM   435   O  O   . LYS A 1 96  ? 128.530 101.352 154.707 1.00 80.51  ? 97  LYS A O   1 
ATOM   436   C  CB  . LYS A 1 96  ? 128.862 104.451 154.206 1.00 80.46  ? 97  LYS A CB  1 
ATOM   437   C  CG  . LYS A 1 96  ? 128.476 105.664 153.418 1.00 80.74  ? 97  LYS A CG  1 
ATOM   438   C  CD  . LYS A 1 96  ? 129.663 106.432 152.935 1.00 81.00  ? 97  LYS A CD  1 
ATOM   439   C  CE  . LYS A 1 96  ? 129.212 107.631 152.146 1.00 81.16  ? 97  LYS A CE  1 
ATOM   440   N  NZ  . LYS A 1 96  ? 128.257 107.238 151.090 1.00 81.24  1 97  LYS A NZ  1 
ATOM   441   N  N   . LYS A 1 97  ? 127.912 102.396 156.578 1.00 85.24  ? 98  LYS A N   1 
ATOM   442   C  CA  . LYS A 1 97  ? 128.207 101.260 157.426 1.00 85.57  ? 98  LYS A CA  1 
ATOM   443   C  C   . LYS A 1 97  ? 127.225 100.156 157.125 1.00 85.39  ? 98  LYS A C   1 
ATOM   444   O  O   . LYS A 1 97  ? 127.537 98.999  157.212 1.00 85.39  ? 98  LYS A O   1 
ATOM   445   C  CB  . LYS A 1 97  ? 128.089 101.652 158.894 1.00 85.97  ? 98  LYS A CB  1 
ATOM   446   C  CG  . LYS A 1 97  ? 128.575 100.607 159.880 1.00 86.33  ? 98  LYS A CG  1 
ATOM   447   C  CD  . LYS A 1 97  ? 128.202 100.997 161.302 1.00 86.59  ? 98  LYS A CD  1 
ATOM   448   C  CE  . LYS A 1 97  ? 129.000 100.229 162.350 1.00 86.77  ? 98  LYS A CE  1 
ATOM   449   N  NZ  . LYS A 1 97  ? 128.697 98.781  162.357 1.00 86.85  1 98  LYS A NZ  1 
ATOM   450   N  N   . PHE A 1 98  ? 126.025 100.535 156.736 1.00 82.01  ? 99  PHE A N   1 
ATOM   451   C  CA  . PHE A 1 98  ? 124.990 99.565  156.436 1.00 81.79  ? 99  PHE A CA  1 
ATOM   452   C  C   . PHE A 1 98  ? 124.732 99.351  154.954 1.00 81.52  ? 99  PHE A C   1 
ATOM   453   O  O   . PHE A 1 98  ? 123.770 98.699  154.575 1.00 81.50  ? 99  PHE A O   1 
ATOM   454   C  CB  . PHE A 1 98  ? 123.707 99.878  157.191 1.00 81.83  ? 99  PHE A CB  1 
ATOM   455   C  CG  . PHE A 1 98  ? 123.809 99.631  158.656 1.00 81.86  ? 99  PHE A CG  1 
ATOM   456   C  CD1 . PHE A 1 98  ? 124.345 100.578 159.490 1.00 81.86  ? 99  PHE A CD1 1 
ATOM   457   C  CD2 . PHE A 1 98  ? 123.379 98.448  159.196 1.00 81.87  ? 99  PHE A CD2 1 
ATOM   458   C  CE1 . PHE A 1 98  ? 124.441 100.347 160.828 1.00 81.86  ? 99  PHE A CE1 1 
ATOM   459   C  CE2 . PHE A 1 98  ? 123.476 98.217  160.531 1.00 81.87  ? 99  PHE A CE2 1 
ATOM   460   C  CZ  . PHE A 1 98  ? 124.006 99.167  161.348 1.00 81.86  ? 99  PHE A CZ  1 
ATOM   461   N  N   . GLY A 1 99  ? 125.611 99.881  154.121 1.00 75.44  ? 100 GLY A N   1 
ATOM   462   C  CA  . GLY A 1 99  ? 125.560 99.606  152.702 1.00 75.18  ? 100 GLY A CA  1 
ATOM   463   C  C   . GLY A 1 99  ? 124.617 100.431 151.862 1.00 74.95  ? 100 GLY A C   1 
ATOM   464   O  O   . GLY A 1 99  ? 124.340 100.079 150.729 1.00 74.92  ? 100 GLY A O   1 
ATOM   465   N  N   . LEU A 1 100 ? 124.104 101.517 152.411 1.00 78.63  ? 101 LEU A N   1 
ATOM   466   C  CA  . LEU A 1 100 ? 123.266 102.400 151.626 1.00 78.46  ? 101 LEU A CA  1 
ATOM   467   C  C   . LEU A 1 100 ? 124.056 103.009 150.497 1.00 78.71  ? 101 LEU A C   1 
ATOM   468   O  O   . LEU A 1 100 ? 125.202 103.379 150.670 1.00 78.71  ? 101 LEU A O   1 
ATOM   469   C  CB  . LEU A 1 100 ? 122.689 103.510 152.489 1.00 78.17  ? 101 LEU A CB  1 
ATOM   470   C  CG  . LEU A 1 100 ? 121.654 103.104 153.523 1.00 77.93  ? 101 LEU A CG  1 
ATOM   471   C  CD1 . LEU A 1 100 ? 121.038 104.332 154.118 1.00 77.83  ? 101 LEU A CD1 1 
ATOM   472   C  CD2 . LEU A 1 100 ? 120.602 102.247 152.888 1.00 77.87  ? 101 LEU A CD2 1 
ATOM   473   N  N   . LYS A 1 101 ? 123.433 103.111 149.336 1.00 77.51  ? 102 LYS A N   1 
ATOM   474   C  CA  . LYS A 1 101 ? 124.067 103.731 148.194 1.00 77.76  ? 102 LYS A CA  1 
ATOM   475   C  C   . LYS A 1 101 ? 123.631 105.176 148.062 1.00 77.84  ? 102 LYS A C   1 
ATOM   476   O  O   . LYS A 1 101 ? 124.275 105.966 147.392 1.00 77.86  ? 102 LYS A O   1 
ATOM   477   C  CB  . LYS A 1 101 ? 123.723 102.962 146.924 1.00 77.86  ? 102 LYS A CB  1 
ATOM   478   C  CG  . LYS A 1 101 ? 123.794 101.460 147.070 1.00 77.92  ? 102 LYS A CG  1 
ATOM   479   C  CD  . LYS A 1 101 ? 123.374 100.759 145.796 1.00 77.96  ? 102 LYS A CD  1 
ATOM   480   C  CE  . LYS A 1 101 ? 122.668 99.444  146.077 1.00 77.97  ? 102 LYS A CE  1 
ATOM   481   N  NZ  . LYS A 1 101 ? 123.513 98.469  146.806 1.00 77.97  1 102 LYS A NZ  1 
ATOM   482   N  N   . CYS A 1 102 ? 122.535 105.511 148.725 1.00 87.71  ? 103 CYS A N   1 
ATOM   483   C  CA  . CYS A 1 102 ? 121.917 106.825 148.616 1.00 87.67  ? 103 CYS A CA  1 
ATOM   484   C  C   . CYS A 1 102 ? 122.449 107.839 149.612 1.00 87.30  ? 103 CYS A C   1 
ATOM   485   O  O   . CYS A 1 102 ? 123.156 107.492 150.542 1.00 87.31  ? 103 CYS A O   1 
ATOM   486   C  CB  . CYS A 1 102 ? 120.422 106.700 148.823 1.00 87.83  ? 103 CYS A CB  1 
ATOM   487   S  SG  . CYS A 1 102 ? 119.974 106.271 150.488 1.00 87.91  ? 103 CYS A SG  1 
ATOM   488   N  N   . GLU A 1 103 ? 122.104 109.101 149.405 1.00 76.92  ? 104 GLU A N   1 
ATOM   489   C  CA  . GLU A 1 103 ? 122.424 110.143 150.365 1.00 76.39  ? 104 GLU A CA  1 
ATOM   490   C  C   . GLU A 1 103 ? 121.415 110.128 151.487 1.00 75.57  ? 104 GLU A C   1 
ATOM   491   O  O   . GLU A 1 103 ? 120.229 110.289 151.266 1.00 75.48  ? 104 GLU A O   1 
ATOM   492   C  CB  . GLU A 1 103 ? 122.411 111.510 149.690 1.00 76.60  ? 104 GLU A CB  1 
ATOM   493   C  CG  . GLU A 1 103 ? 122.811 112.661 150.584 1.00 76.74  ? 104 GLU A CG  1 
ATOM   494   C  CD  . GLU A 1 103 ? 122.670 114.002 149.906 1.00 76.79  ? 104 GLU A CD  1 
ATOM   495   O  OE1 . GLU A 1 103 ? 121.773 114.152 149.064 1.00 76.83  ? 104 GLU A OE1 1 
ATOM   496   O  OE2 . GLU A 1 103 ? 123.461 114.911 150.208 1.00 76.83  1 104 GLU A OE2 1 
ATOM   497   N  N   . LEU A 1 104 ? 121.895 109.941 152.704 1.00 74.32  ? 105 LEU A N   1 
ATOM   498   C  CA  . LEU A 1 104 ? 121.019 109.909 153.857 1.00 73.45  ? 105 LEU A CA  1 
ATOM   499   C  C   . LEU A 1 104 ? 121.022 111.240 154.570 1.00 72.47  ? 105 LEU A C   1 
ATOM   500   O  O   . LEU A 1 104 ? 122.045 111.691 155.047 1.00 72.40  ? 105 LEU A O   1 
ATOM   501   C  CB  . LEU A 1 104 ? 121.458 108.820 154.819 1.00 73.56  ? 105 LEU A CB  1 
ATOM   502   C  CG  . LEU A 1 104 ? 120.477 108.570 155.948 1.00 73.65  ? 105 LEU A CG  1 
ATOM   503   C  CD1 . LEU A 1 104 ? 119.218 108.023 155.367 1.00 73.67  ? 105 LEU A CD1 1 
ATOM   504   C  CD2 . LEU A 1 104 ? 121.056 107.615 156.949 1.00 73.68  ? 105 LEU A CD2 1 
ATOM   505   N  N   . LEU A 1 105 ? 119.862 111.864 154.649 1.00 76.28  ? 106 LEU A N   1 
ATOM   506   C  CA  . LEU A 1 105 ? 119.750 113.164 155.276 1.00 75.40  ? 106 LEU A CA  1 
ATOM   507   C  C   . LEU A 1 105 ? 118.902 113.134 156.533 1.00 74.76  ? 106 LEU A C   1 
ATOM   508   O  O   . LEU A 1 105 ? 117.984 112.346 156.663 1.00 74.67  ? 106 LEU A O   1 
ATOM   509   C  CB  . LEU A 1 105 ? 119.170 114.172 154.299 1.00 75.24  ? 106 LEU A CB  1 
ATOM   510   C  CG  . LEU A 1 105 ? 119.939 114.431 153.018 1.00 75.15  ? 106 LEU A CG  1 
ATOM   511   C  CD1 . LEU A 1 105 ? 119.235 115.490 152.234 1.00 75.10  ? 106 LEU A CD1 1 
ATOM   512   C  CD2 . LEU A 1 105 ? 121.328 114.866 153.331 1.00 75.11  ? 106 LEU A CD2 1 
ATOM   513   N  N   . ALA A 1 106 ? 119.217 114.026 157.452 1.00 62.97  ? 107 ALA A N   1 
ATOM   514   C  CA  . ALA A 1 106 ? 118.499 114.114 158.699 1.00 62.49  ? 107 ALA A CA  1 
ATOM   515   C  C   . ALA A 1 106 ? 117.957 115.504 158.918 1.00 62.41  ? 107 ALA A C   1 
ATOM   516   O  O   . ALA A 1 106 ? 118.683 116.476 158.877 1.00 62.36  ? 107 ALA A O   1 
ATOM   517   C  CB  . ALA A 1 106 ? 119.393 113.729 159.833 1.00 62.30  ? 107 ALA A CB  1 
ATOM   518   N  N   . LYS A 1 107 ? 116.662 115.578 159.159 1.00 68.93  ? 108 LYS A N   1 
ATOM   519   C  CA  . LYS A 1 107 ? 116.016 116.816 159.524 1.00 69.01  ? 108 LYS A CA  1 
ATOM   520   C  C   . LYS A 1 107 ? 116.082 116.917 161.028 1.00 69.70  ? 108 LYS A C   1 
ATOM   521   O  O   . LYS A 1 107 ? 115.308 116.301 161.728 1.00 69.74  ? 108 LYS A O   1 
ATOM   522   C  CB  . LYS A 1 107 ? 114.578 116.788 159.040 1.00 68.59  ? 108 LYS A CB  1 
ATOM   523   C  CG  . LYS A 1 107 ? 113.784 118.011 159.329 1.00 68.23  ? 108 LYS A CG  1 
ATOM   524   C  CD  . LYS A 1 107 ? 114.287 119.195 158.578 1.00 67.97  ? 108 LYS A CD  1 
ATOM   525   C  CE  . LYS A 1 107 ? 113.248 120.288 158.569 1.00 67.79  ? 108 LYS A CE  1 
ATOM   526   N  NZ  . LYS A 1 107 ? 113.829 121.624 158.328 1.00 67.69  1 108 LYS A NZ  1 
ATOM   527   N  N   . CYS A 1 108 ? 117.031 117.692 161.521 1.00 69.38  ? 109 CYS A N   1 
ATOM   528   C  CA  . CYS A 1 108 ? 117.345 117.705 162.938 1.00 70.07  ? 109 CYS A CA  1 
ATOM   529   C  C   . CYS A 1 108 ? 116.454 118.632 163.736 1.00 70.66  ? 109 CYS A C   1 
ATOM   530   O  O   . CYS A 1 108 ? 116.738 119.801 163.890 1.00 70.72  ? 109 CYS A O   1 
ATOM   531   C  CB  . CYS A 1 108 ? 118.805 118.075 163.136 1.00 70.14  ? 109 CYS A CB  1 
ATOM   532   S  SG  . CYS A 1 108 ? 119.942 116.890 162.456 1.00 70.14  ? 109 CYS A SG  1 
ATOM   533   N  N   . GLU A 1 109 ? 115.378 118.084 164.268 1.00 80.28  ? 110 GLU A N   1 
ATOM   534   C  CA  . GLU A 1 109 ? 114.346 118.891 164.887 1.00 80.75  ? 110 GLU A CA  1 
ATOM   535   C  C   . GLU A 1 109 ? 114.635 119.272 166.328 1.00 80.71  ? 110 GLU A C   1 
ATOM   536   O  O   . GLU A 1 109 ? 113.894 120.030 166.929 1.00 80.72  ? 110 GLU A O   1 
ATOM   537   C  CB  . GLU A 1 109 ? 113.005 118.186 164.783 1.00 81.08  ? 110 GLU A CB  1 
ATOM   538   C  CG  . GLU A 1 109 ? 111.869 119.113 164.485 1.00 81.29  ? 110 GLU A CG  1 
ATOM   539   C  CD  . GLU A 1 109 ? 111.909 119.632 163.095 1.00 81.40  ? 110 GLU A CD  1 
ATOM   540   O  OE1 . GLU A 1 109 ? 112.428 118.916 162.232 1.00 81.44  ? 110 GLU A OE1 1 
ATOM   541   O  OE2 . GLU A 1 109 ? 111.430 120.753 162.859 1.00 81.45  1 110 GLU A OE2 1 
ATOM   542   N  N   . PHE A 1 110 ? 115.720 118.754 166.880 1.00 71.29  ? 111 PHE A N   1 
ATOM   543   C  CA  . PHE A 1 110 ? 116.039 119.002 168.277 1.00 71.18  ? 111 PHE A CA  1 
ATOM   544   C  C   . PHE A 1 110 ? 116.669 120.359 168.528 1.00 71.20  ? 111 PHE A C   1 
ATOM   545   O  O   . PHE A 1 110 ? 116.971 120.712 169.655 1.00 71.20  ? 111 PHE A O   1 
ATOM   546   C  CB  . PHE A 1 110 ? 116.899 117.888 168.856 1.00 71.05  ? 111 PHE A CB  1 
ATOM   547   C  CG  . PHE A 1 110 ? 118.078 117.530 168.025 1.00 70.91  ? 111 PHE A CG  1 
ATOM   548   C  CD1 . PHE A 1 110 ? 119.260 118.200 168.168 1.00 70.83  ? 111 PHE A CD1 1 
ATOM   549   C  CD2 . PHE A 1 110 ? 118.014 116.496 167.128 1.00 70.82  ? 111 PHE A CD2 1 
ATOM   550   C  CE1 . PHE A 1 110 ? 120.340 117.861 167.419 1.00 70.78  ? 111 PHE A CE1 1 
ATOM   551   C  CE2 . PHE A 1 110 ? 119.096 116.160 166.381 1.00 70.77  ? 111 PHE A CE2 1 
ATOM   552   C  CZ  . PHE A 1 110 ? 120.256 116.843 166.526 1.00 70.76  ? 111 PHE A CZ  1 
ATOM   553   N  N   . PHE A 1 111 ? 116.877 121.112 167.463 1.00 79.78  ? 112 PHE A N   1 
ATOM   554   C  CA  . PHE A 1 111 ? 117.399 122.461 167.572 1.00 79.77  ? 112 PHE A CA  1 
ATOM   555   C  C   . PHE A 1 111 ? 116.322 123.496 167.837 1.00 79.35  ? 112 PHE A C   1 
ATOM   556   O  O   . PHE A 1 111 ? 116.607 124.673 167.954 1.00 79.34  ? 112 PHE A O   1 
ATOM   557   C  CB  . PHE A 1 111 ? 118.193 122.826 166.336 1.00 80.05  ? 112 PHE A CB  1 
ATOM   558   C  CG  . PHE A 1 111 ? 119.539 122.190 166.286 1.00 80.33  ? 112 PHE A CG  1 
ATOM   559   C  CD1 . PHE A 1 111 ? 119.769 121.077 165.516 1.00 80.46  ? 112 PHE A CD1 1 
ATOM   560   C  CD2 . PHE A 1 111 ? 120.574 122.706 167.014 1.00 80.48  ? 112 PHE A CD2 1 
ATOM   561   C  CE1 . PHE A 1 111 ? 120.997 120.504 165.472 1.00 80.54  ? 112 PHE A CE1 1 
ATOM   562   C  CE2 . PHE A 1 111 ? 121.804 122.129 166.971 1.00 80.55  ? 112 PHE A CE2 1 
ATOM   563   C  CZ  . PHE A 1 111 ? 122.014 121.025 166.202 1.00 80.57  ? 112 PHE A CZ  1 
ATOM   564   N  N   . ASN A 1 112 ? 115.080 123.052 167.914 1.00 67.66  ? 113 ASN A N   1 
ATOM   565   C  CA  . ASN A 1 112 ? 113.986 123.923 168.297 1.00 67.28  ? 113 ASN A CA  1 
ATOM   566   C  C   . ASN A 1 112 ? 114.099 124.357 169.740 1.00 67.17  ? 113 ASN A C   1 
ATOM   567   O  O   . ASN A 1 112 ? 114.710 123.678 170.542 1.00 67.15  ? 113 ASN A O   1 
ATOM   568   C  CB  . ASN A 1 112 ? 112.649 123.243 168.053 1.00 67.11  ? 113 ASN A CB  1 
ATOM   569   C  CG  . ASN A 1 112 ? 112.225 123.300 166.612 1.00 66.98  ? 113 ASN A CG  1 
ATOM   570   O  OD1 . ASN A 1 112 ? 112.387 124.313 165.948 1.00 66.96  ? 113 ASN A OD1 1 
ATOM   571   N  ND2 . ASN A 1 112 ? 111.672 122.211 166.122 1.00 66.90  ? 113 ASN A ND2 1 
ATOM   572   N  N   . ALA A 1 113 ? 113.508 125.499 170.058 1.00 71.95  ? 114 ALA A N   1 
ATOM   573   C  CA  . ALA A 1 113 ? 113.728 126.156 171.333 1.00 71.87  ? 114 ALA A CA  1 
ATOM   574   C  C   . ALA A 1 113 ? 113.449 125.256 172.513 1.00 71.79  ? 114 ALA A C   1 
ATOM   575   O  O   . ALA A 1 113 ? 114.198 125.250 173.478 1.00 71.79  ? 114 ALA A O   1 
ATOM   576   C  CB  . ALA A 1 113 ? 112.873 127.381 171.421 1.00 71.89  ? 114 ALA A CB  1 
ATOM   577   N  N   . GLY A 1 114 ? 112.386 124.477 172.427 1.00 67.88  ? 115 GLY A N   1 
ATOM   578   C  CA  . GLY A 1 114 ? 112.060 123.559 173.494 1.00 67.81  ? 115 GLY A CA  1 
ATOM   579   C  C   . GLY A 1 114 ? 112.800 122.252 173.376 1.00 67.74  ? 115 GLY A C   1 
ATOM   580   O  O   . GLY A 1 114 ? 112.757 121.424 174.266 1.00 67.75  ? 115 GLY A O   1 
ATOM   581   N  N   . GLY A 1 115 ? 113.506 122.076 172.276 1.00 81.81  ? 116 GLY A N   1 
ATOM   582   C  CA  . GLY A 1 115 ? 114.280 120.871 172.073 1.00 81.77  ? 116 GLY A CA  1 
ATOM   583   C  C   . GLY A 1 115 ? 113.604 119.709 171.375 1.00 81.76  ? 116 GLY A C   1 
ATOM   584   O  O   . GLY A 1 115 ? 114.177 118.639 171.294 1.00 81.74  ? 116 GLY A O   1 
ATOM   585   N  N   . SER A 1 116 ? 112.403 119.911 170.860 1.00 70.71  ? 117 SER A N   1 
ATOM   586   C  CA  . SER A 1 116 ? 111.678 118.836 170.199 1.00 70.01  ? 117 SER A CA  1 
ATOM   587   C  C   . SER A 1 116 ? 110.836 119.324 169.043 1.00 71.69  ? 117 SER A C   1 
ATOM   588   O  O   . SER A 1 116 ? 110.595 120.501 168.894 1.00 66.64  ? 117 SER A O   1 
ATOM   589   C  CB  . SER A 1 116 ? 110.788 118.096 171.189 1.00 68.33  ? 117 SER A CB  1 
ATOM   590   O  OG  . SER A 1 116 ? 109.701 118.891 171.595 1.00 78.46  ? 117 SER A OG  1 
ATOM   591   N  N   . VAL A 1 117 ? 110.381 118.387 168.231 1.00 66.16  ? 118 VAL A N   1 
ATOM   592   C  CA  . VAL A 1 117 ? 109.525 118.681 167.094 1.00 61.74  ? 118 VAL A CA  1 
ATOM   593   C  C   . VAL A 1 117 ? 108.192 119.228 167.559 1.00 61.09  ? 118 VAL A C   1 
ATOM   594   O  O   . VAL A 1 117 ? 107.484 119.890 166.835 1.00 62.75  ? 118 VAL A O   1 
ATOM   595   C  CB  . VAL A 1 117 ? 109.332 117.427 166.230 1.00 65.48  ? 118 VAL A CB  1 
ATOM   596   C  CG1 . VAL A 1 117 ? 108.707 116.333 167.035 1.00 71.11  ? 118 VAL A CG1 1 
ATOM   597   C  CG2 . VAL A 1 117 ? 108.512 117.730 165.010 1.00 64.97  ? 118 VAL A CG2 1 
ATOM   598   N  N   . LYS A 1 118 ? 107.858 118.945 168.797 1.00 71.56  ? 119 LYS A N   1 
ATOM   599   C  CA  . LYS A 1 118 ? 106.585 119.356 169.332 1.00 76.86  ? 119 LYS A CA  1 
ATOM   600   C  C   . LYS A 1 118 ? 106.467 120.841 169.539 1.00 76.46  ? 119 LYS A C   1 
ATOM   601   O  O   . LYS A 1 118 ? 105.381 121.351 169.701 1.00 72.54  ? 119 LYS A O   1 
ATOM   602   C  CB  . LYS A 1 118 ? 106.330 118.640 170.635 1.00 80.64  ? 119 LYS A CB  1 
ATOM   603   C  CG  . LYS A 1 118 ? 106.177 117.176 170.476 1.00 80.08  ? 119 LYS A CG  1 
ATOM   604   C  CD  . LYS A 1 118 ? 104.996 116.850 169.655 1.00 76.31  ? 119 LYS A CD  1 
ATOM   605   C  CE  . LYS A 1 118 ? 104.638 115.418 169.830 1.00 74.06  ? 119 LYS A CE  1 
ATOM   606   N  NZ  . LYS A 1 118 ? 105.591 114.657 169.052 1.00 80.05  1 119 LYS A NZ  1 
ATOM   607   N  N   . ASP A 1 119 ? 107.588 121.537 169.556 1.00 77.59  ? 120 ASP A N   1 
ATOM   608   C  CA  . ASP A 1 119 ? 107.554 122.968 169.761 1.00 78.97  ? 120 ASP A CA  1 
ATOM   609   C  C   . ASP A 1 119 ? 106.791 123.612 168.622 1.00 80.95  ? 120 ASP A C   1 
ATOM   610   O  O   . ASP A 1 119 ? 106.193 124.660 168.787 1.00 79.75  ? 120 ASP A O   1 
ATOM   611   C  CB  . ASP A 1 119 ? 108.968 123.546 169.867 1.00 86.76  ? 120 ASP A CB  1 
ATOM   612   C  CG  . ASP A 1 119 ? 109.772 122.932 170.986 1.00 87.35  ? 120 ASP A CG  1 
ATOM   613   O  OD1 . ASP A 1 119 ? 109.176 122.324 171.887 1.00 94.83  ? 120 ASP A OD1 1 
ATOM   614   O  OD2 . ASP A 1 119 ? 111.008 123.060 170.963 1.00 96.44  1 120 ASP A OD2 1 
ATOM   615   N  N   . ARG A 1 120 ? 106.805 122.964 167.468 1.00 67.95  ? 121 ARG A N   1 
ATOM   616   C  CA  . ARG A 1 120 ? 106.076 123.461 166.320 1.00 63.29  ? 121 ARG A CA  1 
ATOM   617   C  C   . ARG A 1 120 ? 104.585 123.416 166.551 1.00 65.71  ? 121 ARG A C   1 
ATOM   618   O  O   . ARG A 1 120 ? 103.915 124.424 166.445 1.00 72.52  ? 121 ARG A O   1 
ATOM   619   C  CB  . ARG A 1 120 ? 106.402 122.638 165.075 1.00 75.48  ? 121 ARG A CB  1 
ATOM   620   C  CG  . ARG A 1 120 ? 107.740 122.900 164.417 1.00 74.62  ? 121 ARG A CG  1 
ATOM   621   C  CD  . ARG A 1 120 ? 107.885 122.025 163.189 1.00 79.24  ? 121 ARG A CD  1 
ATOM   622   N  NE  . ARG A 1 120 ? 109.213 122.008 162.590 1.00 80.46  ? 121 ARG A NE  1 
ATOM   623   C  CZ  . ARG A 1 120 ? 109.575 122.744 161.551 1.00 78.75  ? 121 ARG A CZ  1 
ATOM   624   N  NH1 . ARG A 1 120 ? 108.715 123.573 161.003 1.00 79.80  1 121 ARG A NH1 1 
ATOM   625   N  NH2 . ARG A 1 120 ? 110.796 122.649 161.066 1.00 88.14  ? 121 ARG A NH2 1 
ATOM   626   N  N   . ILE A 1 121 ? 104.067 122.251 166.885 1.00 74.22  ? 122 ILE A N   1 
ATOM   627   C  CA  . ILE A 1 121 ? 102.633 122.107 167.045 1.00 73.58  ? 122 ILE A CA  1 
ATOM   628   C  C   . ILE A 1 121 ? 102.141 122.809 168.287 1.00 73.06  ? 122 ILE A C   1 
ATOM   629   O  O   . ILE A 1 121 ? 100.972 123.128 168.404 1.00 73.06  ? 122 ILE A O   1 
ATOM   630   C  CB  . ILE A 1 121 ? 102.188 120.658 167.074 1.00 73.48  ? 122 ILE A CB  1 
ATOM   631   C  CG1 . ILE A 1 121 ? 102.614 120.002 168.365 1.00 73.45  ? 122 ILE A CG1 1 
ATOM   632   C  CG2 . ILE A 1 121 ? 102.768 119.921 165.928 1.00 73.45  ? 122 ILE A CG2 1 
ATOM   633   C  CD1 . ILE A 1 121 ? 101.983 118.688 168.575 1.00 73.44  ? 122 ILE A CD1 1 
ATOM   634   N  N   . SER A 1 122 ? 103.039 123.047 169.222 1.00 69.08  ? 123 SER A N   1 
ATOM   635   C  CA  . SER A 1 122 ? 102.664 123.765 170.415 1.00 68.65  ? 123 SER A CA  1 
ATOM   636   C  C   . SER A 1 122 ? 102.342 125.201 170.087 1.00 68.53  ? 123 SER A C   1 
ATOM   637   O  O   . SER A 1 122 ? 101.345 125.734 170.537 1.00 68.52  ? 123 SER A O   1 
ATOM   638   C  CB  . SER A 1 122 ? 103.781 123.701 171.437 1.00 68.50  ? 123 SER A CB  1 
ATOM   639   O  OG  . SER A 1 122 ? 103.908 122.395 171.942 1.00 68.48  ? 123 SER A OG  1 
ATOM   640   N  N   . LEU A 1 123 ? 103.181 125.825 169.279 1.00 70.05  ? 124 LEU A N   1 
ATOM   641   C  CA  . LEU A 1 123 ? 102.989 127.220 168.959 1.00 70.06  ? 124 LEU A CA  1 
ATOM   642   C  C   . LEU A 1 123 ? 101.744 127.364 168.123 1.00 70.75  ? 124 LEU A C   1 
ATOM   643   O  O   . LEU A 1 123 ? 100.842 128.120 168.454 1.00 70.83  ? 124 LEU A O   1 
ATOM   644   C  CB  . LEU A 1 123 ? 104.203 127.753 168.207 1.00 69.57  ? 124 LEU A CB  1 
ATOM   645   C  CG  . LEU A 1 123 ? 104.216 129.227 167.811 1.00 69.18  ? 124 LEU A CG  1 
ATOM   646   C  CD1 . LEU A 1 123 ? 104.099 130.114 169.017 1.00 69.05  ? 124 LEU A CD1 1 
ATOM   647   C  CD2 . LEU A 1 123 ? 105.465 129.563 167.041 1.00 69.05  ? 124 LEU A CD2 1 
ATOM   648   N  N   . ARG A 1 124 ? 101.669 126.561 167.076 1.00 74.87  ? 125 ARG A N   1 
ATOM   649   C  CA  . ARG A 1 124 ? 100.600 126.660 166.106 1.00 75.64  ? 125 ARG A CA  1 
ATOM   650   C  C   . ARG A 1 124 ? 99.250  126.470 166.763 1.00 76.24  ? 125 ARG A C   1 
ATOM   651   O  O   . ARG A 1 124 ? 98.364  127.309 166.623 1.00 76.28  ? 125 ARG A O   1 
ATOM   652   C  CB  . ARG A 1 124 ? 100.808 125.613 165.022 1.00 75.79  ? 125 ARG A CB  1 
ATOM   653   C  CG  . ARG A 1 124 ? 99.759  125.596 163.953 1.00 75.95  ? 125 ARG A CG  1 
ATOM   654   C  CD  . ARG A 1 124 ? 99.801  126.842 163.124 1.00 76.08  ? 125 ARG A CD  1 
ATOM   655   N  NE  . ARG A 1 124 ? 98.809  126.801 162.063 1.00 76.22  ? 125 ARG A NE  1 
ATOM   656   C  CZ  . ARG A 1 124 ? 99.072  126.453 160.817 1.00 76.30  ? 125 ARG A CZ  1 
ATOM   657   N  NH1 . ARG A 1 124 ? 100.296 126.128 160.470 1.00 76.30  1 125 ARG A NH1 1 
ATOM   658   N  NH2 . ARG A 1 124 ? 98.107  126.442 159.921 1.00 76.33  ? 125 ARG A NH2 1 
ATOM   659   N  N   . MET A 1 125 ? 99.132  125.413 167.557 1.00 78.82  ? 126 MET A N   1 
ATOM   660   C  CA  . MET A 1 125 ? 97.877  125.088 168.207 1.00 79.43  ? 126 MET A CA  1 
ATOM   661   C  C   . MET A 1 125 ? 97.438  126.235 169.080 1.00 80.12  ? 126 MET A C   1 
ATOM   662   O  O   . MET A 1 125 ? 96.258  126.539 169.170 1.00 80.31  ? 126 MET A O   1 
ATOM   663   C  CB  . MET A 1 125 ? 98.030  123.832 169.057 1.00 79.38  ? 126 MET A CB  1 
ATOM   664   C  CG  . MET A 1 125 ? 97.546  122.576 168.395 1.00 79.35  ? 126 MET A CG  1 
ATOM   665   S  SD  . MET A 1 125 ? 98.271  121.087 169.054 1.00 79.38  ? 126 MET A SD  1 
ATOM   666   C  CE  . MET A 1 125 ? 97.694  121.153 170.716 1.00 79.40  ? 126 MET A CE  1 
ATOM   667   N  N   . ILE A 1 126 ? 98.400  126.910 169.683 1.00 69.95  ? 127 ILE A N   1 
ATOM   668   C  CA  . ILE A 1 126 ? 98.057  128.005 170.549 1.00 70.68  ? 127 ILE A CA  1 
ATOM   669   C  C   . ILE A 1 126 ? 97.639  129.183 169.712 1.00 72.35  ? 127 ILE A C   1 
ATOM   670   O  O   . ILE A 1 126 ? 96.604  129.786 169.954 1.00 72.60  ? 127 ILE A O   1 
ATOM   671   C  CB  . ILE A 1 126 ? 99.216  128.374 171.455 1.00 69.95  ? 127 ILE A CB  1 
ATOM   672   C  CG1 . ILE A 1 126 ? 99.318  127.363 172.584 1.00 69.54  ? 127 ILE A CG1 1 
ATOM   673   C  CG2 . ILE A 1 126 ? 99.023  129.742 172.026 1.00 69.79  ? 127 ILE A CG2 1 
ATOM   674   C  CD1 . ILE A 1 126 ? 100.361 127.696 173.578 1.00 69.34  ? 127 ILE A CD1 1 
ATOM   675   N  N   . GLU A 1 127 ? 98.408  129.475 168.678 1.00 92.31  ? 128 GLU A N   1 
ATOM   676   C  CA  . GLU A 1 127 ? 98.164  130.701 167.950 1.00 94.00  ? 128 GLU A CA  1 
ATOM   677   C  C   . GLU A 1 127 ? 96.813  130.631 167.288 1.00 95.54  ? 128 GLU A C   1 
ATOM   678   O  O   . GLU A 1 127 ? 96.026  131.566 167.374 1.00 95.72  ? 128 GLU A O   1 
ATOM   679   C  CB  . GLU A 1 127 ? 99.279  130.977 166.940 1.00 94.17  ? 128 GLU A CB  1 
ATOM   680   C  CG  . GLU A 1 127 ? 100.520 131.571 167.575 1.00 94.24  ? 128 GLU A CG  1 
ATOM   681   C  CD  . GLU A 1 127 ? 101.648 131.787 166.602 1.00 94.33  ? 128 GLU A CD  1 
ATOM   682   O  OE1 . GLU A 1 127 ? 102.623 132.462 166.978 1.00 94.35  ? 128 GLU A OE1 1 
ATOM   683   O  OE2 . GLU A 1 127 ? 101.570 131.279 165.469 1.00 94.35  1 128 GLU A OE2 1 
ATOM   684   N  N   . ASP A 1 128 ? 96.513  129.483 166.702 1.00 88.65  ? 129 ASP A N   1 
ATOM   685   C  CA  . ASP A 1 128 ? 95.236  129.309 166.053 1.00 90.13  ? 129 ASP A CA  1 
ATOM   686   C  C   . ASP A 1 128 ? 94.131  129.464 167.067 1.00 91.58  ? 129 ASP A C   1 
ATOM   687   O  O   . ASP A 1 128 ? 93.128  130.115 166.801 1.00 91.76  ? 129 ASP A O   1 
ATOM   688   C  CB  . ASP A 1 128 ? 95.144  127.933 165.404 1.00 90.14  ? 129 ASP A CB  1 
ATOM   689   C  CG  . ASP A 1 128 ? 96.003  127.813 164.175 1.00 90.07  ? 129 ASP A CG  1 
ATOM   690   O  OD1 . ASP A 1 128 ? 96.276  126.675 163.748 1.00 90.02  ? 129 ASP A OD1 1 
ATOM   691   O  OD2 . ASP A 1 128 ? 96.406  128.860 163.638 1.00 90.12  1 129 ASP A OD2 1 
ATOM   692   N  N   . ALA A 1 129 ? 94.336  128.921 168.256 1.00 83.16  ? 130 ALA A N   1 
ATOM   693   C  CA  . ALA A 1 129 ? 93.291  129.004 169.245 1.00 84.63  ? 130 ALA A CA  1 
ATOM   694   C  C   . ALA A 1 129 ? 93.090  130.451 169.619 1.00 86.37  ? 130 ALA A C   1 
ATOM   695   O  O   . ALA A 1 129 ? 91.969  130.898 169.811 1.00 86.53  ? 130 ALA A O   1 
ATOM   696   C  CB  . ALA A 1 129 ? 93.643  128.193 170.445 1.00 84.47  ? 130 ALA A CB  1 
ATOM   697   N  N   . GLU A 1 130 ? 94.180  131.204 169.654 1.00 95.13  ? 131 GLU A N   1 
ATOM   698   C  CA  . GLU A 1 130 ? 94.090  132.602 170.021 1.00 96.91  ? 131 GLU A CA  1 
ATOM   699   C  C   . GLU A 1 130 ? 93.327  133.354 168.962 1.00 99.11  ? 131 GLU A C   1 
ATOM   700   O  O   . GLU A 1 130 ? 92.637  134.320 169.250 1.00 99.29  ? 131 GLU A O   1 
ATOM   701   C  CB  . GLU A 1 130 ? 95.479  133.206 170.222 1.00 96.62  ? 131 GLU A CB  1 
ATOM   702   C  CG  . GLU A 1 130 ? 96.150  132.779 171.514 1.00 96.39  ? 131 GLU A CG  1 
ATOM   703   C  CD  . GLU A 1 130 ? 97.558  133.295 171.648 1.00 96.31  ? 131 GLU A CD  1 
ATOM   704   O  OE1 . GLU A 1 130 ? 98.120  133.218 172.753 1.00 96.20  ? 131 GLU A OE1 1 
ATOM   705   O  OE2 . GLU A 1 130 ? 98.105  133.775 170.645 1.00 96.30  1 131 GLU A OE2 1 
ATOM   706   N  N   . ARG A 1 131 ? 93.440  132.895 167.728 1.00 120.76 ? 132 ARG A N   1 
ATOM   707   C  CA  . ARG A 1 131 ? 92.707  133.521 166.654 1.00 122.98 ? 132 ARG A CA  1 
ATOM   708   C  C   . ARG A 1 131 ? 91.260  133.103 166.672 1.00 122.78 ? 132 ARG A C   1 
ATOM   709   O  O   . ARG A 1 131 ? 90.399  133.819 166.187 1.00 122.86 ? 132 ARG A O   1 
ATOM   710   C  CB  . ARG A 1 131 ? 93.297  133.137 165.314 1.00 124.99 ? 132 ARG A CB  1 
ATOM   711   C  CG  . ARG A 1 131 ? 94.692  133.614 165.080 1.00 126.65 ? 132 ARG A CG  1 
ATOM   712   C  CD  . ARG A 1 131 ? 95.140  133.086 163.747 1.00 127.85 ? 132 ARG A CD  1 
ATOM   713   N  NE  . ARG A 1 131 ? 96.548  133.326 163.471 1.00 128.72 ? 132 ARG A NE  1 
ATOM   714   C  CZ  . ARG A 1 131 ? 97.184  132.777 162.446 1.00 129.51 ? 132 ARG A CZ  1 
ATOM   715   N  NH1 . ARG A 1 131 ? 96.525  131.967 161.636 1.00 129.88 1 132 ARG A NH1 1 
ATOM   716   N  NH2 . ARG A 1 131 ? 98.465  133.030 162.231 1.00 129.54 ? 132 ARG A NH2 1 
ATOM   717   N  N   . ASP A 1 132 ? 90.994  131.925 167.219 1.00 111.86 ? 133 ASP A N   1 
ATOM   718   C  CA  . ASP A 1 132 ? 89.633  131.421 167.263 1.00 111.49 ? 133 ASP A CA  1 
ATOM   719   C  C   . ASP A 1 132 ? 88.828  132.247 168.238 1.00 110.73 ? 133 ASP A C   1 
ATOM   720   O  O   . ASP A 1 132 ? 87.610  132.316 168.160 1.00 110.70 ? 133 ASP A O   1 
ATOM   721   C  CB  . ASP A 1 132 ? 89.613  129.954 167.682 1.00 111.72 ? 133 ASP A CB  1 
ATOM   722   C  CG  . ASP A 1 132 ? 90.034  129.025 166.569 1.00 111.82 ? 133 ASP A CG  1 
ATOM   723   O  OD1 . ASP A 1 132 ? 89.788  129.360 165.397 1.00 111.89 ? 133 ASP A OD1 1 
ATOM   724   O  OD2 . ASP A 1 132 ? 90.603  127.955 166.860 1.00 111.89 1 133 ASP A OD2 1 
ATOM   725   N  N   . GLY A 1 133 ? 89.536  132.881 169.159 1.00 96.52  ? 134 GLY A N   1 
ATOM   726   C  CA  . GLY A 1 133 ? 88.916  133.618 170.232 1.00 95.68  ? 134 GLY A CA  1 
ATOM   727   C  C   . GLY A 1 133 ? 88.605  132.693 171.378 1.00 94.86  ? 134 GLY A C   1 
ATOM   728   O  O   . GLY A 1 133 ? 88.097  133.112 172.405 1.00 94.78  ? 134 GLY A O   1 
ATOM   729   N  N   . THR A 1 134 ? 88.917  131.420 171.197 1.00 97.86  ? 135 THR A N   1 
ATOM   730   C  CA  . THR A 1 134 ? 88.672  130.443 172.235 1.00 97.17  ? 135 THR A CA  1 
ATOM   731   C  C   . THR A 1 134 ? 89.633  130.630 173.386 1.00 96.78  ? 135 THR A C   1 
ATOM   732   O  O   . THR A 1 134 ? 89.242  130.583 174.540 1.00 96.72  ? 135 THR A O   1 
ATOM   733   C  CB  . THR A 1 134 ? 88.806  129.021 171.701 1.00 96.97  ? 135 THR A CB  1 
ATOM   734   O  OG1 . THR A 1 134 ? 90.102  128.847 171.133 1.00 96.94  ? 135 THR A OG1 1 
ATOM   735   C  CG2 . THR A 1 134 ? 87.774  128.762 170.634 1.00 96.90  ? 135 THR A CG2 1 
ATOM   736   N  N   . LEU A 1 135 ? 90.894  130.861 173.073 1.00 89.07  ? 136 LEU A N   1 
ATOM   737   C  CA  . LEU A 1 135 ? 91.891  131.006 174.114 1.00 88.83  ? 136 LEU A CA  1 
ATOM   738   C  C   . LEU A 1 135 ? 92.025  132.452 174.541 1.00 90.15  ? 136 LEU A C   1 
ATOM   739   O  O   . LEU A 1 135 ? 92.419  133.306 173.767 1.00 90.23  ? 136 LEU A O   1 
ATOM   740   C  CB  . LEU A 1 135 ? 93.231  130.456 173.648 1.00 87.61  ? 136 LEU A CB  1 
ATOM   741   C  CG  . LEU A 1 135 ? 94.333  130.352 174.690 1.00 86.60  ? 136 LEU A CG  1 
ATOM   742   C  CD1 . LEU A 1 135 ? 93.859  129.570 175.876 1.00 86.29  ? 136 LEU A CD1 1 
ATOM   743   C  CD2 . LEU A 1 135 ? 95.540  129.695 174.088 1.00 86.27  ? 136 LEU A CD2 1 
ATOM   744   N  N   . LYS A 1 136 ? 91.714  132.708 175.800 1.00 118.34 ? 137 LYS A N   1 
ATOM   745   C  CA  . LYS A 1 136 ? 91.689  134.053 176.338 1.00 119.53 ? 137 LYS A CA  1 
ATOM   746   C  C   . LYS A 1 136 ? 92.928  134.258 177.193 1.00 118.57 ? 137 LYS A C   1 
ATOM   747   O  O   . LYS A 1 136 ? 93.514  133.293 177.657 1.00 118.34 ? 137 LYS A O   1 
ATOM   748   C  CB  . LYS A 1 136 ? 90.428  134.241 177.178 1.00 121.42 ? 137 LYS A CB  1 
ATOM   749   C  CG  . LYS A 1 136 ? 89.155  133.726 176.517 1.00 122.94 ? 137 LYS A CG  1 
ATOM   750   C  CD  . LYS A 1 136 ? 87.922  133.950 177.396 1.00 124.21 ? 137 LYS A CD  1 
ATOM   751   C  CE  . LYS A 1 136 ? 87.841  132.967 178.561 1.00 125.01 ? 137 LYS A CE  1 
ATOM   752   N  NZ  . LYS A 1 136 ? 87.485  131.590 178.122 1.00 125.48 1 137 LYS A NZ  1 
ATOM   753   N  N   . PRO A 1 137 ? 93.353  135.512 177.379 1.00 103.24 ? 138 PRO A N   1 
ATOM   754   C  CA  . PRO A 1 137 ? 94.529  135.743 178.212 1.00 102.32 ? 138 PRO A CA  1 
ATOM   755   C  C   . PRO A 1 137 ? 94.293  135.248 179.620 1.00 100.93 ? 138 PRO A C   1 
ATOM   756   O  O   . PRO A 1 137 ? 93.194  135.400 180.137 1.00 100.87 ? 138 PRO A O   1 
ATOM   757   C  CB  . PRO A 1 137 ? 94.635  137.262 178.231 1.00 102.69 ? 138 PRO A CB  1 
ATOM   758   C  CG  . PRO A 1 137 ? 93.986  137.695 176.997 1.00 102.99 ? 138 PRO A CG  1 
ATOM   759   C  CD  . PRO A 1 137 ? 92.860  136.756 176.775 1.00 103.19 ? 138 PRO A CD  1 
ATOM   760   N  N   . GLY A 1 138 ? 95.310  134.655 180.227 1.00 94.91  ? 139 GLY A N   1 
ATOM   761   C  CA  . GLY A 1 138 ? 95.216  134.200 181.599 1.00 93.55  ? 139 GLY A CA  1 
ATOM   762   C  C   . GLY A 1 138 ? 94.524  132.864 181.764 1.00 92.21  ? 139 GLY A C   1 
ATOM   763   O  O   . GLY A 1 138 ? 94.397  132.360 182.871 1.00 92.09  ? 139 GLY A O   1 
ATOM   764   N  N   . ASP A 1 139 ? 94.088  132.284 180.654 1.00 101.01 ? 140 ASP A N   1 
ATOM   765   C  CA  . ASP A 1 139 ? 93.357  131.022 180.664 1.00 99.73  ? 140 ASP A CA  1 
ATOM   766   C  C   . ASP A 1 139 ? 94.225  129.814 180.952 1.00 98.09  ? 140 ASP A C   1 
ATOM   767   O  O   . ASP A 1 139 ? 95.427  129.855 180.772 1.00 97.99  ? 140 ASP A O   1 
ATOM   768   C  CB  . ASP A 1 139 ? 92.628  130.827 179.348 1.00 100.04 ? 140 ASP A CB  1 
ATOM   769   C  CG  . ASP A 1 139 ? 91.315  131.539 179.313 1.00 100.32 ? 140 ASP A CG  1 
ATOM   770   O  OD1 . ASP A 1 139 ? 91.081  132.369 180.206 1.00 100.46 ? 140 ASP A OD1 1 
ATOM   771   O  OD2 . ASP A 1 139 ? 90.514  131.271 178.399 1.00 100.47 1 140 ASP A OD2 1 
ATOM   772   N  N   . THR A 1 140 ? 93.608  128.747 181.439 1.00 81.73  ? 141 THR A N   1 
ATOM   773   C  CA  . THR A 1 140 ? 94.327  127.515 181.704 1.00 80.15  ? 141 THR A CA  1 
ATOM   774   C  C   . THR A 1 140 ? 94.308  126.547 180.530 1.00 78.91  ? 141 THR A C   1 
ATOM   775   O  O   . THR A 1 140 ? 93.269  126.276 179.949 1.00 78.83  ? 141 THR A O   1 
ATOM   776   C  CB  . THR A 1 140 ? 93.762  126.810 182.921 1.00 79.94  ? 141 THR A CB  1 
ATOM   777   O  OG1 . THR A 1 140 ? 93.733  127.720 184.019 1.00 79.91  ? 141 THR A OG1 1 
ATOM   778   C  CG2 . THR A 1 140 ? 94.619  125.642 183.289 1.00 79.81  ? 141 THR A CG2 1 
ATOM   779   N  N   . ILE A 1 141 ? 95.474  126.011 180.208 1.00 82.73  ? 142 ILE A N   1 
ATOM   780   C  CA  . ILE A 1 141 ? 95.631  125.057 179.129 1.00 81.56  ? 142 ILE A CA  1 
ATOM   781   C  C   . ILE A 1 141 ? 95.978  123.718 179.716 1.00 80.36  ? 142 ILE A C   1 
ATOM   782   O  O   . ILE A 1 141 ? 96.938  123.602 180.440 1.00 80.24  ? 142 ILE A O   1 
ATOM   783   C  CB  . ILE A 1 141 ? 96.778  125.463 178.220 1.00 81.61  ? 142 ILE A CB  1 
ATOM   784   C  CG1 . ILE A 1 141 ? 96.491  126.804 177.562 1.00 81.65  ? 142 ILE A CG1 1 
ATOM   785   C  CG2 . ILE A 1 141 ? 97.000  124.428 177.162 1.00 81.61  ? 142 ILE A CG2 1 
ATOM   786   C  CD1 . ILE A 1 141 ? 97.663  127.366 176.820 1.00 81.68  ? 142 ILE A CD1 1 
ATOM   787   N  N   . ILE A 1 142 ? 95.188  122.706 179.404 1.00 77.74  ? 143 ILE A N   1 
ATOM   788   C  CA  . ILE A 1 142 ? 95.447  121.356 179.857 1.00 76.64  ? 143 ILE A CA  1 
ATOM   789   C  C   . ILE A 1 142 ? 95.812  120.509 178.658 1.00 75.56  ? 143 ILE A C   1 
ATOM   790   O  O   . ILE A 1 142 ? 95.175  120.611 177.628 1.00 75.50  ? 143 ILE A O   1 
ATOM   791   C  CB  . ILE A 1 142 ? 94.198  120.783 180.519 1.00 76.64  ? 143 ILE A CB  1 
ATOM   792   C  CG1 . ILE A 1 142 ? 93.827  121.619 181.735 1.00 76.68  ? 143 ILE A CG1 1 
ATOM   793   C  CG2 . ILE A 1 142 ? 94.415  119.366 180.934 1.00 76.62  ? 143 ILE A CG2 1 
ATOM   794   C  CD1 . ILE A 1 142 ? 92.467  121.346 182.271 1.00 76.72  ? 143 ILE A CD1 1 
ATOM   795   N  N   . GLU A 1 143 ? 96.839  119.679 178.770 1.00 80.42  ? 144 GLU A N   1 
ATOM   796   C  CA  . GLU A 1 143 ? 97.201  118.842 177.637 1.00 79.39  ? 144 GLU A CA  1 
ATOM   797   C  C   . GLU A 1 143 ? 97.749  117.480 178.002 1.00 78.54  ? 144 GLU A C   1 
ATOM   798   O  O   . GLU A 1 143 ? 98.717  117.373 178.740 1.00 78.46  ? 144 GLU A O   1 
ATOM   799   C  CB  . GLU A 1 143 ? 98.196  119.559 176.743 1.00 79.31  ? 144 GLU A CB  1 
ATOM   800   C  CG  . GLU A 1 143 ? 98.485  118.825 175.452 1.00 79.26  ? 144 GLU A CG  1 
ATOM   801   C  CD  . GLU A 1 143 ? 97.337  118.880 174.475 1.00 79.25  ? 144 GLU A CD  1 
ATOM   802   O  OE1 . GLU A 1 143 ? 97.327  118.085 173.521 1.00 79.25  ? 144 GLU A OE1 1 
ATOM   803   O  OE2 . GLU A 1 143 ? 96.448  119.727 174.653 1.00 79.26  1 144 GLU A OE2 1 
ATOM   804   N  N   . PRO A 1 144 ? 97.092  116.421 177.528 1.00 65.75  ? 145 PRO A N   1 
ATOM   805   C  CA  . PRO A 1 144 ? 97.696  115.097 177.566 1.00 65.31  ? 145 PRO A CA  1 
ATOM   806   C  C   . PRO A 1 144 ? 98.916  115.058 176.671 1.00 64.98  ? 145 PRO A C   1 
ATOM   807   O  O   . PRO A 1 144 ? 98.858  115.622 175.593 1.00 64.96  ? 145 PRO A O   1 
ATOM   808   C  CB  . PRO A 1 144 ? 96.591  114.213 177.011 1.00 65.28  ? 145 PRO A CB  1 
ATOM   809   C  CG  . PRO A 1 144 ? 95.829  115.079 176.135 1.00 65.33  ? 145 PRO A CG  1 
ATOM   810   C  CD  . PRO A 1 144 ? 95.859  116.432 176.734 1.00 65.49  ? 145 PRO A CD  1 
ATOM   811   N  N   . THR A 1 145 ? 99.970  114.356 177.064 1.00 73.18  ? 146 THR A N   1 
ATOM   812   C  CA  . THR A 1 145 ? 101.170 114.313 176.236 1.00 72.92  ? 146 THR A CA  1 
ATOM   813   C  C   . THR A 1 145 ? 102.213 113.304 176.660 1.00 72.76  ? 146 THR A C   1 
ATOM   814   O  O   . THR A 1 145 ? 102.214 112.837 177.778 1.00 72.81  ? 146 THR A O   1 
ATOM   815   C  CB  . THR A 1 145 ? 101.858 115.668 176.181 1.00 72.85  ? 146 THR A CB  1 
ATOM   816   O  OG1 . THR A 1 145 ? 102.972 115.593 175.290 1.00 72.81  ? 146 THR A OG1 1 
ATOM   817   C  CG2 . THR A 1 145 ? 102.348 116.047 177.536 1.00 72.83  ? 146 THR A CG2 1 
ATOM   818   N  N   . SER A 1 146 ? 103.109 112.981 175.740 1.00 75.85  ? 147 SER A N   1 
ATOM   819   C  CA  . SER A 1 146 ? 104.274 112.173 176.049 1.00 75.68  ? 147 SER A CA  1 
ATOM   820   C  C   . SER A 1 146 ? 105.332 113.045 176.667 1.00 75.51  ? 147 SER A C   1 
ATOM   821   O  O   . SER A 1 146 ? 106.339 112.561 177.150 1.00 75.62  ? 147 SER A O   1 
ATOM   822   C  CB  . SER A 1 146 ? 104.835 111.538 174.790 1.00 75.69  ? 147 SER A CB  1 
ATOM   823   O  OG  . SER A 1 146 ? 103.968 110.551 174.282 1.00 75.71  ? 147 SER A OG  1 
ATOM   824   N  N   . GLY A 1 147 ? 105.109 114.347 176.625 1.00 64.27  ? 148 GLY A N   1 
ATOM   825   C  CA  . GLY A 1 147 ? 106.023 115.279 177.237 1.00 64.07  ? 148 GLY A CA  1 
ATOM   826   C  C   . GLY A 1 147 ? 106.485 116.407 176.358 1.00 63.88  ? 148 GLY A C   1 
ATOM   827   O  O   . GLY A 1 147 ? 106.455 117.557 176.759 1.00 63.83  ? 148 GLY A O   1 
ATOM   828   N  N   . ASN A 1 148 ? 106.932 116.084 175.160 1.00 67.45  ? 149 ASN A N   1 
ATOM   829   C  CA  . ASN A 1 148 ? 107.487 117.101 174.298 1.00 67.34  ? 149 ASN A CA  1 
ATOM   830   C  C   . ASN A 1 148 ? 106.480 118.165 173.889 1.00 67.22  ? 149 ASN A C   1 
ATOM   831   O  O   . ASN A 1 148 ? 106.812 119.347 173.833 1.00 67.22  ? 149 ASN A O   1 
ATOM   832   C  CB  . ASN A 1 148 ? 108.126 116.453 173.082 1.00 67.36  ? 149 ASN A CB  1 
ATOM   833   C  CG  . ASN A 1 148 ? 109.442 115.824 173.392 1.00 67.37  ? 149 ASN A CG  1 
ATOM   834   O  OD1 . ASN A 1 148 ? 110.140 116.247 174.292 1.00 67.37  ? 149 ASN A OD1 1 
ATOM   835   N  ND2 . ASN A 1 148 ? 109.799 114.822 172.636 1.00 67.37  ? 149 ASN A ND2 1 
ATOM   836   N  N   . THR A 1 149 ? 105.245 117.758 173.631 1.00 71.15  ? 150 THR A N   1 
ATOM   837   C  CA  . THR A 1 149 ? 104.196 118.720 173.352 1.00 71.02  ? 150 THR A CA  1 
ATOM   838   C  C   . THR A 1 149 ? 103.941 119.516 174.601 1.00 70.70  ? 150 THR A C   1 
ATOM   839   O  O   . THR A 1 149 ? 103.656 120.701 174.558 1.00 70.70  ? 150 THR A O   1 
ATOM   840   C  CB  . THR A 1 149 ? 102.880 118.047 172.955 1.00 71.11  ? 150 THR A CB  1 
ATOM   841   O  OG1 . THR A 1 149 ? 103.078 117.207 171.824 1.00 71.18  ? 150 THR A OG1 1 
ATOM   842   C  CG2 . THR A 1 149 ? 101.854 119.072 172.593 1.00 71.16  ? 150 THR A CG2 1 
ATOM   843   N  N   . GLY A 1 150 ? 104.077 118.851 175.729 1.00 66.93  ? 151 GLY A N   1 
ATOM   844   C  CA  . GLY A 1 150 ? 103.839 119.492 176.994 1.00 66.61  ? 151 GLY A CA  1 
ATOM   845   C  C   . GLY A 1 150 ? 104.910 120.489 177.329 1.00 66.29  ? 151 GLY A C   1 
ATOM   846   O  O   . GLY A 1 150 ? 104.642 121.523 177.908 1.00 66.32  ? 151 GLY A O   1 
ATOM   847   N  N   . ILE A 1 151 ? 106.136 120.170 176.965 1.00 63.32  ? 152 ILE A N   1 
ATOM   848   C  CA  . ILE A 1 151 ? 107.220 121.100 177.161 1.00 63.01  ? 152 ILE A CA  1 
ATOM   849   C  C   . ILE A 1 151 ? 107.062 122.304 176.261 1.00 63.58  ? 152 ILE A C   1 
ATOM   850   O  O   . ILE A 1 151 ? 107.277 123.429 176.684 1.00 63.66  ? 152 ILE A O   1 
ATOM   851   C  CB  . ILE A 1 151 ? 108.568 120.429 176.923 1.00 62.33  ? 152 ILE A CB  1 
ATOM   852   C  CG1 . ILE A 1 151 ? 108.856 119.446 178.048 1.00 61.97  ? 152 ILE A CG1 1 
ATOM   853   C  CG2 . ILE A 1 151 ? 109.665 121.447 176.861 1.00 62.17  ? 152 ILE A CG2 1 
ATOM   854   C  CD1 . ILE A 1 151 ? 110.087 118.633 177.839 1.00 61.78  ? 152 ILE A CD1 1 
ATOM   855   N  N   . GLY A 1 152 ? 106.633 122.085 175.027 1.00 62.51  ? 153 GLY A N   1 
ATOM   856   C  CA  . GLY A 1 152 ? 106.478 123.210 174.127 1.00 63.17  ? 153 GLY A CA  1 
ATOM   857   C  C   . GLY A 1 152 ? 105.354 124.127 174.547 1.00 63.90  ? 153 GLY A C   1 
ATOM   858   O  O   . GLY A 1 152 ? 105.454 125.348 174.466 1.00 63.99  ? 153 GLY A O   1 
ATOM   859   N  N   . LEU A 1 153 ? 104.285 123.523 175.036 1.00 70.18  ? 154 LEU A N   1 
ATOM   860   C  CA  . LEU A 1 153 ? 103.149 124.283 175.505 1.00 70.97  ? 154 LEU A CA  1 
ATOM   861   C  C   . LEU A 1 153 ? 103.461 125.009 176.783 1.00 71.86  ? 154 LEU A C   1 
ATOM   862   O  O   . LEU A 1 153 ? 103.008 126.109 176.985 1.00 72.01  ? 154 LEU A O   1 
ATOM   863   C  CB  . LEU A 1 153 ? 101.949 123.372 175.719 1.00 70.92  ? 154 LEU A CB  1 
ATOM   864   C  CG  . LEU A 1 153 ? 101.244 122.874 174.468 1.00 70.87  ? 154 LEU A CG  1 
ATOM   865   C  CD1 . LEU A 1 153 ? 100.136 121.944 174.839 1.00 70.88  ? 154 LEU A CD1 1 
ATOM   866   C  CD2 . LEU A 1 153 ? 100.707 124.034 173.701 1.00 70.87  ? 154 LEU A CD2 1 
ATOM   867   N  N   . ALA A 1 154 ? 104.214 124.372 177.662 1.00 79.37  ? 155 ALA A N   1 
ATOM   868   C  CA  . ALA A 1 154 ? 104.605 125.004 178.911 1.00 80.21  ? 155 ALA A CA  1 
ATOM   869   C  C   . ALA A 1 154 ? 105.538 126.168 178.671 1.00 81.02  ? 155 ALA A C   1 
ATOM   870   O  O   . ALA A 1 154 ? 105.525 127.147 179.399 1.00 81.09  ? 155 ALA A O   1 
ATOM   871   C  CB  . ALA A 1 154 ? 105.249 124.002 179.822 1.00 80.23  ? 155 ALA A CB  1 
ATOM   872   N  N   . LEU A 1 155 ? 106.354 126.042 177.637 1.00 79.58  ? 156 LEU A N   1 
ATOM   873   C  CA  . LEU A 1 155 ? 107.282 127.085 177.261 1.00 80.37  ? 156 LEU A CA  1 
ATOM   874   C  C   . LEU A 1 155 ? 106.518 128.279 176.735 1.00 80.73  ? 156 LEU A C   1 
ATOM   875   O  O   . LEU A 1 155 ? 106.688 129.415 177.189 1.00 80.82  ? 156 LEU A O   1 
ATOM   876   C  CB  . LEU A 1 155 ? 108.210 126.550 176.181 1.00 80.68  ? 156 LEU A CB  1 
ATOM   877   C  CG  . LEU A 1 155 ? 109.144 127.541 175.518 1.00 80.99  ? 156 LEU A CG  1 
ATOM   878   C  CD1 . LEU A 1 155 ? 110.026 128.085 176.556 1.00 81.05  ? 156 LEU A CD1 1 
ATOM   879   C  CD2 . LEU A 1 155 ? 109.964 126.853 174.484 1.00 81.10  ? 156 LEU A CD2 1 
ATOM   880   N  N   . ALA A 1 156 ? 105.638 128.010 175.789 1.00 74.72  ? 157 ALA A N   1 
ATOM   881   C  CA  . ALA A 1 156 ? 104.854 129.074 175.210 1.00 75.04  ? 157 ALA A CA  1 
ATOM   882   C  C   . ALA A 1 156 ? 103.965 129.697 176.257 1.00 75.41  ? 157 ALA A C   1 
ATOM   883   O  O   . ALA A 1 156 ? 103.695 130.880 176.223 1.00 75.44  ? 157 ALA A O   1 
ATOM   884   C  CB  . ALA A 1 156 ? 104.027 128.542 174.087 1.00 75.02  ? 157 ALA A CB  1 
ATOM   885   N  N   . ALA A 1 157 ? 103.513 128.891 177.198 1.00 85.98  ? 158 ALA A N   1 
ATOM   886   C  CA  . ALA A 1 157 ? 102.637 129.383 178.233 1.00 86.41  ? 158 ALA A CA  1 
ATOM   887   C  C   . ALA A 1 157 ? 103.410 130.282 179.149 1.00 86.95  ? 158 ALA A C   1 
ATOM   888   O  O   . ALA A 1 157 ? 102.906 131.294 179.608 1.00 86.99  ? 158 ALA A O   1 
ATOM   889   C  CB  . ALA A 1 157 ? 102.051 128.240 179.006 1.00 86.35  ? 158 ALA A CB  1 
ATOM   890   N  N   . ALA A 1 158 ? 104.645 129.905 179.425 1.00 73.98  ? 159 ALA A N   1 
ATOM   891   C  CA  . ALA A 1 158 ? 105.455 130.692 180.318 1.00 74.62  ? 159 ALA A CA  1 
ATOM   892   C  C   . ALA A 1 158 ? 105.712 132.033 179.694 1.00 75.69  ? 159 ALA A C   1 
ATOM   893   O  O   . ALA A 1 158 ? 105.745 133.044 180.375 1.00 75.75  ? 159 ALA A O   1 
ATOM   894   C  CB  . ALA A 1 158 ? 106.742 129.997 180.587 1.00 74.41  ? 159 ALA A CB  1 
ATOM   895   N  N   . VAL A 1 159 ? 105.858 132.046 178.381 1.00 77.90  ? 160 VAL A N   1 
ATOM   896   C  CA  . VAL A 1 159 ? 106.127 133.303 177.709 1.00 79.13  ? 160 VAL A CA  1 
ATOM   897   C  C   . VAL A 1 159 ? 104.885 134.167 177.603 1.00 80.70  ? 160 VAL A C   1 
ATOM   898   O  O   . VAL A 1 159 ? 104.911 135.343 177.919 1.00 80.85  ? 160 VAL A O   1 
ATOM   899   C  CB  . VAL A 1 159 ? 106.710 133.073 176.317 1.00 78.88  ? 160 VAL A CB  1 
ATOM   900   C  CG1 . VAL A 1 159 ? 106.710 134.347 175.533 1.00 78.81  ? 160 VAL A CG1 1 
ATOM   901   C  CG2 . VAL A 1 159 ? 108.106 132.526 176.424 1.00 78.76  ? 160 VAL A CG2 1 
ATOM   902   N  N   . ARG A 1 160 ? 103.792 133.565 177.171 1.00 103.71 ? 161 ARG A N   1 
ATOM   903   C  CA  . ARG A 1 160 ? 102.572 134.301 176.887 1.00 105.14 ? 161 ARG A CA  1 
ATOM   904   C  C   . ARG A 1 160 ? 101.629 134.457 178.065 1.00 104.50 ? 161 ARG A C   1 
ATOM   905   O  O   . ARG A 1 160 ? 100.600 135.108 177.949 1.00 104.53 ? 161 ARG A O   1 
ATOM   906   C  CB  . ARG A 1 160 ? 101.836 133.698 175.693 1.00 106.88 ? 161 ARG A CB  1 
ATOM   907   C  CG  . ARG A 1 160 ? 102.618 133.767 174.407 1.00 108.40 ? 161 ARG A CG  1 
ATOM   908   C  CD  . ARG A 1 160 ? 101.723 133.841 173.189 1.00 109.76 ? 161 ARG A CD  1 
ATOM   909   N  NE  . ARG A 1 160 ? 102.509 133.911 171.964 1.00 110.89 ? 161 ARG A NE  1 
ATOM   910   C  CZ  . ARG A 1 160 ? 102.000 134.058 170.749 1.00 111.87 ? 161 ARG A CZ  1 
ATOM   911   N  NH1 . ARG A 1 160 ? 100.694 134.157 170.587 1.00 112.19 1 161 ARG A NH1 1 
ATOM   912   N  NH2 . ARG A 1 160 ? 102.801 134.108 169.695 1.00 112.19 ? 161 ARG A NH2 1 
ATOM   913   N  N   . GLY A 1 161 ? 101.977 133.869 179.199 1.00 98.85  ? 162 GLY A N   1 
ATOM   914   C  CA  . GLY A 1 161 ? 101.178 134.033 180.399 1.00 98.01  ? 162 GLY A CA  1 
ATOM   915   C  C   . GLY A 1 161 ? 99.936  133.185 180.603 1.00 97.02  ? 162 GLY A C   1 
ATOM   916   O  O   . GLY A 1 161 ? 98.953  133.661 181.147 1.00 96.98  ? 162 GLY A O   1 
ATOM   917   N  N   . TYR A 1 162 ? 99.959  131.947 180.134 1.00 84.28  ? 163 TYR A N   1 
ATOM   918   C  CA  . TYR A 1 162 ? 98.883  131.009 180.412 1.00 83.24  ? 163 TYR A CA  1 
ATOM   919   C  C   . TYR A 1 162 ? 99.221  130.070 181.551 1.00 82.13  ? 163 TYR A C   1 
ATOM   920   O  O   . TYR A 1 162 ? 100.374 129.739 181.755 1.00 82.04  ? 163 TYR A O   1 
ATOM   921   C  CB  . TYR A 1 162 ? 98.587  130.180 179.177 1.00 83.28  ? 163 TYR A CB  1 
ATOM   922   C  CG  . TYR A 1 162 ? 98.130  130.986 178.003 1.00 83.33  ? 163 TYR A CG  1 
ATOM   923   C  CD1 . TYR A 1 162 ? 98.939  131.163 176.910 1.00 83.33  ? 163 TYR A CD1 1 
ATOM   924   C  CD2 . TYR A 1 162 ? 96.889  131.571 177.990 1.00 83.35  ? 163 TYR A CD2 1 
ATOM   925   C  CE1 . TYR A 1 162 ? 98.524  131.897 175.835 1.00 83.35  ? 163 TYR A CE1 1 
ATOM   926   C  CE2 . TYR A 1 162 ? 96.468  132.308 176.922 1.00 83.37  ? 163 TYR A CE2 1 
ATOM   927   C  CZ  . TYR A 1 162 ? 97.288  132.468 175.847 1.00 83.37  ? 163 TYR A CZ  1 
ATOM   928   O  OH  . TYR A 1 162 ? 96.870  133.206 174.772 1.00 83.42  ? 163 TYR A OH  1 
ATOM   929   N  N   . ARG A 1 163 ? 98.215  129.649 182.307 1.00 84.46  ? 164 ARG A N   1 
ATOM   930   C  CA  . ARG A 1 163 ? 98.397  128.548 183.243 1.00 83.40  ? 164 ARG A CA  1 
ATOM   931   C  C   . ARG A 1 163 ? 98.517  127.273 182.442 1.00 82.19  ? 164 ARG A C   1 
ATOM   932   O  O   . ARG A 1 163 ? 97.825  127.112 181.456 1.00 82.14  ? 164 ARG A O   1 
ATOM   933   C  CB  . ARG A 1 163 ? 97.223  128.448 184.212 1.00 83.54  ? 164 ARG A CB  1 
ATOM   934   C  CG  . ARG A 1 163 ? 97.422  127.429 185.323 1.00 83.67  ? 164 ARG A CG  1 
ATOM   935   C  CD  . ARG A 1 163 ? 96.179  127.270 186.177 1.00 83.77  ? 164 ARG A CD  1 
ATOM   936   N  NE  . ARG A 1 163 ? 96.338  126.234 187.189 1.00 83.85  ? 164 ARG A NE  1 
ATOM   937   C  CZ  . ARG A 1 163 ? 95.342  125.721 187.898 1.00 83.91  ? 164 ARG A CZ  1 
ATOM   938   N  NH1 . ARG A 1 163 ? 94.109  126.143 187.707 1.00 83.94  1 164 ARG A NH1 1 
ATOM   939   N  NH2 . ARG A 1 163 ? 95.580  124.784 188.795 1.00 83.92  ? 164 ARG A NH2 1 
ATOM   940   N  N   . CYS A 1 164 ? 99.376  126.357 182.870 1.00 80.73  ? 165 CYS A N   1 
ATOM   941   C  CA  . CYS A 1 164 ? 99.631  125.157 182.086 1.00 79.55  ? 165 CYS A CA  1 
ATOM   942   C  C   . CYS A 1 164 ? 99.647  123.885 182.904 1.00 78.51  ? 165 CYS A C   1 
ATOM   943   O  O   . CYS A 1 164 ? 100.457 123.722 183.802 1.00 78.43  ? 165 CYS A O   1 
ATOM   944   C  CB  . CYS A 1 164 ? 100.944 125.283 181.328 1.00 79.49  ? 165 CYS A CB  1 
ATOM   945   S  SG  . CYS A 1 164 ? 101.252 123.944 180.197 1.00 79.45  ? 165 CYS A SG  1 
ATOM   946   N  N   . ILE A 1 165 ? 98.749  122.974 182.560 1.00 72.67  ? 166 ILE A N   1 
ATOM   947   C  CA  . ILE A 1 165 ? 98.628  121.688 183.222 1.00 71.72  ? 166 ILE A CA  1 
ATOM   948   C  C   . ILE A 1 165 ? 98.925  120.539 182.266 1.00 71.20  ? 166 ILE A C   1 
ATOM   949   O  O   . ILE A 1 165 ? 98.251  120.352 181.262 1.00 71.17  ? 166 ILE A O   1 
ATOM   950   C  CB  . ILE A 1 165 ? 97.231  121.508 183.818 1.00 71.41  ? 166 ILE A CB  1 
ATOM   951   C  CG1 . ILE A 1 165 ? 96.954  122.606 184.839 1.00 71.24  ? 166 ILE A CG1 1 
ATOM   952   C  CG2 . ILE A 1 165 ? 97.105  120.156 184.457 1.00 71.32  ? 166 ILE A CG2 1 
ATOM   953   C  CD1 . ILE A 1 165 ? 95.567  122.598 185.391 1.00 71.16  ? 166 ILE A CD1 1 
ATOM   954   N  N   . ILE A 1 166 ? 99.955  119.777 182.594 1.00 73.14  ? 167 ILE A N   1 
ATOM   955   C  CA  . ILE A 1 166 ? 100.419 118.698 181.751 1.00 72.74  ? 167 ILE A CA  1 
ATOM   956   C  C   . ILE A 1 166 ? 99.998  117.365 182.312 1.00 72.88  ? 167 ILE A C   1 
ATOM   957   O  O   . ILE A 1 166 ? 100.195 117.106 183.479 1.00 72.85  ? 167 ILE A O   1 
ATOM   958   C  CB  . ILE A 1 166 ? 101.939 118.715 181.667 1.00 72.37  ? 167 ILE A CB  1 
ATOM   959   C  CG1 . ILE A 1 166 ? 102.401 119.978 180.969 1.00 72.19  ? 167 ILE A CG1 1 
ATOM   960   C  CG2 . ILE A 1 166 ? 102.445 117.522 180.928 1.00 72.28  ? 167 ILE A CG2 1 
ATOM   961   C  CD1 . ILE A 1 166 ? 101.671 120.245 179.703 1.00 72.12  ? 167 ILE A CD1 1 
ATOM   962   N  N   . VAL A 1 167 ? 99.426  116.507 181.481 1.00 69.34  ? 168 VAL A N   1 
ATOM   963   C  CA  . VAL A 1 167 ? 99.097  115.171 181.935 1.00 69.68  ? 168 VAL A CA  1 
ATOM   964   C  C   . VAL A 1 167 ? 99.880  114.153 181.135 1.00 70.76  ? 168 VAL A C   1 
ATOM   965   O  O   . VAL A 1 167 ? 99.641  113.987 179.950 1.00 70.80  ? 168 VAL A O   1 
ATOM   966   C  CB  . VAL A 1 167 ? 97.608  114.883 181.800 1.00 69.14  ? 168 VAL A CB  1 
ATOM   967   C  CG1 . VAL A 1 167 ? 97.276  113.564 182.439 1.00 68.99  ? 168 VAL A CG1 1 
ATOM   968   C  CG2 . VAL A 1 167 ? 96.807  115.974 182.444 1.00 68.96  ? 168 VAL A CG2 1 
ATOM   969   N  N   . MET A 1 168 ? 100.821 113.475 181.783 1.00 87.83  ? 169 MET A N   1 
ATOM   970   C  CA  . MET A 1 168 ? 101.665 112.509 181.083 1.00 88.98  ? 169 MET A CA  1 
ATOM   971   C  C   . MET A 1 168 ? 101.817 111.172 181.802 1.00 89.74  ? 169 MET A C   1 
ATOM   972   O  O   . MET A 1 168 ? 101.682 111.093 183.005 1.00 89.68  ? 169 MET A O   1 
ATOM   973   C  CB  . MET A 1 168 ? 103.029 113.118 180.746 1.00 89.33  ? 169 MET A CB  1 
ATOM   974   C  CG  . MET A 1 168 ? 103.920 113.355 181.912 1.00 89.53  ? 169 MET A CG  1 
ATOM   975   S  SD  . MET A 1 168 ? 105.310 114.399 181.494 1.00 89.85  ? 169 MET A SD  1 
ATOM   976   C  CE  . MET A 1 168 ? 105.988 113.457 180.173 1.00 89.99  ? 169 MET A CE  1 
ATOM   977   N  N   . PRO A 1 169 ? 102.080 110.107 181.047 1.00 72.15  ? 170 PRO A N   1 
ATOM   978   C  CA  . PRO A 1 169 ? 102.201 108.761 181.585 1.00 72.76  ? 170 PRO A CA  1 
ATOM   979   C  C   . PRO A 1 169 ? 103.359 108.595 182.548 1.00 73.50  ? 170 PRO A C   1 
ATOM   980   O  O   . PRO A 1 169 ? 104.342 109.303 182.456 1.00 73.50  ? 170 PRO A O   1 
ATOM   981   C  CB  . PRO A 1 169 ? 102.426 107.922 180.336 1.00 72.62  ? 170 PRO A CB  1 
ATOM   982   C  CG  . PRO A 1 169 ? 101.747 108.655 179.293 1.00 72.46  ? 170 PRO A CG  1 
ATOM   983   C  CD  . PRO A 1 169 ? 101.991 110.079 179.583 1.00 72.29  ? 170 PRO A CD  1 
ATOM   984   N  N   . GLU A 1 170 ? 103.204 107.679 183.496 1.00 111.32 ? 171 GLU A N   1 
ATOM   985   C  CA  . GLU A 1 170 ? 104.209 107.438 184.522 1.00 112.04 ? 171 GLU A CA  1 
ATOM   986   C  C   . GLU A 1 170 ? 105.535 106.933 183.953 1.00 112.18 ? 171 GLU A C   1 
ATOM   987   O  O   . GLU A 1 170 ? 106.567 107.037 184.598 1.00 112.22 ? 171 GLU A O   1 
ATOM   988   C  CB  . GLU A 1 170 ? 103.669 106.483 185.601 1.00 112.49 ? 171 GLU A CB  1 
ATOM   989   C  CG  . GLU A 1 170 ? 103.376 105.078 185.114 1.00 112.77 ? 171 GLU A CG  1 
ATOM   990   C  CD  . GLU A 1 170 ? 102.560 104.262 186.089 1.00 112.96 ? 171 GLU A CD  1 
ATOM   991   O  OE1 . GLU A 1 170 ? 102.281 104.759 187.196 1.00 113.05 ? 171 GLU A OE1 1 
ATOM   992   O  OE2 . GLU A 1 170 ? 102.189 103.125 185.732 1.00 113.03 1 171 GLU A OE2 1 
ATOM   993   N  N   . LYS A 1 171 ? 105.494 106.367 182.753 1.00 79.47  ? 172 LYS A N   1 
ATOM   994   C  CA  . LYS A 1 171 ? 106.687 105.857 182.083 1.00 79.50  ? 172 LYS A CA  1 
ATOM   995   C  C   . LYS A 1 171 ? 107.699 106.905 181.658 1.00 79.56  ? 172 LYS A C   1 
ATOM   996   O  O   . LYS A 1 171 ? 108.887 106.634 181.590 1.00 79.56  ? 172 LYS A O   1 
ATOM   997   C  CB  . LYS A 1 171 ? 106.274 105.029 180.870 1.00 79.41  ? 172 LYS A CB  1 
ATOM   998   C  CG  . LYS A 1 171 ? 107.092 105.228 179.622 1.00 79.30  ? 172 LYS A CG  1 
ATOM   999   C  CD  . LYS A 1 171 ? 106.434 104.536 178.455 1.00 79.19  ? 172 LYS A CD  1 
ATOM   1000  C  CE  . LYS A 1 171 ? 107.127 104.844 177.157 1.00 79.12  ? 172 LYS A CE  1 
ATOM   1001  N  NZ  . LYS A 1 171 ? 106.504 104.126 176.024 1.00 79.07  1 172 LYS A NZ  1 
ATOM   1002  N  N   . MET A 1 172 ? 107.227 108.103 181.378 1.00 90.13  ? 173 MET A N   1 
ATOM   1003  C  CA  . MET A 1 172 ? 108.071 109.126 180.792 1.00 90.08  ? 173 MET A CA  1 
ATOM   1004  C  C   . MET A 1 172 ? 109.131 109.662 181.738 1.00 89.51  ? 173 MET A C   1 
ATOM   1005  O  O   . MET A 1 172 ? 108.954 109.662 182.946 1.00 89.50  ? 173 MET A O   1 
ATOM   1006  C  CB  . MET A 1 172 ? 107.216 110.261 180.266 1.00 90.43  ? 173 MET A CB  1 
ATOM   1007  C  CG  . MET A 1 172 ? 106.140 109.830 179.310 1.00 90.69  ? 173 MET A CG  1 
ATOM   1008  S  SD  . MET A 1 172 ? 106.791 109.105 177.816 1.00 90.90  ? 173 MET A SD  1 
ATOM   1009  C  CE  . MET A 1 172 ? 105.280 108.630 177.006 1.00 91.10  ? 173 MET A CE  1 
ATOM   1010  N  N   . SER A 1 173 ? 110.227 110.139 181.163 1.00 75.57  ? 174 SER A N   1 
ATOM   1011  C  CA  . SER A 1 173 ? 111.439 110.463 181.905 1.00 74.96  ? 174 SER A CA  1 
ATOM   1012  C  C   . SER A 1 173 ? 111.307 111.594 182.901 1.00 74.35  ? 174 SER A C   1 
ATOM   1013  O  O   . SER A 1 173 ? 110.561 112.533 182.696 1.00 74.29  ? 174 SER A O   1 
ATOM   1014  C  CB  . SER A 1 173 ? 112.557 110.805 180.940 1.00 74.94  ? 174 SER A CB  1 
ATOM   1015  O  OG  . SER A 1 173 ? 112.337 112.071 180.373 1.00 74.94  ? 174 SER A OG  1 
ATOM   1016  N  N   . SER A 1 174 ? 112.066 111.491 183.982 1.00 82.41  ? 175 SER A N   1 
ATOM   1017  C  CA  . SER A 1 174 ? 112.087 112.505 185.022 1.00 81.88  ? 175 SER A CA  1 
ATOM   1018  C  C   . SER A 1 174 ? 112.638 113.817 184.523 1.00 81.39  ? 175 SER A C   1 
ATOM   1019  O  O   . SER A 1 174 ? 112.346 114.863 185.076 1.00 81.33  ? 175 SER A O   1 
ATOM   1020  C  CB  . SER A 1 174 ? 112.910 112.029 186.215 1.00 81.86  ? 175 SER A CB  1 
ATOM   1021  O  OG  . SER A 1 174 ? 114.252 111.794 185.854 1.00 81.87  ? 175 SER A OG  1 
ATOM   1022  N  N   . GLU A 1 175 ? 113.453 113.755 183.486 1.00 80.29  ? 176 GLU A N   1 
ATOM   1023  C  CA  . GLU A 1 175 ? 114.033 114.956 182.932 1.00 79.91  ? 176 GLU A CA  1 
ATOM   1024  C  C   . GLU A 1 175 ? 112.954 115.871 182.390 1.00 79.92  ? 176 GLU A C   1 
ATOM   1025  O  O   . GLU A 1 175 ? 113.002 117.085 182.575 1.00 79.88  ? 176 GLU A O   1 
ATOM   1026  C  CB  . GLU A 1 175 ? 115.008 114.590 181.819 1.00 79.66  ? 176 GLU A CB  1 
ATOM   1027  C  CG  . GLU A 1 175 ? 116.323 113.993 182.281 1.00 79.52  ? 176 GLU A CG  1 
ATOM   1028  C  CD  . GLU A 1 175 ? 116.244 112.516 182.576 1.00 79.46  ? 176 GLU A CD  1 
ATOM   1029  O  OE1 . GLU A 1 175 ? 115.129 112.006 182.748 1.00 79.45  ? 176 GLU A OE1 1 
ATOM   1030  O  OE2 . GLU A 1 175 ? 117.300 111.858 182.629 1.00 79.47  1 176 GLU A OE2 1 
ATOM   1031  N  N   . LYS A 1 176 ? 111.952 115.283 181.757 1.00 74.62  ? 177 LYS A N   1 
ATOM   1032  C  CA  . LYS A 1 176 ? 110.864 116.065 181.210 1.00 74.67  ? 177 LYS A CA  1 
ATOM   1033  C  C   . LYS A 1 176 ? 110.116 116.726 182.344 1.00 74.59  ? 177 LYS A C   1 
ATOM   1034  O  O   . LYS A 1 176 ? 109.641 117.846 182.227 1.00 74.54  ? 177 LYS A O   1 
ATOM   1035  C  CB  . LYS A 1 176 ? 109.917 115.180 180.410 1.00 74.79  ? 177 LYS A CB  1 
ATOM   1036  C  CG  . LYS A 1 176 ? 110.532 114.508 179.218 1.00 74.90  ? 177 LYS A CG  1 
ATOM   1037  C  CD  . LYS A 1 176 ? 109.527 113.645 178.498 1.00 74.99  ? 177 LYS A CD  1 
ATOM   1038  C  CE  . LYS A 1 176 ? 110.163 112.834 177.397 1.00 75.07  ? 177 LYS A CE  1 
ATOM   1039  N  NZ  . LYS A 1 176 ? 109.220 111.856 176.812 1.00 75.10  1 177 LYS A NZ  1 
ATOM   1040  N  N   . VAL A 1 177 ? 110.033 116.023 183.457 1.00 76.28  ? 178 VAL A N   1 
ATOM   1041  C  CA  . VAL A 1 177 ? 109.320 116.538 184.597 1.00 76.18  ? 178 VAL A CA  1 
ATOM   1042  C  C   . VAL A 1 177 ? 110.069 117.708 185.169 1.00 75.98  ? 178 VAL A C   1 
ATOM   1043  O  O   . VAL A 1 177 ? 109.479 118.704 185.537 1.00 75.99  ? 178 VAL A O   1 
ATOM   1044  C  CB  . VAL A 1 177 ? 109.154 115.467 185.672 1.00 76.23  ? 178 VAL A CB  1 
ATOM   1045  C  CG1 . VAL A 1 177 ? 108.481 116.043 186.890 1.00 76.26  ? 178 VAL A CG1 1 
ATOM   1046  C  CG2 . VAL A 1 177 ? 108.355 114.318 185.128 1.00 76.20  ? 178 VAL A CG2 1 
ATOM   1047  N  N   . ASP A 1 178 ? 111.384 117.591 185.225 1.00 89.04  ? 179 ASP A N   1 
ATOM   1048  C  CA  . ASP A 1 178 ? 112.184 118.656 185.783 1.00 88.74  ? 179 ASP A CA  1 
ATOM   1049  C  C   . ASP A 1 178 ? 112.080 119.894 184.912 1.00 88.11  ? 179 ASP A C   1 
ATOM   1050  O  O   . ASP A 1 178 ? 111.983 121.013 185.414 1.00 88.06  ? 179 ASP A O   1 
ATOM   1051  C  CB  . ASP A 1 178 ? 113.641 118.219 185.922 1.00 88.95  ? 179 ASP A CB  1 
ATOM   1052  C  CG  . ASP A 1 178 ? 113.846 117.177 187.008 1.00 89.08  ? 179 ASP A CG  1 
ATOM   1053  O  OD1 . ASP A 1 178 ? 113.046 117.130 187.956 1.00 89.12  ? 179 ASP A OD1 1 
ATOM   1054  O  OD2 . ASP A 1 178 ? 114.822 116.409 186.919 1.00 89.13  1 179 ASP A OD2 1 
ATOM   1055  N  N   . VAL A 1 179 ? 112.046 119.695 183.603 1.00 72.91  ? 180 VAL A N   1 
ATOM   1056  C  CA  . VAL A 1 179 ? 111.960 120.839 182.716 1.00 72.31  ? 180 VAL A CA  1 
ATOM   1057  C  C   . VAL A 1 179 ? 110.602 121.499 182.808 1.00 72.16  ? 180 VAL A C   1 
ATOM   1058  O  O   . VAL A 1 179 ? 110.501 122.712 182.868 1.00 72.16  ? 180 VAL A O   1 
ATOM   1059  C  CB  . VAL A 1 179 ? 112.277 120.468 181.264 1.00 71.98  ? 180 VAL A CB  1 
ATOM   1060  C  CG1 . VAL A 1 179 ? 111.932 121.599 180.351 1.00 71.85  ? 180 VAL A CG1 1 
ATOM   1061  C  CG2 . VAL A 1 179 ? 113.730 120.145 181.118 1.00 71.90  ? 180 VAL A CG2 1 
ATOM   1062  N  N   . LEU A 1 180 ? 109.555 120.693 182.844 1.00 69.34  ? 181 LEU A N   1 
ATOM   1063  C  CA  . LEU A 1 180 ? 108.212 121.230 182.925 1.00 69.31  ? 181 LEU A CA  1 
ATOM   1064  C  C   . LEU A 1 180 ? 107.984 121.961 184.227 1.00 70.29  ? 181 LEU A C   1 
ATOM   1065  O  O   . LEU A 1 180 ? 107.257 122.940 184.284 1.00 70.34  ? 181 LEU A O   1 
ATOM   1066  C  CB  . LEU A 1 180 ? 107.196 120.106 182.799 1.00 68.61  ? 181 LEU A CB  1 
ATOM   1067  C  CG  . LEU A 1 180 ? 106.952 119.509 181.424 1.00 68.03  ? 181 LEU A CG  1 
ATOM   1068  C  CD1 . LEU A 1 180 ? 106.206 118.217 181.550 1.00 67.83  ? 181 LEU A CD1 1 
ATOM   1069  C  CD2 . LEU A 1 180 ? 106.159 120.471 180.617 1.00 67.85  ? 181 LEU A CD2 1 
ATOM   1070  N  N   . ARG A 1 181 ? 108.608 121.463 185.280 1.00 86.67  ? 182 ARG A N   1 
ATOM   1071  C  CA  . ARG A 1 181 ? 108.495 122.074 186.591 1.00 87.74  ? 182 ARG A CA  1 
ATOM   1072  C  C   . ARG A 1 181 ? 109.227 123.399 186.604 1.00 87.97  ? 182 ARG A C   1 
ATOM   1073  O  O   . ARG A 1 181 ? 108.771 124.362 187.203 1.00 88.01  ? 182 ARG A O   1 
ATOM   1074  C  CB  . ARG A 1 181 ? 109.041 121.124 187.656 1.00 88.45  ? 182 ARG A CB  1 
ATOM   1075  C  CG  . ARG A 1 181 ? 108.874 121.587 189.077 1.00 89.08  ? 182 ARG A CG  1 
ATOM   1076  C  CD  . ARG A 1 181 ? 108.593 120.428 190.025 1.00 89.59  ? 182 ARG A CD  1 
ATOM   1077  N  NE  . ARG A 1 181 ? 109.572 119.353 189.918 1.00 90.01  ? 182 ARG A NE  1 
ATOM   1078  C  CZ  . ARG A 1 181 ? 109.457 118.181 190.530 1.00 90.44  ? 182 ARG A CZ  1 
ATOM   1079  N  NH1 . ARG A 1 181 ? 108.403 117.937 191.286 1.00 90.58  1 182 ARG A NH1 1 
ATOM   1080  N  NH2 . ARG A 1 181 ? 110.387 117.251 190.381 1.00 90.57  ? 182 ARG A NH2 1 
ATOM   1081  N  N   . ALA A 1 182 ? 110.360 123.451 185.921 1.00 72.57  ? 183 ALA A N   1 
ATOM   1082  C  CA  . ALA A 1 182 ? 111.108 124.694 185.815 1.00 72.81  ? 183 ALA A CA  1 
ATOM   1083  C  C   . ALA A 1 182 ? 110.393 125.767 185.008 1.00 73.03  ? 183 ALA A C   1 
ATOM   1084  O  O   . ALA A 1 182 ? 110.590 126.951 185.234 1.00 73.04  ? 183 ALA A O   1 
ATOM   1085  C  CB  . ALA A 1 182 ? 112.461 124.432 185.235 1.00 72.81  ? 183 ALA A CB  1 
ATOM   1086  N  N   . LEU A 1 183 ? 109.577 125.341 184.052 1.00 75.68  ? 184 LEU A N   1 
ATOM   1087  C  CA  . LEU A 1 183 ? 108.851 126.255 183.179 1.00 75.85  ? 184 LEU A CA  1 
ATOM   1088  C  C   . LEU A 1 183 ? 107.576 126.754 183.826 1.00 75.87  ? 184 LEU A C   1 
ATOM   1089  O  O   . LEU A 1 183 ? 106.922 127.649 183.316 1.00 75.90  ? 184 LEU A O   1 
ATOM   1090  C  CB  . LEU A 1 183 ? 108.519 125.578 181.857 1.00 75.96  ? 184 LEU A CB  1 
ATOM   1091  C  CG  . LEU A 1 183 ? 109.685 125.269 180.938 1.00 76.04  ? 184 LEU A CG  1 
ATOM   1092  C  CD1 . LEU A 1 183 ? 109.248 124.304 179.890 1.00 76.08  ? 184 LEU A CD1 1 
ATOM   1093  C  CD2 . LEU A 1 183 ? 110.170 126.526 180.299 1.00 76.05  ? 184 LEU A CD2 1 
ATOM   1094  N  N   . GLY A 1 184 ? 107.229 126.165 184.960 1.00 77.79  ? 185 GLY A N   1 
ATOM   1095  C  CA  . GLY A 1 184 ? 106.072 126.599 185.711 1.00 77.77  ? 185 GLY A CA  1 
ATOM   1096  C  C   . GLY A 1 184 ? 104.792 125.845 185.451 1.00 77.70  ? 185 GLY A C   1 
ATOM   1097  O  O   . GLY A 1 184 ? 103.725 126.294 185.835 1.00 77.70  ? 185 GLY A O   1 
ATOM   1098  N  N   . ALA A 1 185 ? 104.883 124.710 184.779 1.00 78.72  ? 186 ALA A N   1 
ATOM   1099  C  CA  . ALA A 1 185 ? 103.695 123.918 184.509 1.00 78.58  ? 186 ALA A CA  1 
ATOM   1100  C  C   . ALA A 1 185 ? 103.294 123.057 185.688 1.00 78.28  ? 186 ALA A C   1 
ATOM   1101  O  O   . ALA A 1 185 ? 104.136 122.506 186.369 1.00 78.28  ? 186 ALA A O   1 
ATOM   1102  C  CB  . ALA A 1 185 ? 103.916 123.054 183.301 1.00 78.64  ? 186 ALA A CB  1 
ATOM   1103  N  N   . GLU A 1 186 ? 101.999 122.935 185.928 1.00 87.79  ? 187 GLU A N   1 
ATOM   1104  C  CA  . GLU A 1 186 ? 101.515 121.946 186.868 1.00 87.35  ? 187 GLU A CA  1 
ATOM   1105  C  C   . GLU A 1 186 ? 101.586 120.590 186.197 1.00 86.25  ? 187 GLU A C   1 
ATOM   1106  O  O   . GLU A 1 186 ? 101.382 120.494 185.003 1.00 86.20  ? 187 GLU A O   1 
ATOM   1107  C  CB  . GLU A 1 186 ? 100.097 122.287 187.314 1.00 87.86  ? 187 GLU A CB  1 
ATOM   1108  C  CG  . GLU A 1 186 ? 100.018 123.606 188.059 1.00 88.18  ? 187 GLU A CG  1 
ATOM   1109  C  CD  . GLU A 1 186 ? 98.609  124.062 188.349 1.00 88.37  ? 187 GLU A CD  1 
ATOM   1110  O  OE1 . GLU A 1 186 ? 98.402  125.282 188.484 1.00 88.43  ? 187 GLU A OE1 1 
ATOM   1111  O  OE2 . GLU A 1 186 ? 97.710  123.211 188.450 1.00 88.40  1 187 GLU A OE2 1 
ATOM   1112  N  N   . ILE A 1 187 ? 101.871 119.541 186.957 1.00 75.19  ? 188 ILE A N   1 
ATOM   1113  C  CA  . ILE A 1 187 ? 102.104 118.229 186.367 1.00 74.05  ? 188 ILE A CA  1 
ATOM   1114  C  C   . ILE A 1 187 ? 101.281 117.121 187.010 1.00 72.80  ? 188 ILE A C   1 
ATOM   1115  O  O   . ILE A 1 187 ? 101.172 117.044 188.218 1.00 72.76  ? 188 ILE A O   1 
ATOM   1116  C  CB  . ILE A 1 187 ? 103.571 117.836 186.469 1.00 74.15  ? 188 ILE A CB  1 
ATOM   1117  C  CG1 . ILE A 1 187 ? 104.459 118.919 185.886 1.00 74.22  ? 188 ILE A CG1 1 
ATOM   1118  C  CG2 . ILE A 1 187 ? 103.824 116.558 185.737 1.00 74.15  ? 188 ILE A CG2 1 
ATOM   1119  C  CD1 . ILE A 1 187 ? 105.909 118.646 186.073 1.00 74.25  ? 188 ILE A CD1 1 
ATOM   1120  N  N   . VAL A 1 188 ? 100.714 116.257 186.179 1.00 65.12  ? 189 VAL A N   1 
ATOM   1121  C  CA  . VAL A 1 188 ? 99.912  115.137 186.628 1.00 64.02  ? 189 VAL A CA  1 
ATOM   1122  C  C   . VAL A 1 188 ? 100.347 113.921 185.848 1.00 63.50  ? 189 VAL A C   1 
ATOM   1123  O  O   . VAL A 1 188 ? 100.641 114.010 184.669 1.00 63.45  ? 189 VAL A O   1 
ATOM   1124  C  CB  . VAL A 1 188 ? 98.432  115.382 186.359 1.00 63.60  ? 189 VAL A CB  1 
ATOM   1125  C  CG1 . VAL A 1 188 ? 97.624  114.175 186.707 1.00 63.46  ? 189 VAL A CG1 1 
ATOM   1126  C  CG2 . VAL A 1 188 ? 97.948  116.552 187.149 1.00 63.50  ? 189 VAL A CG2 1 
ATOM   1127  N  N   . ARG A 1 189 ? 100.396 112.781 186.513 1.00 64.48  ? 190 ARG A N   1 
ATOM   1128  C  CA  . ARG A 1 189 ? 100.822 111.563 185.866 1.00 64.23  ? 190 ARG A CA  1 
ATOM   1129  C  C   . ARG A 1 189 ? 99.720  110.531 185.778 1.00 65.29  ? 190 ARG A C   1 
ATOM   1130  O  O   . ARG A 1 189 ? 98.792  110.547 186.562 1.00 65.44  ? 190 ARG A O   1 
ATOM   1131  C  CB  . ARG A 1 189 ? 102.030 110.988 186.576 1.00 63.28  ? 190 ARG A CB  1 
ATOM   1132  C  CG  . ARG A 1 189 ? 103.129 111.980 186.740 1.00 62.60  ? 190 ARG A CG  1 
ATOM   1133  C  CD  . ARG A 1 189 ? 103.552 112.542 185.417 1.00 62.07  ? 190 ARG A CD  1 
ATOM   1134  N  NE  . ARG A 1 189 ? 104.260 111.556 184.627 1.00 61.69  ? 190 ARG A NE  1 
ATOM   1135  C  CZ  . ARG A 1 189 ? 105.537 111.272 184.785 1.00 61.34  ? 190 ARG A CZ  1 
ATOM   1136  N  NH1 . ARG A 1 189 ? 106.236 111.904 185.701 1.00 61.23  1 190 ARG A NH1 1 
ATOM   1137  N  NH2 . ARG A 1 189 ? 106.111 110.357 184.031 1.00 61.25  ? 190 ARG A NH2 1 
ATOM   1138  N  N   . THR A 1 190 ? 99.824  109.643 184.799 1.00 69.56  ? 191 THR A N   1 
ATOM   1139  C  CA  . THR A 1 190 ? 98.868  108.555 184.642 1.00 70.73  ? 191 THR A CA  1 
ATOM   1140  C  C   . THR A 1 190 ? 99.594  107.243 184.449 1.00 72.04  ? 191 THR A C   1 
ATOM   1141  O  O   . THR A 1 190 ? 100.712 107.228 183.974 1.00 72.23  ? 191 THR A O   1 
ATOM   1142  C  CB  . THR A 1 190 ? 97.967  108.771 183.443 1.00 70.68  ? 191 THR A CB  1 
ATOM   1143  O  OG1 . THR A 1 190 ? 98.758  108.809 182.257 1.00 70.72  ? 191 THR A OG1 1 
ATOM   1144  C  CG2 . THR A 1 190 ? 97.204  110.053 183.579 1.00 70.68  ? 191 THR A CG2 1 
ATOM   1145  N  N   . PRO A 1 191 ? 98.967  106.131 184.835 1.00 74.74  ? 192 PRO A N   1 
ATOM   1146  C  CA  . PRO A 1 191 ? 99.627  104.844 184.652 1.00 75.79  ? 192 PRO A CA  1 
ATOM   1147  C  C   . PRO A 1 191 ? 99.909  104.534 183.199 1.00 77.14  ? 192 PRO A C   1 
ATOM   1148  O  O   . PRO A 1 191 ? 99.122  104.874 182.335 1.00 77.27  ? 192 PRO A O   1 
ATOM   1149  C  CB  . PRO A 1 191 ? 98.633  103.849 185.249 1.00 75.52  ? 192 PRO A CB  1 
ATOM   1150  C  CG  . PRO A 1 191 ? 97.388  104.581 185.420 1.00 75.26  ? 192 PRO A CG  1 
ATOM   1151  C  CD  . PRO A 1 191 ? 97.735  105.994 185.615 1.00 74.99  ? 192 PRO A CD  1 
ATOM   1152  N  N   . THR A 1 192 ? 101.043 103.899 182.944 1.00 76.77  ? 193 THR A N   1 
ATOM   1153  C  CA  . THR A 1 192 ? 101.489 103.652 181.585 1.00 78.03  ? 193 THR A CA  1 
ATOM   1154  C  C   . THR A 1 192 ? 100.601 102.683 180.841 1.00 78.72  ? 193 THR A C   1 
ATOM   1155  O  O   . THR A 1 192 ? 100.326 102.861 179.665 1.00 78.82  ? 193 THR A O   1 
ATOM   1156  C  CB  . THR A 1 192 ? 102.907 103.090 181.567 1.00 78.42  ? 193 THR A CB  1 
ATOM   1157  O  OG1 . THR A 1 192 ? 103.771 103.957 182.297 1.00 78.49  ? 193 THR A OG1 1 
ATOM   1158  C  CG2 . THR A 1 192 ? 103.410 102.975 180.158 1.00 78.63  ? 193 THR A CG2 1 
ATOM   1159  N  N   . ASN A 1 193 ? 100.137 101.660 181.534 1.00 87.33  ? 194 ASN A N   1 
ATOM   1160  C  CA  . ASN A 1 193 ? 99.390  100.613 180.873 1.00 87.78  ? 194 ASN A CA  1 
ATOM   1161  C  C   . ASN A 1 193 ? 97.897  100.840 180.905 1.00 87.54  ? 194 ASN A C   1 
ATOM   1162  O  O   . ASN A 1 193 ? 97.123  99.980  180.508 1.00 87.55  ? 194 ASN A O   1 
ATOM   1163  C  CB  . ASN A 1 193 ? 99.762  99.239  181.420 1.00 88.24  ? 194 ASN A CB  1 
ATOM   1164  C  CG  . ASN A 1 193 ? 99.690  99.175  182.907 1.00 88.55  ? 194 ASN A CG  1 
ATOM   1165  O  OD1 . ASN A 1 193 ? 99.842  100.180 183.582 1.00 88.62  ? 194 ASN A OD1 1 
ATOM   1166  N  ND2 . ASN A 1 193 ? 99.457  97.987  183.436 1.00 88.77  ? 194 ASN A ND2 1 
ATOM   1167  N  N   . ALA A 1 194 ? 97.492  102.003 181.389 1.00 71.88  ? 195 ALA A N   1 
ATOM   1168  C  CA  . ALA A 1 194 ? 96.088  102.347 181.386 1.00 71.55  ? 195 ALA A CA  1 
ATOM   1169  C  C   . ALA A 1 194 ? 95.599  102.416 179.965 1.00 71.42  ? 195 ALA A C   1 
ATOM   1170  O  O   . ALA A 1 194 ? 96.228  103.029 179.127 1.00 71.40  ? 195 ALA A O   1 
ATOM   1171  C  CB  . ALA A 1 194 ? 95.880  103.666 182.061 1.00 71.43  ? 195 ALA A CB  1 
ATOM   1172  N  N   . ARG A 1 195 ? 94.463  101.796 179.699 1.00 80.00  ? 196 ARG A N   1 
ATOM   1173  C  CA  . ARG A 1 195 ? 93.882  101.837 178.376 1.00 79.92  ? 196 ARG A CA  1 
ATOM   1174  C  C   . ARG A 1 195 ? 93.406  103.239 178.116 1.00 79.60  ? 196 ARG A C   1 
ATOM   1175  O  O   . ARG A 1 195 ? 92.982  103.922 179.032 1.00 79.60  ? 196 ARG A O   1 
ATOM   1176  C  CB  . ARG A 1 195 ? 92.713  100.869 178.280 1.00 80.16  ? 196 ARG A CB  1 
ATOM   1177  C  CG  . ARG A 1 195 ? 93.086  99.414  178.403 1.00 80.34  ? 196 ARG A CG  1 
ATOM   1178  C  CD  . ARG A 1 195 ? 93.260  98.789  177.048 1.00 80.52  ? 196 ARG A CD  1 
ATOM   1179  N  NE  . ARG A 1 195 ? 92.105  99.024  176.196 1.00 80.73  ? 196 ARG A NE  1 
ATOM   1180  C  CZ  . ARG A 1 195 ? 92.115  98.873  174.883 1.00 80.97  ? 196 ARG A CZ  1 
ATOM   1181  N  NH1 . ARG A 1 195 ? 93.224  98.493  174.278 1.00 81.09  1 196 ARG A NH1 1 
ATOM   1182  N  NH2 . ARG A 1 195 ? 91.025  99.114  174.180 1.00 81.08  ? 196 ARG A NH2 1 
ATOM   1183  N  N   . PHE A 1 196 ? 93.474  103.669 176.868 1.00 75.16  ? 197 PHE A N   1 
ATOM   1184  C  CA  . PHE A 1 196 ? 93.066  105.015 176.519 1.00 74.92  ? 197 PHE A CA  1 
ATOM   1185  C  C   . PHE A 1 196 ? 91.590  105.230 176.788 1.00 75.64  ? 197 PHE A C   1 
ATOM   1186  O  O   . PHE A 1 196 ? 91.152  106.335 177.051 1.00 75.67  ? 197 PHE A O   1 
ATOM   1187  C  CB  . PHE A 1 196 ? 93.393  105.304 175.062 1.00 74.22  ? 197 PHE A CB  1 
ATOM   1188  C  CG  . PHE A 1 196 ? 92.446  104.684 174.092 1.00 73.55  ? 197 PHE A CG  1 
ATOM   1189  C  CD1 . PHE A 1 196 ? 91.507  105.448 173.444 1.00 73.23  ? 197 PHE A CD1 1 
ATOM   1190  C  CD2 . PHE A 1 196 ? 92.498  103.346 173.815 1.00 73.14  ? 197 PHE A CD2 1 
ATOM   1191  C  CE1 . PHE A 1 196 ? 90.641  104.886 172.551 1.00 72.99  ? 197 PHE A CE1 1 
ATOM   1192  C  CE2 . PHE A 1 196 ? 91.630  102.787 172.918 1.00 72.93  ? 197 PHE A CE2 1 
ATOM   1193  C  CZ  . PHE A 1 196 ? 90.703  103.560 172.287 1.00 72.90  ? 197 PHE A CZ  1 
ATOM   1194  N  N   . ASP A 1 197 ? 90.833  104.146 176.711 1.00 100.40 ? 198 ASP A N   1 
ATOM   1195  C  CA  . ASP A 1 197 ? 89.416  104.135 177.032 1.00 101.05 ? 198 ASP A CA  1 
ATOM   1196  C  C   . ASP A 1 197 ? 89.163  104.406 178.498 1.00 101.31 ? 198 ASP A C   1 
ATOM   1197  O  O   . ASP A 1 197 ? 88.142  104.962 178.868 1.00 101.36 ? 198 ASP A O   1 
ATOM   1198  C  CB  . ASP A 1 197 ? 88.832  102.756 176.730 1.00 101.28 ? 198 ASP A CB  1 
ATOM   1199  C  CG  . ASP A 1 197 ? 88.799  102.436 175.262 1.00 101.37 ? 198 ASP A CG  1 
ATOM   1200  O  OD1 . ASP A 1 197 ? 88.383  103.302 174.477 1.00 101.38 ? 198 ASP A OD1 1 
ATOM   1201  O  OD2 . ASP A 1 197 ? 89.178  101.308 174.897 1.00 101.41 1 198 ASP A OD2 1 
ATOM   1202  N  N   . SER A 1 198 ? 90.097  103.984 179.330 1.00 80.25  ? 199 SER A N   1 
ATOM   1203  C  CA  . SER A 1 198 ? 89.914  104.007 180.765 1.00 80.46  ? 199 SER A CA  1 
ATOM   1204  C  C   . SER A 1 198 ? 89.989  105.413 181.316 1.00 80.68  ? 199 SER A C   1 
ATOM   1205  O  O   . SER A 1 198 ? 90.613  106.271 180.723 1.00 80.68  ? 199 SER A O   1 
ATOM   1206  C  CB  . SER A 1 198 ? 90.959  103.126 181.429 1.00 80.45  ? 199 SER A CB  1 
ATOM   1207  O  OG  . SER A 1 198 ? 92.222  103.738 181.379 1.00 80.43  ? 199 SER A OG  1 
ATOM   1208  N  N   . PRO A 1 199 ? 89.333  105.658 182.451 1.00 75.71  ? 200 PRO A N   1 
ATOM   1209  C  CA  . PRO A 1 199 ? 89.378  106.933 183.158 1.00 75.98  ? 200 PRO A CA  1 
ATOM   1210  C  C   . PRO A 1 199 ? 90.780  107.333 183.578 1.00 76.45  ? 200 PRO A C   1 
ATOM   1211  O  O   . PRO A 1 199 ? 91.050  108.509 183.757 1.00 76.48  ? 200 PRO A O   1 
ATOM   1212  C  CB  . PRO A 1 199 ? 88.490  106.689 184.374 1.00 75.82  ? 200 PRO A CB  1 
ATOM   1213  C  CG  . PRO A 1 199 ? 88.376  105.256 184.492 1.00 75.72  ? 200 PRO A CG  1 
ATOM   1214  C  CD  . PRO A 1 199 ? 88.426  104.722 183.123 1.00 75.68  ? 200 PRO A CD  1 
ATOM   1215  N  N   . GLU A 1 200 ? 91.646  106.357 183.788 1.00 99.52  ? 201 GLU A N   1 
ATOM   1216  C  CA  . GLU A 1 200 ? 92.992  106.627 184.265 1.00 99.92  ? 201 GLU A CA  1 
ATOM   1217  C  C   . GLU A 1 200 ? 94.008  107.018 183.188 1.00 99.76  ? 201 GLU A C   1 
ATOM   1218  O  O   . GLU A 1 200 ? 95.147  107.319 183.498 1.00 99.65  ? 201 GLU A O   1 
ATOM   1219  C  CB  . GLU A 1 200 ? 93.511  105.440 185.067 1.00 100.31 ? 201 GLU A CB  1 
ATOM   1220  C  CG  . GLU A 1 200 ? 92.734  105.172 186.325 1.00 100.56 ? 201 GLU A CG  1 
ATOM   1221  C  CD  . GLU A 1 200 ? 91.435  104.477 186.055 1.00 100.69 ? 201 GLU A CD  1 
ATOM   1222  O  OE1 . GLU A 1 200 ? 91.356  103.788 185.028 1.00 100.76 ? 201 GLU A OE1 1 
ATOM   1223  O  OE2 . GLU A 1 200 ? 90.495  104.623 186.859 1.00 100.77 1 201 GLU A OE2 1 
ATOM   1224  N  N   . SER A 1 201 ? 93.602  106.995 181.927 1.00 83.15  ? 202 SER A N   1 
ATOM   1225  C  CA  . SER A 1 201 ? 94.494  107.345 180.829 1.00 82.94  ? 202 SER A CA  1 
ATOM   1226  C  C   . SER A 1 201 ? 94.786  108.825 180.817 1.00 82.62  ? 202 SER A C   1 
ATOM   1227  O  O   . SER A 1 201 ? 94.023  109.611 181.349 1.00 82.61  ? 202 SER A O   1 
ATOM   1228  C  CB  . SER A 1 201 ? 93.894  106.938 179.495 1.00 82.98  ? 202 SER A CB  1 
ATOM   1229  O  OG  . SER A 1 201 ? 92.912  107.858 179.086 1.00 83.01  ? 202 SER A OG  1 
ATOM   1230  N  N   . HIS A 1 202 ? 95.905  109.206 180.220 1.00 80.95  ? 203 HIS A N   1 
ATOM   1231  C  CA  . HIS A 1 202 ? 96.286  110.603 180.209 1.00 80.65  ? 203 HIS A CA  1 
ATOM   1232  C  C   . HIS A 1 202 ? 95.252  111.444 179.501 1.00 81.17  ? 203 HIS A C   1 
ATOM   1233  O  O   . HIS A 1 202 ? 94.965  112.564 179.904 1.00 81.10  ? 203 HIS A O   1 
ATOM   1234  C  CB  . HIS A 1 202 ? 97.685  110.799 179.619 1.00 80.12  ? 203 HIS A CB  1 
ATOM   1235  C  CG  . HIS A 1 202 ? 97.811  110.423 178.180 1.00 79.64  ? 203 HIS A CG  1 
ATOM   1236  N  ND1 . HIS A 1 202 ? 97.476  109.178 177.703 1.00 79.43  ? 203 HIS A ND1 1 
ATOM   1237  C  CD2 . HIS A 1 202 ? 98.277  111.120 177.120 1.00 79.33  ? 203 HIS A CD2 1 
ATOM   1238  C  CE1 . HIS A 1 202 ? 97.710  109.132 176.406 1.00 79.27  ? 203 HIS A CE1 1 
ATOM   1239  N  NE2 . HIS A 1 202 ? 98.195  110.297 176.028 1.00 79.24  ? 203 HIS A NE2 1 
ATOM   1240  N  N   . VAL A 1 203 ? 94.642  110.873 178.481 1.00 91.81  ? 204 VAL A N   1 
ATOM   1241  C  CA  . VAL A 1 203 ? 93.580  111.555 177.775 1.00 92.33  ? 204 VAL A CA  1 
ATOM   1242  C  C   . VAL A 1 203 ? 92.364  111.727 178.670 1.00 92.35  ? 204 VAL A C   1 
ATOM   1243  O  O   . VAL A 1 203 ? 91.800  112.822 178.791 1.00 92.42  ? 204 VAL A O   1 
ATOM   1244  C  CB  . VAL A 1 203 ? 93.188  110.774 176.530 1.00 92.71  ? 204 VAL A CB  1 
ATOM   1245  C  CG1 . VAL A 1 203 ? 91.929  111.344 175.929 1.00 92.86  ? 204 VAL A CG1 1 
ATOM   1246  C  CG2 . VAL A 1 203 ? 94.319  110.795 175.529 1.00 92.81  ? 204 VAL A CG2 1 
ATOM   1247  N  N   . GLY A 1 204 ? 91.988  110.648 179.336 1.00 79.80  ? 205 GLY A N   1 
ATOM   1248  C  CA  . GLY A 1 204 ? 90.809  110.680 180.162 1.00 79.75  ? 205 GLY A CA  1 
ATOM   1249  C  C   . GLY A 1 204 ? 90.993  111.590 181.346 1.00 79.72  ? 205 GLY A C   1 
ATOM   1250  O  O   . GLY A 1 204 ? 90.112  112.368 181.673 1.00 79.74  ? 205 GLY A O   1 
ATOM   1251  N  N   . VAL A 1 205 ? 92.152  111.520 181.979 1.00 77.23  ? 206 VAL A N   1 
ATOM   1252  C  CA  . VAL A 1 205 ? 92.417  112.380 183.117 1.00 77.27  ? 206 VAL A CA  1 
ATOM   1253  C  C   . VAL A 1 205 ? 92.455  113.827 182.686 1.00 77.96  ? 206 VAL A C   1 
ATOM   1254  O  O   . VAL A 1 205 ? 92.014  114.703 183.407 1.00 77.98  ? 206 VAL A O   1 
ATOM   1255  C  CB  . VAL A 1 205 ? 93.719  111.995 183.822 1.00 76.79  ? 206 VAL A CB  1 
ATOM   1256  C  CG1 . VAL A 1 205 ? 94.071  113.006 184.871 1.00 76.67  ? 206 VAL A CG1 1 
ATOM   1257  C  CG2 . VAL A 1 205 ? 93.574  110.644 184.451 1.00 76.59  ? 206 VAL A CG2 1 
ATOM   1258  N  N   . ALA A 1 206 ? 92.943  114.075 181.483 1.00 77.06  ? 207 ALA A N   1 
ATOM   1259  C  CA  . ALA A 1 206 ? 92.991  115.439 181.002 1.00 77.91  ? 207 ALA A CA  1 
ATOM   1260  C  C   . ALA A 1 206 ? 91.596  115.983 180.872 1.00 79.06  ? 207 ALA A C   1 
ATOM   1261  O  O   . ALA A 1 206 ? 91.310  117.099 181.285 1.00 79.09  ? 207 ALA A O   1 
ATOM   1262  C  CB  . ALA A 1 206 ? 93.685  115.497 179.677 1.00 77.77  ? 207 ALA A CB  1 
ATOM   1263  N  N   . TRP A 1 207 ? 90.708  115.179 180.317 1.00 95.76  ? 208 TRP A N   1 
ATOM   1264  C  CA  . TRP A 1 207 ? 89.347  115.649 180.185 1.00 97.01  ? 208 TRP A CA  1 
ATOM   1265  C  C   . TRP A 1 207 ? 88.677  115.837 181.539 1.00 96.76  ? 208 TRP A C   1 
ATOM   1266  O  O   . TRP A 1 207 ? 87.989  116.827 181.767 1.00 96.79  ? 208 TRP A O   1 
ATOM   1267  C  CB  . TRP A 1 207 ? 88.538  114.720 179.280 1.00 98.21  ? 208 TRP A CB  1 
ATOM   1268  C  CG  . TRP A 1 207 ? 88.782  114.969 177.833 1.00 99.40  ? 208 TRP A CG  1 
ATOM   1269  C  CD1 . TRP A 1 207 ? 89.663  114.324 177.031 1.00 99.88  ? 208 TRP A CD1 1 
ATOM   1270  C  CD2 . TRP A 1 207 ? 88.143  115.949 177.020 1.00 100.25 ? 208 TRP A CD2 1 
ATOM   1271  N  NE1 . TRP A 1 207 ? 89.611  114.834 175.762 1.00 100.31 ? 208 TRP A NE1 1 
ATOM   1272  C  CE2 . TRP A 1 207 ? 88.683  115.837 175.731 1.00 100.54 ? 208 TRP A CE2 1 
ATOM   1273  C  CE3 . TRP A 1 207 ? 87.162  116.910 177.258 1.00 100.69 ? 208 TRP A CE3 1 
ATOM   1274  C  CZ2 . TRP A 1 207 ? 88.278  116.647 174.684 1.00 100.90 ? 208 TRP A CZ2 1 
ATOM   1275  C  CZ3 . TRP A 1 207 ? 86.763  117.715 176.220 1.00 100.97 ? 208 TRP A CZ3 1 
ATOM   1276  C  CH2 . TRP A 1 207 ? 87.321  117.581 174.947 1.00 101.04 ? 208 TRP A CH2 1 
ATOM   1277  N  N   . ARG A 1 208 ? 88.923  114.914 182.455 1.00 91.24  ? 209 ARG A N   1 
ATOM   1278  C  CA  . ARG A 1 208 ? 88.290  114.996 183.755 1.00 91.02  ? 209 ARG A CA  1 
ATOM   1279  C  C   . ARG A 1 208 ? 88.749  116.230 184.497 1.00 90.67  ? 209 ARG A C   1 
ATOM   1280  O  O   . ARG A 1 208 ? 87.986  116.843 185.226 1.00 90.67  ? 209 ARG A O   1 
ATOM   1281  C  CB  . ARG A 1 208 ? 88.558  113.737 184.580 1.00 91.15  ? 209 ARG A CB  1 
ATOM   1282  C  CG  . ARG A 1 208 ? 87.824  112.505 184.094 1.00 91.27  ? 209 ARG A CG  1 
ATOM   1283  C  CD  . ARG A 1 208 ? 87.767  111.418 185.151 1.00 91.38  ? 209 ARG A CD  1 
ATOM   1284  N  NE  . ARG A 1 208 ? 89.063  110.801 185.399 1.00 91.47  ? 209 ARG A NE  1 
ATOM   1285  C  CZ  . ARG A 1 208 ? 89.328  110.004 186.428 1.00 91.56  ? 209 ARG A CZ  1 
ATOM   1286  N  NH1 . ARG A 1 208 ? 88.392  109.734 187.318 1.00 91.59  1 209 ARG A NH1 1 
ATOM   1287  N  NH2 . ARG A 1 208 ? 90.537  109.491 186.576 1.00 91.59  ? 209 ARG A NH2 1 
ATOM   1288  N  N   . LEU A 1 209 ? 90.002  116.600 184.299 1.00 80.93  ? 210 LEU A N   1 
ATOM   1289  C  CA  . LEU A 1 209 ? 90.505  117.821 184.883 1.00 80.67  ? 210 LEU A CA  1 
ATOM   1290  C  C   . LEU A 1 209 ? 89.849  119.010 184.227 1.00 81.58  ? 210 LEU A C   1 
ATOM   1291  O  O   . LEU A 1 209 ? 89.525  119.985 184.886 1.00 81.63  ? 210 LEU A O   1 
ATOM   1292  C  CB  . LEU A 1 209 ? 92.013  117.916 184.714 1.00 79.86  ? 210 LEU A CB  1 
ATOM   1293  C  CG  . LEU A 1 209 ? 92.858  116.904 185.471 1.00 79.20  ? 210 LEU A CG  1 
ATOM   1294  C  CD1 . LEU A 1 209 ? 94.293  117.049 185.075 1.00 78.96  ? 210 LEU A CD1 1 
ATOM   1295  C  CD2 . LEU A 1 209 ? 92.705  117.095 186.949 1.00 79.03  ? 210 LEU A CD2 1 
ATOM   1296  N  N   . LYS A 1 210 ? 89.640  118.926 182.921 1.00 94.33  ? 211 LYS A N   1 
ATOM   1297  C  CA  . LYS A 1 210 ? 89.071  120.055 182.207 1.00 95.30  ? 211 LYS A CA  1 
ATOM   1298  C  C   . LYS A 1 210 ? 87.669  120.344 182.697 1.00 96.71  ? 211 LYS A C   1 
ATOM   1299  O  O   . LYS A 1 210 ? 87.271  121.497 182.814 1.00 96.85  ? 211 LYS A O   1 
ATOM   1300  C  CB  . LYS A 1 210 ? 89.054  119.784 180.706 1.00 95.03  ? 211 LYS A CB  1 
ATOM   1301  C  CG  . LYS A 1 210 ? 88.517  120.916 179.855 1.00 94.81  ? 211 LYS A CG  1 
ATOM   1302  C  CD  . LYS A 1 210 ? 87.061  120.724 179.540 1.00 94.68  ? 211 LYS A CD  1 
ATOM   1303  C  CE  . LYS A 1 210 ? 86.474  121.936 178.862 1.00 94.57  ? 211 LYS A CE  1 
ATOM   1304  N  NZ  . LYS A 1 210 ? 86.826  121.974 177.425 1.00 94.53  1 211 LYS A NZ  1 
ATOM   1305  N  N   . ASN A 1 211 ? 86.927  119.292 183.011 1.00 108.46 ? 212 ASN A N   1 
ATOM   1306  C  CA  . ASN A 1 211 ? 85.546  119.468 183.430 1.00 109.75 ? 212 ASN A CA  1 
ATOM   1307  C  C   . ASN A 1 211 ? 85.415  120.181 184.761 1.00 110.34 ? 212 ASN A C   1 
ATOM   1308  O  O   . ASN A 1 211 ? 84.419  120.841 185.011 1.00 110.44 ? 212 ASN A O   1 
ATOM   1309  C  CB  . ASN A 1 211 ? 84.808  118.132 183.464 1.00 110.21 ? 212 ASN A CB  1 
ATOM   1310  C  CG  . ASN A 1 211 ? 84.512  117.594 182.080 1.00 110.51 ? 212 ASN A CG  1 
ATOM   1311  O  OD1 . ASN A 1 211 ? 84.405  118.350 181.122 1.00 110.59 ? 212 ASN A OD1 1 
ATOM   1312  N  ND2 . ASN A 1 211 ? 84.376  116.279 181.972 1.00 110.74 ? 212 ASN A ND2 1 
ATOM   1313  N  N   . GLU A 1 212 ? 86.422  120.047 185.613 1.00 103.48 ? 213 GLU A N   1 
ATOM   1314  C  CA  . GLU A 1 212 ? 86.384  120.659 186.936 1.00 103.86 ? 213 GLU A CA  1 
ATOM   1315  C  C   . GLU A 1 212 ? 86.993  122.057 187.041 1.00 103.51 ? 213 GLU A C   1 
ATOM   1316  O  O   . GLU A 1 212 ? 86.795  122.744 188.034 1.00 103.51 ? 213 GLU A O   1 
ATOM   1317  C  CB  . GLU A 1 212 ? 87.037  119.736 187.958 1.00 104.35 ? 213 GLU A CB  1 
ATOM   1318  C  CG  . GLU A 1 212 ? 86.382  118.376 188.059 1.00 104.65 ? 213 GLU A CG  1 
ATOM   1319  C  CD  . GLU A 1 212 ? 84.961  118.448 188.567 1.00 104.80 ? 213 GLU A CD  1 
ATOM   1320  O  OE1 . GLU A 1 212 ? 84.710  119.176 189.548 1.00 104.88 ? 213 GLU A OE1 1 
ATOM   1321  O  OE2 . GLU A 1 212 ? 84.089  117.781 187.978 1.00 104.86 1 213 GLU A OE2 1 
ATOM   1322  N  N   . ILE A 1 213 ? 87.732  122.478 186.026 1.00 83.83  ? 214 ILE A N   1 
ATOM   1323  C  CA  . ILE A 1 213 ? 88.387  123.777 186.071 1.00 83.40  ? 214 ILE A CA  1 
ATOM   1324  C  C   . ILE A 1 213 ? 87.779  124.781 185.104 1.00 83.89  ? 214 ILE A C   1 
ATOM   1325  O  O   . ILE A 1 213 ? 87.773  124.560 183.903 1.00 83.89  ? 214 ILE A O   1 
ATOM   1326  C  CB  . ILE A 1 213 ? 89.870  123.658 185.780 1.00 82.57  ? 214 ILE A CB  1 
ATOM   1327  C  CG1 . ILE A 1 213 ? 90.504  122.638 186.710 1.00 82.09  ? 214 ILE A CG1 1 
ATOM   1328  C  CG2 . ILE A 1 213 ? 90.537  124.992 185.945 1.00 82.37  ? 214 ILE A CG2 1 
ATOM   1329  C  CD1 . ILE A 1 213 ? 91.948  122.380 186.418 1.00 81.84  ? 214 ILE A CD1 1 
ATOM   1330  N  N   . PRO A 1 214 ? 87.251  125.884 185.630 1.00 113.96 ? 215 PRO A N   1 
ATOM   1331  C  CA  . PRO A 1 214 ? 86.709  126.992 184.840 1.00 113.93 ? 215 PRO A CA  1 
ATOM   1332  C  C   . PRO A 1 214 ? 87.774  127.656 183.988 1.00 113.28 ? 215 PRO A C   1 
ATOM   1333  O  O   . PRO A 1 214 ? 88.918  127.726 184.413 1.00 113.27 ? 215 PRO A O   1 
ATOM   1334  C  CB  . PRO A 1 214 ? 86.234  127.974 185.906 1.00 114.30 ? 215 PRO A CB  1 
ATOM   1335  C  CG  . PRO A 1 214 ? 86.004  127.144 187.104 1.00 114.43 ? 215 PRO A CG  1 
ATOM   1336  C  CD  . PRO A 1 214 ? 87.056  126.101 187.071 1.00 114.31 ? 215 PRO A CD  1 
ATOM   1337  N  N   . ASN A 1 215 ? 87.390  128.144 182.815 1.00 106.52 ? 216 ASN A N   1 
ATOM   1338  C  CA  . ASN A 1 215 ? 88.311  128.792 181.890 1.00 105.66 ? 216 ASN A CA  1 
ATOM   1339  C  C   . ASN A 1 215 ? 89.474  127.908 181.496 1.00 104.00 ? 216 ASN A C   1 
ATOM   1340  O  O   . ASN A 1 215 ? 90.596  128.368 181.367 1.00 103.92 ? 216 ASN A O   1 
ATOM   1341  C  CB  . ASN A 1 215 ? 88.834  130.104 182.464 1.00 106.20 ? 216 ASN A CB  1 
ATOM   1342  C  CG  . ASN A 1 215 ? 87.808  131.211 182.418 1.00 106.58 ? 216 ASN A CG  1 
ATOM   1343  O  OD1 . ASN A 1 215 ? 86.864  131.165 181.637 1.00 106.64 ? 216 ASN A OD1 1 
ATOM   1344  N  ND2 . ASN A 1 215 ? 87.993  132.223 183.254 1.00 106.80 ? 216 ASN A ND2 1 
ATOM   1345  N  N   . SER A 1 216 ? 89.192  126.631 181.305 1.00 85.77  ? 217 SER A N   1 
ATOM   1346  C  CA  . SER A 1 216 ? 90.213  125.689 180.898 1.00 84.04  ? 217 SER A CA  1 
ATOM   1347  C  C   . SER A 1 216 ? 89.933  125.143 179.514 1.00 82.20  ? 217 SER A C   1 
ATOM   1348  O  O   . SER A 1 216 ? 88.789  124.984 179.127 1.00 82.09  ? 217 SER A O   1 
ATOM   1349  C  CB  . SER A 1 216 ? 90.296  124.543 181.894 1.00 84.13  ? 217 SER A CB  1 
ATOM   1350  O  OG  . SER A 1 216 ? 89.117  123.775 181.867 1.00 84.24  ? 217 SER A OG  1 
ATOM   1351  N  N   . HIS A 1 217 ? 90.989  124.848 178.773 1.00 90.45  ? 218 HIS A N   1 
ATOM   1352  C  CA  . HIS A 1 217 ? 90.836  124.281 177.449 1.00 88.75  ? 218 HIS A CA  1 
ATOM   1353  C  C   . HIS A 1 217 ? 91.791  123.123 177.234 1.00 86.81  ? 218 HIS A C   1 
ATOM   1354  O  O   . HIS A 1 217 ? 92.899  123.137 177.728 1.00 86.68  ? 218 HIS A O   1 
ATOM   1355  C  CB  . HIS A 1 217 ? 91.138  125.333 176.398 1.00 88.97  ? 218 HIS A CB  1 
ATOM   1356  C  CG  . HIS A 1 217 ? 90.436  126.628 176.616 1.00 89.22  ? 218 HIS A CG  1 
ATOM   1357  N  ND1 . HIS A 1 217 ? 89.133  126.838 176.232 1.00 89.29  ? 218 HIS A ND1 1 
ATOM   1358  C  CD2 . HIS A 1 217 ? 90.862  127.789 177.158 1.00 89.31  ? 218 HIS A CD2 1 
ATOM   1359  C  CE1 . HIS A 1 217 ? 88.782  128.071 176.540 1.00 89.36  ? 218 HIS A CE1 1 
ATOM   1360  N  NE2 . HIS A 1 217 ? 89.813  128.670 177.103 1.00 89.36  ? 218 HIS A NE2 1 
ATOM   1361  N  N   . ILE A 1 218 ? 91.356  122.123 176.484 1.00 73.86  ? 219 ILE A N   1 
ATOM   1362  C  CA  . ILE A 1 218 ? 92.249  121.086 176.007 1.00 72.15  ? 219 ILE A CA  1 
ATOM   1363  C  C   . ILE A 1 218 ? 92.442  121.313 174.530 1.00 71.33  ? 219 ILE A C   1 
ATOM   1364  O  O   . ILE A 1 218 ? 91.526  121.125 173.751 1.00 71.25  ? 219 ILE A O   1 
ATOM   1365  C  CB  . ILE A 1 218 ? 91.653  119.705 176.202 1.00 71.49  ? 219 ILE A CB  1 
ATOM   1366  C  CG1 . ILE A 1 218 ? 91.473  119.411 177.681 1.00 71.24  ? 219 ILE A CG1 1 
ATOM   1367  C  CG2 . ILE A 1 218 ? 92.542  118.666 175.602 1.00 71.28  ? 219 ILE A CG2 1 
ATOM   1368  C  CD1 . ILE A 1 218 ? 90.736  118.143 177.950 1.00 71.15  ? 219 ILE A CD1 1 
ATOM   1369  N  N   . LEU A 1 219 ? 93.631  121.745 174.146 1.00 79.87  ? 220 LEU A N   1 
ATOM   1370  C  CA  . LEU A 1 219 ? 93.929  121.991 172.749 1.00 79.27  ? 220 LEU A CA  1 
ATOM   1371  C  C   . LEU A 1 219 ? 93.908  120.711 171.919 1.00 79.14  ? 220 LEU A C   1 
ATOM   1372  O  O   . LEU A 1 219 ? 93.584  120.734 170.741 1.00 79.09  ? 220 LEU A O   1 
ATOM   1373  C  CB  . LEU A 1 219 ? 95.267  122.706 172.622 1.00 78.95  ? 220 LEU A CB  1 
ATOM   1374  C  CG  . LEU A 1 219 ? 95.367  124.091 173.245 1.00 78.70  ? 220 LEU A CG  1 
ATOM   1375  C  CD1 . LEU A 1 219 ? 96.765  124.630 173.111 1.00 78.60  ? 220 LEU A CD1 1 
ATOM   1376  C  CD2 . LEU A 1 219 ? 94.396  125.021 172.592 1.00 78.62  ? 220 LEU A CD2 1 
ATOM   1377  N  N   . ASP A 1 220 ? 94.250  119.598 172.553 1.00 81.90  ? 221 ASP A N   1 
ATOM   1378  C  CA  . ASP A 1 220 ? 94.129  118.258 171.974 1.00 81.78  ? 221 ASP A CA  1 
ATOM   1379  C  C   . ASP A 1 220 ? 94.915  118.002 170.707 1.00 81.55  ? 221 ASP A C   1 
ATOM   1380  O  O   . ASP A 1 220 ? 94.389  118.111 169.614 1.00 81.51  ? 221 ASP A O   1 
ATOM   1381  C  CB  . ASP A 1 220 ? 92.667  117.907 171.726 1.00 81.86  ? 221 ASP A CB  1 
ATOM   1382  C  CG  . ASP A 1 220 ? 92.430  116.422 171.685 1.00 81.90  ? 221 ASP A CG  1 
ATOM   1383  O  OD1 . ASP A 1 220 ? 91.294  115.990 171.937 1.00 81.92  ? 221 ASP A OD1 1 
ATOM   1384  O  OD2 . ASP A 1 220 ? 93.386  115.684 171.413 1.00 81.91  1 221 ASP A OD2 1 
ATOM   1385  N  N   . GLN A 1 221 ? 96.165  117.602 170.868 1.00 75.44  ? 222 GLN A N   1 
ATOM   1386  C  CA  . GLN A 1 221 ? 97.025  117.314 169.736 1.00 75.23  ? 222 GLN A CA  1 
ATOM   1387  C  C   . GLN A 1 221 ? 96.522  116.134 168.924 1.00 75.24  ? 222 GLN A C   1 
ATOM   1388  O  O   . GLN A 1 221 ? 96.858  115.987 167.764 1.00 75.24  ? 222 GLN A O   1 
ATOM   1389  C  CB  . GLN A 1 221 ? 98.455  117.061 170.208 1.00 75.06  ? 222 GLN A CB  1 
ATOM   1390  C  CG  . GLN A 1 221 ? 98.591  115.960 171.229 1.00 74.93  ? 222 GLN A CG  1 
ATOM   1391  C  CD  . GLN A 1 221 ? 100.023 115.693 171.620 1.00 74.81  ? 222 GLN A CD  1 
ATOM   1392  O  OE1 . GLN A 1 221 ? 100.942 115.945 170.858 1.00 74.76  ? 222 GLN A OE1 1 
ATOM   1393  N  NE2 . GLN A 1 221 ? 100.217 115.185 172.816 1.00 74.74  ? 222 GLN A NE2 1 
ATOM   1394  N  N   . TYR A 1 222 ? 95.734  115.279 169.555 1.00 76.34  ? 223 TYR A N   1 
ATOM   1395  C  CA  . TYR A 1 222 ? 95.225  114.087 168.901 1.00 76.36  ? 223 TYR A CA  1 
ATOM   1396  C  C   . TYR A 1 222 ? 94.104  114.360 167.925 1.00 76.39  ? 223 TYR A C   1 
ATOM   1397  O  O   . TYR A 1 222 ? 93.811  113.540 167.076 1.00 76.30  ? 223 TYR A O   1 
ATOM   1398  C  CB  . TYR A 1 222 ? 94.783  113.071 169.942 1.00 76.33  ? 223 TYR A CB  1 
ATOM   1399  C  CG  . TYR A 1 222 ? 95.890  112.693 170.876 1.00 76.30  ? 223 TYR A CG  1 
ATOM   1400  C  CD1 . TYR A 1 222 ? 96.864  111.805 170.491 1.00 76.28  ? 223 TYR A CD1 1 
ATOM   1401  C  CD2 . TYR A 1 222 ? 95.975  113.241 172.134 1.00 76.29  ? 223 TYR A CD2 1 
ATOM   1402  C  CE1 . TYR A 1 222 ? 97.886  111.463 171.336 1.00 76.25  ? 223 TYR A CE1 1 
ATOM   1403  C  CE2 . TYR A 1 222 ? 96.991  112.904 172.985 1.00 76.27  ? 223 TYR A CE2 1 
ATOM   1404  C  CZ  . TYR A 1 222 ? 97.944  112.013 172.580 1.00 76.27  ? 223 TYR A CZ  1 
ATOM   1405  O  OH  . TYR A 1 222 ? 98.968  111.668 173.420 1.00 76.23  ? 223 TYR A OH  1 
ATOM   1406  N  N   . ARG A 1 223 ? 93.482  115.521 168.034 1.00 81.52  ? 224 ARG A N   1 
ATOM   1407  C  CA  . ARG A 1 223 ? 92.377  115.847 167.152 1.00 81.57  ? 224 ARG A CA  1 
ATOM   1408  C  C   . ARG A 1 223 ? 92.545  117.175 166.439 1.00 80.88  ? 224 ARG A C   1 
ATOM   1409  O  O   . ARG A 1 223 ? 91.997  117.371 165.368 1.00 80.84  ? 224 ARG A O   1 
ATOM   1410  C  CB  . ARG A 1 223 ? 91.055  115.842 167.918 1.00 82.23  ? 224 ARG A CB  1 
ATOM   1411  C  CG  . ARG A 1 223 ? 90.850  114.651 168.821 1.00 82.81  ? 224 ARG A CG  1 
ATOM   1412  C  CD  . ARG A 1 223 ? 89.429  114.575 169.325 1.00 83.26  ? 224 ARG A CD  1 
ATOM   1413  N  NE  . ARG A 1 223 ? 88.516  114.199 168.258 1.00 83.57  ? 224 ARG A NE  1 
ATOM   1414  C  CZ  . ARG A 1 223 ? 87.653  115.024 167.686 1.00 83.87  ? 224 ARG A CZ  1 
ATOM   1415  N  NH1 . ARG A 1 223 ? 87.567  116.276 168.096 1.00 83.95  1 224 ARG A NH1 1 
ATOM   1416  N  NH2 . ARG A 1 223 ? 86.870  114.588 166.713 1.00 84.00  ? 224 ARG A NH2 1 
ATOM   1417  N  N   . ASN A 1 224 ? 93.291  118.092 167.039 1.00 70.34  ? 225 ASN A N   1 
ATOM   1418  C  CA  . ASN A 1 224 ? 93.435  119.428 166.475 1.00 69.65  ? 225 ASN A CA  1 
ATOM   1419  C  C   . ASN A 1 224 ? 94.125  119.417 165.131 1.00 69.14  ? 225 ASN A C   1 
ATOM   1420  O  O   . ASN A 1 224 ? 95.139  118.775 164.951 1.00 68.98  ? 225 ASN A O   1 
ATOM   1421  C  CB  . ASN A 1 224 ? 94.192  120.342 167.433 1.00 69.55  ? 225 ASN A CB  1 
ATOM   1422  C  CG  . ASN A 1 224 ? 93.999  121.804 167.121 1.00 69.44  ? 225 ASN A CG  1 
ATOM   1423  O  OD1 . ASN A 1 224 ? 93.714  122.175 165.997 1.00 69.43  ? 225 ASN A OD1 1 
ATOM   1424  N  ND2 . ASN A 1 224 ? 94.155  122.642 168.122 1.00 69.39  ? 225 ASN A ND2 1 
ATOM   1425  N  N   . ALA A 1 225 ? 93.571  120.159 164.190 1.00 78.54  ? 226 ALA A N   1 
ATOM   1426  C  CA  . ALA A 1 225 ? 94.134  120.227 162.861 1.00 78.07  ? 226 ALA A CA  1 
ATOM   1427  C  C   . ALA A 1 225 ? 95.432  120.996 162.840 1.00 77.55  ? 226 ALA A C   1 
ATOM   1428  O  O   . ALA A 1 225 ? 96.251  120.808 161.956 1.00 77.44  ? 226 ALA A O   1 
ATOM   1429  C  CB  . ALA A 1 225 ? 93.150  120.838 161.910 1.00 78.11  ? 226 ALA A CB  1 
ATOM   1430  N  N   . SER A 1 226 ? 95.621  121.854 163.828 1.00 67.51  ? 227 SER A N   1 
ATOM   1431  C  CA  . SER A 1 226 ? 96.791  122.708 163.878 1.00 67.05  ? 227 SER A CA  1 
ATOM   1432  C  C   . SER A 1 226 ? 98.071  121.895 164.000 1.00 66.51  ? 227 SER A C   1 
ATOM   1433  O  O   . SER A 1 226 ? 99.135  122.320 163.563 1.00 66.47  ? 227 SER A O   1 
ATOM   1434  C  CB  . SER A 1 226 ? 96.664  123.713 165.014 1.00 67.10  ? 227 SER A CB  1 
ATOM   1435  O  OG  . SER A 1 226 ? 95.539  124.545 164.828 1.00 67.18  ? 227 SER A OG  1 
ATOM   1436  N  N   . ASN A 1 227 ? 97.955  120.709 164.572 1.00 65.91  ? 228 ASN A N   1 
ATOM   1437  C  CA  . ASN A 1 227 ? 99.089  119.812 164.664 1.00 65.41  ? 228 ASN A CA  1 
ATOM   1438  C  C   . ASN A 1 227 ? 99.591  119.396 163.285 1.00 65.16  ? 228 ASN A C   1 
ATOM   1439  O  O   . ASN A 1 227 ? 100.648 119.842 162.883 1.00 65.14  ? 228 ASN A O   1 
ATOM   1440  C  CB  . ASN A 1 227 ? 98.771  118.638 165.611 1.00 65.26  ? 228 ASN A CB  1 
ATOM   1441  C  CG  . ASN A 1 227 ? 99.751  117.496 165.519 1.00 65.15  ? 228 ASN A CG  1 
ATOM   1442  O  OD1 . ASN A 1 227 ? 100.845 117.623 164.998 1.00 65.18  ? 228 ASN A OD1 1 
ATOM   1443  N  ND2 . ASN A 1 227 ? 99.357  116.363 166.056 1.00 65.08  ? 228 ASN A ND2 1 
ATOM   1444  N  N   . PRO A 1 228 ? 98.853  118.555 162.549 1.00 66.36  ? 229 PRO A N   1 
ATOM   1445  C  CA  . PRO A 1 228 ? 99.396  118.201 161.239 1.00 66.27  ? 229 PRO A CA  1 
ATOM   1446  C  C   . PRO A 1 228 ? 99.581  119.381 160.304 1.00 66.30  ? 229 PRO A C   1 
ATOM   1447  O  O   . PRO A 1 228 ? 100.493 119.391 159.493 1.00 66.29  ? 229 PRO A O   1 
ATOM   1448  C  CB  . PRO A 1 228 ? 98.358  117.239 160.686 1.00 66.21  ? 229 PRO A CB  1 
ATOM   1449  C  CG  . PRO A 1 228 ? 97.133  117.610 161.347 1.00 66.21  ? 229 PRO A CG  1 
ATOM   1450  C  CD  . PRO A 1 228 ? 97.489  118.035 162.707 1.00 66.27  ? 229 PRO A CD  1 
ATOM   1451  N  N   . LEU A 1 229 ? 98.714  120.369 160.418 1.00 72.79  ? 230 LEU A N   1 
ATOM   1452  C  CA  . LEU A 1 229 ? 98.800  121.505 159.530 1.00 72.85  ? 230 LEU A CA  1 
ATOM   1453  C  C   . LEU A 1 229 ? 100.081 122.269 159.749 1.00 72.74  ? 230 LEU A C   1 
ATOM   1454  O  O   . LEU A 1 229 ? 100.604 122.870 158.825 1.00 72.77  ? 230 LEU A O   1 
ATOM   1455  C  CB  . LEU A 1 229 ? 97.602  122.429 159.701 1.00 72.99  ? 230 LEU A CB  1 
ATOM   1456  C  CG  . LEU A 1 229 ? 96.322  122.012 158.996 1.00 73.11  ? 230 LEU A CG  1 
ATOM   1457  C  CD1 . LEU A 1 229 ? 95.196  122.913 159.401 1.00 73.15  ? 230 LEU A CD1 1 
ATOM   1458  C  CD2 . LEU A 1 229 ? 96.513  122.071 157.520 1.00 73.14  ? 230 LEU A CD2 1 
ATOM   1459  N  N   . ALA A 1 230 ? 100.593 122.256 160.971 1.00 64.09  ? 231 ALA A N   1 
ATOM   1460  C  CA  . ALA A 1 230 ? 101.845 122.936 161.217 1.00 64.02  ? 231 ALA A CA  1 
ATOM   1461  C  C   . ALA A 1 230 ? 102.954 122.294 160.410 1.00 64.07  ? 231 ALA A C   1 
ATOM   1462  O  O   . ALA A 1 230 ? 103.823 122.967 159.891 1.00 64.08  ? 231 ALA A O   1 
ATOM   1463  C  CB  . ALA A 1 230 ? 102.172 122.897 162.670 1.00 63.95  ? 231 ALA A CB  1 
ATOM   1464  N  N   . HIS A 1 231 ? 102.896 120.983 160.275 1.00 74.28  ? 232 HIS A N   1 
ATOM   1465  C  CA  . HIS A 1 231 ? 103.906 120.269 159.523 1.00 74.38  ? 232 HIS A CA  1 
ATOM   1466  C  C   . HIS A 1 231 ? 103.696 120.387 158.027 1.00 74.38  ? 232 HIS A C   1 
ATOM   1467  O  O   . HIS A 1 231 ? 104.641 120.362 157.258 1.00 74.40  ? 232 HIS A O   1 
ATOM   1468  C  CB  . HIS A 1 231 ? 103.948 118.807 159.952 1.00 74.46  ? 232 HIS A CB  1 
ATOM   1469  C  CG  . HIS A 1 231 ? 104.369 118.609 161.370 1.00 74.54  ? 232 HIS A CG  1 
ATOM   1470  N  ND1 . HIS A 1 231 ? 105.613 118.966 161.832 1.00 74.60  ? 232 HIS A ND1 1 
ATOM   1471  C  CD2 . HIS A 1 231 ? 103.711 118.087 162.426 1.00 74.59  ? 232 HIS A CD2 1 
ATOM   1472  C  CE1 . HIS A 1 231 ? 105.702 118.675 163.115 1.00 74.63  ? 232 HIS A CE1 1 
ATOM   1473  N  NE2 . HIS A 1 231 ? 104.561 118.141 163.500 1.00 74.62  ? 232 HIS A NE2 1 
ATOM   1474  N  N   . TYR A 1 232 ? 102.447 120.517 157.618 1.00 61.75  ? 233 TYR A N   1 
ATOM   1475  C  CA  . TYR A 1 232 ? 102.129 120.697 156.217 1.00 61.77  ? 233 TYR A CA  1 
ATOM   1476  C  C   . TYR A 1 232 ? 102.589 122.048 155.731 1.00 62.53  ? 233 TYR A C   1 
ATOM   1477  O  O   . TYR A 1 232 ? 103.145 122.178 154.659 1.00 62.64  ? 233 TYR A O   1 
ATOM   1478  C  CB  . TYR A 1 232 ? 100.627 120.568 156.039 1.00 61.23  ? 233 TYR A CB  1 
ATOM   1479  C  CG  . TYR A 1 232 ? 100.102 120.715 154.634 1.00 60.71  ? 233 TYR A CG  1 
ATOM   1480  C  CD1 . TYR A 1 232 ? 100.040 119.636 153.779 1.00 60.49  ? 233 TYR A CD1 1 
ATOM   1481  C  CD2 . TYR A 1 232 ? 99.614  121.920 154.185 1.00 60.46  ? 233 TYR A CD2 1 
ATOM   1482  C  CE1 . TYR A 1 232 ? 99.539  119.760 152.518 1.00 60.31  ? 233 TYR A CE1 1 
ATOM   1483  C  CE2 . TYR A 1 232 ? 99.109  122.050 152.924 1.00 60.32  ? 233 TYR A CE2 1 
ATOM   1484  C  CZ  . TYR A 1 232 ? 99.072  120.968 152.095 1.00 60.28  ? 233 TYR A CZ  1 
ATOM   1485  O  OH  . TYR A 1 232 ? 98.568  121.104 150.835 1.00 60.27  ? 233 TYR A OH  1 
ATOM   1486  N  N   . ASP A 1 233 ? 102.377 123.061 156.548 1.00 89.29  ? 234 ASP A N   1 
ATOM   1487  C  CA  . ASP A 1 233 ? 102.700 124.415 156.153 1.00 90.00  ? 234 ASP A CA  1 
ATOM   1488  C  C   . ASP A 1 233 ? 104.166 124.782 156.297 1.00 90.37  ? 234 ASP A C   1 
ATOM   1489  O  O   . ASP A 1 233 ? 104.704 125.469 155.449 1.00 90.43  ? 234 ASP A O   1 
ATOM   1490  C  CB  . ASP A 1 233 ? 101.854 125.415 156.936 1.00 90.23  ? 234 ASP A CB  1 
ATOM   1491  C  CG  . ASP A 1 233 ? 100.405 125.393 156.532 1.00 90.37  ? 234 ASP A CG  1 
ATOM   1492  O  OD1 . ASP A 1 233 ? 100.100 124.865 155.452 1.00 90.37  ? 234 ASP A OD1 1 
ATOM   1493  O  OD2 . ASP A 1 233 ? 99.573  125.915 157.297 1.00 90.40  1 234 ASP A OD2 1 
ATOM   1494  N  N   . THR A 1 234 ? 104.814 124.337 157.364 1.00 68.46  ? 235 THR A N   1 
ATOM   1495  C  CA  . THR A 1 234 ? 106.180 124.775 157.629 1.00 68.77  ? 235 THR A CA  1 
ATOM   1496  C  C   . THR A 1 234 ? 107.245 123.707 157.424 1.00 69.13  ? 235 THR A C   1 
ATOM   1497  O  O   . THR A 1 234 ? 108.139 123.879 156.616 1.00 69.16  ? 235 THR A O   1 
ATOM   1498  C  CB  . THR A 1 234 ? 106.339 125.397 159.025 1.00 68.70  ? 235 THR A CB  1 
ATOM   1499  O  OG1 . THR A 1 234 ? 106.153 124.400 160.024 1.00 68.68  ? 235 THR A OG1 1 
ATOM   1500  C  CG2 . THR A 1 234 ? 105.338 126.490 159.236 1.00 68.65  ? 235 THR A CG2 1 
ATOM   1501  N  N   . THR A 1 235 ? 107.145 122.608 158.151 1.00 68.14  ? 236 THR A N   1 
ATOM   1502  C  CA  . THR A 1 235 ? 108.184 121.594 158.131 1.00 68.48  ? 236 THR A CA  1 
ATOM   1503  C  C   . THR A 1 235 ? 108.395 121.053 156.729 1.00 68.85  ? 236 THR A C   1 
ATOM   1504  O  O   . THR A 1 235 ? 109.521 120.914 156.266 1.00 68.84  ? 236 THR A O   1 
ATOM   1505  C  CB  . THR A 1 235 ? 107.809 120.428 159.049 1.00 68.45  ? 236 THR A CB  1 
ATOM   1506  O  OG1 . THR A 1 235 ? 107.337 120.936 160.296 1.00 68.46  ? 236 THR A OG1 1 
ATOM   1507  C  CG2 . THR A 1 235 ? 108.990 119.547 159.300 1.00 68.45  ? 236 THR A CG2 1 
ATOM   1508  N  N   . ALA A 1 236 ? 107.299 120.777 156.044 1.00 77.72  ? 237 ALA A N   1 
ATOM   1509  C  CA  . ALA A 1 236 ? 107.369 120.226 154.709 1.00 78.00  ? 237 ALA A CA  1 
ATOM   1510  C  C   . ALA A 1 236 ? 107.939 121.206 153.707 1.00 77.92  ? 237 ALA A C   1 
ATOM   1511  O  O   . ALA A 1 236 ? 108.652 120.823 152.794 1.00 77.91  ? 237 ALA A O   1 
ATOM   1512  C  CB  . ALA A 1 236 ? 106.007 119.768 154.276 1.00 78.16  ? 237 ALA A CB  1 
ATOM   1513  N  N   . ASP A 1 237 ? 107.620 122.477 153.875 1.00 99.57  ? 238 ASP A N   1 
ATOM   1514  C  CA  . ASP A 1 237 ? 108.164 123.493 152.997 1.00 99.28  ? 238 ASP A CA  1 
ATOM   1515  C  C   . ASP A 1 237 ? 109.653 123.584 153.192 1.00 98.31  ? 238 ASP A C   1 
ATOM   1516  O  O   . ASP A 1 237 ? 110.397 123.801 152.249 1.00 98.27  ? 238 ASP A O   1 
ATOM   1517  C  CB  . ASP A 1 237 ? 107.546 124.852 153.300 1.00 99.69  ? 238 ASP A CB  1 
ATOM   1518  C  CG  . ASP A 1 237 ? 106.240 125.065 152.594 1.00 99.90  ? 238 ASP A CG  1 
ATOM   1519  O  OD1 . ASP A 1 237 ? 105.690 124.087 152.062 1.00 99.99  ? 238 ASP A OD1 1 
ATOM   1520  O  OD2 . ASP A 1 237 ? 105.760 126.214 152.574 1.00 100.00 1 238 ASP A OD2 1 
ATOM   1521  N  N   . GLU A 1 238 ? 110.085 123.397 154.428 1.00 75.52  ? 239 GLU A N   1 
ATOM   1522  C  CA  . GLU A 1 238 ? 111.492 123.466 154.744 1.00 74.47  ? 239 GLU A CA  1 
ATOM   1523  C  C   . GLU A 1 238 ? 112.218 122.301 154.127 1.00 73.37  ? 239 GLU A C   1 
ATOM   1524  O  O   . GLU A 1 238 ? 113.289 122.454 153.572 1.00 73.35  ? 239 GLU A O   1 
ATOM   1525  C  CB  . GLU A 1 238 ? 111.696 123.444 156.252 1.00 74.52  ? 239 GLU A CB  1 
ATOM   1526  C  CG  . GLU A 1 238 ? 111.232 124.679 156.966 1.00 74.57  ? 239 GLU A CG  1 
ATOM   1527  C  CD  . GLU A 1 238 ? 111.246 124.518 158.457 1.00 74.59  ? 239 GLU A CD  1 
ATOM   1528  O  OE1 . GLU A 1 238 ? 110.536 125.272 159.138 1.00 74.58  ? 239 GLU A OE1 1 
ATOM   1529  O  OE2 . GLU A 1 238 ? 111.963 123.636 158.953 1.00 74.57  1 239 GLU A OE2 1 
ATOM   1530  N  N   . ILE A 1 239 ? 111.624 121.128 154.219 1.00 65.39  ? 240 ILE A N   1 
ATOM   1531  C  CA  . ILE A 1 239 ? 112.258 119.966 153.649 1.00 64.39  ? 240 ILE A CA  1 
ATOM   1532  C  C   . ILE A 1 239 ? 112.334 120.100 152.143 1.00 64.36  ? 240 ILE A C   1 
ATOM   1533  O  O   . ILE A 1 239 ? 113.339 119.778 151.534 1.00 64.40  ? 240 ILE A O   1 
ATOM   1534  C  CB  . ILE A 1 239 ? 111.498 118.700 154.028 1.00 63.65  ? 240 ILE A CB  1 
ATOM   1535  C  CG1 . ILE A 1 239 ? 111.525 118.514 155.535 1.00 63.28  ? 240 ILE A CG1 1 
ATOM   1536  C  CG2 . ILE A 1 239 ? 112.103 117.501 153.369 1.00 63.47  ? 240 ILE A CG2 1 
ATOM   1537  C  CD1 . ILE A 1 239 ? 110.679 117.391 156.006 1.00 63.08  ? 240 ILE A CD1 1 
ATOM   1538  N  N   . LEU A 1 240 ? 111.276 120.619 151.544 1.00 63.04  ? 241 LEU A N   1 
ATOM   1539  C  CA  . LEU A 1 240 ? 111.236 120.765 150.104 1.00 63.16  ? 241 LEU A CA  1 
ATOM   1540  C  C   . LEU A 1 240 ? 112.224 121.785 149.599 1.00 64.58  ? 241 LEU A C   1 
ATOM   1541  O  O   . LEU A 1 240 ? 112.818 121.616 148.549 1.00 64.72  ? 241 LEU A O   1 
ATOM   1542  C  CB  . LEU A 1 240 ? 109.838 121.147 149.664 1.00 62.27  ? 241 LEU A CB  1 
ATOM   1543  C  CG  . LEU A 1 240 ? 108.879 119.980 149.581 1.00 61.55  ? 241 LEU A CG  1 
ATOM   1544  C  CD1 . LEU A 1 240 ? 107.522 120.487 149.248 1.00 61.29  ? 241 LEU A CD1 1 
ATOM   1545  C  CD2 . LEU A 1 240 ? 109.351 119.037 148.527 1.00 61.35  ? 241 LEU A CD2 1 
ATOM   1546  N  N   . GLN A 1 241 ? 112.405 122.844 150.368 1.00 86.85  ? 242 GLN A N   1 
ATOM   1547  C  CA  . GLN A 1 241 ? 113.313 123.904 149.983 1.00 88.36  ? 242 GLN A CA  1 
ATOM   1548  C  C   . GLN A 1 241 ? 114.748 123.475 150.177 1.00 89.01  ? 242 GLN A C   1 
ATOM   1549  O  O   . GLN A 1 241 ? 115.603 123.770 149.364 1.00 89.11  ? 242 GLN A O   1 
ATOM   1550  C  CB  . GLN A 1 241 ? 113.021 125.161 150.791 1.00 89.09  ? 242 GLN A CB  1 
ATOM   1551  C  CG  . GLN A 1 241 ? 113.872 126.338 150.419 1.00 89.67  ? 242 GLN A CG  1 
ATOM   1552  C  CD  . GLN A 1 241 ? 113.457 127.604 151.131 1.00 90.09  ? 242 GLN A CD  1 
ATOM   1553  O  OE1 . GLN A 1 241 ? 112.449 127.633 151.834 1.00 90.17  ? 242 GLN A OE1 1 
ATOM   1554  N  NE2 . GLN A 1 241 ? 114.235 128.662 150.954 1.00 90.34  ? 242 GLN A NE2 1 
ATOM   1555  N  N   . GLN A 1 242 ? 115.006 122.771 151.262 1.00 66.12  ? 243 GLN A N   1 
ATOM   1556  C  CA  . GLN A 1 242 ? 116.344 122.311 151.551 1.00 66.71  ? 243 GLN A CA  1 
ATOM   1557  C  C   . GLN A 1 242 ? 116.793 121.262 150.563 1.00 67.78  ? 243 GLN A C   1 
ATOM   1558  O  O   . GLN A 1 242 ? 117.974 121.109 150.306 1.00 67.87  ? 243 GLN A O   1 
ATOM   1559  C  CB  . GLN A 1 242 ? 116.416 121.769 152.972 1.00 66.34  ? 243 GLN A CB  1 
ATOM   1560  C  CG  . GLN A 1 242 ? 116.411 122.840 154.042 1.00 66.06  ? 243 GLN A CG  1 
ATOM   1561  C  CD  . GLN A 1 242 ? 116.289 122.280 155.432 1.00 65.88  ? 243 GLN A CD  1 
ATOM   1562  O  OE1 . GLN A 1 242 ? 115.537 121.350 155.665 1.00 65.88  ? 243 GLN A OE1 1 
ATOM   1563  N  NE2 . GLN A 1 242 ? 117.031 122.845 156.364 1.00 65.76  ? 243 GLN A NE2 1 
ATOM   1564  N  N   . CYS A 1 243 ? 115.836 120.535 150.013 1.00 75.13  ? 244 CYS A N   1 
ATOM   1565  C  CA  . CYS A 1 243 ? 116.130 119.454 149.089 1.00 76.23  ? 244 CYS A CA  1 
ATOM   1566  C  C   . CYS A 1 243 ? 115.987 119.866 147.638 1.00 77.45  ? 244 CYS A C   1 
ATOM   1567  O  O   . CYS A 1 243 ? 116.137 119.055 146.741 1.00 77.54  ? 244 CYS A O   1 
ATOM   1568  C  CB  . CYS A 1 243 ? 115.252 118.246 149.389 1.00 76.19  ? 244 CYS A CB  1 
ATOM   1569  S  SG  . CYS A 1 243 ? 115.677 117.392 150.901 1.00 76.10  ? 244 CYS A SG  1 
ATOM   1570  N  N   . ASP A 1 244 ? 115.688 121.137 147.424 1.00 89.27  ? 245 ASP A N   1 
ATOM   1571  C  CA  . ASP A 1 244 ? 115.513 121.701 146.092 1.00 90.46  ? 245 ASP A CA  1 
ATOM   1572  C  C   . ASP A 1 244 ? 114.471 120.940 145.302 1.00 91.61  ? 245 ASP A C   1 
ATOM   1573  O  O   . ASP A 1 244 ? 114.533 120.863 144.087 1.00 91.67  ? 245 ASP A O   1 
ATOM   1574  C  CB  . ASP A 1 244 ? 116.840 121.740 145.339 1.00 90.50  ? 245 ASP A CB  1 
ATOM   1575  C  CG  . ASP A 1 244 ? 117.819 122.721 145.937 1.00 90.51  ? 245 ASP A CG  1 
ATOM   1576  O  OD1 . ASP A 1 244 ? 117.461 123.900 146.083 1.00 90.55  ? 245 ASP A OD1 1 
ATOM   1577  O  OD2 . ASP A 1 244 ? 118.945 122.313 146.270 1.00 90.54  1 245 ASP A OD2 1 
ATOM   1578  N  N   . GLY A 1 245 ? 113.519 120.370 146.020 1.00 69.29  ? 246 GLY A N   1 
ATOM   1579  C  CA  . GLY A 1 245 ? 112.395 119.685 145.423 1.00 70.55  ? 246 GLY A CA  1 
ATOM   1580  C  C   . GLY A 1 245 ? 112.686 118.229 145.182 1.00 71.82  ? 246 GLY A C   1 
ATOM   1581  O  O   . GLY A 1 245 ? 111.785 117.423 145.026 1.00 71.92  ? 246 GLY A O   1 
ATOM   1582  N  N   . LYS A 1 246 ? 113.963 117.891 145.179 1.00 97.94  ? 247 LYS A N   1 
ATOM   1583  C  CA  . LYS A 1 246 ? 114.384 116.543 144.861 1.00 99.10  ? 247 LYS A CA  1 
ATOM   1584  C  C   . LYS A 1 246 ? 114.482 115.684 146.108 1.00 98.77  ? 247 LYS A C   1 
ATOM   1585  O  O   . LYS A 1 246 ? 115.270 115.955 146.995 1.00 98.64  ? 247 LYS A O   1 
ATOM   1586  C  CB  . LYS A 1 246 ? 115.719 116.581 144.130 1.00 100.39 ? 247 LYS A CB  1 
ATOM   1587  C  CG  . LYS A 1 246 ? 115.696 117.381 142.845 1.00 101.40 ? 247 LYS A CG  1 
ATOM   1588  C  CD  . LYS A 1 246 ? 117.011 117.258 142.083 1.00 102.24 ? 247 LYS A CD  1 
ATOM   1589  C  CE  . LYS A 1 246 ? 118.134 118.049 142.735 1.00 102.76 ? 247 LYS A CE  1 
ATOM   1590  N  NZ  . LYS A 1 246 ? 117.920 119.512 142.610 1.00 103.05 1 247 LYS A NZ  1 
ATOM   1591  N  N   . LEU A 1 247 ? 113.687 114.628 146.153 1.00 80.24  ? 248 LEU A N   1 
ATOM   1592  C  CA  . LEU A 1 247 ? 113.559 113.823 147.349 1.00 79.80  ? 248 LEU A CA  1 
ATOM   1593  C  C   . LEU A 1 247 ? 112.913 112.493 147.014 1.00 78.75  ? 248 LEU A C   1 
ATOM   1594  O  O   . LEU A 1 247 ? 111.856 112.447 146.414 1.00 78.67  ? 248 LEU A O   1 
ATOM   1595  C  CB  . LEU A 1 247 ? 112.717 114.575 148.367 1.00 80.24  ? 248 LEU A CB  1 
ATOM   1596  C  CG  . LEU A 1 247 ? 112.470 113.883 149.692 1.00 80.57  ? 248 LEU A CG  1 
ATOM   1597  C  CD1 . LEU A 1 247 ? 113.764 113.350 150.204 1.00 80.56  ? 248 LEU A CD1 1 
ATOM   1598  C  CD2 . LEU A 1 247 ? 111.888 114.857 150.663 1.00 80.72  ? 248 LEU A CD2 1 
ATOM   1599  N  N   . ASP A 1 248 ? 113.559 111.410 147.409 1.00 76.94  ? 249 ASP A N   1 
ATOM   1600  C  CA  . ASP A 1 248 ? 113.136 110.086 146.995 1.00 75.88  ? 249 ASP A CA  1 
ATOM   1601  C  C   . ASP A 1 248 ? 112.415 109.292 148.066 1.00 74.84  ? 249 ASP A C   1 
ATOM   1602  O  O   . ASP A 1 248 ? 111.576 108.466 147.761 1.00 74.77  ? 249 ASP A O   1 
ATOM   1603  C  CB  . ASP A 1 248 ? 114.336 109.300 146.486 1.00 75.85  ? 249 ASP A CB  1 
ATOM   1604  C  CG  . ASP A 1 248 ? 114.953 109.920 145.262 1.00 75.85  ? 249 ASP A CG  1 
ATOM   1605  O  OD1 . ASP A 1 248 ? 114.567 109.525 144.152 1.00 75.82  ? 249 ASP A OD1 1 
ATOM   1606  O  OD2 . ASP A 1 248 ? 115.818 110.803 145.399 1.00 75.85  1 249 ASP A OD2 1 
ATOM   1607  N  N   . MET A 1 249 ? 112.745 109.541 149.322 1.00 80.24  ? 250 MET A N   1 
ATOM   1608  C  CA  . MET A 1 249 ? 112.153 108.799 150.422 1.00 79.23  ? 250 MET A CA  1 
ATOM   1609  C  C   . MET A 1 249 ? 112.180 109.599 151.712 1.00 78.25  ? 250 MET A C   1 
ATOM   1610  O  O   . MET A 1 249 ? 113.117 110.329 151.971 1.00 78.18  ? 250 MET A O   1 
ATOM   1611  C  CB  . MET A 1 249 ? 112.887 107.474 150.605 1.00 79.20  ? 250 MET A CB  1 
ATOM   1612  C  CG  . MET A 1 249 ? 112.492 106.694 151.834 1.00 79.18  ? 250 MET A CG  1 
ATOM   1613  S  SD  . MET A 1 249 ? 113.277 105.085 151.948 1.00 79.18  ? 250 MET A SD  1 
ATOM   1614  C  CE  . MET A 1 249 ? 112.449 104.232 150.633 1.00 79.17  ? 250 MET A CE  1 
ATOM   1615  N  N   . LEU A 1 250 ? 111.135 109.460 152.514 1.00 78.98  ? 251 LEU A N   1 
ATOM   1616  C  CA  . LEU A 1 250 ? 111.070 110.101 153.815 1.00 78.01  ? 251 LEU A CA  1 
ATOM   1617  C  C   . LEU A 1 250 ? 110.694 109.109 154.885 1.00 76.78  ? 251 LEU A C   1 
ATOM   1618  O  O   . LEU A 1 250 ? 109.676 108.453 154.794 1.00 76.69  ? 251 LEU A O   1 
ATOM   1619  C  CB  . LEU A 1 250 ? 110.036 111.206 153.823 1.00 78.27  ? 251 LEU A CB  1 
ATOM   1620  C  CG  . LEU A 1 250 ? 109.860 111.771 155.225 1.00 78.49  ? 251 LEU A CG  1 
ATOM   1621  C  CD1 . LEU A 1 250 ? 110.590 113.069 155.370 1.00 78.57  ? 251 LEU A CD1 1 
ATOM   1622  C  CD2 . LEU A 1 250 ? 108.414 111.944 155.546 1.00 78.53  ? 251 LEU A CD2 1 
ATOM   1623  N  N   . VAL A 1 251 ? 111.518 109.016 155.915 1.00 70.01  ? 252 VAL A N   1 
ATOM   1624  C  CA  . VAL A 1 251 ? 111.251 108.112 157.011 1.00 68.94  ? 252 VAL A CA  1 
ATOM   1625  C  C   . VAL A 1 251 ? 110.933 108.882 158.275 1.00 68.49  ? 252 VAL A C   1 
ATOM   1626  O  O   . VAL A 1 251 ? 111.677 109.780 158.688 1.00 68.40  ? 252 VAL A O   1 
ATOM   1627  C  CB  . VAL A 1 251 ? 112.437 107.189 157.253 1.00 68.50  ? 252 VAL A CB  1 
ATOM   1628  C  CG1 . VAL A 1 251 ? 112.073 106.138 158.246 1.00 68.33  ? 252 VAL A CG1 1 
ATOM   1629  C  CG2 . VAL A 1 251 ? 112.849 106.545 155.970 1.00 68.39  ? 252 VAL A CG2 1 
ATOM   1630  N  N   . ALA A 1 252 ? 109.821 108.516 158.896 1.00 63.52  ? 253 ALA A N   1 
ATOM   1631  C  CA  . ALA A 1 252 ? 109.359 109.217 160.077 1.00 63.27  ? 253 ALA A CA  1 
ATOM   1632  C  C   . ALA A 1 252 ? 108.697 108.291 161.073 1.00 63.36  ? 253 ALA A C   1 
ATOM   1633  O  O   . ALA A 1 252 ? 107.864 107.484 160.716 1.00 63.35  ? 253 ALA A O   1 
ATOM   1634  C  CB  . ALA A 1 252 ? 108.409 110.290 159.682 1.00 63.10  ? 253 ALA A CB  1 
ATOM   1635  N  N   . SER A 1 253 ? 109.085 108.413 162.332 1.00 73.00  ? 254 SER A N   1 
ATOM   1636  C  CA  . SER A 1 253 ? 108.441 107.680 163.400 1.00 73.16  ? 254 SER A CA  1 
ATOM   1637  C  C   . SER A 1 253 ? 107.132 108.345 163.715 1.00 73.34  ? 254 SER A C   1 
ATOM   1638  O  O   . SER A 1 253 ? 106.995 109.540 163.549 1.00 73.32  ? 254 SER A O   1 
ATOM   1639  C  CB  . SER A 1 253 ? 109.318 107.655 164.633 1.00 73.16  ? 254 SER A CB  1 
ATOM   1640  O  OG  . SER A 1 253 ? 109.606 108.964 165.053 1.00 73.13  ? 254 SER A OG  1 
ATOM   1641  N  N   . VAL A 1 254 ? 106.170 107.566 164.184 1.00 73.49  ? 255 VAL A N   1 
ATOM   1642  C  CA  . VAL A 1 254 ? 104.815 108.057 164.343 1.00 73.60  ? 255 VAL A CA  1 
ATOM   1643  C  C   . VAL A 1 254 ? 104.338 108.046 165.785 1.00 73.40  ? 255 VAL A C   1 
ATOM   1644  O  O   . VAL A 1 254 ? 104.533 107.084 166.499 1.00 73.39  ? 255 VAL A O   1 
ATOM   1645  C  CB  . VAL A 1 254 ? 103.861 107.226 163.495 1.00 73.84  ? 255 VAL A CB  1 
ATOM   1646  C  CG1 . VAL A 1 254 ? 102.473 107.788 163.546 1.00 73.91  ? 255 VAL A CG1 1 
ATOM   1647  C  CG2 . VAL A 1 254 ? 104.342 107.196 162.082 1.00 73.91  ? 255 VAL A CG2 1 
ATOM   1648  N  N   . GLY A 1 255 ? 103.703 109.132 166.201 1.00 71.38  ? 256 GLY A N   1 
ATOM   1649  C  CA  . GLY A 1 255 ? 103.095 109.226 167.511 1.00 71.09  ? 256 GLY A CA  1 
ATOM   1650  C  C   . GLY A 1 255 ? 101.642 109.611 167.387 1.00 70.75  ? 256 GLY A C   1 
ATOM   1651  O  O   . GLY A 1 255 ? 100.781 108.756 167.266 1.00 70.72  ? 256 GLY A O   1 
ATOM   1652  N  N   . THR A 1 256 ? 101.362 110.903 167.432 1.00 67.22  ? 257 THR A N   1 
ATOM   1653  C  CA  . THR A 1 256 ? 100.035 111.374 167.106 1.00 66.85  ? 257 THR A CA  1 
ATOM   1654  C  C   . THR A 1 256 ? 99.820  111.220 165.623 1.00 66.36  ? 257 THR A C   1 
ATOM   1655  O  O   . THR A 1 256 ? 98.702  111.148 165.152 1.00 66.28  ? 257 THR A O   1 
ATOM   1656  C  CB  . THR A 1 256 ? 99.849  112.825 167.466 1.00 66.91  ? 257 THR A CB  1 
ATOM   1657  O  OG1 . THR A 1 256 ? 100.644 113.625 166.596 1.00 66.90  ? 257 THR A OG1 1 
ATOM   1658  C  CG2 . THR A 1 256 ? 100.261 113.067 168.881 1.00 66.95  ? 257 THR A CG2 1 
ATOM   1659  N  N   . GLY A 1 257 ? 100.920 111.151 164.893 1.00 79.61  ? 258 GLY A N   1 
ATOM   1660  C  CA  . GLY A 1 257 ? 100.890 111.014 163.453 1.00 79.04  ? 258 GLY A CA  1 
ATOM   1661  C  C   . GLY A 1 257 ? 100.854 112.314 162.693 1.00 78.39  ? 258 GLY A C   1 
ATOM   1662  O  O   . GLY A 1 257 ? 100.790 112.324 161.476 1.00 78.31  ? 258 GLY A O   1 
ATOM   1663  N  N   . GLY A 1 258 ? 100.912 113.419 163.412 1.00 85.27  ? 259 GLY A N   1 
ATOM   1664  C  CA  . GLY A 1 258 ? 100.813 114.711 162.777 1.00 84.54  ? 259 GLY A CA  1 
ATOM   1665  C  C   . GLY A 1 258 ? 101.984 115.029 161.882 1.00 83.77  ? 259 GLY A C   1 
ATOM   1666  O  O   . GLY A 1 258 ? 101.828 115.684 160.861 1.00 83.73  ? 259 GLY A O   1 
ATOM   1667  N  N   . THR A 1 259 ? 103.160 114.551 162.254 1.00 58.75  ? 260 THR A N   1 
ATOM   1668  C  CA  . THR A 1 259 ? 104.354 114.842 161.487 1.00 58.01  ? 260 THR A CA  1 
ATOM   1669  C  C   . THR A 1 259 ? 104.316 114.145 160.146 1.00 57.78  ? 260 THR A C   1 
ATOM   1670  O  O   . THR A 1 259 ? 104.428 114.774 159.105 1.00 57.77  ? 260 THR A O   1 
ATOM   1671  C  CB  . THR A 1 259 ? 105.604 114.403 162.245 1.00 57.65  ? 260 THR A CB  1 
ATOM   1672  O  OG1 . THR A 1 259 ? 105.659 115.080 163.502 1.00 57.62  ? 260 THR A OG1 1 
ATOM   1673  C  CG2 . THR A 1 259 ? 106.830 114.726 161.463 1.00 57.46  ? 260 THR A CG2 1 
ATOM   1674  N  N   . ILE A 1 260 ? 104.118 112.840 160.172 1.00 58.69  ? 261 ILE A N   1 
ATOM   1675  C  CA  . ILE A 1 260 ? 104.109 112.078 158.944 1.00 58.61  ? 261 ILE A CA  1 
ATOM   1676  C  C   . ILE A 1 260 ? 102.929 112.458 158.071 1.00 59.30  ? 261 ILE A C   1 
ATOM   1677  O  O   . ILE A 1 260 ? 103.021 112.425 156.866 1.00 59.40  ? 261 ILE A O   1 
ATOM   1678  C  CB  . ILE A 1 260 ? 104.138 110.565 159.206 1.00 58.00  ? 261 ILE A CB  1 
ATOM   1679  C  CG1 . ILE A 1 260 ? 104.590 109.822 157.963 1.00 57.67  ? 261 ILE A CG1 1 
ATOM   1680  C  CG2 . ILE A 1 260 ? 102.795 110.057 159.647 1.00 57.89  ? 261 ILE A CG2 1 
ATOM   1681  C  CD1 . ILE A 1 260 ? 104.780 108.367 158.179 1.00 57.49  ? 261 ILE A CD1 1 
ATOM   1682  N  N   . THR A 1 261 ? 101.828 112.858 158.682 1.00 77.68  ? 262 THR A N   1 
ATOM   1683  C  CA  . THR A 1 261 ? 100.645 113.194 157.917 1.00 78.41  ? 262 THR A CA  1 
ATOM   1684  C  C   . THR A 1 261 ? 100.823 114.525 157.228 1.00 78.74  ? 262 THR A C   1 
ATOM   1685  O  O   . THR A 1 261 ? 100.605 114.650 156.026 1.00 78.81  ? 262 THR A O   1 
ATOM   1686  C  CB  . THR A 1 261 ? 99.409  113.235 158.807 1.00 78.70  ? 262 THR A CB  1 
ATOM   1687  O  OG1 . THR A 1 261 ? 99.123  111.916 159.273 1.00 78.74  ? 262 THR A OG1 1 
ATOM   1688  C  CG2 . THR A 1 261 ? 98.228  113.742 158.046 1.00 78.85  ? 262 THR A CG2 1 
ATOM   1689  N  N   . GLY A 1 262 ? 101.270 115.512 157.982 1.00 74.75  ? 263 GLY A N   1 
ATOM   1690  C  CA  . GLY A 1 262 ? 101.439 116.836 157.430 1.00 74.99  ? 263 GLY A CA  1 
ATOM   1691  C  C   . GLY A 1 262 ? 102.535 116.889 156.398 1.00 75.18  ? 263 GLY A C   1 
ATOM   1692  O  O   . GLY A 1 262 ? 102.432 117.585 155.406 1.00 75.20  ? 263 GLY A O   1 
ATOM   1693  N  N   . ILE A 1 263 ? 103.593 116.136 156.627 1.00 69.61  ? 264 ILE A N   1 
ATOM   1694  C  CA  . ILE A 1 263 ? 104.665 116.099 155.661 1.00 69.77  ? 264 ILE A CA  1 
ATOM   1695  C  C   . ILE A 1 263 ? 104.247 115.322 154.427 1.00 70.30  ? 264 ILE A C   1 
ATOM   1696  O  O   . ILE A 1 263 ? 104.455 115.768 153.310 1.00 70.36  ? 264 ILE A O   1 
ATOM   1697  C  CB  . ILE A 1 263 ? 105.939 115.496 156.263 1.00 69.47  ? 264 ILE A CB  1 
ATOM   1698  C  CG1 . ILE A 1 263 ? 106.511 116.430 157.322 1.00 69.26  ? 264 ILE A CG1 1 
ATOM   1699  C  CG2 . ILE A 1 263 ? 106.968 115.269 155.198 1.00 69.45  ? 264 ILE A CG2 1 
ATOM   1700  C  CD1 . ILE A 1 263 ? 107.737 115.908 157.985 1.00 69.15  ? 264 ILE A CD1 1 
ATOM   1701  N  N   . ALA A 1 264 ? 103.633 114.167 154.629 1.00 75.04  ? 265 ALA A N   1 
ATOM   1702  C  CA  . ALA A 1 264 ? 103.277 113.316 153.505 1.00 75.54  ? 265 ALA A CA  1 
ATOM   1703  C  C   . ALA A 1 264 ? 102.215 113.893 152.596 1.00 75.95  ? 265 ALA A C   1 
ATOM   1704  O  O   . ALA A 1 264 ? 102.226 113.636 151.409 1.00 76.06  ? 265 ALA A O   1 
ATOM   1705  C  CB  . ALA A 1 264 ? 102.872 111.945 153.971 1.00 75.59  ? 265 ALA A CB  1 
ATOM   1706  N  N   . ARG A 1 265 ? 101.291 114.671 153.131 1.00 68.83  ? 266 ARG A N   1 
ATOM   1707  C  CA  . ARG A 1 265 ? 100.290 115.242 152.249 1.00 69.18  ? 266 ARG A CA  1 
ATOM   1708  C  C   . ARG A 1 265 ? 100.912 116.247 151.290 1.00 69.91  ? 266 ARG A C   1 
ATOM   1709  O  O   . ARG A 1 265 ? 100.716 116.180 150.074 1.00 70.01  ? 266 ARG A O   1 
ATOM   1710  C  CB  . ARG A 1 265 ? 99.137  115.855 153.045 1.00 68.85  ? 266 ARG A CB  1 
ATOM   1711  C  CG  . ARG A 1 265 ? 98.141  114.841 153.561 1.00 68.54  ? 266 ARG A CG  1 
ATOM   1712  C  CD  . ARG A 1 265 ? 96.969  115.494 154.227 1.00 68.27  ? 266 ARG A CD  1 
ATOM   1713  N  NE  . ARG A 1 265 ? 95.949  114.527 154.592 1.00 68.07  ? 266 ARG A NE  1 
ATOM   1714  C  CZ  . ARG A 1 265 ? 94.799  114.846 155.163 1.00 67.90  ? 266 ARG A CZ  1 
ATOM   1715  N  NH1 . ARG A 1 265 ? 94.529  116.106 155.438 1.00 67.83  1 266 ARG A NH1 1 
ATOM   1716  N  NH2 . ARG A 1 265 ? 93.926  113.903 155.462 1.00 67.84  ? 266 ARG A NH2 1 
ATOM   1717  N  N   . LYS A 1 266 ? 101.703 117.155 151.833 1.00 70.27  ? 267 LYS A N   1 
ATOM   1718  C  CA  . LYS A 1 266 ? 102.364 118.126 150.991 1.00 70.98  ? 267 LYS A CA  1 
ATOM   1719  C  C   . LYS A 1 266 ? 103.359 117.473 150.058 1.00 71.56  ? 267 LYS A C   1 
ATOM   1720  O  O   . LYS A 1 266 ? 103.528 117.909 148.942 1.00 71.63  ? 267 LYS A O   1 
ATOM   1721  C  CB  . LYS A 1 266 ? 103.050 119.200 151.824 1.00 71.08  ? 267 LYS A CB  1 
ATOM   1722  C  CG  . LYS A 1 266 ? 103.785 120.217 150.999 1.00 71.15  ? 267 LYS A CG  1 
ATOM   1723  C  CD  . LYS A 1 266 ? 103.710 121.591 151.604 1.00 71.19  ? 267 LYS A CD  1 
ATOM   1724  C  CE  . LYS A 1 266 ? 102.325 122.162 151.507 1.00 71.21  ? 267 LYS A CE  1 
ATOM   1725  N  NZ  . LYS A 1 266 ? 102.231 123.466 152.204 1.00 71.25  1 267 LYS A NZ  1 
ATOM   1726  N  N   . LEU A 1 267 ? 104.009 116.412 150.503 1.00 79.69  ? 268 LEU A N   1 
ATOM   1727  C  CA  . LEU A 1 267 ? 104.956 115.730 149.638 1.00 80.20  ? 268 LEU A CA  1 
ATOM   1728  C  C   . LEU A 1 267 ? 104.257 115.014 148.502 1.00 80.31  ? 268 LEU A C   1 
ATOM   1729  O  O   . LEU A 1 267 ? 104.744 114.998 147.387 1.00 80.40  ? 268 LEU A O   1 
ATOM   1730  C  CB  . LEU A 1 267 ? 105.811 114.750 150.434 1.00 80.51  ? 268 LEU A CB  1 
ATOM   1731  C  CG  . LEU A 1 267 ? 107.281 115.110 150.591 1.00 80.77  ? 268 LEU A CG  1 
ATOM   1732  C  CD1 . LEU A 1 267 ? 107.431 116.559 150.961 1.00 80.87  ? 268 LEU A CD1 1 
ATOM   1733  C  CD2 . LEU A 1 267 ? 107.899 114.244 151.643 1.00 80.87  ? 268 LEU A CD2 1 
ATOM   1734  N  N   . LYS A 1 268 ? 103.104 114.432 148.787 1.00 72.73  ? 269 LYS A N   1 
ATOM   1735  C  CA  . LYS A 1 268 ? 102.350 113.738 147.764 1.00 72.80  ? 269 LYS A CA  1 
ATOM   1736  C  C   . LYS A 1 268 ? 101.870 114.742 146.755 1.00 73.27  ? 269 LYS A C   1 
ATOM   1737  O  O   . LYS A 1 268 ? 101.692 114.429 145.593 1.00 73.31  ? 269 LYS A O   1 
ATOM   1738  C  CB  . LYS A 1 268 ? 101.169 112.980 148.366 1.00 72.49  ? 269 LYS A CB  1 
ATOM   1739  C  CG  . LYS A 1 268 ? 101.522 111.670 149.039 1.00 72.19  ? 269 LYS A CG  1 
ATOM   1740  C  CD  . LYS A 1 268 ? 101.883 110.611 148.035 1.00 71.99  ? 269 LYS A CD  1 
ATOM   1741  C  CE  . LYS A 1 268 ? 102.457 109.387 148.697 1.00 71.82  ? 269 LYS A CE  1 
ATOM   1742  N  NZ  . LYS A 1 268 ? 101.447 108.654 149.486 1.00 71.74  1 269 LYS A NZ  1 
ATOM   1743  N  N   . GLU A 1 269 ? 101.657 115.965 147.205 1.00 83.10  ? 270 GLU A N   1 
ATOM   1744  C  CA  . GLU A 1 269 ? 101.250 116.999 146.275 1.00 83.52  ? 270 GLU A CA  1 
ATOM   1745  C  C   . GLU A 1 269 ? 102.389 117.596 145.455 1.00 83.66  ? 270 GLU A C   1 
ATOM   1746  O  O   . GLU A 1 269 ? 102.242 117.794 144.261 1.00 83.68  ? 270 GLU A O   1 
ATOM   1747  C  CB  . GLU A 1 269 ? 100.486 118.093 147.009 1.00 83.72  ? 270 GLU A CB  1 
ATOM   1748  C  CG  . GLU A 1 269 ? 99.197  117.604 147.616 1.00 83.85  ? 270 GLU A CG  1 
ATOM   1749  C  CD  . GLU A 1 269 ? 98.594  118.571 148.598 1.00 83.93  ? 270 GLU A CD  1 
ATOM   1750  O  OE1 . GLU A 1 269 ? 99.185  119.640 148.822 1.00 83.90  ? 270 GLU A OE1 1 
ATOM   1751  O  OE2 . GLU A 1 269 ? 97.524  118.260 149.148 1.00 83.95  1 270 GLU A OE2 1 
ATOM   1752  N  N   . LYS A 1 270 ? 103.522 117.874 146.085 1.00 76.29  ? 271 LYS A N   1 
ATOM   1753  C  CA  . LYS A 1 270 ? 104.603 118.586 145.414 1.00 76.39  ? 271 LYS A CA  1 
ATOM   1754  C  C   . LYS A 1 270 ? 105.783 117.716 144.994 1.00 76.79  ? 271 LYS A C   1 
ATOM   1755  O  O   . LYS A 1 270 ? 106.704 118.197 144.350 1.00 76.82  ? 271 LYS A O   1 
ATOM   1756  C  CB  . LYS A 1 270 ? 105.122 119.731 146.284 1.00 76.16  ? 271 LYS A CB  1 
ATOM   1757  C  CG  . LYS A 1 270 ? 104.095 120.752 146.702 1.00 75.96  ? 271 LYS A CG  1 
ATOM   1758  C  CD  . LYS A 1 270 ? 103.352 121.311 145.518 1.00 75.81  ? 271 LYS A CD  1 
ATOM   1759  C  CE  . LYS A 1 270 ? 102.449 122.471 145.903 1.00 75.68  ? 271 LYS A CE  1 
ATOM   1760  N  NZ  . LYS A 1 270 ? 103.209 123.734 146.061 1.00 75.63  1 271 LYS A NZ  1 
ATOM   1761  N  N   . CYS A 1 271 ? 105.767 116.444 145.364 1.00 81.94  ? 272 CYS A N   1 
ATOM   1762  C  CA  . CYS A 1 271 ? 106.865 115.544 145.031 1.00 82.34  ? 272 CYS A CA  1 
ATOM   1763  C  C   . CYS A 1 271 ? 106.385 114.112 145.074 1.00 82.73  ? 272 CYS A C   1 
ATOM   1764  O  O   . CYS A 1 271 ? 106.787 113.351 145.933 1.00 82.75  ? 272 CYS A O   1 
ATOM   1765  C  CB  . CYS A 1 271 ? 108.010 115.736 146.016 1.00 82.36  ? 272 CYS A CB  1 
ATOM   1766  S  SG  . CYS A 1 271 ? 109.501 114.807 145.667 1.00 82.38  ? 272 CYS A SG  1 
ATOM   1767  N  N   . PRO A 1 272 ? 105.531 113.739 144.117 1.00 79.88  ? 273 PRO A N   1 
ATOM   1768  C  CA  . PRO A 1 272 ? 104.742 112.509 144.109 1.00 80.19  ? 273 PRO A CA  1 
ATOM   1769  C  C   . PRO A 1 272 ? 105.549 111.230 144.157 1.00 80.60  ? 273 PRO A C   1 
ATOM   1770  O  O   . PRO A 1 272 ? 105.075 110.238 144.683 1.00 80.63  ? 273 PRO A O   1 
ATOM   1771  C  CB  . PRO A 1 272 ? 103.982 112.601 142.789 1.00 80.10  ? 273 PRO A CB  1 
ATOM   1772  C  CG  . PRO A 1 272 ? 104.763 113.507 141.966 1.00 80.02  ? 273 PRO A CG  1 
ATOM   1773  C  CD  . PRO A 1 272 ? 105.327 114.511 142.890 1.00 79.94  ? 273 PRO A CD  1 
ATOM   1774  N  N   . GLY A 1 273 ? 106.749 111.236 143.609 1.00 74.03  ? 274 GLY A N   1 
ATOM   1775  C  CA  . GLY A 1 273 ? 107.511 110.011 143.563 1.00 74.42  ? 274 GLY A CA  1 
ATOM   1776  C  C   . GLY A 1 273 ? 108.120 109.597 144.885 1.00 74.78  ? 274 GLY A C   1 
ATOM   1777  O  O   . GLY A 1 273 ? 108.504 108.453 145.055 1.00 74.82  ? 274 GLY A O   1 
ATOM   1778  N  N   . CYS A 1 274 ? 108.203 110.525 145.825 1.00 82.46  ? 275 CYS A N   1 
ATOM   1779  C  CA  . CYS A 1 274 ? 108.797 110.236 147.121 1.00 82.74  ? 275 CYS A CA  1 
ATOM   1780  C  C   . CYS A 1 274 ? 107.994 109.219 147.904 1.00 82.79  ? 275 CYS A C   1 
ATOM   1781  O  O   . CYS A 1 274 ? 106.780 109.307 147.976 1.00 82.83  ? 275 CYS A O   1 
ATOM   1782  C  CB  . CYS A 1 274 ? 108.928 111.514 147.938 1.00 82.84  ? 275 CYS A CB  1 
ATOM   1783  S  SG  . CYS A 1 274 ? 109.711 111.300 149.528 1.00 82.87  ? 275 CYS A SG  1 
ATOM   1784  N  N   . ARG A 1 275 ? 108.683 108.263 148.510 1.00 88.79  ? 276 ARG A N   1 
ATOM   1785  C  CA  . ARG A 1 275 ? 108.027 107.229 149.295 1.00 88.67  ? 276 ARG A CA  1 
ATOM   1786  C  C   . ARG A 1 275 ? 107.934 107.612 150.754 1.00 87.53  ? 276 ARG A C   1 
ATOM   1787  O  O   . ARG A 1 275 ? 108.887 108.098 151.330 1.00 87.47  ? 276 ARG A O   1 
ATOM   1788  C  CB  . ARG A 1 275 ? 108.765 105.898 149.169 1.00 89.53  ? 276 ARG A CB  1 
ATOM   1789  C  CG  . ARG A 1 275 ? 108.683 105.254 147.807 1.00 90.22  ? 276 ARG A CG  1 
ATOM   1790  C  CD  . ARG A 1 275 ? 109.120 103.806 147.868 1.00 90.81  ? 276 ARG A CD  1 
ATOM   1791  N  NE  . ARG A 1 275 ? 108.044 102.931 148.318 1.00 91.28  ? 276 ARG A NE  1 
ATOM   1792  C  CZ  . ARG A 1 275 ? 108.226 101.753 148.903 1.00 91.74  ? 276 ARG A CZ  1 
ATOM   1793  N  NH1 . ARG A 1 275 ? 109.450 101.300 149.129 1.00 91.88  1 276 ARG A NH1 1 
ATOM   1794  N  NH2 . ARG A 1 275 ? 107.176 101.036 149.271 1.00 91.88  ? 276 ARG A NH2 1 
ATOM   1795  N  N   . ILE A 1 276 ? 106.780 107.367 151.353 1.00 72.22  ? 277 ILE A N   1 
ATOM   1796  C  CA  . ILE A 1 276 ? 106.554 107.695 152.748 1.00 71.06  ? 277 ILE A CA  1 
ATOM   1797  C  C   . ILE A 1 276 ? 106.655 106.453 153.617 1.00 69.95  ? 277 ILE A C   1 
ATOM   1798  O  O   . ILE A 1 276 ? 105.850 105.545 153.504 1.00 69.85  ? 277 ILE A O   1 
ATOM   1799  C  CB  . ILE A 1 276 ? 105.177 108.323 152.937 1.00 71.03  ? 277 ILE A CB  1 
ATOM   1800  C  CG1 . ILE A 1 276 ? 105.023 109.538 152.039 1.00 71.01  ? 277 ILE A CG1 1 
ATOM   1801  C  CG2 . ILE A 1 276 ? 104.978 108.722 154.360 1.00 71.02  ? 277 ILE A CG2 1 
ATOM   1802  C  CD1 . ILE A 1 276 ? 105.978 110.621 152.348 1.00 71.00  ? 277 ILE A CD1 1 
ATOM   1803  N  N   . ILE A 1 277 ? 107.652 106.420 154.490 1.00 76.94  ? 278 ILE A N   1 
ATOM   1804  C  CA  . ILE A 1 277 ? 107.877 105.271 155.353 1.00 75.90  ? 278 ILE A CA  1 
ATOM   1805  C  C   . ILE A 1 277 ? 107.653 105.610 156.815 1.00 75.01  ? 278 ILE A C   1 
ATOM   1806  O  O   . ILE A 1 277 ? 108.303 106.491 157.365 1.00 74.93  ? 278 ILE A O   1 
ATOM   1807  C  CB  . ILE A 1 277 ? 109.291 104.731 155.195 1.00 75.81  ? 278 ILE A CB  1 
ATOM   1808  C  CG1 . ILE A 1 277 ? 109.591 104.441 153.734 1.00 75.79  ? 278 ILE A CG1 1 
ATOM   1809  C  CG2 . ILE A 1 277 ? 109.455 103.484 155.994 1.00 75.78  ? 278 ILE A CG2 1 
ATOM   1810  C  CD1 . ILE A 1 277 ? 108.725 103.397 153.148 1.00 75.77  ? 278 ILE A CD1 1 
ATOM   1811  N  N   . GLY A 1 278 ? 106.733 104.892 157.442 1.00 60.94  ? 279 GLY A N   1 
ATOM   1812  C  CA  . GLY A 1 278 ? 106.389 105.132 158.825 1.00 60.22  ? 279 GLY A CA  1 
ATOM   1813  C  C   . GLY A 1 278 ? 106.996 104.142 159.785 1.00 59.65  ? 279 GLY A C   1 
ATOM   1814  O  O   . GLY A 1 278 ? 107.116 102.975 159.478 1.00 59.59  ? 279 GLY A O   1 
ATOM   1815  N  N   . VAL A 1 279 ? 107.372 104.620 160.963 1.00 62.88  ? 280 VAL A N   1 
ATOM   1816  C  CA  . VAL A 1 279 ? 107.975 103.769 161.972 1.00 62.62  ? 280 VAL A CA  1 
ATOM   1817  C  C   . VAL A 1 279 ? 107.111 103.636 163.209 1.00 63.41  ? 280 VAL A C   1 
ATOM   1818  O  O   . VAL A 1 279 ? 106.738 104.620 163.815 1.00 63.42  ? 280 VAL A O   1 
ATOM   1819  C  CB  . VAL A 1 279 ? 109.332 104.303 162.390 1.00 61.85  ? 280 VAL A CB  1 
ATOM   1820  C  CG1 . VAL A 1 279 ? 109.974 103.367 163.370 1.00 61.58  ? 280 VAL A CG1 1 
ATOM   1821  C  CG2 . VAL A 1 279 ? 110.205 104.476 161.185 1.00 61.62  ? 280 VAL A CG2 1 
ATOM   1822  N  N   . ASP A 1 280 ? 106.816 102.397 163.581 1.00 77.79  ? 281 ASP A N   1 
ATOM   1823  C  CA  . ASP A 1 280 ? 105.943 102.104 164.714 1.00 78.78  ? 281 ASP A CA  1 
ATOM   1824  C  C   . ASP A 1 280 ? 106.578 101.067 165.636 1.00 79.83  ? 281 ASP A C   1 
ATOM   1825  O  O   . ASP A 1 280 ? 107.008 100.022 165.184 1.00 79.95  ? 281 ASP A O   1 
ATOM   1826  C  CB  . ASP A 1 280 ? 104.615 101.583 164.186 1.00 78.78  ? 281 ASP A CB  1 
ATOM   1827  C  CG  . ASP A 1 280 ? 103.547 101.537 165.229 1.00 78.81  ? 281 ASP A CG  1 
ATOM   1828  O  OD1 . ASP A 1 280 ? 102.856 100.512 165.301 1.00 78.82  ? 281 ASP A OD1 1 
ATOM   1829  O  OD2 . ASP A 1 280 ? 103.376 102.522 165.956 1.00 78.83  1 281 ASP A OD2 1 
ATOM   1830  N  N   . PRO A 1 281 ? 106.682 101.376 166.932 1.00 74.48  ? 282 PRO A N   1 
ATOM   1831  C  CA  . PRO A 1 281 ? 107.260 100.474 167.925 1.00 75.29  ? 282 PRO A CA  1 
ATOM   1832  C  C   . PRO A 1 281 ? 106.462 99.205  168.136 1.00 76.25  ? 282 PRO A C   1 
ATOM   1833  O  O   . PRO A 1 281 ? 105.252 99.225  168.007 1.00 76.34  ? 282 PRO A O   1 
ATOM   1834  C  CB  . PRO A 1 281 ? 107.253 101.313 169.190 1.00 75.12  ? 282 PRO A CB  1 
ATOM   1835  C  CG  . PRO A 1 281 ? 106.172 102.238 169.002 1.00 74.90  ? 282 PRO A CG  1 
ATOM   1836  C  CD  . PRO A 1 281 ? 106.134 102.580 167.566 1.00 74.68  ? 282 PRO A CD  1 
ATOM   1837  N  N   . GLU A 1 282 ? 107.133 98.110  168.461 1.00 95.42  ? 283 GLU A N   1 
ATOM   1838  C  CA  . GLU A 1 282 ? 106.418 96.901  168.815 1.00 96.18  ? 283 GLU A CA  1 
ATOM   1839  C  C   . GLU A 1 282 ? 105.613 97.154  170.066 1.00 96.02  ? 283 GLU A C   1 
ATOM   1840  O  O   . GLU A 1 282 ? 106.099 97.753  171.006 1.00 96.04  ? 283 GLU A O   1 
ATOM   1841  C  CB  . GLU A 1 282 ? 107.378 95.735  169.016 1.00 96.86  ? 283 GLU A CB  1 
ATOM   1842  C  CG  . GLU A 1 282 ? 107.655 94.948  167.752 1.00 97.28  ? 283 GLU A CG  1 
ATOM   1843  C  CD  . GLU A 1 282 ? 108.857 94.035  167.871 1.00 97.53  ? 283 GLU A CD  1 
ATOM   1844  O  OE1 . GLU A 1 282 ? 109.487 93.736  166.837 1.00 97.62  ? 283 GLU A OE1 1 
ATOM   1845  O  OE2 . GLU A 1 282 ? 109.180 93.616  168.996 1.00 97.58  1 283 GLU A OE2 1 
ATOM   1846  N  N   . GLY A 1 283 ? 104.380 96.673  170.073 1.00 74.07  ? 284 GLY A N   1 
ATOM   1847  C  CA  . GLY A 1 283 ? 103.444 96.944  171.143 1.00 73.74  ? 284 GLY A CA  1 
ATOM   1848  C  C   . GLY A 1 283 ? 102.414 97.983  170.771 1.00 73.24  ? 284 GLY A C   1 
ATOM   1849  O  O   . GLY A 1 283 ? 101.382 98.099  171.408 1.00 73.20  ? 284 GLY A O   1 
ATOM   1850  N  N   . SER A 1 284 ? 102.695 98.738  169.723 1.00 82.52  ? 285 SER A N   1 
ATOM   1851  C  CA  . SER A 1 284 ? 101.758 99.731  169.216 1.00 81.96  ? 285 SER A CA  1 
ATOM   1852  C  C   . SER A 1 284 ? 100.909 99.161  168.092 1.00 81.39  ? 285 SER A C   1 
ATOM   1853  O  O   . SER A 1 284 ? 101.250 98.149  167.507 1.00 81.48  ? 285 SER A O   1 
ATOM   1854  C  CB  . SER A 1 284 ? 102.504 100.971 168.733 1.00 81.95  ? 285 SER A CB  1 
ATOM   1855  O  OG  . SER A 1 284 ? 101.618 101.902 168.153 1.00 81.94  ? 285 SER A OG  1 
ATOM   1856  N  N   . ILE A 1 285 ? 99.799  99.817  167.799 1.00 73.33  ? 286 ILE A N   1 
ATOM   1857  C  CA  . ILE A 1 285 ? 98.880  99.325  166.794 1.00 72.78  ? 286 ILE A CA  1 
ATOM   1858  C  C   . ILE A 1 285 ? 98.752  100.232 165.585 1.00 72.55  ? 286 ILE A C   1 
ATOM   1859  O  O   . ILE A 1 285 ? 97.898  100.014 164.744 1.00 72.52  ? 286 ILE A O   1 
ATOM   1860  C  CB  . ILE A 1 285 ? 97.488  99.137  167.371 1.00 72.51  ? 286 ILE A CB  1 
ATOM   1861  C  CG1 . ILE A 1 285 ? 96.981  100.456 167.919 1.00 72.36  ? 286 ILE A CG1 1 
ATOM   1862  C  CG2 . ILE A 1 285 ? 97.499  98.105  168.458 1.00 72.47  ? 286 ILE A CG2 1 
ATOM   1863  C  CD1 . ILE A 1 285 ? 95.512  100.647 167.761 1.00 72.27  ? 286 ILE A CD1 1 
ATOM   1864  N  N   . LEU A 1 286 ? 99.587  101.253 165.499 1.00 77.00  ? 287 LEU A N   1 
ATOM   1865  C  CA  . LEU A 1 286 ? 99.480  102.222 164.417 1.00 76.87  ? 287 LEU A CA  1 
ATOM   1866  C  C   . LEU A 1 286 ? 99.753  101.648 163.038 1.00 76.92  ? 287 LEU A C   1 
ATOM   1867  O  O   . LEU A 1 286 ? 99.198  102.098 162.055 1.00 76.89  ? 287 LEU A O   1 
ATOM   1868  C  CB  . LEU A 1 286 ? 100.426 103.389 164.669 1.00 76.79  ? 287 LEU A CB  1 
ATOM   1869  C  CG  . LEU A 1 286 ? 100.200 104.165 165.956 1.00 76.75  ? 287 LEU A CG  1 
ATOM   1870  C  CD1 . LEU A 1 286 ? 101.184 105.284 166.072 1.00 76.75  ? 287 LEU A CD1 1 
ATOM   1871  C  CD2 . LEU A 1 286 ? 98.810  104.702 165.976 1.00 76.73  ? 287 LEU A CD2 1 
ATOM   1872  N  N   . ALA A 1 287 ? 100.606 100.643 162.977 1.00 70.31  ? 288 ALA A N   1 
ATOM   1873  C  CA  . ALA A 1 287 ? 101.110 100.137 161.715 1.00 70.63  ? 288 ALA A CA  1 
ATOM   1874  C  C   . ALA A 1 287 ? 100.099 99.364  160.895 1.00 71.65  ? 288 ALA A C   1 
ATOM   1875  O  O   . ALA A 1 287 ? 99.193  98.751  161.430 1.00 71.73  ? 288 ALA A O   1 
ATOM   1876  C  CB  . ALA A 1 287 ? 102.312 99.290  161.959 1.00 70.32  ? 288 ALA A CB  1 
ATOM   1877  N  N   . GLU A 1 288 ? 100.281 99.390  159.584 1.00 78.89  ? 289 GLU A N   1 
ATOM   1878  C  CA  . GLU A 1 288 ? 99.482  98.593  158.676 1.00 80.30  ? 289 GLU A CA  1 
ATOM   1879  C  C   . GLU A 1 288 ? 100.406 97.800  157.792 1.00 82.15  ? 289 GLU A C   1 
ATOM   1880  O  O   . GLU A 1 288 ? 101.485 98.262  157.462 1.00 82.21  ? 289 GLU A O   1 
ATOM   1881  C  CB  . GLU A 1 288 ? 98.633  99.492  157.798 1.00 79.81  ? 289 GLU A CB  1 
ATOM   1882  C  CG  . GLU A 1 288 ? 97.588  100.252 158.541 1.00 79.52  ? 289 GLU A CG  1 
ATOM   1883  C  CD  . GLU A 1 288 ? 96.613  100.939 157.629 1.00 79.43  ? 289 GLU A CD  1 
ATOM   1884  O  OE1 . GLU A 1 288 ? 97.044  101.459 156.587 1.00 79.40  ? 289 GLU A OE1 1 
ATOM   1885  O  OE2 . GLU A 1 288 ? 95.410  100.953 157.949 1.00 79.41  1 289 GLU A OE2 1 
ATOM   1886  N  N   . PRO A 1 289 ? 99.987  96.603  157.382 1.00 79.52  ? 290 PRO A N   1 
ATOM   1887  C  CA  . PRO A 1 289 ? 98.765  95.862  157.684 1.00 81.23  ? 290 PRO A CA  1 
ATOM   1888  C  C   . PRO A 1 289 ? 98.732  95.348  159.105 1.00 83.88  ? 290 PRO A C   1 
ATOM   1889  O  O   . PRO A 1 289 ? 99.772  95.256  159.731 1.00 84.01  ? 290 PRO A O   1 
ATOM   1890  C  CB  . PRO A 1 289 ? 98.837  94.689  156.723 1.00 80.78  ? 290 PRO A CB  1 
ATOM   1891  C  CG  . PRO A 1 289 ? 100.254 94.480  156.526 1.00 80.27  ? 290 PRO A CG  1 
ATOM   1892  C  CD  . PRO A 1 289 ? 100.857 95.832  156.489 1.00 79.84  ? 290 PRO A CD  1 
ATOM   1893  N  N   . GLU A 1 290 ? 97.546  94.995  159.586 1.00 114.99 ? 291 GLU A N   1 
ATOM   1894  C  CA  . GLU A 1 290 ? 97.318  94.664  160.986 1.00 117.67 ? 291 GLU A CA  1 
ATOM   1895  C  C   . GLU A 1 290 ? 98.188  93.502  161.415 1.00 118.97 ? 291 GLU A C   1 
ATOM   1896  O  O   . GLU A 1 290 ? 98.509  93.352  162.584 1.00 119.18 ? 291 GLU A O   1 
ATOM   1897  C  CB  . GLU A 1 290 ? 95.845  94.330  161.206 1.00 118.61 ? 291 GLU A CB  1 
ATOM   1898  C  CG  . GLU A 1 290 ? 95.463  94.023  162.640 1.00 119.26 ? 291 GLU A CG  1 
ATOM   1899  C  CD  . GLU A 1 290 ? 95.573  95.221  163.563 1.00 119.55 ? 291 GLU A CD  1 
ATOM   1900  O  OE1 . GLU A 1 290 ? 95.335  96.356  163.107 1.00 119.69 ? 291 GLU A OE1 1 
ATOM   1901  O  OE2 . GLU A 1 290 ? 95.896  95.027  164.752 1.00 119.69 1 291 GLU A OE2 1 
ATOM   1902  N  N   . GLU A 1 291 ? 98.598  92.700  160.448 1.00 117.62 ? 292 GLU A N   1 
ATOM   1903  C  CA  . GLU A 1 291 ? 99.429  91.541  160.714 1.00 118.63 ? 292 GLU A CA  1 
ATOM   1904  C  C   . GLU A 1 291 ? 100.749 91.903  161.387 1.00 118.49 ? 292 GLU A C   1 
ATOM   1905  O  O   . GLU A 1 291 ? 101.299 91.123  162.153 1.00 118.51 ? 292 GLU A O   1 
ATOM   1906  C  CB  . GLU A 1 291 ? 99.699  90.789  159.410 1.00 119.41 ? 292 GLU A CB  1 
ATOM   1907  C  CG  . GLU A 1 291 ? 98.516  89.979  158.884 1.00 119.87 ? 292 GLU A CG  1 
ATOM   1908  C  CD  . GLU A 1 291 ? 97.497  90.804  158.114 1.00 120.08 ? 292 GLU A CD  1 
ATOM   1909  O  OE1 . GLU A 1 291 ? 97.895  91.524  157.178 1.00 120.13 ? 292 GLU A OE1 1 
ATOM   1910  O  OE2 . GLU A 1 291 ? 96.293  90.721  158.436 1.00 120.16 1 292 GLU A OE2 1 
ATOM   1911  N  N   . LEU A 1 292 ? 101.261 93.086  161.090 1.00 82.08  ? 293 LEU A N   1 
ATOM   1912  C  CA  . LEU A 1 292 ? 102.492 93.555  161.702 1.00 81.93  ? 293 LEU A CA  1 
ATOM   1913  C  C   . LEU A 1 292 ? 102.344 93.818  163.185 1.00 83.70  ? 293 LEU A C   1 
ATOM   1914  O  O   . LEU A 1 292 ? 103.303 93.738  163.934 1.00 83.65  ? 293 LEU A O   1 
ATOM   1915  C  CB  . LEU A 1 292 ? 102.958 94.833  161.020 1.00 80.47  ? 293 LEU A CB  1 
ATOM   1916  C  CG  . LEU A 1 292 ? 103.534 94.718  159.619 1.00 79.28  ? 293 LEU A CG  1 
ATOM   1917  C  CD1 . LEU A 1 292 ? 103.651 96.082  159.019 1.00 78.83  ? 293 LEU A CD1 1 
ATOM   1918  C  CD2 . LEU A 1 292 ? 104.877 94.042  159.662 1.00 78.89  ? 293 LEU A CD2 1 
ATOM   1919  N  N   . ASN A 1 293 ? 101.136 94.143  163.609 1.00 89.54  ? 294 ASN A N   1 
ATOM   1920  C  CA  . ASN A 1 293 ? 100.927 94.594  164.972 1.00 91.65  ? 294 ASN A CA  1 
ATOM   1921  C  C   . ASN A 1 293 ? 100.847 93.474  165.998 1.00 95.22  ? 294 ASN A C   1 
ATOM   1922  O  O   . ASN A 1 293 ? 100.845 93.725  167.197 1.00 95.51  ? 294 ASN A O   1 
ATOM   1923  C  CB  . ASN A 1 293 ? 99.673  95.458  165.048 1.00 90.71  ? 294 ASN A CB  1 
ATOM   1924  C  CG  . ASN A 1 293 ? 99.782  96.701  164.220 1.00 89.92  ? 294 ASN A CG  1 
ATOM   1925  O  OD1 . ASN A 1 293 ? 100.866 97.223  164.023 1.00 89.60  ? 294 ASN A OD1 1 
ATOM   1926  N  ND2 . ASN A 1 293 ? 98.656  97.189  163.730 1.00 89.53  ? 294 ASN A ND2 1 
ATOM   1927  N  N   . GLN A 1 294 ? 100.777 92.240  165.521 1.00 127.03 ? 295 GLN A N   1 
ATOM   1928  C  CA  . GLN A 1 294 ? 100.604 91.095  166.400 1.00 130.87 ? 295 GLN A CA  1 
ATOM   1929  C  C   . GLN A 1 294 ? 101.852 90.871  167.222 1.00 133.96 ? 295 GLN A C   1 
ATOM   1930  O  O   . GLN A 1 294 ? 102.909 90.578  166.679 1.00 134.24 ? 295 GLN A O   1 
ATOM   1931  C  CB  . GLN A 1 294 ? 100.298 89.842  165.580 1.00 131.48 ? 295 GLN A CB  1 
ATOM   1932  C  CG  . GLN A 1 294 ? 99.099  89.966  164.652 1.00 131.86 ? 295 GLN A CG  1 
ATOM   1933  C  CD  . GLN A 1 294 ? 97.782  90.017  165.396 1.00 132.25 ? 295 GLN A CD  1 
ATOM   1934  O  OE1 . GLN A 1 294 ? 97.678  89.537  166.524 1.00 132.32 ? 295 GLN A OE1 1 
ATOM   1935  N  NE2 . GLN A 1 294 ? 96.766  90.600  164.769 1.00 132.49 ? 295 GLN A NE2 1 
ATOM   1936  N  N   . THR A 1 295 ? 101.724 90.977  168.538 1.00 119.30 ? 296 THR A N   1 
ATOM   1937  C  CA  . THR A 1 295 ? 102.888 90.933  169.410 1.00 122.29 ? 296 THR A CA  1 
ATOM   1938  C  C   . THR A 1 295 ? 102.552 90.490  170.808 1.00 124.87 ? 296 THR A C   1 
ATOM   1939  O  O   . THR A 1 295 ? 101.405 90.534  171.231 1.00 125.12 ? 296 THR A O   1 
ATOM   1940  C  CB  . THR A 1 295 ? 103.535 92.309  169.546 1.00 122.49 ? 296 THR A CB  1 
ATOM   1941  O  OG1 . THR A 1 295 ? 104.647 92.222  170.442 1.00 122.59 ? 296 THR A OG1 1 
ATOM   1942  C  CG2 . THR A 1 295 ? 102.536 93.302  170.099 1.00 122.40 ? 296 THR A CG2 1 
ATOM   1943  N  N   . GLU A 1 296 ? 103.575 90.068  171.533 1.00 141.02 ? 297 GLU A N   1 
ATOM   1944  C  CA  . GLU A 1 296 ? 103.399 89.678  172.915 1.00 142.97 ? 297 GLU A CA  1 
ATOM   1945  C  C   . GLU A 1 296 ? 103.389 90.908  173.815 1.00 142.21 ? 297 GLU A C   1 
ATOM   1946  O  O   . GLU A 1 296 ? 102.445 91.132  174.569 1.00 142.28 ? 297 GLU A O   1 
ATOM   1947  C  CB  . GLU A 1 296 ? 104.523 88.734  173.337 1.00 144.73 ? 297 GLU A CB  1 
ATOM   1948  N  N   . GLN A 1 297 ? 104.442 91.710  173.707 1.00 146.71 ? 298 GLN A N   1 
ATOM   1949  C  CA  . GLN A 1 297 ? 104.643 92.864  174.572 1.00 145.13 ? 298 GLN A CA  1 
ATOM   1950  C  C   . GLN A 1 297 ? 103.617 93.939  174.272 1.00 140.50 ? 298 GLN A C   1 
ATOM   1951  O  O   . GLN A 1 297 ? 103.094 94.002  173.171 1.00 140.03 ? 298 GLN A O   1 
ATOM   1952  C  CB  . GLN A 1 297 ? 106.057 93.414  174.384 1.00 147.30 ? 298 GLN A CB  1 
ATOM   1953  C  CG  . GLN A 1 297 ? 107.150 92.346  174.424 1.00 148.86 ? 298 GLN A CG  1 
ATOM   1954  C  CD  . GLN A 1 297 ? 108.229 92.641  175.445 1.00 149.86 ? 298 GLN A CD  1 
ATOM   1955  O  OE1 . GLN A 1 297 ? 107.938 92.956  176.598 1.00 150.08 ? 298 GLN A OE1 1 
ATOM   1956  N  NE2 . GLN A 1 297 ? 109.486 92.543  175.025 1.00 150.57 ? 298 GLN A NE2 1 
ATOM   1957  N  N   . THR A 1 298 ? 103.303 94.764  175.261 1.00 123.11 ? 299 THR A N   1 
ATOM   1958  C  CA  . THR A 1 298 ? 102.396 95.880  175.031 1.00 118.80 ? 299 THR A CA  1 
ATOM   1959  C  C   . THR A 1 298 ? 103.010 97.222  175.407 1.00 114.13 ? 299 THR A C   1 
ATOM   1960  O  O   . THR A 1 298 ? 102.633 98.250  174.857 1.00 113.81 ? 299 THR A O   1 
ATOM   1961  C  CB  . THR A 1 298 ? 101.055 95.700  175.751 1.00 119.09 ? 299 THR A CB  1 
ATOM   1962  O  OG1 . THR A 1 298 ? 100.216 96.828  175.483 1.00 119.12 ? 299 THR A OG1 1 
ATOM   1963  C  CG2 . THR A 1 298 ? 101.261 95.578  177.240 1.00 119.24 ? 299 THR A CG2 1 
ATOM   1964  N  N   . THR A 1 299 ? 103.943 97.213  176.355 1.00 116.56 ? 300 THR A N   1 
ATOM   1965  C  CA  . THR A 1 299 ? 104.693 98.418  176.701 1.00 112.25 ? 300 THR A CA  1 
ATOM   1966  C  C   . THR A 1 299 ? 106.130 98.331  176.214 1.00 108.04 ? 300 THR A C   1 
ATOM   1967  O  O   . THR A 1 299 ? 106.658 97.246  176.014 1.00 107.75 ? 300 THR A O   1 
ATOM   1968  C  CB  . THR A 1 299 ? 104.699 98.689  178.206 1.00 112.33 ? 300 THR A CB  1 
ATOM   1969  O  OG1 . THR A 1 299 ? 105.176 97.531  178.895 1.00 112.32 ? 300 THR A OG1 1 
ATOM   1970  C  CG2 . THR A 1 299 ? 103.305 99.033  178.690 1.00 112.50 ? 300 THR A CG2 1 
ATOM   1971  N  N   . TYR A 1 300 ? 106.754 99.487  176.037 1.00 77.10  ? 301 TYR A N   1 
ATOM   1972  C  CA  . TYR A 1 300 ? 108.112 99.571  175.528 1.00 73.68  ? 301 TYR A CA  1 
ATOM   1973  C  C   . TYR A 1 300 ? 108.788 100.807 176.083 1.00 72.81  ? 301 TYR A C   1 
ATOM   1974  O  O   . TYR A 1 300 ? 108.129 101.777 176.416 1.00 72.66  ? 301 TYR A O   1 
ATOM   1975  C  CB  . TYR A 1 300 ? 108.091 99.627  174.012 1.00 71.89  ? 301 TYR A CB  1 
ATOM   1976  C  CG  . TYR A 1 300 ? 107.031 100.541 173.460 1.00 70.22  ? 301 TYR A CG  1 
ATOM   1977  C  CD1 . TYR A 1 300 ? 107.267 101.884 173.300 1.00 69.36  ? 301 TYR A CD1 1 
ATOM   1978  C  CD2 . TYR A 1 300 ? 105.797 100.056 173.100 1.00 69.27  ? 301 TYR A CD2 1 
ATOM   1979  C  CE1 . TYR A 1 300 ? 106.313 102.706 172.805 1.00 68.72  ? 301 TYR A CE1 1 
ATOM   1980  C  CE2 . TYR A 1 300 ? 104.839 100.877 172.604 1.00 68.70  ? 301 TYR A CE2 1 
ATOM   1981  C  CZ  . TYR A 1 300 ? 105.099 102.200 172.457 1.00 68.50  ? 301 TYR A CZ  1 
ATOM   1982  O  OH  . TYR A 1 300 ? 104.136 103.031 171.959 1.00 68.19  ? 301 TYR A OH  1 
ATOM   1983  N  N   . GLU A 1 301 ? 110.105 100.760 176.207 1.00 93.95  ? 302 GLU A N   1 
ATOM   1984  C  CA  . GLU A 1 301 ? 110.837 101.855 176.831 1.00 93.27  ? 302 GLU A CA  1 
ATOM   1985  C  C   . GLU A 1 301 ? 110.919 103.147 176.021 1.00 92.40  ? 302 GLU A C   1 
ATOM   1986  O  O   . GLU A 1 301 ? 111.049 104.221 176.590 1.00 92.33  ? 302 GLU A O   1 
ATOM   1987  C  CB  . GLU A 1 301 ? 112.231 101.397 177.259 1.00 93.44  ? 302 GLU A CB  1 
ATOM   1988  C  CG  . GLU A 1 301 ? 112.231 100.250 178.249 1.00 93.58  ? 302 GLU A CG  1 
ATOM   1989  C  CD  . GLU A 1 301 ? 111.771 100.644 179.632 1.00 93.66  ? 302 GLU A CD  1 
ATOM   1990  O  OE1 . GLU A 1 301 ? 111.673 101.848 179.912 1.00 93.67  ? 302 GLU A OE1 1 
ATOM   1991  O  OE2 . GLU A 1 301 ? 111.506 99.745  180.450 1.00 93.67  1 302 GLU A OE2 1 
ATOM   1992  N  N   . VAL A 1 302 ? 110.845 103.049 174.702 1.00 76.91  ? 303 VAL A N   1 
ATOM   1993  C  CA  . VAL A 1 302 ? 111.024 104.221 173.859 1.00 76.08  ? 303 VAL A CA  1 
ATOM   1994  C  C   . VAL A 1 302 ? 109.902 105.216 174.047 1.00 75.25  ? 303 VAL A C   1 
ATOM   1995  O  O   . VAL A 1 302 ? 108.745 104.841 174.083 1.00 75.21  ? 303 VAL A O   1 
ATOM   1996  C  CB  . VAL A 1 302 ? 111.133 103.837 172.385 1.00 76.08  ? 303 VAL A CB  1 
ATOM   1997  C  CG1 . VAL A 1 302 ? 111.130 105.056 171.524 1.00 76.05  ? 303 VAL A CG1 1 
ATOM   1998  C  CG2 . VAL A 1 302 ? 112.392 103.065 172.146 1.00 76.12  ? 303 VAL A CG2 1 
ATOM   1999  N  N   . GLU A 1 303 ? 110.251 106.491 174.156 1.00 92.26  ? 304 GLU A N   1 
ATOM   2000  C  CA  . GLU A 1 303 ? 109.268 107.526 174.418 1.00 91.36  ? 304 GLU A CA  1 
ATOM   2001  C  C   . GLU A 1 303 ? 108.853 108.319 173.191 1.00 89.93  ? 304 GLU A C   1 
ATOM   2002  O  O   . GLU A 1 303 ? 109.659 108.594 172.320 1.00 89.83  ? 304 GLU A O   1 
ATOM   2003  C  CB  . GLU A 1 303 ? 109.795 108.480 175.483 1.00 91.76  ? 304 GLU A CB  1 
ATOM   2004  C  CG  . GLU A 1 303 ? 110.082 107.828 176.805 1.00 92.01  ? 304 GLU A CG  1 
ATOM   2005  C  CD  . GLU A 1 303 ? 110.662 108.783 177.816 1.00 92.08  ? 304 GLU A CD  1 
ATOM   2006  O  OE1 . GLU A 1 303 ? 111.601 108.380 178.521 1.00 92.07  ? 304 GLU A OE1 1 
ATOM   2007  O  OE2 . GLU A 1 303 ? 110.182 109.926 177.913 1.00 92.11  1 304 GLU A OE2 1 
ATOM   2008  N  N   . GLY A 1 304 ? 107.587 108.704 173.149 1.00 76.23  ? 305 GLY A N   1 
ATOM   2009  C  CA  . GLY A 1 304 ? 107.095 109.632 172.152 1.00 74.86  ? 305 GLY A CA  1 
ATOM   2010  C  C   . GLY A 1 304 ? 106.434 109.062 170.920 1.00 73.53  ? 305 GLY A C   1 
ATOM   2011  O  O   . GLY A 1 304 ? 105.795 109.783 170.176 1.00 73.38  ? 305 GLY A O   1 
ATOM   2012  N  N   . ILE A 1 305 ? 106.564 107.767 170.704 1.00 66.65  ? 306 ILE A N   1 
ATOM   2013  C  CA  . ILE A 1 305 ? 105.942 107.158 169.549 1.00 65.55  ? 306 ILE A CA  1 
ATOM   2014  C  C   . ILE A 1 305 ? 105.118 105.946 169.921 1.00 65.32  ? 306 ILE A C   1 
ATOM   2015  O  O   . ILE A 1 305 ? 105.360 105.307 170.926 1.00 65.32  ? 306 ILE A O   1 
ATOM   2016  C  CB  . ILE A 1 305 ? 106.962 106.742 168.510 1.00 64.85  ? 306 ILE A CB  1 
ATOM   2017  C  CG1 . ILE A 1 305 ? 107.983 105.805 169.117 1.00 64.48  ? 306 ILE A CG1 1 
ATOM   2018  C  CG2 . ILE A 1 305 ? 107.648 107.934 167.952 1.00 64.73  ? 306 ILE A CG2 1 
ATOM   2019  C  CD1 . ILE A 1 305 ? 108.816 105.134 168.103 1.00 64.28  ? 306 ILE A CD1 1 
ATOM   2020  N  N   . GLY A 1 306 ? 104.120 105.652 169.105 1.00 81.65  ? 307 GLY A N   1 
ATOM   2021  C  CA  . GLY A 1 306 ? 103.282 104.486 169.302 1.00 81.52  ? 307 GLY A CA  1 
ATOM   2022  C  C   . GLY A 1 306 ? 102.103 104.740 170.211 1.00 81.38  ? 307 GLY A C   1 
ATOM   2023  O  O   . GLY A 1 306 ? 102.205 105.485 171.172 1.00 81.36  ? 307 GLY A O   1 
ATOM   2024  N  N   . TYR A 1 307 ? 100.982 104.099 169.917 1.00 69.96  ? 308 TYR A N   1 
ATOM   2025  C  CA  . TYR A 1 307 ? 99.774  104.290 170.699 1.00 69.85  ? 308 TYR A CA  1 
ATOM   2026  C  C   . TYR A 1 307 ? 98.858  103.091 170.609 1.00 70.10  ? 308 TYR A C   1 
ATOM   2027  O  O   . TYR A 1 307 ? 98.957  102.294 169.694 1.00 70.12  ? 308 TYR A O   1 
ATOM   2028  C  CB  . TYR A 1 307 ? 99.020  105.539 170.249 1.00 69.58  ? 308 TYR A CB  1 
ATOM   2029  C  CG  . TYR A 1 307 ? 99.486  106.823 170.885 1.00 69.32  ? 308 TYR A CG  1 
ATOM   2030  C  CD1 . TYR A 1 307 ? 100.006 107.842 170.125 1.00 69.20  ? 308 TYR A CD1 1 
ATOM   2031  C  CD2 . TYR A 1 307 ? 99.401  107.013 172.244 1.00 69.17  ? 308 TYR A CD2 1 
ATOM   2032  C  CE1 . TYR A 1 307 ? 100.429 109.007 170.699 1.00 69.12  ? 308 TYR A CE1 1 
ATOM   2033  C  CE2 . TYR A 1 307 ? 99.822  108.175 172.822 1.00 69.09  ? 308 TYR A CE2 1 
ATOM   2034  C  CZ  . TYR A 1 307 ? 100.336 109.166 172.047 1.00 69.08  ? 308 TYR A CZ  1 
ATOM   2035  O  OH  . TYR A 1 307 ? 100.755 110.328 172.627 1.00 69.07  ? 308 TYR A OH  1 
ATOM   2036  N  N   . ASP A 1 308 ? 97.965  102.980 171.580 1.00 84.22  ? 309 ASP A N   1 
ATOM   2037  C  CA  . ASP A 1 308 ? 97.008  101.897 171.635 1.00 84.42  ? 309 ASP A CA  1 
ATOM   2038  C  C   . ASP A 1 308 ? 95.706  102.284 170.967 1.00 84.41  ? 309 ASP A C   1 
ATOM   2039  O  O   . ASP A 1 308 ? 94.701  101.621 171.131 1.00 84.43  ? 309 ASP A O   1 
ATOM   2040  C  CB  . ASP A 1 308 ? 96.761  101.488 173.076 1.00 84.57  ? 309 ASP A CB  1 
ATOM   2041  C  CG  . ASP A 1 308 ? 96.264  102.622 173.920 1.00 84.65  ? 309 ASP A CG  1 
ATOM   2042  O  OD1 . ASP A 1 308 ? 96.610  103.773 173.626 1.00 84.69  ? 309 ASP A OD1 1 
ATOM   2043  O  OD2 . ASP A 1 308 ? 95.523  102.365 174.884 1.00 84.72  1 309 ASP A OD2 1 
ATOM   2044  N  N   . PHE A 1 309 ? 95.736  103.375 170.222 1.00 72.06  ? 310 PHE A N   1 
ATOM   2045  C  CA  . PHE A 1 309 ? 94.586  103.827 169.469 1.00 71.99  ? 310 PHE A CA  1 
ATOM   2046  C  C   . PHE A 1 309 ? 95.063  104.619 168.274 1.00 71.67  ? 310 PHE A C   1 
ATOM   2047  O  O   . PHE A 1 309 ? 96.169  105.111 168.276 1.00 71.67  ? 310 PHE A O   1 
ATOM   2048  C  CB  . PHE A 1 309 ? 93.701  104.698 170.338 1.00 72.14  ? 310 PHE A CB  1 
ATOM   2049  C  CG  . PHE A 1 309 ? 94.340  105.976 170.758 1.00 72.26  ? 310 PHE A CG  1 
ATOM   2050  C  CD1 . PHE A 1 309 ? 94.078  107.144 170.087 1.00 72.31  ? 310 PHE A CD1 1 
ATOM   2051  C  CD2 . PHE A 1 309 ? 95.195  106.013 171.833 1.00 72.30  ? 310 PHE A CD2 1 
ATOM   2052  C  CE1 . PHE A 1 309 ? 94.664  108.314 170.469 1.00 72.33  ? 310 PHE A CE1 1 
ATOM   2053  C  CE2 . PHE A 1 309 ? 95.782  107.187 172.219 1.00 72.32  ? 310 PHE A CE2 1 
ATOM   2054  C  CZ  . PHE A 1 309 ? 95.517  108.335 171.537 1.00 72.33  ? 310 PHE A CZ  1 
ATOM   2055  N  N   . ILE A 1 310 ? 94.228  104.750 167.254 1.00 74.65  ? 311 ILE A N   1 
ATOM   2056  C  CA  . ILE A 1 310 ? 94.608  105.508 166.076 1.00 74.30  ? 311 ILE A CA  1 
ATOM   2057  C  C   . ILE A 1 310 ? 94.115  106.928 166.213 1.00 73.85  ? 311 ILE A C   1 
ATOM   2058  O  O   . ILE A 1 310 ? 92.925  107.173 166.167 1.00 73.97  ? 311 ILE A O   1 
ATOM   2059  C  CB  . ILE A 1 310 ? 93.941  104.940 164.832 1.00 74.37  ? 311 ILE A CB  1 
ATOM   2060  C  CG1 . ILE A 1 310 ? 94.130  103.435 164.765 1.00 74.41  ? 311 ILE A CG1 1 
ATOM   2061  C  CG2 . ILE A 1 310 ? 94.503  105.577 163.611 1.00 74.38  ? 311 ILE A CG2 1 
ATOM   2062  C  CD1 . ILE A 1 310 ? 95.539  103.010 164.605 1.00 74.43  ? 311 ILE A CD1 1 
ATOM   2063  N  N   . PRO A 1 311 ? 95.038  107.878 166.348 1.00 73.83  ? 312 PRO A N   1 
ATOM   2064  C  CA  . PRO A 1 311 ? 94.697  109.284 166.521 1.00 73.41  ? 312 PRO A CA  1 
ATOM   2065  C  C   . PRO A 1 311 ? 94.006  109.847 165.303 1.00 72.85  ? 312 PRO A C   1 
ATOM   2066  O  O   . PRO A 1 311 ? 94.286  109.427 164.198 1.00 72.80  ? 312 PRO A O   1 
ATOM   2067  C  CB  . PRO A 1 311 ? 96.054  109.941 166.723 1.00 73.54  ? 312 PRO A CB  1 
ATOM   2068  C  CG  . PRO A 1 311 ? 96.923  108.871 167.183 1.00 73.65  ? 312 PRO A CG  1 
ATOM   2069  C  CD  . PRO A 1 311 ? 96.482  107.666 166.459 1.00 73.75  ? 312 PRO A CD  1 
ATOM   2070  N  N   . THR A 1 312 ? 93.103  110.790 165.515 1.00 66.11  ? 313 THR A N   1 
ATOM   2071  C  CA  . THR A 1 312 ? 92.312  111.356 164.445 1.00 65.61  ? 313 THR A CA  1 
ATOM   2072  C  C   . THR A 1 312 ? 93.168  112.063 163.413 1.00 65.30  ? 313 THR A C   1 
ATOM   2073  O  O   . THR A 1 312 ? 92.899  112.001 162.226 1.00 65.31  ? 313 THR A O   1 
ATOM   2074  C  CB  . THR A 1 312 ? 91.327  112.364 165.030 1.00 65.52  ? 313 THR A CB  1 
ATOM   2075  O  OG1 . THR A 1 312 ? 90.489  111.708 165.980 1.00 65.50  ? 313 THR A OG1 1 
ATOM   2076  C  CG2 . THR A 1 312 ? 90.467  112.960 163.964 1.00 65.50  ? 313 THR A CG2 1 
ATOM   2077  N  N   . VAL A 1 313 ? 94.222  112.717 163.868 1.00 66.94  ? 314 VAL A N   1 
ATOM   2078  C  CA  . VAL A 1 313 ? 95.077  113.484 162.977 1.00 66.75  ? 314 VAL A CA  1 
ATOM   2079  C  C   . VAL A 1 313 ? 95.920  112.626 162.053 1.00 66.97  ? 314 VAL A C   1 
ATOM   2080  O  O   . VAL A 1 313 ? 96.343  113.068 161.003 1.00 66.97  ? 314 VAL A O   1 
ATOM   2081  C  CB  . VAL A 1 313 ? 95.973  114.445 163.751 1.00 66.49  ? 314 VAL A CB  1 
ATOM   2082  C  CG1 . VAL A 1 313 ? 95.141  115.504 164.403 1.00 66.43  ? 314 VAL A CG1 1 
ATOM   2083  C  CG2 . VAL A 1 313 ? 96.765  113.702 164.785 1.00 66.40  ? 314 VAL A CG2 1 
ATOM   2084  N  N   . LEU A 1 314 ? 96.178  111.399 162.463 1.00 65.22  ? 315 LEU A N   1 
ATOM   2085  C  CA  . LEU A 1 314 ? 96.921  110.467 161.643 1.00 65.57  ? 315 LEU A CA  1 
ATOM   2086  C  C   . LEU A 1 314 ? 96.142  110.072 160.400 1.00 66.47  ? 315 LEU A C   1 
ATOM   2087  O  O   . LEU A 1 314 ? 94.963  109.777 160.466 1.00 66.52  ? 315 LEU A O   1 
ATOM   2088  C  CB  . LEU A 1 314 ? 97.275  109.233 162.467 1.00 65.18  ? 315 LEU A CB  1 
ATOM   2089  C  CG  . LEU A 1 314 ? 97.969  108.049 161.813 1.00 64.85  ? 315 LEU A CG  1 
ATOM   2090  C  CD1 . LEU A 1 314 ? 99.197  108.490 161.085 1.00 64.77  ? 315 LEU A CD1 1 
ATOM   2091  C  CD2 . LEU A 1 314 ? 98.335  107.056 162.859 1.00 64.73  ? 315 LEU A CD2 1 
ATOM   2092  N  N   . ASP A 1 315 ? 96.825  110.040 159.267 1.00 72.68  ? 316 ASP A N   1 
ATOM   2093  C  CA  . ASP A 1 315 ? 96.229  109.611 158.018 1.00 73.70  ? 316 ASP A CA  1 
ATOM   2094  C  C   . ASP A 1 315 ? 97.067  108.493 157.459 1.00 74.66  ? 316 ASP A C   1 
ATOM   2095  O  O   . ASP A 1 315 ? 98.103  108.725 156.878 1.00 74.75  ? 316 ASP A O   1 
ATOM   2096  C  CB  . ASP A 1 315 ? 96.170  110.768 157.031 1.00 73.75  ? 316 ASP A CB  1 
ATOM   2097  C  CG  . ASP A 1 315 ? 95.580  110.372 155.706 1.00 73.79  ? 316 ASP A CG  1 
ATOM   2098  O  OD1 . ASP A 1 315 ? 95.396  111.252 154.849 1.00 73.80  ? 316 ASP A OD1 1 
ATOM   2099  O  OD2 . ASP A 1 315 ? 95.306  109.178 155.514 1.00 73.82  1 316 ASP A OD2 1 
ATOM   2100  N  N   . ARG A 1 316 ? 96.616  107.268 157.647 1.00 76.27  ? 317 ARG A N   1 
ATOM   2101  C  CA  . ARG A 1 316 ? 97.415  106.121 157.270 1.00 77.15  ? 317 ARG A CA  1 
ATOM   2102  C  C   . ARG A 1 316 ? 97.363  105.851 155.780 1.00 77.60  ? 317 ARG A C   1 
ATOM   2103  O  O   . ARG A 1 316 ? 98.127  105.054 155.264 1.00 77.65  ? 317 ARG A O   1 
ATOM   2104  C  CB  . ARG A 1 316 ? 96.956  104.889 158.036 1.00 77.53  ? 317 ARG A CB  1 
ATOM   2105  C  CG  . ARG A 1 316 ? 96.929  105.053 159.523 1.00 77.81  ? 317 ARG A CG  1 
ATOM   2106  C  CD  . ARG A 1 316 ? 95.863  104.176 160.130 1.00 78.09  ? 317 ARG A CD  1 
ATOM   2107  N  NE  . ARG A 1 316 ? 96.381  102.912 160.623 1.00 78.31  ? 317 ARG A NE  1 
ATOM   2108  C  CZ  . ARG A 1 316 ? 95.613  101.891 160.962 1.00 78.52  ? 317 ARG A CZ  1 
ATOM   2109  N  NH1 . ARG A 1 316 ? 94.306  101.994 160.843 1.00 78.58  1 317 ARG A NH1 1 
ATOM   2110  N  NH2 . ARG A 1 316 ? 96.144  100.771 161.408 1.00 78.61  ? 317 ARG A NH2 1 
ATOM   2111  N  N   . THR A 1 317 ? 96.448  106.507 155.092 1.00 72.89  ? 318 THR A N   1 
ATOM   2112  C  CA  . THR A 1 317 ? 96.319  106.309 153.663 1.00 73.25  ? 318 THR A CA  1 
ATOM   2113  C  C   . THR A 1 317 ? 97.532  106.833 152.915 1.00 73.48  ? 318 THR A C   1 
ATOM   2114  O  O   . THR A 1 317 ? 97.882  106.333 151.857 1.00 73.52  ? 318 THR A O   1 
ATOM   2115  C  CB  . THR A 1 317 ? 95.045  106.961 153.115 1.00 73.33  ? 318 THR A CB  1 
ATOM   2116  O  OG1 . THR A 1 317 ? 95.145  108.379 153.222 1.00 73.30  ? 318 THR A OG1 1 
ATOM   2117  C  CG2 . THR A 1 317 ? 93.852  106.502 153.892 1.00 73.36  ? 318 THR A CG2 1 
ATOM   2118  N  N   . VAL A 1 318 ? 98.175  107.847 153.469 1.00 83.23  ? 319 VAL A N   1 
ATOM   2119  C  CA  . VAL A 1 318 ? 99.323  108.440 152.815 1.00 83.36  ? 319 VAL A CA  1 
ATOM   2120  C  C   . VAL A 1 318 ? 100.627 107.758 153.170 1.00 83.07  ? 319 VAL A C   1 
ATOM   2121  O  O   . VAL A 1 318 ? 101.665 108.093 152.631 1.00 83.06  ? 319 VAL A O   1 
ATOM   2122  C  CB  . VAL A 1 318 ? 99.427  109.935 153.090 1.00 83.69  ? 319 VAL A CB  1 
ATOM   2123  C  CG1 . VAL A 1 318 ? 98.254  110.648 152.490 1.00 83.80  ? 319 VAL A CG1 1 
ATOM   2124  C  CG2 . VAL A 1 318 ? 99.490  110.189 154.555 1.00 83.77  ? 319 VAL A CG2 1 
ATOM   2125  N  N   . VAL A 1 319 ? 100.582 106.804 154.081 1.00 66.12  ? 320 VAL A N   1 
ATOM   2126  C  CA  . VAL A 1 319 ? 101.784 106.067 154.408 1.00 65.84  ? 320 VAL A CA  1 
ATOM   2127  C  C   . VAL A 1 319 ? 101.966 104.917 153.444 1.00 65.98  ? 320 VAL A C   1 
ATOM   2128  O  O   . VAL A 1 319 ? 101.184 103.985 153.431 1.00 65.98  ? 320 VAL A O   1 
ATOM   2129  C  CB  . VAL A 1 319 ? 101.741 105.520 155.820 1.00 65.51  ? 320 VAL A CB  1 
ATOM   2130  C  CG1 . VAL A 1 319 ? 102.971 104.696 156.085 1.00 65.39  ? 320 VAL A CG1 1 
ATOM   2131  C  CG2 . VAL A 1 319 ? 101.634 106.647 156.809 1.00 65.41  ? 320 VAL A CG2 1 
ATOM   2132  N  N   . ASP A 1 320 ? 103.002 104.999 152.624 1.00 79.57  ? 321 ASP A N   1 
ATOM   2133  C  CA  . ASP A 1 320 ? 103.264 103.978 151.624 1.00 79.71  ? 321 ASP A CA  1 
ATOM   2134  C  C   . ASP A 1 320 ? 103.678 102.637 152.210 1.00 79.74  ? 321 ASP A C   1 
ATOM   2135  O  O   . ASP A 1 320 ? 103.268 101.599 151.719 1.00 79.75  ? 321 ASP A O   1 
ATOM   2136  C  CB  . ASP A 1 320 ? 104.306 104.478 150.630 1.00 79.79  ? 321 ASP A CB  1 
ATOM   2137  C  CG  . ASP A 1 320 ? 103.835 105.683 149.858 1.00 79.84  ? 321 ASP A CG  1 
ATOM   2138  O  OD1 . ASP A 1 320 ? 102.641 105.744 149.521 1.00 79.86  ? 321 ASP A OD1 1 
ATOM   2139  O  OD2 . ASP A 1 320 ? 104.652 106.577 149.590 1.00 79.90  1 321 ASP A OD2 1 
ATOM   2140  N  N   . LYS A 1 321 ? 104.468 102.660 153.277 1.00 73.55  ? 322 LYS A N   1 
ATOM   2141  C  CA  . LYS A 1 321 ? 104.901 101.431 153.934 1.00 73.57  ? 322 LYS A CA  1 
ATOM   2142  C  C   . LYS A 1 321 ? 105.267 101.651 155.391 1.00 73.78  ? 322 LYS A C   1 
ATOM   2143  O  O   . LYS A 1 321 ? 105.757 102.701 155.765 1.00 73.79  ? 322 LYS A O   1 
ATOM   2144  C  CB  . LYS A 1 321 ? 106.075 100.791 153.195 1.00 73.41  ? 322 LYS A CB  1 
ATOM   2145  C  CG  . LYS A 1 321 ? 106.473 99.445  153.756 1.00 73.27  ? 322 LYS A CG  1 
ATOM   2146  C  CD  . LYS A 1 321 ? 107.534 98.749  152.952 1.00 73.16  ? 322 LYS A CD  1 
ATOM   2147  C  CE  . LYS A 1 321 ? 107.763 97.359  153.496 1.00 73.08  ? 322 LYS A CE  1 
ATOM   2148  N  NZ  . LYS A 1 321 ? 108.819 96.624  152.767 1.00 73.05  1 322 LYS A NZ  1 
ATOM   2149  N  N   . TRP A 1 322 ? 105.015 100.638 156.208 1.00 73.25  ? 323 TRP A N   1 
ATOM   2150  C  CA  . TRP A 1 322 ? 105.299 100.696 157.627 1.00 73.51  ? 323 TRP A CA  1 
ATOM   2151  C  C   . TRP A 1 322 ? 106.420 99.758  158.021 1.00 74.20  ? 323 TRP A C   1 
ATOM   2152  O  O   . TRP A 1 322 ? 106.627 98.732  157.398 1.00 74.24  ? 323 TRP A O   1 
ATOM   2153  C  CB  . TRP A 1 322 ? 104.060 100.319 158.426 1.00 73.21  ? 323 TRP A CB  1 
ATOM   2154  C  CG  . TRP A 1 322 ? 102.984 101.334 158.436 1.00 72.91  ? 323 TRP A CG  1 
ATOM   2155  C  CD1 . TRP A 1 322 ? 101.957 101.439 157.563 1.00 72.79  ? 323 TRP A CD1 1 
ATOM   2156  C  CD2 . TRP A 1 322 ? 102.810 102.379 159.386 1.00 72.69  ? 323 TRP A CD2 1 
ATOM   2157  N  NE1 . TRP A 1 322 ? 101.158 102.491 157.898 1.00 72.68  ? 323 TRP A NE1 1 
ATOM   2158  C  CE2 . TRP A 1 322 ? 101.663 103.085 159.021 1.00 72.62  ? 323 TRP A CE2 1 
ATOM   2159  C  CE3 . TRP A 1 322 ? 103.520 102.789 160.510 1.00 72.59  ? 323 TRP A CE3 1 
ATOM   2160  C  CZ2 . TRP A 1 322 ? 101.208 104.175 159.736 1.00 72.54  ? 323 TRP A CZ2 1 
ATOM   2161  C  CZ3 . TRP A 1 322 ? 103.067 103.867 161.214 1.00 72.52  ? 323 TRP A CZ3 1 
ATOM   2162  C  CH2 . TRP A 1 322 ? 101.926 104.550 160.828 1.00 72.51  ? 323 TRP A CH2 1 
ATOM   2163  N  N   . PHE A 1 323 ? 107.131 100.116 159.078 1.00 75.99  ? 324 PHE A N   1 
ATOM   2164  C  CA  . PHE A 1 323 ? 108.136 99.246  159.653 1.00 76.69  ? 324 PHE A CA  1 
ATOM   2165  C  C   . PHE A 1 323 ? 108.019 99.244  161.156 1.00 77.62  ? 324 PHE A C   1 
ATOM   2166  O  O   . PHE A 1 323 ? 107.806 100.278 161.774 1.00 77.64  ? 324 PHE A O   1 
ATOM   2167  C  CB  . PHE A 1 323 ? 109.528 99.714  159.277 1.00 76.55  ? 324 PHE A CB  1 
ATOM   2168  C  CG  . PHE A 1 323 ? 109.972 99.284  157.918 1.00 76.40  ? 324 PHE A CG  1 
ATOM   2169  C  CD1 . PHE A 1 323 ? 110.792 98.196  157.764 1.00 76.36  ? 324 PHE A CD1 1 
ATOM   2170  C  CD2 . PHE A 1 323 ? 109.594 99.983  156.803 1.00 76.35  ? 324 PHE A CD2 1 
ATOM   2171  C  CE1 . PHE A 1 323 ? 111.213 97.811  156.527 1.00 76.32  ? 324 PHE A CE1 1 
ATOM   2172  C  CE2 . PHE A 1 323 ? 110.011 99.602  155.572 1.00 76.32  ? 324 PHE A CE2 1 
ATOM   2173  C  CZ  . PHE A 1 323 ? 110.822 98.514  155.431 1.00 76.31  ? 324 PHE A CZ  1 
ATOM   2174  N  N   . LYS A 1 324 ? 108.163 98.066  161.740 1.00 81.09  ? 325 LYS A N   1 
ATOM   2175  C  CA  . LYS A 1 324 ? 108.124 97.916  163.179 1.00 82.02  ? 325 LYS A CA  1 
ATOM   2176  C  C   . LYS A 1 324 ? 109.509 98.037  163.769 1.00 82.53  ? 325 LYS A C   1 
ATOM   2177  O  O   . LYS A 1 324 ? 110.468 97.533  163.207 1.00 82.58  ? 325 LYS A O   1 
ATOM   2178  C  CB  . LYS A 1 324 ? 107.519 96.568  163.542 1.00 82.34  ? 325 LYS A CB  1 
ATOM   2179  C  CG  . LYS A 1 324 ? 106.016 96.536  163.477 1.00 82.62  ? 325 LYS A CG  1 
ATOM   2180  C  CD  . LYS A 1 324 ? 105.423 97.287  164.638 1.00 82.90  ? 325 LYS A CD  1 
ATOM   2181  C  CE  . LYS A 1 324 ? 103.919 97.283  164.607 1.00 83.14  ? 325 LYS A CE  1 
ATOM   2182  N  NZ  . LYS A 1 324 ? 103.353 97.872  165.846 1.00 83.21  1 325 LYS A NZ  1 
ATOM   2183  N  N   . SER A 1 325 ? 109.612 98.694  164.915 1.00 80.88  ? 326 SER A N   1 
ATOM   2184  C  CA  . SER A 1 325 ? 110.898 98.835  165.576 1.00 81.38  ? 326 SER A CA  1 
ATOM   2185  C  C   . SER A 1 325 ? 110.798 98.391  167.011 1.00 81.90  ? 326 SER A C   1 
ATOM   2186  O  O   . SER A 1 325 ? 109.715 98.334  167.566 1.00 81.88  ? 326 SER A O   1 
ATOM   2187  C  CB  . SER A 1 325 ? 111.384 100.274 165.521 1.00 81.38  ? 326 SER A CB  1 
ATOM   2188  O  OG  . SER A 1 325 ? 110.628 101.099 166.371 1.00 81.36  ? 326 SER A OG  1 
ATOM   2189  N  N   . ASN A 1 326 ? 111.937 98.057  167.602 1.00 79.20  ? 327 ASN A N   1 
ATOM   2190  C  CA  . ASN A 1 326 ? 111.997 97.689  169.008 1.00 79.77  ? 327 ASN A CA  1 
ATOM   2191  C  C   . ASN A 1 326 ? 112.930 98.591  169.794 1.00 80.66  ? 327 ASN A C   1 
ATOM   2192  O  O   . ASN A 1 326 ? 113.595 99.439  169.229 1.00 80.71  ? 327 ASN A O   1 
ATOM   2193  C  CB  . ASN A 1 326 ? 112.411 96.234  169.174 1.00 79.58  ? 327 ASN A CB  1 
ATOM   2194  C  CG  . ASN A 1 326 ? 113.770 95.944  168.599 1.00 79.43  ? 327 ASN A CG  1 
ATOM   2195  O  OD1 . ASN A 1 326 ? 114.778 96.434  169.087 1.00 79.48  ? 327 ASN A OD1 1 
ATOM   2196  N  ND2 . ASN A 1 326 ? 113.810 95.120  167.571 1.00 79.36  ? 327 ASN A ND2 1 
ATOM   2197  N  N   . ASP A 1 327 ? 112.964 98.418  171.106 1.00 88.74  ? 328 ASP A N   1 
ATOM   2198  C  CA  . ASP A 1 327 ? 113.774 99.278  171.952 1.00 89.64  ? 328 ASP A CA  1 
ATOM   2199  C  C   . ASP A 1 327 ? 115.279 99.132  171.740 1.00 90.30  ? 328 ASP A C   1 
ATOM   2200  O  O   . ASP A 1 327 ? 116.015 100.114 171.789 1.00 90.30  ? 328 ASP A O   1 
ATOM   2201  C  CB  . ASP A 1 327 ? 113.429 99.050  173.423 1.00 89.80  ? 328 ASP A CB  1 
ATOM   2202  C  CG  . ASP A 1 327 ? 112.041 99.517  173.776 1.00 89.80  ? 328 ASP A CG  1 
ATOM   2203  O  OD1 . ASP A 1 327 ? 111.499 99.069  174.801 1.00 89.83  ? 328 ASP A OD1 1 
ATOM   2204  O  OD2 . ASP A 1 327 ? 111.488 100.333 173.028 1.00 89.81  1 328 ASP A OD2 1 
ATOM   2205  N  N   . GLU A 1 328 ? 115.730 97.913  171.481 1.00 107.59 ? 329 GLU A N   1 
ATOM   2206  C  CA  . GLU A 1 328 ? 117.154 97.653  171.372 1.00 108.12 ? 329 GLU A CA  1 
ATOM   2207  C  C   . GLU A 1 328 ? 117.725 98.355  170.174 1.00 107.42 ? 329 GLU A C   1 
ATOM   2208  O  O   . GLU A 1 328 ? 118.782 98.973  170.246 1.00 107.29 ? 329 GLU A O   1 
ATOM   2209  C  CB  . GLU A 1 328 ? 117.424 96.157  171.263 1.00 109.02 ? 329 GLU A CB  1 
ATOM   2210  C  CG  . GLU A 1 328 ? 118.890 95.819  171.025 1.00 109.61 ? 329 GLU A CG  1 
ATOM   2211  C  CD  . GLU A 1 328 ? 119.204 94.337  171.185 1.00 109.90 ? 329 GLU A CD  1 
ATOM   2212  O  OE1 . GLU A 1 328 ? 120.392 94.001  171.377 1.00 110.02 ? 329 GLU A OE1 1 
ATOM   2213  O  OE2 . GLU A 1 328 ? 118.268 93.511  171.120 1.00 109.98 1 329 GLU A OE2 1 
ATOM   2214  N  N   . GLU A 1 329 ? 116.995 98.281  169.074 1.00 86.20  ? 330 GLU A N   1 
ATOM   2215  C  CA  . GLU A 1 329 ? 117.413 98.914  167.847 1.00 85.39  ? 330 GLU A CA  1 
ATOM   2216  C  C   . GLU A 1 329 ? 117.472 100.397 168.051 1.00 84.14  ? 330 GLU A C   1 
ATOM   2217  O  O   . GLU A 1 329 ? 118.391 101.068 167.607 1.00 83.96  ? 330 GLU A O   1 
ATOM   2218  C  CB  . GLU A 1 329 ? 116.381 98.650  166.765 1.00 85.67  ? 330 GLU A CB  1 
ATOM   2219  C  CG  . GLU A 1 329 ? 116.450 97.306  166.119 1.00 85.87  ? 330 GLU A CG  1 
ATOM   2220  C  CD  . GLU A 1 329 ? 115.365 97.133  165.095 1.00 85.96  ? 330 GLU A CD  1 
ATOM   2221  O  OE1 . GLU A 1 329 ? 114.329 97.809  165.221 1.00 85.98  ? 330 GLU A OE1 1 
ATOM   2222  O  OE2 . GLU A 1 329 ? 115.550 96.334  164.158 1.00 86.00  1 330 GLU A OE2 1 
ATOM   2223  N  N   . ALA A 1 330 ? 116.478 100.898 168.755 1.00 83.29  ? 331 ALA A N   1 
ATOM   2224  C  CA  . ALA A 1 330 ? 116.297 102.318 168.882 1.00 82.02  ? 331 ALA A CA  1 
ATOM   2225  C  C   . ALA A 1 330 ? 117.436 102.912 169.652 1.00 80.83  ? 331 ALA A C   1 
ATOM   2226  O  O   . ALA A 1 330 ? 118.058 103.869 169.223 1.00 80.58  ? 331 ALA A O   1 
ATOM   2227  C  CB  . ALA A 1 330 ? 115.011 102.592 169.585 1.00 81.96  ? 331 ALA A CB  1 
ATOM   2228  N  N   . PHE A 1 331 ? 117.713 102.330 170.804 1.00 81.11  ? 332 PHE A N   1 
ATOM   2229  C  CA  . PHE A 1 331 ? 118.765 102.852 171.644 1.00 80.06  ? 332 PHE A CA  1 
ATOM   2230  C  C   . PHE A 1 331 ? 120.147 102.625 171.061 1.00 79.24  ? 332 PHE A C   1 
ATOM   2231  O  O   . PHE A 1 331 ? 121.010 103.488 171.151 1.00 79.12  ? 332 PHE A O   1 
ATOM   2232  C  CB  . PHE A 1 331 ? 118.629 102.277 173.043 1.00 79.90  ? 332 PHE A CB  1 
ATOM   2233  C  CG  . PHE A 1 331 ? 117.347 102.643 173.707 1.00 79.77  ? 332 PHE A CG  1 
ATOM   2234  C  CD1 . PHE A 1 331 ? 116.812 103.893 173.543 1.00 79.69  ? 332 PHE A CD1 1 
ATOM   2235  C  CD2 . PHE A 1 331 ? 116.665 101.736 174.472 1.00 79.70  ? 332 PHE A CD2 1 
ATOM   2236  C  CE1 . PHE A 1 331 ? 115.639 104.234 174.144 1.00 79.63  ? 332 PHE A CE1 1 
ATOM   2237  C  CE2 . PHE A 1 331 ? 115.483 102.078 175.073 1.00 79.63  ? 332 PHE A CE2 1 
ATOM   2238  C  CZ  . PHE A 1 331 ? 114.973 103.326 174.908 1.00 79.61  ? 332 PHE A CZ  1 
ATOM   2239  N  N   . THR A 1 332 ? 120.341 101.487 170.414 1.00 76.35  ? 333 THR A N   1 
ATOM   2240  C  CA  . THR A 1 332 ? 121.628 101.200 169.818 1.00 75.63  ? 333 THR A CA  1 
ATOM   2241  C  C   . THR A 1 332 ? 121.924 102.220 168.752 1.00 75.02  ? 333 THR A C   1 
ATOM   2242  O  O   . THR A 1 332 ? 123.000 102.793 168.705 1.00 74.94  ? 333 THR A O   1 
ATOM   2243  C  CB  . THR A 1 332 ? 121.622 99.844  169.148 1.00 75.57  ? 333 THR A CB  1 
ATOM   2244  O  OG1 . THR A 1 332 ? 121.373 98.835  170.125 1.00 75.60  ? 333 THR A OG1 1 
ATOM   2245  C  CG2 . THR A 1 332 ? 122.944 99.580  168.507 1.00 75.52  ? 333 THR A CG2 1 
ATOM   2246  N  N   . PHE A 1 333 ? 120.948 102.442 167.892 1.00 72.00  ? 334 PHE A N   1 
ATOM   2247  C  CA  . PHE A 1 333 ? 121.096 103.408 166.827 1.00 71.49  ? 334 PHE A CA  1 
ATOM   2248  C  C   . PHE A 1 333 ? 121.166 104.847 167.285 1.00 71.20  ? 334 PHE A C   1 
ATOM   2249  O  O   . PHE A 1 333 ? 121.833 105.641 166.663 1.00 71.16  ? 334 PHE A O   1 
ATOM   2250  C  CB  . PHE A 1 333 ? 120.012 103.221 165.777 1.00 71.34  ? 334 PHE A CB  1 
ATOM   2251  C  CG  . PHE A 1 333 ? 120.367 102.227 164.735 1.00 71.22  ? 334 PHE A CG  1 
ATOM   2252  C  CD1 . PHE A 1 333 ? 120.147 100.893 164.938 1.00 71.14  ? 334 PHE A CD1 1 
ATOM   2253  C  CD2 . PHE A 1 333 ? 120.939 102.626 163.560 1.00 71.13  ? 334 PHE A CD2 1 
ATOM   2254  C  CE1 . PHE A 1 333 ? 120.483 99.984  163.988 1.00 71.10  ? 334 PHE A CE1 1 
ATOM   2255  C  CE2 . PHE A 1 333 ? 121.274 101.718 162.611 1.00 71.10  ? 334 PHE A CE2 1 
ATOM   2256  C  CZ  . PHE A 1 333 ? 121.047 100.396 162.824 1.00 71.09  ? 334 PHE A CZ  1 
ATOM   2257  N  N   . ALA A 1 334 ? 120.495 105.194 168.369 1.00 70.14  ? 335 ALA A N   1 
ATOM   2258  C  CA  . ALA A 1 334 ? 120.587 106.557 168.857 1.00 69.93  ? 335 ALA A CA  1 
ATOM   2259  C  C   . ALA A 1 334 ? 121.990 106.795 169.359 1.00 69.82  ? 335 ALA A C   1 
ATOM   2260  O  O   . ALA A 1 334 ? 122.618 107.817 169.071 1.00 69.78  ? 335 ALA A O   1 
ATOM   2261  C  CB  . ALA A 1 334 ? 119.593 106.785 169.952 1.00 69.89  ? 335 ALA A CB  1 
ATOM   2262  N  N   . ARG A 1 335 ? 122.498 105.812 170.083 1.00 73.00  ? 336 ARG A N   1 
ATOM   2263  C  CA  . ARG A 1 335 ? 123.850 105.891 170.583 1.00 72.97  ? 336 ARG A CA  1 
ATOM   2264  C  C   . ARG A 1 335 ? 124.834 105.932 169.442 1.00 73.10  ? 336 ARG A C   1 
ATOM   2265  O  O   . ARG A 1 335 ? 125.873 106.563 169.536 1.00 73.10  ? 336 ARG A O   1 
ATOM   2266  C  CB  . ARG A 1 335 ? 124.149 104.704 171.482 1.00 72.86  ? 336 ARG A CB  1 
ATOM   2267  C  CG  . ARG A 1 335 ? 123.458 104.773 172.807 1.00 72.80  ? 336 ARG A CG  1 
ATOM   2268  C  CD  . ARG A 1 335 ? 123.802 103.595 173.669 1.00 72.77  ? 336 ARG A CD  1 
ATOM   2269  N  NE  . ARG A 1 335 ? 123.909 103.999 175.058 1.00 72.80  ? 336 ARG A NE  1 
ATOM   2270  C  CZ  . ARG A 1 335 ? 124.824 103.539 175.891 1.00 72.89  ? 336 ARG A CZ  1 
ATOM   2271  N  NH1 . ARG A 1 335 ? 124.855 103.970 177.134 1.00 72.99  1 336 ARG A NH1 1 
ATOM   2272  N  NH2 . ARG A 1 335 ? 125.703 102.651 175.476 1.00 72.90  ? 336 ARG A NH2 1 
ATOM   2273  N  N   . MET A 1 336 ? 124.501 105.254 168.358 1.00 78.47  ? 337 MET A N   1 
ATOM   2274  C  CA  . MET A 1 336 ? 125.320 105.296 167.162 1.00 78.60  ? 337 MET A CA  1 
ATOM   2275  C  C   . MET A 1 336 ? 125.282 106.654 166.480 1.00 78.30  ? 337 MET A C   1 
ATOM   2276  O  O   . MET A 1 336 ? 126.267 107.093 165.921 1.00 78.30  ? 337 MET A O   1 
ATOM   2277  C  CB  . MET A 1 336 ? 124.879 104.202 166.195 1.00 78.95  ? 337 MET A CB  1 
ATOM   2278  C  CG  . MET A 1 336 ? 125.850 103.923 165.078 1.00 79.19  ? 337 MET A CG  1 
ATOM   2279  S  SD  . MET A 1 336 ? 125.253 102.636 163.992 1.00 79.43  ? 337 MET A SD  1 
ATOM   2280  C  CE  . MET A 1 336 ? 124.906 101.365 165.177 1.00 79.54  ? 337 MET A CE  1 
ATOM   2281  N  N   . LEU A 1 337 ? 124.140 107.323 166.537 1.00 71.88  ? 338 LEU A N   1 
ATOM   2282  C  CA  . LEU A 1 337 ? 124.009 108.629 165.924 1.00 71.55  ? 338 LEU A CA  1 
ATOM   2283  C  C   . LEU A 1 337 ? 124.901 109.589 166.664 1.00 71.09  ? 338 LEU A C   1 
ATOM   2284  O  O   . LEU A 1 337 ? 125.578 110.413 166.064 1.00 71.05  ? 338 LEU A O   1 
ATOM   2285  C  CB  . LEU A 1 337 ? 122.571 109.127 166.021 1.00 71.65  ? 338 LEU A CB  1 
ATOM   2286  C  CG  . LEU A 1 337 ? 121.567 109.100 164.866 1.00 71.73  ? 338 LEU A CG  1 
ATOM   2287  C  CD1 . LEU A 1 337 ? 122.223 109.296 163.538 1.00 71.76  ? 338 LEU A CD1 1 
ATOM   2288  C  CD2 . LEU A 1 337 ? 120.790 107.830 164.863 1.00 71.76  ? 338 LEU A CD2 1 
ATOM   2289  N  N   . ILE A 1 338 ? 124.920 109.460 167.981 1.00 64.31  ? 339 ILE A N   1 
ATOM   2290  C  CA  . ILE A 1 338 ? 125.760 110.330 168.781 1.00 63.91  ? 339 ILE A CA  1 
ATOM   2291  C  C   . ILE A 1 338 ? 127.227 110.031 168.569 1.00 64.35  ? 339 ILE A C   1 
ATOM   2292  O  O   . ILE A 1 338 ? 128.024 110.921 168.342 1.00 64.37  ? 339 ILE A O   1 
ATOM   2293  C  CB  . ILE A 1 338 ? 125.455 110.171 170.258 1.00 63.25  ? 339 ILE A CB  1 
ATOM   2294  C  CG1 . ILE A 1 338 ? 123.996 110.483 170.527 1.00 62.91  ? 339 ILE A CG1 1 
ATOM   2295  C  CG2 . ILE A 1 338 ? 126.311 111.089 171.067 1.00 63.08  ? 339 ILE A CG2 1 
ATOM   2296  C  CD1 . ILE A 1 338 ? 123.585 110.191 171.914 1.00 62.73  ? 339 ILE A CD1 1 
ATOM   2297  N  N   . ALA A 1 339 ? 127.574 108.758 168.641 1.00 71.83  ? 340 ALA A N   1 
ATOM   2298  C  CA  . ALA A 1 339 ? 128.960 108.343 168.553 1.00 72.33  ? 340 ALA A CA  1 
ATOM   2299  C  C   . ALA A 1 339 ? 129.588 108.578 167.199 1.00 72.80  ? 340 ALA A C   1 
ATOM   2300  O  O   . ALA A 1 339 ? 130.774 108.830 167.103 1.00 72.83  ? 340 ALA A O   1 
ATOM   2301  C  CB  . ALA A 1 339 ? 129.087 106.894 168.932 1.00 72.34  ? 340 ALA A CB  1 
ATOM   2302  N  N   . GLN A 1 340 ? 128.792 108.498 166.148 1.00 82.02  ? 341 GLN A N   1 
ATOM   2303  C  CA  . GLN A 1 340 ? 129.340 108.573 164.812 1.00 82.40  ? 341 GLN A CA  1 
ATOM   2304  C  C   . GLN A 1 340 ? 129.099 109.908 164.158 1.00 82.04  ? 341 GLN A C   1 
ATOM   2305  O  O   . GLN A 1 340 ? 130.001 110.487 163.586 1.00 82.04  ? 341 GLN A O   1 
ATOM   2306  C  CB  . GLN A 1 340 ? 128.736 107.493 163.935 1.00 82.92  ? 341 GLN A CB  1 
ATOM   2307  C  CG  . GLN A 1 340 ? 128.797 106.118 164.512 1.00 83.31  ? 341 GLN A CG  1 
ATOM   2308  C  CD  . GLN A 1 340 ? 130.051 105.399 164.156 1.00 83.61  ? 341 GLN A CD  1 
ATOM   2309  O  OE1 . GLN A 1 340 ? 131.010 106.001 163.699 1.00 83.66  ? 341 GLN A OE1 1 
ATOM   2310  N  NE2 . GLN A 1 340 ? 130.056 104.093 164.354 1.00 83.81  ? 341 GLN A NE2 1 
ATOM   2311  N  N   . GLU A 1 341 ? 127.869 110.388 164.218 1.00 69.85  ? 342 GLU A N   1 
ATOM   2312  C  CA  . GLU A 1 341 ? 127.525 111.579 163.471 1.00 69.46  ? 342 GLU A CA  1 
ATOM   2313  C  C   . GLU A 1 341 ? 127.543 112.828 164.310 1.00 69.20  ? 342 GLU A C   1 
ATOM   2314  O  O   . GLU A 1 341 ? 127.473 113.923 163.788 1.00 69.16  ? 342 GLU A O   1 
ATOM   2315  C  CB  . GLU A 1 341 ? 126.169 111.418 162.806 1.00 69.38  ? 342 GLU A CB  1 
ATOM   2316  C  CG  . GLU A 1 341 ? 126.059 110.196 161.930 1.00 69.34  ? 342 GLU A CG  1 
ATOM   2317  C  CD  . GLU A 1 341 ? 126.947 110.252 160.716 1.00 69.34  ? 342 GLU A CD  1 
ATOM   2318  O  OE1 . GLU A 1 341 ? 127.251 111.359 160.249 1.00 69.33  ? 342 GLU A OE1 1 
ATOM   2319  O  OE2 . GLU A 1 341 ? 127.342 109.183 160.222 1.00 69.34  1 342 GLU A OE2 1 
ATOM   2320  N  N   . GLY A 1 342 ? 127.638 112.664 165.616 1.00 62.07  ? 343 GLY A N   1 
ATOM   2321  C  CA  . GLY A 1 342 ? 127.699 113.806 166.491 1.00 61.94  ? 343 GLY A CA  1 
ATOM   2322  C  C   . GLY A 1 342 ? 126.362 114.459 166.700 1.00 61.91  ? 343 GLY A C   1 
ATOM   2323  O  O   . GLY A 1 342 ? 126.273 115.604 167.103 1.00 61.88  ? 343 GLY A O   1 
ATOM   2324  N  N   . LEU A 1 343 ? 125.310 113.726 166.391 1.00 72.22  ? 344 LEU A N   1 
ATOM   2325  C  CA  . LEU A 1 343 ? 123.961 114.232 166.548 1.00 72.32  ? 344 LEU A CA  1 
ATOM   2326  C  C   . LEU A 1 343 ? 123.385 113.838 167.894 1.00 72.69  ? 344 LEU A C   1 
ATOM   2327  O  O   . LEU A 1 343 ? 123.170 112.671 168.159 1.00 72.70  ? 344 LEU A O   1 
ATOM   2328  C  CB  . LEU A 1 343 ? 123.078 113.695 165.434 1.00 72.14  ? 344 LEU A CB  1 
ATOM   2329  C  CG  . LEU A 1 343 ? 123.537 114.022 164.023 1.00 72.00  ? 344 LEU A CG  1 
ATOM   2330  C  CD1 . LEU A 1 343 ? 122.717 113.259 163.031 1.00 71.96  ? 344 LEU A CD1 1 
ATOM   2331  C  CD2 . LEU A 1 343 ? 123.409 115.489 163.775 1.00 71.96  ? 344 LEU A CD2 1 
ATOM   2332  N  N   . LEU A 1 344 ? 123.129 114.822 168.743 1.00 70.90  ? 345 LEU A N   1 
ATOM   2333  C  CA  . LEU A 1 344 ? 122.692 114.557 170.102 1.00 71.25  ? 345 LEU A CA  1 
ATOM   2334  C  C   . LEU A 1 344 ? 121.192 114.370 170.187 1.00 71.51  ? 345 LEU A C   1 
ATOM   2335  O  O   . LEU A 1 344 ? 120.477 115.232 170.665 1.00 71.54  ? 345 LEU A O   1 
ATOM   2336  C  CB  . LEU A 1 344 ? 123.137 115.685 171.017 1.00 71.31  ? 345 LEU A CB  1 
ATOM   2337  C  CG  . LEU A 1 344 ? 124.645 115.868 171.087 1.00 71.33  ? 345 LEU A CG  1 
ATOM   2338  C  CD1 . LEU A 1 344 ? 124.995 117.050 171.946 1.00 71.35  ? 345 LEU A CD1 1 
ATOM   2339  C  CD2 . LEU A 1 344 ? 125.271 114.629 171.631 1.00 71.34  ? 345 LEU A CD2 1 
ATOM   2340  N  N   . CYS A 1 345 ? 120.732 113.214 169.738 1.00 90.71  ? 346 CYS A N   1 
ATOM   2341  C  CA  . CYS A 1 345 ? 119.316 112.954 169.553 1.00 90.83  ? 346 CYS A CA  1 
ATOM   2342  C  C   . CYS A 1 345 ? 118.777 111.852 170.449 1.00 90.62  ? 346 CYS A C   1 
ATOM   2343  O  O   . CYS A 1 345 ? 119.524 111.058 170.986 1.00 90.64  ? 346 CYS A O   1 
ATOM   2344  C  CB  . CYS A 1 345 ? 119.070 112.572 168.107 1.00 90.99  ? 346 CYS A CB  1 
ATOM   2345  S  SG  . CYS A 1 345 ? 119.969 111.114 167.604 1.00 91.04  ? 346 CYS A SG  1 
ATOM   2346  N  N   . GLY A 1 346 ? 117.458 111.802 170.580 1.00 74.18  ? 347 GLY A N   1 
ATOM   2347  C  CA  . GLY A 1 346 ? 116.798 110.851 171.450 1.00 73.80  ? 347 GLY A CA  1 
ATOM   2348  C  C   . GLY A 1 346 ? 116.489 109.520 170.810 1.00 73.34  ? 347 GLY A C   1 
ATOM   2349  O  O   . GLY A 1 346 ? 116.994 109.203 169.753 1.00 73.30  ? 347 GLY A O   1 
ATOM   2350  N  N   . GLY A 1 347 ? 115.659 108.729 171.474 1.00 71.23  ? 348 GLY A N   1 
ATOM   2351  C  CA  . GLY A 1 347 ? 115.402 107.369 171.048 1.00 70.72  ? 348 GLY A CA  1 
ATOM   2352  C  C   . GLY A 1 347 ? 114.542 107.162 169.823 1.00 70.18  ? 348 GLY A C   1 
ATOM   2353  O  O   . GLY A 1 347 ? 114.765 106.235 169.060 1.00 70.15  ? 348 GLY A O   1 
ATOM   2354  N  N   . SER A 1 348 ? 113.553 108.018 169.627 1.00 72.87  ? 349 SER A N   1 
ATOM   2355  C  CA  . SER A 1 348 ? 112.710 107.898 168.456 1.00 72.38  ? 349 SER A CA  1 
ATOM   2356  C  C   . SER A 1 348 ? 113.529 108.156 167.204 1.00 71.90  ? 349 SER A C   1 
ATOM   2357  O  O   . SER A 1 348 ? 113.281 107.573 166.153 1.00 71.85  ? 349 SER A O   1 
ATOM   2358  C  CB  . SER A 1 348 ? 111.516 108.843 168.547 1.00 72.39  ? 349 SER A CB  1 
ATOM   2359  O  OG  . SER A 1 348 ? 111.923 110.173 168.741 1.00 72.42  ? 349 SER A OG  1 
ATOM   2360  N  N   . ALA A 1 349 ? 114.530 109.011 167.329 1.00 68.43  ? 350 ALA A N   1 
ATOM   2361  C  CA  . ALA A 1 349 ? 115.436 109.255 166.230 1.00 68.00  ? 350 ALA A CA  1 
ATOM   2362  C  C   . ALA A 1 349 ? 116.177 107.983 165.908 1.00 67.74  ? 350 ALA A C   1 
ATOM   2363  O  O   . ALA A 1 349 ? 116.406 107.655 164.750 1.00 67.70  ? 350 ALA A O   1 
ATOM   2364  C  CB  . ALA A 1 349 ? 116.402 110.320 166.601 1.00 67.93  ? 350 ALA A CB  1 
ATOM   2365  N  N   . GLY A 1 350 ? 116.502 107.232 166.944 1.00 63.03  ? 351 GLY A N   1 
ATOM   2366  C  CA  . GLY A 1 350 ? 117.198 105.987 166.754 1.00 62.87  ? 351 GLY A CA  1 
ATOM   2367  C  C   . GLY A 1 350 ? 116.320 104.959 166.096 1.00 62.77  ? 351 GLY A C   1 
ATOM   2368  O  O   . GLY A 1 350 ? 116.776 104.196 165.262 1.00 62.75  ? 351 GLY A O   1 
ATOM   2369  N  N   . SER A 1 351 ? 115.047 104.960 166.449 1.00 65.52  ? 352 SER A N   1 
ATOM   2370  C  CA  . SER A 1 351 ? 114.122 104.033 165.837 1.00 65.51  ? 352 SER A CA  1 
ATOM   2371  C  C   . SER A 1 351 ? 114.032 104.334 164.365 1.00 65.54  ? 352 SER A C   1 
ATOM   2372  O  O   . SER A 1 351 ? 114.050 103.439 163.521 1.00 65.54  ? 352 SER A O   1 
ATOM   2373  C  CB  . SER A 1 351 ? 112.742 104.192 166.452 1.00 65.50  ? 352 SER A CB  1 
ATOM   2374  O  OG  . SER A 1 351 ? 112.749 103.898 167.825 1.00 65.58  ? 352 SER A OG  1 
ATOM   2375  N  N   . THR A 1 352 ? 113.982 105.621 164.063 1.00 72.64  ? 353 THR A N   1 
ATOM   2376  C  CA  . THR A 1 352 ? 113.788 106.060 162.699 1.00 72.69  ? 353 THR A CA  1 
ATOM   2377  C  C   . THR A 1 352 ? 114.968 105.704 161.824 1.00 72.61  ? 353 THR A C   1 
ATOM   2378  O  O   . THR A 1 352 ? 114.795 105.163 160.752 1.00 72.62  ? 353 THR A O   1 
ATOM   2379  C  CB  . THR A 1 352 ? 113.553 107.562 162.637 1.00 72.80  ? 353 THR A CB  1 
ATOM   2380  O  OG1 . THR A 1 352 ? 112.485 107.907 163.517 1.00 72.83  ? 353 THR A OG1 1 
ATOM   2381  C  CG2 . THR A 1 352 ? 113.187 107.977 161.248 1.00 72.86  ? 353 THR A CG2 1 
ATOM   2382  N  N   . VAL A 1 353 ? 116.171 106.002 162.281 1.00 61.64  ? 354 VAL A N   1 
ATOM   2383  C  CA  . VAL A 1 353 ? 117.345 105.661 161.496 1.00 61.61  ? 354 VAL A CA  1 
ATOM   2384  C  C   . VAL A 1 353 ? 117.546 104.161 161.384 1.00 62.15  ? 354 VAL A C   1 
ATOM   2385  O  O   . VAL A 1 353 ? 117.990 103.647 160.352 1.00 62.17  ? 354 VAL A O   1 
ATOM   2386  C  CB  . VAL A 1 353 ? 118.581 106.316 162.085 1.00 61.20  ? 354 VAL A CB  1 
ATOM   2387  C  CG1 . VAL A 1 353 ? 119.816 105.814 161.412 1.00 61.05  ? 354 VAL A CG1 1 
ATOM   2388  C  CG2 . VAL A 1 353 ? 118.476 107.796 161.931 1.00 61.09  ? 354 VAL A CG2 1 
ATOM   2389  N  N   . ALA A 1 354 ? 117.168 103.456 162.440 1.00 70.46  ? 355 ALA A N   1 
ATOM   2390  C  CA  . ALA A 1 354 ? 117.268 102.010 162.449 1.00 71.06  ? 355 ALA A CA  1 
ATOM   2391  C  C   . ALA A 1 354 ? 116.373 101.416 161.388 1.00 71.76  ? 355 ALA A C   1 
ATOM   2392  O  O   . ALA A 1 354 ? 116.704 100.414 160.774 1.00 71.85  ? 355 ALA A O   1 
ATOM   2393  C  CB  . ALA A 1 354 ? 116.894 101.474 163.795 1.00 71.02  ? 355 ALA A CB  1 
ATOM   2394  N  N   . VAL A 1 355 ? 115.233 102.045 161.164 1.00 77.82  ? 356 VAL A N   1 
ATOM   2395  C  CA  . VAL A 1 355 ? 114.405 101.641 160.049 1.00 78.50  ? 356 VAL A CA  1 
ATOM   2396  C  C   . VAL A 1 355 ? 114.992 102.095 158.728 1.00 78.89  ? 356 VAL A C   1 
ATOM   2397  O  O   . VAL A 1 355 ? 114.957 101.371 157.753 1.00 78.96  ? 356 VAL A O   1 
ATOM   2398  C  CB  . VAL A 1 355 ? 112.983 102.156 160.198 1.00 78.72  ? 356 VAL A CB  1 
ATOM   2399  C  CG1 . VAL A 1 355 ? 112.246 102.050 158.902 1.00 78.81  ? 356 VAL A CG1 1 
ATOM   2400  C  CG2 . VAL A 1 355 ? 112.275 101.370 161.251 1.00 78.76  ? 356 VAL A CG2 1 
ATOM   2401  N  N   . ALA A 1 356 ? 115.571 103.283 158.707 1.00 71.73  ? 357 ALA A N   1 
ATOM   2402  C  CA  . ALA A 1 356 ? 116.023 103.869 157.459 1.00 72.07  ? 357 ALA A CA  1 
ATOM   2403  C  C   . ALA A 1 356 ? 117.109 103.065 156.793 1.00 72.39  ? 357 ALA A C   1 
ATOM   2404  O  O   . ALA A 1 356 ? 117.148 102.957 155.576 1.00 72.48  ? 357 ALA A O   1 
ATOM   2405  C  CB  . ALA A 1 356 ? 116.494 105.272 157.690 1.00 72.08  ? 357 ALA A CB  1 
ATOM   2406  N  N   . VAL A 1 357 ? 117.974 102.459 157.586 1.00 68.81  ? 358 VAL A N   1 
ATOM   2407  C  CA  . VAL A 1 357 ? 119.041 101.682 156.987 1.00 69.14  ? 358 VAL A CA  1 
ATOM   2408  C  C   . VAL A 1 357 ? 118.527 100.404 156.364 1.00 70.04  ? 358 VAL A C   1 
ATOM   2409  O  O   . VAL A 1 357 ? 119.214 99.775  155.584 1.00 70.15  ? 358 VAL A O   1 
ATOM   2410  C  CB  . VAL A 1 357 ? 120.164 101.381 157.968 1.00 68.69  ? 358 VAL A CB  1 
ATOM   2411  C  CG1 . VAL A 1 357 ? 120.900 102.648 158.307 1.00 68.54  ? 358 VAL A CG1 1 
ATOM   2412  C  CG2 . VAL A 1 357 ? 119.619 100.735 159.202 1.00 68.54  ? 358 VAL A CG2 1 
ATOM   2413  N  N   . LYS A 1 358 ? 117.312 100.020 156.719 1.00 79.67  ? 359 LYS A N   1 
ATOM   2414  C  CA  . LYS A 1 358 ? 116.665 98.877  156.099 1.00 80.64  ? 359 LYS A CA  1 
ATOM   2415  C  C   . LYS A 1 358 ? 115.865 99.309  154.892 1.00 81.46  ? 359 LYS A C   1 
ATOM   2416  O  O   . LYS A 1 358 ? 116.039 98.800  153.798 1.00 81.56  ? 359 LYS A O   1 
ATOM   2417  C  CB  . LYS A 1 358 ? 115.735 98.173  157.086 1.00 80.81  ? 359 LYS A CB  1 
ATOM   2418  C  CG  . LYS A 1 358 ? 116.434 97.412  158.191 1.00 80.94  ? 359 LYS A CG  1 
ATOM   2419  C  CD  . LYS A 1 358 ? 115.613 96.230  158.664 1.00 81.08  ? 359 LYS A CD  1 
ATOM   2420  C  CE  . LYS A 1 358 ? 114.500 96.649  159.593 1.00 81.18  ? 359 LYS A CE  1 
ATOM   2421  N  NZ  . LYS A 1 358 ? 114.969 96.775  160.988 1.00 81.23  1 359 LYS A NZ  1 
ATOM   2422  N  N   . ALA A 1 359 ? 114.976 100.260 155.110 1.00 81.21  ? 360 ALA A N   1 
ATOM   2423  C  CA  . ALA A 1 359 ? 114.040 100.692 154.094 1.00 82.01  ? 360 ALA A CA  1 
ATOM   2424  C  C   . ALA A 1 359 ? 114.695 101.349 152.905 1.00 82.80  ? 360 ALA A C   1 
ATOM   2425  O  O   . ALA A 1 359 ? 114.175 101.294 151.806 1.00 82.86  ? 360 ALA A O   1 
ATOM   2426  C  CB  . ALA A 1 359 ? 113.032 101.621 154.698 1.00 82.03  ? 360 ALA A CB  1 
ATOM   2427  N  N   . ALA A 1 360 ? 115.835 101.980 153.114 1.00 75.85  ? 361 ALA A N   1 
ATOM   2428  C  CA  . ALA A 1 360 ? 116.459 102.706 152.024 1.00 76.71  ? 361 ALA A CA  1 
ATOM   2429  C  C   . ALA A 1 360 ? 117.376 101.858 151.169 1.00 77.86  ? 361 ALA A C   1 
ATOM   2430  O  O   . ALA A 1 360 ? 118.000 102.363 150.256 1.00 77.92  ? 361 ALA A O   1 
ATOM   2431  C  CB  . ALA A 1 360 ? 117.188 103.901 152.542 1.00 76.56  ? 361 ALA A CB  1 
ATOM   2432  N  N   . GLN A 1 361 ? 117.473 100.574 151.470 1.00 81.43  ? 362 GLN A N   1 
ATOM   2433  C  CA  . GLN A 1 361 ? 118.370 99.699  150.732 1.00 82.63  ? 362 GLN A CA  1 
ATOM   2434  C  C   . GLN A 1 361 ? 118.009 99.619  149.266 1.00 84.13  ? 362 GLN A C   1 
ATOM   2435  O  O   . GLN A 1 361 ? 118.866 99.419  148.423 1.00 84.25  ? 362 GLN A O   1 
ATOM   2436  C  CB  . GLN A 1 361 ? 118.348 98.296  151.322 1.00 82.44  ? 362 GLN A CB  1 
ATOM   2437  C  CG  . GLN A 1 361 ? 119.032 98.174  152.651 1.00 82.25  ? 362 GLN A CG  1 
ATOM   2438  C  CD  . GLN A 1 361 ? 120.526 98.093  152.527 1.00 82.19  ? 362 GLN A CD  1 
ATOM   2439  O  OE1 . GLN A 1 361 ? 121.045 97.442  151.630 1.00 82.18  ? 362 GLN A OE1 1 
ATOM   2440  N  NE2 . GLN A 1 361 ? 121.230 98.753  153.428 1.00 82.13  ? 362 GLN A NE2 1 
ATOM   2441  N  N   . GLU A 1 362 ? 116.729 99.768  148.966 1.00 107.19 ? 363 GLU A N   1 
ATOM   2442  C  CA  . GLU A 1 362 ? 116.262 99.703  147.594 1.00 108.56 ? 363 GLU A CA  1 
ATOM   2443  C  C   . GLU A 1 362 ? 116.753 100.887 146.786 1.00 108.97 ? 363 GLU A C   1 
ATOM   2444  O  O   . GLU A 1 362 ? 116.867 100.818 145.573 1.00 109.04 ? 363 GLU A O   1 
ATOM   2445  C  CB  . GLU A 1 362 ? 114.734 99.629  147.545 1.00 109.28 ? 363 GLU A CB  1 
ATOM   2446  C  CG  . GLU A 1 362 ? 114.012 100.865 148.038 1.00 109.72 ? 363 GLU A CG  1 
ATOM   2447  C  CD  . GLU A 1 362 ? 112.509 100.787 147.841 1.00 109.99 ? 363 GLU A CD  1 
ATOM   2448  O  OE1 . GLU A 1 362 ? 111.967 99.667  147.804 1.00 110.10 ? 363 GLU A OE1 1 
ATOM   2449  O  OE2 . GLU A 1 362 ? 111.864 101.846 147.718 1.00 110.10 1 363 GLU A OE2 1 
ATOM   2450  N  N   . LEU A 1 363 ? 117.040 101.978 147.472 1.00 89.47  ? 364 LEU A N   1 
ATOM   2451  C  CA  . LEU A 1 363 ? 117.492 103.193 146.820 1.00 89.69  ? 364 LEU A CA  1 
ATOM   2452  C  C   . LEU A 1 363 ? 118.902 103.034 146.292 1.00 89.72  ? 364 LEU A C   1 
ATOM   2453  O  O   . LEU A 1 363 ? 119.668 102.236 146.802 1.00 89.75  ? 364 LEU A O   1 
ATOM   2454  C  CB  . LEU A 1 363 ? 117.444 104.351 147.799 1.00 89.80  ? 364 LEU A CB  1 
ATOM   2455  C  CG  . LEU A 1 363 ? 116.210 105.237 147.786 1.00 89.87  ? 364 LEU A CG  1 
ATOM   2456  C  CD1 . LEU A 1 363 ? 114.969 104.417 147.785 1.00 89.90  ? 364 LEU A CD1 1 
ATOM   2457  C  CD2 . LEU A 1 363 ? 116.236 106.122 148.993 1.00 89.90  ? 364 LEU A CD2 1 
ATOM   2458  N  N   . GLN A 1 364 ? 119.246 103.789 145.261 1.00 91.95  ? 365 GLN A N   1 
ATOM   2459  C  CA  . GLN A 1 364 ? 120.588 103.725 144.724 1.00 91.80  ? 365 GLN A CA  1 
ATOM   2460  C  C   . GLN A 1 364 ? 121.208 105.092 144.575 1.00 91.12  ? 365 GLN A C   1 
ATOM   2461  O  O   . GLN A 1 364 ? 120.619 106.086 144.960 1.00 91.03  ? 365 GLN A O   1 
ATOM   2462  C  CB  . GLN A 1 364 ? 120.603 102.980 143.402 1.00 92.19  ? 365 GLN A CB  1 
ATOM   2463  C  CG  . GLN A 1 364 ? 119.502 103.364 142.468 1.00 92.47  ? 365 GLN A CG  1 
ATOM   2464  C  CD  . GLN A 1 364 ? 119.303 102.337 141.390 1.00 92.66  ? 365 GLN A CD  1 
ATOM   2465  O  OE1 . GLN A 1 364 ? 119.858 101.245 141.456 1.00 92.70  ? 365 GLN A OE1 1 
ATOM   2466  N  NE2 . GLN A 1 364 ? 118.509 102.675 140.385 1.00 92.77  ? 365 GLN A NE2 1 
ATOM   2467  N  N   . GLU A 1 365 ? 122.401 105.129 144.004 1.00 100.34 ? 366 GLU A N   1 
ATOM   2468  C  CA  . GLU A 1 365 ? 123.201 106.339 143.978 1.00 99.48  ? 366 GLU A CA  1 
ATOM   2469  C  C   . GLU A 1 365 ? 122.494 107.482 143.286 1.00 97.60  ? 366 GLU A C   1 
ATOM   2470  O  O   . GLU A 1 365 ? 121.879 107.308 142.251 1.00 97.53  ? 366 GLU A O   1 
ATOM   2471  C  CB  . GLU A 1 365 ? 124.537 106.065 143.297 1.00 100.24 ? 366 GLU A CB  1 
ATOM   2472  C  CG  . GLU A 1 365 ? 125.354 104.993 143.980 1.00 100.77 ? 366 GLU A CG  1 
ATOM   2473  C  CD  . GLU A 1 365 ? 126.720 104.795 143.354 1.00 101.04 ? 366 GLU A CD  1 
ATOM   2474  O  OE1 . GLU A 1 365 ? 126.978 105.387 142.287 1.00 101.14 ? 366 GLU A OE1 1 
ATOM   2475  O  OE2 . GLU A 1 365 ? 127.540 104.048 143.933 1.00 101.16 1 366 GLU A OE2 1 
ATOM   2476  N  N   . GLY A 1 366 ? 122.588 108.658 143.880 1.00 73.02  ? 367 GLY A N   1 
ATOM   2477  C  CA  . GLY A 1 366 ? 121.976 109.842 143.325 1.00 71.18  ? 367 GLY A CA  1 
ATOM   2478  C  C   . GLY A 1 366 ? 120.607 110.096 143.893 1.00 69.36  ? 367 GLY A C   1 
ATOM   2479  O  O   . GLY A 1 366 ? 120.065 111.176 143.746 1.00 69.23  ? 367 GLY A O   1 
ATOM   2480  N  N   . GLN A 1 367 ? 120.044 109.094 144.544 1.00 75.79  ? 368 GLN A N   1 
ATOM   2481  C  CA  . GLN A 1 367 ? 118.787 109.263 145.242 1.00 74.19  ? 368 GLN A CA  1 
ATOM   2482  C  C   . GLN A 1 367 ? 119.064 109.650 146.674 1.00 72.91  ? 368 GLN A C   1 
ATOM   2483  O  O   . GLN A 1 367 ? 120.162 109.455 147.156 1.00 72.83  ? 368 GLN A O   1 
ATOM   2484  C  CB  . GLN A 1 367 ? 117.954 107.993 145.168 1.00 73.97  ? 368 GLN A CB  1 
ATOM   2485  C  CG  . GLN A 1 367 ? 117.421 107.716 143.789 1.00 73.86  ? 368 GLN A CG  1 
ATOM   2486  C  CD  . GLN A 1 367 ? 116.621 106.453 143.704 1.00 73.71  ? 368 GLN A CD  1 
ATOM   2487  O  OE1 . GLN A 1 367 ? 117.118 105.376 143.987 1.00 73.70  ? 368 GLN A OE1 1 
ATOM   2488  N  NE2 . GLN A 1 367 ? 115.372 106.577 143.307 1.00 73.65  ? 368 GLN A NE2 1 
ATOM   2489  N  N   . ARG A 1 368 ? 118.081 110.218 147.355 1.00 70.23  ? 369 ARG A N   1 
ATOM   2490  C  CA  . ARG A 1 368 ? 118.293 110.606 148.735 1.00 69.13  ? 369 ARG A CA  1 
ATOM   2491  C  C   . ARG A 1 368 ? 117.151 110.246 149.661 1.00 68.45  ? 369 ARG A C   1 
ATOM   2492  O  O   . ARG A 1 368 ? 115.997 110.272 149.286 1.00 68.44  ? 369 ARG A O   1 
ATOM   2493  C  CB  . ARG A 1 368 ? 118.610 112.091 148.846 1.00 68.78  ? 369 ARG A CB  1 
ATOM   2494  C  CG  . ARG A 1 368 ? 117.497 113.001 148.486 1.00 68.53  ? 369 ARG A CG  1 
ATOM   2495  C  CD  . ARG A 1 368 ? 117.745 114.386 149.025 1.00 68.32  ? 369 ARG A CD  1 
ATOM   2496  N  NE  . ARG A 1 368 ? 119.029 114.941 148.619 1.00 68.15  ? 369 ARG A NE  1 
ATOM   2497  C  CZ  . ARG A 1 368 ? 119.176 116.013 147.851 1.00 67.99  ? 369 ARG A CZ  1 
ATOM   2498  N  NH1 . ARG A 1 368 ? 118.118 116.651 147.389 1.00 67.93  1 369 ARG A NH1 1 
ATOM   2499  N  NH2 . ARG A 1 368 ? 120.384 116.446 147.547 1.00 67.93  ? 369 ARG A NH2 1 
ATOM   2500  N  N   . CYS A 1 369 ? 117.504 109.899 150.887 1.00 72.87  ? 370 CYS A N   1 
ATOM   2501  C  CA  . CYS A 1 369 ? 116.530 109.573 151.907 1.00 72.26  ? 370 CYS A CA  1 
ATOM   2502  C  C   . CYS A 1 369 ? 116.633 110.557 153.045 1.00 71.78  ? 370 CYS A C   1 
ATOM   2503  O  O   . CYS A 1 369 ? 117.695 110.749 153.609 1.00 71.77  ? 370 CYS A O   1 
ATOM   2504  C  CB  . CYS A 1 369 ? 116.770 108.168 152.436 1.00 72.20  ? 370 CYS A CB  1 
ATOM   2505  S  SG  . CYS A 1 369 ? 115.714 107.698 153.789 1.00 72.18  ? 370 CYS A SG  1 
ATOM   2506  N  N   . VAL A 1 370 ? 115.510 111.181 153.370 1.00 68.78  ? 371 VAL A N   1 
ATOM   2507  C  CA  . VAL A 1 370 ? 115.422 112.117 154.475 1.00 68.34  ? 371 VAL A CA  1 
ATOM   2508  C  C   . VAL A 1 370 ? 114.812 111.463 155.700 1.00 67.80  ? 371 VAL A C   1 
ATOM   2509  O  O   . VAL A 1 370 ? 113.832 110.752 155.606 1.00 67.79  ? 371 VAL A O   1 
ATOM   2510  C  CB  . VAL A 1 370 ? 114.606 113.337 154.072 1.00 68.45  ? 371 VAL A CB  1 
ATOM   2511  C  CG1 . VAL A 1 370 ? 114.149 114.098 155.279 1.00 68.45  ? 371 VAL A CG1 1 
ATOM   2512  C  CG2 . VAL A 1 370 ? 115.421 114.221 153.182 1.00 68.57  ? 371 VAL A CG2 1 
ATOM   2513  N  N   . VAL A 1 371 ? 115.407 111.715 156.855 1.00 63.99  ? 372 VAL A N   1 
ATOM   2514  C  CA  . VAL A 1 371 ? 114.994 111.081 158.085 1.00 63.51  ? 372 VAL A CA  1 
ATOM   2515  C  C   . VAL A 1 371 ? 114.615 112.122 159.114 1.00 63.36  ? 372 VAL A C   1 
ATOM   2516  O  O   . VAL A 1 371 ? 115.291 113.122 159.242 1.00 63.36  ? 372 VAL A O   1 
ATOM   2517  C  CB  . VAL A 1 371 ? 116.138 110.240 158.620 1.00 63.25  ? 372 VAL A CB  1 
ATOM   2518  C  CG1 . VAL A 1 371 ? 116.052 110.098 160.094 1.00 63.15  ? 372 VAL A CG1 1 
ATOM   2519  C  CG2 . VAL A 1 371 ? 116.124 108.899 157.974 1.00 63.19  ? 372 VAL A CG2 1 
ATOM   2520  N  N   . ILE A 1 372 ? 113.528 111.907 159.843 1.00 75.21  ? 373 ILE A N   1 
ATOM   2521  C  CA  . ILE A 1 372 ? 113.179 112.853 160.908 1.00 75.12  ? 373 ILE A CA  1 
ATOM   2522  C  C   . ILE A 1 372 ? 113.789 112.496 162.267 1.00 74.89  ? 373 ILE A C   1 
ATOM   2523  O  O   . ILE A 1 372 ? 113.751 111.357 162.678 1.00 74.87  ? 373 ILE A O   1 
ATOM   2524  C  CB  . ILE A 1 372 ? 111.660 113.021 161.043 1.00 75.25  ? 373 ILE A CB  1 
ATOM   2525  C  CG1 . ILE A 1 372 ? 111.049 113.392 159.705 1.00 75.33  ? 373 ILE A CG1 1 
ATOM   2526  C  CG2 . ILE A 1 372 ? 111.330 114.097 162.020 1.00 75.27  ? 373 ILE A CG2 1 
ATOM   2527  C  CD1 . ILE A 1 372 ? 111.564 114.656 159.160 1.00 75.37  ? 373 ILE A CD1 1 
ATOM   2528  N  N   . LEU A 1 373 ? 114.317 113.490 162.971 1.00 63.93  ? 374 LEU A N   1 
ATOM   2529  C  CA  . LEU A 1 373 ? 114.979 113.287 164.250 1.00 63.80  ? 374 LEU A CA  1 
ATOM   2530  C  C   . LEU A 1 373 ? 114.332 114.171 165.290 1.00 64.52  ? 374 LEU A C   1 
ATOM   2531  O  O   . LEU A 1 373 ? 114.784 115.268 165.535 1.00 64.57  ? 374 LEU A O   1 
ATOM   2532  C  CB  . LEU A 1 373 ? 116.456 113.636 164.160 1.00 63.18  ? 374 LEU A CB  1 
ATOM   2533  C  CG  . LEU A 1 373 ? 117.367 112.907 163.185 1.00 62.69  ? 374 LEU A CG  1 
ATOM   2534  C  CD1 . LEU A 1 373 ? 118.796 113.217 163.495 1.00 62.51  ? 374 LEU A CD1 1 
ATOM   2535  C  CD2 . LEU A 1 373 ? 117.141 111.441 163.263 1.00 62.56  ? 374 LEU A CD2 1 
ATOM   2536  N  N   . PRO A 1 374 ? 113.245 113.689 165.888 1.00 67.32  ? 375 PRO A N   1 
ATOM   2537  C  CA  . PRO A 1 374 ? 112.273 114.438 166.687 1.00 67.93  ? 375 PRO A CA  1 
ATOM   2538  C  C   . PRO A 1 374 ? 112.744 115.204 167.919 1.00 68.72  ? 375 PRO A C   1 
ATOM   2539  O  O   . PRO A 1 374 ? 112.218 116.278 168.145 1.00 68.81  ? 375 PRO A O   1 
ATOM   2540  C  CB  . PRO A 1 374 ? 111.297 113.351 167.122 1.00 67.78  ? 375 PRO A CB  1 
ATOM   2541  C  CG  . PRO A 1 374 ? 111.447 112.294 166.129 1.00 67.62  ? 375 PRO A CG  1 
ATOM   2542  C  CD  . PRO A 1 374 ? 112.871 112.276 165.781 1.00 67.45  ? 375 PRO A CD  1 
ATOM   2543  N  N   . ASP A 1 375 ? 113.712 114.707 168.676 1.00 72.61  ? 376 ASP A N   1 
ATOM   2544  C  CA  . ASP A 1 375 ? 114.096 115.376 169.919 1.00 73.32  ? 376 ASP A CA  1 
ATOM   2545  C  C   . ASP A 1 375 ? 115.506 115.083 170.401 1.00 73.82  ? 376 ASP A C   1 
ATOM   2546  O  O   . ASP A 1 375 ? 116.181 114.228 169.864 1.00 73.87  ? 376 ASP A O   1 
ATOM   2547  C  CB  . ASP A 1 375 ? 113.081 115.108 171.031 1.00 73.48  ? 376 ASP A CB  1 
ATOM   2548  C  CG  . ASP A 1 375 ? 113.268 113.775 171.690 1.00 73.54  ? 376 ASP A CG  1 
ATOM   2549  O  OD1 . ASP A 1 375 ? 113.792 112.860 171.045 1.00 73.60  ? 376 ASP A OD1 1 
ATOM   2550  O  OD2 . ASP A 1 375 ? 112.873 113.632 172.859 1.00 73.66  1 376 ASP A OD2 1 
ATOM   2551  N  N   . SER A 1 376 ? 115.940 115.817 171.418 1.00 81.47  ? 377 SER A N   1 
ATOM   2552  C  CA  . SER A 1 376 ? 117.319 115.759 171.901 1.00 81.87  ? 377 SER A CA  1 
ATOM   2553  C  C   . SER A 1 376 ? 117.575 114.781 173.035 1.00 82.13  ? 377 SER A C   1 
ATOM   2554  O  O   . SER A 1 376 ? 116.651 114.259 173.629 1.00 82.16  ? 377 SER A O   1 
ATOM   2555  C  CB  . SER A 1 376 ? 117.797 117.143 172.320 1.00 81.94  ? 377 SER A CB  1 
ATOM   2556  O  OG  . SER A 1 376 ? 117.314 117.478 173.596 1.00 81.96  ? 377 SER A OG  1 
ATOM   2557  N  N   . VAL A 1 377 ? 118.847 114.565 173.342 1.00 67.29  ? 378 VAL A N   1 
ATOM   2558  C  CA  . VAL A 1 377 ? 119.259 113.643 174.391 1.00 67.52  ? 378 VAL A CA  1 
ATOM   2559  C  C   . VAL A 1 377 ? 118.907 114.134 175.765 1.00 68.10  ? 378 VAL A C   1 
ATOM   2560  O  O   . VAL A 1 377 ? 118.981 113.392 176.718 1.00 68.17  ? 378 VAL A O   1 
ATOM   2561  C  CB  . VAL A 1 377 ? 120.767 113.415 174.401 1.00 67.26  ? 378 VAL A CB  1 
ATOM   2562  C  CG1 . VAL A 1 377 ? 121.160 112.452 173.337 1.00 67.15  ? 378 VAL A CG1 1 
ATOM   2563  C  CG2 . VAL A 1 377 ? 121.490 114.713 174.232 1.00 67.18  ? 378 VAL A CG2 1 
ATOM   2564  N  N   . ARG A 1 378 ? 118.549 115.398 175.869 1.00 77.16  ? 379 ARG A N   1 
ATOM   2565  C  CA  . ARG A 1 378 ? 118.329 116.014 177.160 1.00 77.74  ? 379 ARG A CA  1 
ATOM   2566  C  C   . ARG A 1 378 ? 117.258 115.297 177.946 1.00 78.03  ? 379 ARG A C   1 
ATOM   2567  O  O   . ARG A 1 378 ? 117.338 115.197 179.157 1.00 78.08  ? 379 ARG A O   1 
ATOM   2568  C  CB  . ARG A 1 378 ? 117.939 117.475 176.970 1.00 78.00  ? 379 ARG A CB  1 
ATOM   2569  C  CG  . ARG A 1 378 ? 117.382 118.131 178.192 1.00 78.22  ? 379 ARG A CG  1 
ATOM   2570  C  CD  . ARG A 1 378 ? 117.099 119.578 177.945 1.00 78.38  ? 379 ARG A CD  1 
ATOM   2571  N  NE  . ARG A 1 378 ? 116.050 119.778 176.961 1.00 78.50  ? 379 ARG A NE  1 
ATOM   2572  C  CZ  . ARG A 1 378 ? 114.805 119.357 177.111 1.00 78.61  ? 379 ARG A CZ  1 
ATOM   2573  N  NH1 . ARG A 1 378 ? 114.461 118.697 178.197 1.00 78.64  1 379 ARG A NH1 1 
ATOM   2574  N  NH2 . ARG A 1 378 ? 113.910 119.585 176.170 1.00 78.64  ? 379 ARG A NH2 1 
ATOM   2575  N  N   . ASN A 1 379 ? 116.274 114.754 177.255 1.00 73.44  ? 380 ASN A N   1 
ATOM   2576  C  CA  . ASN A 1 379 ? 115.187 114.076 177.929 1.00 73.72  ? 380 ASN A CA  1 
ATOM   2577  C  C   . ASN A 1 379 ? 115.561 112.697 178.418 1.00 73.97  ? 380 ASN A C   1 
ATOM   2578  O  O   . ASN A 1 379 ? 114.829 112.096 179.178 1.00 74.03  ? 380 ASN A O   1 
ATOM   2579  C  CB  . ASN A 1 379 ? 113.981 113.961 177.012 1.00 73.74  ? 380 ASN A CB  1 
ATOM   2580  C  CG  . ASN A 1 379 ? 113.261 115.259 176.833 1.00 73.75  ? 380 ASN A CG  1 
ATOM   2581  O  OD1 . ASN A 1 379 ? 113.426 116.185 177.611 1.00 73.75  ? 380 ASN A OD1 1 
ATOM   2582  N  ND2 . ASN A 1 379 ? 112.440 115.331 175.808 1.00 73.76  ? 380 ASN A ND2 1 
ATOM   2583  N  N   . TYR A 1 380 ? 116.696 112.189 177.970 1.00 72.96  ? 381 TYR A N   1 
ATOM   2584  C  CA  . TYR A 1 380 ? 117.073 110.816 178.259 1.00 73.22  ? 381 TYR A CA  1 
ATOM   2585  C  C   . TYR A 1 380 ? 118.468 110.705 178.858 1.00 73.77  ? 381 TYR A C   1 
ATOM   2586  O  O   . TYR A 1 380 ? 119.155 109.715 178.671 1.00 73.80  ? 381 TYR A O   1 
ATOM   2587  C  CB  . TYR A 1 380 ? 116.965 109.973 176.992 1.00 73.00  ? 381 TYR A CB  1 
ATOM   2588  C  CG  . TYR A 1 380 ? 115.751 110.293 176.166 1.00 72.75  ? 381 TYR A CG  1 
ATOM   2589  C  CD1 . TYR A 1 380 ? 115.843 111.102 175.055 1.00 72.63  ? 381 TYR A CD1 1 
ATOM   2590  C  CD2 . TYR A 1 380 ? 114.510 109.807 176.510 1.00 72.63  ? 381 TYR A CD2 1 
ATOM   2591  C  CE1 . TYR A 1 380 ? 114.738 111.408 174.310 1.00 72.52  ? 381 TYR A CE1 1 
ATOM   2592  C  CE2 . TYR A 1 380 ? 113.404 110.109 175.771 1.00 72.55  ? 381 TYR A CE2 1 
ATOM   2593  C  CZ  . TYR A 1 380 ? 113.522 110.908 174.674 1.00 72.50  ? 381 TYR A CZ  1 
ATOM   2594  O  OH  . TYR A 1 380 ? 112.418 111.214 173.927 1.00 72.47  ? 381 TYR A OH  1 
ATOM   2595  N  N   . MET A 1 381 ? 118.867 111.728 179.597 1.00 86.07  ? 382 MET A N   1 
ATOM   2596  C  CA  . MET A 1 381 ? 120.201 111.803 180.160 1.00 86.53  ? 382 MET A CA  1 
ATOM   2597  C  C   . MET A 1 381 ? 120.486 110.663 181.108 1.00 86.50  ? 382 MET A C   1 
ATOM   2598  O  O   . MET A 1 381 ? 121.606 110.190 181.196 1.00 86.55  ? 382 MET A O   1 
ATOM   2599  C  CB  . MET A 1 381 ? 120.350 113.103 180.936 1.00 86.85  ? 382 MET A CB  1 
ATOM   2600  C  CG  . MET A 1 381 ? 120.454 114.346 180.096 1.00 87.05  ? 382 MET A CG  1 
ATOM   2601  S  SD  . MET A 1 381 ? 122.124 114.655 179.549 1.00 87.22  ? 382 MET A SD  1 
ATOM   2602  C  CE  . MET A 1 381 ? 121.916 114.412 177.811 1.00 87.32  ? 382 MET A CE  1 
ATOM   2603  N  N   . THR A 1 382 ? 119.459 110.230 181.823 1.00 91.90  ? 383 THR A N   1 
ATOM   2604  C  CA  . THR A 1 382 ? 119.610 109.193 182.824 1.00 91.73  ? 383 THR A CA  1 
ATOM   2605  C  C   . THR A 1 382 ? 119.007 107.889 182.364 1.00 91.13  ? 383 THR A C   1 
ATOM   2606  O  O   . THR A 1 382 ? 118.863 106.964 183.143 1.00 91.12  ? 383 THR A O   1 
ATOM   2607  C  CB  . THR A 1 382 ? 118.974 109.593 184.151 1.00 92.03  ? 383 THR A CB  1 
ATOM   2608  O  OG1 . THR A 1 382 ? 117.590 109.878 183.948 1.00 92.05  ? 383 THR A OG1 1 
ATOM   2609  C  CG2 . THR A 1 382 ? 119.644 110.819 184.704 1.00 92.20  ? 383 THR A CG2 1 
ATOM   2610  N  N   . LYS A 1 383 ? 118.635 107.824 181.098 1.00 70.61  ? 384 LYS A N   1 
ATOM   2611  C  CA  . LYS A 1 383 ? 118.104 106.594 180.541 1.00 70.05  ? 384 LYS A CA  1 
ATOM   2612  C  C   . LYS A 1 383 ? 119.090 105.941 179.600 1.00 70.67  ? 384 LYS A C   1 
ATOM   2613  O  O   . LYS A 1 383 ? 120.128 105.480 180.028 1.00 70.83  ? 384 LYS A O   1 
ATOM   2614  C  CB  . LYS A 1 383 ? 116.775 106.835 179.836 1.00 69.07  ? 384 LYS A CB  1 
ATOM   2615  C  CG  . LYS A 1 383 ? 115.614 107.048 180.777 1.00 68.24  ? 384 LYS A CG  1 
ATOM   2616  C  CD  . LYS A 1 383 ? 114.310 106.736 180.088 1.00 67.52  ? 384 LYS A CD  1 
ATOM   2617  C  CE  . LYS A 1 383 ? 113.131 106.879 181.005 1.00 67.04  ? 384 LYS A CE  1 
ATOM   2618  N  NZ  . LYS A 1 383 ? 111.893 106.572 180.272 1.00 66.81  1 384 LYS A NZ  1 
ATOM   2619  N  N   . PHE A 1 384 ? 118.778 105.910 178.315 1.00 73.14  ? 385 PHE A N   1 
ATOM   2620  C  CA  . PHE A 1 384 ? 119.614 105.179 177.372 1.00 73.73  ? 385 PHE A CA  1 
ATOM   2621  C  C   . PHE A 1 384 ? 121.017 105.745 177.245 1.00 74.75  ? 385 PHE A C   1 
ATOM   2622  O  O   . PHE A 1 384 ? 121.944 105.050 176.857 1.00 74.81  ? 385 PHE A O   1 
ATOM   2623  C  CB  . PHE A 1 384 ? 118.937 105.036 176.008 1.00 73.45  ? 385 PHE A CB  1 
ATOM   2624  C  CG  . PHE A 1 384 ? 119.030 106.244 175.138 1.00 73.19  ? 385 PHE A CG  1 
ATOM   2625  C  CD1 . PHE A 1 384 ? 120.112 106.438 174.322 1.00 73.08  ? 385 PHE A CD1 1 
ATOM   2626  C  CD2 . PHE A 1 384 ? 118.014 107.157 175.100 1.00 73.06  ? 385 PHE A CD2 1 
ATOM   2627  C  CE1 . PHE A 1 384 ? 120.190 107.533 173.520 1.00 73.00  ? 385 PHE A CE1 1 
ATOM   2628  C  CE2 . PHE A 1 384 ? 118.091 108.249 174.293 1.00 72.98  ? 385 PHE A CE2 1 
ATOM   2629  C  CZ  . PHE A 1 384 ? 119.179 108.438 173.505 1.00 72.97  ? 385 PHE A CZ  1 
ATOM   2630  N  N   . LEU A 1 385 ? 121.165 107.020 177.547 1.00 75.05  ? 386 LEU A N   1 
ATOM   2631  C  CA  . LEU A 1 385 ? 122.480 107.610 177.577 1.00 76.17  ? 386 LEU A CA  1 
ATOM   2632  C  C   . LEU A 1 385 ? 123.314 107.043 178.707 1.00 77.79  ? 386 LEU A C   1 
ATOM   2633  O  O   . LEU A 1 385 ? 124.522 106.940 178.600 1.00 77.92  ? 386 LEU A O   1 
ATOM   2634  C  CB  . LEU A 1 385 ? 122.381 109.114 177.723 1.00 75.79  ? 386 LEU A CB  1 
ATOM   2635  C  CG  . LEU A 1 385 ? 123.661 109.813 177.300 1.00 75.49  ? 386 LEU A CG  1 
ATOM   2636  C  CD1 . LEU A 1 385 ? 123.875 109.585 175.840 1.00 75.37  ? 386 LEU A CD1 1 
ATOM   2637  C  CD2 . LEU A 1 385 ? 123.584 111.274 177.591 1.00 75.40  ? 386 LEU A CD2 1 
ATOM   2638  N  N   . SER A 1 386 ? 122.662 106.667 179.795 1.00 88.94  ? 387 SER A N   1 
ATOM   2639  C  CA  . SER A 1 386 ? 123.369 106.141 180.948 1.00 90.82  ? 387 SER A CA  1 
ATOM   2640  C  C   . SER A 1 386 ? 123.609 104.652 180.818 1.00 92.70  ? 387 SER A C   1 
ATOM   2641  O  O   . SER A 1 386 ? 122.679 103.887 180.623 1.00 92.82  ? 387 SER A O   1 
ATOM   2642  C  CB  . SER A 1 386 ? 122.581 106.424 182.219 1.00 90.84  ? 387 SER A CB  1 
ATOM   2643  O  OG  . SER A 1 386 ? 123.205 105.841 183.344 1.00 90.91  ? 387 SER A OG  1 
ATOM   2644  N  N   . ASP A 1 387 ? 124.860 104.237 180.942 1.00 101.88 ? 388 ASP A N   1 
ATOM   2645  C  CA  . ASP A 1 387 ? 125.196 102.834 180.764 1.00 103.72 ? 388 ASP A CA  1 
ATOM   2646  C  C   . ASP A 1 387 ? 124.568 101.941 181.825 1.00 105.42 ? 388 ASP A C   1 
ATOM   2647  O  O   . ASP A 1 387 ? 124.198 100.801 181.554 1.00 105.61 ? 388 ASP A O   1 
ATOM   2648  C  CB  . ASP A 1 387 ? 126.715 102.640 180.762 1.00 103.79 ? 388 ASP A CB  1 
ATOM   2649  C  CG  . ASP A 1 387 ? 127.398 103.312 179.587 1.00 103.72 ? 388 ASP A CG  1 
ATOM   2650  O  OD1 . ASP A 1 387 ? 126.923 103.164 178.450 1.00 103.67 ? 388 ASP A OD1 1 
ATOM   2651  O  OD2 . ASP A 1 387 ? 128.420 103.988 179.807 1.00 103.78 1 388 ASP A OD2 1 
ATOM   2652  N  N   . ARG A 1 388 ? 124.446 102.453 183.037 1.00 119.80 ? 389 ARG A N   1 
ATOM   2653  C  CA  . ARG A 1 388 ? 123.886 101.639 184.097 1.00 121.27 ? 389 ARG A CA  1 
ATOM   2654  C  C   . ARG A 1 388 ? 122.418 101.334 183.845 1.00 119.89 ? 389 ARG A C   1 
ATOM   2655  O  O   . ARG A 1 388 ? 121.939 100.258 184.178 1.00 119.88 ? 389 ARG A O   1 
ATOM   2656  C  CB  . ARG A 1 388 ? 124.110 102.283 185.471 1.00 123.42 ? 389 ARG A CB  1 
ATOM   2657  C  CG  . ARG A 1 388 ? 123.372 103.589 185.701 1.00 125.34 ? 389 ARG A CG  1 
ATOM   2658  C  CD  . ARG A 1 388 ? 122.067 103.363 186.447 1.00 127.06 ? 389 ARG A CD  1 
ATOM   2659  N  NE  . ARG A 1 388 ? 121.139 104.477 186.295 1.00 128.75 ? 389 ARG A NE  1 
ATOM   2660  C  CZ  . ARG A 1 388 ? 119.854 104.419 186.622 1.00 130.20 ? 389 ARG A CZ  1 
ATOM   2661  N  NH1 . ARG A 1 388 ? 119.346 103.300 187.114 1.00 130.65 1 389 ARG A NH1 1 
ATOM   2662  N  NH2 . ARG A 1 388 ? 119.075 105.476 186.452 1.00 130.67 ? 389 ARG A NH2 1 
ATOM   2663  N  N   . TRP A 1 389 ? 121.714 102.275 183.231 1.00 85.35  ? 390 TRP A N   1 
ATOM   2664  C  CA  . TRP A 1 389 ? 120.308 102.077 182.921 1.00 83.74  ? 390 TRP A CA  1 
ATOM   2665  C  C   . TRP A 1 389 ? 120.167 101.052 181.823 1.00 84.29  ? 390 TRP A C   1 
ATOM   2666  O  O   . TRP A 1 389 ? 119.278 100.219 181.859 1.00 84.29  ? 390 TRP A O   1 
ATOM   2667  C  CB  . TRP A 1 389 ? 119.667 103.398 182.494 1.00 82.17  ? 390 TRP A CB  1 
ATOM   2668  C  CG  . TRP A 1 389 ? 118.194 103.337 182.203 1.00 80.53  ? 390 TRP A CG  1 
ATOM   2669  C  CD1 . TRP A 1 389 ? 117.189 103.574 183.070 1.00 79.99  ? 390 TRP A CD1 1 
ATOM   2670  C  CD2 . TRP A 1 389 ? 117.577 103.050 180.950 1.00 79.52  ? 390 TRP A CD2 1 
ATOM   2671  N  NE1 . TRP A 1 389 ? 115.983 103.439 182.450 1.00 79.48  ? 390 TRP A NE1 1 
ATOM   2672  C  CE2 . TRP A 1 389 ? 116.197 103.117 181.141 1.00 79.21  ? 390 TRP A CE2 1 
ATOM   2673  C  CE3 . TRP A 1 389 ? 118.061 102.734 179.686 1.00 78.99  ? 390 TRP A CE3 1 
ATOM   2674  C  CZ2 . TRP A 1 389 ? 115.298 102.880 180.126 1.00 78.84  ? 390 TRP A CZ2 1 
ATOM   2675  C  CZ3 . TRP A 1 389 ? 117.165 102.500 178.681 1.00 78.73  ? 390 TRP A CZ3 1 
ATOM   2676  C  CH2 . TRP A 1 389 ? 115.801 102.573 178.904 1.00 78.67  ? 390 TRP A CH2 1 
ATOM   2677  N  N   . MET A 1 390 ? 121.061 101.119 180.846 1.00 95.80  ? 391 MET A N   1 
ATOM   2678  C  CA  . MET A 1 390 ? 121.044 100.181 179.738 1.00 96.40  ? 391 MET A CA  1 
ATOM   2679  C  C   . MET A 1 390 ? 121.357 98.776  180.211 1.00 97.63  ? 391 MET A C   1 
ATOM   2680  O  O   . MET A 1 390 ? 120.858 97.798  179.662 1.00 97.72  ? 391 MET A O   1 
ATOM   2681  C  CB  . MET A 1 390 ? 122.042 100.603 178.661 1.00 95.96  ? 391 MET A CB  1 
ATOM   2682  C  CG  . MET A 1 390 ? 121.647 101.844 177.885 1.00 95.63  ? 391 MET A CG  1 
ATOM   2683  S  SD  . MET A 1 390 ? 120.439 101.552 176.591 1.00 95.32  ? 391 MET A SD  1 
ATOM   2684  C  CE  . MET A 1 390 ? 121.443 100.768 175.353 1.00 95.16  ? 391 MET A CE  1 
ATOM   2685  N  N   . LEU A 1 391 ? 122.186 98.679  181.238 1.00 106.02 ? 392 LEU A N   1 
ATOM   2686  C  CA  . LEU A 1 391 ? 122.515 97.382  181.799 1.00 107.23 ? 392 LEU A CA  1 
ATOM   2687  C  C   . LEU A 1 391 ? 121.332 96.848  182.569 1.00 107.72 ? 392 LEU A C   1 
ATOM   2688  O  O   . LEU A 1 391 ? 120.943 95.697  182.421 1.00 107.78 ? 392 LEU A O   1 
ATOM   2689  C  CB  . LEU A 1 391 ? 123.715 97.503  182.730 1.00 107.75 ? 392 LEU A CB  1 
ATOM   2690  C  CG  . LEU A 1 391 ? 125.064 97.656  182.032 1.00 108.17 ? 392 LEU A CG  1 
ATOM   2691  C  CD1 . LEU A 1 391 ? 126.127 98.055  183.022 1.00 108.33 ? 392 LEU A CD1 1 
ATOM   2692  C  CD2 . LEU A 1 391 ? 125.436 96.359  181.351 1.00 108.33 ? 392 LEU A CD2 1 
ATOM   2693  N  N   . GLN A 1 392 ? 120.756 97.720  183.379 1.00 107.95 ? 393 GLN A N   1 
ATOM   2694  C  CA  . GLN A 1 392 ? 119.663 97.373  184.263 1.00 108.35 ? 393 GLN A CA  1 
ATOM   2695  C  C   . GLN A 1 392 ? 118.425 96.935  183.500 1.00 108.06 ? 393 GLN A C   1 
ATOM   2696  O  O   . GLN A 1 392 ? 117.678 96.084  183.954 1.00 108.05 ? 393 GLN A O   1 
ATOM   2697  C  CB  . GLN A 1 392 ? 119.360 98.583  185.130 1.00 108.88 ? 393 GLN A CB  1 
ATOM   2698  C  CG  . GLN A 1 392 ? 118.146 98.488  185.982 1.00 109.30 ? 393 GLN A CG  1 
ATOM   2699  C  CD  . GLN A 1 392 ? 117.943 99.745  186.794 1.00 109.60 ? 393 GLN A CD  1 
ATOM   2700  O  OE1 . GLN A 1 392 ? 118.764 100.659 186.755 1.00 109.65 ? 393 GLN A OE1 1 
ATOM   2701  N  NE2 . GLN A 1 392 ? 116.846 99.801  187.537 1.00 109.77 ? 393 GLN A NE2 1 
ATOM   2702  N  N   . LYS A 1 393 ? 118.217 97.518  182.329 1.00 93.39  ? 394 LYS A N   1 
ATOM   2703  C  CA  . LYS A 1 393 ? 117.081 97.165  181.492 1.00 93.11  ? 394 LYS A CA  1 
ATOM   2704  C  C   . LYS A 1 393 ? 117.423 96.034  180.544 1.00 93.96  ? 394 LYS A C   1 
ATOM   2705  O  O   . LYS A 1 393 ? 116.586 95.580  179.774 1.00 93.97  ? 394 LYS A O   1 
ATOM   2706  C  CB  . LYS A 1 393 ? 116.583 98.375  180.710 1.00 92.29  ? 394 LYS A CB  1 
ATOM   2707  C  CG  . LYS A 1 393 ? 115.850 99.401  181.543 1.00 91.55  ? 394 LYS A CG  1 
ATOM   2708  C  CD  . LYS A 1 393 ? 114.537 98.852  182.032 1.00 91.00  ? 394 LYS A CD  1 
ATOM   2709  C  CE  . LYS A 1 393 ? 113.924 99.718  183.113 1.00 90.55  ? 394 LYS A CE  1 
ATOM   2710  N  NZ  . LYS A 1 393 ? 113.151 100.866 182.579 1.00 90.34  1 394 LYS A NZ  1 
ATOM   2711  N  N   . GLY A 1 394 ? 118.671 95.597  180.584 1.00 116.31 ? 395 GLY A N   1 
ATOM   2712  C  CA  . GLY A 1 394 ? 119.090 94.455  179.800 1.00 117.27 ? 395 GLY A CA  1 
ATOM   2713  C  C   . GLY A 1 394 ? 119.354 94.728  178.340 1.00 118.37 ? 395 GLY A C   1 
ATOM   2714  O  O   . GLY A 1 394 ? 119.415 93.804  177.539 1.00 118.43 ? 395 GLY A O   1 
ATOM   2715  N  N   . PHE A 1 395 ? 119.475 95.993  177.974 1.00 93.83  ? 396 PHE A N   1 
ATOM   2716  C  CA  . PHE A 1 395 ? 119.771 96.323  176.591 1.00 95.18  ? 396 PHE A CA  1 
ATOM   2717  C  C   . PHE A 1 395 ? 121.231 96.095  176.255 1.00 99.39  ? 396 PHE A C   1 
ATOM   2718  O  O   . PHE A 1 395 ? 121.574 95.741  175.134 1.00 99.64  ? 396 PHE A O   1 
ATOM   2719  C  CB  . PHE A 1 395 ? 119.364 97.756  176.279 1.00 93.25  ? 396 PHE A CB  1 
ATOM   2720  C  CG  . PHE A 1 395 ? 117.892 97.990  176.359 1.00 91.41  ? 396 PHE A CG  1 
ATOM   2721  C  CD1 . PHE A 1 395 ? 117.024 97.261  175.584 1.00 90.55  ? 396 PHE A CD1 1 
ATOM   2722  C  CD2 . PHE A 1 395 ? 117.378 98.941  177.209 1.00 90.44  ? 396 PHE A CD2 1 
ATOM   2723  C  CE1 . PHE A 1 395 ? 115.682 97.472  175.659 1.00 89.87  ? 396 PHE A CE1 1 
ATOM   2724  C  CE2 . PHE A 1 395 ? 116.036 99.157  177.283 1.00 89.87  ? 396 PHE A CE2 1 
ATOM   2725  C  CZ  . PHE A 1 395 ? 115.186 98.422  176.506 1.00 89.66  ? 396 PHE A CZ  1 
ATOM   2726  N  N   . LEU A 1 396 ? 122.087 96.294  177.242 1.00 113.48 ? 397 LEU A N   1 
ATOM   2727  C  CA  . LEU A 1 396 ? 123.508 96.062  177.070 1.00 118.19 ? 397 LEU A CA  1 
ATOM   2728  C  C   . LEU A 1 396 ? 123.952 94.783  177.748 1.00 123.45 ? 397 LEU A C   1 
ATOM   2729  O  O   . LEU A 1 396 ? 123.941 94.688  178.971 1.00 123.68 ? 397 LEU A O   1 
ATOM   2730  C  CB  . LEU A 1 396 ? 124.312 97.219  177.641 1.00 117.96 ? 397 LEU A CB  1 
ATOM   2731  C  CG  . LEU A 1 396 ? 124.595 98.377  176.699 1.00 117.66 ? 397 LEU A CG  1 
ATOM   2732  C  CD1 . LEU A 1 396 ? 125.625 99.288  177.324 1.00 117.57 ? 397 LEU A CD1 1 
ATOM   2733  C  CD2 . LEU A 1 396 ? 125.096 97.849  175.383 1.00 117.70 ? 397 LEU A CD2 1 
ATOM   2734  N  N   . LYS A 1 397 ? 124.311 93.787  176.949 1.00 148.40 ? 398 LYS A N   1 
ATOM   2735  C  CA  . LYS A 1 397 ? 125.009 92.617  177.458 1.00 153.75 ? 398 LYS A CA  1 
ATOM   2736  C  C   . LYS A 1 397 ? 126.406 93.032  177.876 1.00 156.42 ? 398 LYS A C   1 
ATOM   2737  O  O   . LYS A 1 397 ? 127.069 93.762  177.147 1.00 156.72 ? 398 LYS A O   1 
ATOM   2738  C  CB  . LYS A 1 397 ? 125.104 91.547  176.377 1.00 156.14 ? 398 LYS A CB  1 
ATOM   2739  C  CG  . LYS A 1 397 ? 123.792 90.863  176.047 1.00 158.13 ? 398 LYS A CG  1 
ATOM   2740  C  CD  . LYS A 1 397 ? 124.038 89.472  175.480 1.00 160.02 ? 398 LYS A CD  1 
ATOM   2741  C  CE  . LYS A 1 397 ? 123.986 89.461  173.968 1.00 161.30 ? 398 LYS A CE  1 
ATOM   2742  N  NZ  . LYS A 1 397 ? 124.790 88.352  173.396 1.00 161.96 1 398 LYS A NZ  1 
ATOM   2743  N  N   . GLU A 1 398 ? 126.876 92.548  179.021 1.00 130.25 ? 399 GLU A N   1 
ATOM   2744  C  CA  . GLU A 1 398 ? 128.211 92.910  179.483 1.00 132.61 ? 399 GLU A CA  1 
ATOM   2745  C  C   . GLU A 1 398 ? 129.267 92.420  178.519 1.00 134.78 ? 399 GLU A C   1 
ATOM   2746  O  O   . GLU A 1 398 ? 130.288 93.072  178.317 1.00 135.07 ? 399 GLU A O   1 
ATOM   2747  C  CB  . GLU A 1 398 ? 128.481 92.314  180.856 1.00 132.72 ? 399 GLU A CB  1 
ATOM   2748  C  CG  . GLU A 1 398 ? 127.418 91.352  181.326 1.00 132.73 ? 399 GLU A CG  1 
ATOM   2749  C  CD  . GLU A 1 398 ? 127.314 91.324  182.830 1.00 132.78 ? 399 GLU A CD  1 
ATOM   2750  O  OE1 . GLU A 1 398 ? 126.288 90.844  183.348 1.00 132.78 ? 399 GLU A OE1 1 
ATOM   2751  O  OE2 . GLU A 1 398 ? 128.261 91.792  183.495 1.00 132.78 1 399 GLU A OE2 1 
ATOM   2752  N  N   . GLU A 1 399 ? 128.992 91.280  177.899 1.00 157.64 ? 400 GLU A N   1 
ATOM   2753  C  CA  . GLU A 1 399 ? 129.942 90.658  177.002 1.00 159.64 ? 400 GLU A CA  1 
ATOM   2754  C  C   . GLU A 1 399 ? 130.287 91.577  175.847 1.00 161.29 ? 400 GLU A C   1 
ATOM   2755  O  O   . GLU A 1 399 ? 131.454 91.844  175.601 1.00 161.45 ? 400 GLU A O   1 
ATOM   2756  C  CB  . GLU A 1 399 ? 129.393 89.326  176.489 1.00 159.89 ? 400 GLU A CB  1 
ATOM   2757  C  CG  . GLU A 1 399 ? 127.883 89.284  176.366 1.00 159.99 ? 400 GLU A CG  1 
ATOM   2758  C  CD  . GLU A 1 399 ? 127.304 87.922  176.709 1.00 160.09 ? 400 GLU A CD  1 
ATOM   2759  O  OE1 . GLU A 1 399 ? 127.620 86.940  176.005 1.00 160.11 ? 400 GLU A OE1 1 
ATOM   2760  O  OE2 . GLU A 1 399 ? 126.539 87.833  177.694 1.00 160.12 1 400 GLU A OE2 1 
ATOM   2761  N  N   . ASP A 1 400 ? 129.269 92.107  175.181 1.00 147.92 ? 401 ASP A N   1 
ATOM   2762  C  CA  . ASP A 1 400 ? 129.480 92.960  174.015 1.00 149.29 ? 401 ASP A CA  1 
ATOM   2763  C  C   . ASP A 1 400 ? 130.317 94.197  174.338 1.00 150.10 ? 401 ASP A C   1 
ATOM   2764  O  O   . ASP A 1 400 ? 131.352 94.436  173.715 1.00 150.23 ? 401 ASP A O   1 
ATOM   2765  C  CB  . ASP A 1 400 ? 128.140 93.380  173.412 1.00 149.59 ? 401 ASP A CB  1 
ATOM   2766  N  N   . THR A 1 402 ? 132.421 94.473  176.918 1.00 141.91 ? 403 THR A N   1 
ATOM   2767  C  CA  . THR A 1 402 ? 133.753 93.976  177.238 1.00 140.93 ? 403 THR A CA  1 
ATOM   2768  C  C   . THR A 1 402 ? 134.532 93.576  175.990 1.00 139.40 ? 403 THR A C   1 
ATOM   2769  O  O   . THR A 1 402 ? 135.727 93.827  175.886 1.00 139.33 ? 403 THR A O   1 
ATOM   2770  C  CB  . THR A 1 402 ? 133.698 92.796  178.223 1.00 141.27 ? 403 THR A CB  1 
ATOM   2771  N  N   . GLU A 1 403 ? 133.848 92.949  175.044 1.00 142.30 ? 404 GLU A N   1 
ATOM   2772  C  CA  . GLU A 1 403 ? 134.510 92.450  173.851 1.00 140.42 ? 404 GLU A CA  1 
ATOM   2773  C  C   . GLU A 1 403 ? 135.081 93.561  172.993 1.00 137.28 ? 404 GLU A C   1 
ATOM   2774  O  O   . GLU A 1 403 ? 136.050 93.360  172.275 1.00 137.10 ? 404 GLU A O   1 
ATOM   2775  C  CB  . GLU A 1 403 ? 133.578 91.559  173.030 1.00 141.34 ? 404 GLU A CB  1 
ATOM   2776  C  CG  . GLU A 1 403 ? 133.108 90.257  173.706 1.00 141.96 ? 404 GLU A CG  1 
ATOM   2777  C  CD  . GLU A 1 403 ? 134.048 89.723  174.785 1.00 142.25 ? 404 GLU A CD  1 
ATOM   2778  O  OE1 . GLU A 1 403 ? 135.279 89.698  174.578 1.00 142.36 ? 404 GLU A OE1 1 
ATOM   2779  O  OE2 . GLU A 1 403 ? 133.543 89.299  175.847 1.00 142.36 1 404 GLU A OE2 1 
ATOM   2780  N  N   . LYS A 1 404 ? 134.476 94.738  173.080 1.00 135.17 ? 405 LYS A N   1 
ATOM   2781  C  CA  . LYS A 1 404 ? 134.962 95.914  172.370 1.00 132.18 ? 405 LYS A CA  1 
ATOM   2782  C  C   . LYS A 1 404 ? 136.309 96.345  172.935 1.00 129.77 ? 405 LYS A C   1 
ATOM   2783  O  O   . LYS A 1 404 ? 137.090 97.020  172.276 1.00 129.62 ? 405 LYS A O   1 
ATOM   2784  C  CB  . LYS A 1 404 ? 133.956 97.058  172.533 1.00 131.57 ? 405 LYS A CB  1 
ATOM   2785  C  CG  . LYS A 1 404 ? 133.401 97.630  171.234 1.00 131.00 ? 405 LYS A CG  1 
ATOM   2786  C  CD  . LYS A 1 404 ? 131.889 97.459  171.136 1.00 130.38 ? 405 LYS A CD  1 
ATOM   2787  C  CE  . LYS A 1 404 ? 131.536 96.318  170.203 1.00 129.94 ? 405 LYS A CE  1 
ATOM   2788  N  NZ  . LYS A 1 404 ? 132.340 96.411  168.957 1.00 129.72 1 405 LYS A NZ  1 
ATOM   2789  N  N   . LYS A 1 405 ? 136.548 95.945  174.178 1.00 156.21 ? 406 LYS A N   1 
ATOM   2790  C  CA  . LYS A 1 405 ? 137.629 96.456  175.022 1.00 153.61 ? 406 LYS A CA  1 
ATOM   2791  C  C   . LYS A 1 405 ? 139.031 95.853  174.856 1.00 148.54 ? 406 LYS A C   1 
ATOM   2792  O  O   . LYS A 1 405 ? 139.172 94.736  174.376 1.00 148.22 ? 406 LYS A O   1 
ATOM   2793  C  CB  . LYS A 1 405 ? 137.166 96.420  176.475 1.00 155.78 ? 406 LYS A CB  1 
ATOM   2794  C  CG  . LYS A 1 405 ? 135.973 97.326  176.709 1.00 157.74 ? 406 LYS A CG  1 
ATOM   2795  C  CD  . LYS A 1 405 ? 135.206 96.853  177.902 1.00 159.31 ? 406 LYS A CD  1 
ATOM   2796  C  CE  . LYS A 1 405 ? 133.933 97.626  178.152 1.00 160.57 ? 406 LYS A CE  1 
ATOM   2797  N  NZ  . LYS A 1 405 ? 133.135 96.960  179.226 1.00 161.19 1 406 LYS A NZ  1 
ATOM   2798  N  N   . PRO A 1 406 ? 140.071 96.609  175.255 1.00 105.96 ? 407 PRO A N   1 
ATOM   2799  C  CA  . PRO A 1 406 ? 141.469 96.222  175.082 1.00 102.89 ? 407 PRO A CA  1 
ATOM   2800  C  C   . PRO A 1 406 ? 141.884 95.028  175.913 1.00 99.99  ? 407 PRO A C   1 
ATOM   2801  O  O   . PRO A 1 406 ? 141.096 94.496  176.682 1.00 99.77  ? 407 PRO A O   1 
ATOM   2802  C  CB  . PRO A 1 406 ? 142.231 97.448  175.580 1.00 103.06 ? 407 PRO A CB  1 
ATOM   2803  C  CG  . PRO A 1 406 ? 141.279 98.541  175.539 1.00 103.68 ? 407 PRO A CG  1 
ATOM   2804  C  CD  . PRO A 1 406 ? 139.972 97.948  175.850 1.00 104.74 ? 407 PRO A CD  1 
ATOM   2805  N  N   . TRP A 1 407 ? 143.135 94.621  175.737 1.00 115.85 ? 408 TRP A N   1 
ATOM   2806  C  CA  . TRP A 1 407 ? 143.688 93.441  176.382 1.00 113.51 ? 408 TRP A CA  1 
ATOM   2807  C  C   . TRP A 1 407 ? 143.784 93.530  177.894 1.00 112.26 ? 408 TRP A C   1 
ATOM   2808  O  O   . TRP A 1 407 ? 143.637 92.534  178.587 1.00 112.11 ? 408 TRP A O   1 
ATOM   2809  C  CB  . TRP A 1 407 ? 145.071 93.156  175.812 1.00 112.80 ? 408 TRP A CB  1 
ATOM   2810  C  CG  . TRP A 1 407 ? 146.063 94.237  176.055 1.00 112.18 ? 408 TRP A CG  1 
ATOM   2811  C  CD1 . TRP A 1 407 ? 146.310 95.313  175.265 1.00 111.90 ? 408 TRP A CD1 1 
ATOM   2812  C  CD2 . TRP A 1 407 ? 146.959 94.336  177.159 1.00 111.70 ? 408 TRP A CD2 1 
ATOM   2813  N  NE1 . TRP A 1 407 ? 147.305 96.084  175.811 1.00 111.68 ? 408 TRP A NE1 1 
ATOM   2814  C  CE2 . TRP A 1 407 ? 147.719 95.501  176.977 1.00 111.58 ? 408 TRP A CE2 1 
ATOM   2815  C  CE3 . TRP A 1 407 ? 147.194 93.549  178.286 1.00 111.50 ? 408 TRP A CE3 1 
ATOM   2816  C  CZ2 . TRP A 1 407 ? 148.692 95.898  177.878 1.00 111.43 ? 408 TRP A CZ2 1 
ATOM   2817  C  CZ3 . TRP A 1 407 ? 148.159 93.944  179.174 1.00 111.39 ? 408 TRP A CZ3 1 
ATOM   2818  C  CH2 . TRP A 1 407 ? 148.897 95.106  178.969 1.00 111.37 ? 408 TRP A CH2 1 
ATOM   2819  N  N   . TRP A 1 408 ? 144.021 94.727  178.406 1.00 104.14 ? 409 TRP A N   1 
ATOM   2820  C  CA  . TRP A 1 408 ? 144.266 94.893  179.826 1.00 103.12 ? 409 TRP A CA  1 
ATOM   2821  C  C   . TRP A 1 408 ? 142.989 94.950  180.631 1.00 102.85 ? 409 TRP A C   1 
ATOM   2822  O  O   . TRP A 1 408 ? 143.021 95.004  181.847 1.00 102.78 ? 409 TRP A O   1 
ATOM   2823  C  CB  . TRP A 1 408 ? 145.120 96.126  180.090 1.00 102.60 ? 409 TRP A CB  1 
ATOM   2824  C  CG  . TRP A 1 408 ? 144.567 97.404  179.573 1.00 102.11 ? 409 TRP A CG  1 
ATOM   2825  C  CD1 . TRP A 1 408 ? 144.918 98.038  178.428 1.00 101.91 ? 409 TRP A CD1 1 
ATOM   2826  C  CD2 . TRP A 1 408 ? 143.582 98.227  180.200 1.00 101.69 ? 409 TRP A CD2 1 
ATOM   2827  N  NE1 . TRP A 1 408 ? 144.208 99.202  178.295 1.00 101.72 ? 409 TRP A NE1 1 
ATOM   2828  C  CE2 . TRP A 1 408 ? 143.382 99.339  179.376 1.00 101.58 ? 409 TRP A CE2 1 
ATOM   2829  C  CE3 . TRP A 1 408 ? 142.851 98.130  181.378 1.00 101.42 ? 409 TRP A CE3 1 
ATOM   2830  C  CZ2 . TRP A 1 408 ? 142.484 100.337 179.688 1.00 101.36 ? 409 TRP A CZ2 1 
ATOM   2831  C  CZ3 . TRP A 1 408 ? 141.963 99.122  181.681 1.00 101.26 ? 409 TRP A CZ3 1 
ATOM   2832  C  CH2 . TRP A 1 408 ? 141.785 100.209 180.842 1.00 101.18 ? 409 TRP A CH2 1 
ATOM   2833  N  N   . TRP A 1 409 ? 141.862 94.942  179.942 1.00 103.47 ? 410 TRP A N   1 
ATOM   2834  C  CA  . TRP A 1 409 ? 140.585 95.173  180.587 1.00 103.27 ? 410 TRP A CA  1 
ATOM   2835  C  C   . TRP A 1 409 ? 140.245 94.107  181.612 1.00 104.61 ? 410 TRP A C   1 
ATOM   2836  O  O   . TRP A 1 409 ? 139.698 94.405  182.664 1.00 104.69 ? 410 TRP A O   1 
ATOM   2837  C  CB  . TRP A 1 409 ? 139.482 95.235  179.532 1.00 102.16 ? 410 TRP A CB  1 
ATOM   2838  C  CG  . TRP A 1 409 ? 138.226 95.862  180.011 1.00 101.03 ? 410 TRP A CG  1 
ATOM   2839  C  CD1 . TRP A 1 409 ? 137.104 95.230  180.425 1.00 100.73 ? 410 TRP A CD1 1 
ATOM   2840  C  CD2 . TRP A 1 409 ? 137.969 97.255  180.127 1.00 100.27 ? 410 TRP A CD2 1 
ATOM   2841  N  NE1 . TRP A 1 409 ? 136.159 96.141  180.798 1.00 100.45 ? 410 TRP A NE1 1 
ATOM   2842  C  CE2 . TRP A 1 409 ? 136.672 97.397  180.628 1.00 100.13 ? 410 TRP A CE2 1 
ATOM   2843  C  CE3 . TRP A 1 409 ? 138.717 98.397  179.867 1.00 99.80  ? 410 TRP A CE3 1 
ATOM   2844  C  CZ2 . TRP A 1 409 ? 136.098 98.630  180.851 1.00 99.75  ? 410 TRP A CZ2 1 
ATOM   2845  C  CZ3 . TRP A 1 409 ? 138.149 99.618  180.098 1.00 99.55  ? 410 TRP A CZ3 1 
ATOM   2846  C  CH2 . TRP A 1 409 ? 136.853 99.728  180.585 1.00 99.52  ? 410 TRP A CH2 1 
ATOM   2847  N  N   . HIS A 1 410 ? 140.597 92.868  181.325 1.00 131.52 ? 411 HIS A N   1 
ATOM   2848  C  CA  . HIS A 1 410 ? 140.289 91.796  182.250 1.00 132.78 ? 411 HIS A CA  1 
ATOM   2849  C  C   . HIS A 1 410 ? 141.517 91.408  183.050 1.00 132.09 ? 411 HIS A C   1 
ATOM   2850  O  O   . HIS A 1 410 ? 141.995 90.283  182.976 1.00 132.11 ? 411 HIS A O   1 
ATOM   2851  C  CB  . HIS A 1 410 ? 139.727 90.587  181.514 1.00 134.24 ? 411 HIS A CB  1 
ATOM   2852  C  CG  . HIS A 1 410 ? 138.362 90.806  180.950 1.00 135.69 ? 411 HIS A CG  1 
ATOM   2853  N  ND1 . HIS A 1 410 ? 137.216 90.653  181.697 1.00 136.39 ? 411 HIS A ND1 1 
ATOM   2854  C  CD2 . HIS A 1 410 ? 137.959 91.166  179.709 1.00 136.54 ? 411 HIS A CD2 1 
ATOM   2855  C  CE1 . HIS A 1 410 ? 136.164 90.907  180.941 1.00 136.89 ? 411 HIS A CE1 1 
ATOM   2856  N  NE2 . HIS A 1 410 ? 136.587 91.220  179.730 1.00 136.97 ? 411 HIS A NE2 1 
ATOM   2857  N  N   . LEU A 1 411 ? 142.026 92.356  183.815 1.00 99.20  ? 412 LEU A N   1 
ATOM   2858  C  CA  . LEU A 1 411 ? 143.170 92.114  184.663 1.00 98.60  ? 412 LEU A CA  1 
ATOM   2859  C  C   . LEU A 1 411 ? 142.887 92.648  186.041 1.00 99.72  ? 412 LEU A C   1 
ATOM   2860  O  O   . LEU A 1 411 ? 142.227 93.660  186.198 1.00 99.70  ? 412 LEU A O   1 
ATOM   2861  C  CB  . LEU A 1 411 ? 144.400 92.812  184.108 1.00 97.33  ? 412 LEU A CB  1 
ATOM   2862  C  CG  . LEU A 1 411 ? 145.138 92.095  182.991 1.00 96.29  ? 412 LEU A CG  1 
ATOM   2863  C  CD1 . LEU A 1 411 ? 146.433 92.807  182.713 1.00 95.89  ? 412 LEU A CD1 1 
ATOM   2864  C  CD2 . LEU A 1 411 ? 145.388 90.667  183.386 1.00 96.01  ? 412 LEU A CD2 1 
ATOM   2865  N  N   . ARG A 1 412 ? 143.392 91.960  187.047 1.00 127.09 ? 413 ARG A N   1 
ATOM   2866  C  CA  . ARG A 1 412 ? 143.134 92.346  188.417 1.00 128.26 ? 413 ARG A CA  1 
ATOM   2867  C  C   . ARG A 1 412 ? 143.949 93.555  188.837 1.00 128.46 ? 413 ARG A C   1 
ATOM   2868  O  O   . ARG A 1 412 ? 145.037 93.781  188.327 1.00 128.49 ? 413 ARG A O   1 
ATOM   2869  C  CB  . ARG A 1 412 ? 143.387 91.161  189.332 1.00 129.03 ? 413 ARG A CB  1 
ATOM   2870  C  CG  . ARG A 1 412 ? 142.592 89.940  188.917 1.00 129.74 ? 413 ARG A CG  1 
ATOM   2871  C  CD  . ARG A 1 412 ? 141.116 90.257  188.912 1.00 130.31 ? 413 ARG A CD  1 
ATOM   2872  N  NE  . ARG A 1 412 ? 140.331 89.287  188.161 1.00 130.90 ? 413 ARG A NE  1 
ATOM   2873  C  CZ  . ARG A 1 412 ? 139.789 88.197  188.687 1.00 131.38 ? 413 ARG A CZ  1 
ATOM   2874  N  NH1 . ARG A 1 412 ? 139.954 87.928  189.973 1.00 131.56 1 413 ARG A NH1 1 
ATOM   2875  N  NH2 . ARG A 1 412 ? 139.086 87.375  187.925 1.00 131.57 ? 413 ARG A NH2 1 
ATOM   2876  N  N   . VAL A 1 413 ? 143.413 94.333  189.767 1.00 107.48 ? 414 VAL A N   1 
ATOM   2877  C  CA  . VAL A 1 413 ? 144.076 95.542  190.227 1.00 107.69 ? 414 VAL A CA  1 
ATOM   2878  C  C   . VAL A 1 413 ? 145.404 95.229  190.904 1.00 108.27 ? 414 VAL A C   1 
ATOM   2879  O  O   . VAL A 1 413 ? 146.342 96.016  190.846 1.00 108.23 ? 414 VAL A O   1 
ATOM   2880  C  CB  . VAL A 1 413 ? 143.163 96.342  191.172 1.00 107.38 ? 414 VAL A CB  1 
ATOM   2881  C  CG1 . VAL A 1 413 ? 143.910 97.466  191.828 1.00 107.27 ? 414 VAL A CG1 1 
ATOM   2882  C  CG2 . VAL A 1 413 ? 141.993 96.895  190.411 1.00 107.26 ? 414 VAL A CG2 1 
ATOM   2883  N  N   . GLN A 1 414 ? 145.503 94.045  191.491 1.00 140.96 ? 415 GLN A N   1 
ATOM   2884  C  CA  . GLN A 1 414 ? 146.689 93.662  192.251 1.00 141.39 ? 415 GLN A CA  1 
ATOM   2885  C  C   . GLN A 1 414 ? 147.935 93.649  191.385 1.00 140.41 ? 415 GLN A C   1 
ATOM   2886  O  O   . GLN A 1 414 ? 149.047 93.780  191.878 1.00 140.39 ? 415 GLN A O   1 
ATOM   2887  C  CB  . GLN A 1 414 ? 146.497 92.290  192.883 1.00 142.49 ? 415 GLN A CB  1 
ATOM   2888  C  CG  . GLN A 1 414 ? 146.257 91.201  191.878 1.00 143.21 ? 415 GLN A CG  1 
ATOM   2889  C  CD  . GLN A 1 414 ? 145.931 89.883  192.522 1.00 143.79 ? 415 GLN A CD  1 
ATOM   2890  O  OE1 . GLN A 1 414 ? 144.870 89.309  192.286 1.00 143.88 ? 415 GLN A OE1 1 
ATOM   2891  N  NE2 . GLN A 1 414 ? 146.845 89.387  193.340 1.00 144.07 ? 415 GLN A NE2 1 
ATOM   2892  N  N   . GLU A 1 415 ? 147.732 93.508  190.085 1.00 118.61 ? 416 GLU A N   1 
ATOM   2893  C  CA  . GLU A 1 415 ? 148.825 93.406  189.135 1.00 117.50 ? 416 GLU A CA  1 
ATOM   2894  C  C   . GLU A 1 415 ? 149.431 94.761  188.812 1.00 116.19 ? 416 GLU A C   1 
ATOM   2895  O  O   . GLU A 1 415 ? 150.389 94.856  188.059 1.00 115.96 ? 416 GLU A O   1 
ATOM   2896  C  CB  . GLU A 1 415 ? 148.339 92.703  187.867 1.00 117.64 ? 416 GLU A CB  1 
ATOM   2897  C  CG  . GLU A 1 415 ? 148.043 91.227  188.083 1.00 117.73 ? 416 GLU A CG  1 
ATOM   2898  C  CD  . GLU A 1 415 ? 147.221 90.612  186.978 1.00 117.75 ? 416 GLU A CD  1 
ATOM   2899  O  OE1 . GLU A 1 415 ? 146.425 91.341  186.359 1.00 117.71 ? 416 GLU A OE1 1 
ATOM   2900  O  OE2 . GLU A 1 415 ? 147.368 89.398  186.734 1.00 117.75 1 416 GLU A OE2 1 
ATOM   2901  N  N   . LEU A 1 416 ? 148.854 95.811  189.378 1.00 109.58 ? 417 LEU A N   1 
ATOM   2902  C  CA  . LEU A 1 416 ? 149.341 97.164  189.154 1.00 108.43 ? 417 LEU A CA  1 
ATOM   2903  C  C   . LEU A 1 416 ? 150.734 97.409  189.701 1.00 107.48 ? 417 LEU A C   1 
ATOM   2904  O  O   . LEU A 1 416 ? 151.435 98.307  189.246 1.00 107.40 ? 417 LEU A O   1 
ATOM   2905  C  CB  . LEU A 1 416 ? 148.401 98.175  189.789 1.00 108.28 ? 417 LEU A CB  1 
ATOM   2906  C  CG  . LEU A 1 416 ? 147.088 98.448  189.073 1.00 108.16 ? 417 LEU A CG  1 
ATOM   2907  C  CD1 . LEU A 1 416 ? 146.254 99.385  189.904 1.00 108.09 ? 417 LEU A CD1 1 
ATOM   2908  C  CD2 . LEU A 1 416 ? 147.350 99.045  187.726 1.00 108.11 ? 417 LEU A CD2 1 
ATOM   2909  N  N   . GLY A 1 417 ? 151.130 96.631  190.693 1.00 99.42  ? 418 GLY A N   1 
ATOM   2910  C  CA  . GLY A 1 417 ? 152.389 96.888  191.354 1.00 98.57  ? 418 GLY A CA  1 
ATOM   2911  C  C   . GLY A 1 417 ? 152.198 97.942  192.416 1.00 97.81  ? 418 GLY A C   1 
ATOM   2912  O  O   . GLY A 1 417 ? 152.875 98.961  192.438 1.00 97.73  ? 418 GLY A O   1 
ATOM   2913  N  N   . LEU A 1 418 ? 151.249 97.684  193.300 1.00 104.73 ? 419 LEU A N   1 
ATOM   2914  C  CA  . LEU A 1 418 ? 150.906 98.609  194.360 1.00 104.11 ? 419 LEU A CA  1 
ATOM   2915  C  C   . LEU A 1 418 ? 151.915 98.648  195.489 1.00 103.71 ? 419 LEU A C   1 
ATOM   2916  O  O   . LEU A 1 418 ? 152.593 97.668  195.766 1.00 103.70 ? 419 LEU A O   1 
ATOM   2917  C  CB  . LEU A 1 418 ? 149.554 98.233  194.928 1.00 103.96 ? 419 LEU A CB  1 
ATOM   2918  C  CG  . LEU A 1 418 ? 148.462 98.210  193.876 1.00 103.84 ? 419 LEU A CG  1 
ATOM   2919  C  CD1 . LEU A 1 418 ? 147.198 97.688  194.487 1.00 103.78 ? 419 LEU A CD1 1 
ATOM   2920  C  CD2 . LEU A 1 418 ? 148.263 99.603  193.330 1.00 103.81 ? 419 LEU A CD2 1 
ATOM   2921  N  N   . SER A 1 419 ? 151.996 99.793  196.147 1.00 106.93 ? 420 SER A N   1 
ATOM   2922  C  CA  . SER A 1 419 ? 152.786 99.921  197.352 1.00 106.51 ? 420 SER A CA  1 
ATOM   2923  C  C   . SER A 1 419 ? 151.945 100.619 198.394 1.00 105.97 ? 420 SER A C   1 
ATOM   2924  O  O   . SER A 1 419 ? 151.360 101.656 198.119 1.00 105.93 ? 420 SER A O   1 
ATOM   2925  C  CB  . SER A 1 419 ? 154.031 100.745 197.080 1.00 106.58 ? 420 SER A CB  1 
ATOM   2926  O  OG  . SER A 1 419 ? 153.698 102.110 196.951 1.00 106.62 ? 420 SER A OG  1 
ATOM   2927  N  N   . ALA A 1 420 ? 151.886 100.054 199.592 1.00 105.38 ? 421 ALA A N   1 
ATOM   2928  C  CA  . ALA A 1 420 ? 151.082 100.634 200.656 1.00 104.77 ? 421 ALA A CA  1 
ATOM   2929  C  C   . ALA A 1 420 ? 151.702 101.919 201.165 1.00 104.06 ? 421 ALA A C   1 
ATOM   2930  O  O   . ALA A 1 420 ? 152.848 101.931 201.589 1.00 104.01 ? 421 ALA A O   1 
ATOM   2931  C  CB  . ALA A 1 420 ? 150.937 99.656  201.777 1.00 104.82 ? 421 ALA A CB  1 
ATOM   2932  N  N   . PRO A 1 421 ? 150.931 103.007 201.129 1.00 97.85  ? 422 PRO A N   1 
ATOM   2933  C  CA  . PRO A 1 421 ? 151.381 104.336 201.520 1.00 97.31  ? 422 PRO A CA  1 
ATOM   2934  C  C   . PRO A 1 421 ? 151.372 104.528 203.017 1.00 96.67  ? 422 PRO A C   1 
ATOM   2935  O  O   . PRO A 1 421 ? 150.734 103.775 203.733 1.00 96.63  ? 422 PRO A O   1 
ATOM   2936  C  CB  . PRO A 1 421 ? 150.342 105.235 200.879 1.00 97.40  ? 422 PRO A CB  1 
ATOM   2937  C  CG  . PRO A 1 421 ? 149.115 104.441 200.952 1.00 97.52  ? 422 PRO A CG  1 
ATOM   2938  C  CD  . PRO A 1 421 ? 149.506 103.009 200.773 1.00 97.69  ? 422 PRO A CD  1 
ATOM   2939  N  N   . LEU A 1 422 ? 152.089 105.534 203.482 1.00 103.72 ? 423 LEU A N   1 
ATOM   2940  C  CA  . LEU A 1 422 ? 152.008 105.931 204.867 1.00 103.11 ? 423 LEU A CA  1 
ATOM   2941  C  C   . LEU A 1 422 ? 150.792 106.815 205.016 1.00 102.38 ? 423 LEU A C   1 
ATOM   2942  O  O   . LEU A 1 422 ? 150.592 107.718 204.224 1.00 102.28 ? 423 LEU A O   1 
ATOM   2943  C  CB  . LEU A 1 422 ? 153.257 106.709 205.237 1.00 103.22 ? 423 LEU A CB  1 
ATOM   2944  C  CG  . LEU A 1 422 ? 153.544 106.968 206.703 1.00 103.33 ? 423 LEU A CG  1 
ATOM   2945  C  CD1 . LEU A 1 422 ? 153.525 105.671 207.462 1.00 103.36 ? 423 LEU A CD1 1 
ATOM   2946  C  CD2 . LEU A 1 422 ? 154.892 107.625 206.805 1.00 103.37 ? 423 LEU A CD2 1 
ATOM   2947  N  N   . THR A 1 423 ? 149.977 106.551 206.027 1.00 98.94  ? 424 THR A N   1 
ATOM   2948  C  CA  . THR A 1 423 ? 148.776 107.336 206.265 1.00 98.32  ? 424 THR A CA  1 
ATOM   2949  C  C   . THR A 1 423 ? 149.037 108.409 207.296 1.00 97.91  ? 424 THR A C   1 
ATOM   2950  O  O   . THR A 1 423 ? 149.948 108.293 208.095 1.00 97.88  ? 424 THR A O   1 
ATOM   2951  C  CB  . THR A 1 423 ? 147.610 106.461 206.742 1.00 98.19  ? 424 THR A CB  1 
ATOM   2952  O  OG1 . THR A 1 423 ? 147.910 105.916 208.029 1.00 98.18  ? 424 THR A OG1 1 
ATOM   2953  C  CG2 . THR A 1 423 ? 147.360 105.326 205.770 1.00 98.13  ? 424 THR A CG2 1 
ATOM   2954  N  N   . VAL A 1 424 ? 148.234 109.460 207.276 1.00 91.18  ? 425 VAL A N   1 
ATOM   2955  C  CA  . VAL A 1 424 ? 148.337 110.500 208.284 1.00 90.98  ? 425 VAL A CA  1 
ATOM   2956  C  C   . VAL A 1 424 ? 146.967 110.880 208.827 1.00 91.47  ? 425 VAL A C   1 
ATOM   2957  O  O   . VAL A 1 424 ? 145.949 110.652 208.191 1.00 91.47  ? 425 VAL A O   1 
ATOM   2958  C  CB  . VAL A 1 424 ? 149.020 111.763 207.750 1.00 90.46  ? 425 VAL A CB  1 
ATOM   2959  C  CG1 . VAL A 1 424 ? 150.370 111.443 207.169 1.00 90.28  ? 425 VAL A CG1 1 
ATOM   2960  C  CG2 . VAL A 1 424 ? 148.160 112.425 206.718 1.00 90.31  ? 425 VAL A CG2 1 
ATOM   2961  N  N   . LEU A 1 425 ? 146.955 111.434 210.030 1.00 98.86  ? 426 LEU A N   1 
ATOM   2962  C  CA  . LEU A 1 425 ? 145.740 111.936 210.644 1.00 99.48  ? 426 LEU A CA  1 
ATOM   2963  C  C   . LEU A 1 425 ? 145.354 113.239 209.993 1.00 100.25 ? 426 LEU A C   1 
ATOM   2964  O  O   . LEU A 1 425 ? 146.206 113.963 209.524 1.00 100.40 ? 426 LEU A O   1 
ATOM   2965  C  CB  . LEU A 1 425 ? 145.978 112.183 212.124 1.00 99.42  ? 426 LEU A CB  1 
ATOM   2966  C  CG  . LEU A 1 425 ? 145.510 111.115 213.102 1.00 99.38  ? 426 LEU A CG  1 
ATOM   2967  C  CD1 . LEU A 1 425 ? 145.828 109.722 212.598 1.00 99.38  ? 426 LEU A CD1 1 
ATOM   2968  C  CD2 . LEU A 1 425 ? 146.149 111.375 214.454 1.00 99.38  ? 426 LEU A CD2 1 
ATOM   2969  N  N   . PRO A 1 426 ? 144.060 113.549 209.960 1.00 90.53  ? 427 PRO A N   1 
ATOM   2970  C  CA  . PRO A 1 426 ? 143.597 114.850 209.483 1.00 91.37  ? 427 PRO A CA  1 
ATOM   2971  C  C   . PRO A 1 426 ? 144.198 115.959 210.312 1.00 92.85  ? 427 PRO A C   1 
ATOM   2972  O  O   . PRO A 1 426 ? 144.416 117.060 209.836 1.00 92.93  ? 427 PRO A O   1 
ATOM   2973  C  CB  . PRO A 1 426 ? 142.088 114.784 209.688 1.00 90.94  ? 427 PRO A CB  1 
ATOM   2974  C  CG  . PRO A 1 426 ? 141.875 113.699 210.658 1.00 90.65  ? 427 PRO A CG  1 
ATOM   2975  C  CD  . PRO A 1 426 ? 142.940 112.704 210.392 1.00 90.50  ? 427 PRO A CD  1 
ATOM   2976  N  N   . THR A 1 427 ? 144.451 115.652 211.573 1.00 106.06 ? 428 THR A N   1 
ATOM   2977  C  CA  . THR A 1 427 ? 144.924 116.639 212.524 1.00 107.69 ? 428 THR A CA  1 
ATOM   2978  C  C   . THR A 1 427 ? 146.423 116.921 212.452 1.00 109.56 ? 428 THR A C   1 
ATOM   2979  O  O   . THR A 1 427 ? 146.915 117.823 213.114 1.00 109.69 ? 428 THR A O   1 
ATOM   2980  C  CB  . THR A 1 427 ? 144.524 116.249 213.946 1.00 107.55 ? 428 THR A CB  1 
ATOM   2981  O  OG1 . THR A 1 427 ? 144.840 114.873 214.163 1.00 107.52 ? 428 THR A OG1 1 
ATOM   2982  C  CG2 . THR A 1 427 ? 143.036 116.434 214.126 1.00 107.43 ? 428 THR A CG2 1 
ATOM   2983  N  N   . ILE A 1 428 ? 147.146 116.153 211.650 1.00 116.98 ? 429 ILE A N   1 
ATOM   2984  C  CA  . ILE A 1 428 ? 148.579 116.371 211.497 1.00 118.76 ? 429 ILE A CA  1 
ATOM   2985  C  C   . ILE A 1 428 ? 148.813 117.711 210.815 1.00 119.41 ? 429 ILE A C   1 
ATOM   2986  O  O   . ILE A 1 428 ? 147.939 118.201 210.121 1.00 119.46 ? 429 ILE A O   1 
ATOM   2987  C  CB  . ILE A 1 428 ? 149.238 115.230 210.697 1.00 119.67 ? 429 ILE A CB  1 
ATOM   2988  C  CG1 . ILE A 1 428 ? 150.756 115.266 210.831 1.00 120.27 ? 429 ILE A CG1 1 
ATOM   2989  C  CG2 . ILE A 1 428 ? 148.874 115.308 209.247 1.00 119.73 ? 429 ILE A CG2 1 
ATOM   2990  C  CD1 . ILE A 1 428 ? 151.433 114.175 210.057 1.00 120.58 ? 429 ILE A CD1 1 
ATOM   2991  N  N   . THR A 1 429 ? 149.954 118.340 211.065 1.00 113.44 ? 430 THR A N   1 
ATOM   2992  C  CA  . THR A 1 429 ? 150.244 119.637 210.461 1.00 113.91 ? 430 THR A CA  1 
ATOM   2993  C  C   . THR A 1 429 ? 151.048 119.548 209.157 1.00 114.07 ? 430 THR A C   1 
ATOM   2994  O  O   . THR A 1 429 ? 151.737 118.567 208.907 1.00 114.10 ? 430 THR A O   1 
ATOM   2995  C  CB  . THR A 1 429 ? 150.897 120.600 211.471 1.00 114.10 ? 430 THR A CB  1 
ATOM   2996  O  OG1 . THR A 1 429 ? 151.192 121.848 210.835 1.00 114.12 ? 430 THR A OG1 1 
ATOM   2997  C  CG2 . THR A 1 429 ? 152.162 120.014 212.027 1.00 114.17 ? 430 THR A CG2 1 
ATOM   2998  N  N   . CYS A 1 430 ? 150.952 120.587 208.334 1.00 116.90 ? 431 CYS A N   1 
ATOM   2999  C  CA  . CYS A 1 430 ? 151.449 120.547 206.961 1.00 116.93 ? 431 CYS A CA  1 
ATOM   3000  C  C   . CYS A 1 430 ? 152.940 120.326 206.791 1.00 116.80 ? 431 CYS A C   1 
ATOM   3001  O  O   . CYS A 1 430 ? 153.357 119.434 206.064 1.00 116.80 ? 431 CYS A O   1 
ATOM   3002  C  CB  . CYS A 1 430 ? 151.066 121.833 206.232 1.00 117.02 ? 431 CYS A CB  1 
ATOM   3003  S  SG  . CYS A 1 430 ? 149.363 121.904 205.666 1.00 117.06 ? 431 CYS A SG  1 
ATOM   3004  N  N   . GLY A 1 431 ? 153.747 121.130 207.464 1.00 97.52  ? 432 GLY A N   1 
ATOM   3005  C  CA  . GLY A 1 431 ? 155.180 121.055 207.268 1.00 97.36  ? 432 GLY A CA  1 
ATOM   3006  C  C   . GLY A 1 431 ? 155.705 119.757 207.828 1.00 97.21  ? 432 GLY A C   1 
ATOM   3007  O  O   . GLY A 1 431 ? 156.698 119.198 207.367 1.00 97.08  ? 432 GLY A O   1 
ATOM   3008  N  N   . HIS A 1 432 ? 155.002 119.269 208.831 1.00 121.11 ? 433 HIS A N   1 
ATOM   3009  C  CA  . HIS A 1 432 ? 155.348 118.026 209.463 1.00 120.98 ? 433 HIS A CA  1 
ATOM   3010  C  C   . HIS A 1 432 ? 155.185 116.918 208.450 1.00 119.68 ? 433 HIS A C   1 
ATOM   3011  O  O   . HIS A 1 432 ? 156.065 116.079 208.284 1.00 119.51 ? 433 HIS A O   1 
ATOM   3012  C  CB  . HIS A 1 432 ? 154.400 117.809 210.626 1.00 121.80 ? 433 HIS A CB  1 
ATOM   3013  C  CG  . HIS A 1 432 ? 154.871 116.799 211.616 1.00 122.60 ? 433 HIS A CG  1 
ATOM   3014  N  ND1 . HIS A 1 432 ? 154.598 115.457 211.489 1.00 122.93 ? 433 HIS A ND1 1 
ATOM   3015  C  CD2 . HIS A 1 432 ? 155.576 116.935 212.762 1.00 123.01 ? 433 HIS A CD2 1 
ATOM   3016  C  CE1 . HIS A 1 432 ? 155.130 114.805 212.506 1.00 123.17 ? 433 HIS A CE1 1 
ATOM   3017  N  NE2 . HIS A 1 432 ? 155.723 115.680 213.296 1.00 123.20 ? 433 HIS A NE2 1 
ATOM   3018  N  N   . THR A 1 433 ? 154.054 116.933 207.758 1.00 99.87  ? 434 THR A N   1 
ATOM   3019  C  CA  . THR A 1 433 ? 153.770 115.930 206.745 1.00 98.63  ? 434 THR A CA  1 
ATOM   3020  C  C   . THR A 1 433 ? 154.737 116.038 205.586 1.00 97.56  ? 434 THR A C   1 
ATOM   3021  O  O   . THR A 1 433 ? 155.119 115.046 204.985 1.00 97.41  ? 434 THR A O   1 
ATOM   3022  C  CB  . THR A 1 433 ? 152.342 116.073 206.216 1.00 98.51  ? 434 THR A CB  1 
ATOM   3023  O  OG1 . THR A 1 433 ? 151.431 116.131 207.317 1.00 98.50  ? 434 THR A OG1 1 
ATOM   3024  C  CG2 . THR A 1 433 ? 151.981 114.904 205.329 1.00 98.44  ? 434 THR A CG2 1 
ATOM   3025  N  N   . ILE A 1 434 ? 155.143 117.259 205.285 1.00 99.80  ? 435 ILE A N   1 
ATOM   3026  C  CA  . ILE A 1 434 ? 156.081 117.477 204.207 1.00 98.83  ? 435 ILE A CA  1 
ATOM   3027  C  C   . ILE A 1 434 ? 157.363 116.777 204.583 1.00 98.84  ? 435 ILE A C   1 
ATOM   3028  O  O   . ILE A 1 434 ? 157.934 116.033 203.791 1.00 98.81  ? 435 ILE A O   1 
ATOM   3029  C  CB  . ILE A 1 434 ? 156.314 118.981 203.994 1.00 98.06  ? 435 ILE A CB  1 
ATOM   3030  C  CG1 . ILE A 1 434 ? 155.273 119.543 203.033 1.00 97.63  ? 435 ILE A CG1 1 
ATOM   3031  C  CG2 . ILE A 1 434 ? 157.675 119.249 203.449 1.00 97.88  ? 435 ILE A CG2 1 
ATOM   3032  C  CD1 . ILE A 1 434 ? 155.087 121.017 203.149 1.00 97.39  ? 435 ILE A CD1 1 
ATOM   3033  N  N   . GLU A 1 435 ? 157.766 116.952 205.833 1.00 112.73 ? 436 GLU A N   1 
ATOM   3034  C  CA  . GLU A 1 435 ? 158.989 116.334 206.298 1.00 112.74 ? 436 GLU A CA  1 
ATOM   3035  C  C   . GLU A 1 435 ? 158.886 114.826 206.278 1.00 112.26 ? 436 GLU A C   1 
ATOM   3036  O  O   . GLU A 1 435 ? 159.808 114.157 205.833 1.00 112.33 ? 436 GLU A O   1 
ATOM   3037  C  CB  . GLU A 1 435 ? 159.332 116.824 207.701 1.00 113.12 ? 436 GLU A CB  1 
ATOM   3038  C  CG  . GLU A 1 435 ? 159.818 118.256 207.737 1.00 113.39 ? 436 GLU A CG  1 
ATOM   3039  C  CD  . GLU A 1 435 ? 159.997 118.784 209.142 1.00 113.53 ? 436 GLU A CD  1 
ATOM   3040  O  OE1 . GLU A 1 435 ? 160.008 117.972 210.085 1.00 113.57 ? 436 GLU A OE1 1 
ATOM   3041  O  OE2 . GLU A 1 435 ? 160.119 120.015 209.302 1.00 113.58 1 436 GLU A OE2 1 
ATOM   3042  N  N   . ILE A 1 436 ? 157.753 114.292 206.720 1.00 102.99 ? 437 ILE A N   1 
ATOM   3043  C  CA  . ILE A 1 436 ? 157.599 112.848 206.797 1.00 102.48 ? 437 ILE A CA  1 
ATOM   3044  C  C   . ILE A 1 436 ? 157.633 112.227 205.417 1.00 102.27 ? 437 ILE A C   1 
ATOM   3045  O  O   . ILE A 1 436 ? 158.318 111.233 205.181 1.00 102.24 ? 437 ILE A O   1 
ATOM   3046  C  CB  . ILE A 1 436 ? 156.274 112.456 207.450 1.00 102.28 ? 437 ILE A CB  1 
ATOM   3047  C  CG1 . ILE A 1 436 ? 156.180 112.996 208.873 1.00 102.23 ? 437 ILE A CG1 1 
ATOM   3048  C  CG2 . ILE A 1 436 ? 156.126 110.949 207.465 1.00 102.20 ? 437 ILE A CG2 1 
ATOM   3049  C  CD1 . ILE A 1 436 ? 156.794 112.094 209.908 1.00 102.16 ? 437 ILE A CD1 1 
ATOM   3050  N  N   . LEU A 1 437 ? 156.905 112.838 204.496 1.00 98.77  ? 438 LEU A N   1 
ATOM   3051  C  CA  . LEU A 1 437 ? 156.808 112.312 203.149 1.00 98.70  ? 438 LEU A CA  1 
ATOM   3052  C  C   . LEU A 1 437 ? 158.130 112.399 202.424 1.00 99.70  ? 438 LEU A C   1 
ATOM   3053  O  O   . LEU A 1 437 ? 158.514 111.475 201.715 1.00 99.83  ? 438 LEU A O   1 
ATOM   3054  C  CB  . LEU A 1 437 ? 155.742 113.061 202.358 1.00 97.95  ? 438 LEU A CB  1 
ATOM   3055  C  CG  . LEU A 1 437 ? 154.285 112.716 202.640 1.00 97.34  ? 438 LEU A CG  1 
ATOM   3056  C  CD1 . LEU A 1 437 ? 153.370 113.589 201.813 1.00 97.11  ? 438 LEU A CD1 1 
ATOM   3057  C  CD2 . LEU A 1 437 ? 154.034 111.270 202.345 1.00 97.17  ? 438 LEU A CD2 1 
ATOM   3058  N  N   . ARG A 1 438 ? 158.840 113.503 202.603 1.00 100.25 ? 439 ARG A N   1 
ATOM   3059  C  CA  . ARG A 1 438 ? 160.128 113.621 201.953 1.00 101.35 ? 439 ARG A CA  1 
ATOM   3060  C  C   . ARG A 1 438 ? 161.108 112.624 202.540 1.00 103.75 ? 439 ARG A C   1 
ATOM   3061  O  O   . ARG A 1 438 ? 161.882 112.005 201.822 1.00 103.93 ? 439 ARG A O   1 
ATOM   3062  C  CB  . ARG A 1 438 ? 160.669 115.036 202.084 1.00 100.26 ? 439 ARG A CB  1 
ATOM   3063  C  CG  . ARG A 1 438 ? 159.863 116.064 201.347 1.00 99.34  ? 439 ARG A CG  1 
ATOM   3064  C  CD  . ARG A 1 438 ? 160.098 117.429 201.927 1.00 98.64  ? 439 ARG A CD  1 
ATOM   3065  N  NE  . ARG A 1 438 ? 161.228 118.121 201.335 1.00 98.05  ? 439 ARG A NE  1 
ATOM   3066  C  CZ  . ARG A 1 438 ? 161.130 118.955 200.312 1.00 97.49  ? 439 ARG A CZ  1 
ATOM   3067  N  NH1 . ARG A 1 438 ? 159.954 119.192 199.759 1.00 97.27  1 439 ARG A NH1 1 
ATOM   3068  N  NH2 . ARG A 1 438 ? 162.212 119.548 199.837 1.00 97.30  ? 439 ARG A NH2 1 
ATOM   3069  N  N   . GLU A 1 439 ? 161.048 112.452 203.852 1.00 136.09 ? 440 GLU A N   1 
ATOM   3070  C  CA  . GLU A 1 439 ? 161.967 111.559 204.535 1.00 138.38 ? 440 GLU A CA  1 
ATOM   3071  C  C   . GLU A 1 439 ? 161.734 110.118 204.115 1.00 139.01 ? 440 GLU A C   1 
ATOM   3072  O  O   . GLU A 1 439 ? 162.660 109.314 204.086 1.00 139.13 ? 440 GLU A O   1 
ATOM   3073  C  CB  . GLU A 1 439 ? 161.823 111.706 206.050 1.00 139.58 ? 440 GLU A CB  1 
ATOM   3074  C  CG  . GLU A 1 439 ? 163.055 111.301 206.849 1.00 140.43 ? 440 GLU A CG  1 
ATOM   3075  C  CD  . GLU A 1 439 ? 163.068 111.881 208.261 1.00 140.86 ? 440 GLU A CD  1 
ATOM   3076  O  OE1 . GLU A 1 439 ? 161.983 112.061 208.852 1.00 141.01 ? 440 GLU A OE1 1 
ATOM   3077  O  OE2 . GLU A 1 439 ? 164.170 112.163 208.780 1.00 141.02 1 440 GLU A OE2 1 
ATOM   3078  N  N   . LYS A 1 440 ? 160.488 109.795 203.795 1.00 110.72 ? 441 LYS A N   1 
ATOM   3079  C  CA  . LYS A 1 440 ? 160.154 108.452 203.343 1.00 111.07 ? 441 LYS A CA  1 
ATOM   3080  C  C   . LYS A 1 440 ? 160.227 108.284 201.832 1.00 110.64 ? 441 LYS A C   1 
ATOM   3081  O  O   . LYS A 1 440 ? 160.097 107.178 201.321 1.00 110.65 ? 441 LYS A O   1 
ATOM   3082  C  CB  . LYS A 1 440 ? 158.776 108.049 203.850 1.00 111.57 ? 441 LYS A CB  1 
ATOM   3083  C  CG  . LYS A 1 440 ? 158.704 107.834 205.345 1.00 111.92 ? 441 LYS A CG  1 
ATOM   3084  C  CD  . LYS A 1 440 ? 159.187 106.450 205.733 1.00 112.18 ? 441 LYS A CD  1 
ATOM   3085  C  CE  . LYS A 1 440 ? 160.136 106.502 206.915 1.00 112.36 ? 441 LYS A CE  1 
ATOM   3086  N  NZ  . LYS A 1 440 ? 160.536 105.145 207.369 1.00 112.46 1 441 LYS A NZ  1 
ATOM   3087  N  N   . GLY A 1 441 ? 160.422 109.383 201.116 1.00 118.01 ? 442 GLY A N   1 
ATOM   3088  C  CA  . GLY A 1 441 ? 160.525 109.320 199.670 1.00 117.45 ? 442 GLY A CA  1 
ATOM   3089  C  C   . GLY A 1 441 ? 159.178 109.203 198.988 1.00 116.80 ? 442 GLY A C   1 
ATOM   3090  O  O   . GLY A 1 441 ? 159.094 108.920 197.799 1.00 116.77 ? 442 GLY A O   1 
ATOM   3091  N  N   . PHE A 1 442 ? 158.119 109.394 199.759 1.00 120.31 ? 443 PHE A N   1 
ATOM   3092  C  CA  . PHE A 1 442 ? 156.761 109.364 199.238 1.00 119.59 ? 443 PHE A CA  1 
ATOM   3093  C  C   . PHE A 1 442 ? 156.301 110.711 198.708 1.00 118.54 ? 443 PHE A C   1 
ATOM   3094  O  O   . PHE A 1 442 ? 156.807 111.748 199.112 1.00 118.41 ? 443 PHE A O   1 
ATOM   3095  C  CB  . PHE A 1 442 ? 155.802 108.871 200.310 1.00 119.80 ? 443 PHE A CB  1 
ATOM   3096  C  CG  . PHE A 1 442 ? 155.818 107.389 200.494 1.00 120.01 ? 443 PHE A CG  1 
ATOM   3097  C  CD1 . PHE A 1 442 ? 154.785 106.614 200.012 1.00 120.08 ? 443 PHE A CD1 1 
ATOM   3098  C  CD2 . PHE A 1 442 ? 156.864 106.769 201.140 1.00 120.12 ? 443 PHE A CD2 1 
ATOM   3099  C  CE1 . PHE A 1 442 ? 154.795 105.252 200.175 1.00 120.11 ? 443 PHE A CE1 1 
ATOM   3100  C  CE2 . PHE A 1 442 ? 156.876 105.410 201.305 1.00 120.17 ? 443 PHE A CE2 1 
ATOM   3101  C  CZ  . PHE A 1 442 ? 155.842 104.649 200.822 1.00 120.16 ? 443 PHE A CZ  1 
ATOM   3102  N  N   . ASN A 1 443 ? 155.346 110.684 197.789 1.00 105.15 ? 444 ASN A N   1 
ATOM   3103  C  CA  . ASN A 1 443 ? 154.817 111.906 197.209 1.00 104.12 ? 444 ASN A CA  1 
ATOM   3104  C  C   . ASN A 1 443 ? 153.413 112.257 197.672 1.00 102.80 ? 444 ASN A C   1 
ATOM   3105  O  O   . ASN A 1 443 ? 152.931 113.348 197.417 1.00 102.73 ? 444 ASN A O   1 
ATOM   3106  C  CB  . ASN A 1 443 ? 154.851 111.812 195.690 1.00 104.29 ? 444 ASN A CB  1 
ATOM   3107  C  CG  . ASN A 1 443 ? 154.159 110.575 195.173 1.00 104.42 ? 444 ASN A CG  1 
ATOM   3108  O  OD1 . ASN A 1 443 ? 153.985 109.601 195.900 1.00 104.43 ? 444 ASN A OD1 1 
ATOM   3109  N  ND2 . ASN A 1 443 ? 153.762 110.603 193.908 1.00 104.46 ? 444 ASN A ND2 1 
ATOM   3110  N  N   . GLN A 1 444 ? 152.763 111.332 198.365 1.00 116.59 ? 445 GLN A N   1 
ATOM   3111  C  CA  . GLN A 1 444 ? 151.384 111.534 198.781 1.00 115.15 ? 445 GLN A CA  1 
ATOM   3112  C  C   . GLN A 1 444 ? 150.995 110.613 199.917 1.00 112.79 ? 445 GLN A C   1 
ATOM   3113  O  O   . GLN A 1 444 ? 151.587 109.559 200.096 1.00 112.66 ? 445 GLN A O   1 
ATOM   3114  C  CB  . GLN A 1 444 ? 150.459 111.272 197.611 1.00 115.87 ? 445 GLN A CB  1 
ATOM   3115  C  CG  . GLN A 1 444 ? 150.509 109.847 197.130 1.00 116.41 ? 445 GLN A CG  1 
ATOM   3116  C  CD  . GLN A 1 444 ? 149.776 109.658 195.835 1.00 116.72 ? 445 GLN A CD  1 
ATOM   3117  O  OE1 . GLN A 1 444 ? 149.343 110.620 195.212 1.00 116.67 ? 445 GLN A OE1 1 
ATOM   3118  N  NE2 . GLN A 1 444 ? 149.630 108.414 195.418 1.00 116.78 ? 445 GLN A NE2 1 
ATOM   3119  N  N   . ALA A 1 445 ? 149.986 111.013 200.679 1.00 99.07  ? 446 ALA A N   1 
ATOM   3120  C  CA  . ALA A 1 445 ? 149.516 110.210 201.794 1.00 96.78  ? 446 ALA A CA  1 
ATOM   3121  C  C   . ALA A 1 445 ? 148.016 110.297 201.933 1.00 94.83  ? 446 ALA A C   1 
ATOM   3122  O  O   . ALA A 1 445 ? 147.460 111.389 201.961 1.00 94.60  ? 446 ALA A O   1 
ATOM   3123  C  CB  . ALA A 1 445 ? 150.168 110.666 203.058 1.00 96.68  ? 446 ALA A CB  1 
ATOM   3124  N  N   . PRO A 1 446 ? 147.345 109.142 201.988 1.00 73.31  ? 447 PRO A N   1 
ATOM   3125  C  CA  . PRO A 1 446 ? 145.931 109.155 202.332 1.00 72.75  ? 447 PRO A CA  1 
ATOM   3126  C  C   . PRO A 1 446 ? 145.726 109.681 203.730 1.00 73.17  ? 447 PRO A C   1 
ATOM   3127  O  O   . PRO A 1 446 ? 146.524 109.410 204.606 1.00 73.13  ? 447 PRO A O   1 
ATOM   3128  C  CB  . PRO A 1 446 ? 145.537 107.685 202.246 1.00 72.18  ? 447 PRO A CB  1 
ATOM   3129  C  CG  . PRO A 1 446 ? 146.783 106.939 202.255 1.00 72.07  ? 447 PRO A CG  1 
ATOM   3130  C  CD  . PRO A 1 446 ? 147.805 107.798 201.636 1.00 72.47  ? 447 PRO A CD  1 
ATOM   3131  N  N   . VAL A 1 447 ? 144.656 110.431 203.930 1.00 89.91  ? 448 VAL A N   1 
ATOM   3132  C  CA  . VAL A 1 447 ? 144.321 110.931 205.244 1.00 90.67  ? 448 VAL A CA  1 
ATOM   3133  C  C   . VAL A 1 447 ? 143.247 110.069 205.859 1.00 91.90  ? 448 VAL A C   1 
ATOM   3134  O  O   . VAL A 1 447 ? 142.099 110.059 205.405 1.00 91.97  ? 448 VAL A O   1 
ATOM   3135  C  CB  . VAL A 1 447 ? 143.829 112.358 205.191 1.00 90.37  ? 448 VAL A CB  1 
ATOM   3136  C  CG1 . VAL A 1 447 ? 143.303 112.763 206.536 1.00 90.27  ? 448 VAL A CG1 1 
ATOM   3137  C  CG2 . VAL A 1 447 ? 144.946 113.275 204.766 1.00 90.25  ? 448 VAL A CG2 1 
ATOM   3138  N  N   . VAL A 1 448 ? 143.645 109.334 206.889 1.00 103.74 ? 449 VAL A N   1 
ATOM   3139  C  CA  . VAL A 1 448 ? 142.767 108.417 207.591 1.00 104.95 ? 449 VAL A CA  1 
ATOM   3140  C  C   . VAL A 1 448 ? 142.583 108.854 209.042 1.00 105.79 ? 449 VAL A C   1 
ATOM   3141  O  O   . VAL A 1 448 ? 143.492 109.390 209.668 1.00 105.87 ? 449 VAL A O   1 
ATOM   3142  C  CB  . VAL A 1 448 ? 143.309 106.984 207.522 1.00 105.25 ? 449 VAL A CB  1 
ATOM   3143  C  CG1 . VAL A 1 448 ? 142.290 106.001 208.038 1.00 105.37 ? 449 VAL A CG1 1 
ATOM   3144  C  CG2 . VAL A 1 448 ? 143.673 106.638 206.097 1.00 105.31 ? 449 VAL A CG2 1 
ATOM   3145  N  N   . ASP A 1 449 ? 141.385 108.614 209.553 1.00 122.84 ? 450 ASP A N   1 
ATOM   3146  C  CA  . ASP A 1 449 ? 140.934 109.065 210.861 1.00 123.47 ? 450 ASP A CA  1 
ATOM   3147  C  C   . ASP A 1 449 ? 141.539 108.268 211.997 1.00 123.32 ? 450 ASP A C   1 
ATOM   3148  O  O   . ASP A 1 449 ? 142.046 107.176 211.781 1.00 123.37 ? 450 ASP A O   1 
ATOM   3149  C  CB  . ASP A 1 449 ? 139.425 108.911 210.915 1.00 123.89 ? 450 ASP A CB  1 
ATOM   3150  C  CG  . ASP A 1 449 ? 138.783 109.798 211.930 1.00 124.17 ? 450 ASP A CG  1 
ATOM   3151  O  OD1 . ASP A 1 449 ? 139.309 110.895 212.167 1.00 124.28 ? 450 ASP A OD1 1 
ATOM   3152  O  OD2 . ASP A 1 449 ? 137.742 109.401 212.488 1.00 124.27 1 450 ASP A OD2 1 
ATOM   3153  N  N   . GLU A 1 450 ? 141.479 108.811 213.210 1.00 103.76 ? 451 GLU A N   1 
ATOM   3154  C  CA  . GLU A 1 450 ? 141.882 108.067 214.395 1.00 103.39 ? 451 GLU A CA  1 
ATOM   3155  C  C   . GLU A 1 450 ? 141.048 106.807 214.492 1.00 102.43 ? 451 GLU A C   1 
ATOM   3156  O  O   . GLU A 1 450 ? 141.505 105.787 214.984 1.00 102.38 ? 451 GLU A O   1 
ATOM   3157  C  CB  . GLU A 1 450 ? 141.639 108.886 215.659 1.00 103.79 ? 451 GLU A CB  1 
ATOM   3158  C  CG  . GLU A 1 450 ? 142.778 109.765 216.107 1.00 104.07 ? 451 GLU A CG  1 
ATOM   3159  C  CD  . GLU A 1 450 ? 142.433 110.562 217.353 1.00 104.21 ? 451 GLU A CD  1 
ATOM   3160  O  OE1 . GLU A 1 450 ? 141.236 110.647 217.689 1.00 104.25 ? 451 GLU A OE1 1 
ATOM   3161  O  OE2 . GLU A 1 450 ? 143.356 111.103 217.997 1.00 104.26 1 451 GLU A OE2 1 
ATOM   3162  N  N   . ALA A 1 451 ? 139.822 106.884 214.005 1.00 82.15  ? 452 ALA A N   1 
ATOM   3163  C  CA  . ALA A 1 451 ? 138.921 105.751 214.020 1.00 81.23  ? 452 ALA A CA  1 
ATOM   3164  C  C   . ALA A 1 451 ? 139.149 104.860 212.822 1.00 80.67  ? 452 ALA A C   1 
ATOM   3165  O  O   . ALA A 1 451 ? 138.508 103.832 212.671 1.00 80.61  ? 452 ALA A O   1 
ATOM   3166  C  CB  . ALA A 1 451 ? 137.506 106.227 214.043 1.00 81.04  ? 452 ALA A CB  1 
ATOM   3167  N  N   . GLY A 1 452 ? 140.054 105.273 211.954 1.00 102.82 ? 453 GLY A N   1 
ATOM   3168  C  CA  . GLY A 1 452 ? 140.393 104.470 210.803 1.00 102.42 ? 453 GLY A CA  1 
ATOM   3169  C  C   . GLY A 1 452 ? 139.481 104.604 209.605 1.00 102.09 ? 453 GLY A C   1 
ATOM   3170  O  O   . GLY A 1 452 ? 139.580 103.823 208.670 1.00 102.06 ? 453 GLY A O   1 
ATOM   3171  N  N   . VAL A 1 453 ? 138.574 105.569 209.627 1.00 96.78  ? 454 VAL A N   1 
ATOM   3172  C  CA  . VAL A 1 453 ? 137.830 105.878 208.419 1.00 96.54  ? 454 VAL A CA  1 
ATOM   3173  C  C   . VAL A 1 453 ? 138.667 106.783 207.528 1.00 96.45  ? 454 VAL A C   1 
ATOM   3174  O  O   . VAL A 1 453 ? 139.277 107.734 208.002 1.00 96.51  ? 454 VAL A O   1 
ATOM   3175  C  CB  . VAL A 1 453 ? 136.456 106.510 208.718 1.00 96.44  ? 454 VAL A CB  1 
ATOM   3176  C  CG1 . VAL A 1 453 ? 136.566 107.605 209.735 1.00 96.46  ? 454 VAL A CG1 1 
ATOM   3177  C  CG2 . VAL A 1 453 ? 135.824 107.034 207.450 1.00 96.38  ? 454 VAL A CG2 1 
ATOM   3178  N  N   . ILE A 1 454 ? 138.713 106.477 206.238 1.00 93.50  ? 455 ILE A N   1 
ATOM   3179  C  CA  . ILE A 1 454 ? 139.506 107.276 205.322 1.00 93.43  ? 455 ILE A CA  1 
ATOM   3180  C  C   . ILE A 1 454 ? 138.793 108.571 205.025 1.00 93.86  ? 455 ILE A C   1 
ATOM   3181  O  O   . ILE A 1 454 ? 137.648 108.570 204.607 1.00 93.88  ? 455 ILE A O   1 
ATOM   3182  C  CB  . ILE A 1 454 ? 139.773 106.551 204.011 1.00 93.05  ? 455 ILE A CB  1 
ATOM   3183  C  CG1 . ILE A 1 454 ? 140.488 105.234 204.264 1.00 92.86  ? 455 ILE A CG1 1 
ATOM   3184  C  CG2 . ILE A 1 454 ? 140.621 107.403 203.125 1.00 92.94  ? 455 ILE A CG2 1 
ATOM   3185  C  CD1 . ILE A 1 454 ? 139.591 104.041 204.198 1.00 92.78  ? 455 ILE A CD1 1 
ATOM   3186  N  N   . LEU A 1 455 ? 139.479 109.679 205.256 1.00 105.18 ? 456 LEU A N   1 
ATOM   3187  C  CA  . LEU A 1 455 ? 138.881 110.982 205.053 1.00 105.56 ? 456 LEU A CA  1 
ATOM   3188  C  C   . LEU A 1 455 ? 139.261 111.578 203.721 1.00 105.31 ? 456 LEU A C   1 
ATOM   3189  O  O   . LEU A 1 455 ? 138.521 112.372 203.158 1.00 105.32 ? 456 LEU A O   1 
ATOM   3190  C  CB  . LEU A 1 455 ? 139.281 111.934 206.166 1.00 106.00 ? 456 LEU A CB  1 
ATOM   3191  C  CG  . LEU A 1 455 ? 138.890 111.491 207.566 1.00 106.36 ? 456 LEU A CG  1 
ATOM   3192  C  CD1 . LEU A 1 455 ? 139.042 112.637 208.533 1.00 106.50 ? 456 LEU A CD1 1 
ATOM   3193  C  CD2 . LEU A 1 455 ? 137.479 110.973 207.571 1.00 106.46 ? 456 LEU A CD2 1 
ATOM   3194  N  N   . GLY A 1 456 ? 140.423 111.208 203.211 1.00 90.80  ? 457 GLY A N   1 
ATOM   3195  C  CA  . GLY A 1 456 ? 140.816 111.744 201.928 1.00 90.45  ? 457 GLY A CA  1 
ATOM   3196  C  C   . GLY A 1 456 ? 142.244 111.508 201.520 1.00 90.05  ? 457 GLY A C   1 
ATOM   3197  O  O   . GLY A 1 456 ? 142.794 110.444 201.737 1.00 90.04  ? 457 GLY A O   1 
ATOM   3198  N  N   . MET A 1 457 ? 142.843 112.518 200.911 1.00 96.79  ? 458 MET A N   1 
ATOM   3199  C  CA  . MET A 1 457 ? 144.170 112.379 200.353 1.00 96.30  ? 458 MET A CA  1 
ATOM   3200  C  C   . MET A 1 457 ? 144.884 113.704 200.372 1.00 95.49  ? 458 MET A C   1 
ATOM   3201  O  O   . MET A 1 457 ? 144.265 114.746 200.240 1.00 95.40  ? 458 MET A O   1 
ATOM   3202  C  CB  . MET A 1 457 ? 144.063 111.890 198.918 1.00 96.51  ? 458 MET A CB  1 
ATOM   3203  C  CG  . MET A 1 457 ? 145.341 111.352 198.341 1.00 96.65  ? 458 MET A CG  1 
ATOM   3204  S  SD  . MET A 1 457 ? 145.628 109.655 198.809 1.00 96.78  ? 458 MET A SD  1 
ATOM   3205  C  CE  . MET A 1 457 ? 143.947 109.147 199.031 1.00 96.87  ? 458 MET A CE  1 
ATOM   3206  N  N   . VAL A 1 458 ? 146.197 113.662 200.538 1.00 94.02  ? 459 VAL A N   1 
ATOM   3207  C  CA  . VAL A 1 458 ? 146.994 114.875 200.465 1.00 93.24  ? 459 VAL A CA  1 
ATOM   3208  C  C   . VAL A 1 458 ? 148.278 114.614 199.703 1.00 92.31  ? 459 VAL A C   1 
ATOM   3209  O  O   . VAL A 1 458 ? 148.904 113.583 199.879 1.00 92.38  ? 459 VAL A O   1 
ATOM   3210  C  CB  . VAL A 1 458 ? 147.314 115.427 201.862 1.00 93.40  ? 459 VAL A CB  1 
ATOM   3211  C  CG1 . VAL A 1 458 ? 148.337 116.509 201.768 1.00 93.48  ? 459 VAL A CG1 1 
ATOM   3212  C  CG2 . VAL A 1 458 ? 146.074 115.979 202.506 1.00 93.44  ? 459 VAL A CG2 1 
ATOM   3213  N  N   . THR A 1 459 ? 148.656 115.549 198.842 1.00 76.07  ? 460 THR A N   1 
ATOM   3214  C  CA  . THR A 1 459 ? 149.844 115.393 198.028 1.00 75.27  ? 460 THR A CA  1 
ATOM   3215  C  C   . THR A 1 459 ? 150.876 116.442 198.354 1.00 75.05  ? 460 THR A C   1 
ATOM   3216  O  O   . THR A 1 459 ? 150.550 117.556 198.733 1.00 75.05  ? 460 THR A O   1 
ATOM   3217  C  CB  . THR A 1 459 ? 149.528 115.472 196.541 1.00 74.90  ? 460 THR A CB  1 
ATOM   3218  O  OG1 . THR A 1 459 ? 149.030 116.770 196.229 1.00 74.87  ? 460 THR A OG1 1 
ATOM   3219  C  CG2 . THR A 1 459 ? 148.499 114.448 196.166 1.00 74.73  ? 460 THR A CG2 1 
ATOM   3220  N  N   . LEU A 1 460 ? 152.133 116.069 198.201 1.00 78.97  ? 461 LEU A N   1 
ATOM   3221  C  CA  . LEU A 1 460 ? 153.224 116.950 198.535 1.00 78.93  ? 461 LEU A CA  1 
ATOM   3222  C  C   . LEU A 1 460 ? 153.209 118.192 197.670 1.00 79.72  ? 461 LEU A C   1 
ATOM   3223  O  O   . LEU A 1 460 ? 153.417 119.295 198.155 1.00 79.85  ? 461 LEU A O   1 
ATOM   3224  C  CB  . LEU A 1 460 ? 154.530 116.199 198.348 1.00 78.35  ? 461 LEU A CB  1 
ATOM   3225  C  CG  . LEU A 1 460 ? 155.818 116.997 198.383 1.00 77.91  ? 461 LEU A CG  1 
ATOM   3226  C  CD1 . LEU A 1 460 ? 156.088 117.465 199.777 1.00 77.79  ? 461 LEU A CD1 1 
ATOM   3227  C  CD2 . LEU A 1 460 ? 156.945 116.137 197.880 1.00 77.76  ? 461 LEU A CD2 1 
ATOM   3228  N  N   . GLY A 1 461 ? 152.901 118.022 196.395 1.00 83.07  ? 462 GLY A N   1 
ATOM   3229  C  CA  . GLY A 1 461 ? 152.976 119.126 195.462 1.00 83.99  ? 462 GLY A CA  1 
ATOM   3230  C  C   . GLY A 1 461 ? 151.925 120.177 195.702 1.00 85.02  ? 462 GLY A C   1 
ATOM   3231  O  O   . GLY A 1 461 ? 152.172 121.366 195.553 1.00 85.09  ? 462 GLY A O   1 
ATOM   3232  N  N   . ASN A 1 462 ? 150.741 119.731 196.082 1.00 92.31  ? 463 ASN A N   1 
ATOM   3233  C  CA  . ASN A 1 462 ? 149.669 120.647 196.409 1.00 93.41  ? 463 ASN A CA  1 
ATOM   3234  C  C   . ASN A 1 462 ? 149.987 121.436 197.655 1.00 94.52  ? 463 ASN A C   1 
ATOM   3235  O  O   . ASN A 1 462 ? 149.604 122.590 197.791 1.00 94.65  ? 463 ASN A O   1 
ATOM   3236  C  CB  . ASN A 1 462 ? 148.373 119.881 196.613 1.00 93.38  ? 463 ASN A CB  1 
ATOM   3237  C  CG  . ASN A 1 462 ? 147.180 120.786 196.729 1.00 93.40  ? 463 ASN A CG  1 
ATOM   3238  O  OD1 . ASN A 1 462 ? 147.076 121.785 196.034 1.00 93.41  ? 463 ASN A OD1 1 
ATOM   3239  N  ND2 . ASN A 1 462 ? 146.272 120.444 197.616 1.00 93.43  ? 463 ASN A ND2 1 
ATOM   3240  N  N   . MET A 1 463 ? 150.702 120.798 198.568 1.00 102.22 ? 464 MET A N   1 
ATOM   3241  C  CA  . MET A 1 463 ? 151.078 121.443 199.805 1.00 103.27 ? 464 MET A CA  1 
ATOM   3242  C  C   . MET A 1 463 ? 152.107 122.503 199.524 1.00 103.89 ? 464 MET A C   1 
ATOM   3243  O  O   . MET A 1 463 ? 152.003 123.625 199.999 1.00 103.96 ? 464 MET A O   1 
ATOM   3244  C  CB  . MET A 1 463 ? 151.676 120.425 200.763 1.00 103.61 ? 464 MET A CB  1 
ATOM   3245  C  CG  . MET A 1 463 ? 150.690 119.670 201.605 1.00 103.84 ? 464 MET A CG  1 
ATOM   3246  S  SD  . MET A 1 463 ? 151.553 118.487 202.629 1.00 104.13 ? 464 MET A SD  1 
ATOM   3247  C  CE  . MET A 1 463 ? 150.362 118.261 203.927 1.00 104.28 ? 464 MET A CE  1 
ATOM   3248  N  N   . LEU A 1 464 ? 153.108 122.140 198.742 1.00 97.17  ? 465 LEU A N   1 
ATOM   3249  C  CA  . LEU A 1 464 ? 154.166 123.076 198.448 1.00 97.67  ? 465 LEU A CA  1 
ATOM   3250  C  C   . LEU A 1 464 ? 153.595 124.251 197.694 1.00 97.84  ? 465 LEU A C   1 
ATOM   3251  O  O   . LEU A 1 464 ? 153.956 125.396 197.943 1.00 97.88  ? 465 LEU A O   1 
ATOM   3252  C  CB  . LEU A 1 464 ? 155.253 122.405 197.614 1.00 97.89  ? 465 LEU A CB  1 
ATOM   3253  C  CG  . LEU A 1 464 ? 155.980 121.223 198.249 1.00 98.04  ? 465 LEU A CG  1 
ATOM   3254  C  CD1 . LEU A 1 464 ? 157.024 120.665 197.307 1.00 98.10  ? 465 LEU A CD1 1 
ATOM   3255  C  CD2 . LEU A 1 464 ? 156.612 121.642 199.551 1.00 98.09  ? 465 LEU A CD2 1 
ATOM   3256  N  N   . SER A 1 465 ? 152.670 123.968 196.790 1.00 105.56 ? 466 SER A N   1 
ATOM   3257  C  CA  . SER A 1 465 ? 152.094 125.024 195.983 1.00 105.61 ? 466 SER A CA  1 
ATOM   3258  C  C   . SER A 1 465 ? 151.257 125.943 196.834 1.00 105.44 ? 466 SER A C   1 
ATOM   3259  O  O   . SER A 1 465 ? 151.265 127.153 196.652 1.00 105.44 ? 466 SER A O   1 
ATOM   3260  C  CB  . SER A 1 465 ? 151.233 124.442 194.874 1.00 105.71 ? 466 SER A CB  1 
ATOM   3261  O  OG  . SER A 1 465 ? 150.517 125.472 194.219 1.00 105.70 ? 466 SER A OG  1 
ATOM   3262  N  N   . SER A 1 466 ? 150.524 125.356 197.764 1.00 91.70  ? 467 SER A N   1 
ATOM   3263  C  CA  . SER A 1 466 ? 149.674 126.139 198.629 1.00 91.45  ? 467 SER A CA  1 
ATOM   3264  C  C   . SER A 1 466 ? 150.501 127.011 199.543 1.00 91.12  ? 467 SER A C   1 
ATOM   3265  O  O   . SER A 1 466 ? 150.106 128.115 199.887 1.00 91.14  ? 467 SER A O   1 
ATOM   3266  C  CB  . SER A 1 466 ? 148.781 125.221 199.441 1.00 91.48  ? 467 SER A CB  1 
ATOM   3267  O  OG  . SER A 1 466 ? 148.010 124.406 198.589 1.00 91.49  ? 467 SER A OG  1 
ATOM   3268  N  N   . LEU A 1 467 ? 151.665 126.511 199.924 1.00 93.50  ? 468 LEU A N   1 
ATOM   3269  C  CA  . LEU A 1 467 ? 152.519 127.235 200.841 1.00 93.18  ? 468 LEU A CA  1 
ATOM   3270  C  C   . LEU A 1 467 ? 153.173 128.388 200.140 1.00 93.21  ? 468 LEU A C   1 
ATOM   3271  O  O   . LEU A 1 467 ? 153.197 129.499 200.642 1.00 93.18  ? 468 LEU A O   1 
ATOM   3272  C  CB  . LEU A 1 467 ? 153.601 126.320 201.381 1.00 92.97  ? 468 LEU A CB  1 
ATOM   3273  C  CG  . LEU A 1 467 ? 153.229 125.438 202.558 1.00 92.83  ? 468 LEU A CG  1 
ATOM   3274  C  CD1 . LEU A 1 467 ? 154.377 124.519 202.857 1.00 92.75  ? 468 LEU A CD1 1 
ATOM   3275  C  CD2 . LEU A 1 467 ? 152.907 126.293 203.757 1.00 92.87  ? 468 LEU A CD2 1 
ATOM   3276  N  N   . LEU A 1 468 ? 153.696 128.113 198.959 1.00 87.24  ? 469 LEU A N   1 
ATOM   3277  C  CA  . LEU A 1 468 ? 154.430 129.108 198.208 1.00 87.33  ? 469 LEU A CA  1 
ATOM   3278  C  C   . LEU A 1 468 ? 153.511 130.248 197.813 1.00 88.61  ? 469 LEU A C   1 
ATOM   3279  O  O   . LEU A 1 468 ? 153.946 131.371 197.619 1.00 88.68  ? 469 LEU A O   1 
ATOM   3280  C  CB  . LEU A 1 468 ? 155.052 128.459 196.978 1.00 86.41  ? 469 LEU A CB  1 
ATOM   3281  C  CG  . LEU A 1 468 ? 155.918 129.304 196.052 1.00 85.65  ? 469 LEU A CG  1 
ATOM   3282  C  CD1 . LEU A 1 468 ? 157.054 129.936 196.805 1.00 85.41  ? 469 LEU A CD1 1 
ATOM   3283  C  CD2 . LEU A 1 468 ? 156.452 128.438 194.938 1.00 85.40  ? 469 LEU A CD2 1 
ATOM   3284  N  N   . ALA A 1 469 ? 152.227 129.950 197.698 1.00 103.00 ? 470 ALA A N   1 
ATOM   3285  C  CA  . ALA A 1 469 ? 151.248 130.965 197.351 1.00 104.30 ? 470 ALA A CA  1 
ATOM   3286  C  C   . ALA A 1 469 ? 150.762 131.733 198.565 1.00 105.33 ? 470 ALA A C   1 
ATOM   3287  O  O   . ALA A 1 469 ? 150.083 132.745 198.439 1.00 105.44 ? 470 ALA A O   1 
ATOM   3288  C  CB  . ALA A 1 469 ? 150.088 130.333 196.635 1.00 104.46 ? 470 ALA A CB  1 
ATOM   3289  N  N   . GLY A 1 470 ? 151.109 131.244 199.743 1.00 116.32 ? 471 GLY A N   1 
ATOM   3290  C  CA  . GLY A 1 470 ? 150.714 131.905 200.969 1.00 117.20 ? 471 GLY A CA  1 
ATOM   3291  C  C   . GLY A 1 470 ? 149.298 131.584 201.385 1.00 117.95 ? 471 GLY A C   1 
ATOM   3292  O  O   . GLY A 1 470 ? 148.763 132.183 202.309 1.00 118.04 ? 471 GLY A O   1 
ATOM   3293  N  N   . LYS A 1 471 ? 148.682 130.636 200.695 1.00 108.92 ? 472 LYS A N   1 
ATOM   3294  C  CA  . LYS A 1 471 ? 147.318 130.243 201.010 1.00 109.50 ? 472 LYS A CA  1 
ATOM   3295  C  C   . LYS A 1 471 ? 147.230 129.567 202.368 1.00 110.07 ? 472 LYS A C   1 
ATOM   3296  O  O   . LYS A 1 471 ? 146.180 129.563 202.995 1.00 110.12 ? 472 LYS A O   1 
ATOM   3297  C  CB  . LYS A 1 471 ? 146.763 129.307 199.935 1.00 109.48 ? 472 LYS A CB  1 
ATOM   3298  C  CG  . LYS A 1 471 ? 146.920 129.807 198.512 1.00 109.43 ? 472 LYS A CG  1 
ATOM   3299  C  CD  . LYS A 1 471 ? 146.088 131.045 198.239 1.00 109.38 ? 472 LYS A CD  1 
ATOM   3300  C  CE  . LYS A 1 471 ? 146.401 131.620 196.859 1.00 109.32 ? 472 LYS A CE  1 
ATOM   3301  N  NZ  . LYS A 1 471 ? 145.591 132.829 196.529 1.00 109.32 1 472 LYS A NZ  1 
ATOM   3302  N  N   . VAL A 1 472 ? 148.341 128.990 202.810 1.00 105.94 ? 473 VAL A N   1 
ATOM   3303  C  CA  . VAL A 1 472 ? 148.374 128.144 203.997 1.00 106.53 ? 473 VAL A CA  1 
ATOM   3304  C  C   . VAL A 1 472 ? 149.727 128.322 204.694 1.00 107.59 ? 473 VAL A C   1 
ATOM   3305  O  O   . VAL A 1 472 ? 150.674 128.780 204.075 1.00 107.61 ? 473 VAL A O   1 
ATOM   3306  C  CB  . VAL A 1 472 ? 148.152 126.666 203.597 1.00 106.13 ? 473 VAL A CB  1 
ATOM   3307  C  CG1 . VAL A 1 472 ? 148.312 125.736 204.764 1.00 105.99 ? 473 VAL A CG1 1 
ATOM   3308  C  CG2 . VAL A 1 472 ? 146.780 126.476 203.011 1.00 105.98 ? 473 VAL A CG2 1 
ATOM   3309  N  N   . GLN A 1 473 ? 149.813 127.981 205.977 1.00 136.52 ? 474 GLN A N   1 
ATOM   3310  C  CA  . GLN A 1 473 ? 151.057 128.065 206.736 1.00 137.46 ? 474 GLN A CA  1 
ATOM   3311  C  C   . GLN A 1 473 ? 151.561 126.675 207.084 1.00 136.86 ? 474 GLN A C   1 
ATOM   3312  O  O   . GLN A 1 473 ? 150.783 125.737 207.139 1.00 136.88 ? 474 GLN A O   1 
ATOM   3313  C  CB  . GLN A 1 473 ? 150.832 128.831 208.032 1.00 138.60 ? 474 GLN A CB  1 
ATOM   3314  C  CG  . GLN A 1 473 ? 150.201 130.184 207.850 1.00 139.39 ? 474 GLN A CG  1 
ATOM   3315  C  CD  . GLN A 1 473 ? 151.022 131.087 206.964 1.00 139.95 ? 474 GLN A CD  1 
ATOM   3316  O  OE1 . GLN A 1 473 ? 152.191 131.353 207.236 1.00 140.09 ? 474 GLN A OE1 1 
ATOM   3317  N  NE2 . GLN A 1 473 ? 150.414 131.562 205.889 1.00 140.31 ? 474 GLN A NE2 1 
ATOM   3318  N  N   . PRO A 1 474 ? 152.869 126.530 207.301 1.00 97.25  ? 475 PRO A N   1 
ATOM   3319  C  CA  . PRO A 1 474 ? 153.426 125.234 207.677 1.00 97.05  ? 475 PRO A CA  1 
ATOM   3320  C  C   . PRO A 1 474 ? 152.809 124.675 208.953 1.00 97.18  ? 475 PRO A C   1 
ATOM   3321  O  O   . PRO A 1 474 ? 152.675 123.467 209.097 1.00 97.17  ? 475 PRO A O   1 
ATOM   3322  C  CB  . PRO A 1 474 ? 154.898 125.545 207.880 1.00 96.85  ? 475 PRO A CB  1 
ATOM   3323  C  CG  . PRO A 1 474 ? 155.148 126.689 207.016 1.00 96.82  ? 475 PRO A CG  1 
ATOM   3324  C  CD  . PRO A 1 474 ? 153.926 127.525 207.088 1.00 96.96  ? 475 PRO A CD  1 
ATOM   3325  N  N   . SER A 1 475 ? 152.442 125.562 209.872 1.00 114.87 ? 476 SER A N   1 
ATOM   3326  C  CA  . SER A 1 475 ? 151.861 125.156 211.148 1.00 115.10 ? 476 SER A CA  1 
ATOM   3327  C  C   . SER A 1 475 ? 150.388 124.789 210.999 1.00 115.40 ? 476 SER A C   1 
ATOM   3328  O  O   . SER A 1 475 ? 149.779 124.234 211.914 1.00 115.42 ? 476 SER A O   1 
ATOM   3329  C  CB  . SER A 1 475 ? 152.026 126.267 212.187 1.00 115.07 ? 476 SER A CB  1 
ATOM   3330  O  OG  . SER A 1 475 ? 151.437 127.477 211.742 1.00 115.05 ? 476 SER A OG  1 
ATOM   3331  N  N   . ASP A 1 476 ? 149.824 125.102 209.838 1.00 121.52 ? 477 ASP A N   1 
ATOM   3332  C  CA  . ASP A 1 476 ? 148.406 124.868 209.578 1.00 121.71 ? 477 ASP A CA  1 
ATOM   3333  C  C   . ASP A 1 476 ? 148.023 123.399 209.491 1.00 121.42 ? 477 ASP A C   1 
ATOM   3334  O  O   . ASP A 1 476 ? 148.834 122.547 209.150 1.00 121.42 ? 477 ASP A O   1 
ATOM   3335  C  CB  . ASP A 1 476 ? 147.956 125.576 208.302 1.00 121.98 ? 477 ASP A CB  1 
ATOM   3336  C  CG  . ASP A 1 476 ? 147.640 127.031 208.522 1.00 122.11 ? 477 ASP A CG  1 
ATOM   3337  O  OD1 . ASP A 1 476 ? 147.569 127.780 207.526 1.00 122.18 ? 477 ASP A OD1 1 
ATOM   3338  O  OD2 . ASP A 1 476 ? 147.462 127.425 209.689 1.00 122.16 1 477 ASP A OD2 1 
ATOM   3339  N  N   . GLN A 1 477 ? 146.767 123.123 209.813 1.00 127.86 ? 478 GLN A N   1 
ATOM   3340  C  CA  . GLN A 1 477 ? 146.206 121.785 209.722 1.00 127.35 ? 478 GLN A CA  1 
ATOM   3341  C  C   . GLN A 1 477 ? 146.147 121.279 208.290 1.00 125.78 ? 478 GLN A C   1 
ATOM   3342  O  O   . GLN A 1 477 ? 145.933 122.038 207.358 1.00 125.68 ? 478 GLN A O   1 
ATOM   3343  C  CB  . GLN A 1 477 ? 144.802 121.771 210.318 1.00 128.11 ? 478 GLN A CB  1 
ATOM   3344  C  CG  . GLN A 1 477 ? 144.762 121.905 211.826 1.00 128.67 ? 478 GLN A CG  1 
ATOM   3345  C  CD  . GLN A 1 477 ? 144.863 120.571 212.513 1.00 129.03 ? 478 GLN A CD  1 
ATOM   3346  O  OE1 . GLN A 1 477 ? 145.205 119.577 211.888 1.00 129.03 ? 478 GLN A OE1 1 
ATOM   3347  N  NE2 . GLN A 1 477 ? 144.557 120.538 213.801 1.00 129.29 ? 478 GLN A NE2 1 
ATOM   3348  N  N   . VAL A 1 478 ? 146.329 119.981 208.132 1.00 94.24  ? 479 VAL A N   1 
ATOM   3349  C  CA  . VAL A 1 478 ? 146.331 119.349 206.827 1.00 92.81  ? 479 VAL A CA  1 
ATOM   3350  C  C   . VAL A 1 478 ? 144.957 119.379 206.180 1.00 92.17  ? 479 VAL A C   1 
ATOM   3351  O  O   . VAL A 1 478 ? 144.827 119.337 204.967 1.00 92.09  ? 479 VAL A O   1 
ATOM   3352  C  CB  . VAL A 1 478 ? 146.901 117.925 206.942 1.00 92.16  ? 479 VAL A CB  1 
ATOM   3353  C  CG1 . VAL A 1 478 ? 146.491 117.058 205.790 1.00 91.87  ? 479 VAL A CG1 1 
ATOM   3354  C  CG2 . VAL A 1 478 ? 148.399 117.996 207.024 1.00 92.04  ? 479 VAL A CG2 1 
ATOM   3355  N  N   . GLY A 1 479 ? 143.929 119.528 206.996 1.00 103.90 ? 480 GLY A N   1 
ATOM   3356  C  CA  . GLY A 1 479 ? 142.573 119.473 206.500 1.00 103.32 ? 480 GLY A CA  1 
ATOM   3357  C  C   . GLY A 1 479 ? 142.226 120.680 205.660 1.00 102.75 ? 480 GLY A C   1 
ATOM   3358  O  O   . GLY A 1 479 ? 141.261 120.666 204.910 1.00 102.67 ? 480 GLY A O   1 
ATOM   3359  N  N   . LYS A 1 480 ? 143.026 121.728 205.773 1.00 112.47 ? 481 LYS A N   1 
ATOM   3360  C  CA  . LYS A 1 480 ? 142.835 122.911 204.949 1.00 111.89 ? 481 LYS A CA  1 
ATOM   3361  C  C   . LYS A 1 480 ? 143.135 122.636 203.481 1.00 109.76 ? 481 LYS A C   1 
ATOM   3362  O  O   . LYS A 1 480 ? 142.725 123.391 202.609 1.00 109.62 ? 481 LYS A O   1 
ATOM   3363  C  CB  . LYS A 1 480 ? 143.699 124.070 205.450 1.00 113.24 ? 481 LYS A CB  1 
ATOM   3364  C  CG  . LYS A 1 480 ? 143.266 124.640 206.790 1.00 114.33 ? 481 LYS A CG  1 
ATOM   3365  C  CD  . LYS A 1 480 ? 144.140 125.804 207.214 1.00 115.19 ? 481 LYS A CD  1 
ATOM   3366  C  CE  . LYS A 1 480 ? 143.796 127.061 206.455 1.00 115.73 ? 481 LYS A CE  1 
ATOM   3367  N  NZ  . LYS A 1 480 ? 142.412 127.497 206.760 1.00 116.03 1 481 LYS A NZ  1 
ATOM   3368  N  N   . VAL A 1 481 ? 143.859 121.555 203.220 1.00 90.39  ? 482 VAL A N   1 
ATOM   3369  C  CA  . VAL A 1 481 ? 144.418 121.286 201.903 1.00 88.39  ? 482 VAL A CA  1 
ATOM   3370  C  C   . VAL A 1 481 ? 144.037 119.877 201.422 1.00 86.67  ? 482 VAL A C   1 
ATOM   3371  O  O   . VAL A 1 481 ? 144.386 119.445 200.334 1.00 86.52  ? 482 VAL A O   1 
ATOM   3372  C  CB  . VAL A 1 481 ? 145.944 121.576 201.950 1.00 88.20  ? 482 VAL A CB  1 
ATOM   3373  C  CG1 . VAL A 1 481 ? 146.733 120.865 200.887 1.00 88.10  ? 482 VAL A CG1 1 
ATOM   3374  C  CG2 . VAL A 1 481 ? 146.183 123.062 201.856 1.00 88.21  ? 482 VAL A CG2 1 
ATOM   3375  N  N   . ILE A 1 482 ? 143.254 119.179 202.227 1.00 89.64  ? 483 ILE A N   1 
ATOM   3376  C  CA  . ILE A 1 482 ? 142.885 117.804 201.915 1.00 88.12  ? 483 ILE A CA  1 
ATOM   3377  C  C   . ILE A 1 482 ? 142.028 117.631 200.659 1.00 86.90  ? 483 ILE A C   1 
ATOM   3378  O  O   . ILE A 1 482 ? 141.138 118.423 200.391 1.00 86.80  ? 483 ILE A O   1 
ATOM   3379  C  CB  . ILE A 1 482 ? 142.181 117.140 203.107 1.00 87.93  ? 483 ILE A CB  1 
ATOM   3380  C  CG1 . ILE A 1 482 ? 141.816 115.702 202.777 1.00 87.78  ? 483 ILE A CG1 1 
ATOM   3381  C  CG2 . ILE A 1 482 ? 140.941 117.892 203.473 1.00 87.99  ? 483 ILE A CG2 1 
ATOM   3382  C  CD1 . ILE A 1 482 ? 141.140 114.984 203.888 1.00 87.72  ? 483 ILE A CD1 1 
ATOM   3383  N  N   . TYR A 1 483 ? 142.316 116.586 199.891 1.00 81.29  ? 484 TYR A N   1 
ATOM   3384  C  CA  . TYR A 1 483 ? 141.465 116.176 198.789 1.00 80.25  ? 484 TYR A CA  1 
ATOM   3385  C  C   . TYR A 1 483 ? 140.398 115.243 199.332 1.00 80.09  ? 484 TYR A C   1 
ATOM   3386  O  O   . TYR A 1 483 ? 140.646 114.068 199.540 1.00 80.08  ? 484 TYR A O   1 
ATOM   3387  C  CB  . TYR A 1 483 ? 142.278 115.438 197.729 1.00 79.65  ? 484 TYR A CB  1 
ATOM   3388  C  CG  . TYR A 1 483 ? 143.307 116.264 196.988 1.00 79.10  ? 484 TYR A CG  1 
ATOM   3389  C  CD1 . TYR A 1 483 ? 143.140 117.618 196.792 1.00 78.83  ? 484 TYR A CD1 1 
ATOM   3390  C  CD2 . TYR A 1 483 ? 144.443 115.673 196.466 1.00 78.77  ? 484 TYR A CD2 1 
ATOM   3391  C  CE1 . TYR A 1 483 ? 144.076 118.359 196.107 1.00 78.64  ? 484 TYR A CE1 1 
ATOM   3392  C  CE2 . TYR A 1 483 ? 145.379 116.404 195.785 1.00 78.62  ? 484 TYR A CE2 1 
ATOM   3393  C  CZ  . TYR A 1 483 ? 145.193 117.743 195.608 1.00 78.59  ? 484 TYR A CZ  1 
ATOM   3394  O  OH  . TYR A 1 483 ? 146.134 118.462 194.926 1.00 78.66  ? 484 TYR A OH  1 
ATOM   3395  N  N   . LYS A 1 484 ? 139.208 115.774 199.570 1.00 87.11  ? 485 LYS A N   1 
ATOM   3396  C  CA  . LYS A 1 484 ? 138.136 115.015 200.200 1.00 87.03  ? 485 LYS A CA  1 
ATOM   3397  C  C   . LYS A 1 484 ? 137.550 113.872 199.372 1.00 87.07  ? 485 LYS A C   1 
ATOM   3398  O  O   . LYS A 1 484 ? 136.982 112.944 199.920 1.00 87.05  ? 485 LYS A O   1 
ATOM   3399  C  CB  . LYS A 1 484 ? 137.004 115.949 200.627 1.00 86.98  ? 485 LYS A CB  1 
ATOM   3400  C  CG  . LYS A 1 484 ? 137.385 117.039 201.606 1.00 86.97  ? 485 LYS A CG  1 
ATOM   3401  C  CD  . LYS A 1 484 ? 136.147 117.827 202.019 1.00 86.96  ? 485 LYS A CD  1 
ATOM   3402  C  CE  . LYS A 1 484 ? 136.471 118.946 202.982 1.00 86.97  ? 485 LYS A CE  1 
ATOM   3403  N  NZ  . LYS A 1 484 ? 137.217 120.048 202.324 1.00 86.97  1 485 LYS A NZ  1 
ATOM   3404  N  N   . GLN A 1 485 ? 137.661 113.946 198.055 1.00 88.73  ? 486 GLN A N   1 
ATOM   3405  C  CA  . GLN A 1 485 ? 136.944 113.006 197.199 1.00 88.84  ? 486 GLN A CA  1 
ATOM   3406  C  C   . GLN A 1 485 ? 137.780 111.865 196.647 1.00 89.26  ? 486 GLN A C   1 
ATOM   3407  O  O   . GLN A 1 485 ? 138.852 112.085 196.110 1.00 89.26  ? 486 GLN A O   1 
ATOM   3408  C  CB  . GLN A 1 485 ? 136.278 113.755 196.051 1.00 88.64  ? 486 GLN A CB  1 
ATOM   3409  C  CG  . GLN A 1 485 ? 135.479 112.872 195.142 1.00 88.50  ? 486 GLN A CG  1 
ATOM   3410  C  CD  . GLN A 1 485 ? 134.713 113.647 194.109 1.00 88.41  ? 486 GLN A CD  1 
ATOM   3411  O  OE1 . GLN A 1 485 ? 134.290 114.773 194.349 1.00 88.41  ? 486 GLN A OE1 1 
ATOM   3412  N  NE2 . GLN A 1 485 ? 134.528 113.048 192.943 1.00 88.36  ? 486 GLN A NE2 1 
ATOM   3413  N  N   . PHE A 1 486 ? 137.261 110.650 196.758 1.00 78.70  ? 487 PHE A N   1 
ATOM   3414  C  CA  . PHE A 1 486 ? 137.951 109.468 196.267 1.00 79.32  ? 487 PHE A CA  1 
ATOM   3415  C  C   . PHE A 1 486 ? 137.005 108.285 196.145 1.00 81.57  ? 487 PHE A C   1 
ATOM   3416  O  O   . PHE A 1 486 ? 135.864 108.360 196.571 1.00 81.69  ? 487 PHE A O   1 
ATOM   3417  C  CB  . PHE A 1 486 ? 139.105 109.106 197.189 1.00 78.20  ? 487 PHE A CB  1 
ATOM   3418  C  CG  . PHE A 1 486 ? 138.674 108.690 198.554 1.00 77.12  ? 487 PHE A CG  1 
ATOM   3419  C  CD1 . PHE A 1 486 ? 138.535 109.615 199.558 1.00 76.64  ? 487 PHE A CD1 1 
ATOM   3420  C  CD2 . PHE A 1 486 ? 138.409 107.372 198.834 1.00 76.56  ? 487 PHE A CD2 1 
ATOM   3421  C  CE1 . PHE A 1 486 ? 138.139 109.235 200.800 1.00 76.25  ? 487 PHE A CE1 1 
ATOM   3422  C  CE2 . PHE A 1 486 ? 138.010 106.995 200.075 1.00 76.24  ? 487 PHE A CE2 1 
ATOM   3423  C  CZ  . PHE A 1 486 ? 137.873 107.925 201.058 1.00 76.15  ? 487 PHE A CZ  1 
ATOM   3424  N  N   . LYS A 1 487 ? 137.486 107.192 195.562 1.00 97.28  ? 488 LYS A N   1 
ATOM   3425  C  CA  . LYS A 1 487 ? 136.721 105.951 195.506 1.00 99.85  ? 488 LYS A CA  1 
ATOM   3426  C  C   . LYS A 1 487 ? 137.560 104.734 195.881 1.00 102.00 ? 488 LYS A C   1 
ATOM   3427  O  O   . LYS A 1 487 ? 138.743 104.672 195.581 1.00 102.07 ? 488 LYS A O   1 
ATOM   3428  C  CB  . LYS A 1 487 ? 136.128 105.740 194.121 1.00 100.25 ? 488 LYS A CB  1 
ATOM   3429  C  CG  . LYS A 1 487 ? 135.106 104.634 194.080 1.00 100.66 ? 488 LYS A CG  1 
ATOM   3430  C  CD  . LYS A 1 487 ? 133.866 105.050 194.829 1.00 100.93 ? 488 LYS A CD  1 
ATOM   3431  C  CE  . LYS A 1 487 ? 132.990 103.871 195.190 1.00 101.16 ? 488 LYS A CE  1 
ATOM   3432  N  NZ  . LYS A 1 487 ? 133.129 103.500 196.627 1.00 101.27 1 488 LYS A NZ  1 
ATOM   3433  N  N   . GLN A 1 488 ? 136.932 103.770 196.544 1.00 103.59 ? 489 GLN A N   1 
ATOM   3434  C  CA  . GLN A 1 488 ? 137.588 102.541 196.971 1.00 105.80 ? 489 GLN A CA  1 
ATOM   3435  C  C   . GLN A 1 488 ? 137.493 101.414 195.950 1.00 107.46 ? 489 GLN A C   1 
ATOM   3436  O  O   . GLN A 1 488 ? 136.534 101.345 195.201 1.00 107.60 ? 489 GLN A O   1 
ATOM   3437  C  CB  . GLN A 1 488 ? 136.970 102.063 198.283 1.00 106.26 ? 489 GLN A CB  1 
ATOM   3438  C  CG  . GLN A 1 488 ? 137.050 103.058 199.421 1.00 106.55 ? 489 GLN A CG  1 
ATOM   3439  C  CD  . GLN A 1 488 ? 136.506 102.503 200.725 1.00 106.81 ? 489 GLN A CD  1 
ATOM   3440  O  OE1 . GLN A 1 488 ? 136.160 101.332 200.817 1.00 106.87 ? 489 GLN A OE1 1 
ATOM   3441  N  NE2 . GLN A 1 488 ? 136.431 103.348 201.740 1.00 106.92 ? 489 GLN A NE2 1 
ATOM   3442  N  N   . ILE A 1 489 ? 138.476 100.517 195.948 1.00 100.96 ? 490 ILE A N   1 
ATOM   3443  C  CA  . ILE A 1 489 ? 138.409 99.287  195.157 1.00 102.52 ? 490 ILE A CA  1 
ATOM   3444  C  C   . ILE A 1 489 ? 139.098 98.112  195.832 1.00 104.45 ? 490 ILE A C   1 
ATOM   3445  O  O   . ILE A 1 489 ? 140.029 98.289  196.603 1.00 104.55 ? 490 ILE A O   1 
ATOM   3446  C  CB  . ILE A 1 489 ? 139.071 99.427  193.791 1.00 102.20 ? 490 ILE A CB  1 
ATOM   3447  C  CG1 . ILE A 1 489 ? 140.300 100.307 193.885 1.00 102.06 ? 490 ILE A CG1 1 
ATOM   3448  C  CG2 . ILE A 1 489 ? 138.133 99.995  192.803 1.00 101.95 ? 490 ILE A CG2 1 
ATOM   3449  C  CD1 . ILE A 1 489 ? 141.139 100.240 192.656 1.00 101.98 ? 490 ILE A CD1 1 
ATOM   3450  N  N   . ARG A 1 490 ? 138.624 96.910  195.524 1.00 129.31 ? 491 ARG A N   1 
ATOM   3451  C  CA  . ARG A 1 490 ? 139.261 95.672  195.959 1.00 131.04 ? 491 ARG A CA  1 
ATOM   3452  C  C   . ARG A 1 490 ? 140.501 95.359  195.141 1.00 130.24 ? 491 ARG A C   1 
ATOM   3453  O  O   . ARG A 1 490 ? 140.618 95.788  194.001 1.00 130.21 ? 491 ARG A O   1 
ATOM   3454  C  CB  . ARG A 1 490 ? 138.295 94.495  195.833 1.00 133.24 ? 491 ARG A CB  1 
ATOM   3455  C  CG  . ARG A 1 490 ? 137.114 94.517  196.778 1.00 135.04 ? 491 ARG A CG  1 
ATOM   3456  C  CD  . ARG A 1 490 ? 136.328 93.231  196.656 1.00 136.54 ? 491 ARG A CD  1 
ATOM   3457  N  NE  . ARG A 1 490 ? 135.744 93.080  195.329 1.00 137.72 ? 491 ARG A NE  1 
ATOM   3458  C  CZ  . ARG A 1 490 ? 134.506 93.441  195.027 1.00 138.86 ? 491 ARG A CZ  1 
ATOM   3459  N  NH1 . ARG A 1 490 ? 133.733 93.962  195.964 1.00 139.26 1 491 ARG A NH1 1 
ATOM   3460  N  NH2 . ARG A 1 490 ? 134.040 93.278  193.797 1.00 139.29 ? 491 ARG A NH2 1 
ATOM   3461  N  N   . LEU A 1 491 ? 141.421 94.599  195.721 1.00 98.41  ? 492 LEU A N   1 
ATOM   3462  C  CA  . LEU A 1 491 ? 142.589 94.136  194.992 1.00 97.61  ? 492 LEU A CA  1 
ATOM   3463  C  C   . LEU A 1 491 ? 142.203 93.224  193.845 1.00 97.43  ? 492 LEU A C   1 
ATOM   3464  O  O   . LEU A 1 491 ? 142.918 93.120  192.859 1.00 97.41  ? 492 LEU A O   1 
ATOM   3465  C  CB  . LEU A 1 491 ? 143.534 93.399  195.929 1.00 97.11  ? 492 LEU A CB  1 
ATOM   3466  C  CG  . LEU A 1 491 ? 144.596 94.228  196.642 1.00 96.69  ? 492 LEU A CG  1 
ATOM   3467  C  CD1 . LEU A 1 491 ? 145.157 93.466  197.820 1.00 96.53  ? 492 LEU A CD1 1 
ATOM   3468  C  CD2 . LEU A 1 491 ? 145.703 94.584  195.681 1.00 96.55  ? 492 LEU A CD2 1 
ATOM   3469  N  N   . THR A 1 492 ? 141.072 92.554  193.984 1.00 112.90 ? 493 THR A N   1 
ATOM   3470  C  CA  . THR A 1 492 ? 140.620 91.628  192.964 1.00 112.71 ? 493 THR A CA  1 
ATOM   3471  C  C   . THR A 1 492 ? 139.720 92.271  191.926 1.00 112.39 ? 493 THR A C   1 
ATOM   3472  O  O   . THR A 1 492 ? 139.163 91.584  191.079 1.00 112.47 ? 493 THR A O   1 
ATOM   3473  C  CB  . THR A 1 492 ? 139.910 90.416  193.567 1.00 112.77 ? 493 THR A CB  1 
ATOM   3474  O  OG1 . THR A 1 492 ? 139.009 90.854  194.583 1.00 112.77 ? 493 THR A OG1 1 
ATOM   3475  C  CG2 . THR A 1 492 ? 140.915 89.475  194.180 1.00 112.80 ? 493 THR A CG2 1 
ATOM   3476  N  N   . ASP A 1 493 ? 139.553 93.583  192.000 1.00 122.01 ? 494 ASP A N   1 
ATOM   3477  C  CA  . ASP A 1 493 ? 138.777 94.286  190.989 1.00 121.55 ? 494 ASP A CA  1 
ATOM   3478  C  C   . ASP A 1 493 ? 139.494 94.294  189.650 1.00 120.62 ? 494 ASP A C   1 
ATOM   3479  O  O   . ASP A 1 493 ? 140.715 94.237  189.594 1.00 120.67 ? 494 ASP A O   1 
ATOM   3480  C  CB  . ASP A 1 493 ? 138.482 95.711  191.432 1.00 121.86 ? 494 ASP A CB  1 
ATOM   3481  C  CG  . ASP A 1 493 ? 137.230 95.811  192.262 1.00 122.04 ? 494 ASP A CG  1 
ATOM   3482  O  OD1 . ASP A 1 493 ? 136.262 95.103  191.939 1.00 122.09 ? 494 ASP A OD1 1 
ATOM   3483  O  OD2 . ASP A 1 493 ? 137.213 96.593  193.233 1.00 122.10 1 494 ASP A OD2 1 
ATOM   3484  N  N   . THR A 1 494 ? 138.726 94.322  188.569 1.00 98.48  ? 495 THR A N   1 
ATOM   3485  C  CA  . THR A 1 494 ? 139.303 94.391  187.241 1.00 97.48  ? 495 THR A CA  1 
ATOM   3486  C  C   . THR A 1 494 ? 139.782 95.787  186.907 1.00 96.60  ? 495 THR A C   1 
ATOM   3487  O  O   . THR A 1 494 ? 139.259 96.762  187.413 1.00 96.43  ? 495 THR A O   1 
ATOM   3488  C  CB  . THR A 1 494 ? 138.314 93.951  186.181 1.00 97.38  ? 495 THR A CB  1 
ATOM   3489  O  OG1 . THR A 1 494 ? 137.302 94.946  186.040 1.00 97.37  ? 495 THR A OG1 1 
ATOM   3490  C  CG2 . THR A 1 494 ? 137.678 92.646  186.573 1.00 97.34  ? 495 THR A CG2 1 
ATOM   3491  N  N   . LEU A 1 495 ? 140.776 95.873  186.035 1.00 107.69 ? 496 LEU A N   1 
ATOM   3492  C  CA  . LEU A 1 495 ? 141.330 97.153  185.629 1.00 106.87 ? 496 LEU A CA  1 
ATOM   3493  C  C   . LEU A 1 495 ? 140.295 98.007  184.924 1.00 105.58 ? 496 LEU A C   1 
ATOM   3494  O  O   . LEU A 1 495 ? 140.343 99.228  184.984 1.00 105.40 ? 496 LEU A O   1 
ATOM   3495  C  CB  . LEU A 1 495 ? 142.518 96.941  184.698 1.00 107.23 ? 496 LEU A CB  1 
ATOM   3496  C  CG  . LEU A 1 495 ? 143.840 96.577  185.346 1.00 107.47 ? 496 LEU A CG  1 
ATOM   3497  C  CD1 . LEU A 1 495 ? 144.911 96.499  184.299 1.00 107.55 ? 496 LEU A CD1 1 
ATOM   3498  C  CD2 . LEU A 1 495 ? 144.187 97.613  186.367 1.00 107.56 ? 496 LEU A CD2 1 
ATOM   3499  N  N   . GLY A 1 496 ? 139.355 97.358  184.255 1.00 109.30 ? 497 GLY A N   1 
ATOM   3500  C  CA  . GLY A 1 496 ? 138.337 98.076  183.521 1.00 108.01 ? 497 GLY A CA  1 
ATOM   3501  C  C   . GLY A 1 496 ? 137.400 98.796  184.455 1.00 106.62 ? 497 GLY A C   1 
ATOM   3502  O  O   . GLY A 1 496 ? 136.954 99.904  184.175 1.00 106.50 ? 497 GLY A O   1 
ATOM   3503  N  N   . ARG A 1 497 ? 137.115 98.165  185.583 1.00 97.08  ? 498 ARG A N   1 
ATOM   3504  C  CA  . ARG A 1 497 ? 136.285 98.780  186.596 1.00 95.76  ? 498 ARG A CA  1 
ATOM   3505  C  C   . ARG A 1 497 ? 136.981 100.017 187.108 1.00 94.43  ? 498 ARG A C   1 
ATOM   3506  O  O   . ARG A 1 497 ? 136.355 101.039 187.367 1.00 94.27  ? 498 ARG A O   1 
ATOM   3507  C  CB  . ARG A 1 497 ? 136.085 97.800  187.745 1.00 95.82  ? 498 ARG A CB  1 
ATOM   3508  C  CG  . ARG A 1 497 ? 135.432 98.386  188.980 1.00 95.86  ? 498 ARG A CG  1 
ATOM   3509  C  CD  . ARG A 1 497 ? 133.942 98.192  188.956 1.00 95.90  ? 498 ARG A CD  1 
ATOM   3510  N  NE  . ARG A 1 497 ? 133.289 98.800  190.105 1.00 95.94  ? 498 ARG A NE  1 
ATOM   3511  C  CZ  . ARG A 1 497 ? 132.707 99.991  190.083 1.00 95.98  ? 498 ARG A CZ  1 
ATOM   3512  N  NH1 . ARG A 1 497 ? 132.698 100.701 188.970 1.00 95.99  1 498 ARG A NH1 1 
ATOM   3513  N  NH2 . ARG A 1 497 ? 132.133 100.472 191.172 1.00 95.99  ? 498 ARG A NH2 1 
ATOM   3514  N  N   . LEU A 1 498 ? 138.297 99.927  187.217 1.00 81.89  ? 499 LEU A N   1 
ATOM   3515  C  CA  . LEU A 1 498 ? 139.088 101.047 187.670 1.00 80.66  ? 499 LEU A CA  1 
ATOM   3516  C  C   . LEU A 1 498 ? 138.984 102.155 186.661 1.00 80.61  ? 499 LEU A C   1 
ATOM   3517  O  O   . LEU A 1 498 ? 138.886 103.323 187.012 1.00 80.45  ? 499 LEU A O   1 
ATOM   3518  C  CB  . LEU A 1 498 ? 140.539 100.619 187.818 1.00 79.80  ? 499 LEU A CB  1 
ATOM   3519  C  CG  . LEU A 1 498 ? 141.575 101.718 188.017 1.00 79.06  ? 499 LEU A CG  1 
ATOM   3520  C  CD1 . LEU A 1 498 ? 141.532 102.257 189.420 1.00 78.84  ? 499 LEU A CD1 1 
ATOM   3521  C  CD2 . LEU A 1 498 ? 142.946 101.190 187.698 1.00 78.81  ? 499 LEU A CD2 1 
ATOM   3522  N  N   . SER A 1 499 ? 138.968 101.769 185.395 1.00 85.42  ? 500 SER A N   1 
ATOM   3523  C  CA  . SER A 1 499 ? 138.887 102.733 184.321 1.00 85.47  ? 500 SER A CA  1 
ATOM   3524  C  C   . SER A 1 499 ? 137.560 103.451 184.344 1.00 85.37  ? 500 SER A C   1 
ATOM   3525  O  O   . SER A 1 499 ? 137.477 104.619 184.005 1.00 85.34  ? 500 SER A O   1 
ATOM   3526  C  CB  . SER A 1 499 ? 139.089 102.052 182.977 1.00 85.58  ? 500 SER A CB  1 
ATOM   3527  O  OG  . SER A 1 499 ? 139.420 103.000 181.980 1.00 85.65  ? 500 SER A OG  1 
ATOM   3528  N  N   . HIS A 1 500 ? 136.517 102.750 184.754 1.00 101.50 ? 501 HIS A N   1 
ATOM   3529  C  CA  . HIS A 1 500 ? 135.230 103.394 184.932 1.00 101.33 ? 501 HIS A CA  1 
ATOM   3530  C  C   . HIS A 1 500 ? 135.235 104.338 186.115 1.00 99.81  ? 501 HIS A C   1 
ATOM   3531  O  O   . HIS A 1 500 ? 134.626 105.396 186.078 1.00 99.71  ? 501 HIS A O   1 
ATOM   3532  C  CB  . HIS A 1 500 ? 134.129 102.363 185.116 1.00 102.30 ? 501 HIS A CB  1 
ATOM   3533  C  CG  . HIS A 1 500 ? 133.612 101.801 183.835 1.00 103.22 ? 501 HIS A CG  1 
ATOM   3534  N  ND1 . HIS A 1 500 ? 132.996 102.580 182.883 1.00 103.64 ? 501 HIS A ND1 1 
ATOM   3535  C  CD2 . HIS A 1 500 ? 133.609 100.539 183.350 1.00 103.70 ? 501 HIS A CD2 1 
ATOM   3536  C  CE1 . HIS A 1 500 ? 132.642 101.824 181.861 1.00 103.92 ? 501 HIS A CE1 1 
ATOM   3537  N  NE2 . HIS A 1 500 ? 133.002 100.580 182.120 1.00 103.93 ? 501 HIS A NE2 1 
ATOM   3538  N  N   . ILE A 1 501 ? 135.921 103.942 187.173 1.00 75.24  ? 502 ILE A N   1 
ATOM   3539  C  CA  . ILE A 1 501 ? 135.983 104.758 188.370 1.00 73.83  ? 502 ILE A CA  1 
ATOM   3540  C  C   . ILE A 1 501 ? 136.740 106.052 188.150 1.00 72.89  ? 502 ILE A C   1 
ATOM   3541  O  O   . ILE A 1 501 ? 136.407 107.083 188.713 1.00 72.79  ? 502 ILE A O   1 
ATOM   3542  C  CB  . ILE A 1 501 ? 136.600 103.964 189.501 1.00 73.49  ? 502 ILE A CB  1 
ATOM   3543  C  CG1 . ILE A 1 501 ? 135.642 102.860 189.890 1.00 73.35  ? 502 ILE A CG1 1 
ATOM   3544  C  CG2 . ILE A 1 501 ? 136.866 104.832 190.690 1.00 73.39  ? 502 ILE A CG2 1 
ATOM   3545  C  CD1 . ILE A 1 501 ? 136.065 102.103 191.066 1.00 73.35  ? 502 ILE A CD1 1 
ATOM   3546  N  N   . LEU A 1 502 ? 137.730 106.011 187.277 1.00 73.54  ? 503 LEU A N   1 
ATOM   3547  C  CA  . LEU A 1 502 ? 138.580 107.165 187.085 1.00 72.79  ? 503 LEU A CA  1 
ATOM   3548  C  C   . LEU A 1 502 ? 137.876 108.226 186.277 1.00 72.99  ? 503 LEU A C   1 
ATOM   3549  O  O   . LEU A 1 502 ? 138.362 109.333 186.137 1.00 72.96  ? 503 LEU A O   1 
ATOM   3550  C  CB  . LEU A 1 502 ? 139.898 106.761 186.445 1.00 72.12  ? 503 LEU A CB  1 
ATOM   3551  C  CG  . LEU A 1 502 ? 140.713 105.874 187.377 1.00 71.59  ? 503 LEU A CG  1 
ATOM   3552  C  CD1 . LEU A 1 502 ? 141.943 105.355 186.702 1.00 71.39  ? 503 LEU A CD1 1 
ATOM   3553  C  CD2 . LEU A 1 502 ? 141.079 106.639 188.612 1.00 71.42  ? 503 LEU A CD2 1 
ATOM   3554  N  N   . GLU A 1 503 ? 136.724 107.871 185.736 1.00 85.97  ? 504 GLU A N   1 
ATOM   3555  C  CA  . GLU A 1 503 ? 135.889 108.828 185.039 1.00 86.19  ? 504 GLU A CA  1 
ATOM   3556  C  C   . GLU A 1 503 ? 135.045 109.673 185.990 1.00 86.18  ? 504 GLU A C   1 
ATOM   3557  O  O   . GLU A 1 503 ? 134.423 110.636 185.577 1.00 86.18  ? 504 GLU A O   1 
ATOM   3558  C  CB  . GLU A 1 503 ? 135.017 108.119 184.004 1.00 86.34  ? 504 GLU A CB  1 
ATOM   3559  C  CG  . GLU A 1 503 ? 135.812 107.470 182.893 1.00 86.42  ? 504 GLU A CG  1 
ATOM   3560  C  CD  . GLU A 1 503 ? 134.959 106.764 181.867 1.00 86.47  ? 504 GLU A CD  1 
ATOM   3561  O  OE1 . GLU A 1 503 ? 135.428 106.593 180.729 1.00 86.49  ? 504 GLU A OE1 1 
ATOM   3562  O  OE2 . GLU A 1 503 ? 133.829 106.373 182.193 1.00 86.45  1 504 GLU A OE2 1 
ATOM   3563  N  N   . MET A 1 504 ? 135.033 109.319 187.266 1.00 86.60  ? 505 MET A N   1 
ATOM   3564  C  CA  . MET A 1 504 ? 134.312 110.107 188.255 1.00 86.65  ? 505 MET A CA  1 
ATOM   3565  C  C   . MET A 1 504 ? 135.228 110.631 189.341 1.00 86.22  ? 505 MET A C   1 
ATOM   3566  O  O   . MET A 1 504 ? 134.946 111.649 189.953 1.00 86.18  ? 505 MET A O   1 
ATOM   3567  C  CB  . MET A 1 504 ? 133.188 109.293 188.889 1.00 87.00  ? 505 MET A CB  1 
ATOM   3568  C  CG  . MET A 1 504 ? 132.045 108.991 187.962 1.00 87.24  ? 505 MET A CG  1 
ATOM   3569  S  SD  . MET A 1 504 ? 131.231 110.467 187.369 1.00 87.45  ? 505 MET A SD  1 
ATOM   3570  C  CE  . MET A 1 504 ? 129.896 109.738 186.438 1.00 87.61  ? 505 MET A CE  1 
ATOM   3571  N  N   . ASP A 1 505 ? 136.323 109.926 189.584 1.00 87.63  ? 506 ASP A N   1 
ATOM   3572  C  CA  . ASP A 1 505 ? 137.261 110.313 190.625 1.00 87.23  ? 506 ASP A CA  1 
ATOM   3573  C  C   . ASP A 1 505 ? 138.694 110.230 190.137 1.00 86.85  ? 506 ASP A C   1 
ATOM   3574  O  O   . ASP A 1 505 ? 139.030 109.414 189.297 1.00 86.83  ? 506 ASP A O   1 
ATOM   3575  C  CB  . ASP A 1 505 ? 137.097 109.425 191.854 1.00 87.24  ? 506 ASP A CB  1 
ATOM   3576  C  CG  . ASP A 1 505 ? 135.723 109.517 192.463 1.00 87.27  ? 506 ASP A CG  1 
ATOM   3577  O  OD1 . ASP A 1 505 ? 135.472 110.473 193.210 1.00 87.30  ? 506 ASP A OD1 1 
ATOM   3578  O  OD2 . ASP A 1 505 ? 134.896 108.628 192.210 1.00 87.32  1 506 ASP A OD2 1 
ATOM   3579  N  N   . HIS A 1 506 ? 139.539 111.091 190.673 1.00 79.38  ? 507 HIS A N   1 
ATOM   3580  C  CA  . HIS A 1 506 ? 140.945 111.091 190.326 1.00 79.11  ? 507 HIS A CA  1 
ATOM   3581  C  C   . HIS A 1 506 ? 141.700 109.994 191.051 1.00 79.67  ? 507 HIS A C   1 
ATOM   3582  O  O   . HIS A 1 506 ? 142.561 109.345 190.480 1.00 79.72  ? 507 HIS A O   1 
ATOM   3583  C  CB  . HIS A 1 506 ? 141.549 112.437 190.675 1.00 78.50  ? 507 HIS A CB  1 
ATOM   3584  C  CG  . HIS A 1 506 ? 143.022 112.510 190.467 1.00 77.96  ? 507 HIS A CG  1 
ATOM   3585  N  ND1 . HIS A 1 506 ? 143.905 112.708 191.502 1.00 77.72  ? 507 HIS A ND1 1 
ATOM   3586  C  CD2 . HIS A 1 506 ? 143.769 112.419 189.346 1.00 77.72  ? 507 HIS A CD2 1 
ATOM   3587  C  CE1 . HIS A 1 506 ? 145.135 112.732 191.027 1.00 77.61  ? 507 HIS A CE1 1 
ATOM   3588  N  NE2 . HIS A 1 506 ? 145.081 112.559 189.722 1.00 77.61  ? 507 HIS A NE2 1 
ATOM   3589  N  N   . PHE A 1 507 ? 141.371 109.802 192.321 1.00 80.56  ? 508 PHE A N   1 
ATOM   3590  C  CA  . PHE A 1 507 ? 142.024 108.800 193.144 1.00 81.25  ? 508 PHE A CA  1 
ATOM   3591  C  C   . PHE A 1 507 ? 141.172 107.565 193.285 1.00 82.60  ? 508 PHE A C   1 
ATOM   3592  O  O   . PHE A 1 507 ? 139.973 107.650 193.471 1.00 82.67  ? 508 PHE A O   1 
ATOM   3593  C  CB  . PHE A 1 507 ? 142.288 109.345 194.542 1.00 80.83  ? 508 PHE A CB  1 
ATOM   3594  C  CG  . PHE A 1 507 ? 143.356 110.376 194.599 1.00 80.45  ? 508 PHE A CG  1 
ATOM   3595  C  CD1 . PHE A 1 507 ? 144.668 110.030 194.417 1.00 80.32  ? 508 PHE A CD1 1 
ATOM   3596  C  CD2 . PHE A 1 507 ? 143.050 111.687 194.855 1.00 80.26  ? 508 PHE A CD2 1 
ATOM   3597  C  CE1 . PHE A 1 507 ? 145.655 110.972 194.474 1.00 80.23  ? 508 PHE A CE1 1 
ATOM   3598  C  CE2 . PHE A 1 507 ? 144.032 112.629 194.911 1.00 80.19  ? 508 PHE A CE2 1 
ATOM   3599  C  CZ  . PHE A 1 507 ? 145.338 112.269 194.721 1.00 80.17  ? 508 PHE A CZ  1 
ATOM   3600  N  N   . ALA A 1 508 ? 141.806 106.410 193.220 1.00 91.81  ? 509 ALA A N   1 
ATOM   3601  C  CA  . ALA A 1 508 ? 141.145 105.174 193.569 1.00 93.29  ? 509 ALA A CA  1 
ATOM   3602  C  C   . ALA A 1 508 ? 141.978 104.474 194.621 1.00 94.82  ? 509 ALA A C   1 
ATOM   3603  O  O   . ALA A 1 508 ? 143.113 104.109 194.365 1.00 94.92  ? 509 ALA A O   1 
ATOM   3604  C  CB  . ALA A 1 508 ? 140.995 104.309 192.363 1.00 93.29  ? 509 ALA A CB  1 
ATOM   3605  N  N   . LEU A 1 509 ? 141.425 104.305 195.813 1.00 84.17  ? 510 LEU A N   1 
ATOM   3606  C  CA  . LEU A 1 509 ? 142.155 103.657 196.895 1.00 85.79  ? 510 LEU A CA  1 
ATOM   3607  C  C   . LEU A 1 509 ? 141.898 102.169 196.943 1.00 88.23  ? 510 LEU A C   1 
ATOM   3608  O  O   . LEU A 1 509 ? 140.760 101.731 197.014 1.00 88.40  ? 510 LEU A O   1 
ATOM   3609  C  CB  . LEU A 1 509 ? 141.777 104.270 198.233 1.00 85.28  ? 510 LEU A CB  1 
ATOM   3610  C  CG  . LEU A 1 509 ? 142.014 105.763 198.317 1.00 84.84  ? 510 LEU A CG  1 
ATOM   3611  C  CD1 . LEU A 1 509 ? 141.947 106.219 199.742 1.00 84.71  ? 510 LEU A CD1 1 
ATOM   3612  C  CD2 . LEU A 1 509 ? 143.353 106.043 197.734 1.00 84.76  ? 510 LEU A CD2 1 
ATOM   3613  N  N   . VAL A 1 510 ? 142.961 101.383 196.919 1.00 93.00  ? 511 VAL A N   1 
ATOM   3614  C  CA  . VAL A 1 510 ? 142.806 99.949  197.005 1.00 95.60  ? 511 VAL A CA  1 
ATOM   3615  C  C   . VAL A 1 510 ? 142.704 99.567  198.461 1.00 98.57  ? 511 VAL A C   1 
ATOM   3616  O  O   . VAL A 1 510 ? 143.595 99.869  199.238 1.00 98.80  ? 511 VAL A O   1 
ATOM   3617  C  CB  . VAL A 1 510 ? 143.984 99.241  196.382 1.00 95.41  ? 511 VAL A CB  1 
ATOM   3618  C  CG1 . VAL A 1 510 ? 143.772 97.759  196.435 1.00 95.37  ? 511 VAL A CG1 1 
ATOM   3619  C  CG2 . VAL A 1 510 ? 144.141 99.689  194.963 1.00 95.30  ? 511 VAL A CG2 1 
ATOM   3620  N  N   . VAL A 1 511 ? 141.620 98.897  198.837 1.00 109.70 ? 512 VAL A N   1 
ATOM   3621  C  CA  . VAL A 1 511 ? 141.339 98.672  200.251 1.00 112.85 ? 512 VAL A CA  1 
ATOM   3622  C  C   . VAL A 1 511 ? 140.725 97.327  200.591 1.00 116.44 ? 512 VAL A C   1 
ATOM   3623  O  O   . VAL A 1 511 ? 139.962 96.764  199.818 1.00 116.71 ? 512 VAL A O   1 
ATOM   3624  C  CB  . VAL A 1 511 ? 140.383 99.728  200.797 1.00 112.55 ? 512 VAL A CB  1 
ATOM   3625  C  CG1 . VAL A 1 511 ? 141.058 101.079 200.873 1.00 112.46 ? 512 VAL A CG1 1 
ATOM   3626  C  CG2 . VAL A 1 511 ? 139.153 99.795  199.937 1.00 112.36 ? 512 VAL A CG2 1 
ATOM   3627  N  N   . HIS A 1 512 ? 141.069 96.830  201.775 1.00 134.61 ? 513 HIS A N   1 
ATOM   3628  C  CA  . HIS A 1 512 ? 140.499 95.606  202.325 1.00 138.29 ? 513 HIS A CA  1 
ATOM   3629  C  C   . HIS A 1 512 ? 139.501 95.929  203.422 1.00 139.10 ? 513 HIS A C   1 
ATOM   3630  O  O   . HIS A 1 512 ? 139.480 97.040  203.934 1.00 139.24 ? 513 HIS A O   1 
ATOM   3631  C  CB  . HIS A 1 512 ? 141.602 94.729  202.898 1.00 140.28 ? 513 HIS A CB  1 
ATOM   3632  C  CG  . HIS A 1 512 ? 141.173 93.327  203.189 1.00 142.27 ? 513 HIS A CG  1 
ATOM   3633  N  ND1 . HIS A 1 512 ? 140.300 92.635  202.380 1.00 143.08 ? 513 HIS A ND1 1 
ATOM   3634  C  CD2 . HIS A 1 512 ? 141.503 92.485  204.195 1.00 143.25 ? 513 HIS A CD2 1 
ATOM   3635  C  CE1 . HIS A 1 512 ? 140.109 91.427  202.877 1.00 143.67 ? 513 HIS A CE1 1 
ATOM   3636  N  NE2 . HIS A 1 512 ? 140.826 91.311  203.979 1.00 143.71 ? 513 HIS A NE2 1 
ATOM   3637  N  N   . GLU A 1 513 ? 138.676 94.956  203.783 1.00 106.73 ? 514 GLU A N   1 
ATOM   3638  C  CA  . GLU A 1 513 ? 137.722 95.135  204.873 1.00 107.08 ? 514 GLU A CA  1 
ATOM   3639  C  C   . GLU A 1 513 ? 138.258 94.622  206.206 1.00 107.16 ? 514 GLU A C   1 
ATOM   3640  O  O   . GLU A 1 513 ? 138.346 95.368  207.181 1.00 107.12 ? 514 GLU A O   1 
ATOM   3641  C  CB  . GLU A 1 513 ? 136.403 94.444  204.546 1.00 107.20 ? 514 GLU A CB  1 
ATOM   3642  N  N   . GLN A 1 527 ? 139.027 99.273  206.012 1.00 90.52  ? 528 GLN A N   1 
ATOM   3643  C  CA  . GLN A 1 527 ? 140.041 99.344  207.047 1.00 90.73  ? 528 GLN A CA  1 
ATOM   3644  C  C   . GLN A 1 527 ? 141.341 99.897  206.504 1.00 93.32  ? 528 GLN A C   1 
ATOM   3645  O  O   . GLN A 1 527 ? 141.810 100.950 206.925 1.00 93.49  ? 528 GLN A O   1 
ATOM   3646  C  CB  . GLN A 1 527 ? 140.300 97.955  207.629 1.00 89.02  ? 528 GLN A CB  1 
ATOM   3647  C  CG  . GLN A 1 527 ? 139.869 97.781  209.071 1.00 87.71  ? 528 GLN A CG  1 
ATOM   3648  C  CD  . GLN A 1 527 ? 140.711 98.573  210.060 1.00 86.81  ? 528 GLN A CD  1 
ATOM   3649  O  OE1 . GLN A 1 527 ? 141.820 99.001  209.759 1.00 86.60  ? 528 GLN A OE1 1 
ATOM   3650  N  NE2 . GLN A 1 527 ? 140.176 98.765  211.255 1.00 86.19  ? 528 GLN A NE2 1 
ATOM   3651  N  N   . MET A 1 528 ? 141.905 99.179  205.543 1.00 150.67 ? 529 MET A N   1 
ATOM   3652  C  CA  . MET A 1 528 ? 143.316 99.314  205.214 1.00 153.01 ? 529 MET A CA  1 
ATOM   3653  C  C   . MET A 1 528 ? 143.622 99.608  203.746 1.00 151.12 ? 529 MET A C   1 
ATOM   3654  O  O   . MET A 1 528 ? 143.113 98.945  202.853 1.00 151.14 ? 529 MET A O   1 
ATOM   3655  C  CB  . MET A 1 528 ? 144.017 98.034  205.644 1.00 155.97 ? 529 MET A CB  1 
ATOM   3656  C  CG  . MET A 1 528 ? 145.476 97.961  205.302 1.00 157.75 ? 529 MET A CG  1 
ATOM   3657  S  SD  . MET A 1 528 ? 146.173 96.456  205.990 1.00 159.45 ? 529 MET A SD  1 
ATOM   3658  C  CE  . MET A 1 528 ? 145.998 96.805  207.730 1.00 160.43 ? 529 MET A CE  1 
ATOM   3659  N  N   . VAL A 1 529 ? 144.481 100.595 203.516 1.00 106.36 ? 530 VAL A N   1 
ATOM   3660  C  CA  . VAL A 1 529 ? 144.826 101.025 202.171 1.00 103.98 ? 530 VAL A CA  1 
ATOM   3661  C  C   . VAL A 1 529 ? 146.080 100.348 201.640 1.00 101.29 ? 530 VAL A C   1 
ATOM   3662  O  O   . VAL A 1 529 ? 147.183 100.632 202.082 1.00 101.10 ? 530 VAL A O   1 
ATOM   3663  C  CB  . VAL A 1 529 ? 144.996 102.555 202.096 1.00 104.17 ? 530 VAL A CB  1 
ATOM   3664  C  CG1 . VAL A 1 529 ? 143.656 103.235 202.137 1.00 104.21 ? 530 VAL A CG1 1 
ATOM   3665  C  CG2 . VAL A 1 529 ? 145.855 103.052 203.231 1.00 104.29 ? 530 VAL A CG2 1 
ATOM   3666  N  N   . PHE A 1 530 ? 145.904 99.440  200.690 1.00 106.54 ? 531 PHE A N   1 
ATOM   3667  C  CA  . PHE A 1 530 ? 147.039 98.785  200.051 1.00 104.11 ? 531 PHE A CA  1 
ATOM   3668  C  C   . PHE A 1 530 ? 147.735 99.620  198.986 1.00 101.69 ? 531 PHE A C   1 
ATOM   3669  O  O   . PHE A 1 530 ? 148.871 99.339  198.628 1.00 101.51 ? 531 PHE A O   1 
ATOM   3670  C  CB  . PHE A 1 530 ? 146.626 97.445  199.462 1.00 104.11 ? 531 PHE A CB  1 
ATOM   3671  C  CG  . PHE A 1 530 ? 146.294 96.420  200.489 1.00 104.17 ? 531 PHE A CG  1 
ATOM   3672  C  CD1 . PHE A 1 530 ? 147.283 95.696  201.098 1.00 104.13 ? 531 PHE A CD1 1 
ATOM   3673  C  CD2 . PHE A 1 530 ? 144.994 96.185  200.850 1.00 104.18 ? 531 PHE A CD2 1 
ATOM   3674  C  CE1 . PHE A 1 530 ? 146.979 94.759  202.041 1.00 104.14 ? 531 PHE A CE1 1 
ATOM   3675  C  CE2 . PHE A 1 530 ? 144.691 95.249  201.792 1.00 104.22 ? 531 PHE A CE2 1 
ATOM   3676  C  CZ  . PHE A 1 530 ? 145.681 94.535  202.390 1.00 104.17 ? 531 PHE A CZ  1 
ATOM   3677  N  N   . GLY A 1 531 ? 147.068 100.653 198.487 1.00 102.66 ? 532 GLY A N   1 
ATOM   3678  C  CA  . GLY A 1 531 ? 147.682 101.526 197.504 1.00 100.41 ? 532 GLY A CA  1 
ATOM   3679  C  C   . GLY A 1 531 ? 146.801 102.613 196.925 1.00 98.28  ? 532 GLY A C   1 
ATOM   3680  O  O   . GLY A 1 531 ? 145.591 102.599 197.091 1.00 98.13  ? 532 GLY A O   1 
ATOM   3681  N  N   . VAL A 1 532 ? 147.425 103.554 196.228 1.00 86.35  ? 533 VAL A N   1 
ATOM   3682  C  CA  . VAL A 1 532 ? 146.713 104.647 195.593 1.00 84.54  ? 533 VAL A CA  1 
ATOM   3683  C  C   . VAL A 1 532 ? 146.932 104.635 194.095 1.00 83.18  ? 533 VAL A C   1 
ATOM   3684  O  O   . VAL A 1 532 ? 148.056 104.558 193.636 1.00 83.08  ? 533 VAL A O   1 
ATOM   3685  C  CB  . VAL A 1 532 ? 147.199 105.973 196.123 1.00 84.23  ? 533 VAL A CB  1 
ATOM   3686  C  CG1 . VAL A 1 532 ? 146.492 107.094 195.431 1.00 84.14  ? 533 VAL A CG1 1 
ATOM   3687  C  CG2 . VAL A 1 532 ? 146.961 106.044 197.594 1.00 84.16  ? 533 VAL A CG2 1 
ATOM   3688  N  N   . VAL A 1 533 ? 145.852 104.714 193.331 1.00 85.38  ? 534 VAL A N   1 
ATOM   3689  C  CA  . VAL A 1 533 ? 145.950 104.641 191.885 1.00 84.22  ? 534 VAL A CA  1 
ATOM   3690  C  C   . VAL A 1 533 ? 145.229 105.791 191.202 1.00 83.35  ? 534 VAL A C   1 
ATOM   3691  O  O   . VAL A 1 533 ? 144.103 106.110 191.547 1.00 83.28  ? 534 VAL A O   1 
ATOM   3692  C  CB  . VAL A 1 533 ? 145.342 103.342 191.376 1.00 84.02  ? 534 VAL A CB  1 
ATOM   3693  C  CG1 . VAL A 1 533 ? 145.685 103.138 189.933 1.00 83.93  ? 534 VAL A CG1 1 
ATOM   3694  C  CG2 . VAL A 1 533 ? 145.841 102.183 192.187 1.00 84.00  ? 534 VAL A CG2 1 
ATOM   3695  N  N   . THR A 1 534 ? 145.889 106.406 190.225 1.00 88.72  ? 535 THR A N   1 
ATOM   3696  C  CA  . THR A 1 534 ? 145.266 107.405 189.364 1.00 87.92  ? 535 THR A CA  1 
ATOM   3697  C  C   . THR A 1 534 ? 145.283 106.921 187.931 1.00 87.02  ? 535 THR A C   1 
ATOM   3698  O  O   . THR A 1 534 ? 145.773 105.842 187.650 1.00 86.97  ? 535 THR A O   1 
ATOM   3699  C  CB  . THR A 1 534 ? 145.977 108.753 189.425 1.00 88.02  ? 535 THR A CB  1 
ATOM   3700  O  OG1 . THR A 1 534 ? 147.290 108.633 188.879 1.00 88.03  ? 535 THR A OG1 1 
ATOM   3701  C  CG2 . THR A 1 534 ? 146.076 109.231 190.841 1.00 88.10  ? 535 THR A CG2 1 
ATOM   3702  N  N   . ALA A 1 535 ? 144.735 107.712 187.023 1.00 72.35  ? 536 ALA A N   1 
ATOM   3703  C  CA  . ALA A 1 535 ? 144.722 107.322 185.626 1.00 71.57  ? 536 ALA A CA  1 
ATOM   3704  C  C   . ALA A 1 535 ? 146.117 107.245 185.054 1.00 71.20  ? 536 ALA A C   1 
ATOM   3705  O  O   . ALA A 1 535 ? 146.401 106.415 184.202 1.00 71.13  ? 536 ALA A O   1 
ATOM   3706  C  CB  . ALA A 1 535 ? 143.891 108.284 184.827 1.00 71.39  ? 536 ALA A CB  1 
ATOM   3707  N  N   . ILE A 1 536 ? 146.991 108.109 185.542 1.00 78.47  ? 537 ILE A N   1 
ATOM   3708  C  CA  . ILE A 1 536 ? 148.360 108.136 185.073 1.00 78.26  ? 537 ILE A CA  1 
ATOM   3709  C  C   . ILE A 1 536 ? 149.073 106.841 185.422 1.00 78.85  ? 537 ILE A C   1 
ATOM   3710  O  O   . ILE A 1 536 ? 149.886 106.345 184.660 1.00 78.90  ? 537 ILE A O   1 
ATOM   3711  C  CB  . ILE A 1 536 ? 149.116 109.333 185.663 1.00 77.64  ? 537 ILE A CB  1 
ATOM   3712  C  CG1 . ILE A 1 536 ? 148.539 110.632 185.123 1.00 77.32  ? 537 ILE A CG1 1 
ATOM   3713  C  CG2 . ILE A 1 536 ? 150.572 109.284 185.314 1.00 77.49  ? 537 ILE A CG2 1 
ATOM   3714  C  CD1 . ILE A 1 536 ? 149.276 111.860 185.582 1.00 77.15  ? 537 ILE A CD1 1 
ATOM   3715  N  N   . ASP A 1 537 ? 148.738 106.274 186.567 1.00 92.93  ? 538 ASP A N   1 
ATOM   3716  C  CA  . ASP A 1 537 ? 149.359 105.036 186.988 1.00 93.51  ? 538 ASP A CA  1 
ATOM   3717  C  C   . ASP A 1 537 ? 148.923 103.891 186.089 1.00 93.89  ? 538 ASP A C   1 
ATOM   3718  O  O   . ASP A 1 537 ? 149.727 103.049 185.703 1.00 93.95  ? 538 ASP A O   1 
ATOM   3719  C  CB  . ASP A 1 537 ? 149.014 104.741 188.448 1.00 93.65  ? 538 ASP A CB  1 
ATOM   3720  C  CG  . ASP A 1 537 ? 149.571 105.782 189.406 1.00 93.71  ? 538 ASP A CG  1 
ATOM   3721  O  OD1 . ASP A 1 537 ? 148.860 106.173 190.354 1.00 93.75  ? 538 ASP A OD1 1 
ATOM   3722  O  OD2 . ASP A 1 537 ? 150.724 106.209 189.217 1.00 93.74  1 538 ASP A OD2 1 
ATOM   3723  N  N   . LEU A 1 538 ? 147.645 103.882 185.739 1.00 85.69  ? 539 LEU A N   1 
ATOM   3724  C  CA  . LEU A 1 538 ? 147.101 102.864 184.857 1.00 86.02  ? 539 LEU A CA  1 
ATOM   3725  C  C   . LEU A 1 538 ? 147.721 102.983 183.484 1.00 86.22  ? 539 LEU A C   1 
ATOM   3726  O  O   . LEU A 1 538 ? 147.987 101.989 182.811 1.00 86.36  ? 539 LEU A O   1 
ATOM   3727  C  CB  . LEU A 1 538 ? 145.586 103.026 184.756 1.00 86.12  ? 539 LEU A CB  1 
ATOM   3728  C  CG  . LEU A 1 538 ? 144.870 102.144 183.738 1.00 86.23  ? 539 LEU A CG  1 
ATOM   3729  C  CD1 . LEU A 1 538 ? 145.143 100.699 184.027 1.00 86.27  ? 539 LEU A CD1 1 
ATOM   3730  C  CD2 . LEU A 1 538 ? 143.384 102.401 183.741 1.00 86.28  ? 539 LEU A CD2 1 
ATOM   3731  N  N   . LEU A 1 539 ? 147.986 104.216 183.088 1.00 83.60  ? 540 LEU A N   1 
ATOM   3732  C  CA  . LEU A 1 539 ? 148.597 104.461 181.805 1.00 83.82  ? 540 LEU A CA  1 
ATOM   3733  C  C   . LEU A 1 539 ? 150.011 103.948 181.810 1.00 85.07  ? 540 LEU A C   1 
ATOM   3734  O  O   . LEU A 1 539 ? 150.426 103.271 180.887 1.00 85.22  ? 540 LEU A O   1 
ATOM   3735  C  CB  . LEU A 1 539 ? 148.604 105.951 181.497 1.00 83.07  ? 540 LEU A CB  1 
ATOM   3736  C  CG  . LEU A 1 539 ? 149.276 106.363 180.192 1.00 82.45  ? 540 LEU A CG  1 
ATOM   3737  C  CD1 . LEU A 1 539 ? 148.544 105.764 179.023 1.00 82.26  ? 540 LEU A CD1 1 
ATOM   3738  C  CD2 . LEU A 1 539 ? 149.317 107.863 180.073 1.00 82.25  ? 540 LEU A CD2 1 
ATOM   3739  N  N   . ASN A 1 540 ? 150.744 104.256 182.870 1.00 85.14  ? 541 ASN A N   1 
ATOM   3740  C  CA  . ASN A 1 540 ? 152.134 103.856 182.957 1.00 86.53  ? 541 ASN A CA  1 
ATOM   3741  C  C   . ASN A 1 540 ? 152.248 102.355 182.955 1.00 88.50  ? 541 ASN A C   1 
ATOM   3742  O  O   . ASN A 1 540 ? 153.144 101.795 182.345 1.00 88.79  ? 541 ASN A O   1 
ATOM   3743  C  CB  . ASN A 1 540 ? 152.770 104.394 184.234 1.00 86.17  ? 541 ASN A CB  1 
ATOM   3744  C  CG  . ASN A 1 540 ? 153.104 105.858 184.148 1.00 85.90  ? 541 ASN A CG  1 
ATOM   3745  O  OD1 . ASN A 1 540 ? 153.387 106.378 183.079 1.00 85.88  ? 541 ASN A OD1 1 
ATOM   3746  N  ND2 . ASN A 1 540 ? 153.086 106.532 185.285 1.00 85.78  ? 541 ASN A ND2 1 
ATOM   3747  N  N   . PHE A 1 541 ? 151.303 101.699 183.608 1.00 93.43  ? 542 PHE A N   1 
ATOM   3748  C  CA  . PHE A 1 541 ? 151.327 100.253 183.662 1.00 95.56  ? 542 PHE A CA  1 
ATOM   3749  C  C   . PHE A 1 541 ? 151.076 99.681  182.292 1.00 97.62  ? 542 PHE A C   1 
ATOM   3750  O  O   . PHE A 1 541 ? 151.811 98.814  181.830 1.00 98.01  ? 542 PHE A O   1 
ATOM   3751  C  CB  . PHE A 1 541 ? 150.279 99.736  184.642 1.00 95.65  ? 542 PHE A CB  1 
ATOM   3752  C  CG  . PHE A 1 541 ? 150.027 98.267  184.540 1.00 95.68  ? 542 PHE A CG  1 
ATOM   3753  C  CD1 . PHE A 1 541 ? 150.886 97.366  185.117 1.00 95.71  ? 542 PHE A CD1 1 
ATOM   3754  C  CD2 . PHE A 1 541 ? 148.922 97.791  183.882 1.00 95.70  ? 542 PHE A CD2 1 
ATOM   3755  C  CE1 . PHE A 1 541 ? 150.651 96.020  185.031 1.00 95.77  ? 542 PHE A CE1 1 
ATOM   3756  C  CE2 . PHE A 1 541 ? 148.687 96.449  183.795 1.00 95.71  ? 542 PHE A CE2 1 
ATOM   3757  C  CZ  . PHE A 1 541 ? 149.552 95.561  184.369 1.00 95.73  ? 542 PHE A CZ  1 
ATOM   3758  N  N   . VAL A 1 542 ? 150.043 100.181 181.629 1.00 114.25 ? 543 VAL A N   1 
ATOM   3759  C  CA  . VAL A 1 542 ? 149.676 99.623  180.339 1.00 116.20 ? 543 VAL A CA  1 
ATOM   3760  C  C   . VAL A 1 542 ? 150.784 99.835  179.326 1.00 117.39 ? 543 VAL A C   1 
ATOM   3761  O  O   . VAL A 1 542 ? 151.173 98.916  178.618 1.00 117.73 ? 543 VAL A O   1 
ATOM   3762  C  CB  . VAL A 1 542 ? 148.355 100.219 179.819 1.00 116.81 ? 543 VAL A CB  1 
ATOM   3763  C  CG1 . VAL A 1 542 ? 148.208 99.989  178.332 1.00 117.05 ? 543 VAL A CG1 1 
ATOM   3764  C  CG2 . VAL A 1 542 ? 147.190 99.613  180.553 1.00 116.92 ? 543 VAL A CG2 1 
ATOM   3765  N  N   . ALA A 1 543 ? 151.316 101.047 179.285 1.00 102.96 ? 544 ALA A N   1 
ATOM   3766  C  CA  . ALA A 1 543 ? 152.368 101.362 178.340 1.00 104.01 ? 544 ALA A CA  1 
ATOM   3767  C  C   . ALA A 1 543 ? 153.616 100.568 178.644 1.00 105.28 ? 544 ALA A C   1 
ATOM   3768  O  O   . ALA A 1 543 ? 154.354 100.198 177.742 1.00 105.44 ? 544 ALA A O   1 
ATOM   3769  C  CB  . ALA A 1 543 ? 152.668 102.836 178.363 1.00 103.87 ? 544 ALA A CB  1 
ATOM   3770  N  N   . ALA A 1 544 ? 153.853 100.297 179.917 1.00 106.57 ? 545 ALA A N   1 
ATOM   3771  C  CA  . ALA A 1 544 ? 155.028 99.529  180.284 1.00 107.99 ? 545 ALA A CA  1 
ATOM   3772  C  C   . ALA A 1 544 ? 154.890 98.094  179.824 1.00 109.85 ? 545 ALA A C   1 
ATOM   3773  O  O   . ALA A 1 544 ? 155.828 97.507  179.304 1.00 110.18 ? 545 ALA A O   1 
ATOM   3774  C  CB  . ALA A 1 544 ? 155.247 99.579  181.766 1.00 107.75 ? 545 ALA A CB  1 
ATOM   3775  N  N   . GLN A 1 545 ? 153.713 97.526  180.019 1.00 119.47 ? 546 GLN A N   1 
ATOM   3776  C  CA  . GLN A 1 545 ? 153.481 96.166  179.582 1.00 121.36 ? 546 GLN A CA  1 
ATOM   3777  C  C   . GLN A 1 545 ? 153.508 96.085  178.069 1.00 124.02 ? 546 GLN A C   1 
ATOM   3778  O  O   . GLN A 1 545 ? 153.809 95.040  177.502 1.00 124.37 ? 546 GLN A O   1 
ATOM   3779  C  CB  . GLN A 1 545 ? 152.148 95.663  180.114 1.00 120.88 ? 546 GLN A CB  1 
ATOM   3780  C  CG  . GLN A 1 545 ? 152.098 95.579  181.613 1.00 120.53 ? 546 GLN A CG  1 
ATOM   3781  C  CD  . GLN A 1 545 ? 152.802 94.361  182.128 1.00 120.41 ? 546 GLN A CD  1 
ATOM   3782  O  OE1 . GLN A 1 545 ? 152.668 93.278  181.573 1.00 120.36 ? 546 GLN A OE1 1 
ATOM   3783  N  NE2 . GLN A 1 545 ? 153.564 94.527  183.191 1.00 120.30 ? 546 GLN A NE2 1 
ATOM   3784  N  N   . GLU A 1 546 ? 153.170 97.187  177.415 1.00 116.01 ? 547 GLU A N   1 
ATOM   3785  C  CA  . GLU A 1 546 ? 153.131 97.220  175.959 1.00 118.84 ? 547 GLU A CA  1 
ATOM   3786  C  C   . GLU A 1 546 ? 154.482 97.082  175.273 1.00 122.39 ? 547 GLU A C   1 
ATOM   3787  O  O   . GLU A 1 546 ? 154.580 96.513  174.190 1.00 122.64 ? 547 GLU A O   1 
ATOM   3788  C  CB  . GLU A 1 546 ? 152.410 98.474  175.469 1.00 118.39 ? 547 GLU A CB  1 
ATOM   3789  C  CG  . GLU A 1 546 ? 150.900 98.352  175.534 1.00 118.02 ? 547 GLU A CG  1 
ATOM   3790  C  CD  . GLU A 1 546 ? 150.196 99.556  174.971 1.00 117.94 ? 547 GLU A CD  1 
ATOM   3791  O  OE1 . GLU A 1 546 ? 150.867 100.578 174.730 1.00 117.90 ? 547 GLU A OE1 1 
ATOM   3792  O  OE2 . GLU A 1 546 ? 148.970 99.478  174.767 1.00 117.89 1 547 GLU A OE2 1 
ATOM   3793  N  N   . ARG A 1 547 ? 155.526 97.589  175.905 1.00 122.40 ? 548 ARG A N   1 
ATOM   3794  C  CA  . ARG A 1 547 ? 156.840 97.527  175.297 1.00 125.97 ? 548 ARG A CA  1 
ATOM   3795  C  C   . ARG A 1 547 ? 157.476 96.165  175.524 1.00 128.53 ? 548 ARG A C   1 
ATOM   3796  O  O   . ARG A 1 547 ? 158.475 96.044  176.221 1.00 128.76 ? 548 ARG A O   1 
ATOM   3797  C  CB  . ARG A 1 547 ? 157.720 98.653  175.827 1.00 126.88 ? 548 ARG A CB  1 
ATOM   3798  C  CG  . ARG A 1 547 ? 157.242 100.024 175.399 1.00 127.51 ? 548 ARG A CG  1 
ATOM   3799  C  CD  . ARG A 1 547 ? 158.049 101.114 176.056 1.00 128.25 ? 548 ARG A CD  1 
ATOM   3800  N  NE  . ARG A 1 547 ? 158.045 100.960 177.501 1.00 128.75 ? 548 ARG A NE  1 
ATOM   3801  C  CZ  . ARG A 1 547 ? 158.774 101.695 178.328 1.00 129.25 ? 548 ARG A CZ  1 
ATOM   3802  N  NH1 . ARG A 1 547 ? 158.712 101.483 179.636 1.00 129.41 1 548 ARG A NH1 1 
ATOM   3803  N  NH2 . ARG A 1 547 ? 159.568 102.638 177.846 1.00 129.37 ? 548 ARG A NH2 1 
ATOM   3804  N  N   . LEU B 1 41  ? 155.224 142.732 233.490 1.00 144.59 ? 42  LEU B N   1 
ATOM   3805  C  CA  . LEU B 1 41  ? 154.160 142.304 234.386 1.00 141.68 ? 42  LEU B CA  1 
ATOM   3806  C  C   . LEU B 1 41  ? 152.839 142.073 233.666 1.00 138.04 ? 42  LEU B C   1 
ATOM   3807  O  O   . LEU B 1 41  ? 152.036 142.985 233.496 1.00 137.80 ? 42  LEU B O   1 
ATOM   3808  C  CB  . LEU B 1 41  ? 153.971 143.308 235.519 1.00 142.17 ? 42  LEU B CB  1 
ATOM   3809  C  CG  . LEU B 1 41  ? 154.489 142.863 236.886 1.00 142.58 ? 42  LEU B CG  1 
ATOM   3810  C  CD1 . LEU B 1 41  ? 154.372 143.993 237.897 1.00 142.68 ? 42  LEU B CD1 1 
ATOM   3811  C  CD2 . LEU B 1 41  ? 153.741 141.632 237.371 1.00 142.64 ? 42  LEU B CD2 1 
ATOM   3812  N  N   . TRP B 1 42  ? 152.634 140.839 233.230 1.00 123.93 ? 43  TRP B N   1 
ATOM   3813  C  CA  . TRP B 1 42  ? 151.337 140.402 232.753 1.00 120.44 ? 43  TRP B CA  1 
ATOM   3814  C  C   . TRP B 1 42  ? 151.203 138.916 232.967 1.00 116.40 ? 43  TRP B C   1 
ATOM   3815  O  O   . TRP B 1 42  ? 151.825 138.132 232.268 1.00 116.18 ? 43  TRP B O   1 
ATOM   3816  C  CB  . TRP B 1 42  ? 151.155 140.701 231.277 1.00 120.94 ? 43  TRP B CB  1 
ATOM   3817  C  CG  . TRP B 1 42  ? 149.939 140.046 230.736 1.00 121.45 ? 43  TRP B CG  1 
ATOM   3818  C  CD1 . TRP B 1 42  ? 148.662 140.293 231.101 1.00 121.58 ? 43  TRP B CD1 1 
ATOM   3819  C  CD2 . TRP B 1 42  ? 149.881 139.024 229.739 1.00 121.92 ? 43  TRP B CD2 1 
ATOM   3820  N  NE1 . TRP B 1 42  ? 147.803 139.496 230.394 1.00 121.83 ? 43  TRP B NE1 1 
ATOM   3821  C  CE2 . TRP B 1 42  ? 148.530 138.707 229.548 1.00 122.03 ? 43  TRP B CE2 1 
ATOM   3822  C  CE3 . TRP B 1 42  ? 150.838 138.355 228.985 1.00 122.15 ? 43  TRP B CE3 1 
ATOM   3823  C  CZ2 . TRP B 1 42  ? 148.111 137.753 228.640 1.00 122.22 ? 43  TRP B CZ2 1 
ATOM   3824  C  CZ3 . TRP B 1 42  ? 150.420 137.406 228.085 1.00 122.29 ? 43  TRP B CZ3 1 
ATOM   3825  C  CH2 . TRP B 1 42  ? 149.070 137.114 227.919 1.00 122.27 ? 43  TRP B CH2 1 
ATOM   3826  N  N   . ILE B 1 43  ? 150.395 138.526 233.939 1.00 108.16 ? 44  ILE B N   1 
ATOM   3827  C  CA  . ILE B 1 43  ? 150.190 137.117 234.215 1.00 104.50 ? 44  ILE B CA  1 
ATOM   3828  C  C   . ILE B 1 43  ? 149.082 136.530 233.353 1.00 102.89 ? 44  ILE B C   1 
ATOM   3829  O  O   . ILE B 1 43  ? 148.006 137.093 233.247 1.00 102.68 ? 44  ILE B O   1 
ATOM   3830  C  CB  . ILE B 1 43  ? 149.868 136.902 235.682 1.00 102.90 ? 44  ILE B CB  1 
ATOM   3831  C  CG1 . ILE B 1 43  ? 150.943 137.560 236.538 1.00 102.10 ? 44  ILE B CG1 1 
ATOM   3832  C  CG2 . ILE B 1 43  ? 149.772 135.432 235.986 1.00 102.41 ? 44  ILE B CG2 1 
ATOM   3833  C  CD1 . ILE B 1 43  ? 150.711 137.427 238.015 1.00 101.64 ? 44  ILE B CD1 1 
ATOM   3834  N  N   . ARG B 1 44  ? 149.360 135.390 232.737 1.00 116.49 ? 45  ARG B N   1 
ATOM   3835  C  CA  . ARG B 1 44  ? 148.410 134.738 231.850 1.00 115.10 ? 45  ARG B CA  1 
ATOM   3836  C  C   . ARG B 1 44  ? 147.255 134.092 232.596 1.00 113.15 ? 45  ARG B C   1 
ATOM   3837  O  O   . ARG B 1 44  ? 147.466 133.352 233.546 1.00 112.88 ? 45  ARG B O   1 
ATOM   3838  C  CB  . ARG B 1 44  ? 149.116 133.672 231.015 1.00 115.69 ? 45  ARG B CB  1 
ATOM   3839  C  CG  . ARG B 1 44  ? 149.844 134.198 229.806 1.00 116.28 ? 45  ARG B CG  1 
ATOM   3840  C  CD  . ARG B 1 44  ? 150.450 133.071 228.988 1.00 116.73 ? 45  ARG B CD  1 
ATOM   3841  N  NE  . ARG B 1 44  ? 150.717 133.491 227.621 1.00 117.08 ? 45  ARG B NE  1 
ATOM   3842  C  CZ  . ARG B 1 44  ? 149.942 133.183 226.593 1.00 117.37 ? 45  ARG B CZ  1 
ATOM   3843  N  NH1 . ARG B 1 44  ? 150.246 133.608 225.379 1.00 117.51 1 45  ARG B NH1 1 
ATOM   3844  N  NH2 . ARG B 1 44  ? 148.868 132.441 226.784 1.00 117.44 ? 45  ARG B NH2 1 
ATOM   3845  N  N   . PRO B 1 45  ? 146.024 134.385 232.173 1.00 99.49  ? 46  PRO B N   1 
ATOM   3846  C  CA  . PRO B 1 45  ? 144.798 133.742 232.635 1.00 98.33  ? 46  PRO B CA  1 
ATOM   3847  C  C   . PRO B 1 45  ? 144.712 132.273 232.252 1.00 97.17  ? 46  PRO B C   1 
ATOM   3848  O  O   . PRO B 1 45  ? 143.944 131.527 232.847 1.00 96.95  ? 46  PRO B O   1 
ATOM   3849  C  CB  . PRO B 1 45  ? 143.713 134.535 231.927 1.00 98.43  ? 46  PRO B CB  1 
ATOM   3850  C  CG  . PRO B 1 45  ? 144.335 134.984 230.710 1.00 98.66  ? 46  PRO B CG  1 
ATOM   3851  C  CD  . PRO B 1 45  ? 145.745 135.311 231.067 1.00 99.04  ? 46  PRO B CD  1 
ATOM   3852  N  N   . ASP B 1 46  ? 145.463 131.873 231.237 1.00 104.66 ? 47  ASP B N   1 
ATOM   3853  C  CA  . ASP B 1 46  ? 145.384 130.513 230.733 1.00 103.74 ? 47  ASP B CA  1 
ATOM   3854  C  C   . ASP B 1 46  ? 146.550 129.630 231.128 1.00 103.37 ? 47  ASP B C   1 
ATOM   3855  O  O   . ASP B 1 46  ? 146.752 128.582 230.540 1.00 103.30 ? 47  ASP B O   1 
ATOM   3856  C  CB  . ASP B 1 46  ? 145.225 130.507 229.215 1.00 103.51 ? 47  ASP B CB  1 
ATOM   3857  C  CG  . ASP B 1 46  ? 146.482 130.915 228.495 1.00 103.46 ? 47  ASP B CG  1 
ATOM   3858  O  OD1 . ASP B 1 46  ? 147.191 131.803 228.996 1.00 103.45 ? 47  ASP B OD1 1 
ATOM   3859  O  OD2 . ASP B 1 46  ? 146.762 130.347 227.423 1.00 103.42 1 47  ASP B OD2 1 
ATOM   3860  N  N   . ALA B 1 47  ? 147.325 130.052 232.112 1.00 86.28  ? 48  ALA B N   1 
ATOM   3861  C  CA  . ALA B 1 47  ? 148.460 129.258 232.540 1.00 86.17  ? 48  ALA B CA  1 
ATOM   3862  C  C   . ALA B 1 47  ? 147.964 127.986 233.167 1.00 86.63  ? 48  ALA B C   1 
ATOM   3863  O  O   . ALA B 1 47  ? 146.914 127.980 233.786 1.00 86.53  ? 48  ALA B O   1 
ATOM   3864  C  CB  . ALA B 1 47  ? 149.297 130.020 233.517 1.00 85.88  ? 48  ALA B CB  1 
ATOM   3865  N  N   . PRO B 1 48  ? 148.710 126.893 232.991 1.00 106.26 ? 49  PRO B N   1 
ATOM   3866  C  CA  . PRO B 1 48  ? 148.280 125.612 233.544 1.00 106.75 ? 49  PRO B CA  1 
ATOM   3867  C  C   . PRO B 1 48  ? 148.208 125.678 235.050 1.00 107.36 ? 49  PRO B C   1 
ATOM   3868  O  O   . PRO B 1 48  ? 149.032 126.328 235.680 1.00 107.36 ? 49  PRO B O   1 
ATOM   3869  C  CB  . PRO B 1 48  ? 149.384 124.658 233.105 1.00 106.63 ? 49  PRO B CB  1 
ATOM   3870  C  CG  . PRO B 1 48  ? 150.548 125.523 232.846 1.00 106.50 ? 49  PRO B CG  1 
ATOM   3871  C  CD  . PRO B 1 48  ? 149.997 126.780 232.294 1.00 106.37 ? 49  PRO B CD  1 
ATOM   3872  N  N   . SER B 1 49  ? 147.218 125.006 235.615 1.00 95.45  ? 50  SER B N   1 
ATOM   3873  C  CA  . SER B 1 49  ? 146.978 125.073 237.038 1.00 96.11  ? 50  SER B CA  1 
ATOM   3874  C  C   . SER B 1 49  ? 148.091 124.398 237.806 1.00 96.79  ? 50  SER B C   1 
ATOM   3875  O  O   . SER B 1 49  ? 148.626 123.387 237.377 1.00 96.87  ? 50  SER B O   1 
ATOM   3876  C  CB  . SER B 1 49  ? 145.646 124.424 237.374 1.00 96.11  ? 50  SER B CB  1 
ATOM   3877  O  OG  . SER B 1 49  ? 145.402 124.479 238.763 1.00 96.11  ? 50  SER B OG  1 
ATOM   3878  N  N   . ARG B 1 50  ? 148.448 124.973 238.942 1.00 111.70 ? 51  ARG B N   1 
ATOM   3879  C  CA  . ARG B 1 50  ? 149.438 124.367 239.806 1.00 112.18 ? 51  ARG B CA  1 
ATOM   3880  C  C   . ARG B 1 50  ? 148.827 123.442 240.846 1.00 111.68 ? 51  ARG B C   1 
ATOM   3881  O  O   . ARG B 1 50  ? 149.547 122.794 241.588 1.00 111.69 ? 51  ARG B O   1 
ATOM   3882  C  CB  . ARG B 1 50  ? 150.276 125.441 240.490 1.00 112.90 ? 51  ARG B CB  1 
ATOM   3883  C  CG  . ARG B 1 50  ? 151.152 126.233 239.548 1.00 113.86 ? 51  ARG B CG  1 
ATOM   3884  C  CD  . ARG B 1 50  ? 152.071 127.185 240.293 1.00 114.57 ? 51  ARG B CD  1 
ATOM   3885  N  NE  . ARG B 1 50  ? 151.334 128.167 241.076 1.00 114.95 ? 51  ARG B NE  1 
ATOM   3886  C  CZ  . ARG B 1 50  ? 150.932 129.341 240.605 1.00 115.28 ? 51  ARG B CZ  1 
ATOM   3887  N  NH1 . ARG B 1 50  ? 151.201 129.678 239.354 1.00 115.72 1 51  ARG B NH1 1 
ATOM   3888  N  NH2 . ARG B 1 50  ? 150.265 130.176 241.387 1.00 115.59 ? 51  ARG B NH2 1 
ATOM   3889  N  N   . CYS B 1 51  ? 147.504 123.376 240.901 1.00 98.37  ? 52  CYS B N   1 
ATOM   3890  C  CA  . CYS B 1 51  ? 146.834 122.632 241.961 1.00 97.73  ? 52  CYS B CA  1 
ATOM   3891  C  C   . CYS B 1 51  ? 147.167 121.154 241.905 1.00 97.18  ? 52  CYS B C   1 
ATOM   3892  O  O   . CYS B 1 51  ? 147.237 120.572 240.834 1.00 97.14  ? 52  CYS B O   1 
ATOM   3893  C  CB  . CYS B 1 51  ? 145.324 122.824 241.880 1.00 97.67  ? 52  CYS B CB  1 
ATOM   3894  S  SG  . CYS B 1 51  ? 144.436 122.309 243.348 1.00 97.46  ? 52  CYS B SG  1 
ATOM   3895  N  N   . THR B 1 52  ? 147.372 120.553 243.071 1.00 101.07 ? 53  THR B N   1 
ATOM   3896  C  CA  . THR B 1 52  ? 147.728 119.143 243.158 1.00 100.63 ? 53  THR B CA  1 
ATOM   3897  C  C   . THR B 1 52  ? 146.572 118.306 243.657 1.00 100.59 ? 53  THR B C   1 
ATOM   3898  O  O   . THR B 1 52  ? 146.764 117.188 244.112 1.00 100.56 ? 53  THR B O   1 
ATOM   3899  C  CB  . THR B 1 52  ? 148.926 118.902 244.073 1.00 100.35 ? 53  THR B CB  1 
ATOM   3900  O  OG1 . THR B 1 52  ? 148.606 119.332 245.398 1.00 100.31 ? 53  THR B OG1 1 
ATOM   3901  C  CG2 . THR B 1 52  ? 150.129 119.661 243.574 1.00 100.22 ? 53  THR B CG2 1 
ATOM   3902  N  N   . TRP B 1 53  ? 145.373 118.865 243.600 1.00 95.96  ? 54  TRP B N   1 
ATOM   3903  C  CA  . TRP B 1 53  ? 144.181 118.113 243.944 1.00 95.99  ? 54  TRP B CA  1 
ATOM   3904  C  C   . TRP B 1 53  ? 143.988 116.970 242.975 1.00 97.51  ? 54  TRP B C   1 
ATOM   3905  O  O   . TRP B 1 53  ? 144.226 117.112 241.785 1.00 97.61  ? 54  TRP B O   1 
ATOM   3906  C  CB  . TRP B 1 53  ? 142.941 119.005 243.899 1.00 94.91  ? 54  TRP B CB  1 
ATOM   3907  C  CG  . TRP B 1 53  ? 141.654 118.282 244.214 1.00 93.85  ? 54  TRP B CG  1 
ATOM   3908  C  CD1 . TRP B 1 53  ? 141.063 118.162 245.426 1.00 93.32  ? 54  TRP B CD1 1 
ATOM   3909  C  CD2 . TRP B 1 53  ? 140.808 117.599 243.290 1.00 93.32  ? 54  TRP B CD2 1 
ATOM   3910  N  NE1 . TRP B 1 53  ? 139.906 117.444 245.323 1.00 93.13  ? 54  TRP B NE1 1 
ATOM   3911  C  CE2 . TRP B 1 53  ? 139.728 117.086 244.018 1.00 93.07  ? 54  TRP B CE2 1 
ATOM   3912  C  CE3 . TRP B 1 53  ? 140.860 117.371 241.920 1.00 93.11  ? 54  TRP B CE3 1 
ATOM   3913  C  CZ2 . TRP B 1 53  ? 138.717 116.359 243.425 1.00 92.92  ? 54  TRP B CZ2 1 
ATOM   3914  C  CZ3 . TRP B 1 53  ? 139.856 116.649 241.337 1.00 92.93  ? 54  TRP B CZ3 1 
ATOM   3915  C  CH2 . TRP B 1 53  ? 138.799 116.152 242.084 1.00 92.84  ? 54  TRP B CH2 1 
ATOM   3916  N  N   . GLN B 1 54  ? 143.550 115.835 243.496 1.00 113.60 ? 55  GLN B N   1 
ATOM   3917  C  CA  . GLN B 1 54  ? 143.084 114.743 242.664 1.00 115.21 ? 55  GLN B CA  1 
ATOM   3918  C  C   . GLN B 1 54  ? 142.051 113.966 243.453 1.00 116.69 ? 55  GLN B C   1 
ATOM   3919  O  O   . GLN B 1 54  ? 142.086 113.955 244.679 1.00 116.84 ? 55  GLN B O   1 
ATOM   3920  C  CB  . GLN B 1 54  ? 144.242 113.857 242.198 1.00 115.35 ? 55  GLN B CB  1 
ATOM   3921  C  CG  . GLN B 1 54  ? 145.222 113.463 243.279 1.00 115.44 ? 55  GLN B CG  1 
ATOM   3922  C  CD  . GLN B 1 54  ? 146.459 112.792 242.728 1.00 115.58 ? 55  GLN B CD  1 
ATOM   3923  O  OE1 . GLN B 1 54  ? 146.480 112.358 241.582 1.00 115.59 ? 55  GLN B OE1 1 
ATOM   3924  N  NE2 . GLN B 1 54  ? 147.504 112.714 243.541 1.00 115.66 ? 55  GLN B NE2 1 
ATOM   3925  N  N   . LEU B 1 55  ? 141.115 113.343 242.750 1.00 110.07 ? 56  LEU B N   1 
ATOM   3926  C  CA  . LEU B 1 55  ? 140.007 112.691 243.417 1.00 111.60 ? 56  LEU B CA  1 
ATOM   3927  C  C   . LEU B 1 55  ? 140.522 111.589 244.313 1.00 112.76 ? 56  LEU B C   1 
ATOM   3928  O  O   . LEU B 1 55  ? 141.212 110.684 243.862 1.00 112.85 ? 56  LEU B O   1 
ATOM   3929  C  CB  . LEU B 1 55  ? 139.037 112.123 242.388 1.00 111.92 ? 56  LEU B CB  1 
ATOM   3930  C  CG  . LEU B 1 55  ? 137.813 111.394 242.941 1.00 112.20 ? 56  LEU B CG  1 
ATOM   3931  C  CD1 . LEU B 1 55  ? 137.105 112.244 243.966 1.00 112.29 ? 56  LEU B CD1 1 
ATOM   3932  C  CD2 . LEU B 1 55  ? 136.861 111.024 241.825 1.00 112.30 ? 56  LEU B CD2 1 
ATOM   3933  N  N   . GLY B 1 56  ? 140.137 111.646 245.578 1.00 97.28  ? 57  GLY B N   1 
ATOM   3934  C  CA  . GLY B 1 56  ? 140.609 110.691 246.555 1.00 98.60  ? 57  GLY B CA  1 
ATOM   3935  C  C   . GLY B 1 56  ? 141.475 111.263 247.657 1.00 100.09 ? 57  GLY B C   1 
ATOM   3936  O  O   . GLY B 1 56  ? 141.600 110.660 248.717 1.00 100.18 ? 57  GLY B O   1 
ATOM   3937  N  N   . ARG B 1 57  ? 142.066 112.426 247.426 1.00 135.44 ? 58  ARG B N   1 
ATOM   3938  C  CA  . ARG B 1 57  ? 142.859 113.069 248.463 1.00 136.98 ? 58  ARG B CA  1 
ATOM   3939  C  C   . ARG B 1 57  ? 141.949 113.496 249.602 1.00 137.24 ? 58  ARG B C   1 
ATOM   3940  O  O   . ARG B 1 57  ? 140.880 114.045 249.366 1.00 137.29 ? 58  ARG B O   1 
ATOM   3941  C  CB  . ARG B 1 57  ? 143.587 114.295 247.914 1.00 137.95 ? 58  ARG B CB  1 
ATOM   3942  C  CG  . ARG B 1 57  ? 144.609 114.009 246.828 1.00 138.75 ? 58  ARG B CG  1 
ATOM   3943  C  CD  . ARG B 1 57  ? 145.938 113.541 247.392 1.00 139.41 ? 58  ARG B CD  1 
ATOM   3944  N  NE  . ARG B 1 57  ? 146.663 114.606 248.073 1.00 139.97 ? 58  ARG B NE  1 
ATOM   3945  C  CZ  . ARG B 1 57  ? 147.509 115.432 247.470 1.00 140.50 ? 58  ARG B CZ  1 
ATOM   3946  N  NH1 . ARG B 1 57  ? 148.133 116.369 248.164 1.00 140.72 1 58  ARG B NH1 1 
ATOM   3947  N  NH2 . ARG B 1 57  ? 147.727 115.321 246.173 1.00 140.64 ? 58  ARG B NH2 1 
ATOM   3948  N  N   . PRO B 1 58  ? 142.363 113.230 250.842 1.00 140.04 ? 59  PRO B N   1 
ATOM   3949  C  CA  . PRO B 1 58  ? 141.628 113.670 252.029 1.00 140.04 ? 59  PRO B CA  1 
ATOM   3950  C  C   . PRO B 1 58  ? 141.568 115.181 252.107 1.00 139.81 ? 59  PRO B C   1 
ATOM   3951  O  O   . PRO B 1 58  ? 142.513 115.849 251.705 1.00 139.43 ? 59  PRO B O   1 
ATOM   3952  C  CB  . PRO B 1 58  ? 142.475 113.135 253.180 1.00 140.22 ? 59  PRO B CB  1 
ATOM   3953  C  CG  . PRO B 1 58  ? 143.233 112.011 252.598 1.00 140.28 ? 59  PRO B CG  1 
ATOM   3954  C  CD  . PRO B 1 58  ? 143.530 112.413 251.194 1.00 140.22 ? 59  PRO B CD  1 
ATOM   3955  N  N   . ALA B 1 59  ? 140.472 115.709 252.629 1.00 105.57 ? 60  ALA B N   1 
ATOM   3956  C  CA  . ALA B 1 59  ? 140.287 117.146 252.712 1.00 105.43 ? 60  ALA B CA  1 
ATOM   3957  C  C   . ALA B 1 59  ? 141.314 117.791 253.623 1.00 105.37 ? 60  ALA B C   1 
ATOM   3958  O  O   . ALA B 1 59  ? 141.626 118.967 253.484 1.00 105.32 ? 60  ALA B O   1 
ATOM   3959  C  CB  . ALA B 1 59  ? 138.900 117.463 253.186 1.00 105.37 ? 60  ALA B CB  1 
ATOM   3960  N  N   . SER B 1 60  ? 141.835 117.013 254.561 1.00 151.10 ? 61  SER B N   1 
ATOM   3961  C  CA  . SER B 1 60  ? 142.815 117.517 255.511 1.00 150.87 ? 61  SER B CA  1 
ATOM   3962  C  C   . SER B 1 60  ? 144.112 117.928 254.831 1.00 149.97 ? 61  SER B C   1 
ATOM   3963  O  O   . SER B 1 60  ? 144.829 118.791 255.325 1.00 149.97 ? 61  SER B O   1 
ATOM   3964  C  CB  . SER B 1 60  ? 143.099 116.469 256.584 1.00 151.18 ? 61  SER B CB  1 
ATOM   3965  O  OG  . SER B 1 60  ? 143.511 115.249 256.001 1.00 151.28 ? 61  SER B OG  1 
ATOM   3966  N  N   . GLU B 1 61  ? 144.407 117.311 253.694 1.00 130.92 ? 62  GLU B N   1 
ATOM   3967  C  CA  . GLU B 1 61  ? 145.656 117.579 252.997 1.00 129.69 ? 62  GLU B CA  1 
ATOM   3968  C  C   . GLU B 1 61  ? 145.658 118.919 252.281 1.00 127.06 ? 62  GLU B C   1 
ATOM   3969  O  O   . GLU B 1 61  ? 146.709 119.407 251.882 1.00 126.59 ? 62  GLU B O   1 
ATOM   3970  C  CB  . GLU B 1 61  ? 145.974 116.460 252.009 1.00 130.74 ? 62  GLU B CB  1 
ATOM   3971  C  CG  . GLU B 1 61  ? 146.395 115.163 252.665 1.00 131.43 ? 62  GLU B CG  1 
ATOM   3972  C  CD  . GLU B 1 61  ? 146.776 114.096 251.663 1.00 131.80 ? 62  GLU B CD  1 
ATOM   3973  O  OE1 . GLU B 1 61  ? 147.090 114.446 250.508 1.00 131.93 ? 62  GLU B OE1 1 
ATOM   3974  O  OE2 . GLU B 1 61  ? 146.760 112.905 252.030 1.00 131.93 1 62  GLU B OE2 1 
ATOM   3975  N  N   . SER B 1 62  ? 144.480 119.509 252.116 1.00 123.09 ? 63  SER B N   1 
ATOM   3976  C  CA  . SER B 1 62  ? 144.348 120.775 251.401 1.00 120.58 ? 63  SER B CA  1 
ATOM   3977  C  C   . SER B 1 62  ? 144.986 121.936 252.147 1.00 118.41 ? 63  SER B C   1 
ATOM   3978  O  O   . SER B 1 62  ? 144.817 122.077 253.353 1.00 118.26 ? 63  SER B O   1 
ATOM   3979  C  CB  . SER B 1 62  ? 142.882 121.093 251.128 1.00 120.57 ? 63  SER B CB  1 
ATOM   3980  O  OG  . SER B 1 62  ? 142.765 122.290 250.388 1.00 120.56 ? 63  SER B OG  1 
ATOM   3981  N  N   . PRO B 1 63  ? 145.735 122.768 251.422 1.00 98.84  ? 64  PRO B N   1 
ATOM   3982  C  CA  . PRO B 1 63  ? 146.386 123.940 251.985 1.00 97.76  ? 64  PRO B CA  1 
ATOM   3983  C  C   . PRO B 1 63  ? 145.417 125.090 252.097 1.00 96.86  ? 64  PRO B C   1 
ATOM   3984  O  O   . PRO B 1 63  ? 145.677 126.037 252.822 1.00 96.76  ? 64  PRO B O   1 
ATOM   3985  C  CB  . PRO B 1 63  ? 147.427 124.269 250.930 1.00 97.67  ? 64  PRO B CB  1 
ATOM   3986  C  CG  . PRO B 1 63  ? 146.798 123.864 249.677 1.00 97.65  ? 64  PRO B CG  1 
ATOM   3987  C  CD  . PRO B 1 63  ? 145.995 122.647 249.983 1.00 97.93  ? 64  PRO B CD  1 
ATOM   3988  N  N   . HIS B 1 64  ? 144.311 125.001 251.373 1.00 88.14  ? 65  HIS B N   1 
ATOM   3989  C  CA  . HIS B 1 64  ? 143.380 126.109 251.245 1.00 87.50  ? 65  HIS B CA  1 
ATOM   3990  C  C   . HIS B 1 64  ? 142.574 126.356 252.507 1.00 89.38  ? 65  HIS B C   1 
ATOM   3991  O  O   . HIS B 1 64  ? 142.251 125.429 253.231 1.00 89.45  ? 65  HIS B O   1 
ATOM   3992  C  CB  . HIS B 1 64  ? 142.444 125.858 250.065 1.00 85.69  ? 65  HIS B CB  1 
ATOM   3993  C  CG  . HIS B 1 64  ? 143.153 125.541 248.789 1.00 83.87  ? 65  HIS B CG  1 
ATOM   3994  N  ND1 . HIS B 1 64  ? 143.968 126.448 248.146 1.00 83.04  ? 65  HIS B ND1 1 
ATOM   3995  C  CD2 . HIS B 1 64  ? 143.163 124.421 248.027 1.00 82.71  ? 65  HIS B CD2 1 
ATOM   3996  C  CE1 . HIS B 1 64  ? 144.450 125.897 247.049 1.00 82.29  ? 65  HIS B CE1 1 
ATOM   3997  N  NE2 . HIS B 1 64  ? 143.985 124.674 246.949 1.00 82.02  ? 65  HIS B NE2 1 
ATOM   3998  N  N   . HIS B 1 65  ? 142.254 127.619 252.764 1.00 112.98 ? 66  HIS B N   1 
ATOM   3999  C  CA  . HIS B 1 65  ? 141.374 127.986 253.862 1.00 115.01 ? 66  HIS B CA  1 
ATOM   4000  C  C   . HIS B 1 65  ? 139.937 127.788 253.432 1.00 116.42 ? 66  HIS B C   1 
ATOM   4001  O  O   . HIS B 1 65  ? 139.491 128.384 252.468 1.00 116.54 ? 66  HIS B O   1 
ATOM   4002  C  CB  . HIS B 1 65  ? 141.605 129.444 254.254 1.00 115.47 ? 66  HIS B CB  1 
ATOM   4003  C  CG  . HIS B 1 65  ? 140.529 130.022 255.120 1.00 115.91 ? 66  HIS B CG  1 
ATOM   4004  N  ND1 . HIS B 1 65  ? 140.268 129.564 256.392 1.00 116.10 ? 66  HIS B ND1 1 
ATOM   4005  C  CD2 . HIS B 1 65  ? 139.660 131.037 254.901 1.00 116.06 ? 66  HIS B CD2 1 
ATOM   4006  C  CE1 . HIS B 1 65  ? 139.278 130.263 256.915 1.00 116.18 ? 66  HIS B CE1 1 
ATOM   4007  N  NE2 . HIS B 1 65  ? 138.891 131.163 256.031 1.00 116.08 ? 66  HIS B NE2 1 
ATOM   4008  N  N   . HIS B 1 66  ? 139.212 126.940 254.146 1.00 105.05 ? 67  HIS B N   1 
ATOM   4009  C  CA  . HIS B 1 66  ? 137.815 126.689 253.826 1.00 106.46 ? 67  HIS B CA  1 
ATOM   4010  C  C   . HIS B 1 66  ? 136.864 127.432 254.745 1.00 108.04 ? 67  HIS B C   1 
ATOM   4011  O  O   . HIS B 1 66  ? 137.154 127.636 255.915 1.00 108.13 ? 67  HIS B O   1 
ATOM   4012  C  CB  . HIS B 1 66  ? 137.524 125.196 253.860 1.00 106.35 ? 67  HIS B CB  1 
ATOM   4013  C  CG  . HIS B 1 66  ? 138.229 124.429 252.794 1.00 106.20 ? 67  HIS B CG  1 
ATOM   4014  N  ND1 . HIS B 1 66  ? 137.658 124.162 251.571 1.00 106.14 ? 67  HIS B ND1 1 
ATOM   4015  C  CD2 . HIS B 1 66  ? 139.464 123.881 252.760 1.00 106.18 ? 67  HIS B CD2 1 
ATOM   4016  C  CE1 . HIS B 1 66  ? 138.509 123.479 250.831 1.00 106.14 ? 67  HIS B CE1 1 
ATOM   4017  N  NE2 . HIS B 1 66  ? 139.613 123.293 251.531 1.00 106.16 ? 67  HIS B NE2 1 
ATOM   4018  N  N   . THR B 1 67  ? 135.724 127.837 254.203 1.00 106.43 ? 68  THR B N   1 
ATOM   4019  C  CA  . THR B 1 67  ? 134.733 128.559 254.980 1.00 108.01 ? 68  THR B CA  1 
ATOM   4020  C  C   . THR B 1 67  ? 133.435 127.791 255.074 1.00 109.89 ? 68  THR B C   1 
ATOM   4021  O  O   . THR B 1 67  ? 132.873 127.379 254.071 1.00 109.83 ? 68  THR B O   1 
ATOM   4022  C  CB  . THR B 1 67  ? 134.427 129.930 254.380 1.00 107.78 ? 68  THR B CB  1 
ATOM   4023  O  OG1 . THR B 1 67  ? 133.985 129.775 253.030 1.00 107.77 ? 68  THR B OG1 1 
ATOM   4024  C  CG2 . THR B 1 67  ? 135.662 130.806 254.401 1.00 107.55 ? 68  THR B CG2 1 
ATOM   4025  N  N   . ALA B 1 68  ? 132.964 127.597 256.295 1.00 151.70 ? 69  ALA B N   1 
ATOM   4026  C  CA  . ALA B 1 68  ? 131.682 126.954 256.515 1.00 153.44 ? 69  ALA B CA  1 
ATOM   4027  C  C   . ALA B 1 68  ? 130.564 127.930 256.230 1.00 154.23 ? 69  ALA B C   1 
ATOM   4028  O  O   . ALA B 1 68  ? 130.656 129.096 256.593 1.00 154.37 ? 69  ALA B O   1 
ATOM   4029  C  CB  . ALA B 1 68  ? 131.587 126.453 257.934 1.00 153.88 ? 69  ALA B CB  1 
ATOM   4030  N  N   . PRO B 1 69  ? 129.505 127.460 255.572 1.00 136.30 ? 70  PRO B N   1 
ATOM   4031  C  CA  . PRO B 1 69  ? 128.309 128.284 255.416 1.00 135.82 ? 70  PRO B CA  1 
ATOM   4032  C  C   . PRO B 1 69  ? 127.725 128.592 256.782 1.00 133.96 ? 70  PRO B C   1 
ATOM   4033  O  O   . PRO B 1 69  ? 127.809 127.755 257.674 1.00 133.96 ? 70  PRO B O   1 
ATOM   4034  C  CB  . PRO B 1 69  ? 127.367 127.369 254.641 1.00 136.67 ? 70  PRO B CB  1 
ATOM   4035  C  CG  . PRO B 1 69  ? 128.263 126.472 253.888 1.00 137.05 ? 70  PRO B CG  1 
ATOM   4036  C  CD  . PRO B 1 69  ? 129.438 126.231 254.772 1.00 136.94 ? 70  PRO B CD  1 
ATOM   4037  N  N   . ALA B 1 70  ? 127.162 129.783 256.945 1.00 120.64 ? 71  ALA B N   1 
ATOM   4038  C  CA  . ALA B 1 70  ? 126.612 130.206 258.224 1.00 118.31 ? 71  ALA B CA  1 
ATOM   4039  C  C   . ALA B 1 70  ? 125.123 130.481 258.129 1.00 115.32 ? 71  ALA B C   1 
ATOM   4040  O  O   . ALA B 1 70  ? 124.627 130.871 257.081 1.00 115.15 ? 71  ALA B O   1 
ATOM   4041  C  CB  . ALA B 1 70  ? 127.327 131.436 258.710 1.00 118.64 ? 71  ALA B CB  1 
ATOM   4042  N  N   . LYS B 1 71  ? 124.411 130.268 259.228 1.00 128.45 ? 72  LYS B N   1 
ATOM   4043  C  CA  . LYS B 1 71  ? 122.994 130.591 259.282 1.00 125.40 ? 72  LYS B CA  1 
ATOM   4044  C  C   . LYS B 1 71  ? 122.787 132.093 259.171 1.00 121.07 ? 72  LYS B C   1 
ATOM   4045  O  O   . LYS B 1 71  ? 123.536 132.874 259.745 1.00 120.70 ? 72  LYS B O   1 
ATOM   4046  C  CB  . LYS B 1 71  ? 122.365 130.068 260.573 1.00 126.56 ? 72  LYS B CB  1 
ATOM   4047  C  CG  . LYS B 1 71  ? 122.375 128.557 260.707 1.00 127.57 ? 72  LYS B CG  1 
ATOM   4048  C  CD  . LYS B 1 71  ? 121.792 128.112 262.043 1.00 128.31 ? 72  LYS B CD  1 
ATOM   4049  C  CE  . LYS B 1 71  ? 121.950 126.608 262.251 1.00 128.82 ? 72  LYS B CE  1 
ATOM   4050  N  NZ  . LYS B 1 71  ? 121.378 126.139 263.546 1.00 129.07 1 72  LYS B NZ  1 
ATOM   4051  N  N   . SER B 1 72  ? 121.770 132.489 258.420 1.00 103.20 ? 73  SER B N   1 
ATOM   4052  C  CA  . SER B 1 72  ? 121.419 133.888 258.290 1.00 99.36  ? 73  SER B CA  1 
ATOM   4053  C  C   . SER B 1 72  ? 120.687 134.381 259.519 1.00 95.62  ? 73  SER B C   1 
ATOM   4054  O  O   . SER B 1 72  ? 119.749 133.749 259.978 1.00 95.35  ? 73  SER B O   1 
ATOM   4055  C  CB  . SER B 1 72  ? 120.561 134.108 257.053 1.00 99.43  ? 73  SER B CB  1 
ATOM   4056  O  OG  . SER B 1 72  ? 121.275 133.758 255.885 1.00 99.61  ? 73  SER B OG  1 
ATOM   4057  N  N   . PRO B 1 73  ? 121.121 135.521 260.054 1.00 76.18  ? 74  PRO B N   1 
ATOM   4058  C  CA  . PRO B 1 73  ? 120.554 136.221 261.202 1.00 73.94  ? 74  PRO B CA  1 
ATOM   4059  C  C   . PRO B 1 73  ? 119.198 136.831 260.896 1.00 71.72  ? 74  PRO B C   1 
ATOM   4060  O  O   . PRO B 1 73  ? 118.847 136.975 259.738 1.00 71.57  ? 74  PRO B O   1 
ATOM   4061  C  CB  . PRO B 1 73  ? 121.577 137.315 261.468 1.00 74.14  ? 74  PRO B CB  1 
ATOM   4062  C  CG  . PRO B 1 73  ? 122.212 137.541 260.190 1.00 74.60  ? 74  PRO B CG  1 
ATOM   4063  C  CD  . PRO B 1 73  ? 122.296 136.226 259.530 1.00 75.31  ? 74  PRO B CD  1 
ATOM   4064  N  N   . LYS B 1 74  ? 118.430 137.143 261.930 1.00 82.64  ? 75  LYS B N   1 
ATOM   4065  C  CA  . LYS B 1 74  ? 117.128 137.741 261.746 1.00 80.79  ? 75  LYS B CA  1 
ATOM   4066  C  C   . LYS B 1 74  ? 117.246 139.048 260.992 1.00 78.95  ? 75  LYS B C   1 
ATOM   4067  O  O   . LYS B 1 74  ? 116.473 139.320 260.089 1.00 78.80  ? 75  LYS B O   1 
ATOM   4068  C  CB  . LYS B 1 74  ? 116.488 138.017 263.102 1.00 80.86  ? 75  LYS B CB  1 
ATOM   4069  C  CG  . LYS B 1 74  ? 116.035 136.807 263.886 1.00 81.02  ? 75  LYS B CG  1 
ATOM   4070  C  CD  . LYS B 1 74  ? 115.096 137.242 265.002 1.00 81.12  ? 75  LYS B CD  1 
ATOM   4071  C  CE  . LYS B 1 74  ? 114.436 136.078 265.714 1.00 81.20  ? 75  LYS B CE  1 
ATOM   4072  N  NZ  . LYS B 1 74  ? 115.226 135.612 266.874 1.00 81.24  1 75  LYS B NZ  1 
ATOM   4073  N  N   . ILE B 1 75  ? 118.240 139.844 261.347 1.00 69.04  ? 76  ILE B N   1 
ATOM   4074  C  CA  . ILE B 1 75  ? 118.475 141.099 260.667 1.00 67.39  ? 76  ILE B CA  1 
ATOM   4075  C  C   . ILE B 1 75  ? 119.847 141.047 260.057 1.00 66.44  ? 76  ILE B C   1 
ATOM   4076  O  O   . ILE B 1 75  ? 120.790 140.648 260.707 1.00 66.34  ? 76  ILE B O   1 
ATOM   4077  C  CB  . ILE B 1 75  ? 118.410 142.278 261.634 1.00 66.90  ? 76  ILE B CB  1 
ATOM   4078  C  CG1 . ILE B 1 75  ? 117.010 142.426 262.202 1.00 66.66  ? 76  ILE B CG1 1 
ATOM   4079  C  CG2 . ILE B 1 75  ? 118.792 143.560 260.948 1.00 66.77  ? 76  ILE B CG2 1 
ATOM   4080  C  CD1 . ILE B 1 75  ? 116.908 143.502 263.228 1.00 66.53  ? 76  ILE B CD1 1 
ATOM   4081  N  N   . LEU B 1 76  ? 119.951 141.458 258.803 1.00 63.03  ? 77  LEU B N   1 
ATOM   4082  C  CA  . LEU B 1 76  ? 121.202 141.416 258.062 1.00 62.35  ? 77  LEU B CA  1 
ATOM   4083  C  C   . LEU B 1 76  ? 121.985 142.706 258.207 1.00 62.61  ? 77  LEU B C   1 
ATOM   4084  O  O   . LEU B 1 76  ? 121.481 143.764 257.884 1.00 62.59  ? 77  LEU B O   1 
ATOM   4085  C  CB  . LEU B 1 76  ? 120.915 141.153 256.590 1.00 61.65  ? 77  LEU B CB  1 
ATOM   4086  C  CG  . LEU B 1 76  ? 120.734 139.724 256.086 1.00 61.09  ? 77  LEU B CG  1 
ATOM   4087  C  CD1 . LEU B 1 76  ? 119.692 139.000 256.853 1.00 60.89  ? 77  LEU B CD1 1 
ATOM   4088  C  CD2 . LEU B 1 76  ? 120.359 139.743 254.643 1.00 60.91  ? 77  LEU B CD2 1 
ATOM   4089  N  N   . PRO B 1 77  ? 123.221 142.620 258.714 1.00 69.57  ? 78  PRO B N   1 
ATOM   4090  C  CA  . PRO B 1 77  ? 124.087 143.779 258.928 1.00 69.88  ? 78  PRO B CA  1 
ATOM   4091  C  C   . PRO B 1 77  ? 124.379 144.562 257.664 1.00 70.37  ? 78  PRO B C   1 
ATOM   4092  O  O   . PRO B 1 77  ? 124.554 145.767 257.725 1.00 70.42  ? 78  PRO B O   1 
ATOM   4093  C  CB  . PRO B 1 77  ? 125.361 143.161 259.499 1.00 69.77  ? 78  PRO B CB  1 
ATOM   4094  C  CG  . PRO B 1 77  ? 125.302 141.760 259.153 1.00 69.68  ? 78  PRO B CG  1 
ATOM   4095  C  CD  . PRO B 1 77  ? 123.882 141.375 259.113 1.00 69.60  ? 78  PRO B CD  1 
ATOM   4096  N  N   . ASP B 1 78  ? 124.444 143.875 256.538 1.00 75.76  ? 79  ASP B N   1 
ATOM   4097  C  CA  . ASP B 1 78  ? 124.460 144.524 255.240 1.00 76.25  ? 79  ASP B CA  1 
ATOM   4098  C  C   . ASP B 1 78  ? 124.015 143.561 254.160 1.00 76.64  ? 79  ASP B C   1 
ATOM   4099  O  O   . ASP B 1 78  ? 123.853 142.382 254.410 1.00 76.69  ? 79  ASP B O   1 
ATOM   4100  C  CB  . ASP B 1 78  ? 125.811 145.163 254.918 1.00 76.32  ? 79  ASP B CB  1 
ATOM   4101  C  CG  . ASP B 1 78  ? 126.936 144.170 254.849 1.00 76.36  ? 79  ASP B CG  1 
ATOM   4102  O  OD1 . ASP B 1 78  ? 126.804 143.156 254.152 1.00 76.41  ? 79  ASP B OD1 1 
ATOM   4103  O  OD2 . ASP B 1 78  ? 127.975 144.415 255.488 1.00 76.40  1 79  ASP B OD2 1 
ATOM   4104  N  N   . ILE B 1 79  ? 123.811 144.072 252.959 1.00 64.24  ? 80  ILE B N   1 
ATOM   4105  C  CA  . ILE B 1 79  ? 123.243 143.278 251.883 1.00 64.62  ? 80  ILE B CA  1 
ATOM   4106  C  C   . ILE B 1 79  ? 124.143 142.119 251.448 1.00 65.44  ? 80  ILE B C   1 
ATOM   4107  O  O   . ILE B 1 79  ? 123.680 141.141 250.889 1.00 65.49  ? 80  ILE B O   1 
ATOM   4108  C  CB  . ILE B 1 79  ? 122.853 144.173 250.692 1.00 64.32  ? 80  ILE B CB  1 
ATOM   4109  C  CG1 . ILE B 1 79  ? 121.836 143.479 249.793 1.00 64.19  ? 80  ILE B CG1 1 
ATOM   4110  C  CG2 . ILE B 1 79  ? 124.055 144.569 249.919 1.00 64.23  ? 80  ILE B CG2 1 
ATOM   4111  C  CD1 . ILE B 1 79  ? 120.530 143.214 250.454 1.00 64.13  ? 80  ILE B CD1 1 
ATOM   4112  N  N   . LEU B 1 80  ? 125.428 142.219 251.735 1.00 67.09  ? 81  LEU B N   1 
ATOM   4113  C  CA  . LEU B 1 80  ? 126.370 141.207 251.303 1.00 67.93  ? 81  LEU B CA  1 
ATOM   4114  C  C   . LEU B 1 80  ? 126.098 139.869 251.954 1.00 69.06  ? 81  LEU B C   1 
ATOM   4115  O  O   . LEU B 1 80  ? 126.534 138.842 251.469 1.00 69.15  ? 81  LEU B O   1 
ATOM   4116  C  CB  . LEU B 1 80  ? 127.796 141.654 251.581 1.00 67.74  ? 81  LEU B CB  1 
ATOM   4117  C  CG  . LEU B 1 80  ? 128.202 142.940 250.878 1.00 67.56  ? 81  LEU B CG  1 
ATOM   4118  C  CD1 . LEU B 1 80  ? 129.606 143.325 251.238 1.00 67.51  ? 81  LEU B CD1 1 
ATOM   4119  C  CD2 . LEU B 1 80  ? 128.075 142.768 249.397 1.00 67.53  ? 81  LEU B CD2 1 
ATOM   4120  N  N   . LYS B 1 81  ? 125.382 139.882 253.062 1.00 84.01  ? 82  LYS B N   1 
ATOM   4121  C  CA  . LYS B 1 81  ? 125.024 138.642 253.717 1.00 85.06  ? 82  LYS B CA  1 
ATOM   4122  C  C   . LYS B 1 81  ? 123.902 137.952 252.977 1.00 85.16  ? 82  LYS B C   1 
ATOM   4123  O  O   . LYS B 1 81  ? 123.619 136.795 253.225 1.00 85.20  ? 82  LYS B O   1 
ATOM   4124  C  CB  . LYS B 1 81  ? 124.634 138.880 255.170 1.00 85.77  ? 82  LYS B CB  1 
ATOM   4125  C  CG  . LYS B 1 81  ? 125.802 138.868 256.145 1.00 86.39  ? 82  LYS B CG  1 
ATOM   4126  C  CD  . LYS B 1 81  ? 126.751 140.024 255.906 1.00 86.92  ? 82  LYS B CD  1 
ATOM   4127  C  CE  . LYS B 1 81  ? 128.110 139.784 256.510 1.00 87.35  ? 82  LYS B CE  1 
ATOM   4128  N  NZ  . LYS B 1 81  ? 129.115 140.722 255.954 1.00 87.57  1 82  LYS B NZ  1 
ATOM   4129  N  N   . LYS B 1 82  ? 123.261 138.663 252.062 1.00 79.14  ? 83  LYS B N   1 
ATOM   4130  C  CA  . LYS B 1 82  ? 122.216 138.063 251.245 1.00 79.22  ? 83  LYS B CA  1 
ATOM   4131  C  C   . LYS B 1 82  ? 122.827 137.441 250.001 1.00 78.93  ? 83  LYS B C   1 
ATOM   4132  O  O   . LYS B 1 82  ? 122.405 137.686 248.884 1.00 78.91  ? 83  LYS B O   1 
ATOM   4133  C  CB  . LYS B 1 82  ? 121.140 139.094 250.895 1.00 79.49  ? 83  LYS B CB  1 
ATOM   4134  C  CG  . LYS B 1 82  ? 119.899 138.552 250.201 1.00 79.76  ? 83  LYS B CG  1 
ATOM   4135  C  CD  . LYS B 1 82  ? 119.301 137.387 250.935 1.00 79.96  ? 83  LYS B CD  1 
ATOM   4136  C  CE  . LYS B 1 82  ? 118.124 136.809 250.187 1.00 80.12  ? 83  LYS B CE  1 
ATOM   4137  N  NZ  . LYS B 1 82  ? 118.541 136.229 248.895 1.00 80.19  1 83  LYS B NZ  1 
ATOM   4138  N  N   . ILE B 1 83  ? 123.843 136.625 250.211 1.00 70.30  ? 84  ILE B N   1 
ATOM   4139  C  CA  . ILE B 1 83  ? 124.479 135.915 249.126 1.00 70.06  ? 84  ILE B CA  1 
ATOM   4140  C  C   . ILE B 1 83  ? 124.599 134.476 249.545 1.00 70.76  ? 84  ILE B C   1 
ATOM   4141  O  O   . ILE B 1 83  ? 125.097 134.183 250.615 1.00 70.79  ? 84  ILE B O   1 
ATOM   4142  C  CB  . ILE B 1 83  ? 125.855 136.484 248.841 1.00 69.31  ? 84  ILE B CB  1 
ATOM   4143  C  CG1 . ILE B 1 83  ? 125.730 137.903 248.311 1.00 68.90  ? 84  ILE B CG1 1 
ATOM   4144  C  CG2 . ILE B 1 83  ? 126.566 135.653 247.829 1.00 69.13  ? 84  ILE B CG2 1 
ATOM   4145  C  CD1 . ILE B 1 83  ? 127.034 138.623 248.204 1.00 68.69  ? 84  ILE B CD1 1 
ATOM   4146  N  N   . GLY B 1 84  ? 124.148 133.575 248.688 1.00 76.66  ? 85  GLY B N   1 
ATOM   4147  C  CA  . GLY B 1 84  ? 124.030 132.176 249.040 1.00 77.39  ? 85  GLY B CA  1 
ATOM   4148  C  C   . GLY B 1 84  ? 122.645 131.819 249.531 1.00 78.10  ? 85  GLY B C   1 
ATOM   4149  O  O   . GLY B 1 84  ? 121.764 132.662 249.568 1.00 78.18  ? 85  GLY B O   1 
ATOM   4150  N  N   . ASP B 1 85  ? 122.462 130.556 249.898 1.00 106.72 ? 86  ASP B N   1 
ATOM   4151  C  CA  . ASP B 1 85  ? 121.171 130.015 250.317 1.00 107.18 ? 86  ASP B CA  1 
ATOM   4152  C  C   . ASP B 1 85  ? 120.101 130.201 249.258 1.00 106.98 ? 86  ASP B C   1 
ATOM   4153  O  O   . ASP B 1 85  ? 118.958 130.497 249.568 1.00 106.99 ? 86  ASP B O   1 
ATOM   4154  C  CB  . ASP B 1 85  ? 120.706 130.623 251.644 1.00 107.57 ? 86  ASP B CB  1 
ATOM   4155  C  CG  . ASP B 1 85  ? 121.625 130.289 252.797 1.00 107.76 ? 86  ASP B CG  1 
ATOM   4156  O  OD1 . ASP B 1 85  ? 121.611 131.027 253.803 1.00 107.86 ? 86  ASP B OD1 1 
ATOM   4157  O  OD2 . ASP B 1 85  ? 122.367 129.292 252.702 1.00 107.84 1 86  ASP B OD2 1 
ATOM   4158  N  N   . THR B 1 86  ? 120.486 130.033 248.003 1.00 75.03  ? 87  THR B N   1 
ATOM   4159  C  CA  . THR B 1 86  ? 119.570 130.199 246.893 1.00 74.70  ? 87  THR B CA  1 
ATOM   4160  C  C   . THR B 1 86  ? 118.594 129.039 246.783 1.00 74.44  ? 87  THR B C   1 
ATOM   4161  O  O   . THR B 1 86  ? 118.960 127.908 247.033 1.00 74.42  ? 87  THR B O   1 
ATOM   4162  C  CB  . THR B 1 86  ? 120.338 130.363 245.594 1.00 74.64  ? 87  THR B CB  1 
ATOM   4163  O  OG1 . THR B 1 86  ? 121.091 129.181 245.331 1.00 74.59  ? 87  THR B OG1 1 
ATOM   4164  C  CG2 . THR B 1 86  ? 121.282 131.518 245.711 1.00 74.62  ? 87  THR B CG2 1 
ATOM   4165  N  N   . PRO B 1 87  ? 117.340 129.325 246.416 1.00 76.65  ? 88  PRO B N   1 
ATOM   4166  C  CA  . PRO B 1 87  ? 116.288 128.315 246.318 1.00 76.64  ? 88  PRO B CA  1 
ATOM   4167  C  C   . PRO B 1 87  ? 116.540 127.245 245.280 1.00 76.89  ? 88  PRO B C   1 
ATOM   4168  O  O   . PRO B 1 87  ? 117.091 127.526 244.237 1.00 76.90  ? 88  PRO B O   1 
ATOM   4169  C  CB  . PRO B 1 87  ? 115.068 129.134 245.915 1.00 76.48  ? 88  PRO B CB  1 
ATOM   4170  C  CG  . PRO B 1 87  ? 115.601 130.332 245.316 1.00 76.42  ? 88  PRO B CG  1 
ATOM   4171  C  CD  . PRO B 1 87  ? 116.831 130.652 246.051 1.00 76.48  ? 88  PRO B CD  1 
ATOM   4172  N  N   . MET B 1 88  ? 116.116 126.026 245.569 1.00 82.42  ? 89  MET B N   1 
ATOM   4173  C  CA  . MET B 1 88  ? 116.149 124.955 244.590 1.00 82.78  ? 89  MET B CA  1 
ATOM   4174  C  C   . MET B 1 88  ? 114.738 124.639 244.134 1.00 83.30  ? 89  MET B C   1 
ATOM   4175  O  O   . MET B 1 88  ? 113.978 124.023 244.857 1.00 83.32  ? 89  MET B O   1 
ATOM   4176  C  CB  . MET B 1 88  ? 116.779 123.712 245.191 1.00 82.70  ? 89  MET B CB  1 
ATOM   4177  C  CG  . MET B 1 88  ? 116.868 122.561 244.235 1.00 82.65  ? 89  MET B CG  1 
ATOM   4178  S  SD  . MET B 1 88  ? 118.295 122.656 243.174 1.00 82.63  ? 89  MET B SD  1 
ATOM   4179  C  CE  . MET B 1 88  ? 119.550 122.141 244.314 1.00 82.61  ? 89  MET B CE  1 
ATOM   4180  N  N   . VAL B 1 89  ? 114.391 125.066 242.930 1.00 75.23  ? 90  VAL B N   1 
ATOM   4181  C  CA  . VAL B 1 89  ? 113.021 124.966 242.452 1.00 75.84  ? 90  VAL B CA  1 
ATOM   4182  C  C   . VAL B 1 89  ? 112.839 123.873 241.425 1.00 76.84  ? 90  VAL B C   1 
ATOM   4183  O  O   . VAL B 1 89  ? 113.686 123.668 240.588 1.00 76.88  ? 90  VAL B O   1 
ATOM   4184  C  CB  . VAL B 1 89  ? 112.588 126.267 241.817 1.00 75.55  ? 90  VAL B CB  1 
ATOM   4185  C  CG1 . VAL B 1 89  ? 111.113 126.263 241.592 1.00 75.48  ? 90  VAL B CG1 1 
ATOM   4186  C  CG2 . VAL B 1 89  ? 112.970 127.409 242.705 1.00 75.42  ? 90  VAL B CG2 1 
ATOM   4187  N  N   . ARG B 1 90  ? 111.718 123.172 241.483 1.00 94.41  ? 91  ARG B N   1 
ATOM   4188  C  CA  . ARG B 1 90  ? 111.460 122.094 240.547 1.00 95.51  ? 91  ARG B CA  1 
ATOM   4189  C  C   . ARG B 1 90  ? 110.876 122.595 239.250 1.00 95.63  ? 91  ARG B C   1 
ATOM   4190  O  O   . ARG B 1 90  ? 109.983 123.423 239.251 1.00 95.65  ? 91  ARG B O   1 
ATOM   4191  C  CB  . ARG B 1 90  ? 110.502 121.087 241.162 1.00 96.37  ? 91  ARG B CB  1 
ATOM   4192  C  CG  . ARG B 1 90  ? 110.085 119.990 240.219 1.00 97.09  ? 91  ARG B CG  1 
ATOM   4193  C  CD  . ARG B 1 90  ? 109.101 119.055 240.870 1.00 97.69  ? 91  ARG B CD  1 
ATOM   4194  N  NE  . ARG B 1 90  ? 109.642 118.487 242.092 1.00 98.17  ? 91  ARG B NE  1 
ATOM   4195  C  CZ  . ARG B 1 90  ? 108.900 118.083 243.112 1.00 98.66  ? 91  ARG B CZ  1 
ATOM   4196  N  NH1 . ARG B 1 90  ? 107.585 118.187 243.051 1.00 98.80  1 91  ARG B NH1 1 
ATOM   4197  N  NH2 . ARG B 1 90  ? 109.476 117.579 244.191 1.00 98.81  ? 91  ARG B NH2 1 
ATOM   4198  N  N   . ILE B 1 91  ? 111.375 122.073 238.139 1.00 83.93  ? 92  ILE B N   1 
ATOM   4199  C  CA  . ILE B 1 91  ? 110.832 122.397 236.833 1.00 84.01  ? 92  ILE B CA  1 
ATOM   4200  C  C   . ILE B 1 91  ? 109.679 121.472 236.516 1.00 84.16  ? 92  ILE B C   1 
ATOM   4201  O  O   . ILE B 1 91  ? 109.852 120.273 236.413 1.00 84.17  ? 92  ILE B O   1 
ATOM   4202  C  CB  . ILE B 1 91  ? 111.881 122.238 235.753 1.00 83.95  ? 92  ILE B CB  1 
ATOM   4203  C  CG1 . ILE B 1 91  ? 113.117 123.062 236.092 1.00 83.90  ? 92  ILE B CG1 1 
ATOM   4204  C  CG2 . ILE B 1 91  ? 111.314 122.646 234.428 1.00 83.95  ? 92  ILE B CG2 1 
ATOM   4205  C  CD1 . ILE B 1 91  ? 112.864 124.519 236.153 1.00 83.87  ? 92  ILE B CD1 1 
ATOM   4206  N  N   . ASN B 1 92  ? 108.499 122.037 236.348 1.00 84.99  ? 93  ASN B N   1 
ATOM   4207  C  CA  . ASN B 1 92  ? 107.302 121.229 236.274 1.00 85.17  ? 93  ASN B CA  1 
ATOM   4208  C  C   . ASN B 1 92  ? 106.808 120.917 234.876 1.00 85.58  ? 93  ASN B C   1 
ATOM   4209  O  O   . ASN B 1 92  ? 106.148 119.912 234.662 1.00 85.60  ? 93  ASN B O   1 
ATOM   4210  C  CB  . ASN B 1 92  ? 106.185 121.891 237.071 1.00 85.04  ? 93  ASN B CB  1 
ATOM   4211  C  CG  . ASN B 1 92  ? 106.451 121.890 238.551 1.00 84.93  ? 93  ASN B CG  1 
ATOM   4212  O  OD1 . ASN B 1 92  ? 106.720 120.855 239.145 1.00 84.92  ? 93  ASN B OD1 1 
ATOM   4213  N  ND2 . ASN B 1 92  ? 106.377 123.059 239.159 1.00 84.85  ? 93  ASN B ND2 1 
ATOM   4214  N  N   . LYS B 1 93  ? 107.114 121.779 233.923 1.00 86.43  ? 94  LYS B N   1 
ATOM   4215  C  CA  . LYS B 1 93  ? 106.545 121.623 232.600 1.00 86.94  ? 94  LYS B CA  1 
ATOM   4216  C  C   . LYS B 1 93  ? 107.572 121.343 231.522 1.00 88.23  ? 94  LYS B C   1 
ATOM   4217  O  O   . LYS B 1 93  ? 107.359 120.497 230.664 1.00 88.31  ? 94  LYS B O   1 
ATOM   4218  C  CB  . LYS B 1 93  ? 105.755 122.865 232.222 1.00 86.32  ? 94  LYS B CB  1 
ATOM   4219  C  CG  . LYS B 1 93  ? 104.568 123.145 233.093 1.00 85.78  ? 94  LYS B CG  1 
ATOM   4220  C  CD  . LYS B 1 93  ? 103.898 124.416 232.645 1.00 85.36  ? 94  LYS B CD  1 
ATOM   4221  C  CE  . LYS B 1 93  ? 102.943 124.933 233.672 1.00 85.07  ? 94  LYS B CE  1 
ATOM   4222  N  NZ  . LYS B 1 93  ? 102.677 126.370 233.431 1.00 84.92  1 94  LYS B NZ  1 
ATOM   4223  N  N   . ILE B 1 94  ? 108.683 122.059 231.563 1.00 89.39  ? 95  ILE B N   1 
ATOM   4224  C  CA  . ILE B 1 94  ? 109.651 121.994 230.486 1.00 90.71  ? 95  ILE B CA  1 
ATOM   4225  C  C   . ILE B 1 94  ? 110.250 120.607 230.313 1.00 91.83  ? 95  ILE B C   1 
ATOM   4226  O  O   . ILE B 1 94  ? 110.484 120.159 229.199 1.00 91.96  ? 95  ILE B O   1 
ATOM   4227  C  CB  . ILE B 1 94  ? 110.771 123.004 230.719 1.00 90.87  ? 95  ILE B CB  1 
ATOM   4228  C  CG1 . ILE B 1 94  ? 110.225 124.414 230.584 1.00 90.90  ? 95  ILE B CG1 1 
ATOM   4229  C  CG2 . ILE B 1 94  ? 111.878 122.813 229.734 1.00 90.95  ? 95  ILE B CG2 1 
ATOM   4230  C  CD1 . ILE B 1 94  ? 111.246 125.474 230.800 1.00 90.86  ? 95  ILE B CD1 1 
ATOM   4231  N  N   . GLY B 1 95  ? 110.449 119.901 231.413 1.00 98.32  ? 96  GLY B N   1 
ATOM   4232  C  CA  . GLY B 1 95  ? 111.035 118.583 231.327 1.00 99.38  ? 96  GLY B CA  1 
ATOM   4233  C  C   . GLY B 1 95  ? 110.096 117.586 230.698 1.00 100.35 ? 96  GLY B C   1 
ATOM   4234  O  O   . GLY B 1 95  ? 110.499 116.765 229.889 1.00 100.44 ? 96  GLY B O   1 
ATOM   4235  N  N   . LYS B 1 96  ? 108.829 117.669 231.064 1.00 99.81  ? 97  LYS B N   1 
ATOM   4236  C  CA  . LYS B 1 96  ? 107.828 116.768 230.523 1.00 100.59 ? 97  LYS B CA  1 
ATOM   4237  C  C   . LYS B 1 96  ? 107.510 117.060 229.069 1.00 100.42 ? 97  LYS B C   1 
ATOM   4238  O  O   . LYS B 1 96  ? 107.103 116.184 228.326 1.00 100.45 ? 97  LYS B O   1 
ATOM   4239  C  CB  . LYS B 1 96  ? 106.571 116.807 231.385 1.00 101.34 ? 97  LYS B CB  1 
ATOM   4240  C  CG  . LYS B 1 96  ? 106.869 116.576 232.851 1.00 101.97 ? 97  LYS B CG  1 
ATOM   4241  C  CD  . LYS B 1 96  ? 105.616 116.402 233.680 1.00 102.48 ? 97  LYS B CD  1 
ATOM   4242  C  CE  . LYS B 1 96  ? 105.962 116.217 235.147 1.00 102.82 ? 97  LYS B CE  1 
ATOM   4243  N  NZ  . LYS B 1 96  ? 106.980 115.145 235.352 1.00 102.97 1 97  LYS B NZ  1 
ATOM   4244  N  N   . LYS B 1 97  ? 107.698 118.306 228.672 1.00 101.78 ? 98  LYS B N   1 
ATOM   4245  C  CA  . LYS B 1 97  ? 107.455 118.707 227.302 1.00 101.56 ? 98  LYS B CA  1 
ATOM   4246  C  C   . LYS B 1 97  ? 108.443 118.027 226.374 1.00 100.78 ? 98  LYS B C   1 
ATOM   4247  O  O   . LYS B 1 97  ? 108.144 117.767 225.217 1.00 100.74 ? 98  LYS B O   1 
ATOM   4248  C  CB  . LYS B 1 97  ? 107.593 120.221 227.187 1.00 102.00 ? 98  LYS B CB  1 
ATOM   4249  C  CG  . LYS B 1 97  ? 107.176 120.822 225.859 1.00 102.39 ? 98  LYS B CG  1 
ATOM   4250  C  CD  . LYS B 1 97  ? 107.586 122.283 225.802 1.00 102.69 ? 98  LYS B CD  1 
ATOM   4251  C  CE  . LYS B 1 97  ? 106.800 123.061 224.771 1.00 102.89 ? 98  LYS B CE  1 
ATOM   4252  N  NZ  . LYS B 1 97  ? 107.064 122.583 223.394 1.00 102.98 1 98  LYS B NZ  1 
ATOM   4253  N  N   . PHE B 1 98  ? 109.627 117.738 226.886 1.00 89.76  ? 99  PHE B N   1 
ATOM   4254  C  CA  . PHE B 1 98  ? 110.667 117.143 226.070 1.00 89.03  ? 99  PHE B CA  1 
ATOM   4255  C  C   . PHE B 1 98  ? 110.894 115.689 226.425 1.00 88.88  ? 99  PHE B C   1 
ATOM   4256  O  O   . PHE B 1 98  ? 111.883 115.089 226.030 1.00 88.84  ? 99  PHE B O   1 
ATOM   4257  C  CB  . PHE B 1 98  ? 111.958 117.941 226.177 1.00 88.60  ? 99  PHE B CB  1 
ATOM   4258  C  CG  . PHE B 1 98  ? 111.920 119.240 225.442 1.00 88.20  ? 99  PHE B CG  1 
ATOM   4259  C  CD1 . PHE B 1 98  ? 111.396 120.362 226.032 1.00 87.98  ? 99  PHE B CD1 1 
ATOM   4260  C  CD2 . PHE B 1 98  ? 112.404 119.336 224.163 1.00 87.97  ? 99  PHE B CD2 1 
ATOM   4261  C  CE1 . PHE B 1 98  ? 111.356 121.548 225.362 1.00 87.81  ? 99  PHE B CE1 1 
ATOM   4262  C  CE2 . PHE B 1 98  ? 112.368 120.522 223.488 1.00 87.83  ? 99  PHE B CE2 1 
ATOM   4263  C  CZ  . PHE B 1 98  ? 111.842 121.630 224.089 1.00 87.74  ? 99  PHE B CZ  1 
ATOM   4264  N  N   . GLY B 1 99  ? 109.963 115.128 227.179 1.00 96.51  ? 100 GLY B N   1 
ATOM   4265  C  CA  . GLY B 1 99  ? 109.978 113.711 227.459 1.00 96.45  ? 100 GLY B CA  1 
ATOM   4266  C  C   . GLY B 1 99  ? 110.893 113.212 228.555 1.00 96.48  ? 100 GLY B C   1 
ATOM   4267  O  O   . GLY B 1 99  ? 111.164 112.023 228.633 1.00 96.48  ? 100 GLY B O   1 
ATOM   4268  N  N   . LEU B 1 100 ? 111.396 114.105 229.391 1.00 90.27  ? 101 LEU B N   1 
ATOM   4269  C  CA  . LEU B 1 100 ? 112.206 113.668 230.513 1.00 90.42  ? 101 LEU B CA  1 
ATOM   4270  C  C   . LEU B 1 100 ? 111.389 112.831 231.463 1.00 91.24  ? 101 LEU B C   1 
ATOM   4271  O  O   . LEU B 1 100 ? 110.259 113.163 231.772 1.00 91.29  ? 101 LEU B O   1 
ATOM   4272  C  CB  . LEU B 1 100 ? 112.768 114.860 231.265 1.00 89.93  ? 101 LEU B CB  1 
ATOM   4273  C  CG  . LEU B 1 100 ? 113.878 115.621 230.566 1.00 89.52  ? 101 LEU B CG  1 
ATOM   4274  C  CD1 . LEU B 1 100 ? 114.491 116.619 231.503 1.00 89.36  ? 101 LEU B CD1 1 
ATOM   4275  C  CD2 . LEU B 1 100 ? 114.910 114.644 230.091 1.00 89.42  ? 101 LEU B CD2 1 
ATOM   4276  N  N   . LYS B 1 101 ? 111.970 111.742 231.935 1.00 105.61 ? 102 LYS B N   1 
ATOM   4277  C  CA  . LYS B 1 101 ? 111.300 110.895 232.899 1.00 106.34 ? 102 LYS B CA  1 
ATOM   4278  C  C   . LYS B 1 101 ? 111.724 111.279 234.300 1.00 105.87 ? 102 LYS B C   1 
ATOM   4279  O  O   . LYS B 1 101 ? 111.045 110.976 235.272 1.00 105.87 ? 102 LYS B O   1 
ATOM   4280  C  CB  . LYS B 1 101 ? 111.644 109.426 232.650 1.00 107.31 ? 102 LYS B CB  1 
ATOM   4281  C  CG  . LYS B 1 101 ? 111.630 109.000 231.187 1.00 108.11 ? 102 LYS B CG  1 
ATOM   4282  C  CD  . LYS B 1 101 ? 112.003 107.529 231.035 1.00 108.76 ? 102 LYS B CD  1 
ATOM   4283  C  CE  . LYS B 1 101 ? 112.761 107.255 229.742 1.00 109.19 ? 102 LYS B CE  1 
ATOM   4284  N  NZ  . LYS B 1 101 ? 111.970 107.578 228.533 1.00 109.39 1 102 LYS B NZ  1 
ATOM   4285  N  N   . CYS B 1 102 ? 112.858 111.956 234.393 1.00 105.74 ? 103 CYS B N   1 
ATOM   4286  C  CA  . CYS B 1 102 ? 113.467 112.262 235.675 1.00 105.12 ? 103 CYS B CA  1 
ATOM   4287  C  C   . CYS B 1 102 ? 112.956 113.554 236.279 1.00 104.13 ? 103 CYS B C   1 
ATOM   4288  O  O   . CYS B 1 102 ? 112.259 114.315 235.627 1.00 104.10 ? 103 CYS B O   1 
ATOM   4289  C  CB  . CYS B 1 102 ? 114.981 112.320 235.540 1.00 105.30 ? 103 CYS B CB  1 
ATOM   4290  S  SG  . CYS B 1 102 ? 115.578 113.663 234.537 1.00 105.39 ? 103 CYS B SG  1 
ATOM   4291  N  N   . GLU B 1 103 ? 113.284 113.778 237.544 1.00 100.74 ? 104 GLU B N   1 
ATOM   4292  C  CA  . GLU B 1 103 ? 112.980 115.035 238.207 1.00 99.58  ? 104 GLU B CA  1 
ATOM   4293  C  C   . GLU B 1 103 ? 113.998 116.081 237.786 1.00 97.87  ? 104 GLU B C   1 
ATOM   4294  O  O   . GLU B 1 103 ? 115.191 115.873 237.925 1.00 97.81  ? 104 GLU B O   1 
ATOM   4295  C  CB  . GLU B 1 103 ? 113.018 114.849 239.724 1.00 99.98  ? 104 GLU B CB  1 
ATOM   4296  C  CG  . GLU B 1 103 ? 112.587 116.060 240.521 1.00 100.25 ? 104 GLU B CG  1 
ATOM   4297  C  CD  . GLU B 1 103 ? 112.788 115.897 242.016 1.00 100.39 ? 104 GLU B CD  1 
ATOM   4298  O  OE1 . GLU B 1 103 ? 113.731 115.196 242.420 1.00 100.44 ? 104 GLU B OE1 1 
ATOM   4299  O  OE2 . GLU B 1 103 ? 112.002 116.474 242.791 1.00 100.44 1 104 GLU B OE2 1 
ATOM   4300  N  N   . LEU B 1 104 ? 113.529 117.211 237.277 1.00 91.46  ? 105 LEU B N   1 
ATOM   4301  C  CA  . LEU B 1 104 ? 114.426 118.276 236.851 1.00 89.71  ? 105 LEU B CA  1 
ATOM   4302  C  C   . LEU B 1 104 ? 114.420 119.422 237.841 1.00 88.14  ? 105 LEU B C   1 
ATOM   4303  O  O   . LEU B 1 104 ? 113.400 120.056 238.045 1.00 88.04  ? 105 LEU B O   1 
ATOM   4304  C  CB  . LEU B 1 104 ? 114.014 118.793 235.483 1.00 89.60  ? 105 LEU B CB  1 
ATOM   4305  C  CG  . LEU B 1 104 ? 114.961 119.791 234.839 1.00 89.50  ? 105 LEU B CG  1 
ATOM   4306  C  CD1 . LEU B 1 104 ? 116.282 119.126 234.580 1.00 89.47  ? 105 LEU B CD1 1 
ATOM   4307  C  CD2 . LEU B 1 104 ? 114.375 120.327 233.560 1.00 89.46  ? 105 LEU B CD2 1 
ATOM   4308  N  N   . LEU B 1 105 ? 115.563 119.691 238.453 1.00 83.55  ? 106 LEU B N   1 
ATOM   4309  C  CA  . LEU B 1 105 ? 115.666 120.755 239.440 1.00 82.12  ? 106 LEU B CA  1 
ATOM   4310  C  C   . LEU B 1 105 ? 116.553 121.899 238.987 1.00 80.79  ? 106 LEU B C   1 
ATOM   4311  O  O   . LEU B 1 105 ? 117.529 121.704 238.284 1.00 80.69  ? 106 LEU B O   1 
ATOM   4312  C  CB  . LEU B 1 105 ? 116.200 120.211 240.753 1.00 82.09  ? 106 LEU B CB  1 
ATOM   4313  C  CG  . LEU B 1 105 ? 115.401 119.112 241.431 1.00 82.11  ? 106 LEU B CG  1 
ATOM   4314  C  CD1 . LEU B 1 105 ? 116.052 118.745 242.731 1.00 82.10  ? 106 LEU B CD1 1 
ATOM   4315  C  CD2 . LEU B 1 105 ? 113.998 119.564 241.661 1.00 82.08  ? 106 LEU B CD2 1 
ATOM   4316  N  N   . ALA B 1 106 ? 116.210 123.097 239.424 1.00 75.35  ? 107 ALA B N   1 
ATOM   4317  C  CA  . ALA B 1 106 ? 116.952 124.283 239.063 1.00 74.23  ? 107 ALA B CA  1 
ATOM   4318  C  C   . ALA B 1 106 ? 117.437 125.029 240.287 1.00 73.59  ? 107 ALA B C   1 
ATOM   4319  O  O   . ALA B 1 106 ? 116.664 125.396 241.152 1.00 73.49  ? 107 ALA B O   1 
ATOM   4320  C  CB  . ALA B 1 106 ? 116.103 125.180 238.210 1.00 74.00  ? 107 ALA B CB  1 
ATOM   4321  N  N   . LYS B 1 107 ? 118.736 125.252 240.337 1.00 73.24  ? 108 LYS B N   1 
ATOM   4322  C  CA  . LYS B 1 107 ? 119.355 126.013 241.396 1.00 72.83  ? 108 LYS B CA  1 
ATOM   4323  C  C   . LYS B 1 107 ? 119.336 127.472 240.991 1.00 73.20  ? 108 LYS B C   1 
ATOM   4324  O  O   . LYS B 1 107 ? 120.152 127.912 240.203 1.00 73.20  ? 108 LYS B O   1 
ATOM   4325  C  CB  . LYS B 1 107 ? 120.779 125.515 241.586 1.00 72.30  ? 108 LYS B CB  1 
ATOM   4326  C  CG  . LYS B 1 107 ? 121.582 126.211 242.641 1.00 71.87  ? 108 LYS B CG  1 
ATOM   4327  C  CD  . LYS B 1 107 ? 121.111 125.902 244.028 1.00 71.58  ? 108 LYS B CD  1 
ATOM   4328  C  CE  . LYS B 1 107 ? 122.181 126.252 245.030 1.00 71.38  ? 108 LYS B CE  1 
ATOM   4329  N  NZ  . LYS B 1 107 ? 121.634 126.508 246.375 1.00 71.29  1 108 LYS B NZ  1 
ATOM   4330  N  N   . CYS B 1 108 ? 118.387 128.219 241.531 1.00 77.02  ? 109 CYS B N   1 
ATOM   4331  C  CA  . CYS B 1 108 ? 118.101 129.566 241.062 1.00 77.49  ? 109 CYS B CA  1 
ATOM   4332  C  C   . CYS B 1 108 ? 119.016 130.614 241.655 1.00 78.00  ? 109 CYS B C   1 
ATOM   4333  O  O   . CYS B 1 108 ? 118.730 131.183 242.690 1.00 78.04  ? 109 CYS B O   1 
ATOM   4334  C  CB  . CYS B 1 108 ? 116.655 129.917 241.361 1.00 77.46  ? 109 CYS B CB  1 
ATOM   4335  S  SG  . CYS B 1 108 ? 115.482 128.902 240.489 1.00 77.45  ? 109 CYS B SG  1 
ATOM   4336  N  N   . GLU B 1 109 ? 120.110 130.888 240.965 1.00 92.77  ? 110 GLU B N   1 
ATOM   4337  C  CA  . GLU B 1 109 ? 121.157 131.732 241.510 1.00 93.22  ? 110 GLU B CA  1 
ATOM   4338  C  C   . GLU B 1 109 ? 120.907 133.220 241.356 1.00 93.26  ? 110 GLU B C   1 
ATOM   4339  O  O   . GLU B 1 109 ? 121.659 134.032 241.869 1.00 93.28  ? 110 GLU B O   1 
ATOM   4340  C  CB  . GLU B 1 109 ? 122.499 131.362 240.896 1.00 93.46  ? 110 GLU B CB  1 
ATOM   4341  C  CG  . GLU B 1 109 ? 123.623 131.363 241.895 1.00 93.59  ? 110 GLU B CG  1 
ATOM   4342  C  CD  . GLU B 1 109 ? 123.519 130.235 242.868 1.00 93.62  ? 110 GLU B CD  1 
ATOM   4343  O  OE1 . GLU B 1 109 ? 122.960 129.199 242.482 1.00 93.67  ? 110 GLU B OE1 1 
ATOM   4344  O  OE2 . GLU B 1 109 ? 123.983 130.380 244.013 1.00 93.55  1 110 GLU B OE2 1 
ATOM   4345  N  N   . PHE B 1 110 ? 119.843 133.577 240.658 1.00 80.73  ? 111 PHE B N   1 
ATOM   4346  C  CA  . PHE B 1 110 ? 119.559 134.974 240.391 1.00 80.64  ? 111 PHE B CA  1 
ATOM   4347  C  C   . PHE B 1 110 ? 118.927 135.685 241.577 1.00 80.28  ? 111 PHE B C   1 
ATOM   4348  O  O   . PHE B 1 110 ? 118.655 136.875 241.531 1.00 80.27  ? 111 PHE B O   1 
ATOM   4349  C  CB  . PHE B 1 110 ? 118.716 135.135 239.128 1.00 80.82  ? 111 PHE B CB  1 
ATOM   4350  C  CG  . PHE B 1 110 ? 117.530 134.229 239.056 1.00 80.98  ? 111 PHE B CG  1 
ATOM   4351  C  CD1 . PHE B 1 110 ? 116.334 134.599 239.613 1.00 81.05  ? 111 PHE B CD1 1 
ATOM   4352  C  CD2 . PHE B 1 110 ? 117.603 133.029 238.400 1.00 81.06  ? 111 PHE B CD2 1 
ATOM   4353  C  CE1 . PHE B 1 110 ? 115.250 133.782 239.539 1.00 81.10  ? 111 PHE B CE1 1 
ATOM   4354  C  CE2 . PHE B 1 110 ? 116.518 132.211 238.325 1.00 81.11  ? 111 PHE B CE2 1 
ATOM   4355  C  CZ  . PHE B 1 110 ? 115.341 132.588 238.897 1.00 81.12  ? 111 PHE B CZ  1 
ATOM   4356  N  N   . PHE B 1 111 ? 118.685 134.935 242.637 1.00 85.44  ? 112 PHE B N   1 
ATOM   4357  C  CA  . PHE B 1 111 ? 118.136 135.487 243.857 1.00 85.02  ? 112 PHE B CA  1 
ATOM   4358  C  C   . PHE B 1 111 ? 119.193 136.089 244.770 1.00 84.18  ? 112 PHE B C   1 
ATOM   4359  O  O   . PHE B 1 111 ? 118.879 136.629 245.817 1.00 84.12  ? 112 PHE B O   1 
ATOM   4360  C  CB  . PHE B 1 111 ? 117.331 134.430 244.597 1.00 85.32  ? 112 PHE B CB  1 
ATOM   4361  C  CG  . PHE B 1 111 ? 115.985 134.188 244.010 1.00 85.62  ? 112 PHE B CG  1 
ATOM   4362  C  CD1 . PHE B 1 111 ? 115.758 133.110 243.196 1.00 85.75  ? 112 PHE B CD1 1 
ATOM   4363  C  CD2 . PHE B 1 111 ? 114.954 135.047 244.264 1.00 85.76  ? 112 PHE B CD2 1 
ATOM   4364  C  CE1 . PHE B 1 111 ? 114.534 132.892 242.663 1.00 85.85  ? 112 PHE B CE1 1 
ATOM   4365  C  CE2 . PHE B 1 111 ? 113.732 134.834 243.729 1.00 85.84  ? 112 PHE B CE2 1 
ATOM   4366  C  CZ  . PHE B 1 111 ? 113.521 133.757 242.925 1.00 85.86  ? 112 PHE B CZ  1 
ATOM   4367  N  N   . ASN B 1 112 ? 120.447 135.996 244.370 1.00 70.35  ? 113 ASN B N   1 
ATOM   4368  C  CA  . ASN B 1 112 ? 121.517 136.628 245.113 1.00 69.59  ? 113 ASN B CA  1 
ATOM   4369  C  C   . ASN B 1 112 ? 121.393 138.133 245.036 1.00 69.12  ? 113 ASN B C   1 
ATOM   4370  O  O   . ASN B 1 112 ? 120.758 138.653 244.139 1.00 69.09  ? 113 ASN B O   1 
ATOM   4371  C  CB  . ASN B 1 112 ? 122.871 136.176 244.601 1.00 69.41  ? 113 ASN B CB  1 
ATOM   4372  C  CG  . ASN B 1 112 ? 123.231 134.811 245.073 1.00 69.30  ? 113 ASN B CG  1 
ATOM   4373  O  OD1 . ASN B 1 112 ? 122.976 134.455 246.209 1.00 69.26  ? 113 ASN B OD1 1 
ATOM   4374  N  ND2 . ASN B 1 112 ? 123.828 134.031 244.202 1.00 69.23  ? 113 ASN B ND2 1 
ATOM   4375  N  N   . ALA B 1 113 ? 121.980 138.824 246.001 1.00 68.68  ? 114 ALA B N   1 
ATOM   4376  C  CA  . ALA B 1 113 ? 121.780 140.250 246.151 1.00 68.31  ? 114 ALA B CA  1 
ATOM   4377  C  C   . ALA B 1 113 ? 122.107 141.048 244.903 1.00 68.16  ? 114 ALA B C   1 
ATOM   4378  O  O   . ALA B 1 113 ? 121.396 141.982 244.564 1.00 68.13  ? 114 ALA B O   1 
ATOM   4379  C  CB  . ALA B 1 113 ? 122.603 140.750 247.295 1.00 68.20  ? 114 ALA B CB  1 
ATOM   4380  N  N   . GLY B 1 114 ? 123.173 140.675 244.213 1.00 68.99  ? 115 GLY B N   1 
ATOM   4381  C  CA  . GLY B 1 114 ? 123.545 141.353 242.989 1.00 68.92  ? 115 GLY B CA  1 
ATOM   4382  C  C   . GLY B 1 114 ? 122.853 140.778 241.780 1.00 68.89  ? 115 GLY B C   1 
ATOM   4383  O  O   . GLY B 1 114 ? 122.926 141.318 240.690 1.00 68.91  ? 115 GLY B O   1 
ATOM   4384  N  N   . GLY B 1 115 ? 122.155 139.679 241.990 1.00 79.31  ? 116 GLY B N   1 
ATOM   4385  C  CA  . GLY B 1 115 ? 121.389 139.057 240.935 1.00 79.28  ? 116 GLY B CA  1 
ATOM   4386  C  C   . GLY B 1 115 ? 122.089 138.012 240.101 1.00 79.24  ? 116 GLY B C   1 
ATOM   4387  O  O   . GLY B 1 115 ? 121.525 137.535 239.133 1.00 79.24  ? 116 GLY B O   1 
ATOM   4388  N  N   . SER B 1 116 ? 123.302 137.639 240.468 1.00 74.98  ? 117 SER B N   1 
ATOM   4389  C  CA  . SER B 1 116 ? 124.026 136.635 239.704 1.00 74.65  ? 117 SER B CA  1 
ATOM   4390  C  C   . SER B 1 116 ? 124.818 135.692 240.576 1.00 67.60  ? 117 SER B C   1 
ATOM   4391  O  O   . SER B 1 116 ? 125.030 135.942 241.743 1.00 67.46  ? 117 SER B O   1 
ATOM   4392  C  CB  . SER B 1 116 ? 124.965 137.295 238.712 1.00 78.09  ? 117 SER B CB  1 
ATOM   4393  O  OG  . SER B 1 116 ? 126.016 137.940 239.385 1.00 84.90  ? 117 SER B OG  1 
ATOM   4394  N  N   . VAL B 1 117 ? 125.258 134.596 239.984 1.00 69.17  ? 118 VAL B N   1 
ATOM   4395  C  CA  . VAL B 1 117 ? 126.068 133.616 240.680 1.00 68.82  ? 118 VAL B CA  1 
ATOM   4396  C  C   . VAL B 1 117 ? 127.405 134.219 241.045 1.00 69.95  ? 118 VAL B C   1 
ATOM   4397  O  O   . VAL B 1 117 ? 128.080 133.774 241.945 1.00 66.64  ? 118 VAL B O   1 
ATOM   4398  C  CB  . VAL B 1 117 ? 126.248 132.352 239.823 1.00 69.00  ? 118 VAL B CB  1 
ATOM   4399  C  CG1 . VAL B 1 117 ? 126.870 132.697 238.506 1.00 70.33  ? 118 VAL B CG1 1 
ATOM   4400  C  CG2 . VAL B 1 117 ? 127.064 131.317 240.544 1.00 60.13  ? 118 VAL B CG2 1 
ATOM   4401  N  N   . LYS B 1 118 ? 127.777 135.266 240.344 1.00 76.84  ? 119 LYS B N   1 
ATOM   4402  C  CA  . LYS B 1 118 ? 129.056 135.895 240.567 1.00 81.81  ? 119 LYS B CA  1 
ATOM   4403  C  C   . LYS B 1 118 ? 129.165 136.592 241.902 1.00 81.18  ? 119 LYS B C   1 
ATOM   4404  O  O   . LYS B 1 118 ? 130.255 136.873 242.361 1.00 87.91  ? 119 LYS B O   1 
ATOM   4405  C  CB  . LYS B 1 118 ? 129.339 136.876 239.456 1.00 83.51  ? 119 LYS B CB  1 
ATOM   4406  C  CG  . LYS B 1 118 ? 129.556 136.223 238.145 1.00 72.38  ? 119 LYS B CG  1 
ATOM   4407  C  CD  . LYS B 1 118 ? 130.711 135.303 238.183 1.00 78.54  ? 119 LYS B CD  1 
ATOM   4408  C  CE  . LYS B 1 118 ? 131.105 134.947 236.798 1.00 82.65  ? 119 LYS B CE  1 
ATOM   4409  N  NZ  . LYS B 1 118 ? 130.078 134.052 236.306 1.00 74.51  1 119 LYS B NZ  1 
ATOM   4410  N  N   . ASP B 1 119 ? 128.036 136.889 242.519 1.00 89.39  ? 120 ASP B N   1 
ATOM   4411  C  CA  . ASP B 1 119 ? 128.058 137.581 243.786 1.00 89.10  ? 120 ASP B CA  1 
ATOM   4412  C  C   . ASP B 1 119 ? 128.786 136.737 244.805 1.00 85.57  ? 120 ASP B C   1 
ATOM   4413  O  O   . ASP B 1 119 ? 129.381 137.259 245.727 1.00 94.23  ? 120 ASP B O   1 
ATOM   4414  C  CB  . ASP B 1 119 ? 126.640 137.894 244.262 1.00 94.70  ? 120 ASP B CB  1 
ATOM   4415  C  CG  . ASP B 1 119 ? 125.851 138.704 243.261 1.00 94.13  ? 120 ASP B CG  1 
ATOM   4416  O  OD1 . ASP B 1 119 ? 126.464 139.276 242.346 1.00 97.65  ? 120 ASP B OD1 1 
ATOM   4417  O  OD2 . ASP B 1 119 ? 124.614 138.771 243.390 1.00 103.81 1 120 ASP B OD2 1 
ATOM   4418  N  N   . ARG B 1 120 ? 128.749 135.428 244.617 1.00 63.01  ? 121 ARG B N   1 
ATOM   4419  C  CA  . ARG B 1 120 ? 129.442 134.515 245.506 1.00 68.74  ? 121 ARG B CA  1 
ATOM   4420  C  C   . ARG B 1 120 ? 130.942 134.699 245.434 1.00 71.09  ? 121 ARG B C   1 
ATOM   4421  O  O   . ARG B 1 120 ? 131.572 134.988 246.431 1.00 78.57  ? 121 ARG B O   1 
ATOM   4422  C  CB  . ARG B 1 120 ? 129.111 133.060 245.170 1.00 72.16  ? 121 ARG B CB  1 
ATOM   4423  C  CG  . ARG B 1 120 ? 127.750 132.546 245.604 1.00 77.11  ? 121 ARG B CG  1 
ATOM   4424  C  CD  . ARG B 1 120 ? 127.587 131.100 245.188 1.00 71.53  ? 121 ARG B CD  1 
ATOM   4425  N  NE  . ARG B 1 120 ? 126.246 130.558 245.362 1.00 74.48  ? 121 ARG B NE  1 
ATOM   4426  C  CZ  . ARG B 1 120 ? 125.846 129.882 246.424 1.00 70.29  ? 121 ARG B CZ  1 
ATOM   4427  N  NH1 . ARG B 1 120 ? 126.671 129.678 247.421 1.00 65.68  1 121 ARG B NH1 1 
ATOM   4428  N  NH2 . ARG B 1 120 ? 124.618 129.420 246.487 1.00 61.39  ? 121 ARG B NH2 1 
ATOM   4429  N  N   . ILE B 1 121 ? 131.516 134.546 244.258 1.00 64.91  ? 122 ILE B N   1 
ATOM   4430  C  CA  . ILE B 1 121 ? 132.960 134.654 244.138 1.00 64.64  ? 122 ILE B CA  1 
ATOM   4431  C  C   . ILE B 1 121 ? 133.460 136.065 244.354 1.00 64.93  ? 122 ILE B C   1 
ATOM   4432  O  O   . ILE B 1 121 ? 134.608 136.276 244.688 1.00 65.01  ? 122 ILE B O   1 
ATOM   4433  C  CB  . ILE B 1 121 ? 133.484 134.115 242.804 1.00 64.20  ? 122 ILE B CB  1 
ATOM   4434  C  CG1 . ILE B 1 121 ? 133.201 135.088 241.676 1.00 63.94  ? 122 ILE B CG1 1 
ATOM   4435  C  CG2 . ILE B 1 121 ? 132.876 132.787 242.502 1.00 64.15  ? 122 ILE B CG2 1 
ATOM   4436  C  CD1 . ILE B 1 121 ? 133.906 134.741 240.418 1.00 63.80  ? 122 ILE B CD1 1 
ATOM   4437  N  N   . SER B 1 122 ? 132.596 137.038 244.151 1.00 73.78  ? 123 SER B N   1 
ATOM   4438  C  CA  . SER B 1 122 ? 132.990 138.405 244.383 1.00 74.12  ? 123 SER B CA  1 
ATOM   4439  C  C   . SER B 1 122 ? 133.282 138.627 245.848 1.00 74.52  ? 123 SER B C   1 
ATOM   4440  O  O   . SER B 1 122 ? 134.258 139.262 246.205 1.00 74.55  ? 123 SER B O   1 
ATOM   4441  C  CB  . SER B 1 122 ? 131.891 139.350 243.929 1.00 74.09  ? 123 SER B CB  1 
ATOM   4442  O  OG  . SER B 1 122 ? 131.807 139.378 242.527 1.00 74.07  ? 123 SER B OG  1 
ATOM   4443  N  N   . LEU B 1 123 ? 132.437 138.078 246.700 1.00 73.03  ? 124 LEU B N   1 
ATOM   4444  C  CA  . LEU B 1 123 ? 132.591 138.285 248.118 1.00 73.44  ? 124 LEU B CA  1 
ATOM   4445  C  C   . LEU B 1 123 ? 133.820 137.554 248.591 1.00 73.91  ? 124 LEU B C   1 
ATOM   4446  O  O   . LEU B 1 123 ? 134.701 138.128 249.215 1.00 73.95  ? 124 LEU B O   1 
ATOM   4447  C  CB  . LEU B 1 123 ? 131.358 137.766 248.839 1.00 73.40  ? 124 LEU B CB  1 
ATOM   4448  C  CG  . LEU B 1 123 ? 131.319 137.970 250.341 1.00 73.36  ? 124 LEU B CG  1 
ATOM   4449  C  CD1 . LEU B 1 123 ? 131.493 139.423 250.650 1.00 73.35  ? 124 LEU B CD1 1 
ATOM   4450  C  CD2 . LEU B 1 123 ? 130.017 137.464 250.893 1.00 73.35  ? 124 LEU B CD2 1 
ATOM   4451  N  N   . ARG B 1 124 ? 133.903 136.291 248.222 1.00 75.98  ? 125 ARG B N   1 
ATOM   4452  C  CA  . ARG B 1 124 ? 134.952 135.422 248.703 1.00 76.45  ? 125 ARG B CA  1 
ATOM   4453  C  C   . ARG B 1 124 ? 136.307 135.953 248.307 1.00 76.59  ? 125 ARG B C   1 
ATOM   4454  O  O   . ARG B 1 124 ? 137.196 136.082 249.134 1.00 76.60  ? 125 ARG B O   1 
ATOM   4455  C  CB  . ARG B 1 124 ? 134.750 134.036 248.116 1.00 76.69  ? 125 ARG B CB  1 
ATOM   4456  C  CG  . ARG B 1 124 ? 135.802 133.036 248.480 1.00 76.90  ? 125 ARG B CG  1 
ATOM   4457  C  CD  . ARG B 1 124 ? 135.707 132.618 249.911 1.00 77.04  ? 125 ARG B CD  1 
ATOM   4458  N  NE  . ARG B 1 124 ? 136.612 131.517 250.183 1.00 77.18  ? 125 ARG B NE  1 
ATOM   4459  C  CZ  . ARG B 1 124 ? 136.246 130.246 250.212 1.00 77.29  ? 125 ARG B CZ  1 
ATOM   4460  N  NH1 . ARG B 1 124 ? 134.990 129.919 250.002 1.00 77.34  1 125 ARG B NH1 1 
ATOM   4461  N  NH2 . ARG B 1 124 ? 137.134 129.307 250.462 1.00 77.34  ? 125 ARG B NH2 1 
ATOM   4462  N  N   . MET B 1 125 ? 136.429 136.334 247.048 1.00 80.68  ? 126 MET B N   1 
ATOM   4463  C  CA  . MET B 1 125 ? 137.686 136.820 246.527 1.00 80.77  ? 126 MET B CA  1 
ATOM   4464  C  C   . MET B 1 125 ? 138.103 138.048 247.270 1.00 80.41  ? 126 MET B C   1 
ATOM   4465  O  O   . MET B 1 125 ? 139.280 138.265 247.496 1.00 80.40  ? 126 MET B O   1 
ATOM   4466  C  CB  . MET B 1 125 ? 137.558 137.150 245.044 1.00 81.12  ? 126 MET B CB  1 
ATOM   4467  C  CG  . MET B 1 125 ? 137.996 136.043 244.132 1.00 81.36  ? 126 MET B CG  1 
ATOM   4468  S  SD  . MET B 1 125 ? 137.270 136.118 242.504 1.00 81.62  ? 126 MET B SD  1 
ATOM   4469  C  CE  . MET B 1 125 ? 137.884 137.672 241.946 1.00 81.79  ? 126 MET B CE  1 
ATOM   4470  N  N   . ILE B 1 126 ? 137.130 138.849 247.670 1.00 70.42  ? 127 ILE B N   1 
ATOM   4471  C  CA  . ILE B 1 126 ? 137.464 140.046 248.398 1.00 70.06  ? 127 ILE B CA  1 
ATOM   4472  C  C   . ILE B 1 126 ? 137.856 139.643 249.786 1.00 70.09  ? 127 ILE B C   1 
ATOM   4473  O  O   . ILE B 1 126 ? 138.896 140.051 250.290 1.00 70.12  ? 127 ILE B O   1 
ATOM   4474  C  CB  . ILE B 1 126 ? 136.305 141.021 248.451 1.00 69.74  ? 127 ILE B CB  1 
ATOM   4475  C  CG1 . ILE B 1 126 ? 136.177 141.737 247.122 1.00 69.57  ? 127 ILE B CG1 1 
ATOM   4476  C  CG2 . ILE B 1 126 ? 136.534 142.048 249.513 1.00 69.66  ? 127 ILE B CG2 1 
ATOM   4477  C  CD1 . ILE B 1 126 ? 135.147 142.816 247.119 1.00 69.48  ? 127 ILE B CD1 1 
ATOM   4478  N  N   . GLU B 1 127 ? 137.056 138.774 250.381 1.00 76.43  ? 128 GLU B N   1 
ATOM   4479  C  CA  . GLU B 1 127 ? 137.265 138.458 251.772 1.00 76.49  ? 128 GLU B CA  1 
ATOM   4480  C  C   . GLU B 1 127 ? 138.611 137.798 251.951 1.00 76.66  ? 128 GLU B C   1 
ATOM   4481  O  O   . GLU B 1 127 ? 139.389 138.201 252.805 1.00 76.75  ? 128 GLU B O   1 
ATOM   4482  C  CB  . GLU B 1 127 ? 136.119 137.609 252.318 1.00 76.43  ? 128 GLU B CB  1 
ATOM   4483  C  CG  . GLU B 1 127 ? 134.908 138.441 252.706 1.00 76.41  ? 128 GLU B CG  1 
ATOM   4484  C  CD  . GLU B 1 127 ? 133.760 137.628 253.262 1.00 76.41  ? 128 GLU B CD  1 
ATOM   4485  O  OE1 . GLU B 1 127 ? 132.850 138.226 253.867 1.00 76.44  ? 128 GLU B OE1 1 
ATOM   4486  O  OE2 . GLU B 1 127 ? 133.758 136.397 253.089 1.00 76.42  1 128 GLU B OE2 1 
ATOM   4487  N  N   . ASP B 1 128 ? 138.930 136.857 251.078 1.00 74.65  ? 129 ASP B N   1 
ATOM   4488  C  CA  . ASP B 1 128 ? 140.203 136.183 251.181 1.00 74.88  ? 129 ASP B CA  1 
ATOM   4489  C  C   . ASP B 1 128 ? 141.328 137.174 251.010 1.00 75.45  ? 129 ASP B C   1 
ATOM   4490  O  O   . ASP B 1 128 ? 142.316 137.123 251.732 1.00 75.49  ? 129 ASP B O   1 
ATOM   4491  C  CB  . ASP B 1 128 ? 140.312 135.082 250.139 1.00 74.73  ? 129 ASP B CB  1 
ATOM   4492  C  CG  . ASP B 1 128 ? 139.440 133.901 250.454 1.00 74.67  ? 129 ASP B CG  1 
ATOM   4493  O  OD1 . ASP B 1 128 ? 139.121 133.135 249.528 1.00 74.68  ? 129 ASP B OD1 1 
ATOM   4494  O  OD2 . ASP B 1 128 ? 139.069 133.735 251.625 1.00 74.73  1 129 ASP B OD2 1 
ATOM   4495  N  N   . ALA B 1 129 ? 141.150 138.123 250.107 1.00 70.67  ? 130 ALA B N   1 
ATOM   4496  C  CA  . ALA B 1 129 ? 142.202 139.085 249.880 1.00 71.40  ? 130 ALA B CA  1 
ATOM   4497  C  C   . ALA B 1 129 ? 142.399 139.916 251.121 1.00 72.56  ? 130 ALA B C   1 
ATOM   4498  O  O   . ALA B 1 129 ? 143.524 140.221 251.501 1.00 72.64  ? 130 ALA B O   1 
ATOM   4499  C  CB  . ALA B 1 129 ? 141.867 139.963 248.718 1.00 71.21  ? 130 ALA B CB  1 
ATOM   4500  N  N   . GLU B 1 130 ? 141.298 140.237 251.784 1.00 74.87  ? 131 GLU B N   1 
ATOM   4501  C  CA  . GLU B 1 130 ? 141.378 141.038 252.982 1.00 76.15  ? 131 GLU B CA  1 
ATOM   4502  C  C   . GLU B 1 130 ? 142.078 140.254 254.061 1.00 77.79  ? 131 GLU B C   1 
ATOM   4503  O  O   . GLU B 1 130 ? 142.758 140.822 254.892 1.00 77.91  ? 131 GLU B O   1 
ATOM   4504  C  CB  . GLU B 1 130 ? 139.991 141.461 253.452 1.00 75.91  ? 131 GLU B CB  1 
ATOM   4505  C  CG  . GLU B 1 130 ? 139.364 142.565 252.640 1.00 75.74  ? 131 GLU B CG  1 
ATOM   4506  C  CD  . GLU B 1 130 ? 137.939 142.847 253.036 1.00 75.67  ? 131 GLU B CD  1 
ATOM   4507  O  OE1 . GLU B 1 130 ? 137.383 143.855 252.572 1.00 75.62  ? 131 GLU B OE1 1 
ATOM   4508  O  OE2 . GLU B 1 130 ? 137.371 142.058 253.802 1.00 75.65  1 131 GLU B OE2 1 
ATOM   4509  N  N   . ARG B 1 131 ? 141.919 138.940 254.046 1.00 100.57 ? 132 ARG B N   1 
ATOM   4510  C  CA  . ARG B 1 131 ? 142.587 138.131 255.045 1.00 102.12 ? 132 ARG B CA  1 
ATOM   4511  C  C   . ARG B 1 131 ? 144.040 137.923 254.674 1.00 101.75 ? 132 ARG B C   1 
ATOM   4512  O  O   . ARG B 1 131 ? 144.851 137.603 255.523 1.00 101.77 ? 132 ARG B O   1 
ATOM   4513  C  CB  . ARG B 1 131 ? 141.872 136.794 255.257 1.00 103.73 ? 132 ARG B CB  1 
ATOM   4514  C  CG  . ARG B 1 131 ? 140.521 136.935 255.927 1.00 105.18 ? 132 ARG B CG  1 
ATOM   4515  C  CD  . ARG B 1 131 ? 139.806 135.608 256.146 1.00 106.54 ? 132 ARG B CD  1 
ATOM   4516  N  NE  . ARG B 1 131 ? 138.448 135.820 256.650 1.00 107.72 ? 132 ARG B NE  1 
ATOM   4517  C  CZ  . ARG B 1 131 ? 137.578 134.850 256.917 1.00 108.82 ? 132 ARG B CZ  1 
ATOM   4518  N  NH1 . ARG B 1 131 ? 137.915 133.583 256.730 1.00 109.29 1 132 ARG B NH1 1 
ATOM   4519  N  NH2 . ARG B 1 131 ? 136.368 135.146 257.373 1.00 109.09 ? 132 ARG B NH2 1 
ATOM   4520  N  N   . ASP B 1 132 ? 144.367 138.112 253.402 1.00 97.17  ? 133 ASP B N   1 
ATOM   4521  C  CA  . ASP B 1 132 ? 145.750 138.007 252.961 1.00 96.70  ? 133 ASP B CA  1 
ATOM   4522  C  C   . ASP B 1 132 ? 146.567 139.175 253.465 1.00 95.86  ? 133 ASP B C   1 
ATOM   4523  O  O   . ASP B 1 132 ? 147.776 139.093 253.598 1.00 95.81  ? 133 ASP B O   1 
ATOM   4524  C  CB  . ASP B 1 132 ? 145.827 137.946 251.439 1.00 96.94  ? 133 ASP B CB  1 
ATOM   4525  C  CG  . ASP B 1 132 ? 145.495 136.582 250.892 1.00 97.06  ? 133 ASP B CG  1 
ATOM   4526  O  OD1 . ASP B 1 132 ? 145.713 135.584 251.601 1.00 97.12  ? 133 ASP B OD1 1 
ATOM   4527  O  OD2 . ASP B 1 132 ? 145.024 136.503 249.743 1.00 97.11  1 133 ASP B OD2 1 
ATOM   4528  N  N   . GLY B 1 133 ? 145.889 140.273 253.734 1.00 77.43  ? 134 GLY B N   1 
ATOM   4529  C  CA  . GLY B 1 133 ? 146.557 141.502 254.084 1.00 76.58  ? 134 GLY B CA  1 
ATOM   4530  C  C   . GLY B 1 133 ? 146.954 142.258 252.843 1.00 75.80  ? 134 GLY B C   1 
ATOM   4531  O  O   . GLY B 1 133 ? 147.553 143.320 252.917 1.00 75.72  ? 134 GLY B O   1 
ATOM   4532  N  N   . THR B 1 134 ? 146.614 141.697 251.695 1.00 81.51  ? 135 THR B N   1 
ATOM   4533  C  CA  . THR B 1 134 ? 146.939 142.306 250.422 1.00 80.87  ? 135 THR B CA  1 
ATOM   4534  C  C   . THR B 1 134 ? 146.033 143.476 250.097 1.00 80.27  ? 135 THR B C   1 
ATOM   4535  O  O   . THR B 1 134 ? 146.486 144.502 249.612 1.00 80.21  ? 135 THR B O   1 
ATOM   4536  C  CB  . THR B 1 134 ? 146.860 141.283 249.297 1.00 80.85  ? 135 THR B CB  1 
ATOM   4537  O  OG1 . THR B 1 134 ? 145.598 140.620 249.351 1.00 80.85  ? 135 THR B OG1 1 
ATOM   4538  C  CG2 . THR B 1 134 ? 147.954 140.254 249.449 1.00 80.87  ? 135 THR B CG2 1 
ATOM   4539  N  N   . LEU B 1 135 ? 144.750 143.323 250.374 1.00 75.31  ? 136 LEU B N   1 
ATOM   4540  C  CA  . LEU B 1 135 ? 143.796 144.380 250.100 1.00 74.76  ? 136 LEU B CA  1 
ATOM   4541  C  C   . LEU B 1 135 ? 143.621 145.274 251.309 1.00 74.68  ? 136 LEU B C   1 
ATOM   4542  O  O   . LEU B 1 135 ? 143.144 144.846 252.342 1.00 74.67  ? 136 LEU B O   1 
ATOM   4543  C  CB  . LEU B 1 135 ? 142.462 143.780 249.662 1.00 74.41  ? 136 LEU B CB  1 
ATOM   4544  C  CG  . LEU B 1 135 ? 141.336 144.685 249.156 1.00 74.11  ? 136 LEU B CG  1 
ATOM   4545  C  CD1 . LEU B 1 135 ? 141.806 145.612 248.068 1.00 74.02  ? 136 LEU B CD1 1 
ATOM   4546  C  CD2 . LEU B 1 135 ? 140.192 143.847 248.647 1.00 74.02  ? 136 LEU B CD2 1 
ATOM   4547  N  N   . LYS B 1 136 ? 144.009 146.528 251.157 1.00 71.06  ? 137 LYS B N   1 
ATOM   4548  C  CA  . LYS B 1 136 ? 143.987 147.487 252.243 1.00 71.01  ? 137 LYS B CA  1 
ATOM   4549  C  C   . LYS B 1 136 ? 142.777 148.378 252.102 1.00 70.89  ? 137 LYS B C   1 
ATOM   4550  O  O   . LYS B 1 136 ? 142.253 148.527 251.017 1.00 70.85  ? 137 LYS B O   1 
ATOM   4551  C  CB  . LYS B 1 136 ? 145.247 148.340 252.201 1.00 71.07  ? 137 LYS B CB  1 
ATOM   4552  C  CG  . LYS B 1 136 ? 146.516 147.556 251.994 1.00 71.13  ? 137 LYS B CG  1 
ATOM   4553  C  CD  . LYS B 1 136 ? 147.733 148.458 251.934 1.00 71.17  ? 137 LYS B CD  1 
ATOM   4554  C  CE  . LYS B 1 136 ? 147.814 149.216 250.635 1.00 71.20  ? 137 LYS B CE  1 
ATOM   4555  N  NZ  . LYS B 1 136 ? 148.134 148.327 249.497 1.00 71.22  1 137 LYS B NZ  1 
ATOM   4556  N  N   . PRO B 1 137 ? 142.311 148.962 253.202 1.00 81.10  ? 138 PRO B N   1 
ATOM   4557  C  CA  . PRO B 1 137 ? 141.136 149.808 253.058 1.00 80.96  ? 138 PRO B CA  1 
ATOM   4558  C  C   . PRO B 1 137 ? 141.417 150.952 252.116 1.00 80.69  ? 138 PRO B C   1 
ATOM   4559  O  O   . PRO B 1 137 ? 142.516 151.473 252.108 1.00 80.69  ? 138 PRO B O   1 
ATOM   4560  C  CB  . PRO B 1 137 ? 140.931 150.336 254.467 1.00 81.05  ? 138 PRO B CB  1 
ATOM   4561  C  CG  . PRO B 1 137 ? 141.498 149.304 255.328 1.00 81.11  ? 138 PRO B CG  1 
ATOM   4562  C  CD  . PRO B 1 137 ? 142.680 148.778 254.609 1.00 81.13  ? 138 PRO B CD  1 
ATOM   4563  N  N   . GLY B 1 138 ? 140.428 151.316 251.317 1.00 75.43  ? 139 GLY B N   1 
ATOM   4564  C  CA  . GLY B 1 138 ? 140.546 152.411 250.380 1.00 75.16  ? 139 GLY B CA  1 
ATOM   4565  C  C   . GLY B 1 138 ? 141.204 152.036 249.072 1.00 74.90  ? 139 GLY B C   1 
ATOM   4566  O  O   . GLY B 1 138 ? 141.317 152.854 248.172 1.00 74.88  ? 139 GLY B O   1 
ATOM   4567  N  N   . ASP B 1 139 ? 141.622 150.789 248.958 1.00 75.69  ? 140 ASP B N   1 
ATOM   4568  C  CA  . ASP B 1 139 ? 142.343 150.343 247.779 1.00 75.49  ? 140 ASP B CA  1 
ATOM   4569  C  C   . ASP B 1 139 ? 141.474 150.184 246.546 1.00 75.42  ? 140 ASP B C   1 
ATOM   4570  O  O   . ASP B 1 139 ? 140.266 150.034 246.641 1.00 75.41  ? 140 ASP B O   1 
ATOM   4571  C  CB  . ASP B 1 139 ? 143.100 149.052 248.059 1.00 75.42  ? 140 ASP B CB  1 
ATOM   4572  C  CG  . ASP B 1 139 ? 144.447 149.297 248.664 1.00 75.40  ? 140 ASP B CG  1 
ATOM   4573  O  OD1 . ASP B 1 139 ? 144.697 150.432 249.085 1.00 75.40  ? 140 ASP B OD1 1 
ATOM   4574  O  OD2 . ASP B 1 139 ? 145.254 148.355 248.722 1.00 75.40  1 140 ASP B OD2 1 
ATOM   4575  N  N   . THR B 1 140 ? 142.114 150.253 245.387 1.00 79.13  ? 141 THR B N   1 
ATOM   4576  C  CA  . THR B 1 140 ? 141.439 150.091 244.113 1.00 79.08  ? 141 THR B CA  1 
ATOM   4577  C  C   . THR B 1 140 ? 141.411 148.646 243.648 1.00 79.01  ? 141 THR B C   1 
ATOM   4578  O  O   . THR B 1 140 ? 142.415 147.955 243.674 1.00 79.01  ? 141 THR B O   1 
ATOM   4579  C  CB  . THR B 1 140 ? 142.120 150.927 243.032 1.00 79.11  ? 141 THR B CB  1 
ATOM   4580  O  OG1 . THR B 1 140 ? 142.215 152.284 243.466 1.00 79.11  ? 141 THR B OG1 1 
ATOM   4581  C  CG2 . THR B 1 140 ? 141.330 150.883 241.766 1.00 79.12  ? 141 THR B CG2 1 
ATOM   4582  N  N   . ILE B 1 141 ? 140.246 148.202 243.201 1.00 81.66  ? 142 ILE B N   1 
ATOM   4583  C  CA  . ILE B 1 141 ? 140.087 146.873 242.643 1.00 81.53  ? 142 ILE B CA  1 
ATOM   4584  C  C   . ILE B 1 141 ? 139.808 146.973 241.166 1.00 80.88  ? 142 ILE B C   1 
ATOM   4585  O  O   . ILE B 1 141 ? 138.872 147.630 240.760 1.00 80.82  ? 142 ILE B O   1 
ATOM   4586  C  CB  . ILE B 1 141 ? 138.910 146.165 243.265 1.00 81.97  ? 142 ILE B CB  1 
ATOM   4587  C  CG1 . ILE B 1 141 ? 139.131 145.993 244.758 1.00 82.22  ? 142 ILE B CG1 1 
ATOM   4588  C  CG2 . ILE B 1 141 ? 138.730 144.832 242.633 1.00 82.08  ? 142 ILE B CG2 1 
ATOM   4589  C  CD1 . ILE B 1 141 ? 137.922 145.482 245.482 1.00 82.35  ? 142 ILE B CD1 1 
ATOM   4590  N  N   . ILE B 1 142 ? 140.636 146.320 240.367 1.00 70.09  ? 143 ILE B N   1 
ATOM   4591  C  CA  . ILE B 1 142 ? 140.458 146.268 238.931 1.00 69.47  ? 143 ILE B CA  1 
ATOM   4592  C  C   . ILE B 1 142 ? 140.082 144.862 238.554 1.00 69.38  ? 143 ILE B C   1 
ATOM   4593  O  O   . ILE B 1 142 ? 140.697 143.926 239.018 1.00 69.41  ? 143 ILE B O   1 
ATOM   4594  C  CB  . ILE B 1 142 ? 141.758 146.644 238.221 1.00 69.04  ? 143 ILE B CB  1 
ATOM   4595  C  CG1 . ILE B 1 142 ? 142.133 148.080 238.559 1.00 68.83  ? 143 ILE B CG1 1 
ATOM   4596  C  CG2 . ILE B 1 142 ? 141.620 146.484 236.739 1.00 68.93  ? 143 ILE B CG2 1 
ATOM   4597  C  CD1 . ILE B 1 142 ? 143.511 148.454 238.186 1.00 68.74  ? 143 ILE B CD1 1 
ATOM   4598  N  N   . GLU B 1 143 ? 139.070 144.697 237.715 1.00 75.19  ? 144 GLU B N   1 
ATOM   4599  C  CA  . GLU B 1 143 ? 138.685 143.349 237.332 1.00 75.11  ? 144 GLU B CA  1 
ATOM   4600  C  C   . GLU B 1 143 ? 138.179 143.209 235.915 1.00 74.91  ? 144 GLU B C   1 
ATOM   4601  O  O   . GLU B 1 143 ? 137.239 143.882 235.530 1.00 74.90  ? 144 GLU B O   1 
ATOM   4602  C  CB  . GLU B 1 143 ? 137.638 142.806 238.292 1.00 75.21  ? 144 GLU B CB  1 
ATOM   4603  C  CG  . GLU B 1 143 ? 137.306 141.353 238.063 1.00 75.29  ? 144 GLU B CG  1 
ATOM   4604  C  CD  . GLU B 1 143 ? 138.401 140.432 238.517 1.00 75.33  ? 144 GLU B CD  1 
ATOM   4605  O  OE1 . GLU B 1 143 ? 138.455 139.285 238.047 1.00 75.39  ? 144 GLU B OE1 1 
ATOM   4606  O  OE2 . GLU B 1 143 ? 139.210 140.857 239.352 1.00 75.37  1 144 GLU B OE2 1 
ATOM   4607  N  N   . PRO B 1 144 ? 138.832 142.360 235.117 1.00 69.25  ? 145 PRO B N   1 
ATOM   4608  C  CA  . PRO B 1 144 ? 138.245 141.918 233.856 1.00 69.09  ? 145 PRO B CA  1 
ATOM   4609  C  C   . PRO B 1 144 ? 136.999 141.104 234.112 1.00 68.88  ? 145 PRO B C   1 
ATOM   4610  O  O   . PRO B 1 144 ? 137.028 140.287 235.012 1.00 68.86  ? 145 PRO B O   1 
ATOM   4611  C  CB  . PRO B 1 144 ? 139.336 141.038 233.269 1.00 69.15  ? 145 PRO B CB  1 
ATOM   4612  C  CG  . PRO B 1 144 ? 140.085 140.557 234.415 1.00 69.18  ? 145 PRO B CG  1 
ATOM   4613  C  CD  . PRO B 1 144 ? 140.067 141.630 235.425 1.00 69.21  ? 145 PRO B CD  1 
ATOM   4614  N  N   . THR B 1 145 ? 135.955 141.254 233.308 1.00 70.89  ? 146 THR B N   1 
ATOM   4615  C  CA  . THR B 1 145 ? 134.733 140.489 233.557 1.00 70.68  ? 146 THR B CA  1 
ATOM   4616  C  C   . THR B 1 145 ? 133.711 140.522 232.438 1.00 70.52  ? 146 THR B C   1 
ATOM   4617  O  O   . THR B 1 145 ? 133.753 141.375 231.573 1.00 70.57  ? 146 THR B O   1 
ATOM   4618  C  CB  . THR B 1 145 ? 134.027 140.954 234.830 1.00 70.63  ? 146 THR B CB  1 
ATOM   4619  O  OG1 . THR B 1 145 ? 132.921 140.092 235.104 1.00 70.61  ? 146 THR B OG1 1 
ATOM   4620  C  CG2 . THR B 1 145 ? 133.524 142.347 234.655 1.00 70.60  ? 146 THR B CG2 1 
ATOM   4621  N  N   . SER B 1 146 ? 132.786 139.572 232.474 1.00 81.00  ? 147 SER B N   1 
ATOM   4622  C  CA  . SER B 1 146 ? 131.628 139.597 231.599 1.00 80.83  ? 147 SER B CA  1 
ATOM   4623  C  C   . SER B 1 146 ? 130.581 140.532 232.155 1.00 80.61  ? 147 SER B C   1 
ATOM   4624  O  O   . SER B 1 146 ? 129.616 140.853 231.488 1.00 80.70  ? 147 SER B O   1 
ATOM   4625  C  CB  . SER B 1 146 ? 131.025 138.210 231.456 1.00 80.87  ? 147 SER B CB  1 
ATOM   4626  O  OG  . SER B 1 146 ? 131.896 137.348 230.761 1.00 80.88  ? 147 SER B OG  1 
ATOM   4627  N  N   . GLY B 1 147 ? 130.769 140.962 233.390 1.00 71.36  ? 148 GLY B N   1 
ATOM   4628  C  CA  . GLY B 1 147 ? 129.853 141.898 233.994 1.00 71.10  ? 148 GLY B CA  1 
ATOM   4629  C  C   . GLY B 1 147 ? 129.310 141.482 235.332 1.00 70.84  ? 148 GLY B C   1 
ATOM   4630  O  O   . GLY B 1 147 ? 129.247 142.280 236.249 1.00 70.77  ? 148 GLY B O   1 
ATOM   4631  N  N   . ASN B 1 148 ? 128.901 140.236 235.453 1.00 63.28  ? 149 ASN B N   1 
ATOM   4632  C  CA  . ASN B 1 148 ? 128.318 139.795 236.696 1.00 63.11  ? 149 ASN B CA  1 
ATOM   4633  C  C   . ASN B 1 148 ? 129.304 139.780 237.855 1.00 63.04  ? 149 ASN B C   1 
ATOM   4634  O  O   . ASN B 1 148 ? 128.968 140.175 238.964 1.00 63.03  ? 149 ASN B O   1 
ATOM   4635  C  CB  . ASN B 1 148 ? 127.674 138.434 236.515 1.00 63.07  ? 149 ASN B CB  1 
ATOM   4636  C  CG  . ASN B 1 148 ? 126.351 138.508 235.830 1.00 63.05  ? 149 ASN B CG  1 
ATOM   4637  O  OD1 . ASN B 1 148 ? 125.642 139.493 235.930 1.00 63.03  ? 149 ASN B OD1 1 
ATOM   4638  N  ND2 . ASN B 1 148 ? 126.000 137.455 235.141 1.00 63.11  ? 149 ASN B ND2 1 
ATOM   4639  N  N   . THR B 1 149 ? 130.527 139.338 237.603 1.00 75.84  ? 150 THR B N   1 
ATOM   4640  C  CA  . THR B 1 149 ? 131.559 139.411 238.621 1.00 75.75  ? 150 THR B CA  1 
ATOM   4641  C  C   . THR B 1 149 ? 131.844 140.857 238.911 1.00 75.30  ? 150 THR B C   1 
ATOM   4642  O  O   . THR B 1 149 ? 132.112 141.240 240.037 1.00 75.28  ? 150 THR B O   1 
ATOM   4643  C  CB  . THR B 1 149 ? 132.870 138.764 238.174 1.00 75.97  ? 150 THR B CB  1 
ATOM   4644  O  OG1 . THR B 1 149 ? 132.654 137.402 237.834 1.00 76.10  ? 150 THR B OG1 1 
ATOM   4645  C  CG2 . THR B 1 149 ? 133.861 138.793 239.283 1.00 76.07  ? 150 THR B CG2 1 
ATOM   4646  N  N   . GLY B 1 150 ? 131.758 141.670 237.879 1.00 63.41  ? 151 GLY B N   1 
ATOM   4647  C  CA  . GLY B 1 150 ? 132.041 143.072 238.028 1.00 62.96  ? 151 GLY B CA  1 
ATOM   4648  C  C   . GLY B 1 150 ? 130.975 143.735 238.846 1.00 62.48  ? 151 GLY B C   1 
ATOM   4649  O  O   . GLY B 1 150 ? 131.245 144.626 239.622 1.00 62.45  ? 151 GLY B O   1 
ATOM   4650  N  N   . ILE B 1 151 ? 129.747 143.293 238.659 1.00 64.12  ? 152 ILE B N   1 
ATOM   4651  C  CA  . ILE B 1 151 ? 128.656 143.811 239.441 1.00 63.69  ? 152 ILE B CA  1 
ATOM   4652  C  C   . ILE B 1 151 ? 128.788 143.393 240.887 1.00 64.01  ? 152 ILE B C   1 
ATOM   4653  O  O   . ILE B 1 151 ? 128.555 144.181 241.789 1.00 64.04  ? 152 ILE B O   1 
ATOM   4654  C  CB  . ILE B 1 151 ? 127.326 143.362 238.866 1.00 63.11  ? 152 ILE B CB  1 
ATOM   4655  C  CG1 . ILE B 1 151 ? 127.039 144.143 237.598 1.00 62.80  ? 152 ILE B CG1 1 
ATOM   4656  C  CG2 . ILE B 1 151 ? 126.223 143.613 239.828 1.00 62.97  ? 152 ILE B CG2 1 
ATOM   4657  C  CD1 . ILE B 1 151 ? 125.818 143.693 236.888 1.00 62.64  ? 152 ILE B CD1 1 
ATOM   4658  N  N   . GLY B 1 152 ? 129.215 142.166 241.121 1.00 68.74  ? 153 GLY B N   1 
ATOM   4659  C  CA  . GLY B 1 152 ? 129.330 141.717 242.487 1.00 69.11  ? 153 GLY B CA  1 
ATOM   4660  C  C   . GLY B 1 152 ? 130.428 142.454 243.206 1.00 69.52  ? 153 GLY B C   1 
ATOM   4661  O  O   . GLY B 1 152 ? 130.286 142.856 244.357 1.00 69.56  ? 153 GLY B O   1 
ATOM   4662  N  N   . LEU B 1 153 ? 131.527 142.661 242.504 1.00 68.69  ? 154 LEU B N   1 
ATOM   4663  C  CA  . LEU B 1 153 ? 132.646 143.368 243.083 1.00 69.08  ? 154 LEU B CA  1 
ATOM   4664  C  C   . LEU B 1 153 ? 132.333 144.818 243.292 1.00 69.39  ? 154 LEU B C   1 
ATOM   4665  O  O   . LEU B 1 153 ? 132.787 145.407 244.241 1.00 69.44  ? 154 LEU B O   1 
ATOM   4666  C  CB  . LEU B 1 153 ? 133.881 143.239 242.204 1.00 69.15  ? 154 LEU B CB  1 
ATOM   4667  C  CG  . LEU B 1 153 ? 134.642 141.921 242.258 1.00 69.21  ? 154 LEU B CG  1 
ATOM   4668  C  CD1 . LEU B 1 153 ? 135.766 141.938 241.271 1.00 69.25  ? 154 LEU B CD1 1 
ATOM   4669  C  CD2 . LEU B 1 153 ? 135.178 141.696 243.634 1.00 69.22  ? 154 LEU B CD2 1 
ATOM   4670  N  N   . ALA B 1 154 ? 131.574 145.400 242.380 1.00 74.90  ? 155 ALA B N   1 
ATOM   4671  C  CA  . ALA B 1 154 ? 131.217 146.801 242.484 1.00 75.20  ? 155 ALA B CA  1 
ATOM   4672  C  C   . ALA B 1 154 ? 130.274 147.029 243.636 1.00 75.50  ? 155 ALA B C   1 
ATOM   4673  O  O   . ALA B 1 154 ? 130.296 148.060 244.285 1.00 75.52  ? 155 ALA B O   1 
ATOM   4674  C  CB  . ALA B 1 154 ? 130.600 147.273 241.208 1.00 75.19  ? 155 ALA B CB  1 
ATOM   4675  N  N   . LEU B 1 155 ? 129.446 146.033 243.884 1.00 74.36  ? 156 LEU B N   1 
ATOM   4676  C  CA  . LEU B 1 155 ? 128.502 146.074 244.976 1.00 74.66  ? 156 LEU B CA  1 
ATOM   4677  C  C   . LEU B 1 155 ? 129.243 146.013 246.293 1.00 74.74  ? 156 LEU B C   1 
ATOM   4678  O  O   . LEU B 1 155 ? 129.101 146.874 247.163 1.00 74.76  ? 156 LEU B O   1 
ATOM   4679  C  CB  . LEU B 1 155 ? 127.583 144.875 244.840 1.00 74.83  ? 156 LEU B CB  1 
ATOM   4680  C  CG  . LEU B 1 155 ? 126.560 144.596 245.915 1.00 75.00  ? 156 LEU B CG  1 
ATOM   4681  C  CD1 . LEU B 1 155 ? 125.697 145.781 246.056 1.00 75.07  ? 156 LEU B CD1 1 
ATOM   4682  C  CD2 . LEU B 1 155 ? 125.737 143.413 245.508 1.00 75.05  ? 156 LEU B CD2 1 
ATOM   4683  N  N   . ALA B 1 156 ? 130.087 145.005 246.414 1.00 71.09  ? 157 ALA B N   1 
ATOM   4684  C  CA  . ALA B 1 156 ? 130.847 144.844 247.628 1.00 71.16  ? 157 ALA B CA  1 
ATOM   4685  C  C   . ALA B 1 156 ? 131.760 146.027 247.845 1.00 71.25  ? 157 ALA B C   1 
ATOM   4686  O  O   . ALA B 1 156 ? 132.007 146.421 248.963 1.00 71.25  ? 157 ALA B O   1 
ATOM   4687  C  CB  . ALA B 1 156 ? 131.646 143.586 247.560 1.00 71.15  ? 157 ALA B CB  1 
ATOM   4688  N  N   . ALA B 1 157 ? 132.264 146.596 246.767 1.00 67.02  ? 158 ALA B N   1 
ATOM   4689  C  CA  . ALA B 1 157 ? 133.147 147.735 246.871 1.00 67.15  ? 158 ALA B CA  1 
ATOM   4690  C  C   . ALA B 1 157 ? 132.387 148.942 247.332 1.00 67.38  ? 158 ALA B C   1 
ATOM   4691  O  O   . ALA B 1 157 ? 132.896 149.755 248.085 1.00 67.39  ? 158 ALA B O   1 
ATOM   4692  C  CB  . ALA B 1 157 ? 133.794 148.014 245.553 1.00 67.11  ? 158 ALA B CB  1 
ATOM   4693  N  N   . ALA B 1 158 ? 131.157 149.065 246.864 1.00 68.92  ? 159 ALA B N   1 
ATOM   4694  C  CA  . ALA B 1 158 ? 130.347 150.194 247.247 1.00 69.19  ? 159 ALA B CA  1 
ATOM   4695  C  C   . ALA B 1 158 ? 130.051 150.126 248.719 1.00 69.56  ? 159 ALA B C   1 
ATOM   4696  O  O   . ALA B 1 158 ? 130.001 151.142 249.396 1.00 69.59  ? 159 ALA B O   1 
ATOM   4697  C  CB  . ALA B 1 158 ? 129.080 150.203 246.468 1.00 69.15  ? 159 ALA B CB  1 
ATOM   4698  N  N   . VAL B 1 159 ? 129.884 148.916 249.226 1.00 67.55  ? 160 VAL B N   1 
ATOM   4699  C  CA  . VAL B 1 159 ? 129.586 148.767 250.639 1.00 67.96  ? 160 VAL B CA  1 
ATOM   4700  C  C   . VAL B 1 159 ? 130.810 148.929 251.525 1.00 68.67  ? 160 VAL B C   1 
ATOM   4701  O  O   . VAL B 1 159 ? 130.793 149.669 252.496 1.00 68.73  ? 160 VAL B O   1 
ATOM   4702  C  CB  . VAL B 1 159 ? 128.920 147.421 250.922 1.00 67.73  ? 160 VAL B CB  1 
ATOM   4703  C  CG1 . VAL B 1 159 ? 128.896 147.149 252.390 1.00 67.66  ? 160 VAL B CG1 1 
ATOM   4704  C  CG2 . VAL B 1 159 ? 127.526 147.413 250.369 1.00 67.65  ? 160 VAL B CG2 1 
ATOM   4705  N  N   . ARG B 1 160 ? 131.883 148.248 251.167 1.00 84.90  ? 161 ARG B N   1 
ATOM   4706  C  CA  . ARG B 1 160 ? 133.070 148.198 251.998 1.00 85.57  ? 161 ARG B CA  1 
ATOM   4707  C  C   . ARG B 1 160 ? 134.057 149.323 251.759 1.00 85.35  ? 161 ARG B C   1 
ATOM   4708  O  O   . ARG B 1 160 ? 135.068 149.405 252.431 1.00 85.35  ? 161 ARG B O   1 
ATOM   4709  C  CB  . ARG B 1 160 ? 133.756 146.845 251.868 1.00 86.33  ? 161 ARG B CB  1 
ATOM   4710  C  CG  . ARG B 1 160 ? 132.897 145.691 252.310 1.00 87.01  ? 161 ARG B CG  1 
ATOM   4711  C  CD  . ARG B 1 160 ? 133.730 144.544 252.820 1.00 87.63  ? 161 ARG B CD  1 
ATOM   4712  N  NE  . ARG B 1 160 ? 132.908 143.422 253.249 1.00 88.16  ? 161 ARG B NE  1 
ATOM   4713  C  CZ  . ARG B 1 160 ? 133.391 142.315 253.795 1.00 88.62  ? 161 ARG B CZ  1 
ATOM   4714  N  NH1 . ARG B 1 160 ? 134.692 142.189 253.985 1.00 88.77  1 161 ARG B NH1 1 
ATOM   4715  N  NH2 . ARG B 1 160 ? 132.575 141.336 254.155 1.00 88.77  ? 161 ARG B NH2 1 
ATOM   4716  N  N   . GLY B 1 161 ? 133.761 150.196 250.810 1.00 72.81  ? 162 GLY B N   1 
ATOM   4717  C  CA  . GLY B 1 161 ? 134.608 151.345 250.559 1.00 72.57  ? 162 GLY B CA  1 
ATOM   4718  C  C   . GLY B 1 161 ? 135.845 151.193 249.693 1.00 72.30  ? 162 GLY B C   1 
ATOM   4719  O  O   . GLY B 1 161 ? 136.852 151.831 249.943 1.00 72.28  ? 162 GLY B O   1 
ATOM   4720  N  N   . TYR B 1 162 ? 135.782 150.329 248.693 1.00 70.27  ? 163 TYR B N   1 
ATOM   4721  C  CA  . TYR B 1 162 ? 136.832 150.245 247.692 1.00 70.01  ? 163 TYR B CA  1 
ATOM   4722  C  C   . TYR B 1 162 ? 136.480 150.982 246.413 1.00 69.73  ? 163 TYR B C   1 
ATOM   4723  O  O   . TYR B 1 162 ? 135.329 151.033 246.022 1.00 69.70  ? 163 TYR B O   1 
ATOM   4724  C  CB  . TYR B 1 162 ? 137.088 148.800 247.333 1.00 70.04  ? 163 TYR B CB  1 
ATOM   4725  C  CG  . TYR B 1 162 ? 137.496 147.943 248.483 1.00 70.08  ? 163 TYR B CG  1 
ATOM   4726  C  CD1 . TYR B 1 162 ? 136.644 146.990 248.990 1.00 70.09  ? 163 TYR B CD1 1 
ATOM   4727  C  CD2 . TYR B 1 162 ? 138.738 148.073 249.052 1.00 70.10  ? 163 TYR B CD2 1 
ATOM   4728  C  CE1 . TYR B 1 162 ? 137.016 146.197 250.029 1.00 70.10  ? 163 TYR B CE1 1 
ATOM   4729  C  CE2 . TYR B 1 162 ? 139.117 147.286 250.092 1.00 70.11  ? 163 TYR B CE2 1 
ATOM   4730  C  CZ  . TYR B 1 162 ? 138.252 146.348 250.578 1.00 70.12  ? 163 TYR B CZ  1 
ATOM   4731  O  OH  . TYR B 1 162 ? 138.624 145.552 251.625 1.00 70.15  ? 163 TYR B OH  1 
ATOM   4732  N  N   . ARG B 1 163 ? 137.478 151.570 245.769 1.00 77.90  ? 164 ARG B N   1 
ATOM   4733  C  CA  . ARG B 1 163 ? 137.321 152.070 244.413 1.00 77.64  ? 164 ARG B CA  1 
ATOM   4734  C  C   . ARG B 1 163 ? 137.221 150.894 243.472 1.00 77.09  ? 164 ARG B C   1 
ATOM   4735  O  O   . ARG B 1 163 ? 137.934 149.920 243.633 1.00 77.07  ? 164 ARG B O   1 
ATOM   4736  C  CB  . ARG B 1 163 ? 138.505 152.940 244.027 1.00 77.92  ? 164 ARG B CB  1 
ATOM   4737  C  CG  . ARG B 1 163 ? 138.384 153.600 242.676 1.00 78.19  ? 164 ARG B CG  1 
ATOM   4738  C  CD  . ARG B 1 163 ? 139.675 154.279 242.304 1.00 78.41  ? 164 ARG B CD  1 
ATOM   4739  N  NE  . ARG B 1 163 ? 139.627 154.899 240.991 1.00 78.61  ? 164 ARG B NE  1 
ATOM   4740  C  CZ  . ARG B 1 163 ? 140.699 155.326 240.343 1.00 78.78  ? 164 ARG B CZ  1 
ATOM   4741  N  NH1 . ARG B 1 163 ? 141.889 155.186 240.887 1.00 78.84  1 164 ARG B NH1 1 
ATOM   4742  N  NH2 . ARG B 1 163 ? 140.585 155.882 239.153 1.00 78.83  ? 164 ARG B NH2 1 
ATOM   4743  N  N   . CYS B 1 164 ? 136.363 150.986 242.468 1.00 66.29  ? 165 CYS B N   1 
ATOM   4744  C  CA  . CYS B 1 164 ? 136.128 149.839 241.603 1.00 65.81  ? 165 CYS B CA  1 
ATOM   4745  C  C   . CYS B 1 164 ? 136.196 150.160 240.119 1.00 65.59  ? 165 CYS B C   1 
ATOM   4746  O  O   . CYS B 1 164 ? 135.467 151.002 239.619 1.00 65.55  ? 165 CYS B O   1 
ATOM   4747  C  CB  . CYS B 1 164 ? 134.793 149.186 241.948 1.00 65.68  ? 165 CYS B CB  1 
ATOM   4748  S  SG  . CYS B 1 164 ? 134.495 147.616 241.161 1.00 65.63  ? 165 CYS B SG  1 
ATOM   4749  N  N   . ILE B 1 165 ? 137.087 149.462 239.427 1.00 71.11  ? 166 ILE B N   1 
ATOM   4750  C  CA  . ILE B 1 165 ? 137.262 149.598 237.993 1.00 71.02  ? 166 ILE B CA  1 
ATOM   4751  C  C   . ILE B 1 165 ? 136.972 148.290 237.275 1.00 71.49  ? 166 ILE B C   1 
ATOM   4752  O  O   . ILE B 1 165 ? 137.643 147.287 237.470 1.00 71.52  ? 166 ILE B O   1 
ATOM   4753  C  CB  . ILE B 1 165 ? 138.673 150.051 237.650 1.00 70.60  ? 166 ILE B CB  1 
ATOM   4754  C  CG1 . ILE B 1 165 ? 138.939 151.429 238.234 1.00 70.38  ? 166 ILE B CG1 1 
ATOM   4755  C  CG2 . ILE B 1 165 ? 138.852 150.093 236.172 1.00 70.49  ? 166 ILE B CG2 1 
ATOM   4756  C  CD1 . ILE B 1 165 ? 140.331 151.909 238.035 1.00 70.27  ? 166 ILE B CD1 1 
ATOM   4757  N  N   . ILE B 1 166 ? 135.952 148.318 236.440 1.00 76.71  ? 167 ILE B N   1 
ATOM   4758  C  CA  . ILE B 1 166 ? 135.508 147.139 235.734 1.00 77.26  ? 167 ILE B CA  1 
ATOM   4759  C  C   . ILE B 1 166 ? 135.938 147.202 234.299 1.00 77.83  ? 167 ILE B C   1 
ATOM   4760  O  O   . ILE B 1 166 ? 135.706 148.188 233.642 1.00 77.85  ? 167 ILE B O   1 
ATOM   4761  C  CB  . ILE B 1 166 ? 133.994 147.070 235.755 1.00 77.24  ? 167 ILE B CB  1 
ATOM   4762  C  CG1 . ILE B 1 166 ? 133.510 146.905 237.184 1.00 77.22  ? 167 ILE B CG1 1 
ATOM   4763  C  CG2 . ILE B 1 166 ? 133.504 145.943 234.905 1.00 77.24  ? 167 ILE B CG2 1 
ATOM   4764  C  CD1 . ILE B 1 166 ? 134.243 145.847 237.934 1.00 77.21  ? 167 ILE B CD1 1 
ATOM   4765  N  N   . VAL B 1 167 ? 136.552 146.142 233.801 1.00 73.50  ? 168 VAL B N   1 
ATOM   4766  C  CA  . VAL B 1 167 ? 136.933 146.098 232.403 1.00 74.06  ? 168 VAL B CA  1 
ATOM   4767  C  C   . VAL B 1 167 ? 136.162 145.010 231.703 1.00 74.37  ? 168 VAL B C   1 
ATOM   4768  O  O   . VAL B 1 167 ? 136.374 143.839 231.964 1.00 74.39  ? 168 VAL B O   1 
ATOM   4769  C  CB  . VAL B 1 167 ? 138.410 145.816 232.251 1.00 74.28  ? 168 VAL B CB  1 
ATOM   4770  C  CG1 . VAL B 1 167 ? 138.790 145.858 230.807 1.00 74.37  ? 168 VAL B CG1 1 
ATOM   4771  C  CG2 . VAL B 1 167 ? 139.210 146.824 233.029 1.00 74.33  ? 168 VAL B CG2 1 
ATOM   4772  N  N   . MET B 1 168 ? 135.249 145.394 230.821 1.00 78.64  ? 169 MET B N   1 
ATOM   4773  C  CA  . MET B 1 168 ? 134.412 144.412 230.147 1.00 78.92  ? 169 MET B CA  1 
ATOM   4774  C  C   . MET B 1 168 ? 134.297 144.635 228.647 1.00 79.37  ? 169 MET B C   1 
ATOM   4775  O  O   . MET B 1 168 ? 134.415 145.749 228.169 1.00 79.31  ? 169 MET B O   1 
ATOM   4776  C  CB  . MET B 1 168 ? 133.028 144.342 230.801 1.00 78.78  ? 169 MET B CB  1 
ATOM   4777  C  CG  . MET B 1 168 ? 132.148 145.525 230.532 1.00 78.68  ? 169 MET B CG  1 
ATOM   4778  S  SD  . MET B 1 168 ? 130.697 145.614 231.575 1.00 78.63  ? 169 MET B SD  1 
ATOM   4779  C  CE  . MET B 1 168 ? 130.014 144.021 231.261 1.00 78.59  ? 169 MET B CE  1 
ATOM   4780  N  N   . PRO B 1 169 ? 134.072 143.556 227.898 1.00 75.02  ? 170 PRO B N   1 
ATOM   4781  C  CA  . PRO B 1 169 ? 133.931 143.606 226.450 1.00 75.44  ? 170 PRO B CA  1 
ATOM   4782  C  C   . PRO B 1 169 ? 132.730 144.426 226.004 1.00 75.99  ? 170 PRO B C   1 
ATOM   4783  O  O   . PRO B 1 169 ? 131.733 144.490 226.702 1.00 75.98  ? 170 PRO B O   1 
ATOM   4784  C  CB  . PRO B 1 169 ? 133.749 142.143 226.081 1.00 75.32  ? 170 PRO B CB  1 
ATOM   4785  C  CG  . PRO B 1 169 ? 134.419 141.417 227.134 1.00 75.20  ? 170 PRO B CG  1 
ATOM   4786  C  CD  . PRO B 1 169 ? 134.160 142.169 228.370 1.00 75.09  ? 170 PRO B CD  1 
ATOM   4787  N  N   . GLU B 1 170 ? 132.849 145.060 224.848 1.00 77.25  ? 171 GLU B N   1 
ATOM   4788  C  CA  . GLU B 1 170 ? 131.830 145.956 224.332 1.00 77.85  ? 171 GLU B CA  1 
ATOM   4789  C  C   . GLU B 1 170 ? 130.510 145.266 224.012 1.00 78.48  ? 171 GLU B C   1 
ATOM   4790  O  O   . GLU B 1 170 ? 129.471 145.906 223.942 1.00 78.54  ? 171 GLU B O   1 
ATOM   4791  C  CB  . GLU B 1 170 ? 132.357 146.667 223.089 1.00 77.84  ? 171 GLU B CB  1 
ATOM   4792  C  CG  . GLU B 1 170 ? 133.485 147.631 223.356 1.00 77.80  ? 171 GLU B CG  1 
ATOM   4793  C  CD  . GLU B 1 170 ? 134.096 148.197 222.095 1.00 77.85  ? 171 GLU B CD  1 
ATOM   4794  O  OE1 . GLU B 1 170 ? 133.986 147.547 221.045 1.00 77.90  ? 171 GLU B OE1 1 
ATOM   4795  O  OE2 . GLU B 1 170 ? 134.685 149.294 222.156 1.00 77.89  1 171 GLU B OE2 1 
ATOM   4796  N  N   . LYS B 1 171 ? 130.563 143.961 223.798 1.00 69.34  ? 172 LYS B N   1 
ATOM   4797  C  CA  . LYS B 1 171 ? 129.387 143.177 223.455 1.00 69.93  ? 172 LYS B CA  1 
ATOM   4798  C  C   . LYS B 1 171 ? 128.366 143.142 224.568 1.00 69.92  ? 172 LYS B C   1 
ATOM   4799  O  O   . LYS B 1 171 ? 127.179 142.997 224.331 1.00 69.95  ? 172 LYS B O   1 
ATOM   4800  C  CB  . LYS B 1 171 ? 129.817 141.757 223.116 1.00 70.42  ? 172 LYS B CB  1 
ATOM   4801  C  CG  . LYS B 1 171 ? 128.964 140.661 223.704 1.00 70.82  ? 172 LYS B CG  1 
ATOM   4802  C  CD  . LYS B 1 171 ? 129.627 139.306 223.567 1.00 71.14  ? 172 LYS B CD  1 
ATOM   4803  C  CE  . LYS B 1 171 ? 128.869 138.236 224.310 1.00 71.37  ? 172 LYS B CE  1 
ATOM   4804  N  NZ  . LYS B 1 171 ? 129.469 136.901 224.135 1.00 71.49  1 172 LYS B NZ  1 
ATOM   4805  N  N   . MET B 1 172 ? 128.841 143.291 225.792 1.00 84.85  ? 173 MET B N   1 
ATOM   4806  C  CA  . MET B 1 172 ? 128.006 143.125 226.963 1.00 84.77  ? 173 MET B CA  1 
ATOM   4807  C  C   . MET B 1 172 ? 126.960 144.211 227.122 1.00 84.42  ? 173 MET B C   1 
ATOM   4808  O  O   . MET B 1 172 ? 127.174 145.350 226.740 1.00 84.41  ? 173 MET B O   1 
ATOM   4809  C  CB  . MET B 1 172 ? 128.872 143.035 228.200 1.00 84.94  ? 173 MET B CB  1 
ATOM   4810  C  CG  . MET B 1 172 ? 129.949 141.995 228.103 1.00 85.08  ? 173 MET B CG  1 
ATOM   4811  S  SD  . MET B 1 172 ? 129.290 140.356 227.852 1.00 85.19  ? 173 MET B SD  1 
ATOM   4812  C  CE  . MET B 1 172 ? 130.799 139.450 227.636 1.00 85.31  ? 173 MET B CE  1 
ATOM   4813  N  N   . SER B 1 173 ? 125.833 143.838 227.713 1.00 71.00  ? 174 SER B N   1 
ATOM   4814  C  CA  . SER B 1 173 ? 124.639 144.665 227.729 1.00 70.64  ? 174 SER B CA  1 
ATOM   4815  C  C   . SER B 1 173 ? 124.793 145.969 228.466 1.00 70.34  ? 174 SER B C   1 
ATOM   4816  O  O   . SER B 1 173 ? 125.515 146.069 229.434 1.00 70.29  ? 174 SER B O   1 
ATOM   4817  C  CB  . SER B 1 173 ? 123.473 143.902 228.330 1.00 70.61  ? 174 SER B CB  1 
ATOM   4818  O  OG  . SER B 1 173 ? 123.617 143.810 229.721 1.00 70.59  ? 174 SER B OG  1 
ATOM   4819  N  N   . SER B 1 174 ? 124.085 146.973 227.983 1.00 82.25  ? 175 SER B N   1 
ATOM   4820  C  CA  . SER B 1 174 ? 124.114 148.291 228.573 1.00 82.02  ? 175 SER B CA  1 
ATOM   4821  C  C   . SER B 1 174 ? 123.493 148.298 229.950 1.00 81.81  ? 175 SER B C   1 
ATOM   4822  O  O   . SER B 1 174 ? 123.744 149.189 230.741 1.00 81.75  ? 175 SER B O   1 
ATOM   4823  C  CB  . SER B 1 174 ? 123.393 149.278 227.670 1.00 82.00  ? 175 SER B CB  1 
ATOM   4824  O  OG  . SER B 1 174 ? 122.058 148.881 227.474 1.00 82.01  ? 175 SER B OG  1 
ATOM   4825  N  N   . GLU B 1 175 ? 122.662 147.309 230.234 1.00 84.88  ? 176 GLU B N   1 
ATOM   4826  C  CA  . GLU B 1 175 ? 122.052 147.213 231.545 1.00 84.65  ? 176 GLU B CA  1 
ATOM   4827  C  C   . GLU B 1 175 ? 123.103 147.027 232.629 1.00 84.04  ? 176 GLU B C   1 
ATOM   4828  O  O   . GLU B 1 175 ? 123.034 147.631 233.696 1.00 83.99  ? 176 GLU B O   1 
ATOM   4829  C  CB  . GLU B 1 175 ? 121.069 146.047 231.571 1.00 84.92  ? 176 GLU B CB  1 
ATOM   4830  C  CG  . GLU B 1 175 ? 119.777 146.288 230.828 1.00 85.09  ? 176 GLU B CG  1 
ATOM   4831  C  CD  . GLU B 1 175 ? 119.868 145.981 229.359 1.00 85.17  ? 176 GLU B CD  1 
ATOM   4832  O  OE1 . GLU B 1 175 ? 120.985 145.975 228.823 1.00 85.21  ? 176 GLU B OE1 1 
ATOM   4833  O  OE2 . GLU B 1 175 ? 118.819 145.743 228.733 1.00 85.20  1 176 GLU B OE2 1 
ATOM   4834  N  N   . LYS B 1 176 ? 124.101 146.211 232.330 1.00 71.13  ? 177 LYS B N   1 
ATOM   4835  C  CA  . LYS B 1 176 ? 125.183 145.981 233.259 1.00 70.55  ? 177 LYS B CA  1 
ATOM   4836  C  C   . LYS B 1 176 ? 125.947 147.261 233.454 1.00 70.29  ? 177 LYS B C   1 
ATOM   4837  O  O   . LYS B 1 176 ? 126.451 147.533 234.522 1.00 70.20  ? 177 LYS B O   1 
ATOM   4838  C  CB  . LYS B 1 176 ? 126.115 144.899 232.737 1.00 70.28  ? 177 LYS B CB  1 
ATOM   4839  C  CG  . LYS B 1 176 ? 125.475 143.555 232.582 1.00 70.04  ? 177 LYS B CG  1 
ATOM   4840  C  CD  . LYS B 1 176 ? 126.455 142.537 232.061 1.00 69.81  ? 177 LYS B CD  1 
ATOM   4841  C  CE  . LYS B 1 176 ? 125.779 141.219 231.785 1.00 69.67  ? 177 LYS B CE  1 
ATOM   4842  N  NZ  . LYS B 1 176 ? 126.692 140.232 231.176 1.00 69.58  1 177 LYS B NZ  1 
ATOM   4843  N  N   . VAL B 1 177 ? 126.017 148.061 232.408 1.00 74.37  ? 178 VAL B N   1 
ATOM   4844  C  CA  . VAL B 1 177 ? 126.717 149.319 232.486 1.00 74.15  ? 178 VAL B CA  1 
ATOM   4845  C  C   . VAL B 1 177 ? 125.977 150.281 233.377 1.00 74.02  ? 178 VAL B C   1 
ATOM   4846  O  O   . VAL B 1 177 ? 126.577 150.989 234.163 1.00 74.02  ? 178 VAL B O   1 
ATOM   4847  C  CB  . VAL B 1 177 ? 126.865 149.946 231.108 1.00 74.05  ? 178 VAL B CB  1 
ATOM   4848  C  CG1 . VAL B 1 177 ? 127.534 151.288 231.214 1.00 74.02  ? 178 VAL B CG1 1 
ATOM   4849  C  CG2 . VAL B 1 177 ? 127.655 149.040 230.216 1.00 74.00  ? 178 VAL B CG2 1 
ATOM   4850  N  N   . ASP B 1 178 ? 124.661 150.306 233.256 1.00 85.15  ? 179 ASP B N   1 
ATOM   4851  C  CA  . ASP B 1 178 ? 123.873 151.213 234.060 1.00 84.96  ? 179 ASP B CA  1 
ATOM   4852  C  C   . ASP B 1 178 ? 123.926 150.828 235.524 1.00 84.44  ? 179 ASP B C   1 
ATOM   4853  O  O   . ASP B 1 178 ? 123.996 151.688 236.394 1.00 84.42  ? 179 ASP B O   1 
ATOM   4854  C  CB  . ASP B 1 178 ? 122.432 151.248 233.570 1.00 85.16  ? 179 ASP B CB  1 
ATOM   4855  C  CG  . ASP B 1 178 ? 122.281 151.965 232.256 1.00 85.28  ? 179 ASP B CG  1 
ATOM   4856  O  OD1 . ASP B 1 178 ? 123.130 152.815 231.940 1.00 85.33  ? 179 ASP B OD1 1 
ATOM   4857  O  OD2 . ASP B 1 178 ? 121.306 151.683 231.537 1.00 85.32  1 179 ASP B OD2 1 
ATOM   4858  N  N   . VAL B 1 179 ? 123.924 149.531 235.798 1.00 70.31  ? 180 VAL B N   1 
ATOM   4859  C  CA  . VAL B 1 179 ? 124.001 149.082 237.178 1.00 69.77  ? 180 VAL B CA  1 
ATOM   4860  C  C   . VAL B 1 179 ? 125.380 149.319 237.766 1.00 69.32  ? 180 VAL B C   1 
ATOM   4861  O  O   . VAL B 1 179 ? 125.510 149.786 238.886 1.00 69.25  ? 180 VAL B O   1 
ATOM   4862  C  CB  . VAL B 1 179 ? 123.599 147.612 237.318 1.00 69.73  ? 180 VAL B CB  1 
ATOM   4863  C  CG1 . VAL B 1 179 ? 123.992 147.089 238.655 1.00 69.69  ? 180 VAL B CG1 1 
ATOM   4864  C  CG2 . VAL B 1 179 ? 122.119 147.462 237.137 1.00 69.75  ? 180 VAL B CG2 1 
ATOM   4865  N  N   . LEU B 1 180 ? 126.413 149.037 236.994 1.00 64.82  ? 181 LEU B N   1 
ATOM   4866  C  CA  . LEU B 1 180 ? 127.764 149.289 237.450 1.00 64.49  ? 181 LEU B CA  1 
ATOM   4867  C  C   . LEU B 1 180 ? 128.007 150.764 237.681 1.00 65.21  ? 181 LEU B C   1 
ATOM   4868  O  O   . LEU B 1 180 ? 128.729 151.149 238.584 1.00 65.22  ? 181 LEU B O   1 
ATOM   4869  C  CB  . LEU B 1 180 ? 128.766 148.766 236.430 1.00 63.74  ? 181 LEU B CB  1 
ATOM   4870  C  CG  . LEU B 1 180 ? 128.998 147.263 236.352 1.00 63.13  ? 181 LEU B CG  1 
ATOM   4871  C  CD1 . LEU B 1 180 ? 129.743 146.928 235.101 1.00 62.90  ? 181 LEU B CD1 1 
ATOM   4872  C  CD2 . LEU B 1 180 ? 129.766 146.791 237.542 1.00 62.94  ? 181 LEU B CD2 1 
ATOM   4873  N  N   . ARG B 1 181 ? 127.394 151.592 236.854 1.00 83.34  ? 182 ARG B N   1 
ATOM   4874  C  CA  . ARG B 1 181 ? 127.540 153.027 236.980 1.00 84.10  ? 182 ARG B CA  1 
ATOM   4875  C  C   . ARG B 1 181 ? 126.812 153.501 238.218 1.00 83.49  ? 182 ARG B C   1 
ATOM   4876  O  O   . ARG B 1 181 ? 127.271 154.389 238.917 1.00 83.47  ? 182 ARG B O   1 
ATOM   4877  C  CB  . ARG B 1 181 ? 127.015 153.724 235.719 1.00 85.26  ? 182 ARG B CB  1 
ATOM   4878  C  CG  . ARG B 1 181 ? 127.280 155.216 235.641 1.00 86.23  ? 182 ARG B CG  1 
ATOM   4879  C  CD  . ARG B 1 181 ? 127.583 155.669 234.221 1.00 87.03  ? 182 ARG B CD  1 
ATOM   4880  N  NE  . ARG B 1 181 ? 126.543 155.282 233.280 1.00 87.65  ? 182 ARG B NE  1 
ATOM   4881  C  CZ  . ARG B 1 181 ? 126.611 155.472 231.970 1.00 88.30  ? 182 ARG B CZ  1 
ATOM   4882  N  NH1 . ARG B 1 181 ? 127.673 156.043 231.440 1.00 88.48  1 182 ARG B NH1 1 
ATOM   4883  N  NH2 . ARG B 1 181 ? 125.617 155.087 231.190 1.00 88.50  ? 182 ARG B NH2 1 
ATOM   4884  N  N   . ALA B 1 182 ? 125.669 152.894 238.486 1.00 76.00  ? 183 ALA B N   1 
ATOM   4885  C  CA  . ALA B 1 182 ? 124.893 153.246 239.662 1.00 75.36  ? 183 ALA B CA  1 
ATOM   4886  C  C   . ALA B 1 182 ? 125.556 152.831 240.959 1.00 74.60  ? 183 ALA B C   1 
ATOM   4887  O  O   . ALA B 1 182 ? 125.341 153.446 241.991 1.00 74.54  ? 183 ALA B O   1 
ATOM   4888  C  CB  . ALA B 1 182 ? 123.513 152.658 239.572 1.00 75.44  ? 183 ALA B CB  1 
ATOM   4889  N  N   . LEU B 1 183 ? 126.353 151.775 240.906 1.00 65.91  ? 184 LEU B N   1 
ATOM   4890  C  CA  . LEU B 1 183 ? 127.032 151.282 242.090 1.00 65.23  ? 184 LEU B CA  1 
ATOM   4891  C  C   . LEU B 1 183 ? 128.280 152.086 242.381 1.00 65.04  ? 184 LEU B C   1 
ATOM   4892  O  O   . LEU B 1 183 ? 128.896 151.931 243.417 1.00 65.01  ? 184 LEU B O   1 
ATOM   4893  C  CB  . LEU B 1 183 ? 127.376 149.809 241.937 1.00 64.88  ? 184 LEU B CB  1 
ATOM   4894  C  CG  . LEU B 1 183 ? 126.195 148.855 241.966 1.00 64.61  ? 184 LEU B CG  1 
ATOM   4895  C  CD1 . LEU B 1 183 ? 126.624 147.487 241.565 1.00 64.50  ? 184 LEU B CD1 1 
ATOM   4896  C  CD2 . LEU B 1 183 ? 125.608 148.818 243.337 1.00 64.52  ? 184 LEU B CD2 1 
ATOM   4897  N  N   . GLY B 1 184 ? 128.643 152.953 241.451 1.00 60.98  ? 185 GLY B N   1 
ATOM   4898  C  CA  . GLY B 1 184 ? 129.795 153.814 241.614 1.00 60.94  ? 185 GLY B CA  1 
ATOM   4899  C  C   . GLY B 1 184 ? 131.087 153.308 241.026 1.00 61.02  ? 185 GLY B C   1 
ATOM   4900  O  O   . GLY B 1 184 ? 132.140 153.863 241.275 1.00 61.00  ? 185 GLY B O   1 
ATOM   4901  N  N   . ALA B 1 185 ? 131.014 152.235 240.261 1.00 67.13  ? 186 ALA B N   1 
ATOM   4902  C  CA  . ALA B 1 185 ? 132.202 151.697 239.620 1.00 67.31  ? 186 ALA B CA  1 
ATOM   4903  C  C   . ALA B 1 185 ? 132.592 152.460 238.374 1.00 67.47  ? 186 ALA B C   1 
ATOM   4904  O  O   . ALA B 1 185 ? 131.744 152.879 237.609 1.00 67.50  ? 186 ALA B O   1 
ATOM   4905  C  CB  . ALA B 1 185 ? 131.992 150.253 239.283 1.00 67.32  ? 186 ALA B CB  1 
ATOM   4906  N  N   . GLU B 1 186 ? 133.887 152.629 238.164 1.00 79.48  ? 187 GLU B N   1 
ATOM   4907  C  CA  . GLU B 1 186 ? 134.375 153.125 236.894 1.00 79.53  ? 187 GLU B CA  1 
ATOM   4908  C  C   . GLU B 1 186 ? 134.368 152.004 235.875 1.00 78.97  ? 187 GLU B C   1 
ATOM   4909  O  O   . GLU B 1 186 ? 134.586 150.861 236.213 1.00 78.96  ? 187 GLU B O   1 
ATOM   4910  C  CB  . GLU B 1 186 ? 135.763 153.722 237.058 1.00 79.99  ? 187 GLU B CB  1 
ATOM   4911  C  CG  . GLU B 1 186 ? 135.780 154.898 237.996 1.00 80.28  ? 187 GLU B CG  1 
ATOM   4912  C  CD  . GLU B 1 186 ? 137.165 155.321 238.378 1.00 80.45  ? 187 GLU B CD  1 
ATOM   4913  O  OE1 . GLU B 1 186 ? 137.337 155.860 239.486 1.00 80.51  ? 187 GLU B OE1 1 
ATOM   4914  O  OE2 . GLU B 1 186 ? 138.083 155.120 237.570 1.00 80.48  1 187 GLU B OE2 1 
ATOM   4915  N  N   . ILE B 1 187 ? 134.125 152.336 234.620 1.00 71.01  ? 188 ILE B N   1 
ATOM   4916  C  CA  . ILE B 1 187 ? 133.936 151.316 233.606 1.00 70.39  ? 188 ILE B CA  1 
ATOM   4917  C  C   . ILE B 1 187 ? 134.842 151.536 232.411 1.00 69.69  ? 188 ILE B C   1 
ATOM   4918  O  O   . ILE B 1 187 ? 134.976 152.639 231.917 1.00 69.68  ? 188 ILE B O   1 
ATOM   4919  C  CB  . ILE B 1 187 ? 132.484 151.290 233.124 1.00 70.46  ? 188 ILE B CB  1 
ATOM   4920  C  CG1 . ILE B 1 187 ? 131.535 151.151 234.306 1.00 70.52  ? 188 ILE B CG1 1 
ATOM   4921  C  CG2 . ILE B 1 187 ? 132.265 150.160 232.165 1.00 70.46  ? 188 ILE B CG2 1 
ATOM   4922  C  CD1 . ILE B 1 187 ? 130.099 151.221 233.938 1.00 70.57  ? 188 ILE B CD1 1 
ATOM   4923  N  N   . VAL B 1 188 ? 135.466 150.464 231.956 1.00 60.62  ? 189 VAL B N   1 
ATOM   4924  C  CA  . VAL B 1 188 ? 136.342 150.490 230.808 1.00 60.05  ? 189 VAL B CA  1 
ATOM   4925  C  C   . VAL B 1 188 ? 135.909 149.364 229.907 1.00 60.33  ? 189 VAL B C   1 
ATOM   4926  O  O   . VAL B 1 188 ? 135.640 148.271 230.370 1.00 60.33  ? 189 VAL B O   1 
ATOM   4927  C  CB  . VAL B 1 188 ? 137.802 150.264 231.212 1.00 59.43  ? 189 VAL B CB  1 
ATOM   4928  C  CG1 . VAL B 1 188 ? 138.679 150.181 230.003 1.00 59.22  ? 189 VAL B CG1 1 
ATOM   4929  C  CG2 . VAL B 1 188 ? 138.282 151.367 232.102 1.00 59.25  ? 189 VAL B CG2 1 
ATOM   4930  N  N   . ARG B 1 189 ? 135.828 149.634 228.617 1.00 60.27  ? 190 ARG B N   1 
ATOM   4931  C  CA  . ARG B 1 189 ? 135.369 148.627 227.687 1.00 60.78  ? 190 ARG B CA  1 
ATOM   4932  C  C   . ARG B 1 189 ? 136.468 148.156 226.755 1.00 62.17  ? 190 ARG B C   1 
ATOM   4933  O  O   . ARG B 1 189 ? 137.419 148.867 226.506 1.00 62.31  ? 190 ARG B O   1 
ATOM   4934  C  CB  . ARG B 1 189 ? 134.168 149.135 226.899 1.00 60.14  ? 190 ARG B CB  1 
ATOM   4935  C  CG  . ARG B 1 189 ? 133.056 149.685 227.753 1.00 59.63  ? 190 ARG B CG  1 
ATOM   4936  C  CD  . ARG B 1 189 ? 132.544 148.671 228.732 1.00 59.31  ? 190 ARG B CD  1 
ATOM   4937  N  NE  . ARG B 1 189 ? 131.804 147.602 228.090 1.00 59.07  ? 190 ARG B NE  1 
ATOM   4938  C  CZ  . ARG B 1 189 ? 130.541 147.701 227.720 1.00 58.86  ? 190 ARG B CZ  1 
ATOM   4939  N  NH1 . ARG B 1 189 ? 129.891 148.824 227.920 1.00 58.80  1 190 ARG B NH1 1 
ATOM   4940  N  NH2 . ARG B 1 189 ? 129.936 146.684 227.147 1.00 58.82  ? 190 ARG B NH2 1 
ATOM   4941  N  N   . THR B 1 190 ? 136.333 146.935 226.259 1.00 70.64  ? 191 THR B N   1 
ATOM   4942  C  CA  . THR B 1 190 ? 137.292 146.397 225.311 1.00 72.12  ? 191 THR B CA  1 
ATOM   4943  C  C   . THR B 1 190 ? 136.588 145.796 224.114 1.00 73.67  ? 191 THR B C   1 
ATOM   4944  O  O   . THR B 1 190 ? 135.469 145.337 224.233 1.00 73.82  ? 191 THR B O   1 
ATOM   4945  C  CB  . THR B 1 190 ? 138.152 145.324 225.947 1.00 72.13  ? 191 THR B CB  1 
ATOM   4946  O  OG1 . THR B 1 190 ? 137.320 144.268 226.424 1.00 72.16  ? 191 THR B OG1 1 
ATOM   4947  C  CG2 . THR B 1 190 ? 138.923 145.899 227.087 1.00 72.12  ? 191 THR B CG2 1 
ATOM   4948  N  N   . PRO B 1 191 ? 137.241 145.808 222.950 1.00 73.42  ? 192 PRO B N   1 
ATOM   4949  C  CA  . PRO B 1 191 ? 136.620 145.239 221.762 1.00 74.77  ? 192 PRO B CA  1 
ATOM   4950  C  C   . PRO B 1 191 ? 136.323 143.770 221.930 1.00 76.63  ? 192 PRO B C   1 
ATOM   4951  O  O   . PRO B 1 191 ? 137.112 143.051 222.509 1.00 76.86  ? 192 PRO B O   1 
ATOM   4952  C  CB  . PRO B 1 191 ? 137.676 145.451 220.684 1.00 74.37  ? 192 PRO B CB  1 
ATOM   4953  C  CG  . PRO B 1 191 ? 138.905 145.802 221.390 1.00 74.01  ? 192 PRO B CG  1 
ATOM   4954  C  CD  . PRO B 1 191 ? 138.501 146.480 222.621 1.00 73.67  ? 192 PRO B CD  1 
ATOM   4955  N  N   . THR B 1 192 ? 135.186 143.337 221.409 1.00 76.58  ? 193 THR B N   1 
ATOM   4956  C  CA  . THR B 1 192 ? 134.710 141.987 221.635 1.00 78.44  ? 193 THR B CA  1 
ATOM   4957  C  C   . THR B 1 192 ? 135.595 140.958 220.977 1.00 79.82  ? 193 THR B C   1 
ATOM   4958  O  O   . THR B 1 192 ? 135.859 139.908 221.536 1.00 79.99  ? 193 THR B O   1 
ATOM   4959  C  CB  . THR B 1 192 ? 133.296 141.813 221.092 1.00 78.78  ? 193 THR B CB  1 
ATOM   4960  O  OG1 . THR B 1 192 ? 132.456 142.847 221.605 1.00 78.78  ? 193 THR B OG1 1 
ATOM   4961  C  CG2 . THR B 1 192 ? 132.740 140.484 221.499 1.00 78.98  ? 193 THR B CG2 1 
ATOM   4962  N  N   . ASN B 1 193 ? 136.078 141.272 219.790 1.00 94.20  ? 194 ASN B N   1 
ATOM   4963  C  CA  . ASN B 1 193 ? 136.799 140.288 219.011 1.00 95.32  ? 194 ASN B CA  1 
ATOM   4964  C  C   . ASN B 1 193 ? 138.285 140.286 219.288 1.00 95.61  ? 194 ASN B C   1 
ATOM   4965  O  O   . ASN B 1 193 ? 139.036 139.571 218.646 1.00 95.69  ? 194 ASN B O   1 
ATOM   4966  C  CB  . ASN B 1 193 ? 136.486 140.413 217.515 1.00 95.88  ? 194 ASN B CB  1 
ATOM   4967  C  CG  . ASN B 1 193 ? 136.869 141.751 216.944 1.00 96.25  ? 194 ASN B CG  1 
ATOM   4968  O  OD1 . ASN B 1 193 ? 137.844 142.351 217.357 1.00 96.33  ? 194 ASN B OD1 1 
ATOM   4969  N  ND2 . ASN B 1 193 ? 136.102 142.225 215.980 1.00 96.52  ? 194 ASN B ND2 1 
ATOM   4970  N  N   . ALA B 1 194 ? 138.710 141.104 220.237 1.00 83.41  ? 195 ALA B N   1 
ATOM   4971  C  CA  . ALA B 1 194 ? 140.111 141.147 220.606 1.00 83.52  ? 195 ALA B CA  1 
ATOM   4972  C  C   . ALA B 1 194 ? 140.549 139.813 221.165 1.00 83.64  ? 195 ALA B C   1 
ATOM   4973  O  O   . ALA B 1 194 ? 139.867 139.234 221.993 1.00 83.65  ? 195 ALA B O   1 
ATOM   4974  C  CB  . ALA B 1 194 ? 140.337 142.218 221.620 1.00 83.45  ? 195 ALA B CB  1 
ATOM   4975  N  N   . ARG B 1 195 ? 141.699 139.333 220.715 1.00 88.54  ? 196 ARG B N   1 
ATOM   4976  C  CA  . ARG B 1 195 ? 142.263 138.097 221.225 1.00 88.60  ? 196 ARG B CA  1 
ATOM   4977  C  C   . ARG B 1 195 ? 142.750 138.323 222.636 1.00 88.11  ? 196 ARG B C   1 
ATOM   4978  O  O   . ARG B 1 195 ? 143.230 139.397 222.953 1.00 88.02  ? 196 ARG B O   1 
ATOM   4979  C  CB  . ARG B 1 195 ? 143.425 137.642 220.348 1.00 89.04  ? 196 ARG B CB  1 
ATOM   4980  C  CG  . ARG B 1 195 ? 143.035 137.210 218.960 1.00 89.35  ? 196 ARG B CG  1 
ATOM   4981  C  CD  . ARG B 1 195 ? 142.807 135.726 218.901 1.00 89.61  ? 196 ARG B CD  1 
ATOM   4982  N  NE  . ARG B 1 195 ? 143.965 134.996 219.388 1.00 89.85  ? 196 ARG B NE  1 
ATOM   4983  C  CZ  . ARG B 1 195 ? 143.940 133.718 219.724 1.00 90.09  ? 196 ARG B CZ  1 
ATOM   4984  N  NH1 . ARG B 1 195 ? 142.813 133.037 219.624 1.00 90.16  1 196 ARG B NH1 1 
ATOM   4985  N  NH2 . ARG B 1 195 ? 145.033 133.124 220.167 1.00 90.16  ? 196 ARG B NH2 1 
ATOM   4986  N  N   . PHE B 1 196 ? 142.641 137.310 223.481 1.00 82.50  ? 197 PHE B N   1 
ATOM   4987  C  CA  . PHE B 1 196 ? 143.051 137.462 224.864 1.00 82.08  ? 197 PHE B CA  1 
ATOM   4988  C  C   . PHE B 1 196 ? 144.537 137.751 224.970 1.00 82.29  ? 197 PHE B C   1 
ATOM   4989  O  O   . PHE B 1 196 ? 144.980 138.411 225.894 1.00 82.31  ? 197 PHE B O   1 
ATOM   4990  C  CB  . PHE B 1 196 ? 142.681 136.226 225.675 1.00 81.61  ? 197 PHE B CB  1 
ATOM   4991  C  CG  . PHE B 1 196 ? 143.563 135.058 225.425 1.00 81.14  ? 197 PHE B CG  1 
ATOM   4992  C  CD1 . PHE B 1 196 ? 144.560 134.737 226.308 1.00 80.90  ? 197 PHE B CD1 1 
ATOM   4993  C  CD2 . PHE B 1 196 ? 143.395 134.278 224.310 1.00 80.85  ? 197 PHE B CD2 1 
ATOM   4994  C  CE1 . PHE B 1 196 ? 145.368 133.665 226.085 1.00 80.73  ? 197 PHE B CE1 1 
ATOM   4995  C  CE2 . PHE B 1 196 ? 144.205 133.203 224.084 1.00 80.70  ? 197 PHE B CE2 1 
ATOM   4996  C  CZ  . PHE B 1 196 ? 145.193 132.897 224.973 1.00 80.67  ? 197 PHE B CZ  1 
ATOM   4997  N  N   . ASP B 1 197 ? 145.299 137.257 224.008 1.00 102.01 ? 198 ASP B N   1 
ATOM   4998  C  CA  . ASP B 1 197 ? 146.719 137.526 223.945 1.00 102.12 ? 198 ASP B CA  1 
ATOM   4999  C  C   . ASP B 1 197 ? 146.984 138.993 223.707 1.00 101.74 ? 198 ASP B C   1 
ATOM   5000  O  O   . ASP B 1 197 ? 147.976 139.534 224.167 1.00 101.74 ? 198 ASP B O   1 
ATOM   5001  C  CB  . ASP B 1 197 ? 147.336 136.771 222.780 1.00 102.40 ? 198 ASP B CB  1 
ATOM   5002  C  CG  . ASP B 1 197 ? 147.391 135.295 223.006 1.00 102.53 ? 198 ASP B CG  1 
ATOM   5003  O  OD1 . ASP B 1 197 ? 147.702 134.883 224.137 1.00 102.57 ? 198 ASP B OD1 1 
ATOM   5004  O  OD2 . ASP B 1 197 ? 147.129 134.546 222.046 1.00 102.58 1 198 ASP B OD2 1 
ATOM   5005  N  N   . SER B 1 198 ? 146.094 139.632 222.967 1.00 98.43  ? 199 SER B N   1 
ATOM   5006  C  CA  . SER B 1 198 ? 146.333 140.987 222.504 1.00 97.91  ? 199 SER B CA  1 
ATOM   5007  C  C   . SER B 1 198 ? 146.213 141.995 223.629 1.00 97.17  ? 199 SER B C   1 
ATOM   5008  O  O   . SER B 1 198 ? 145.546 141.740 224.615 1.00 97.14  ? 199 SER B O   1 
ATOM   5009  C  CB  . SER B 1 198 ? 145.383 141.334 221.358 1.00 98.03  ? 199 SER B CB  1 
ATOM   5010  O  OG  . SER B 1 198 ? 144.079 141.575 221.829 1.00 98.09  ? 199 SER B OG  1 
ATOM   5011  N  N   . PRO B 1 199 ? 146.882 143.141 223.490 1.00 82.40  ? 200 PRO B N   1 
ATOM   5012  C  CA  . PRO B 1 199 ? 146.788 144.226 224.461 1.00 81.90  ? 200 PRO B CA  1 
ATOM   5013  C  C   . PRO B 1 199 ? 145.382 144.762 224.638 1.00 81.42  ? 200 PRO B C   1 
ATOM   5014  O  O   . PRO B 1 199 ? 145.091 145.312 225.681 1.00 81.42  ? 200 PRO B O   1 
ATOM   5015  C  CB  . PRO B 1 199 ? 147.714 145.295 223.886 1.00 81.93  ? 200 PRO B CB  1 
ATOM   5016  C  CG  . PRO B 1 199 ? 147.922 144.923 222.503 1.00 82.02  ? 200 PRO B CG  1 
ATOM   5017  C  CD  . PRO B 1 199 ? 147.855 143.457 222.440 1.00 82.19  ? 200 PRO B CD  1 
ATOM   5018  N  N   . GLU B 1 200 ? 144.543 144.655 223.621 1.00 83.65  ? 201 GLU B N   1 
ATOM   5019  C  CA  . GLU B 1 200 ? 143.214 145.247 223.676 1.00 83.17  ? 201 GLU B CA  1 
ATOM   5020  C  C   . GLU B 1 200 ? 142.164 144.417 224.403 1.00 82.66  ? 201 GLU B C   1 
ATOM   5021  O  O   . GLU B 1 200 ? 141.044 144.861 224.574 1.00 82.53  ? 201 GLU B O   1 
ATOM   5022  C  CB  . GLU B 1 200 ? 142.719 145.598 222.278 1.00 83.21  ? 201 GLU B CB  1 
ATOM   5023  C  CG  . GLU B 1 200 ? 143.544 146.634 221.580 1.00 83.26  ? 201 GLU B CG  1 
ATOM   5024  C  CD  . GLU B 1 200 ? 144.826 146.072 221.049 1.00 83.29  ? 201 GLU B CD  1 
ATOM   5025  O  OE1 . GLU B 1 200 ? 144.841 144.869 220.753 1.00 83.32  ? 201 GLU B OE1 1 
ATOM   5026  O  OE2 . GLU B 1 200 ? 145.818 146.821 220.944 1.00 83.31  1 201 GLU B OE2 1 
ATOM   5027  N  N   . SER B 1 201 ? 142.521 143.213 224.821 1.00 75.76  ? 202 SER B N   1 
ATOM   5028  C  CA  . SER B 1 201 ? 141.585 142.338 225.516 1.00 75.38  ? 202 SER B CA  1 
ATOM   5029  C  C   . SER B 1 201 ? 141.297 142.830 226.911 1.00 75.17  ? 202 SER B C   1 
ATOM   5030  O  O   . SER B 1 201 ? 142.074 143.578 227.477 1.00 75.14  ? 202 SER B O   1 
ATOM   5031  C  CB  . SER B 1 201 ? 142.114 140.920 225.583 1.00 75.30  ? 202 SER B CB  1 
ATOM   5032  O  OG  . SER B 1 201 ? 143.115 140.813 226.566 1.00 75.28  ? 202 SER B OG  1 
ATOM   5033  N  N   . HIS B 1 202 ? 140.166 142.424 227.463 1.00 80.57  ? 203 HIS B N   1 
ATOM   5034  C  CA  . HIS B 1 202 ? 139.785 142.899 228.776 1.00 80.45  ? 203 HIS B CA  1 
ATOM   5035  C  C   . HIS B 1 202 ? 140.789 142.515 229.836 1.00 80.74  ? 203 HIS B C   1 
ATOM   5036  O  O   . HIS B 1 202 ? 141.064 143.283 230.745 1.00 80.68  ? 203 HIS B O   1 
ATOM   5037  C  CB  . HIS B 1 202 ? 138.375 142.433 229.146 1.00 80.21  ? 203 HIS B CB  1 
ATOM   5038  C  CG  . HIS B 1 202 ? 138.228 140.954 229.297 1.00 80.01  ? 203 HIS B CG  1 
ATOM   5039  N  ND1 . HIS B 1 202 ? 138.635 140.063 228.334 1.00 79.93  ? 203 HIS B ND1 1 
ATOM   5040  C  CD2 . HIS B 1 202 ? 137.682 140.217 230.288 1.00 79.87  ? 203 HIS B CD2 1 
ATOM   5041  C  CE1 . HIS B 1 202 ? 138.361 138.835 228.734 1.00 79.87  ? 203 HIS B CE1 1 
ATOM   5042  N  NE2 . HIS B 1 202 ? 137.783 138.901 229.916 1.00 79.84  ? 203 HIS B NE2 1 
ATOM   5043  N  N   . VAL B 1 203 ? 141.382 141.347 229.686 1.00 81.43  ? 204 VAL B N   1 
ATOM   5044  C  CA  . VAL B 1 203 ? 142.418 140.920 230.599 1.00 81.73  ? 204 VAL B CA  1 
ATOM   5045  C  C   . VAL B 1 203 ? 143.652 141.789 230.455 1.00 81.70  ? 204 VAL B C   1 
ATOM   5046  O  O   . VAL B 1 203 ? 144.227 142.260 231.434 1.00 81.71  ? 204 VAL B O   1 
ATOM   5047  C  CB  . VAL B 1 203 ? 142.802 139.479 230.318 1.00 81.99  ? 204 VAL B CB  1 
ATOM   5048  C  CG1 . VAL B 1 203 ? 144.017 139.098 231.115 1.00 82.10  ? 204 VAL B CG1 1 
ATOM   5049  C  CG2 . VAL B 1 203 ? 141.658 138.578 230.649 1.00 82.05  ? 204 VAL B CG2 1 
ATOM   5050  N  N   . GLY B 1 204 ? 144.042 142.033 229.220 1.00 83.68  ? 205 GLY B N   1 
ATOM   5051  C  CA  . GLY B 1 204 ? 145.239 142.797 228.989 1.00 83.59  ? 205 GLY B CA  1 
ATOM   5052  C  C   . GLY B 1 204 ? 145.070 144.223 229.433 1.00 83.46  ? 205 GLY B C   1 
ATOM   5053  O  O   . GLY B 1 204 ? 145.955 144.794 230.053 1.00 83.48  ? 205 GLY B O   1 
ATOM   5054  N  N   . VAL B 1 205 ? 143.915 144.797 229.138 1.00 86.31  ? 206 VAL B N   1 
ATOM   5055  C  CA  . VAL B 1 205 ? 143.660 146.164 229.543 1.00 86.17  ? 206 VAL B CA  1 
ATOM   5056  C  C   . VAL B 1 205 ? 143.619 146.244 231.045 1.00 85.93  ? 206 VAL B C   1 
ATOM   5057  O  O   . VAL B 1 205 ? 144.072 147.214 231.632 1.00 85.90  ? 206 VAL B O   1 
ATOM   5058  C  CB  . VAL B 1 205 ? 142.354 146.697 228.958 1.00 86.22  ? 206 VAL B CB  1 
ATOM   5059  C  CG1 . VAL B 1 205 ? 142.066 148.067 229.489 1.00 86.22  ? 206 VAL B CG1 1 
ATOM   5060  C  CG2 . VAL B 1 205 ? 142.453 146.756 227.476 1.00 86.29  ? 206 VAL B CG2 1 
ATOM   5061  N  N   . ALA B 1 206 ? 143.115 145.198 231.676 1.00 65.39  ? 207 ALA B N   1 
ATOM   5062  C  CA  . ALA B 1 206 ? 143.040 145.214 233.116 1.00 65.36  ? 207 ALA B CA  1 
ATOM   5063  C  C   . ALA B 1 206 ? 144.429 145.278 233.683 1.00 66.14  ? 207 ALA B C   1 
ATOM   5064  O  O   . ALA B 1 206 ? 144.710 146.053 234.585 1.00 66.13  ? 207 ALA B O   1 
ATOM   5065  C  CB  . ALA B 1 206 ? 142.341 143.993 233.610 1.00 64.98  ? 207 ALA B CB  1 
ATOM   5066  N  N   . TRP B 1 207 ? 145.316 144.473 233.130 1.00 81.98  ? 208 TRP B N   1 
ATOM   5067  C  CA  . TRP B 1 207 ? 146.667 144.462 233.644 1.00 83.02  ? 208 TRP B CA  1 
ATOM   5068  C  C   . TRP B 1 207 ? 147.380 145.766 233.380 1.00 83.96  ? 208 TRP B C   1 
ATOM   5069  O  O   . TRP B 1 207 ? 148.117 146.269 234.224 1.00 84.04  ? 208 TRP B O   1 
ATOM   5070  C  CB  . TRP B 1 207 ? 147.444 143.284 233.072 1.00 83.19  ? 208 TRP B CB  1 
ATOM   5071  C  CG  . TRP B 1 207 ? 147.138 142.029 233.784 1.00 83.31  ? 208 TRP B CG  1 
ATOM   5072  C  CD1 . TRP B 1 207 ? 146.247 141.080 233.420 1.00 83.33  ? 208 TRP B CD1 1 
ATOM   5073  C  CD2 . TRP B 1 207 ? 147.705 141.599 235.012 1.00 83.39  ? 208 TRP B CD2 1 
ATOM   5074  N  NE1 . TRP B 1 207 ? 146.230 140.072 234.338 1.00 83.39  ? 208 TRP B NE1 1 
ATOM   5075  C  CE2 . TRP B 1 207 ? 147.122 140.370 235.330 1.00 83.45  ? 208 TRP B CE2 1 
ATOM   5076  C  CE3 . TRP B 1 207 ? 148.660 142.132 235.872 1.00 83.46  ? 208 TRP B CE3 1 
ATOM   5077  C  CZ2 . TRP B 1 207 ? 147.458 139.664 236.471 1.00 83.57  ? 208 TRP B CZ2 1 
ATOM   5078  C  CZ3 . TRP B 1 207 ? 148.992 141.433 237.001 1.00 83.53  ? 208 TRP B CZ3 1 
ATOM   5079  C  CH2 . TRP B 1 207 ? 148.394 140.213 237.293 1.00 83.61  ? 208 TRP B CH2 1 
ATOM   5080  N  N   . ARG B 1 208 ? 147.132 146.336 232.216 1.00 92.88  ? 209 ARG B N   1 
ATOM   5081  C  CA  . ARG B 1 208 ? 147.790 147.574 231.866 1.00 93.74  ? 209 ARG B CA  1 
ATOM   5082  C  C   . ARG B 1 208 ? 147.324 148.705 232.753 1.00 93.16  ? 209 ARG B C   1 
ATOM   5083  O  O   . ARG B 1 208 ? 148.078 149.622 233.040 1.00 93.13  ? 209 ARG B O   1 
ATOM   5084  C  CB  . ARG B 1 208 ? 147.584 147.903 230.391 1.00 94.97  ? 209 ARG B CB  1 
ATOM   5085  C  CG  . ARG B 1 208 ? 148.393 147.034 229.457 1.00 95.93  ? 209 ARG B CG  1 
ATOM   5086  C  CD  . ARG B 1 208 ? 148.294 147.520 228.031 1.00 96.76  ? 209 ARG B CD  1 
ATOM   5087  N  NE  . ARG B 1 208 ? 146.961 147.313 227.474 1.00 97.34  ? 209 ARG B NE  1 
ATOM   5088  C  CZ  . ARG B 1 208 ? 146.505 147.898 226.372 1.00 97.87  ? 209 ARG B CZ  1 
ATOM   5089  N  NH1 . ARG B 1 208 ? 147.267 148.745 225.699 1.00 98.13  1 209 ARG B NH1 1 
ATOM   5090  N  NH2 . ARG B 1 208 ? 145.279 147.639 225.948 1.00 97.89  ? 209 ARG B NH2 1 
ATOM   5091  N  N   . LEU B 1 209 ? 146.078 148.631 233.196 1.00 74.61  ? 210 LEU B N   1 
ATOM   5092  C  CA  . LEU B 1 209 ? 145.562 149.600 234.142 1.00 74.04  ? 210 LEU B CA  1 
ATOM   5093  C  C   . LEU B 1 209 ? 146.200 149.391 235.492 1.00 74.06  ? 210 LEU B C   1 
ATOM   5094  O  O   . LEU B 1 209 ? 146.560 150.337 236.166 1.00 74.02  ? 210 LEU B O   1 
ATOM   5095  C  CB  . LEU B 1 209 ? 144.051 149.463 234.275 1.00 73.60  ? 210 LEU B CB  1 
ATOM   5096  C  CG  . LEU B 1 209 ? 143.172 149.893 233.113 1.00 73.24  ? 210 LEU B CG  1 
ATOM   5097  C  CD1 . LEU B 1 209 ? 141.755 149.544 233.411 1.00 73.09  ? 210 LEU B CD1 1 
ATOM   5098  C  CD2 . LEU B 1 209 ? 143.297 151.364 232.897 1.00 73.13  ? 210 LEU B CD2 1 
ATOM   5099  N  N   . LYS B 1 210 ? 146.343 148.136 235.885 1.00 83.29  ? 211 LYS B N   1 
ATOM   5100  C  CA  . LYS B 1 210 ? 146.879 147.839 237.200 1.00 83.33  ? 211 LYS B CA  1 
ATOM   5101  C  C   . LYS B 1 210 ? 148.289 148.339 237.317 1.00 83.41  ? 211 LYS B C   1 
ATOM   5102  O  O   . LYS B 1 210 ? 148.703 148.813 238.362 1.00 83.41  ? 211 LYS B O   1 
ATOM   5103  C  CB  . LYS B 1 210 ? 146.834 146.337 237.468 1.00 83.33  ? 211 LYS B CB  1 
ATOM   5104  C  CG  . LYS B 1 210 ? 147.346 145.912 238.826 1.00 83.34  ? 211 LYS B CG  1 
ATOM   5105  C  CD  . LYS B 1 210 ? 148.798 145.545 238.769 1.00 83.36  ? 211 LYS B CD  1 
ATOM   5106  C  CE  . LYS B 1 210 ? 149.361 145.267 240.130 1.00 83.39  ? 211 LYS B CE  1 
ATOM   5107  N  NZ  . LYS B 1 210 ? 148.929 143.943 240.605 1.00 83.40  1 211 LYS B NZ  1 
ATOM   5108  N  N   . ASN B 1 211 ? 149.033 148.239 236.233 1.00 86.86  ? 212 ASN B N   1 
ATOM   5109  C  CA  . ASN B 1 211 ? 150.408 148.685 236.266 1.00 86.89  ? 212 ASN B CA  1 
ATOM   5110  C  C   . ASN B 1 211 ? 150.554 150.190 236.440 1.00 86.66  ? 212 ASN B C   1 
ATOM   5111  O  O   . ASN B 1 211 ? 151.535 150.656 236.998 1.00 86.67  ? 212 ASN B O   1 
ATOM   5112  C  CB  . ASN B 1 211 ? 151.168 148.184 235.043 1.00 87.06  ? 212 ASN B CB  1 
ATOM   5113  C  CG  . ASN B 1 211 ? 151.413 146.696 235.085 1.00 87.16  ? 212 ASN B CG  1 
ATOM   5114  O  OD1 . ASN B 1 211 ? 151.451 146.099 236.150 1.00 87.18  ? 212 ASN B OD1 1 
ATOM   5115  N  ND2 . ASN B 1 211 ? 151.583 146.090 233.924 1.00 87.23  ? 212 ASN B ND2 1 
ATOM   5116  N  N   . GLU B 1 212 ? 149.577 150.952 235.969 1.00 90.36  ? 213 GLU B N   1 
ATOM   5117  C  CA  . GLU B 1 212 ? 149.652 152.403 236.074 1.00 89.99  ? 213 GLU B CA  1 
ATOM   5118  C  C   . GLU B 1 212 ? 148.999 152.989 237.316 1.00 88.93  ? 213 GLU B C   1 
ATOM   5119  O  O   . GLU B 1 212 ? 149.170 154.163 237.602 1.00 88.88  ? 213 GLU B O   1 
ATOM   5120  C  CB  . GLU B 1 212 ? 149.069 153.067 234.830 1.00 90.46  ? 213 GLU B CB  1 
ATOM   5121  C  CG  . GLU B 1 212 ? 149.749 152.680 233.536 1.00 90.76  ? 213 GLU B CG  1 
ATOM   5122  C  CD  . GLU B 1 212 ? 151.145 153.225 233.424 1.00 90.89  ? 213 GLU B CD  1 
ATOM   5123  O  OE1 . GLU B 1 212 ? 151.352 154.408 233.744 1.00 90.96  ? 213 GLU B OE1 1 
ATOM   5124  O  OE2 . GLU B 1 212 ? 152.039 152.464 233.015 1.00 90.94  1 213 GLU B OE2 1 
ATOM   5125  N  N   . ILE B 1 213 ? 148.248 152.181 238.049 1.00 82.49  ? 214 ILE B N   1 
ATOM   5126  C  CA  . ILE B 1 213 ? 147.542 152.674 239.228 1.00 81.39  ? 214 ILE B CA  1 
ATOM   5127  C  C   . ILE B 1 213 ? 148.082 152.135 240.547 1.00 80.40  ? 214 ILE B C   1 
ATOM   5128  O  O   . ILE B 1 213 ? 148.075 150.939 240.787 1.00 80.32  ? 214 ILE B O   1 
ATOM   5129  C  CB  . ILE B 1 213 ? 146.046 152.397 239.144 1.00 81.33  ? 214 ILE B CB  1 
ATOM   5130  C  CG1 . ILE B 1 213 ? 145.472 153.012 237.883 1.00 81.33  ? 214 ILE B CG1 1 
ATOM   5131  C  CG2 . ILE B 1 213 ? 145.341 152.992 240.323 1.00 81.30  ? 214 ILE B CG2 1 
ATOM   5132  C  CD1 . ILE B 1 213 ? 144.034 152.686 237.668 1.00 81.32  ? 214 ILE B CD1 1 
ATOM   5133  N  N   . PRO B 1 214 ? 148.569 153.027 241.400 1.00 72.20  ? 215 PRO B N   1 
ATOM   5134  C  CA  . PRO B 1 214 ? 149.035 152.683 242.736 1.00 71.73  ? 215 PRO B CA  1 
ATOM   5135  C  C   . PRO B 1 214 ? 147.913 152.137 243.593 1.00 71.51  ? 215 PRO B C   1 
ATOM   5136  O  O   . PRO B 1 214 ? 146.781 152.564 243.440 1.00 71.48  ? 215 PRO B O   1 
ATOM   5137  C  CB  . PRO B 1 214 ? 149.495 154.021 243.291 1.00 71.61  ? 215 PRO B CB  1 
ATOM   5138  C  CG  . PRO B 1 214 ? 149.781 154.837 242.117 1.00 71.64  ? 215 PRO B CG  1 
ATOM   5139  C  CD  . PRO B 1 214 ? 148.784 154.447 241.104 1.00 71.85  ? 215 PRO B CD  1 
ATOM   5140  N  N   . ASN B 1 215 ? 148.239 151.210 244.485 1.00 76.51  ? 216 ASN B N   1 
ATOM   5141  C  CA  . ASN B 1 215 ? 147.274 150.594 245.387 1.00 76.41  ? 216 ASN B CA  1 
ATOM   5142  C  C   . ASN B 1 215 ? 146.119 149.955 244.653 1.00 76.43  ? 216 ASN B C   1 
ATOM   5143  O  O   . ASN B 1 215 ? 144.986 150.010 245.100 1.00 76.43  ? 216 ASN B O   1 
ATOM   5144  C  CB  . ASN B 1 215 ? 146.738 151.600 246.397 1.00 76.33  ? 216 ASN B CB  1 
ATOM   5145  C  CG  . ASN B 1 215 ? 147.715 151.894 247.497 1.00 76.28  ? 216 ASN B CG  1 
ATOM   5146  O  OD1 . ASN B 1 215 ? 148.582 151.089 247.800 1.00 76.27  ? 216 ASN B OD1 1 
ATOM   5147  N  ND2 . ASN B 1 215 ? 147.574 153.052 248.112 1.00 76.24  ? 216 ASN B ND2 1 
ATOM   5148  N  N   . SER B 1 216 ? 146.415 149.354 243.513 1.00 88.68  ? 217 SER B N   1 
ATOM   5149  C  CA  . SER B 1 216 ? 145.405 148.661 242.743 1.00 88.68  ? 217 SER B CA  1 
ATOM   5150  C  C   . SER B 1 216 ? 145.712 147.190 242.711 1.00 88.56  ? 217 SER B C   1 
ATOM   5151  O  O   . SER B 1 216 ? 146.863 146.797 242.721 1.00 88.56  ? 217 SER B O   1 
ATOM   5152  C  CB  . SER B 1 216 ? 145.369 149.194 241.327 1.00 88.76  ? 217 SER B CB  1 
ATOM   5153  O  OG  . SER B 1 216 ? 146.556 148.860 240.649 1.00 88.82  ? 217 SER B OG  1 
ATOM   5154  N  N   . HIS B 1 217 ? 144.671 146.377 242.659 1.00 75.72  ? 218 HIS B N   1 
ATOM   5155  C  CA  . HIS B 1 217 ? 144.838 144.940 242.623 1.00 75.59  ? 218 HIS B CA  1 
ATOM   5156  C  C   . HIS B 1 217 ? 143.919 144.319 241.600 1.00 75.79  ? 218 HIS B C   1 
ATOM   5157  O  O   . HIS B 1 217 ? 142.817 144.779 241.401 1.00 75.79  ? 218 HIS B O   1 
ATOM   5158  C  CB  . HIS B 1 217 ? 144.500 144.347 243.979 1.00 75.38  ? 218 HIS B CB  1 
ATOM   5159  C  CG  . HIS B 1 217 ? 145.148 145.050 245.120 1.00 75.18  ? 218 HIS B CG  1 
ATOM   5160  N  ND1 . HIS B 1 217 ? 146.431 144.774 245.525 1.00 75.09  ? 218 HIS B ND1 1 
ATOM   5161  C  CD2 . HIS B 1 217 ? 144.689 146.011 245.949 1.00 75.07  ? 218 HIS B CD2 1 
ATOM   5162  C  CE1 . HIS B 1 217 ? 146.739 145.543 246.551 1.00 75.03  ? 218 HIS B CE1 1 
ATOM   5163  N  NE2 . HIS B 1 217 ? 145.698 146.302 246.831 1.00 75.03  ? 218 HIS B NE2 1 
ATOM   5164  N  N   . ILE B 1 218 ? 144.376 143.264 240.948 1.00 69.22  ? 219 ILE B N   1 
ATOM   5165  C  CA  . ILE B 1 218 ? 143.499 142.459 240.127 1.00 69.50  ? 219 ILE B CA  1 
ATOM   5166  C  C   . ILE B 1 218 ? 143.272 141.165 240.856 1.00 70.38  ? 219 ILE B C   1 
ATOM   5167  O  O   . ILE B 1 218 ? 144.171 140.351 240.966 1.00 70.42  ? 219 ILE B O   1 
ATOM   5168  C  CB  . ILE B 1 218 ? 144.119 142.138 238.779 1.00 69.02  ? 219 ILE B CB  1 
ATOM   5169  C  CG1 . ILE B 1 218 ? 144.339 143.412 237.979 1.00 68.80  ? 219 ILE B CG1 1 
ATOM   5170  C  CG2 . ILE B 1 218 ? 143.223 141.229 238.006 1.00 68.90  ? 219 ILE B CG2 1 
ATOM   5171  C  CD1 . ILE B 1 218 ? 145.090 143.195 236.720 1.00 68.70  ? 219 ILE B CD1 1 
ATOM   5172  N  N   . LEU B 1 219 ? 142.069 140.982 241.374 1.00 87.02  ? 220 LEU B N   1 
ATOM   5173  C  CA  . LEU B 1 219 ? 141.727 139.767 242.090 1.00 87.87  ? 220 LEU B CA  1 
ATOM   5174  C  C   . LEU B 1 219 ? 141.757 138.554 241.170 1.00 88.07  ? 220 LEU B C   1 
ATOM   5175  O  O   . LEU B 1 219 ? 142.018 137.441 241.606 1.00 88.13  ? 220 LEU B O   1 
ATOM   5176  C  CB  . LEU B 1 219 ? 140.367 139.917 242.752 1.00 88.32  ? 220 LEU B CB  1 
ATOM   5177  C  CG  . LEU B 1 219 ? 140.274 141.034 243.778 1.00 88.73  ? 220 LEU B CG  1 
ATOM   5178  C  CD1 . LEU B 1 219 ? 138.867 141.172 244.284 1.00 88.90  ? 220 LEU B CD1 1 
ATOM   5179  C  CD2 . LEU B 1 219 ? 141.211 140.742 244.907 1.00 88.86  ? 220 LEU B CD2 1 
ATOM   5180  N  N   . ASP B 1 220 ? 141.496 138.789 239.893 1.00 83.56  ? 221 ASP B N   1 
ATOM   5181  C  CA  . ASP B 1 220 ? 141.631 137.779 238.848 1.00 83.71  ? 221 ASP B CA  1 
ATOM   5182  C  C   . ASP B 1 220 ? 140.777 136.541 239.060 1.00 83.70  ? 221 ASP B C   1 
ATOM   5183  O  O   . ASP B 1 220 ? 141.225 135.561 239.631 1.00 83.72  ? 221 ASP B O   1 
ATOM   5184  C  CB  . ASP B 1 220 ? 143.093 137.378 238.676 1.00 83.79  ? 221 ASP B CB  1 
ATOM   5185  C  CG  . ASP B 1 220 ? 143.389 136.845 237.301 1.00 83.84  ? 221 ASP B CG  1 
ATOM   5186  O  OD1 . ASP B 1 220 ? 144.562 136.865 236.895 1.00 83.86  ? 221 ASP B OD1 1 
ATOM   5187  O  OD2 . ASP B 1 220 ? 142.448 136.418 236.620 1.00 83.84  1 221 ASP B OD2 1 
ATOM   5188  N  N   . GLN B 1 221 ? 139.551 136.588 238.564 1.00 84.50  ? 222 GLN B N   1 
ATOM   5189  C  CA  . GLN B 1 221 ? 138.637 135.469 238.680 1.00 84.46  ? 222 GLN B CA  1 
ATOM   5190  C  C   . GLN B 1 221 ? 139.107 134.261 237.904 1.00 84.46  ? 222 GLN B C   1 
ATOM   5191  O  O   . GLN B 1 221 ? 138.683 133.149 238.170 1.00 84.46  ? 222 GLN B O   1 
ATOM   5192  C  CB  . GLN B 1 221 ? 137.240 135.866 238.221 1.00 84.41  ? 222 GLN B CB  1 
ATOM   5193  C  CG  . GLN B 1 221 ? 137.174 136.404 236.832 1.00 84.36  ? 222 GLN B CG  1 
ATOM   5194  C  CD  . GLN B 1 221 ? 135.775 136.782 236.426 1.00 84.31  ? 222 GLN B CD  1 
ATOM   5195  O  OE1 . GLN B 1 221 ? 134.809 136.209 236.899 1.00 84.25  ? 222 GLN B OE1 1 
ATOM   5196  N  NE2 . GLN B 1 221 ? 135.661 137.760 235.551 1.00 84.26  ? 222 GLN B NE2 1 
ATOM   5197  N  N   . TYR B 1 222 ? 139.960 134.484 236.919 1.00 72.02  ? 223 TYR B N   1 
ATOM   5198  C  CA  . TYR B 1 222 ? 140.449 133.402 236.082 1.00 72.07  ? 223 TYR B CA  1 
ATOM   5199  C  C   . TYR B 1 222 ? 141.510 132.517 236.734 1.00 72.91  ? 223 TYR B C   1 
ATOM   5200  O  O   . TYR B 1 222 ? 141.700 131.381 236.333 1.00 72.96  ? 223 TYR B O   1 
ATOM   5201  C  CB  . TYR B 1 222 ? 140.938 133.968 234.755 1.00 71.49  ? 223 TYR B CB  1 
ATOM   5202  C  CG  . TYR B 1 222 ? 139.880 134.760 234.026 1.00 70.92  ? 223 TYR B CG  1 
ATOM   5203  C  CD1 . TYR B 1 222 ? 138.863 134.126 233.354 1.00 70.66  ? 223 TYR B CD1 1 
ATOM   5204  C  CD2 . TYR B 1 222 ? 139.898 136.135 234.021 1.00 70.61  ? 223 TYR B CD2 1 
ATOM   5205  C  CE1 . TYR B 1 222 ? 137.905 134.832 232.702 1.00 70.46  ? 223 TYR B CE1 1 
ATOM   5206  C  CE2 . TYR B 1 222 ? 138.942 136.847 233.370 1.00 70.43  ? 223 TYR B CE2 1 
ATOM   5207  C  CZ  . TYR B 1 222 ? 137.947 136.191 232.711 1.00 70.39  ? 223 TYR B CZ  1 
ATOM   5208  O  OH  . TYR B 1 222 ? 136.979 136.894 232.051 1.00 70.36  ? 223 TYR B OH  1 
ATOM   5209  N  N   . ARG B 1 223 ? 142.176 133.029 237.759 1.00 97.56  ? 224 ARG B N   1 
ATOM   5210  C  CA  . ARG B 1 223 ? 143.237 132.286 238.428 1.00 98.33  ? 224 ARG B CA  1 
ATOM   5211  C  C   . ARG B 1 223 ? 142.993 132.123 239.912 1.00 97.85  ? 224 ARG B C   1 
ATOM   5212  O  O   . ARG B 1 223 ? 143.477 131.178 240.511 1.00 97.82  ? 224 ARG B O   1 
ATOM   5213  C  CB  . ARG B 1 223 ? 144.591 132.971 238.242 1.00 99.45  ? 224 ARG B CB  1 
ATOM   5214  C  CG  . ARG B 1 223 ? 145.088 133.039 236.829 1.00 100.40 ? 224 ARG B CG  1 
ATOM   5215  C  CD  . ARG B 1 223 ? 146.480 133.637 236.761 1.00 101.22 ? 224 ARG B CD  1 
ATOM   5216  N  NE  . ARG B 1 223 ? 147.510 132.706 237.205 1.00 101.89 ? 224 ARG B NE  1 
ATOM   5217  C  CZ  . ARG B 1 223 ? 148.031 131.759 236.435 1.00 102.61 ? 224 ARG B CZ  1 
ATOM   5218  N  NH1 . ARG B 1 223 ? 147.605 131.620 235.191 1.00 102.81 1 224 ARG B NH1 1 
ATOM   5219  N  NH2 . ARG B 1 223 ? 148.965 130.948 236.906 1.00 102.82 ? 224 ARG B NH2 1 
ATOM   5220  N  N   . ASN B 1 224 ? 142.271 133.061 240.513 1.00 83.81  ? 225 ASN B N   1 
ATOM   5221  C  CA  . ASN B 1 224 ? 142.093 133.042 241.957 1.00 83.30  ? 225 ASN B CA  1 
ATOM   5222  C  C   . ASN B 1 224 ? 141.353 131.800 242.393 1.00 82.75  ? 225 ASN B C   1 
ATOM   5223  O  O   . ASN B 1 224 ? 140.345 131.443 241.820 1.00 82.70  ? 225 ASN B O   1 
ATOM   5224  C  CB  . ASN B 1 224 ? 141.350 134.292 242.421 1.00 83.33  ? 225 ASN B CB  1 
ATOM   5225  C  CG  . ASN B 1 224 ? 141.482 134.534 243.900 1.00 83.36  ? 225 ASN B CG  1 
ATOM   5226  O  OD1 . ASN B 1 224 ? 141.618 133.606 244.682 1.00 83.36  ? 225 ASN B OD1 1 
ATOM   5227  N  ND2 . ASN B 1 224 ? 141.435 135.789 244.295 1.00 83.36  ? 225 ASN B ND2 1 
ATOM   5228  N  N   . ALA B 1 225 ? 141.863 131.147 243.424 1.00 73.63  ? 226 ALA B N   1 
ATOM   5229  C  CA  . ALA B 1 225 ? 141.266 129.919 243.906 1.00 73.12  ? 226 ALA B CA  1 
ATOM   5230  C  C   . ALA B 1 225 ? 139.971 130.181 244.631 1.00 72.99  ? 226 ALA B C   1 
ATOM   5231  O  O   . ALA B 1 225 ? 139.142 129.297 244.774 1.00 72.95  ? 226 ALA B O   1 
ATOM   5232  C  CB  . ALA B 1 225 ? 142.226 129.185 244.797 1.00 72.98  ? 226 ALA B CB  1 
ATOM   5233  N  N   . SER B 1 226 ? 139.804 131.416 245.074 1.00 78.05  ? 227 SER B N   1 
ATOM   5234  C  CA  . SER B 1 226 ? 138.647 131.792 245.853 1.00 78.00  ? 227 SER B CA  1 
ATOM   5235  C  C   . SER B 1 226 ? 137.400 131.575 245.035 1.00 78.09  ? 227 SER B C   1 
ATOM   5236  O  O   . SER B 1 226 ? 136.340 131.284 245.564 1.00 78.05  ? 227 SER B O   1 
ATOM   5237  C  CB  . SER B 1 226 ? 138.758 133.248 246.285 1.00 77.91  ? 227 SER B CB  1 
ATOM   5238  O  OG  . SER B 1 226 ? 139.932 133.462 247.038 1.00 77.87  ? 227 SER B OG  1 
ATOM   5239  N  N   . ASN B 1 227 ? 137.542 131.688 243.727 1.00 84.59  ? 228 ASN B N   1 
ATOM   5240  C  CA  . ASN B 1 227 ? 136.419 131.504 242.832 1.00 84.68  ? 228 ASN B CA  1 
ATOM   5241  C  C   . ASN B 1 227 ? 135.881 130.082 242.888 1.00 84.52  ? 228 ASN B C   1 
ATOM   5242  O  O   . ASN B 1 227 ? 134.799 129.877 243.400 1.00 84.46  ? 228 ASN B O   1 
ATOM   5243  C  CB  . ASN B 1 227 ? 136.776 132.000 241.420 1.00 84.85  ? 228 ASN B CB  1 
ATOM   5244  C  CG  . ASN B 1 227 ? 135.810 131.546 240.351 1.00 84.97  ? 228 ASN B CG  1 
ATOM   5245  O  OD1 . ASN B 1 227 ? 134.727 131.055 240.619 1.00 84.86  ? 228 ASN B OD1 1 
ATOM   5246  N  ND2 . ASN B 1 227 ? 136.207 131.738 239.110 1.00 85.06  ? 228 ASN B ND2 1 
ATOM   5247  N  N   . PRO B 1 228 ? 136.615 129.098 242.372 1.00 81.59  ? 229 PRO B N   1 
ATOM   5248  C  CA  . PRO B 1 228 ? 136.024 127.771 242.501 1.00 81.39  ? 229 PRO B CA  1 
ATOM   5249  C  C   . PRO B 1 228 ? 135.796 127.330 243.937 1.00 81.10  ? 229 PRO B C   1 
ATOM   5250  O  O   . PRO B 1 228 ? 134.850 126.608 244.208 1.00 81.08  ? 229 PRO B O   1 
ATOM   5251  C  CB  . PRO B 1 228 ? 137.039 126.877 241.807 1.00 81.43  ? 229 PRO B CB  1 
ATOM   5252  C  CG  . PRO B 1 228 ? 138.289 127.595 241.911 1.00 81.53  ? 229 PRO B CG  1 
ATOM   5253  C  CD  . PRO B 1 228 ? 137.975 129.026 241.827 1.00 81.59  ? 229 PRO B CD  1 
ATOM   5254  N  N   . LEU B 1 229 ? 136.654 127.761 244.848 1.00 83.50  ? 230 LEU B N   1 
ATOM   5255  C  CA  . LEU B 1 229 ? 136.531 127.333 246.233 1.00 83.17  ? 230 LEU B CA  1 
ATOM   5256  C  C   . LEU B 1 229 ? 135.260 127.825 246.873 1.00 82.49  ? 230 LEU B C   1 
ATOM   5257  O  O   . LEU B 1 229 ? 134.744 127.200 247.786 1.00 82.46  ? 230 LEU B O   1 
ATOM   5258  C  CB  . LEU B 1 229 ? 137.722 127.786 247.063 1.00 83.45  ? 230 LEU B CB  1 
ATOM   5259  C  CG  . LEU B 1 229 ? 138.982 126.953 246.929 1.00 83.69  ? 230 LEU B CG  1 
ATOM   5260  C  CD1 . LEU B 1 229 ? 140.081 127.585 247.724 1.00 83.77  ? 230 LEU B CD1 1 
ATOM   5261  C  CD2 . LEU B 1 229 ? 138.718 125.564 247.417 1.00 83.74  ? 230 LEU B CD2 1 
ATOM   5262  N  N   . ALA B 1 230 ? 134.766 128.961 246.410 1.00 67.06  ? 231 ALA B N   1 
ATOM   5263  C  CA  . ALA B 1 230 ? 133.517 129.474 246.925 1.00 66.46  ? 231 ALA B CA  1 
ATOM   5264  C  C   . ALA B 1 230 ? 132.393 128.513 246.608 1.00 66.17  ? 231 ALA B C   1 
ATOM   5265  O  O   . ALA B 1 230 ? 131.506 128.288 247.416 1.00 66.13  ? 231 ALA B O   1 
ATOM   5266  C  CB  . ALA B 1 230 ? 133.237 130.798 246.316 1.00 66.31  ? 231 ALA B CB  1 
ATOM   5267  N  N   . HIS B 1 231 ? 132.459 127.922 245.427 1.00 75.43  ? 232 HIS B N   1 
ATOM   5268  C  CA  . HIS B 1 231 ? 131.434 127.003 244.979 1.00 75.29  ? 232 HIS B CA  1 
ATOM   5269  C  C   . HIS B 1 231 ? 131.620 125.632 245.577 1.00 75.73  ? 232 HIS B C   1 
ATOM   5270  O  O   . HIS B 1 231 ? 130.668 124.890 245.752 1.00 75.77  ? 232 HIS B O   1 
ATOM   5271  C  CB  . HIS B 1 231 ? 131.438 126.918 243.465 1.00 74.91  ? 232 HIS B CB  1 
ATOM   5272  C  CG  . HIS B 1 231 ? 131.075 128.197 242.797 1.00 74.57  ? 232 HIS B CG  1 
ATOM   5273  N  ND1 . HIS B 1 231 ? 129.823 128.755 242.898 1.00 74.42  ? 232 HIS B ND1 1 
ATOM   5274  C  CD2 . HIS B 1 231 ? 131.799 129.037 242.027 1.00 74.40  ? 232 HIS B CD2 1 
ATOM   5275  C  CE1 . HIS B 1 231 ? 129.791 129.881 242.215 1.00 74.33  ? 232 HIS B CE1 1 
ATOM   5276  N  NE2 . HIS B 1 231 ? 130.978 130.076 241.675 1.00 74.32  ? 232 HIS B NE2 1 
ATOM   5277  N  N   . TYR B 1 232 ? 132.862 125.295 245.879 1.00 75.56  ? 233 TYR B N   1 
ATOM   5278  C  CA  . TYR B 1 232 ? 133.167 124.039 246.530 1.00 76.07  ? 233 TYR B CA  1 
ATOM   5279  C  C   . TYR B 1 232 ? 132.667 124.050 247.958 1.00 76.74  ? 233 TYR B C   1 
ATOM   5280  O  O   . TYR B 1 232 ? 132.098 123.086 248.435 1.00 76.87  ? 233 TYR B O   1 
ATOM   5281  C  CB  . TYR B 1 232 ? 134.673 123.817 246.500 1.00 75.96  ? 233 TYR B CB  1 
ATOM   5282  C  CG  . TYR B 1 232 ? 135.151 122.534 247.127 1.00 75.88  ? 233 TYR B CG  1 
ATOM   5283  C  CD1 . TYR B 1 232 ? 135.173 121.359 246.415 1.00 75.86  ? 233 TYR B CD1 1 
ATOM   5284  C  CD2 . TYR B 1 232 ? 135.607 122.512 248.423 1.00 75.84  ? 233 TYR B CD2 1 
ATOM   5285  C  CE1 . TYR B 1 232 ? 135.618 120.202 246.979 1.00 75.84  ? 233 TYR B CE1 1 
ATOM   5286  C  CE2 . TYR B 1 232 ? 136.056 121.358 248.995 1.00 75.85  ? 233 TYR B CE2 1 
ATOM   5287  C  CZ  . TYR B 1 232 ? 136.062 120.203 248.273 1.00 75.85  ? 233 TYR B CZ  1 
ATOM   5288  O  OH  . TYR B 1 232 ? 136.515 119.044 248.853 1.00 75.92  ? 233 TYR B OH  1 
ATOM   5289  N  N   . ASP B 1 233 ? 132.867 125.170 248.629 1.00 88.85  ? 234 ASP B N   1 
ATOM   5290  C  CA  . ASP B 1 233 ? 132.513 125.294 250.027 1.00 89.49  ? 234 ASP B CA  1 
ATOM   5291  C  C   . ASP B 1 233 ? 131.045 125.559 250.265 1.00 89.93  ? 234 ASP B C   1 
ATOM   5292  O  O   . ASP B 1 233 ? 130.463 125.011 251.185 1.00 90.00  ? 234 ASP B O   1 
ATOM   5293  C  CB  . ASP B 1 233 ? 133.316 126.416 250.671 1.00 89.63  ? 234 ASP B CB  1 
ATOM   5294  C  CG  . ASP B 1 233 ? 134.770 126.091 250.788 1.00 89.73  ? 234 ASP B CG  1 
ATOM   5295  O  OD1 . ASP B 1 233 ? 135.108 124.899 250.735 1.00 89.72  ? 234 ASP B OD1 1 
ATOM   5296  O  OD2 . ASP B 1 233 ? 135.575 127.026 250.947 1.00 89.71  1 234 ASP B OD2 1 
ATOM   5297  N  N   . THR B 1 234 ? 130.447 126.411 249.446 1.00 82.98  ? 235 THR B N   1 
ATOM   5298  C  CA  . THR B 1 234 ? 129.089 126.849 249.715 1.00 83.36  ? 235 THR B CA  1 
ATOM   5299  C  C   . THR B 1 234 ? 128.053 126.294 248.755 1.00 83.75  ? 235 THR B C   1 
ATOM   5300  O  O   . THR B 1 234 ? 127.121 125.625 249.172 1.00 83.81  ? 235 THR B O   1 
ATOM   5301  C  CB  . THR B 1 234 ? 128.982 128.373 249.767 1.00 83.34  ? 235 THR B CB  1 
ATOM   5302  O  OG1 . THR B 1 234 ? 129.266 128.917 248.481 1.00 83.32  ? 235 THR B OG1 1 
ATOM   5303  C  CG2 . THR B 1 234 ? 129.956 128.934 250.762 1.00 83.31  ? 235 THR B CG2 1 
ATOM   5304  N  N   . THR B 1 235 ? 128.214 126.564 247.472 1.00 76.72  ? 236 THR B N   1 
ATOM   5305  C  CA  . THR B 1 235 ? 127.190 126.211 246.504 1.00 77.12  ? 236 THR B CA  1 
ATOM   5306  C  C   . THR B 1 235 ? 126.905 124.714 246.478 1.00 77.88  ? 236 THR B C   1 
ATOM   5307  O  O   . THR B 1 235 ? 125.756 124.286 246.505 1.00 77.95  ? 236 THR B O   1 
ATOM   5308  C  CB  . THR B 1 235 ? 127.602 126.667 245.105 1.00 76.85  ? 236 THR B CB  1 
ATOM   5309  O  OG1 . THR B 1 235 ? 128.103 128.002 245.171 1.00 76.72  ? 236 THR B OG1 1 
ATOM   5310  C  CG2 . THR B 1 235 ? 126.433 126.639 244.177 1.00 76.75  ? 236 THR B CG2 1 
ATOM   5311  N  N   . ALA B 1 236 ? 127.963 123.922 246.456 1.00 89.36  ? 237 ALA B N   1 
ATOM   5312  C  CA  . ALA B 1 236 ? 127.831 122.478 246.430 1.00 90.11  ? 237 ALA B CA  1 
ATOM   5313  C  C   . ALA B 1 236 ? 127.240 121.903 247.714 1.00 90.63  ? 237 ALA B C   1 
ATOM   5314  O  O   . ALA B 1 236 ? 126.504 120.927 247.681 1.00 90.70  ? 237 ALA B O   1 
ATOM   5315  C  CB  . ALA B 1 236 ? 129.174 121.847 246.134 1.00 90.22  ? 237 ALA B CB  1 
ATOM   5316  N  N   . ASP B 1 237 ? 127.564 122.507 248.846 1.00 102.58 ? 238 ASP B N   1 
ATOM   5317  C  CA  . ASP B 1 237 ? 127.006 122.054 250.102 1.00 102.91 ? 238 ASP B CA  1 
ATOM   5318  C  C   . ASP B 1 237 ? 125.521 122.322 250.112 1.00 102.72 ? 238 ASP B C   1 
ATOM   5319  O  O   . ASP B 1 237 ? 124.746 121.535 250.638 1.00 102.74 ? 238 ASP B O   1 
ATOM   5320  C  CB  . ASP B 1 237 ? 127.668 122.769 251.274 1.00 103.22 ? 238 ASP B CB  1 
ATOM   5321  C  CG  . ASP B 1 237 ? 128.896 122.048 251.787 1.00 103.36 ? 238 ASP B CG  1 
ATOM   5322  O  OD1 . ASP B 1 237 ? 129.404 121.158 251.085 1.00 103.43 ? 238 ASP B OD1 1 
ATOM   5323  O  OD2 . ASP B 1 237 ? 129.361 122.379 252.896 1.00 103.45 1 238 ASP B OD2 1 
ATOM   5324  N  N   . GLU B 1 238 ? 125.128 123.433 249.509 1.00 81.94  ? 239 GLU B N   1 
ATOM   5325  C  CA  . GLU B 1 238 ? 123.728 123.789 249.455 1.00 81.65  ? 239 GLU B CA  1 
ATOM   5326  C  C   . GLU B 1 238 ? 123.004 122.815 248.570 1.00 81.46  ? 239 GLU B C   1 
ATOM   5327  O  O   . GLU B 1 238 ? 121.920 122.355 248.895 1.00 81.53  ? 239 GLU B O   1 
ATOM   5328  C  CB  . GLU B 1 238 ? 123.551 125.201 248.913 1.00 81.54  ? 239 GLU B CB  1 
ATOM   5329  C  CG  . GLU B 1 238 ? 123.998 126.284 249.849 1.00 81.47  ? 239 GLU B CG  1 
ATOM   5330  C  CD  . GLU B 1 238 ? 123.923 127.650 249.229 1.00 81.39  ? 239 GLU B CD  1 
ATOM   5331  O  OE1 . GLU B 1 238 ? 124.683 128.535 249.651 1.00 81.41  ? 239 GLU B OE1 1 
ATOM   5332  O  OE2 . GLU B 1 238 ? 123.104 127.843 248.319 1.00 81.41  1 239 GLU B OE2 1 
ATOM   5333  N  N   . ILE B 1 239 ? 123.621 122.478 247.452 1.00 80.78  ? 240 ILE B N   1 
ATOM   5334  C  CA  . ILE B 1 239 ? 122.996 121.550 246.536 1.00 80.61  ? 240 ILE B CA  1 
ATOM   5335  C  C   . ILE B 1 239 ? 122.838 120.175 247.160 1.00 81.10  ? 240 ILE B C   1 
ATOM   5336  O  O   . ILE B 1 239 ? 121.801 119.539 247.016 1.00 81.20  ? 240 ILE B O   1 
ATOM   5337  C  CB  . ILE B 1 239 ? 123.801 121.441 245.255 1.00 80.08  ? 240 ILE B CB  1 
ATOM   5338  C  CG1 . ILE B 1 239 ? 123.819 122.786 244.550 1.00 79.80  ? 240 ILE B CG1 1 
ATOM   5339  C  CG2 . ILE B 1 239 ? 123.203 120.404 244.354 1.00 79.97  ? 240 ILE B CG2 1 
ATOM   5340  C  CD1 . ILE B 1 239 ? 124.720 122.829 243.370 1.00 79.66  ? 240 ILE B CD1 1 
ATOM   5341  N  N   . LEU B 1 240 ? 123.862 119.729 247.877 1.00 80.66  ? 241 LEU B N   1 
ATOM   5342  C  CA  . LEU B 1 240 ? 123.815 118.431 248.532 1.00 81.21  ? 241 LEU B CA  1 
ATOM   5343  C  C   . LEU B 1 240 ? 122.800 118.387 249.655 1.00 82.38  ? 241 LEU B C   1 
ATOM   5344  O  O   . LEU B 1 240 ? 122.147 117.379 249.875 1.00 82.52  ? 241 LEU B O   1 
ATOM   5345  C  CB  . LEU B 1 240 ? 125.186 118.057 249.080 1.00 80.78  ? 241 LEU B CB  1 
ATOM   5346  C  CG  . LEU B 1 240 ? 126.208 117.528 248.087 1.00 80.43  ? 241 LEU B CG  1 
ATOM   5347  C  CD1 . LEU B 1 240 ? 127.515 117.310 248.782 1.00 80.31  ? 241 LEU B CD1 1 
ATOM   5348  C  CD2 . LEU B 1 240 ? 125.727 116.245 247.481 1.00 80.34  ? 241 LEU B CD2 1 
ATOM   5349  N  N   . GLN B 1 241 ? 122.671 119.494 250.365 1.00 106.89 ? 242 GLN B N   1 
ATOM   5350  C  CA  . GLN B 1 241 ? 121.759 119.551 251.487 1.00 108.07 ? 242 GLN B CA  1 
ATOM   5351  C  C   . GLN B 1 241 ? 120.325 119.614 251.015 1.00 108.65 ? 242 GLN B C   1 
ATOM   5352  O  O   . GLN B 1 241 ? 119.444 119.008 251.605 1.00 108.70 ? 242 GLN B O   1 
ATOM   5353  C  CB  . GLN B 1 241 ? 122.084 120.757 252.356 1.00 108.59 ? 242 GLN B CB  1 
ATOM   5354  C  CG  . GLN B 1 241 ? 121.184 120.923 253.548 1.00 109.00 ? 242 GLN B CG  1 
ATOM   5355  C  CD  . GLN B 1 241 ? 121.610 122.072 254.429 1.00 109.30 ? 242 GLN B CD  1 
ATOM   5356  O  OE1 . GLN B 1 241 ? 122.659 122.674 254.214 1.00 109.35 ? 242 GLN B OE1 1 
ATOM   5357  N  NE2 . GLN B 1 241 ? 120.797 122.385 255.429 1.00 109.47 ? 242 GLN B NE2 1 
ATOM   5358  N  N   . GLN B 1 242 ? 120.091 120.369 249.955 1.00 85.38  ? 243 GLN B N   1 
ATOM   5359  C  CA  . GLN B 1 242 ? 118.756 120.500 249.403 1.00 85.92  ? 243 GLN B CA  1 
ATOM   5360  C  C   . GLN B 1 242 ? 118.258 119.225 248.757 1.00 87.24  ? 243 GLN B C   1 
ATOM   5361  O  O   . GLN B 1 242 ? 117.068 118.963 248.727 1.00 87.33  ? 243 GLN B O   1 
ATOM   5362  C  CB  . GLN B 1 242 ? 118.711 121.656 248.412 1.00 85.28  ? 243 GLN B CB  1 
ATOM   5363  C  CG  . GLN B 1 242 ? 118.742 123.007 249.078 1.00 84.80  ? 243 GLN B CG  1 
ATOM   5364  C  CD  . GLN B 1 242 ? 118.907 124.139 248.107 1.00 84.40  ? 243 GLN B CD  1 
ATOM   5365  O  OE1 . GLN B 1 242 ? 119.702 124.064 247.185 1.00 84.29  ? 243 GLN B OE1 1 
ATOM   5366  N  NE2 . GLN B 1 242 ? 118.152 125.199 248.310 1.00 84.25  ? 243 GLN B NE2 1 
ATOM   5367  N  N   . CYS B 1 243 ? 119.183 118.430 248.245 1.00 98.38  ? 244 CYS B N   1 
ATOM   5368  C  CA  . CYS B 1 243 ? 118.834 117.201 247.550 1.00 99.68  ? 244 CYS B CA  1 
ATOM   5369  C  C   . CYS B 1 243 ? 118.938 115.977 248.439 1.00 100.91 ? 244 CYS B C   1 
ATOM   5370  O  O   . CYS B 1 243 ? 118.780 114.861 247.978 1.00 101.03 ? 244 CYS B O   1 
ATOM   5371  C  CB  . CYS B 1 243 ? 119.701 117.024 246.310 1.00 99.73  ? 244 CYS B CB  1 
ATOM   5372  S  SG  . CYS B 1 243 ? 119.358 118.203 245.013 1.00 99.67  ? 244 CYS B SG  1 
ATOM   5373  N  N   . ASP B 1 244 ? 119.220 116.202 249.712 1.00 110.46 ? 245 ASP B N   1 
ATOM   5374  C  CA  . ASP B 1 244 ? 119.384 115.134 250.686 1.00 111.51 ? 245 ASP B CA  1 
ATOM   5375  C  C   . ASP B 1 244 ? 120.470 114.152 250.296 1.00 112.26 ? 245 ASP B C   1 
ATOM   5376  O  O   . ASP B 1 244 ? 120.414 112.991 250.661 1.00 112.34 ? 245 ASP B O   1 
ATOM   5377  C  CB  . ASP B 1 244 ? 118.068 114.390 250.906 1.00 111.70 ? 245 ASP B CB  1 
ATOM   5378  C  CG  . ASP B 1 244 ? 116.995 115.264 251.511 1.00 111.77 ? 245 ASP B CG  1 
ATOM   5379  O  OD1 . ASP B 1 244 ? 117.235 115.849 252.582 1.00 111.83 ? 245 ASP B OD1 1 
ATOM   5380  O  OD2 . ASP B 1 244 ? 115.907 115.372 250.914 1.00 111.82 1 245 ASP B OD2 1 
ATOM   5381  N  N   . GLY B 1 245 ? 121.456 114.620 249.548 1.00 90.57  ? 246 GLY B N   1 
ATOM   5382  C  CA  . GLY B 1 245 ? 122.595 113.805 249.181 1.00 91.24  ? 246 GLY B CA  1 
ATOM   5383  C  C   . GLY B 1 245 ? 122.361 113.009 247.919 1.00 91.83  ? 246 GLY B C   1 
ATOM   5384  O  O   . GLY B 1 245 ? 123.294 112.522 247.294 1.00 91.90  ? 246 GLY B O   1 
ATOM   5385  N  N   . LYS B 1 246 ? 121.100 112.902 247.530 1.00 109.01 ? 247 LYS B N   1 
ATOM   5386  C  CA  . LYS B 1 246 ? 120.721 112.121 246.368 1.00 109.41 ? 247 LYS B CA  1 
ATOM   5387  C  C   . LYS B 1 246 ? 120.699 112.990 245.130 1.00 108.70 ? 247 LYS B C   1 
ATOM   5388  O  O   . LYS B 1 246 ? 119.941 113.941 245.052 1.00 108.63 ? 247 LYS B O   1 
ATOM   5389  C  CB  . LYS B 1 246 ? 119.350 111.491 246.590 1.00 110.31 ? 247 LYS B CB  1 
ATOM   5390  C  CG  . LYS B 1 246 ? 119.281 110.577 247.804 1.00 110.99 ? 247 LYS B CG  1 
ATOM   5391  C  CD  . LYS B 1 246 ? 117.913 109.923 247.951 1.00 111.53 ? 247 LYS B CD  1 
ATOM   5392  C  CE  . LYS B 1 246 ? 116.859 110.894 248.467 1.00 111.86 ? 247 LYS B CE  1 
ATOM   5393  N  NZ  . LYS B 1 246 ? 117.071 111.243 249.899 1.00 112.04 1 247 LYS B NZ  1 
ATOM   5394  N  N   . LEU B 1 247 ? 121.519 112.640 244.151 1.00 113.63 ? 248 LEU B N   1 
ATOM   5395  C  CA  . LEU B 1 247 ? 121.701 113.474 242.978 1.00 112.79 ? 248 LEU B CA  1 
ATOM   5396  C  C   . LEU B 1 247 ? 122.336 112.680 241.851 1.00 111.08 ? 248 LEU B C   1 
ATOM   5397  O  O   . LEU B 1 247 ? 123.401 112.109 242.022 1.00 110.99 ? 248 LEU B O   1 
ATOM   5398  C  CB  . LEU B 1 247 ? 122.584 114.656 243.343 1.00 113.44 ? 248 LEU B CB  1 
ATOM   5399  C  CG  . LEU B 1 247 ? 122.878 115.628 242.219 1.00 113.93 ? 248 LEU B CG  1 
ATOM   5400  C  CD1 . LEU B 1 247 ? 121.586 115.991 241.561 1.00 113.97 ? 248 LEU B CD1 1 
ATOM   5401  C  CD2 . LEU B 1 247 ? 123.545 116.846 242.769 1.00 114.15 ? 248 LEU B CD2 1 
ATOM   5402  N  N   . ASP B 1 248 ? 121.684 112.641 240.699 1.00 95.53  ? 249 ASP B N   1 
ATOM   5403  C  CA  . ASP B 1 248 ? 122.129 111.774 239.621 1.00 93.86  ? 249 ASP B CA  1 
ATOM   5404  C  C   . ASP B 1 248 ? 122.892 112.463 238.492 1.00 92.12  ? 249 ASP B C   1 
ATOM   5405  O  O   . ASP B 1 248 ? 123.749 111.857 237.865 1.00 92.02  ? 249 ASP B O   1 
ATOM   5406  C  CB  . ASP B 1 248 ? 120.938 111.006 239.058 1.00 93.89  ? 249 ASP B CB  1 
ATOM   5407  C  CG  . ASP B 1 248 ? 120.327 110.068 240.065 1.00 93.96  ? 249 ASP B CG  1 
ATOM   5408  O  OD1 . ASP B 1 248 ? 120.704 108.884 240.075 1.00 93.95  ? 249 ASP B OD1 1 
ATOM   5409  O  OD2 . ASP B 1 248 ? 119.465 110.509 240.846 1.00 93.93  1 249 ASP B OD2 1 
ATOM   5410  N  N   . MET B 1 249 ? 122.576 113.724 238.228 1.00 99.36  ? 250 MET B N   1 
ATOM   5411  C  CA  . MET B 1 249 ? 123.219 114.465 237.147 1.00 97.69  ? 250 MET B CA  1 
ATOM   5412  C  C   . MET B 1 249 ? 123.195 115.947 237.444 1.00 95.93  ? 250 MET B C   1 
ATOM   5413  O  O   . MET B 1 249 ? 122.230 116.449 237.994 1.00 95.88  ? 250 MET B O   1 
ATOM   5414  C  CB  . MET B 1 249 ? 122.515 114.197 235.816 1.00 97.78  ? 250 MET B CB  1 
ATOM   5415  C  CG  . MET B 1 249 ? 122.983 115.074 234.672 1.00 97.85  ? 250 MET B CG  1 
ATOM   5416  S  SD  . MET B 1 249 ? 122.199 114.738 233.095 1.00 97.95  ? 250 MET B SD  1 
ATOM   5417  C  CE  . MET B 1 249 ? 122.963 113.193 232.676 1.00 98.01  ? 250 MET B CE  1 
ATOM   5418  N  N   . LEU B 1 250 ? 124.263 116.647 237.082 1.00 86.55  ? 251 LEU B N   1 
ATOM   5419  C  CA  . LEU B 1 250 ? 124.324 118.087 237.259 1.00 84.87  ? 251 LEU B CA  1 
ATOM   5420  C  C   . LEU B 1 250 ? 124.733 118.752 235.975 1.00 83.82  ? 251 LEU B C   1 
ATOM   5421  O  O   . LEU B 1 250 ? 125.736 118.397 235.392 1.00 83.72  ? 251 LEU B O   1 
ATOM   5422  C  CB  . LEU B 1 250 ? 125.337 118.456 238.320 1.00 84.44  ? 251 LEU B CB  1 
ATOM   5423  C  CG  . LEU B 1 250 ? 125.538 119.959 238.434 1.00 84.10  ? 251 LEU B CG  1 
ATOM   5424  C  CD1 . LEU B 1 250 ? 124.777 120.503 239.608 1.00 83.99  ? 251 LEU B CD1 1 
ATOM   5425  C  CD2 . LEU B 1 250 ? 126.993 120.292 238.545 1.00 83.98  ? 251 LEU B CD2 1 
ATOM   5426  N  N   . VAL B 1 251 ? 123.954 119.729 235.543 1.00 80.94  ? 252 VAL B N   1 
ATOM   5427  C  CA  . VAL B 1 251 ? 124.254 120.459 234.335 1.00 80.07  ? 252 VAL B CA  1 
ATOM   5428  C  C   . VAL B 1 251 ? 124.618 121.898 234.648 1.00 79.63  ? 252 VAL B C   1 
ATOM   5429  O  O   . VAL B 1 251 ? 123.882 122.610 235.348 1.00 79.57  ? 252 VAL B O   1 
ATOM   5430  C  CB  . VAL B 1 251 ? 123.075 120.430 233.382 1.00 79.76  ? 252 VAL B CB  1 
ATOM   5431  C  CG1 . VAL B 1 251 ? 123.479 120.975 232.050 1.00 79.64  ? 252 VAL B CG1 1 
ATOM   5432  C  CG2 . VAL B 1 251 ? 122.586 119.024 233.233 1.00 79.70  ? 252 VAL B CG2 1 
ATOM   5433  N  N   . ALA B 1 252 ? 125.756 122.323 234.108 1.00 70.45  ? 253 ALA B N   1 
ATOM   5434  C  CA  . ALA B 1 252 ? 126.254 123.669 234.338 1.00 70.14  ? 253 ALA B CA  1 
ATOM   5435  C  C   . ALA B 1 252 ? 126.911 124.274 233.115 1.00 70.02  ? 253 ALA B C   1 
ATOM   5436  O  O   . ALA B 1 252 ? 127.720 123.644 232.461 1.00 69.99  ? 253 ALA B O   1 
ATOM   5437  C  CB  . ALA B 1 252 ? 127.212 123.663 235.478 1.00 70.05  ? 253 ALA B CB  1 
ATOM   5438  N  N   . SER B 1 253 ? 126.547 125.506 232.806 1.00 80.74  ? 254 SER B N   1 
ATOM   5439  C  CA  . SER B 1 253 ? 127.227 126.249 231.765 1.00 80.70  ? 254 SER B CA  1 
ATOM   5440  C  C   . SER B 1 253 ? 128.560 126.730 232.291 1.00 80.73  ? 254 SER B C   1 
ATOM   5441  O  O   . SER B 1 253 ? 128.713 126.955 233.479 1.00 80.70  ? 254 SER B O   1 
ATOM   5442  C  CB  . SER B 1 253 ? 126.384 127.420 231.285 1.00 80.68  ? 254 SER B CB  1 
ATOM   5443  O  OG  . SER B 1 253 ? 126.074 128.286 232.347 1.00 80.67  ? 254 SER B OG  1 
ATOM   5444  N  N   . VAL B 1 254 ? 129.524 126.893 231.398 1.00 81.03  ? 255 VAL B N   1 
ATOM   5445  C  CA  . VAL B 1 254 ? 130.886 127.174 231.806 1.00 81.05  ? 255 VAL B CA  1 
ATOM   5446  C  C   . VAL B 1 254 ? 131.433 128.467 231.232 1.00 80.79  ? 255 VAL B C   1 
ATOM   5447  O  O   . VAL B 1 254 ? 131.285 128.745 230.057 1.00 80.78  ? 255 VAL B O   1 
ATOM   5448  C  CB  . VAL B 1 254 ? 131.811 126.030 231.405 1.00 81.29  ? 255 VAL B CB  1 
ATOM   5449  C  CG1 . VAL B 1 254 ? 133.213 126.290 231.876 1.00 81.35  ? 255 VAL B CG1 1 
ATOM   5450  C  CG2 . VAL B 1 254 ? 131.314 124.748 231.986 1.00 81.37  ? 255 VAL B CG2 1 
ATOM   5451  N  N   . GLY B 1 255 ? 132.077 129.247 232.088 1.00 77.10  ? 256 GLY B N   1 
ATOM   5452  C  CA  . GLY B 1 255 ? 132.726 130.479 231.696 1.00 76.85  ? 256 GLY B CA  1 
ATOM   5453  C  C   . GLY B 1 255 ? 134.150 130.491 232.194 1.00 76.62  ? 256 GLY B C   1 
ATOM   5454  O  O   . GLY B 1 255 ? 135.046 130.050 231.499 1.00 76.60  ? 256 GLY B O   1 
ATOM   5455  N  N   . THR B 1 256 ? 134.363 131.011 233.394 1.00 80.93  ? 257 THR B N   1 
ATOM   5456  C  CA  . THR B 1 256 ? 135.650 130.871 234.055 1.00 80.74  ? 257 THR B CA  1 
ATOM   5457  C  C   . THR B 1 256 ? 135.838 129.436 234.473 1.00 80.38  ? 257 THR B C   1 
ATOM   5458  O  O   . THR B 1 256 ? 136.950 128.964 234.641 1.00 80.44  ? 257 THR B O   1 
ATOM   5459  C  CB  . THR B 1 256 ? 135.749 131.721 235.305 1.00 80.86  ? 257 THR B CB  1 
ATOM   5460  O  OG1 . THR B 1 256 ? 134.892 131.176 236.308 1.00 80.90  ? 257 THR B OG1 1 
ATOM   5461  C  CG2 . THR B 1 256 ? 135.350 133.143 235.011 1.00 80.92  ? 257 THR B CG2 1 
ATOM   5462  N  N   . GLY B 1 257 ? 134.729 128.740 234.628 1.00 82.97  ? 258 GLY B N   1 
ATOM   5463  C  CA  . GLY B 1 257 ? 134.756 127.353 235.021 1.00 82.53  ? 258 GLY B CA  1 
ATOM   5464  C  C   . GLY B 1 257 ? 134.729 127.107 236.506 1.00 82.03  ? 258 GLY B C   1 
ATOM   5465  O  O   . GLY B 1 257 ? 134.725 125.968 236.942 1.00 81.99  ? 258 GLY B O   1 
ATOM   5466  N  N   . GLY B 1 258 ? 134.681 128.169 237.290 1.00 73.60  ? 259 GLY B N   1 
ATOM   5467  C  CA  . GLY B 1 258 ? 134.723 128.017 238.727 1.00 73.15  ? 259 GLY B CA  1 
ATOM   5468  C  C   . GLY B 1 258 ? 133.533 127.287 239.301 1.00 72.75  ? 259 GLY B C   1 
ATOM   5469  O  O   . GLY B 1 258 ? 133.674 126.507 240.230 1.00 72.72  ? 259 GLY B O   1 
ATOM   5470  N  N   . THR B 1 259 ? 132.361 127.521 238.732 1.00 73.36  ? 260 THR B N   1 
ATOM   5471  C  CA  . THR B 1 259 ? 131.154 126.899 239.237 1.00 73.08  ? 260 THR B CA  1 
ATOM   5472  C  C   . THR B 1 259 ? 131.180 125.409 239.015 1.00 73.21  ? 260 THR B C   1 
ATOM   5473  O  O   . THR B 1 259 ? 131.028 124.634 239.945 1.00 73.26  ? 260 THR B O   1 
ATOM   5474  C  CB  . THR B 1 259 ? 129.914 127.463 238.555 1.00 72.81  ? 260 THR B CB  1 
ATOM   5475  O  OG1 . THR B 1 259 ? 129.840 128.869 238.795 1.00 72.79  ? 260 THR B OG1 1 
ATOM   5476  C  CG2 . THR B 1 259 ? 128.676 126.813 239.098 1.00 72.65  ? 260 THR B CG2 1 
ATOM   5477  N  N   . ILE B 1 260 ? 131.392 125.002 237.779 1.00 73.65  ? 261 ILE B N   1 
ATOM   5478  C  CA  . ILE B 1 260 ? 131.401 123.587 237.489 1.00 73.86  ? 261 ILE B CA  1 
ATOM   5479  C  C   . ILE B 1 260 ? 132.579 122.890 238.138 1.00 74.39  ? 261 ILE B C   1 
ATOM   5480  O  O   . ILE B 1 260 ? 132.478 121.748 238.524 1.00 74.49  ? 261 ILE B O   1 
ATOM   5481  C  CB  . ILE B 1 260 ? 131.337 123.298 235.982 1.00 73.64  ? 261 ILE B CB  1 
ATOM   5482  C  CG1 . ILE B 1 260 ? 130.930 121.853 235.745 1.00 73.52  ? 261 ILE B CG1 1 
ATOM   5483  C  CG2 . ILE B 1 260 ? 132.646 123.586 235.316 1.00 73.59  ? 261 ILE B CG2 1 
ATOM   5484  C  CD1 . ILE B 1 260 ? 130.696 121.537 234.329 1.00 73.46  ? 261 ILE B CD1 1 
ATOM   5485  N  N   . THR B 1 261 ? 133.687 123.588 238.300 1.00 82.54  ? 262 THR B N   1 
ATOM   5486  C  CA  . THR B 1 261 ? 134.855 122.962 238.890 1.00 83.10  ? 262 THR B CA  1 
ATOM   5487  C  C   . THR B 1 261 ? 134.641 122.710 240.362 1.00 83.49  ? 262 THR B C   1 
ATOM   5488  O  O   . THR B 1 261 ? 134.810 121.598 240.848 1.00 83.54  ? 262 THR B O   1 
ATOM   5489  C  CB  . THR B 1 261 ? 136.083 123.850 238.736 1.00 83.23  ? 262 THR B CB  1 
ATOM   5490  O  OG1 . THR B 1 261 ? 136.418 123.962 237.351 1.00 83.26  ? 262 THR B OG1 1 
ATOM   5491  C  CG2 . THR B 1 261 ? 137.248 123.270 239.482 1.00 83.31  ? 262 THR B CG2 1 
ATOM   5492  N  N   . GLY B 1 262 ? 134.224 123.751 241.062 1.00 77.38  ? 263 GLY B N   1 
ATOM   5493  C  CA  . GLY B 1 262 ? 134.053 123.665 242.492 1.00 77.78  ? 263 GLY B CA  1 
ATOM   5494  C  C   . GLY B 1 262 ? 132.899 122.781 242.874 1.00 78.21  ? 263 GLY B C   1 
ATOM   5495  O  O   . GLY B 1 262 ? 132.945 122.081 243.869 1.00 78.22  ? 263 GLY B O   1 
ATOM   5496  N  N   . ILE B 1 263 ? 131.851 122.804 242.072 1.00 84.96  ? 264 ILE B N   1 
ATOM   5497  C  CA  . ILE B 1 263 ? 130.733 121.939 242.349 1.00 85.41  ? 264 ILE B CA  1 
ATOM   5498  C  C   . ILE B 1 263 ? 131.107 120.504 242.056 1.00 85.69  ? 264 ILE B C   1 
ATOM   5499  O  O   . ILE B 1 263 ? 130.838 119.611 242.850 1.00 85.75  ? 264 ILE B O   1 
ATOM   5500  C  CB  . ILE B 1 263 ? 129.509 122.327 241.534 1.00 85.57  ? 264 ILE B CB  1 
ATOM   5501  C  CG1 . ILE B 1 263 ? 128.946 123.650 242.038 1.00 85.63  ? 264 ILE B CG1 1 
ATOM   5502  C  CG2 . ILE B 1 263 ? 128.449 121.276 241.660 1.00 85.63  ? 264 ILE B CG2 1 
ATOM   5503  C  CD1 . ILE B 1 263 ? 127.722 124.098 241.308 1.00 85.68  ? 264 ILE B CD1 1 
ATOM   5504  N  N   . ALA B 1 264 ? 131.746 120.281 240.921 1.00 75.57  ? 265 ALA B N   1 
ATOM   5505  C  CA  . ALA B 1 264 ? 132.055 118.922 240.526 1.00 75.91  ? 265 ALA B CA  1 
ATOM   5506  C  C   . ALA B 1 264 ? 133.063 118.245 241.418 1.00 76.49  ? 265 ALA B C   1 
ATOM   5507  O  O   . ALA B 1 264 ? 133.012 117.043 241.577 1.00 76.68  ? 265 ALA B O   1 
ATOM   5508  C  CB  . ALA B 1 264 ? 132.506 118.865 239.100 1.00 75.77  ? 265 ALA B CB  1 
ATOM   5509  N  N   . ARG B 1 265 ? 133.988 118.994 241.997 1.00 82.07  ? 266 ARG B N   1 
ATOM   5510  C  CA  . ARG B 1 265 ? 134.967 118.340 242.848 1.00 82.68  ? 266 ARG B CA  1 
ATOM   5511  C  C   . ARG B 1 265 ? 134.306 117.797 244.099 1.00 83.44  ? 266 ARG B C   1 
ATOM   5512  O  O   . ARG B 1 265 ? 134.446 116.619 244.432 1.00 83.57  ? 266 ARG B O   1 
ATOM   5513  C  CB  . ARG B 1 265 ? 136.131 119.272 243.183 1.00 82.58  ? 266 ARG B CB  1 
ATOM   5514  C  CG  . ARG B 1 265 ? 137.158 119.367 242.071 1.00 82.50  ? 266 ARG B CG  1 
ATOM   5515  C  CD  . ARG B 1 265 ? 138.354 120.198 242.445 1.00 82.44  ? 266 ARG B CD  1 
ATOM   5516  N  NE  . ARG B 1 265 ? 139.363 120.167 241.398 1.00 82.46  ? 266 ARG B NE  1 
ATOM   5517  C  CZ  . ARG B 1 265 ? 140.520 120.810 241.455 1.00 82.46  ? 266 ARG B CZ  1 
ATOM   5518  N  NH1 . ARG B 1 265 ? 140.823 121.542 242.509 1.00 82.48  1 266 ARG B NH1 1 
ATOM   5519  N  NH2 . ARG B 1 265 ? 141.373 120.720 240.454 1.00 82.48  ? 266 ARG B NH2 1 
ATOM   5520  N  N   . LYS B 1 266 ? 133.536 118.637 244.770 1.00 85.60  ? 267 LYS B N   1 
ATOM   5521  C  CA  . LYS B 1 266 ? 132.852 118.179 245.962 1.00 86.38  ? 267 LYS B CA  1 
ATOM   5522  C  C   . LYS B 1 266 ? 131.827 117.114 245.643 1.00 87.48  ? 267 LYS B C   1 
ATOM   5523  O  O   . LYS B 1 266 ? 131.618 116.212 246.425 1.00 87.61  ? 267 LYS B O   1 
ATOM   5524  C  CB  . LYS B 1 266 ? 132.205 119.331 246.721 1.00 86.15  ? 267 LYS B CB  1 
ATOM   5525  C  CG  . LYS B 1 266 ? 131.462 118.877 247.950 1.00 85.97  ? 267 LYS B CG  1 
ATOM   5526  C  CD  . LYS B 1 266 ? 131.442 119.920 249.027 1.00 85.82  ? 267 LYS B CD  1 
ATOM   5527  C  CE  . LYS B 1 266 ? 132.785 120.076 249.669 1.00 85.72  ? 267 LYS B CE  1 
ATOM   5528  N  NZ  . LYS B 1 266 ? 132.757 121.134 250.701 1.00 85.68  1 267 LYS B NZ  1 
ATOM   5529  N  N   . LEU B 1 267 ? 131.190 117.205 244.488 1.00 83.65  ? 268 LEU B N   1 
ATOM   5530  C  CA  . LEU B 1 267 ? 130.217 116.188 244.114 1.00 84.79  ? 268 LEU B CA  1 
ATOM   5531  C  C   . LEU B 1 267 ? 130.867 114.853 243.818 1.00 86.34  ? 268 LEU B C   1 
ATOM   5532  O  O   . LEU B 1 267 ? 130.321 113.810 244.131 1.00 86.63  ? 268 LEU B O   1 
ATOM   5533  C  CB  . LEU B 1 267 ? 129.383 116.647 242.924 1.00 84.50  ? 268 LEU B CB  1 
ATOM   5534  C  CG  . LEU B 1 267 ? 127.894 116.817 243.200 1.00 84.25  ? 268 LEU B CG  1 
ATOM   5535  C  CD1 . LEU B 1 267 ? 127.685 117.697 244.405 1.00 84.19  ? 268 LEU B CD1 1 
ATOM   5536  C  CD2 . LEU B 1 267 ? 127.215 117.406 242.002 1.00 84.18  ? 268 LEU B CD2 1 
ATOM   5537  N  N   . LYS B 1 268 ? 132.041 114.891 243.211 1.00 92.25  ? 269 LYS B N   1 
ATOM   5538  C  CA  . LYS B 1 268 ? 132.778 113.675 242.939 1.00 93.72  ? 269 LYS B CA  1 
ATOM   5539  C  C   . LYS B 1 268 ? 133.228 113.057 244.238 1.00 94.78  ? 269 LYS B C   1 
ATOM   5540  O  O   . LYS B 1 268 ? 133.359 111.850 244.338 1.00 94.89  ? 269 LYS B O   1 
ATOM   5541  C  CB  . LYS B 1 268 ? 133.979 113.955 242.042 1.00 94.01  ? 269 LYS B CB  1 
ATOM   5542  C  CG  . LYS B 1 268 ? 133.635 114.181 240.586 1.00 94.24  ? 269 LYS B CG  1 
ATOM   5543  C  CD  . LYS B 1 268 ? 133.229 112.900 239.900 1.00 94.50  ? 269 LYS B CD  1 
ATOM   5544  C  CE  . LYS B 1 268 ? 132.772 113.156 238.479 1.00 94.69  ? 269 LYS B CE  1 
ATOM   5545  N  NZ  . LYS B 1 268 ? 133.861 113.653 237.606 1.00 94.76  1 269 LYS B NZ  1 
ATOM   5546  N  N   . GLU B 1 269 ? 133.469 113.891 245.238 1.00 105.75 ? 270 GLU B N   1 
ATOM   5547  C  CA  . GLU B 1 269 ? 133.878 113.368 246.534 1.00 106.76 ? 270 GLU B CA  1 
ATOM   5548  C  C   . GLU B 1 269 ? 132.726 112.822 247.378 1.00 107.53 ? 270 GLU B C   1 
ATOM   5549  O  O   . GLU B 1 269 ? 132.852 111.768 247.990 1.00 107.61 ? 270 GLU B O   1 
ATOM   5550  C  CB  . GLU B 1 269 ? 134.651 114.427 247.323 1.00 106.94 ? 270 GLU B CB  1 
ATOM   5551  C  CG  . GLU B 1 269 ? 135.974 114.819 246.701 1.00 107.02 ? 270 GLU B CG  1 
ATOM   5552  C  CD  . GLU B 1 269 ? 136.576 116.053 247.327 1.00 107.08 ? 270 GLU B CD  1 
ATOM   5553  O  OE1 . GLU B 1 269 ? 135.975 116.594 248.271 1.00 106.99 ? 270 GLU B OE1 1 
ATOM   5554  O  OE2 . GLU B 1 269 ? 137.651 116.486 246.869 1.00 107.09 1 270 GLU B OE2 1 
ATOM   5555  N  N   . LYS B 1 270 ? 131.609 113.539 247.409 1.00 103.23 ? 271 LYS B N   1 
ATOM   5556  C  CA  . LYS B 1 270 ? 130.508 113.205 248.303 1.00 103.88 ? 271 LYS B CA  1 
ATOM   5557  C  C   . LYS B 1 270 ? 129.318 112.563 247.614 1.00 104.40 ? 271 LYS B C   1 
ATOM   5558  O  O   . LYS B 1 270 ? 128.370 112.162 248.272 1.00 104.44 ? 271 LYS B O   1 
ATOM   5559  C  CB  . LYS B 1 270 ? 130.022 114.441 249.055 1.00 103.98 ? 271 LYS B CB  1 
ATOM   5560  C  CG  . LYS B 1 270 ? 131.073 115.144 249.877 1.00 104.05 ? 271 LYS B CG  1 
ATOM   5561  C  CD  . LYS B 1 270 ? 131.775 114.201 250.816 1.00 104.10 ? 271 LYS B CD  1 
ATOM   5562  C  CE  . LYS B 1 270 ? 132.669 114.952 251.783 1.00 104.14 ? 271 LYS B CE  1 
ATOM   5563  N  NZ  . LYS B 1 270 ? 131.893 115.603 252.871 1.00 104.16 1 271 LYS B NZ  1 
ATOM   5564  N  N   . CYS B 1 271 ? 129.354 112.475 246.293 1.00 100.12 ? 272 CYS B N   1 
ATOM   5565  C  CA  . CYS B 1 271 ? 128.263 111.854 245.553 1.00 100.61 ? 272 CYS B CA  1 
ATOM   5566  C  C   . CYS B 1 271 ? 128.780 111.358 244.213 1.00 101.02 ? 272 CYS B C   1 
ATOM   5567  O  O   . CYS B 1 271 ? 128.420 111.888 243.171 1.00 101.01 ? 272 CYS B O   1 
ATOM   5568  C  CB  . CYS B 1 271 ? 127.137 112.861 245.348 1.00 100.66 ? 272 CYS B CB  1 
ATOM   5569  S  SG  . CYS B 1 271 ? 125.639 112.207 244.611 1.00 100.69 ? 272 CYS B SG  1 
ATOM   5570  N  N   . PRO B 1 272 ? 129.629 110.325 244.246 1.00 109.70 ? 273 PRO B N   1 
ATOM   5571  C  CA  . PRO B 1 272 ? 130.449 109.866 243.126 1.00 109.82 ? 273 PRO B CA  1 
ATOM   5572  C  C   . PRO B 1 272 ? 129.661 109.461 241.896 1.00 109.68 ? 273 PRO B C   1 
ATOM   5573  O  O   . PRO B 1 272 ? 130.160 109.585 240.785 1.00 109.70 ? 273 PRO B O   1 
ATOM   5574  C  CB  . PRO B 1 272 ? 131.200 108.669 243.709 1.00 109.97 ? 273 PRO B CB  1 
ATOM   5575  C  CG  . PRO B 1 272 ? 130.406 108.242 244.849 1.00 109.99 ? 273 PRO B CG  1 
ATOM   5576  C  CD  . PRO B 1 272 ? 129.817 109.473 245.425 1.00 109.90 ? 273 PRO B CD  1 
ATOM   5577  N  N   . GLY B 1 273 ? 128.451 108.968 242.086 1.00 99.66  ? 274 GLY B N   1 
ATOM   5578  C  CA  . GLY B 1 273 ? 127.687 108.476 240.961 1.00 99.34  ? 274 GLY B CA  1 
ATOM   5579  C  C   . GLY B 1 273 ? 127.161 109.581 240.078 1.00 98.87  ? 274 GLY B C   1 
ATOM   5580  O  O   . GLY B 1 273 ? 126.804 109.339 238.936 1.00 98.87  ? 274 GLY B O   1 
ATOM   5581  N  N   . CYS B 1 274 ? 127.131 110.797 240.603 1.00 105.37 ? 275 CYS B N   1 
ATOM   5582  C  CA  . CYS B 1 274 ? 126.609 111.929 239.856 1.00 104.69 ? 275 CYS B CA  1 
ATOM   5583  C  C   . CYS B 1 274 ? 127.440 112.220 238.622 1.00 103.70 ? 275 CYS B C   1 
ATOM   5584  O  O   . CYS B 1 274 ? 128.658 112.248 238.683 1.00 103.66 ? 275 CYS B O   1 
ATOM   5585  C  CB  . CYS B 1 274 ? 126.566 113.166 240.747 1.00 104.84 ? 275 CYS B CB  1 
ATOM   5586  S  SG  . CYS B 1 274 ? 125.854 114.624 239.980 1.00 104.86 ? 275 CYS B SG  1 
ATOM   5587  N  N   . ARG B 1 275 ? 126.761 112.453 237.505 1.00 108.15 ? 276 ARG B N   1 
ATOM   5588  C  CA  . ARG B 1 275 ? 127.422 112.791 236.256 1.00 106.98 ? 276 ARG B CA  1 
ATOM   5589  C  C   . ARG B 1 275 ? 127.495 114.294 236.071 1.00 104.69 ? 276 ARG B C   1 
ATOM   5590  O  O   . ARG B 1 275 ? 126.522 115.002 236.308 1.00 104.53 ? 276 ARG B O   1 
ATOM   5591  C  CB  . ARG B 1 275 ? 126.689 112.181 235.065 1.00 107.96 ? 276 ARG B CB  1 
ATOM   5592  C  CG  . ARG B 1 275 ? 126.778 110.685 234.940 1.00 108.74 ? 276 ARG B CG  1 
ATOM   5593  C  CD  . ARG B 1 275 ? 126.377 110.254 233.544 1.00 109.38 ? 276 ARG B CD  1 
ATOM   5594  N  NE  . ARG B 1 275 ? 127.472 110.408 232.592 1.00 109.88 ? 276 ARG B NE  1 
ATOM   5595  C  CZ  . ARG B 1 275 ? 127.316 110.543 231.281 1.00 110.38 ? 276 ARG B CZ  1 
ATOM   5596  N  NH1 . ARG B 1 275 ? 126.103 110.566 230.750 1.00 110.54 1 276 ARG B NH1 1 
ATOM   5597  N  NH2 . ARG B 1 275 ? 128.378 110.669 230.502 1.00 110.53 ? 276 ARG B NH2 1 
ATOM   5598  N  N   . ILE B 1 276 ? 128.644 114.771 235.616 1.00 88.15  ? 277 ILE B N   1 
ATOM   5599  C  CA  . ILE B 1 276 ? 128.859 116.193 235.439 1.00 85.95  ? 277 ILE B CA  1 
ATOM   5600  C  C   . ILE B 1 276 ? 128.775 116.580 233.977 1.00 83.89  ? 277 ILE B C   1 
ATOM   5601  O  O   . ILE B 1 276 ? 129.574 116.140 233.169 1.00 83.77  ? 277 ILE B O   1 
ATOM   5602  C  CB  . ILE B 1 276 ? 130.220 116.604 235.988 1.00 85.90  ? 277 ILE B CB  1 
ATOM   5603  C  CG1 . ILE B 1 276 ? 130.347 116.185 237.448 1.00 85.87  ? 277 ILE B CG1 1 
ATOM   5604  C  CG2 . ILE B 1 276 ? 130.412 118.091 235.856 1.00 85.88  ? 277 ILE B CG2 1 
ATOM   5605  C  CD1 . ILE B 1 276 ? 129.362 116.853 238.350 1.00 85.86  ? 277 ILE B CD1 1 
ATOM   5606  N  N   . ILE B 1 277 ? 127.801 117.415 233.648 1.00 83.48  ? 278 ILE B N   1 
ATOM   5607  C  CA  . ILE B 1 277 ? 127.576 117.848 232.279 1.00 81.59  ? 278 ILE B CA  1 
ATOM   5608  C  C   . ILE B 1 277 ? 127.887 119.321 232.091 1.00 80.30  ? 278 ILE B C   1 
ATOM   5609  O  O   . ILE B 1 277 ? 127.245 120.178 232.688 1.00 80.17  ? 278 ILE B O   1 
ATOM   5610  C  CB  . ILE B 1 277 ? 126.124 117.640 231.880 1.00 81.22  ? 278 ILE B CB  1 
ATOM   5611  C  CG1 . ILE B 1 277 ? 125.692 116.202 232.146 1.00 81.04  ? 278 ILE B CG1 1 
ATOM   5612  C  CG2 . ILE B 1 277 ? 125.924 118.012 230.438 1.00 81.11  ? 278 ILE B CG2 1 
ATOM   5613  C  CD1 . ILE B 1 277 ? 126.476 115.185 231.391 1.00 80.96  ? 278 ILE B CD1 1 
ATOM   5614  N  N   . GLY B 1 278 ? 128.862 119.616 231.243 1.00 70.78  ? 279 GLY B N   1 
ATOM   5615  C  CA  . GLY B 1 278 ? 129.267 120.987 231.006 1.00 69.74  ? 279 GLY B CA  1 
ATOM   5616  C  C   . GLY B 1 278 ? 128.720 121.563 229.723 1.00 68.91  ? 279 GLY B C   1 
ATOM   5617  O  O   . GLY B 1 278 ? 128.602 120.858 228.742 1.00 68.86  ? 279 GLY B O   1 
ATOM   5618  N  N   . VAL B 1 279 ? 128.391 122.848 229.726 1.00 68.00  ? 280 VAL B N   1 
ATOM   5619  C  CA  . VAL B 1 279 ? 127.852 123.480 228.532 1.00 67.56  ? 280 VAL B CA  1 
ATOM   5620  C  C   . VAL B 1 279 ? 128.718 124.608 227.994 1.00 68.46  ? 280 VAL B C   1 
ATOM   5621  O  O   . VAL B 1 279 ? 129.041 125.535 228.708 1.00 68.47  ? 280 VAL B O   1 
ATOM   5622  C  CB  . VAL B 1 279 ? 126.459 124.024 228.784 1.00 66.58  ? 280 VAL B CB  1 
ATOM   5623  C  CG1 . VAL B 1 279 ? 125.891 124.570 227.514 1.00 66.23  ? 280 VAL B CG1 1 
ATOM   5624  C  CG2 . VAL B 1 279 ? 125.571 122.943 229.308 1.00 66.30  ? 280 VAL B CG2 1 
ATOM   5625  N  N   . ASP B 1 280 ? 129.075 124.523 226.720 1.00 87.74  ? 281 ASP B N   1 
ATOM   5626  C  CA  . ASP B 1 280 ? 129.927 125.522 226.087 1.00 88.87  ? 281 ASP B CA  1 
ATOM   5627  C  C   . ASP B 1 280 ? 129.292 126.025 224.800 1.00 89.86  ? 281 ASP B C   1 
ATOM   5628  O  O   . ASP B 1 280 ? 128.838 125.240 223.988 1.00 89.95  ? 281 ASP B O   1 
ATOM   5629  C  CB  . ASP B 1 280 ? 131.289 124.905 225.786 1.00 88.99  ? 281 ASP B CB  1 
ATOM   5630  C  CG  . ASP B 1 280 ? 132.323 125.924 225.367 1.00 89.10  ? 281 ASP B CG  1 
ATOM   5631  O  OD1 . ASP B 1 280 ? 133.050 125.664 224.390 1.00 89.15  ? 281 ASP B OD1 1 
ATOM   5632  O  OD2 . ASP B 1 280 ? 132.433 126.971 226.021 1.00 89.16  1 281 ASP B OD2 1 
ATOM   5633  N  N   . PRO B 1 281 ? 129.225 127.345 224.627 1.00 79.60  ? 282 PRO B N   1 
ATOM   5634  C  CA  . PRO B 1 281 ? 128.697 127.967 223.416 1.00 80.37  ? 282 PRO B CA  1 
ATOM   5635  C  C   . PRO B 1 281 ? 129.529 127.691 222.174 1.00 81.28  ? 282 PRO B C   1 
ATOM   5636  O  O   . PRO B 1 281 ? 130.738 127.576 222.270 1.00 81.38  ? 282 PRO B O   1 
ATOM   5637  C  CB  . PRO B 1 281 ? 128.736 129.451 223.755 1.00 80.21  ? 282 PRO B CB  1 
ATOM   5638  C  CG  . PRO B 1 281 ? 129.816 129.572 224.706 1.00 80.01  ? 282 PRO B CG  1 
ATOM   5639  C  CD  . PRO B 1 281 ? 129.791 128.345 225.537 1.00 79.79  ? 282 PRO B CD  1 
ATOM   5640  N  N   . GLU B 1 282 ? 128.886 127.596 221.019 1.00 94.12  ? 283 GLU B N   1 
ATOM   5641  C  CA  . GLU B 1 282 ? 129.618 127.484 219.772 1.00 94.90  ? 283 GLU B CA  1 
ATOM   5642  C  C   . GLU B 1 282 ? 130.433 128.743 219.589 1.00 94.92  ? 283 GLU B C   1 
ATOM   5643  O  O   . GLU B 1 282 ? 129.965 129.830 219.858 1.00 94.95  ? 283 GLU B O   1 
ATOM   5644  C  CB  . GLU B 1 282 ? 128.660 127.277 218.599 1.00 95.46  ? 283 GLU B CB  1 
ATOM   5645  C  CG  . GLU B 1 282 ? 128.251 125.827 218.385 1.00 95.81  ? 283 GLU B CG  1 
ATOM   5646  C  CD  . GLU B 1 282 ? 127.015 125.655 217.509 1.00 96.03  ? 283 GLU B CD  1 
ATOM   5647  O  OE1 . GLU B 1 282 ? 126.352 124.602 217.608 1.00 96.10  ? 283 GLU B OE1 1 
ATOM   5648  O  OE2 . GLU B 1 282 ? 126.701 126.566 216.724 1.00 96.08  1 283 GLU B OE2 1 
ATOM   5649  N  N   . GLY B 1 283 ? 131.659 128.586 219.125 1.00 70.46  ? 284 GLY B N   1 
ATOM   5650  C  CA  . GLY B 1 283 ? 132.590 129.691 219.021 1.00 70.41  ? 284 GLY B CA  1 
ATOM   5651  C  C   . GLY B 1 283 ? 133.600 129.723 220.149 1.00 70.28  ? 284 GLY B C   1 
ATOM   5652  O  O   . GLY B 1 283 ? 134.620 130.388 220.062 1.00 70.25  ? 284 GLY B O   1 
ATOM   5653  N  N   . SER B 1 284 ? 133.311 128.987 221.211 1.00 93.24  ? 285 SER B N   1 
ATOM   5654  C  CA  . SER B 1 284 ? 134.217 128.862 222.340 1.00 93.12  ? 285 SER B CA  1 
ATOM   5655  C  C   . SER B 1 284 ? 135.074 127.630 222.189 1.00 92.99  ? 285 SER B C   1 
ATOM   5656  O  O   . SER B 1 284 ? 134.739 126.736 221.431 1.00 92.98  ? 285 SER B O   1 
ATOM   5657  C  CB  . SER B 1 284 ? 133.428 128.771 223.636 1.00 93.12  ? 285 SER B CB  1 
ATOM   5658  O  OG  . SER B 1 284 ? 134.276 128.473 224.722 1.00 93.12  ? 285 SER B OG  1 
ATOM   5659  N  N   . ILE B 1 285 ? 136.182 127.582 222.913 1.00 86.45  ? 286 ILE B N   1 
ATOM   5660  C  CA  . ILE B 1 285 ? 137.088 126.448 222.838 1.00 86.37  ? 286 ILE B CA  1 
ATOM   5661  C  C   . ILE B 1 285 ? 137.179 125.626 224.113 1.00 86.72  ? 286 ILE B C   1 
ATOM   5662  O  O   . ILE B 1 285 ? 138.037 124.768 224.224 1.00 86.73  ? 286 ILE B O   1 
ATOM   5663  C  CB  . ILE B 1 285 ? 138.505 126.883 222.471 1.00 86.03  ? 286 ILE B CB  1 
ATOM   5664  C  CG1 . ILE B 1 285 ? 139.042 127.837 223.525 1.00 85.84  ? 286 ILE B CG1 1 
ATOM   5665  C  CG2 . ILE B 1 285 ? 138.525 127.543 221.120 1.00 85.96  ? 286 ILE B CG2 1 
ATOM   5666  C  CD1 . ILE B 1 285 ? 140.511 127.742 223.734 1.00 85.73  ? 286 ILE B CD1 1 
ATOM   5667  N  N   . LEU B 1 286 ? 136.319 125.893 225.082 1.00 83.22  ? 287 LEU B N   1 
ATOM   5668  C  CA  . LEU B 1 286 ? 136.404 125.195 226.355 1.00 83.65  ? 287 LEU B CA  1 
ATOM   5669  C  C   . LEU B 1 286 ? 136.087 123.721 226.262 1.00 84.50  ? 287 LEU B C   1 
ATOM   5670  O  O   . LEU B 1 286 ? 136.611 122.927 227.022 1.00 84.55  ? 287 LEU B O   1 
ATOM   5671  C  CB  . LEU B 1 286 ? 135.473 125.820 227.377 1.00 83.38  ? 287 LEU B CB  1 
ATOM   5672  C  CG  . LEU B 1 286 ? 135.755 127.255 227.778 1.00 83.18  ? 287 LEU B CG  1 
ATOM   5673  C  CD1 . LEU B 1 286 ? 134.771 127.678 228.819 1.00 83.11  ? 287 LEU B CD1 1 
ATOM   5674  C  CD2 . LEU B 1 286 ? 137.147 127.378 228.301 1.00 83.13  ? 287 LEU B CD2 1 
ATOM   5675  N  N   . ALA B 1 287 ? 135.229 123.354 225.328 1.00 76.40  ? 288 ALA B N   1 
ATOM   5676  C  CA  . ALA B 1 287 ? 134.692 122.004 225.284 1.00 77.46  ? 288 ALA B CA  1 
ATOM   5677  C  C   . ALA B 1 287 ? 135.691 120.935 224.881 1.00 78.91  ? 288 ALA B C   1 
ATOM   5678  O  O   . ALA B 1 287 ? 136.608 121.185 224.119 1.00 79.03  ? 288 ALA B O   1 
ATOM   5679  C  CB  . ALA B 1 287 ? 133.499 121.956 224.381 1.00 77.25  ? 288 ALA B CB  1 
ATOM   5680  N  N   . GLU B 1 288 ? 135.489 119.734 225.402 1.00 92.11  ? 289 GLU B N   1 
ATOM   5681  C  CA  . GLU B 1 288 ? 136.288 118.586 225.023 1.00 93.78  ? 289 GLU B CA  1 
ATOM   5682  C  C   . GLU B 1 288 ? 135.370 117.464 224.589 1.00 95.48  ? 289 GLU B C   1 
ATOM   5683  O  O   . GLU B 1 288 ? 134.286 117.308 225.131 1.00 95.53  ? 289 GLU B O   1 
ATOM   5684  C  CB  . GLU B 1 288 ? 137.102 118.103 226.213 1.00 93.59  ? 289 GLU B CB  1 
ATOM   5685  C  CG  . GLU B 1 288 ? 138.172 119.050 226.675 1.00 93.50  ? 289 GLU B CG  1 
ATOM   5686  C  CD  . GLU B 1 288 ? 139.128 118.406 227.649 1.00 93.45  ? 289 GLU B CD  1 
ATOM   5687  O  OE1 . GLU B 1 288 ? 138.670 117.644 228.518 1.00 93.43  ? 289 GLU B OE1 1 
ATOM   5688  O  OE2 . GLU B 1 288 ? 140.342 118.653 227.536 1.00 93.43  1 289 GLU B OE2 1 
ATOM   5689  N  N   . PRO B 1 289 ? 135.805 116.657 223.620 1.00 101.50 ? 290 PRO B N   1 
ATOM   5690  C  CA  . PRO B 1 289 ? 137.043 116.679 222.841 1.00 102.74 ? 290 PRO B CA  1 
ATOM   5691  C  C   . PRO B 1 289 ? 137.105 117.829 221.855 1.00 104.28 ? 290 PRO B C   1 
ATOM   5692  O  O   . PRO B 1 289 ? 136.085 118.407 221.519 1.00 104.38 ? 290 PRO B O   1 
ATOM   5693  C  CB  . PRO B 1 289 ? 136.984 115.367 222.078 1.00 102.63 ? 290 PRO B CB  1 
ATOM   5694  C  CG  . PRO B 1 289 ? 135.564 115.125 221.909 1.00 102.34 ? 290 PRO B CG  1 
ATOM   5695  C  CD  . PRO B 1 289 ? 134.938 115.555 223.188 1.00 101.95 ? 290 PRO B CD  1 
ATOM   5696  N  N   . GLU B 1 290 ? 138.306 118.138 221.390 1.00 121.83 ? 291 GLU B N   1 
ATOM   5697  C  CA  . GLU B 1 290 ? 138.552 119.325 220.591 1.00 123.17 ? 291 GLU B CA  1 
ATOM   5698  C  C   . GLU B 1 290 ? 137.700 119.327 219.337 1.00 123.10 ? 291 GLU B C   1 
ATOM   5699  O  O   . GLU B 1 290 ? 137.391 120.377 218.795 1.00 123.17 ? 291 GLU B O   1 
ATOM   5700  C  CB  . GLU B 1 290 ? 140.040 119.405 220.229 1.00 124.07 ? 291 GLU B CB  1 
ATOM   5701  C  CG  . GLU B 1 290 ? 140.448 120.633 219.432 1.00 124.68 ? 291 GLU B CG  1 
ATOM   5702  C  CD  . GLU B 1 290 ? 140.367 121.914 220.234 1.00 124.93 ? 291 GLU B CD  1 
ATOM   5703  O  OE1 . GLU B 1 290 ? 140.647 121.877 221.449 1.00 125.07 ? 291 GLU B OE1 1 
ATOM   5704  O  OE2 . GLU B 1 290 ? 140.024 122.962 219.650 1.00 125.08 1 291 GLU B OE2 1 
ATOM   5705  N  N   . GLU B 1 291 ? 137.301 118.147 218.893 1.00 116.15 ? 292 GLU B N   1 
ATOM   5706  C  CA  . GLU B 1 291 ? 136.528 118.022 217.672 1.00 115.85 ? 292 GLU B CA  1 
ATOM   5707  C  C   . GLU B 1 291 ? 135.214 118.786 217.751 1.00 114.68 ? 292 GLU B C   1 
ATOM   5708  O  O   . GLU B 1 291 ? 134.692 119.237 216.740 1.00 114.61 ? 292 GLU B O   1 
ATOM   5709  C  CB  . GLU B 1 291 ? 136.247 116.547 217.369 1.00 116.45 ? 292 GLU B CB  1 
ATOM   5710  C  CG  . GLU B 1 291 ? 137.433 115.753 216.848 1.00 116.82 ? 292 GLU B CG  1 
ATOM   5711  C  CD  . GLU B 1 291 ? 138.314 115.170 217.940 1.00 116.98 ? 292 GLU B CD  1 
ATOM   5712  O  OE1 . GLU B 1 291 ? 137.785 114.547 218.880 1.00 117.04 ? 292 GLU B OE1 1 
ATOM   5713  O  OE2 . GLU B 1 291 ? 139.547 115.326 217.850 1.00 117.05 1 292 GLU B OE2 1 
ATOM   5714  N  N   . LEU B 1 292 ? 134.677 118.921 218.956 1.00 87.99  ? 293 LEU B N   1 
ATOM   5715  C  CA  . LEU B 1 292 ? 133.433 119.649 219.159 1.00 86.97  ? 293 LEU B CA  1 
ATOM   5716  C  C   . LEU B 1 292 ? 133.578 121.138 218.915 1.00 87.99  ? 293 LEU B C   1 
ATOM   5717  O  O   . LEU B 1 292 ? 132.614 121.814 218.584 1.00 87.88  ? 293 LEU B O   1 
ATOM   5718  C  CB  . LEU B 1 292 ? 132.915 119.423 220.570 1.00 85.42  ? 293 LEU B CB  1 
ATOM   5719  C  CG  . LEU B 1 292 ? 132.262 118.079 220.835 1.00 84.19  ? 293 LEU B CG  1 
ATOM   5720  C  CD1 . LEU B 1 292 ? 132.042 117.887 222.307 1.00 83.75  ? 293 LEU B CD1 1 
ATOM   5721  C  CD2 . LEU B 1 292 ? 130.965 118.020 220.104 1.00 83.76  ? 293 LEU B CD2 1 
ATOM   5722  N  N   . ASN B 1 293 ? 134.789 121.645 219.089 1.00 100.22 ? 294 ASN B N   1 
ATOM   5723  C  CA  . ASN B 1 293 ? 135.040 123.075 219.004 1.00 101.57 ? 294 ASN B CA  1 
ATOM   5724  C  C   . ASN B 1 293 ? 135.190 123.601 217.590 1.00 104.12 ? 294 ASN B C   1 
ATOM   5725  O  O   . ASN B 1 293 ? 135.246 124.801 217.379 1.00 104.35 ? 294 ASN B O   1 
ATOM   5726  C  CB  . ASN B 1 293 ? 136.277 123.446 219.814 1.00 100.80 ? 294 ASN B CB  1 
ATOM   5727  C  CG  . ASN B 1 293 ? 136.115 123.158 221.276 1.00 100.19 ? 294 ASN B CG  1 
ATOM   5728  O  OD1 . ASN B 1 293 ? 135.009 123.172 221.793 1.00 99.95  ? 294 ASN B OD1 1 
ATOM   5729  N  ND2 . ASN B 1 293 ? 137.217 122.892 221.956 1.00 99.89  ? 294 ASN B ND2 1 
ATOM   5730  N  N   . GLN B 1 294 ? 135.263 122.709 216.620 1.00 127.29 ? 295 GLN B N   1 
ATOM   5731  C  CA  . GLN B 1 294 ? 135.457 123.129 215.244 1.00 130.07 ? 295 GLN B CA  1 
ATOM   5732  C  C   . GLN B 1 294 ? 134.227 123.853 214.737 1.00 132.56 ? 295 GLN B C   1 
ATOM   5733  O  O   . GLN B 1 294 ? 133.158 123.266 214.653 1.00 132.75 ? 295 GLN B O   1 
ATOM   5734  C  CB  . GLN B 1 294 ? 135.741 121.912 214.371 1.00 130.32 ? 295 GLN B CB  1 
ATOM   5735  C  CG  . GLN B 1 294 ? 136.912 121.079 214.852 1.00 130.47 ? 295 GLN B CG  1 
ATOM   5736  C  CD  . GLN B 1 294 ? 138.240 121.794 214.699 1.00 130.67 ? 295 GLN B CD  1 
ATOM   5737  O  OE1 . GLN B 1 294 ? 138.380 122.690 213.868 1.00 130.71 ? 295 GLN B OE1 1 
ATOM   5738  N  NE2 . GLN B 1 294 ? 139.223 121.402 215.504 1.00 130.79 ? 295 GLN B NE2 1 
ATOM   5739  N  N   . THR B 1 295 ? 134.385 125.120 214.371 1.00 109.00 ? 296 THR B N   1 
ATOM   5740  C  CA  . THR B 1 295 ? 133.234 125.951 214.030 1.00 111.47 ? 296 THR B CA  1 
ATOM   5741  C  C   . THR B 1 295 ? 133.575 127.090 213.088 1.00 113.77 ? 296 THR B C   1 
ATOM   5742  O  O   . THR B 1 295 ? 134.722 127.513 213.005 1.00 114.00 ? 296 THR B O   1 
ATOM   5743  C  CB  . THR B 1 295 ? 132.611 126.568 215.278 1.00 111.53 ? 296 THR B CB  1 
ATOM   5744  O  OG1 . THR B 1 295 ? 131.502 127.393 214.900 1.00 111.58 ? 296 THR B OG1 1 
ATOM   5745  C  CG2 . THR B 1 295 ? 133.639 127.416 216.002 1.00 111.43 ? 296 THR B CG2 1 
ATOM   5746  N  N   . GLN B 1 297 ? 131.634 130.184 213.338 1.00 140.64 ? 298 GLN B N   1 
ATOM   5747  C  CA  . GLN B 1 297 ? 131.384 131.354 214.168 1.00 138.93 ? 298 GLN B CA  1 
ATOM   5748  C  C   . GLN B 1 297 ? 132.448 131.502 215.248 1.00 135.15 ? 298 GLN B C   1 
ATOM   5749  O  O   . GLN B 1 297 ? 133.009 130.513 215.705 1.00 134.79 ? 298 GLN B O   1 
ATOM   5750  C  CB  . GLN B 1 297 ? 130.003 131.251 214.803 1.00 140.40 ? 298 GLN B CB  1 
ATOM   5751  C  CG  . GLN B 1 297 ? 128.884 131.114 213.790 1.00 141.44 ? 298 GLN B CG  1 
ATOM   5752  C  CD  . GLN B 1 297 ? 127.517 131.127 214.431 1.00 142.08 ? 298 GLN B CD  1 
ATOM   5753  O  OE1 . GLN B 1 297 ? 127.322 130.564 215.509 1.00 142.22 ? 298 GLN B OE1 1 
ATOM   5754  N  NE2 . GLN B 1 297 ? 126.560 131.780 213.776 1.00 142.54 ? 298 GLN B NE2 1 
ATOM   5755  N  N   . THR B 1 298 ? 132.735 132.737 215.643 1.00 110.82 ? 299 THR B N   1 
ATOM   5756  C  CA  . THR B 1 298 ? 133.668 132.972 216.742 1.00 107.34 ? 299 THR B CA  1 
ATOM   5757  C  C   . THR B 1 298 ? 133.080 133.842 217.847 1.00 103.98 ? 299 THR B C   1 
ATOM   5758  O  O   . THR B 1 298 ? 133.449 133.701 219.004 1.00 103.71 ? 299 THR B O   1 
ATOM   5759  C  CB  . THR B 1 298 ? 135.003 133.558 216.265 1.00 107.28 ? 299 THR B CB  1 
ATOM   5760  O  OG1 . THR B 1 298 ? 135.857 133.767 217.392 1.00 107.27 ? 299 THR B OG1 1 
ATOM   5761  C  CG2 . THR B 1 298 ? 134.795 134.873 215.553 1.00 107.28 ? 299 THR B CG2 1 
ATOM   5762  N  N   . THR B 1 299 ? 132.177 134.748 217.490 1.00 102.14 ? 300 THR B N   1 
ATOM   5763  C  CA  . THR B 1 299 ? 131.433 135.510 218.486 1.00 99.10  ? 300 THR B CA  1 
ATOM   5764  C  C   . THR B 1 299 ? 129.983 135.081 218.521 1.00 96.49  ? 300 THR B C   1 
ATOM   5765  O  O   . THR B 1 299 ? 129.454 134.570 217.545 1.00 96.29  ? 300 THR B O   1 
ATOM   5766  C  CB  . THR B 1 299 ? 131.481 137.011 218.241 1.00 98.88  ? 300 THR B CB  1 
ATOM   5767  O  OG1 . THR B 1 299 ? 131.035 137.290 216.913 1.00 98.84  ? 300 THR B OG1 1 
ATOM   5768  C  CG2 . THR B 1 299 ? 132.883 137.536 218.429 1.00 98.85  ? 300 THR B CG2 1 
ATOM   5769  N  N   . TYR B 1 300 ? 129.343 135.311 219.657 1.00 90.39  ? 301 TYR B N   1 
ATOM   5770  C  CA  . TYR B 1 300 ? 127.983 134.868 219.884 1.00 88.21  ? 301 TYR B CA  1 
ATOM   5771  C  C   . TYR B 1 300 ? 127.303 135.825 220.834 1.00 87.16  ? 301 TYR B C   1 
ATOM   5772  O  O   . TYR B 1 300 ? 127.957 136.467 221.636 1.00 86.97  ? 301 TYR B O   1 
ATOM   5773  C  CB  . TYR B 1 300 ? 127.992 133.463 220.470 1.00 87.42  ? 301 TYR B CB  1 
ATOM   5774  C  CG  . TYR B 1 300 ? 129.035 133.265 221.532 1.00 86.70  ? 301 TYR B CG  1 
ATOM   5775  C  CD1 . TYR B 1 300 ? 128.769 133.570 222.845 1.00 86.30  ? 301 TYR B CD1 1 
ATOM   5776  C  CD2 . TYR B 1 300 ? 130.288 132.781 221.218 1.00 86.28  ? 301 TYR B CD2 1 
ATOM   5777  C  CE1 . TYR B 1 300 ? 129.716 133.399 223.817 1.00 86.00  ? 301 TYR B CE1 1 
ATOM   5778  C  CE2 . TYR B 1 300 ? 131.240 132.610 222.186 1.00 86.01  ? 301 TYR B CE2 1 
ATOM   5779  C  CZ  . TYR B 1 300 ? 130.948 132.920 223.485 1.00 85.90  ? 301 TYR B CZ  1 
ATOM   5780  O  OH  . TYR B 1 300 ? 131.887 132.754 224.468 1.00 85.69  ? 301 TYR B OH  1 
ATOM   5781  N  N   . GLU B 1 301 ? 125.990 135.942 220.720 1.00 90.45  ? 302 GLU B N   1 
ATOM   5782  C  CA  . GLU B 1 301 ? 125.239 136.920 221.500 1.00 89.57  ? 302 GLU B CA  1 
ATOM   5783  C  C   . GLU B 1 301 ? 125.103 136.619 222.987 1.00 88.59  ? 302 GLU B C   1 
ATOM   5784  O  O   . GLU B 1 301 ? 124.893 137.523 223.781 1.00 88.45  ? 302 GLU B O   1 
ATOM   5785  C  CB  . GLU B 1 301 ? 123.863 137.153 220.885 1.00 89.67  ? 302 GLU B CB  1 
ATOM   5786  C  CG  . GLU B 1 301 ? 123.890 137.698 219.475 1.00 89.77  ? 302 GLU B CG  1 
ATOM   5787  C  CD  . GLU B 1 301 ? 124.372 139.123 219.400 1.00 89.82  ? 302 GLU B CD  1 
ATOM   5788  O  OE1 . GLU B 1 301 ? 124.403 139.793 220.444 1.00 89.82  ? 302 GLU B OE1 1 
ATOM   5789  O  OE2 . GLU B 1 301 ? 124.721 139.576 218.295 1.00 89.83  1 302 GLU B OE2 1 
ATOM   5790  N  N   . VAL B 1 302 ? 125.199 135.352 223.361 1.00 78.95  ? 303 VAL B N   1 
ATOM   5791  C  CA  . VAL B 1 302 ? 125.032 134.972 224.756 1.00 78.06  ? 303 VAL B CA  1 
ATOM   5792  C  C   . VAL B 1 302 ? 126.157 135.508 225.613 1.00 77.29  ? 303 VAL B C   1 
ATOM   5793  O  O   . VAL B 1 302 ? 127.312 135.422 225.245 1.00 77.25  ? 303 VAL B O   1 
ATOM   5794  C  CB  . VAL B 1 302 ? 124.923 133.453 224.909 1.00 77.98  ? 303 VAL B CB  1 
ATOM   5795  C  CG1 . VAL B 1 302 ? 124.980 133.056 226.349 1.00 77.93  ? 303 VAL B CG1 1 
ATOM   5796  C  CG2 . VAL B 1 302 ? 123.636 132.968 224.304 1.00 77.99  ? 303 VAL B CG2 1 
ATOM   5797  N  N   . GLU B 1 303 ? 125.806 136.058 226.766 1.00 84.66  ? 304 GLU B N   1 
ATOM   5798  C  CA  . GLU B 1 303 ? 126.777 136.670 227.648 1.00 83.91  ? 304 GLU B CA  1 
ATOM   5799  C  C   . GLU B 1 303 ? 127.118 135.792 228.835 1.00 83.20  ? 304 GLU B C   1 
ATOM   5800  O  O   . GLU B 1 303 ? 126.263 135.120 229.380 1.00 83.16  ? 304 GLU B O   1 
ATOM   5801  C  CB  . GLU B 1 303 ? 126.253 138.011 228.145 1.00 83.88  ? 304 GLU B CB  1 
ATOM   5802  C  CG  . GLU B 1 303 ? 125.977 139.005 227.043 1.00 83.86  ? 304 GLU B CG  1 
ATOM   5803  C  CD  . GLU B 1 303 ? 125.382 140.304 227.533 1.00 83.80  ? 304 GLU B CD  1 
ATOM   5804  O  OE1 . GLU B 1 303 ? 124.422 140.783 226.907 1.00 83.75  ? 304 GLU B OE1 1 
ATOM   5805  O  OE2 . GLU B 1 303 ? 125.876 140.853 228.530 1.00 83.77  1 304 GLU B OE2 1 
ATOM   5806  N  N   . GLY B 1 304 ? 128.378 135.815 229.239 1.00 82.92  ? 305 GLY B N   1 
ATOM   5807  C  CA  . GLY B 1 304 ? 128.797 135.186 230.475 1.00 82.26  ? 305 GLY B CA  1 
ATOM   5808  C  C   . GLY B 1 304 ? 129.398 133.801 230.415 1.00 81.68  ? 305 GLY B C   1 
ATOM   5809  O  O   . GLY B 1 304 ? 129.974 133.345 231.389 1.00 81.62  ? 305 GLY B O   1 
ATOM   5810  N  N   . ILE B 1 305 ? 129.288 133.132 229.278 1.00 77.70  ? 306 ILE B N   1 
ATOM   5811  C  CA  . ILE B 1 305 ? 129.907 131.828 229.125 1.00 77.23  ? 306 ILE B CA  1 
ATOM   5812  C  C   . ILE B 1 305 ? 130.770 131.748 227.881 1.00 77.13  ? 306 ILE B C   1 
ATOM   5813  O  O   . ILE B 1 305 ? 130.558 132.470 226.922 1.00 77.14  ? 306 ILE B O   1 
ATOM   5814  C  CB  . ILE B 1 305 ? 128.881 130.694 229.089 1.00 76.97  ? 306 ILE B CB  1 
ATOM   5815  C  CG1 . ILE B 1 305 ? 127.864 130.918 227.985 1.00 76.84  ? 306 ILE B CG1 1 
ATOM   5816  C  CG2 . ILE B 1 305 ? 128.183 130.570 230.395 1.00 76.91  ? 306 ILE B CG2 1 
ATOM   5817  C  CD1 . ILE B 1 305 ? 126.992 129.722 227.742 1.00 76.78  ? 306 ILE B CD1 1 
ATOM   5818  N  N   . GLY B 1 306 ? 131.765 130.877 227.919 1.00 68.52  ? 307 GLY B N   1 
ATOM   5819  C  CA  . GLY B 1 306 ? 132.630 130.645 226.781 1.00 68.58  ? 307 GLY B CA  1 
ATOM   5820  C  C   . GLY B 1 306 ? 133.827 131.560 226.738 1.00 68.74  ? 307 GLY B C   1 
ATOM   5821  O  O   . GLY B 1 306 ? 133.730 132.714 227.111 1.00 68.70  ? 307 GLY B O   1 
ATOM   5822  N  N   . TYR B 1 307 ? 134.952 131.042 226.261 1.00 72.79  ? 308 TYR B N   1 
ATOM   5823  C  CA  . TYR B 1 307 ? 136.187 131.812 226.168 1.00 73.06  ? 308 TYR B CA  1 
ATOM   5824  C  C   . TYR B 1 307 ? 137.125 131.303 225.081 1.00 73.57  ? 308 TYR B C   1 
ATOM   5825  O  O   . TYR B 1 307 ? 137.028 130.167 224.652 1.00 73.60  ? 308 TYR B O   1 
ATOM   5826  C  CB  . TYR B 1 307 ? 136.926 131.816 227.503 1.00 72.92  ? 308 TYR B CB  1 
ATOM   5827  C  CG  . TYR B 1 307 ? 136.455 132.864 228.480 1.00 72.78  ? 308 TYR B CG  1 
ATOM   5828  C  CD1 . TYR B 1 307 ? 135.909 132.511 229.692 1.00 72.72  ? 308 TYR B CD1 1 
ATOM   5829  C  CD2 . TYR B 1 307 ? 136.561 134.204 228.189 1.00 72.72  ? 308 TYR B CD2 1 
ATOM   5830  C  CE1 . TYR B 1 307 ? 135.485 133.456 230.576 1.00 72.67  ? 308 TYR B CE1 1 
ATOM   5831  C  CE2 . TYR B 1 307 ? 136.136 135.151 229.070 1.00 72.67  ? 308 TYR B CE2 1 
ATOM   5832  C  CZ  . TYR B 1 307 ? 135.601 134.772 230.259 1.00 72.66  ? 308 TYR B CZ  1 
ATOM   5833  O  OH  . TYR B 1 307 ? 135.178 135.722 231.144 1.00 72.63  ? 308 TYR B OH  1 
ATOM   5834  N  N   . ASP B 1 308 ? 138.033 132.165 224.642 1.00 89.19  ? 309 ASP B N   1 
ATOM   5835  C  CA  . ASP B 1 308 ? 139.015 131.812 223.629 1.00 89.66  ? 309 ASP B CA  1 
ATOM   5836  C  C   . ASP B 1 308 ? 140.314 131.340 224.252 1.00 89.96  ? 309 ASP B C   1 
ATOM   5837  O  O   . ASP B 1 308 ? 141.340 131.270 223.594 1.00 90.00  ? 309 ASP B O   1 
ATOM   5838  C  CB  . ASP B 1 308 ? 139.270 132.974 222.668 1.00 89.78  ? 309 ASP B CB  1 
ATOM   5839  C  CG  . ASP B 1 308 ? 139.769 134.210 223.362 1.00 89.83  ? 309 ASP B CG  1 
ATOM   5840  O  OD1 . ASP B 1 308 ? 139.426 134.399 224.535 1.00 89.86  ? 309 ASP B OD1 1 
ATOM   5841  O  OD2 . ASP B 1 308 ? 140.496 135.000 222.730 1.00 89.88  1 309 ASP B OD2 1 
ATOM   5842  N  N   . PHE B 1 309 ? 140.262 131.031 225.536 1.00 80.64  ? 310 PHE B N   1 
ATOM   5843  C  CA  . PHE B 1 309 ? 141.403 130.488 226.238 1.00 80.90  ? 310 PHE B CA  1 
ATOM   5844  C  C   . PHE B 1 309 ? 140.871 129.670 227.380 1.00 81.18  ? 310 PHE B C   1 
ATOM   5845  O  O   . PHE B 1 309 ? 139.736 129.838 227.771 1.00 81.21  ? 310 PHE B O   1 
ATOM   5846  C  CB  . PHE B 1 309 ? 142.272 131.606 226.782 1.00 80.87  ? 310 PHE B CB  1 
ATOM   5847  C  CG  . PHE B 1 309 ? 141.620 132.395 227.857 1.00 80.80  ? 310 PHE B CG  1 
ATOM   5848  C  CD1 . PHE B 1 309 ? 141.872 132.124 229.176 1.00 80.78  ? 310 PHE B CD1 1 
ATOM   5849  C  CD2 . PHE B 1 309 ? 140.746 133.405 227.550 1.00 80.75  ? 310 PHE B CD2 1 
ATOM   5850  C  CE1 . PHE B 1 309 ? 141.264 132.841 230.154 1.00 80.74  ? 310 PHE B CE1 1 
ATOM   5851  C  CE2 . PHE B 1 309 ? 140.140 134.122 228.530 1.00 80.72  ? 310 PHE B CE2 1 
ATOM   5852  C  CZ  . PHE B 1 309 ? 140.398 133.841 229.830 1.00 80.72  ? 310 PHE B CZ  1 
ATOM   5853  N  N   . ILE B 1 310 ? 141.691 128.784 227.922 1.00 83.22  ? 311 ILE B N   1 
ATOM   5854  C  CA  . ILE B 1 310 ? 141.260 127.960 229.032 1.00 83.47  ? 311 ILE B CA  1 
ATOM   5855  C  C   . ILE B 1 310 ? 141.726 128.572 230.333 1.00 83.41  ? 311 ILE B C   1 
ATOM   5856  O  O   . ILE B 1 310 ? 142.913 128.631 230.590 1.00 83.56  ? 311 ILE B O   1 
ATOM   5857  C  CB  . ILE B 1 310 ? 141.874 126.574 228.933 1.00 83.67  ? 311 ILE B CB  1 
ATOM   5858  C  CG1 . ILE B 1 310 ? 141.727 126.027 227.516 1.00 83.78  ? 311 ILE B CG1 1 
ATOM   5859  C  CG2 . ILE B 1 310 ? 141.258 125.653 229.956 1.00 83.73  ? 311 ILE B CG2 1 
ATOM   5860  C  CD1 . ILE B 1 310 ? 140.309 125.833 227.067 1.00 83.83  ? 311 ILE B CD1 1 
ATOM   5861  N  N   . PRO B 1 311 ? 140.785 129.011 231.174 1.00 83.73  ? 312 PRO B N   1 
ATOM   5862  C  CA  . PRO B 1 311 ? 141.099 129.650 232.447 1.00 83.53  ? 312 PRO B CA  1 
ATOM   5863  C  C   . PRO B 1 311 ? 141.788 128.692 233.388 1.00 83.17  ? 312 PRO B C   1 
ATOM   5864  O  O   . PRO B 1 311 ? 141.496 127.507 233.363 1.00 83.16  ? 312 PRO B O   1 
ATOM   5865  C  CB  . PRO B 1 311 ? 139.728 130.020 232.998 1.00 83.64  ? 312 PRO B CB  1 
ATOM   5866  C  CG  . PRO B 1 311 ? 138.838 130.002 231.852 1.00 83.71  ? 312 PRO B CG  1 
ATOM   5867  C  CD  . PRO B 1 311 ? 139.336 128.931 230.968 1.00 83.75  ? 312 PRO B CD  1 
ATOM   5868  N  N   . THR B 1 312 ? 142.685 129.209 234.213 1.00 78.85  ? 313 THR B N   1 
ATOM   5869  C  CA  . THR B 1 312 ? 143.450 128.385 235.129 1.00 78.50  ? 313 THR B CA  1 
ATOM   5870  C  C   . THR B 1 312 ? 142.564 127.659 236.130 1.00 78.21  ? 313 THR B C   1 
ATOM   5871  O  O   . THR B 1 312 ? 142.811 126.516 236.472 1.00 78.27  ? 313 THR B O   1 
ATOM   5872  C  CB  . THR B 1 312 ? 144.444 129.254 235.898 1.00 78.49  ? 313 THR B CB  1 
ATOM   5873  O  OG1 . THR B 1 312 ? 145.315 129.909 234.978 1.00 78.47  ? 313 THR B OG1 1 
ATOM   5874  C  CG2 . THR B 1 312 ? 145.267 128.426 236.825 1.00 78.54  ? 313 THR B CG2 1 
ATOM   5875  N  N   . VAL B 1 313 ? 141.512 128.319 236.581 1.00 73.88  ? 314 VAL B N   1 
ATOM   5876  C  CA  . VAL B 1 313 ? 140.650 127.744 237.595 1.00 73.68  ? 314 VAL B CA  1 
ATOM   5877  C  C   . VAL B 1 313 ? 139.813 126.592 237.077 1.00 74.15  ? 314 VAL B C   1 
ATOM   5878  O  O   . VAL B 1 313 ? 139.360 125.758 237.843 1.00 74.13  ? 314 VAL B O   1 
ATOM   5879  C  CB  . VAL B 1 313 ? 139.750 128.798 238.222 1.00 73.19  ? 314 VAL B CB  1 
ATOM   5880  C  CG1 . VAL B 1 313 ? 140.574 129.771 239.011 1.00 73.00  ? 314 VAL B CG1 1 
ATOM   5881  C  CG2 . VAL B 1 313 ? 138.969 129.517 237.158 1.00 73.08  ? 314 VAL B CG2 1 
ATOM   5882  N  N   . LEU B 1 314 ? 139.583 126.564 235.775 1.00 82.62  ? 315 LEU B N   1 
ATOM   5883  C  CA  . LEU B 1 314 ? 138.819 125.488 235.170 1.00 83.28  ? 315 LEU B CA  1 
ATOM   5884  C  C   . LEU B 1 314 ? 139.550 124.165 235.250 1.00 84.53  ? 315 LEU B C   1 
ATOM   5885  O  O   . LEU B 1 314 ? 140.729 124.091 234.951 1.00 84.60  ? 315 LEU B O   1 
ATOM   5886  C  CB  . LEU B 1 314 ? 138.499 125.821 233.717 1.00 82.89  ? 315 LEU B CB  1 
ATOM   5887  C  CG  . LEU B 1 314 ? 137.812 124.752 232.871 1.00 82.59  ? 315 LEU B CG  1 
ATOM   5888  C  CD1 . LEU B 1 314 ? 136.521 124.290 233.494 1.00 82.50  ? 315 LEU B CD1 1 
ATOM   5889  C  CD2 . LEU B 1 314 ? 137.554 125.287 231.497 1.00 82.50  ? 315 LEU B CD2 1 
ATOM   5890  N  N   . ASP B 1 315 ? 138.828 123.114 235.616 1.00 80.37  ? 316 ASP B N   1 
ATOM   5891  C  CA  . ASP B 1 315 ? 139.374 121.768 235.646 1.00 81.88  ? 316 ASP B CA  1 
ATOM   5892  C  C   . ASP B 1 315 ? 138.531 120.879 234.769 1.00 83.83  ? 316 ASP B C   1 
ATOM   5893  O  O   . ASP B 1 315 ? 137.471 120.439 235.160 1.00 83.96  ? 316 ASP B O   1 
ATOM   5894  C  CB  . ASP B 1 315 ? 139.395 121.223 237.070 1.00 81.63  ? 316 ASP B CB  1 
ATOM   5895  C  CG  . ASP B 1 315 ? 139.918 119.806 237.146 1.00 81.54  ? 316 ASP B CG  1 
ATOM   5896  O  OD1 . ASP B 1 315 ? 140.015 119.271 238.263 1.00 81.49  ? 316 ASP B OD1 1 
ATOM   5897  O  OD2 . ASP B 1 315 ? 140.226 119.224 236.094 1.00 81.54  1 316 ASP B OD2 1 
ATOM   5898  N  N   . ARG B 1 316 ? 139.017 120.613 233.571 1.00 101.32 ? 317 ARG B N   1 
ATOM   5899  C  CA  . ARG B 1 316 ? 138.233 119.896 232.586 1.00 103.20 ? 317 ARG B CA  1 
ATOM   5900  C  C   . ARG B 1 316 ? 138.208 118.405 232.843 1.00 103.28 ? 317 ARG B C   1 
ATOM   5901  O  O   . ARG B 1 316 ? 137.442 117.680 232.228 1.00 103.33 ? 317 ARG B O   1 
ATOM   5902  C  CB  . ARG B 1 316 ? 138.770 120.185 231.191 1.00 104.78 ? 317 ARG B CB  1 
ATOM   5903  C  CG  . ARG B 1 316 ? 138.838 121.653 230.883 1.00 106.03 ? 317 ARG B CG  1 
ATOM   5904  C  CD  . ARG B 1 316 ? 139.902 121.956 229.866 1.00 107.19 ? 317 ARG B CD  1 
ATOM   5905  N  NE  . ARG B 1 316 ? 139.373 121.954 228.514 1.00 108.11 ? 317 ARG B NE  1 
ATOM   5906  C  CZ  . ARG B 1 316 ? 140.127 122.003 227.427 1.00 109.05 ? 317 ARG B CZ  1 
ATOM   5907  N  NH1 . ARG B 1 316 ? 141.441 122.048 227.542 1.00 109.33 1 317 ARG B NH1 1 
ATOM   5908  N  NH2 . ARG B 1 316 ? 139.570 121.998 226.229 1.00 109.32 ? 317 ARG B NH2 1 
ATOM   5909  N  N   . THR B 1 317 ? 139.067 117.942 233.736 1.00 94.60  ? 318 THR B N   1 
ATOM   5910  C  CA  . THR B 1 317 ? 139.117 116.529 234.050 1.00 94.54  ? 318 THR B CA  1 
ATOM   5911  C  C   . THR B 1 317 ? 137.866 116.048 234.747 1.00 94.15  ? 318 THR B C   1 
ATOM   5912  O  O   . THR B 1 317 ? 137.469 114.906 234.591 1.00 94.15  ? 318 THR B O   1 
ATOM   5913  C  CB  . THR B 1 317 ? 140.328 116.192 234.914 1.00 94.74  ? 318 THR B CB  1 
ATOM   5914  O  OG1 . THR B 1 317 ? 140.161 116.761 236.212 1.00 94.71  ? 318 THR B OG1 1 
ATOM   5915  C  CG2 . THR B 1 317 ? 141.580 116.752 234.294 1.00 94.85  ? 318 THR B CG2 1 
ATOM   5916  N  N   . VAL B 1 318 ? 137.243 116.919 235.521 1.00 90.74  ? 319 VAL B N   1 
ATOM   5917  C  CA  . VAL B 1 318 ? 136.088 116.513 236.296 1.00 90.30  ? 319 VAL B CA  1 
ATOM   5918  C  C   . VAL B 1 318 ? 134.798 116.632 235.525 1.00 89.76  ? 319 VAL B C   1 
ATOM   5919  O  O   . VAL B 1 318 ? 133.747 116.255 236.011 1.00 89.72  ? 319 VAL B O   1 
ATOM   5920  C  CB  . VAL B 1 318 ? 135.974 117.280 237.607 1.00 90.36  ? 319 VAL B CB  1 
ATOM   5921  C  CG1 . VAL B 1 318 ? 137.149 116.964 238.493 1.00 90.38  ? 319 VAL B CG1 1 
ATOM   5922  C  CG2 . VAL B 1 318 ? 135.906 118.742 237.342 1.00 90.39  ? 319 VAL B CG2 1 
ATOM   5923  N  N   . VAL B 1 319 ? 134.876 117.163 234.320 1.00 84.78  ? 320 VAL B N   1 
ATOM   5924  C  CA  . VAL B 1 319 ? 133.707 117.232 233.467 1.00 84.34  ? 320 VAL B CA  1 
ATOM   5925  C  C   . VAL B 1 319 ? 133.530 115.932 232.711 1.00 84.42  ? 320 VAL B C   1 
ATOM   5926  O  O   . VAL B 1 319 ? 134.301 115.617 231.818 1.00 84.41  ? 320 VAL B O   1 
ATOM   5927  C  CB  . VAL B 1 319 ? 133.828 118.362 232.461 1.00 83.92  ? 320 VAL B CB  1 
ATOM   5928  C  CG1 . VAL B 1 319 ? 132.642 118.365 231.539 1.00 83.77  ? 320 VAL B CG1 1 
ATOM   5929  C  CG2 . VAL B 1 319 ? 133.938 119.674 233.177 1.00 83.80  ? 320 VAL B CG2 1 
ATOM   5930  N  N   . ASP B 1 320 ? 132.519 115.165 233.089 1.00 97.05  ? 321 ASP B N   1 
ATOM   5931  C  CA  . ASP B 1 320 ? 132.281 113.869 232.479 1.00 97.18  ? 321 ASP B CA  1 
ATOM   5932  C  C   . ASP B 1 320 ? 131.889 113.938 231.008 1.00 97.22  ? 321 ASP B C   1 
ATOM   5933  O  O   . ASP B 1 320 ? 132.286 113.088 230.227 1.00 97.23  ? 321 ASP B O   1 
ATOM   5934  C  CB  . ASP B 1 320 ? 131.234 113.102 233.278 1.00 97.23  ? 321 ASP B CB  1 
ATOM   5935  C  CG  . ASP B 1 320 ? 131.672 112.830 234.698 1.00 97.26  ? 321 ASP B CG  1 
ATOM   5936  O  OD1 . ASP B 1 320 ? 132.861 112.539 234.913 1.00 97.28  ? 321 ASP B OD1 1 
ATOM   5937  O  OD2 . ASP B 1 320 ? 130.827 112.906 235.607 1.00 97.29  1 321 ASP B OD2 1 
ATOM   5938  N  N   . LYS B 1 321 ? 131.137 114.964 230.626 1.00 99.04  ? 322 LYS B N   1 
ATOM   5939  C  CA  . LYS B 1 321 ? 130.740 115.144 229.232 1.00 99.02  ? 322 LYS B CA  1 
ATOM   5940  C  C   . LYS B 1 321 ? 130.417 116.595 228.918 1.00 98.02  ? 322 LYS B C   1 
ATOM   5941  O  O   . LYS B 1 321 ? 129.890 117.308 229.759 1.00 97.93  ? 322 LYS B O   1 
ATOM   5942  C  CB  . LYS B 1 321 ? 129.536 114.270 228.892 1.00 99.82  ? 322 LYS B CB  1 
ATOM   5943  C  CG  . LYS B 1 321 ? 129.148 114.292 227.425 1.00 100.52 ? 322 LYS B CG  1 
ATOM   5944  C  CD  . LYS B 1 321 ? 128.025 113.322 227.114 1.00 101.10 ? 322 LYS B CD  1 
ATOM   5945  C  CE  . LYS B 1 321 ? 127.719 113.273 225.631 1.00 101.51 ? 322 LYS B CE  1 
ATOM   5946  N  NZ  . LYS B 1 321 ? 126.615 112.327 225.321 1.00 101.72 1 322 LYS B NZ  1 
ATOM   5947  N  N   . TRP B 1 322 ? 130.740 117.025 227.702 1.00 88.00  ? 323 TRP B N   1 
ATOM   5948  C  CA  . TRP B 1 322 ? 130.462 118.381 227.254 1.00 86.99  ? 323 TRP B CA  1 
ATOM   5949  C  C   . TRP B 1 322 ? 129.341 118.417 226.230 1.00 86.03  ? 323 TRP B C   1 
ATOM   5950  O  O   . TRP B 1 322 ? 129.136 117.468 225.496 1.00 85.98  ? 323 TRP B O   1 
ATOM   5951  C  CB  . TRP B 1 322 ? 131.703 119.007 226.626 1.00 86.95  ? 323 TRP B CB  1 
ATOM   5952  C  CG  . TRP B 1 322 ? 132.790 119.364 227.571 1.00 86.92  ? 323 TRP B CG  1 
ATOM   5953  C  CD1 . TRP B 1 322 ? 133.809 118.573 227.971 1.00 86.88  ? 323 TRP B CD1 1 
ATOM   5954  C  CD2 . TRP B 1 322 ? 132.985 120.622 228.213 1.00 86.83  ? 323 TRP B CD2 1 
ATOM   5955  N  NE1 . TRP B 1 322 ? 134.620 119.246 228.837 1.00 86.85  ? 323 TRP B NE1 1 
ATOM   5956  C  CE2 . TRP B 1 322 ? 134.134 120.512 229.001 1.00 86.82  ? 323 TRP B CE2 1 
ATOM   5957  C  CE3 . TRP B 1 322 ? 132.291 121.829 228.203 1.00 86.79  ? 323 TRP B CE3 1 
ATOM   5958  C  CZ2 . TRP B 1 322 ? 134.606 121.558 229.770 1.00 86.77  ? 323 TRP B CZ2 1 
ATOM   5959  C  CZ3 . TRP B 1 322 ? 132.764 122.865 228.964 1.00 86.74  ? 323 TRP B CZ3 1 
ATOM   5960  C  CH2 . TRP B 1 322 ? 133.906 122.725 229.737 1.00 86.74  ? 323 TRP B CH2 1 
ATOM   5961  N  N   . PHE B 1 323 ? 128.631 119.533 226.177 1.00 83.55  ? 324 PHE B N   1 
ATOM   5962  C  CA  . PHE B 1 323 ? 127.649 119.773 225.139 1.00 82.67  ? 324 PHE B CA  1 
ATOM   5963  C  C   . PHE B 1 323 ? 127.810 121.183 224.615 1.00 82.00  ? 324 PHE B C   1 
ATOM   5964  O  O   . PHE B 1 323 ? 128.058 122.112 225.374 1.00 81.90  ? 324 PHE B O   1 
ATOM   5965  C  CB  . PHE B 1 323 ? 126.244 119.635 225.691 1.00 82.56  ? 324 PHE B CB  1 
ATOM   5966  C  CG  . PHE B 1 323 ? 125.744 118.228 225.777 1.00 82.48  ? 324 PHE B CG  1 
ATOM   5967  C  CD1 . PHE B 1 323 ? 124.954 117.703 224.785 1.00 82.44  ? 324 PHE B CD1 1 
ATOM   5968  C  CD2 . PHE B 1 323 ? 126.024 117.453 226.870 1.00 82.43  ? 324 PHE B CD2 1 
ATOM   5969  C  CE1 . PHE B 1 323 ? 124.484 116.431 224.873 1.00 82.41  ? 324 PHE B CE1 1 
ATOM   5970  C  CE2 . PHE B 1 323 ? 125.555 116.185 226.959 1.00 82.40  ? 324 PHE B CE2 1 
ATOM   5971  C  CZ  . PHE B 1 323 ? 124.785 115.671 225.961 1.00 82.39  ? 324 PHE B CZ  1 
ATOM   5972  N  N   . LYS B 1 324 ? 127.672 121.338 223.307 1.00 77.74  ? 325 LYS B N   1 
ATOM   5973  C  CA  . LYS B 1 324 ? 127.722 122.647 222.687 1.00 77.23  ? 325 LYS B CA  1 
ATOM   5974  C  C   . LYS B 1 324 ? 126.340 123.251 222.583 1.00 77.64  ? 325 LYS B C   1 
ATOM   5975  O  O   . LYS B 1 324 ? 125.373 122.557 222.321 1.00 77.64  ? 325 LYS B O   1 
ATOM   5976  C  CB  . LYS B 1 324 ? 128.366 122.560 221.308 1.00 76.59  ? 325 LYS B CB  1 
ATOM   5977  C  CG  . LYS B 1 324 ? 129.874 122.484 221.331 1.00 76.08  ? 325 LYS B CG  1 
ATOM   5978  C  CD  . LYS B 1 324 ? 130.475 123.831 221.611 1.00 75.69  ? 325 LYS B CD  1 
ATOM   5979  C  CE  . LYS B 1 324 ? 131.973 123.776 221.648 1.00 75.42  ? 325 LYS B CE  1 
ATOM   5980  N  NZ  . LYS B 1 324 ? 132.576 125.119 221.771 1.00 75.24  1 325 LYS B NZ  1 
ATOM   5981  N  N   . SER B 1 325 ? 126.253 124.556 222.776 1.00 86.45  ? 326 SER B N   1 
ATOM   5982  C  CA  . SER B 1 325 ? 124.978 125.240 222.660 1.00 86.97  ? 326 SER B CA  1 
ATOM   5983  C  C   . SER B 1 325 ? 125.116 126.446 221.757 1.00 87.61  ? 326 SER B C   1 
ATOM   5984  O  O   . SER B 1 325 ? 126.208 126.950 221.557 1.00 87.63  ? 326 SER B O   1 
ATOM   5985  C  CB  . SER B 1 325 ? 124.474 125.678 224.025 1.00 86.91  ? 326 SER B CB  1 
ATOM   5986  O  OG  . SER B 1 325 ? 125.249 126.742 224.527 1.00 86.87  ? 326 SER B OG  1 
ATOM   5987  N  N   . ASN B 1 326 ? 123.997 126.895 221.203 1.00 85.33  ? 327 ASN B N   1 
ATOM   5988  C  CA  . ASN B 1 326 ? 123.984 128.069 220.349 1.00 86.09  ? 327 ASN B CA  1 
ATOM   5989  C  C   . ASN B 1 326 ? 123.029 129.126 220.861 1.00 87.25  ? 327 ASN B C   1 
ATOM   5990  O  O   . ASN B 1 326 ? 122.299 128.895 221.809 1.00 87.31  ? 327 ASN B O   1 
ATOM   5991  C  CB  . ASN B 1 326 ? 123.660 127.700 218.899 1.00 85.86  ? 327 ASN B CB  1 
ATOM   5992  C  CG  . ASN B 1 326 ? 122.302 127.065 218.738 1.00 85.69  ? 327 ASN B CG  1 
ATOM   5993  O  OD1 . ASN B 1 326 ? 121.279 127.707 218.928 1.00 85.77  ? 327 ASN B OD1 1 
ATOM   5994  N  ND2 . ASN B 1 326 ? 122.285 125.804 218.356 1.00 85.60  ? 327 ASN B ND2 1 
ATOM   5995  N  N   . ASP B 1 327 ? 123.047 130.292 220.233 1.00 87.18  ? 328 ASP B N   1 
ATOM   5996  C  CA  . ASP B 1 327 ? 122.234 131.412 220.677 1.00 88.37  ? 328 ASP B CA  1 
ATOM   5997  C  C   . ASP B 1 327 ? 120.736 131.200 220.558 1.00 89.35  ? 328 ASP B C   1 
ATOM   5998  O  O   . ASP B 1 327 ? 119.974 131.598 221.435 1.00 89.35  ? 328 ASP B O   1 
ATOM   5999  C  CB  . ASP B 1 327 ? 122.623 132.670 219.912 1.00 88.51  ? 328 ASP B CB  1 
ATOM   6000  C  CG  . ASP B 1 327 ? 123.983 133.182 220.294 1.00 88.52  ? 328 ASP B CG  1 
ATOM   6001  O  OD1 . ASP B 1 327 ? 124.543 134.000 219.542 1.00 88.55  ? 328 ASP B OD1 1 
ATOM   6002  O  OD2 . ASP B 1 327 ? 124.497 132.766 221.346 1.00 88.52  1 328 ASP B OD2 1 
ATOM   6003  N  N   . GLU B 1 328 ? 120.314 130.552 219.487 1.00 105.43 ? 329 GLU B N   1 
ATOM   6004  C  CA  . GLU B 1 328 ? 118.897 130.384 219.248 1.00 106.26 ? 329 GLU B CA  1 
ATOM   6005  C  C   . GLU B 1 328 ? 118.296 129.517 220.332 1.00 105.67 ? 329 GLU B C   1 
ATOM   6006  O  O   . GLU B 1 328 ? 117.245 129.830 220.890 1.00 105.54 ? 329 GLU B O   1 
ATOM   6007  C  CB  . GLU B 1 328 ? 118.664 129.762 217.873 1.00 107.28 ? 329 GLU B CB  1 
ATOM   6008  C  CG  . GLU B 1 328 ? 117.204 129.549 217.530 1.00 107.93 ? 329 GLU B CG  1 
ATOM   6009  C  CD  . GLU B 1 328 ? 116.977 129.246 216.064 1.00 108.26 ? 329 GLU B CD  1 
ATOM   6010  O  OE1 . GLU B 1 328 ? 115.835 129.422 215.593 1.00 108.39 ? 329 GLU B OE1 1 
ATOM   6011  O  OE2 . GLU B 1 328 ? 117.934 128.831 215.381 1.00 108.34 1 329 GLU B OE2 1 
ATOM   6012  N  N   . GLU B 1 329 ? 119.004 128.449 220.662 1.00 101.11 ? 330 GLU B N   1 
ATOM   6013  C  CA  . GLU B 1 329 ? 118.554 127.533 221.682 1.00 100.29 ? 330 GLU B CA  1 
ATOM   6014  C  C   . GLU B 1 329 ? 118.485 128.270 222.982 1.00 98.36  ? 330 GLU B C   1 
ATOM   6015  O  O   . GLU B 1 329 ? 117.545 128.114 223.746 1.00 98.13  ? 330 GLU B O   1 
ATOM   6016  C  CB  . GLU B 1 329 ? 119.562 126.400 221.847 1.00 101.08 ? 330 GLU B CB  1 
ATOM   6017  C  CG  . GLU B 1 329 ? 119.487 125.292 220.835 1.00 101.62 ? 330 GLU B CG  1 
ATOM   6018  C  CD  . GLU B 1 329 ? 120.498 124.207 221.117 1.00 101.88 ? 330 GLU B CD  1 
ATOM   6019  O  OE1 . GLU B 1 329 ? 121.510 124.502 221.781 1.00 101.97 ? 330 GLU B OE1 1 
ATOM   6020  O  OE2 . GLU B 1 329 ? 120.279 123.059 220.685 1.00 102.00 1 330 GLU B OE2 1 
ATOM   6021  N  N   . ALA B 1 330 ? 119.483 129.102 223.216 1.00 81.04  ? 331 ALA B N   1 
ATOM   6022  C  CA  . ALA B 1 330 ? 119.639 129.718 224.507 1.00 79.08  ? 331 ALA B CA  1 
ATOM   6023  C  C   . ALA B 1 330 ? 118.498 130.655 224.781 1.00 77.30  ? 331 ALA B C   1 
ATOM   6024  O  O   . ALA B 1 330 ? 117.844 130.570 225.809 1.00 77.06  ? 331 ALA B O   1 
ATOM   6025  C  CB  . ALA B 1 330 ? 120.935 130.455 224.564 1.00 79.00  ? 331 ALA B CB  1 
ATOM   6026  N  N   . PHE B 1 331 ? 118.250 131.550 223.845 1.00 74.72  ? 332 PHE B N   1 
ATOM   6027  C  CA  . PHE B 1 331 ? 117.196 132.517 224.043 1.00 73.22  ? 332 PHE B CA  1 
ATOM   6028  C  C   . PHE B 1 331 ? 115.817 131.891 224.011 1.00 72.93  ? 332 PHE B C   1 
ATOM   6029  O  O   . PHE B 1 331 ? 114.929 132.284 224.768 1.00 72.86  ? 332 PHE B O   1 
ATOM   6030  C  CB  . PHE B 1 331 ? 117.339 133.642 223.036 1.00 72.39  ? 332 PHE B CB  1 
ATOM   6031  C  CG  . PHE B 1 331 ? 118.619 134.388 223.174 1.00 71.64  ? 332 PHE B CG  1 
ATOM   6032  C  CD1 . PHE B 1 331 ? 119.200 134.544 224.408 1.00 71.27  ? 332 PHE B CD1 1 
ATOM   6033  C  CD2 . PHE B 1 331 ? 119.251 134.915 222.081 1.00 71.23  ? 332 PHE B CD2 1 
ATOM   6034  C  CE1 . PHE B 1 331 ? 120.373 135.222 224.549 1.00 70.97  ? 332 PHE B CE1 1 
ATOM   6035  C  CE2 . PHE B 1 331 ? 120.429 135.591 222.222 1.00 70.96  ? 332 PHE B CE2 1 
ATOM   6036  C  CZ  . PHE B 1 331 ? 120.988 135.743 223.457 1.00 70.88  ? 332 PHE B CZ  1 
ATOM   6037  N  N   . THR B 1 332 ? 115.656 130.878 223.174 1.00 75.44  ? 333 THR B N   1 
ATOM   6038  C  CA  . THR B 1 332 ? 114.379 130.205 223.084 1.00 75.22  ? 333 THR B CA  1 
ATOM   6039  C  C   . THR B 1 332 ? 114.049 129.592 224.420 1.00 74.99  ? 333 THR B C   1 
ATOM   6040  O  O   . THR B 1 332 ? 112.974 129.795 224.969 1.00 74.97  ? 333 THR B O   1 
ATOM   6041  C  CB  . THR B 1 332 ? 114.438 129.085 222.057 1.00 75.26  ? 333 THR B CB  1 
ATOM   6042  O  OG1 . THR B 1 332 ? 114.717 129.639 220.770 1.00 75.31  ? 333 THR B OG1 1 
ATOM   6043  C  CG2 . THR B 1 332 ? 113.131 128.350 221.996 1.00 75.26  ? 333 THR B CG2 1 
ATOM   6044  N  N   . PHE B 1 333 ? 115.000 128.847 224.951 1.00 75.08  ? 334 PHE B N   1 
ATOM   6045  C  CA  . PHE B 1 333 ? 114.787 128.186 226.213 1.00 74.90  ? 334 PHE B CA  1 
ATOM   6046  C  C   . PHE B 1 333 ? 114.668 129.132 227.380 1.00 74.87  ? 334 PHE B C   1 
ATOM   6047  O  O   . PHE B 1 333 ? 113.923 128.862 228.290 1.00 74.80  ? 334 PHE B O   1 
ATOM   6048  C  CB  . PHE B 1 333 ? 115.862 127.142 226.463 1.00 74.80  ? 334 PHE B CB  1 
ATOM   6049  C  CG  . PHE B 1 333 ? 115.525 125.804 225.912 1.00 74.72  ? 334 PHE B CG  1 
ATOM   6050  C  CD1 . PHE B 1 333 ? 115.760 125.511 224.597 1.00 74.70  ? 334 PHE B CD1 1 
ATOM   6051  C  CD2 . PHE B 1 333 ? 114.957 124.845 226.706 1.00 74.67  ? 334 PHE B CD2 1 
ATOM   6052  C  CE1 . PHE B 1 333 ? 115.444 124.288 224.090 1.00 74.67  ? 334 PHE B CE1 1 
ATOM   6053  C  CE2 . PHE B 1 333 ? 114.640 123.620 226.200 1.00 74.65  ? 334 PHE B CE2 1 
ATOM   6054  C  CZ  . PHE B 1 333 ? 114.884 123.341 224.894 1.00 74.66  ? 334 PHE B CZ  1 
ATOM   6055  N  N   . ALA B 1 334 ? 115.372 130.250 227.357 1.00 71.10  ? 335 ALA B N   1 
ATOM   6056  C  CA  . ALA B 1 334 ? 115.249 131.182 228.464 1.00 71.14  ? 335 ALA B CA  1 
ATOM   6057  C  C   . ALA B 1 334 ? 113.855 131.751 228.486 1.00 71.26  ? 335 ALA B C   1 
ATOM   6058  O  O   . ALA B 1 334 ? 113.213 131.836 229.533 1.00 71.21  ? 335 ALA B O   1 
ATOM   6059  C  CB  . ALA B 1 334 ? 116.258 132.285 228.339 1.00 71.11  ? 335 ALA B CB  1 
ATOM   6060  N  N   . ARG B 1 335 ? 113.367 132.106 227.307 1.00 78.43  ? 336 ARG B N   1 
ATOM   6061  C  CA  . ARG B 1 335 ? 112.026 132.642 227.208 1.00 78.58  ? 336 ARG B CA  1 
ATOM   6062  C  C   . ARG B 1 335 ? 111.015 131.602 227.618 1.00 78.38  ? 336 ARG B C   1 
ATOM   6063  O  O   . ARG B 1 335 ? 109.989 131.916 228.198 1.00 78.35  ? 336 ARG B O   1 
ATOM   6064  C  CB  . ARG B 1 335 ? 111.749 133.110 225.792 1.00 78.86  ? 336 ARG B CB  1 
ATOM   6065  C  CG  . ARG B 1 335 ? 112.473 134.365 225.417 1.00 79.13  ? 336 ARG B CG  1 
ATOM   6066  C  CD  . ARG B 1 335 ? 112.095 134.802 224.036 1.00 79.39  ? 336 ARG B CD  1 
ATOM   6067  N  NE  . ARG B 1 335 ? 112.020 136.248 223.934 1.00 79.63  ? 336 ARG B NE  1 
ATOM   6068  C  CZ  . ARG B 1 335 ? 111.139 136.884 223.180 1.00 79.88  ? 336 ARG B CZ  1 
ATOM   6069  N  NH1 . ARG B 1 335 ? 111.125 138.202 223.140 1.00 80.02  1 336 ARG B NH1 1 
ATOM   6070  N  NH2 . ARG B 1 335 ? 110.268 136.194 222.472 1.00 79.95  ? 336 ARG B NH2 1 
ATOM   6071  N  N   . MET B 1 336 ? 111.318 130.353 227.322 1.00 85.59  ? 337 MET B N   1 
ATOM   6072  C  CA  . MET B 1 336 ? 110.461 129.267 227.745 1.00 85.38  ? 337 MET B CA  1 
ATOM   6073  C  C   . MET B 1 336 ? 110.469 129.122 229.254 1.00 84.48  ? 337 MET B C   1 
ATOM   6074  O  O   . MET B 1 336 ? 109.466 128.781 229.852 1.00 84.48  ? 337 MET B O   1 
ATOM   6075  C  CB  . MET B 1 336 ? 110.917 127.965 227.092 1.00 85.95  ? 337 MET B CB  1 
ATOM   6076  C  CG  . MET B 1 336 ? 109.921 126.842 227.169 1.00 86.34  ? 337 MET B CG  1 
ATOM   6077  S  SD  . MET B 1 336 ? 110.520 125.352 226.393 1.00 86.74  ? 337 MET B SD  1 
ATOM   6078  C  CE  . MET B 1 336 ? 110.990 125.980 224.798 1.00 86.92  ? 337 MET B CE  1 
ATOM   6079  N  N   . LEU B 1 337 ? 111.609 129.402 229.868 1.00 69.94  ? 338 LEU B N   1 
ATOM   6080  C  CA  . LEU B 1 337 ? 111.741 129.274 231.301 1.00 69.05  ? 338 LEU B CA  1 
ATOM   6081  C  C   . LEU B 1 337 ? 110.818 130.287 231.908 1.00 68.56  ? 338 LEU B C   1 
ATOM   6082  O  O   . LEU B 1 337 ? 110.104 130.004 232.861 1.00 68.53  ? 338 LEU B O   1 
ATOM   6083  C  CB  . LEU B 1 337 ? 113.172 129.583 231.736 1.00 68.79  ? 338 LEU B CB  1 
ATOM   6084  C  CG  . LEU B 1 337 ? 114.187 128.519 232.152 1.00 68.62  ? 338 LEU B CG  1 
ATOM   6085  C  CD1 . LEU B 1 337 ? 113.511 127.376 232.827 1.00 68.58  ? 338 LEU B CD1 1 
ATOM   6086  C  CD2 . LEU B 1 337 ? 114.982 128.028 230.991 1.00 68.54  ? 338 LEU B CD2 1 
ATOM   6087  N  N   . ILE B 1 338 ? 110.806 131.472 231.320 1.00 65.24  ? 339 ILE B N   1 
ATOM   6088  C  CA  . ILE B 1 338 ? 109.969 132.522 231.855 1.00 64.88  ? 339 ILE B CA  1 
ATOM   6089  C  C   . ILE B 1 338 ? 108.510 132.205 231.655 1.00 65.87  ? 339 ILE B C   1 
ATOM   6090  O  O   . ILE B 1 338 ? 107.729 132.277 232.584 1.00 65.94  ? 339 ILE B O   1 
ATOM   6091  C  CB  . ILE B 1 338 ? 110.271 133.863 231.203 1.00 63.87  ? 339 ILE B CB  1 
ATOM   6092  C  CG1 . ILE B 1 338 ? 111.721 134.253 231.443 1.00 63.33  ? 339 ILE B CG1 1 
ATOM   6093  C  CG2 . ILE B 1 338 ? 109.390 134.926 231.773 1.00 63.62  ? 339 ILE B CG2 1 
ATOM   6094  C  CD1 . ILE B 1 338 ? 112.129 135.487 230.731 1.00 63.05  ? 339 ILE B CD1 1 
ATOM   6095  N  N   . ALA B 1 339 ? 108.146 131.832 230.441 1.00 75.49  ? 340 ALA B N   1 
ATOM   6096  C  CA  . ALA B 1 339 ? 106.744 131.616 230.110 1.00 76.64  ? 340 ALA B CA  1 
ATOM   6097  C  C   . ALA B 1 339 ? 106.110 130.434 230.808 1.00 77.85  ? 340 ALA B C   1 
ATOM   6098  O  O   . ALA B 1 339 ? 104.934 130.455 231.134 1.00 77.97  ? 340 ALA B O   1 
ATOM   6099  C  CB  . ALA B 1 339 ? 106.578 131.480 228.623 1.00 76.61  ? 340 ALA B CB  1 
ATOM   6100  N  N   . GLN B 1 340 ? 106.901 129.403 231.047 1.00 90.03  ? 341 GLN B N   1 
ATOM   6101  C  CA  . GLN B 1 340 ? 106.360 128.157 231.547 1.00 91.18  ? 341 GLN B CA  1 
ATOM   6102  C  C   . GLN B 1 340 ? 106.599 127.971 233.029 1.00 91.75  ? 341 GLN B C   1 
ATOM   6103  O  O   . GLN B 1 340 ? 105.705 127.572 233.756 1.00 91.82  ? 341 GLN B O   1 
ATOM   6104  C  CB  . GLN B 1 340 ? 106.981 126.987 230.801 1.00 91.59  ? 341 GLN B CB  1 
ATOM   6105  C  CG  . GLN B 1 340 ? 106.925 127.103 229.306 1.00 91.86  ? 341 GLN B CG  1 
ATOM   6106  C  CD  . GLN B 1 340 ? 105.657 126.557 228.726 1.00 92.09  ? 341 GLN B CD  1 
ATOM   6107  O  OE1 . GLN B 1 340 ? 104.708 126.269 229.442 1.00 92.13  ? 341 GLN B OE1 1 
ATOM   6108  N  NE2 . GLN B 1 340 ? 105.633 126.406 227.415 1.00 92.25  ? 341 GLN B NE2 1 
ATOM   6109  N  N   . GLU B 1 341 ? 107.816 128.237 233.476 1.00 92.71  ? 342 GLU B N   1 
ATOM   6110  C  CA  . GLU B 1 341 ? 108.151 127.973 234.860 1.00 93.06  ? 342 GLU B CA  1 
ATOM   6111  C  C   . GLU B 1 341 ? 108.117 129.211 235.728 1.00 92.68  ? 342 GLU B C   1 
ATOM   6112  O  O   . GLU B 1 341 ? 108.145 129.123 236.943 1.00 92.67  ? 342 GLU B O   1 
ATOM   6113  C  CB  . GLU B 1 341 ? 109.505 127.294 234.942 1.00 93.54  ? 342 GLU B CB  1 
ATOM   6114  C  CG  . GLU B 1 341 ? 109.593 126.048 234.101 1.00 93.86  ? 342 GLU B CG  1 
ATOM   6115  C  CD  . GLU B 1 341 ? 108.685 124.948 234.586 1.00 94.05  ? 342 GLU B CD  1 
ATOM   6116  O  OE1 . GLU B 1 341 ? 108.390 124.904 235.790 1.00 94.11  ? 342 GLU B OE1 1 
ATOM   6117  O  OE2 . GLU B 1 341 ? 108.263 124.118 233.765 1.00 94.15  1 342 GLU B OE2 1 
ATOM   6118  N  N   . GLY B 1 342 ? 108.044 130.368 235.097 1.00 83.37  ? 343 GLY B N   1 
ATOM   6119  C  CA  . GLY B 1 342 ? 107.951 131.603 235.833 1.00 82.85  ? 343 GLY B CA  1 
ATOM   6120  C  C   . GLY B 1 342 ? 109.275 132.038 236.401 1.00 82.26  ? 343 GLY B C   1 
ATOM   6121  O  O   . GLY B 1 342 ? 109.339 132.888 237.270 1.00 82.19  ? 343 GLY B O   1 
ATOM   6122  N  N   . LEU B 1 343 ? 110.341 131.434 235.915 1.00 72.63  ? 344 LEU B N   1 
ATOM   6123  C  CA  . LEU B 1 343 ? 111.666 131.754 236.400 1.00 71.98  ? 344 LEU B CA  1 
ATOM   6124  C  C   . LEU B 1 343 ? 112.304 132.854 235.572 1.00 71.26  ? 344 LEU B C   1 
ATOM   6125  O  O   . LEU B 1 343 ? 112.592 132.668 234.407 1.00 71.21  ? 344 LEU B O   1 
ATOM   6126  C  CB  . LEU B 1 343 ? 112.537 130.506 236.377 1.00 72.03  ? 344 LEU B CB  1 
ATOM   6127  C  CG  . LEU B 1 343 ? 112.040 129.302 237.167 1.00 72.07  ? 344 LEU B CG  1 
ATOM   6128  C  CD1 . LEU B 1 343 ? 112.889 128.111 236.875 1.00 72.07  ? 344 LEU B CD1 1 
ATOM   6129  C  CD2 . LEU B 1 343 ? 112.085 129.596 238.623 1.00 72.06  ? 344 LEU B CD2 1 
ATOM   6130  N  N   . LEU B 1 344 ? 112.540 134.001 236.188 1.00 74.88  ? 345 LEU B N   1 
ATOM   6131  C  CA  . LEU B 1 344 ? 113.060 135.154 235.469 1.00 74.26  ? 345 LEU B CA  1 
ATOM   6132  C  C   . LEU B 1 344 ? 114.574 135.143 235.355 1.00 74.26  ? 345 LEU B C   1 
ATOM   6133  O  O   . LEU B 1 344 ? 115.258 135.900 236.023 1.00 74.24  ? 345 LEU B O   1 
ATOM   6134  C  CB  . LEU B 1 344 ? 112.595 136.429 236.148 1.00 73.80  ? 345 LEU B CB  1 
ATOM   6135  C  CG  . LEU B 1 344 ? 111.086 136.592 236.236 1.00 73.42  ? 345 LEU B CG  1 
ATOM   6136  C  CD1 . LEU B 1 344 ? 110.755 137.855 236.980 1.00 73.28  ? 345 LEU B CD1 1 
ATOM   6137  C  CD2 . LEU B 1 344 ? 110.481 136.622 234.866 1.00 73.31  ? 345 LEU B CD2 1 
ATOM   6138  N  N   . CYS B 1 345 ? 115.081 134.290 234.479 1.00 92.43  ? 346 CYS B N   1 
ATOM   6139  C  CA  . CYS B 1 345 ? 116.507 134.036 234.363 1.00 92.42  ? 346 CYS B CA  1 
ATOM   6140  C  C   . CYS B 1 345 ? 117.080 134.481 233.023 1.00 92.30  ? 346 CYS B C   1 
ATOM   6141  O  O   . CYS B 1 345 ? 116.351 134.709 232.078 1.00 92.28  ? 346 CYS B O   1 
ATOM   6142  C  CB  . CYS B 1 345 ? 116.762 132.552 234.557 1.00 92.48  ? 346 CYS B CB  1 
ATOM   6143  S  SG  . CYS B 1 345 ? 115.954 131.530 233.332 1.00 92.51  ? 346 CYS B SG  1 
ATOM   6144  N  N   . GLY B 1 346 ? 118.398 134.579 232.945 1.00 71.30  ? 347 GLY B N   1 
ATOM   6145  C  CA  . GLY B 1 346 ? 119.060 135.062 231.751 1.00 71.24  ? 347 GLY B CA  1 
ATOM   6146  C  C   . GLY B 1 346 ? 119.349 134.004 230.713 1.00 71.25  ? 347 GLY B C   1 
ATOM   6147  O  O   . GLY B 1 346 ? 118.831 132.908 230.784 1.00 71.25  ? 347 GLY B O   1 
ATOM   6148  N  N   . GLY B 1 347 ? 120.185 134.342 229.742 1.00 71.81  ? 348 GLY B N   1 
ATOM   6149  C  CA  . GLY B 1 347 ? 120.435 133.474 228.611 1.00 71.95  ? 348 GLY B CA  1 
ATOM   6150  C  C   . GLY B 1 347 ? 121.270 132.239 228.849 1.00 72.19  ? 348 GLY B C   1 
ATOM   6151  O  O   . GLY B 1 347 ? 121.034 131.203 228.242 1.00 72.19  ? 348 GLY B O   1 
ATOM   6152  N  N   . SER B 1 348 ? 122.251 132.333 229.729 1.00 73.66  ? 349 SER B N   1 
ATOM   6153  C  CA  . SER B 1 348 ? 123.080 131.181 230.016 1.00 73.95  ? 349 SER B CA  1 
ATOM   6154  C  C   . SER B 1 348 ? 122.250 130.098 230.664 1.00 74.29  ? 349 SER B C   1 
ATOM   6155  O  O   . SER B 1 348 ? 122.506 128.911 230.495 1.00 74.35  ? 349 SER B O   1 
ATOM   6156  C  CB  . SER B 1 348 ? 124.242 131.566 230.911 1.00 73.93  ? 349 SER B CB  1 
ATOM   6157  O  OG  . SER B 1 348 ? 123.781 132.147 232.103 1.00 73.90  ? 349 SER B OG  1 
ATOM   6158  N  N   . ALA B 1 349 ? 121.239 130.516 231.405 1.00 77.77  ? 350 ALA B N   1 
ATOM   6159  C  CA  . ALA B 1 349 ? 120.333 129.576 232.024 1.00 78.09  ? 350 ALA B CA  1 
ATOM   6160  C  C   . ALA B 1 349 ? 119.623 128.822 230.933 1.00 78.38  ? 350 ALA B C   1 
ATOM   6161  O  O   . ALA B 1 349 ? 119.391 127.624 231.034 1.00 78.43  ? 350 ALA B O   1 
ATOM   6162  C  CB  . ALA B 1 349 ? 119.342 130.312 232.872 1.00 78.10  ? 350 ALA B CB  1 
ATOM   6163  N  N   . GLY B 1 350 ? 119.319 129.530 229.860 1.00 77.52  ? 351 GLY B N   1 
ATOM   6164  C  CA  . GLY B 1 350 ? 118.636 128.928 228.745 1.00 77.79  ? 351 GLY B CA  1 
ATOM   6165  C  C   . GLY B 1 350 ? 119.532 127.960 228.023 1.00 78.03  ? 351 GLY B C   1 
ATOM   6166  O  O   . GLY B 1 350 ? 119.084 126.917 227.578 1.00 78.07  ? 351 GLY B O   1 
ATOM   6167  N  N   . SER B 1 351 ? 120.808 128.295 227.924 1.00 78.82  ? 352 SER B N   1 
ATOM   6168  C  CA  . SER B 1 351 ? 121.741 127.403 227.275 1.00 79.02  ? 352 SER B CA  1 
ATOM   6169  C  C   . SER B 1 351 ? 121.797 126.129 228.070 1.00 79.18  ? 352 SER B C   1 
ATOM   6170  O  O   . SER B 1 351 ? 121.787 125.024 227.526 1.00 79.21  ? 352 SER B O   1 
ATOM   6171  C  CB  . SER B 1 351 ? 123.123 128.032 227.253 1.00 79.04  ? 352 SER B CB  1 
ATOM   6172  O  OG  . SER B 1 351 ? 123.119 129.249 226.546 1.00 79.07  ? 352 SER B OG  1 
ATOM   6173  N  N   . THR B 1 352 ? 121.782 126.300 229.379 1.00 81.03  ? 353 THR B N   1 
ATOM   6174  C  CA  . THR B 1 352 ? 121.945 125.189 230.287 1.00 81.17  ? 353 THR B CA  1 
ATOM   6175  C  C   . THR B 1 352 ? 120.768 124.237 230.255 1.00 81.18  ? 353 THR B C   1 
ATOM   6176  O  O   . THR B 1 352 ? 120.939 123.034 230.151 1.00 81.21  ? 353 THR B O   1 
ATOM   6177  C  CB  . THR B 1 352 ? 122.134 125.696 231.706 1.00 81.27  ? 353 THR B CB  1 
ATOM   6178  O  OG1 . THR B 1 352 ? 123.193 126.655 231.729 1.00 81.27  ? 353 THR B OG1 1 
ATOM   6179  C  CG2 . THR B 1 352 ? 122.479 124.562 232.627 1.00 81.33  ? 353 THR B CG2 1 
ATOM   6180  N  N   . VAL B 1 353 ? 119.564 124.773 230.348 1.00 83.09  ? 354 VAL B N   1 
ATOM   6181  C  CA  . VAL B 1 353 ? 118.389 123.922 230.299 1.00 83.11  ? 354 VAL B CA  1 
ATOM   6182  C  C   . VAL B 1 353 ? 118.219 123.289 228.932 1.00 83.43  ? 354 VAL B C   1 
ATOM   6183  O  O   . VAL B 1 353 ? 117.809 122.124 228.807 1.00 83.45  ? 354 VAL B O   1 
ATOM   6184  C  CB  . VAL B 1 353 ? 117.143 124.703 230.688 1.00 82.88  ? 354 VAL B CB  1 
ATOM   6185  C  CG1 . VAL B 1 353 ? 115.915 123.881 230.456 1.00 82.81  ? 354 VAL B CG1 1 
ATOM   6186  C  CG2 . VAL B 1 353 ? 117.233 125.102 232.131 1.00 82.79  ? 354 VAL B CG2 1 
ATOM   6187  N  N   . ALA B 1 354 ? 118.599 124.045 227.910 1.00 79.16  ? 355 ALA B N   1 
ATOM   6188  C  CA  . ALA B 1 354 ? 118.495 123.565 226.548 1.00 79.53  ? 355 ALA B CA  1 
ATOM   6189  C  C   . ALA B 1 354 ? 119.362 122.346 226.377 1.00 80.07  ? 355 ALA B C   1 
ATOM   6190  O  O   . ALA B 1 354 ? 119.000 121.417 225.670 1.00 80.15  ? 355 ALA B O   1 
ATOM   6191  C  CB  . ALA B 1 354 ? 118.922 124.630 225.584 1.00 79.44  ? 355 ALA B CB  1 
ATOM   6192  N  N   . VAL B 1 355 ? 120.508 122.334 227.039 1.00 87.78  ? 356 VAL B N   1 
ATOM   6193  C  CA  . VAL B 1 355 ? 121.296 121.115 227.048 1.00 88.32  ? 356 VAL B CA  1 
ATOM   6194  C  C   . VAL B 1 355 ? 120.673 120.045 227.937 1.00 88.77  ? 356 VAL B C   1 
ATOM   6195  O  O   . VAL B 1 355 ? 120.689 118.870 227.604 1.00 88.83  ? 356 VAL B O   1 
ATOM   6196  C  CB  . VAL B 1 355 ? 122.748 121.384 227.444 1.00 88.38  ? 356 VAL B CB  1 
ATOM   6197  C  CG1 . VAL B 1 355 ? 123.443 120.107 227.823 1.00 88.41  ? 356 VAL B CG1 1 
ATOM   6198  C  CG2 . VAL B 1 355 ? 123.471 122.058 226.305 1.00 88.37  ? 356 VAL B CG2 1 
ATOM   6199  N  N   . ALA B 1 356 ? 120.082 120.458 229.047 1.00 86.79  ? 357 ALA B N   1 
ATOM   6200  C  CA  . ALA B 1 356 ? 119.606 119.493 230.026 1.00 87.19  ? 357 ALA B CA  1 
ATOM   6201  C  C   . ALA B 1 356 ? 118.517 118.583 229.501 1.00 87.52  ? 357 ALA B C   1 
ATOM   6202  O  O   . ALA B 1 356 ? 118.487 117.397 229.816 1.00 87.65  ? 357 ALA B O   1 
ATOM   6203  C  CB  . ALA B 1 356 ? 119.128 120.202 231.252 1.00 87.23  ? 357 ALA B CB  1 
ATOM   6204  N  N   . VAL B 1 357 ? 117.640 119.115 228.668 1.00 86.44  ? 358 VAL B N   1 
ATOM   6205  C  CA  . VAL B 1 357 ? 116.577 118.269 228.152 1.00 86.71  ? 358 VAL B CA  1 
ATOM   6206  C  C   . VAL B 1 357 ? 117.107 117.231 227.181 1.00 87.31  ? 358 VAL B C   1 
ATOM   6207  O  O   . VAL B 1 357 ? 116.430 116.270 226.869 1.00 87.41  ? 358 VAL B O   1 
ATOM   6208  C  CB  . VAL B 1 357 ? 115.462 119.066 227.495 1.00 86.46  ? 358 VAL B CB  1 
ATOM   6209  C  CG1 . VAL B 1 357 ? 114.729 119.865 228.528 1.00 86.38  ? 358 VAL B CG1 1 
ATOM   6210  C  CG2 . VAL B 1 357 ? 116.024 119.957 226.443 1.00 86.37  ? 358 VAL B CG2 1 
ATOM   6211  N  N   . LYS B 1 358 ? 118.317 117.442 226.688 1.00 84.29  ? 359 LYS B N   1 
ATOM   6212  C  CA  . LYS B 1 358 ? 118.966 116.464 225.834 1.00 84.97  ? 359 LYS B CA  1 
ATOM   6213  C  C   . LYS B 1 358 ? 119.752 115.464 226.664 1.00 86.26  ? 359 LYS B C   1 
ATOM   6214  O  O   . LYS B 1 358 ? 119.556 114.262 226.561 1.00 86.39  ? 359 LYS B O   1 
ATOM   6215  C  CB  . LYS B 1 358 ? 119.905 117.156 224.849 1.00 84.53  ? 359 LYS B CB  1 
ATOM   6216  C  CG  . LYS B 1 358 ? 119.201 117.926 223.757 1.00 84.19  ? 359 LYS B CG  1 
ATOM   6217  C  CD  . LYS B 1 358 ? 119.969 119.170 223.312 1.00 83.92  ? 359 LYS B CD  1 
ATOM   6218  C  CE  . LYS B 1 358 ? 121.085 118.862 222.339 1.00 83.76  ? 359 LYS B CE  1 
ATOM   6219  N  NZ  . LYS B 1 358 ? 121.605 120.106 221.724 1.00 83.67  1 359 LYS B NZ  1 
ATOM   6220  N  N   . ALA B 1 359 ? 120.645 115.977 227.492 1.00 96.29  ? 360 ALA B N   1 
ATOM   6221  C  CA  . ALA B 1 359 ? 121.564 115.148 228.249 1.00 97.64  ? 360 ALA B CA  1 
ATOM   6222  C  C   . ALA B 1 359 ? 120.883 114.264 229.261 1.00 99.08  ? 360 ALA B C   1 
ATOM   6223  O  O   . ALA B 1 359 ? 121.381 113.202 229.585 1.00 99.17  ? 360 ALA B O   1 
ATOM   6224  C  CB  . ALA B 1 359 ? 122.579 116.009 228.932 1.00 97.61  ? 360 ALA B CB  1 
ATOM   6225  N  N   . ALA B 1 360 ? 119.747 114.702 229.775 1.00 99.40  ? 361 ALA B N   1 
ATOM   6226  C  CA  . ALA B 1 360 ? 119.097 113.945 230.833 1.00 100.94 ? 361 ALA B CA  1 
ATOM   6227  C  C   . ALA B 1 360 ? 118.158 112.872 230.313 1.00 102.57 ? 361 ALA B C   1 
ATOM   6228  O  O   . ALA B 1 360 ? 117.489 112.207 231.090 1.00 102.69 ? 361 ALA B O   1 
ATOM   6229  C  CB  . ALA B 1 360 ? 118.375 114.871 231.783 1.00 100.90 ? 361 ALA B CB  1 
ATOM   6230  N  N   . GLN B 1 361 ? 118.092 112.715 228.998 1.00 99.92  ? 362 GLN B N   1 
ATOM   6231  C  CA  . GLN B 1 361 ? 117.192 111.736 228.402 1.00 101.49 ? 362 GLN B CA  1 
ATOM   6232  C  C   . GLN B 1 361 ? 117.528 110.320 228.841 1.00 102.87 ? 362 GLN B C   1 
ATOM   6233  O  O   . GLN B 1 361 ? 116.652 109.473 228.934 1.00 102.99 ? 362 GLN B O   1 
ATOM   6234  C  CB  . GLN B 1 361 ? 117.237 111.816 226.880 1.00 101.62 ? 362 GLN B CB  1 
ATOM   6235  C  CG  . GLN B 1 361 ? 116.598 113.048 226.291 1.00 101.67 ? 362 GLN B CG  1 
ATOM   6236  C  CD  . GLN B 1 361 ? 115.099 112.944 226.199 1.00 101.79 ? 362 GLN B CD  1 
ATOM   6237  O  OE1 . GLN B 1 361 ? 114.557 111.884 225.919 1.00 101.81 ? 362 GLN B OE1 1 
ATOM   6238  N  NE2 . GLN B 1 361 ? 114.418 114.050 226.434 1.00 101.85 ? 362 GLN B NE2 1 
ATOM   6239  N  N   . GLU B 1 362 ? 118.802 110.066 229.106 1.00 113.77 ? 363 GLU B N   1 
ATOM   6240  C  CA  . GLU B 1 362 ? 119.246 108.748 229.541 1.00 115.04 ? 363 GLU B CA  1 
ATOM   6241  C  C   . GLU B 1 362 ? 118.710 108.404 230.917 1.00 115.81 ? 363 GLU B C   1 
ATOM   6242  O  O   . GLU B 1 362 ? 118.557 107.242 231.265 1.00 115.90 ? 363 GLU B O   1 
ATOM   6243  C  CB  . GLU B 1 362 ? 120.777 108.652 229.528 1.00 115.41 ? 363 GLU B CB  1 
ATOM   6244  C  CG  . GLU B 1 362 ? 121.486 109.546 230.531 1.00 115.63 ? 363 GLU B CG  1 
ATOM   6245  C  CD  . GLU B 1 362 ? 122.982 109.311 230.582 1.00 115.75 ? 363 GLU B CD  1 
ATOM   6246  O  OE1 . GLU B 1 362 ? 123.558 108.916 229.555 1.00 115.80 ? 363 GLU B OE1 1 
ATOM   6247  O  OE2 . GLU B 1 362 ? 123.586 109.521 231.649 1.00 115.81 1 363 GLU B OE2 1 
ATOM   6248  N  N   . LEU B 1 363 ? 118.428 109.435 231.695 1.00 105.63 ? 364 LEU B N   1 
ATOM   6249  C  CA  . LEU B 1 363 ? 117.962 109.267 233.055 1.00 106.34 ? 364 LEU B CA  1 
ATOM   6250  C  C   . LEU B 1 363 ? 116.561 108.703 233.053 1.00 107.38 ? 364 LEU B C   1 
ATOM   6251  O  O   . LEU B 1 363 ? 115.839 108.850 232.080 1.00 107.46 ? 364 LEU B O   1 
ATOM   6252  C  CB  . LEU B 1 363 ? 117.978 110.602 233.778 1.00 106.04 ? 364 LEU B CB  1 
ATOM   6253  C  CG  . LEU B 1 363 ? 119.219 110.962 234.580 1.00 105.78 ? 364 LEU B CG  1 
ATOM   6254  C  CD1 . LEU B 1 363 ? 120.456 110.738 233.780 1.00 105.70 ? 364 LEU B CD1 1 
ATOM   6255  C  CD2 . LEU B 1 363 ? 119.136 112.401 235.000 1.00 105.70 ? 364 LEU B CD2 1 
ATOM   6256  N  N   . GLN B 1 364 ? 116.184 108.030 234.130 1.00 121.26 ? 365 GLN B N   1 
ATOM   6257  C  CA  . GLN B 1 364 ? 114.828 107.523 234.244 1.00 122.07 ? 365 GLN B CA  1 
ATOM   6258  C  C   . GLN B 1 364 ? 114.181 107.891 235.561 1.00 121.81 ? 365 GLN B C   1 
ATOM   6259  O  O   . GLN B 1 364 ? 114.776 108.566 236.382 1.00 121.77 ? 365 GLN B O   1 
ATOM   6260  C  CB  . GLN B 1 364 ? 114.800 106.016 234.035 1.00 122.90 ? 365 GLN B CB  1 
ATOM   6261  C  CG  . GLN B 1 364 ? 115.878 105.272 234.781 1.00 123.47 ? 365 GLN B CG  1 
ATOM   6262  C  CD  . GLN B 1 364 ? 116.067 103.874 234.251 1.00 123.92 ? 365 GLN B CD  1 
ATOM   6263  O  OE1 . GLN B 1 364 ? 115.511 103.513 233.215 1.00 123.98 ? 365 GLN B OE1 1 
ATOM   6264  N  NE2 . GLN B 1 364 ? 116.855 103.074 234.957 1.00 124.16 ? 365 GLN B NE2 1 
ATOM   6265  N  N   . GLU B 1 365 ? 112.954 107.429 235.754 1.00 123.37 ? 366 GLU B N   1 
ATOM   6266  C  CA  . GLU B 1 365 ? 112.129 107.874 236.867 1.00 122.82 ? 366 GLU B CA  1 
ATOM   6267  C  C   . GLU B 1 365 ? 112.742 107.562 238.217 1.00 121.06 ? 366 GLU B C   1 
ATOM   6268  O  O   . GLU B 1 365 ? 113.320 106.505 238.419 1.00 121.00 ? 366 GLU B O   1 
ATOM   6269  C  CB  . GLU B 1 365 ? 110.731 107.264 236.768 1.00 123.70 ? 366 GLU B CB  1 
ATOM   6270  C  CG  . GLU B 1 365 ? 109.972 107.666 235.517 1.00 124.28 ? 366 GLU B CG  1 
ATOM   6271  C  CD  . GLU B 1 365 ? 108.563 107.115 235.472 1.00 124.59 ? 366 GLU B CD  1 
ATOM   6272  O  OE1 . GLU B 1 365 ? 108.237 106.244 236.301 1.00 124.71 ? 366 GLU B OE1 1 
ATOM   6273  O  OE2 . GLU B 1 365 ? 107.780 107.557 234.607 1.00 124.71 1 366 GLU B OE2 1 
ATOM   6274  N  N   . GLY B 1 366 ? 112.606 108.505 239.136 1.00 91.80  ? 367 GLY B N   1 
ATOM   6275  C  CA  . GLY B 1 366 ? 113.152 108.369 240.466 1.00 90.03  ? 367 GLY B CA  1 
ATOM   6276  C  C   . GLY B 1 366 ? 114.516 109.011 240.586 1.00 88.28  ? 367 GLY B C   1 
ATOM   6277  O  O   . GLY B 1 366 ? 115.003 109.262 241.682 1.00 88.15  ? 367 GLY B O   1 
ATOM   6278  N  N   . GLN B 1 367 ? 115.133 109.280 239.445 1.00 95.52  ? 368 GLN B N   1 
ATOM   6279  C  CA  . GLN B 1 367 ? 116.407 109.977 239.407 1.00 93.96  ? 368 GLN B CA  1 
ATOM   6280  C  C   . GLN B 1 367 ? 116.182 111.468 239.254 1.00 92.77  ? 368 GLN B C   1 
ATOM   6281  O  O   . GLN B 1 367 ? 115.096 111.890 238.885 1.00 92.68  ? 368 GLN B O   1 
ATOM   6282  C  CB  . GLN B 1 367 ? 117.261 109.459 238.261 1.00 93.69  ? 368 GLN B CB  1 
ATOM   6283  C  CG  . GLN B 1 367 ? 117.733 108.047 238.448 1.00 93.53  ? 368 GLN B CG  1 
ATOM   6284  C  CD  . GLN B 1 367 ? 118.536 107.551 237.285 1.00 93.37  ? 368 GLN B CD  1 
ATOM   6285  O  OE1 . GLN B 1 367 ? 118.027 107.421 236.180 1.00 93.36  ? 368 GLN B OE1 1 
ATOM   6286  N  NE2 . GLN B 1 367 ? 119.803 107.274 237.523 1.00 93.30  ? 368 GLN B NE2 1 
ATOM   6287  N  N   . ARG B 1 368 ? 117.199 112.269 239.548 1.00 102.25 ? 369 ARG B N   1 
ATOM   6288  C  CA  . ARG B 1 368 ? 117.060 113.714 239.409 1.00 101.08 ? 369 ARG B CA  1 
ATOM   6289  C  C   . ARG B 1 368 ? 118.249 114.417 238.761 1.00 99.35  ? 369 ARG B C   1 
ATOM   6290  O  O   . ARG B 1 368 ? 119.394 114.051 238.967 1.00 99.25  ? 369 ARG B O   1 
ATOM   6291  C  CB  . ARG B 1 368 ? 116.720 114.370 240.748 1.00 101.57 ? 369 ARG B CB  1 
ATOM   6292  C  CG  . ARG B 1 368 ? 117.813 114.335 241.780 1.00 101.98 ? 369 ARG B CG  1 
ATOM   6293  C  CD  . ARG B 1 368 ? 117.556 115.352 242.879 1.00 102.27 ? 369 ARG B CD  1 
ATOM   6294  N  NE  . ARG B 1 368 ? 116.245 115.195 243.494 1.00 102.52 ? 369 ARG B NE  1 
ATOM   6295  C  CZ  . ARG B 1 368 ? 116.053 114.903 244.772 1.00 102.75 ? 369 ARG B CZ  1 
ATOM   6296  N  NH1 . ARG B 1 368 ? 117.085 114.737 245.574 1.00 102.84 1 369 ARG B NH1 1 
ATOM   6297  N  NH2 . ARG B 1 368 ? 114.829 114.777 245.247 1.00 102.84 ? 369 ARG B NH2 1 
ATOM   6298  N  N   . CYS B 1 369 ? 117.948 115.436 237.970 1.00 100.09 ? 370 CYS B N   1 
ATOM   6299  C  CA  . CYS B 1 369 ? 118.960 116.241 237.317 1.00 98.36  ? 370 CYS B CA  1 
ATOM   6300  C  C   . CYS B 1 369 ? 118.854 117.667 237.792 1.00 96.60  ? 370 CYS B C   1 
ATOM   6301  O  O   . CYS B 1 369 ? 117.801 118.271 237.708 1.00 96.44  ? 370 CYS B O   1 
ATOM   6302  C  CB  . CYS B 1 369 ? 118.766 116.207 235.813 1.00 98.41  ? 370 CYS B CB  1 
ATOM   6303  S  SG  . CYS B 1 369 ? 119.832 117.319 234.906 1.00 98.38  ? 370 CYS B SG  1 
ATOM   6304  N  N   . VAL B 1 370 ? 119.953 118.201 238.297 1.00 79.62  ? 371 VAL B N   1 
ATOM   6305  C  CA  . VAL B 1 370 ? 119.998 119.564 238.790 1.00 78.04  ? 371 VAL B CA  1 
ATOM   6306  C  C   . VAL B 1 370 ? 120.629 120.481 237.764 1.00 76.83  ? 371 VAL B C   1 
ATOM   6307  O  O   . VAL B 1 370 ? 121.638 120.148 237.183 1.00 76.75  ? 371 VAL B O   1 
ATOM   6308  C  CB  . VAL B 1 370 ? 120.800 119.632 240.085 1.00 77.78  ? 371 VAL B CB  1 
ATOM   6309  C  CG1 . VAL B 1 370 ? 121.240 121.038 240.371 1.00 77.64  ? 371 VAL B CG1 1 
ATOM   6310  C  CG2 . VAL B 1 370 ? 119.982 119.109 241.219 1.00 77.80  ? 371 VAL B CG2 1 
ATOM   6311  N  N   . VAL B 1 371 ? 120.032 121.644 237.552 1.00 87.58  ? 372 VAL B N   1 
ATOM   6312  C  CA  . VAL B 1 371 ? 120.506 122.576 236.548 1.00 86.49  ? 372 VAL B CA  1 
ATOM   6313  C  C   . VAL B 1 371 ? 120.854 123.908 237.173 1.00 85.41  ? 372 VAL B C   1 
ATOM   6314  O  O   . VAL B 1 371 ? 120.124 124.393 238.018 1.00 85.33  ? 372 VAL B O   1 
ATOM   6315  C  CB  . VAL B 1 371 ? 119.423 122.788 235.501 1.00 86.49  ? 372 VAL B CB  1 
ATOM   6316  C  CG1 . VAL B 1 371 ? 119.596 124.096 234.801 1.00 86.46  ? 372 VAL B CG1 1 
ATOM   6317  C  CG2 . VAL B 1 371 ? 119.451 121.668 234.516 1.00 86.54  ? 372 VAL B CG2 1 
ATOM   6318  N  N   . ILE B 1 372 ? 121.973 124.504 236.775 1.00 77.50  ? 373 ILE B N   1 
ATOM   6319  C  CA  . ILE B 1 372 ? 122.297 125.836 237.289 1.00 76.45  ? 373 ILE B CA  1 
ATOM   6320  C  C   . ILE B 1 372 ? 121.696 126.980 236.468 1.00 75.24  ? 373 ILE B C   1 
ATOM   6321  O  O   . ILE B 1 372 ? 121.752 126.965 235.253 1.00 75.11  ? 373 ILE B O   1 
ATOM   6322  C  CB  . ILE B 1 372 ? 123.799 126.037 237.399 1.00 76.59  ? 373 ILE B CB  1 
ATOM   6323  C  CG1 . ILE B 1 372 ? 124.422 124.893 238.181 1.00 76.69  ? 373 ILE B CG1 1 
ATOM   6324  C  CG2 . ILE B 1 372 ? 124.096 127.328 238.092 1.00 76.63  ? 373 ILE B CG2 1 
ATOM   6325  C  CD1 . ILE B 1 372 ? 123.917 124.779 239.573 1.00 76.73  ? 373 ILE B CD1 1 
ATOM   6326  N  N   . LEU B 1 373 ? 121.169 127.994 237.146 1.00 74.00  ? 374 LEU B N   1 
ATOM   6327  C  CA  . LEU B 1 373 ? 120.546 129.138 236.496 1.00 72.97  ? 374 LEU B CA  1 
ATOM   6328  C  C   . LEU B 1 373 ? 121.218 130.400 236.986 1.00 72.50  ? 374 LEU B C   1 
ATOM   6329  O  O   . LEU B 1 373 ? 120.758 131.022 237.925 1.00 72.47  ? 374 LEU B O   1 
ATOM   6330  C  CB  . LEU B 1 373 ? 119.069 129.209 236.824 1.00 72.59  ? 374 LEU B CB  1 
ATOM   6331  C  CG  . LEU B 1 373 ? 118.198 128.029 236.444 1.00 72.32  ? 374 LEU B CG  1 
ATOM   6332  C  CD1 . LEU B 1 373 ? 116.752 128.414 236.557 1.00 72.20  ? 374 LEU B CD1 1 
ATOM   6333  C  CD2 . LEU B 1 373 ? 118.504 127.578 235.057 1.00 72.26  ? 374 LEU B CD2 1 
ATOM   6334  N  N   . PRO B 1 374 ? 122.334 130.761 236.351 1.00 76.42  ? 375 PRO B N   1 
ATOM   6335  C  CA  . PRO B 1 374 ? 123.334 131.726 236.805 1.00 76.32  ? 375 PRO B CA  1 
ATOM   6336  C  C   . PRO B 1 374 ? 122.891 133.154 237.095 1.00 76.47  ? 375 PRO B C   1 
ATOM   6337  O  O   . PRO B 1 374 ? 123.415 133.738 238.029 1.00 76.49  ? 375 PRO B O   1 
ATOM   6338  C  CB  . PRO B 1 374 ? 124.331 131.737 235.651 1.00 76.18  ? 375 PRO B CB  1 
ATOM   6339  C  CG  . PRO B 1 374 ? 124.115 130.482 234.947 1.00 76.14  ? 375 PRO B CG  1 
ATOM   6340  C  CD  . PRO B 1 374 ? 122.681 130.215 235.035 1.00 76.22  ? 375 PRO B CD  1 
ATOM   6341  N  N   . ASP B 1 375 ? 121.948 133.703 236.346 1.00 70.51  ? 376 ASP B N   1 
ATOM   6342  C  CA  . ASP B 1 375 ? 121.614 135.114 236.509 1.00 70.75  ? 376 ASP B CA  1 
ATOM   6343  C  C   . ASP B 1 375 ? 120.239 135.514 236.015 1.00 71.05  ? 376 ASP B C   1 
ATOM   6344  O  O   . ASP B 1 375 ? 119.560 134.749 235.356 1.00 71.07  ? 376 ASP B O   1 
ATOM   6345  C  CB  . ASP B 1 375 ? 122.693 136.011 235.897 1.00 70.77  ? 376 ASP B CB  1 
ATOM   6346  C  CG  . ASP B 1 375 ? 122.579 136.144 234.403 1.00 70.82  ? 376 ASP B CG  1 
ATOM   6347  O  OD1 . ASP B 1 375 ? 122.075 135.216 233.755 1.00 70.83  ? 376 ASP B OD1 1 
ATOM   6348  O  OD2 . ASP B 1 375 ? 123.012 137.181 233.869 1.00 70.90  1 376 ASP B OD2 1 
ATOM   6349  N  N   . SER B 1 376 ? 119.842 136.730 236.353 1.00 71.50  ? 377 SER B N   1 
ATOM   6350  C  CA  . SER B 1 376 ? 118.491 137.203 236.109 1.00 71.84  ? 377 SER B CA  1 
ATOM   6351  C  C   . SER B 1 376 ? 118.291 137.895 234.777 1.00 72.25  ? 377 SER B C   1 
ATOM   6352  O  O   . SER B 1 376 ? 119.238 138.238 234.095 1.00 72.26  ? 377 SER B O   1 
ATOM   6353  C  CB  . SER B 1 376 ? 118.035 138.131 237.231 1.00 71.83  ? 377 SER B CB  1 
ATOM   6354  O  OG  . SER B 1 376 ? 118.588 139.415 237.088 1.00 71.82  ? 377 SER B OG  1 
ATOM   6355  N  N   . VAL B 1 377 ? 117.030 138.112 234.438 1.00 67.12  ? 378 VAL B N   1 
ATOM   6356  C  CA  . VAL B 1 377 ? 116.646 138.770 233.205 1.00 67.61  ? 378 VAL B CA  1 
ATOM   6357  C  C   . VAL B 1 377 ? 117.004 140.233 233.200 1.00 68.60  ? 378 VAL B C   1 
ATOM   6358  O  O   . VAL B 1 377 ? 116.967 140.864 232.167 1.00 68.66  ? 378 VAL B O   1 
ATOM   6359  C  CB  . VAL B 1 377 ? 115.144 138.671 232.959 1.00 67.23  ? 378 VAL B CB  1 
ATOM   6360  C  CG1 . VAL B 1 377 ? 114.781 137.321 232.442 1.00 67.09  ? 378 VAL B CG1 1 
ATOM   6361  C  CG2 . VAL B 1 377 ? 114.395 138.954 234.215 1.00 67.11  ? 378 VAL B CG2 1 
ATOM   6362  N  N   . ARG B 1 378 ? 117.343 140.774 234.358 1.00 81.60  ? 379 ARG B N   1 
ATOM   6363  C  CA  . ARG B 1 378 ? 117.577 142.202 234.494 1.00 82.66  ? 379 ARG B CA  1 
ATOM   6364  C  C   . ARG B 1 378 ? 118.667 142.679 233.565 1.00 83.04  ? 379 ARG B C   1 
ATOM   6365  O  O   . ARG B 1 378 ? 118.622 143.790 233.069 1.00 83.09  ? 379 ARG B O   1 
ATOM   6366  C  CB  . ARG B 1 378 ? 117.954 142.537 235.933 1.00 83.20  ? 379 ARG B CB  1 
ATOM   6367  C  CG  . ARG B 1 378 ? 118.604 143.882 236.096 1.00 83.65  ? 379 ARG B CG  1 
ATOM   6368  C  CD  . ARG B 1 378 ? 118.816 144.261 237.539 1.00 83.96  ? 379 ARG B CD  1 
ATOM   6369  N  NE  . ARG B 1 378 ? 119.775 143.417 238.240 1.00 84.19  ? 379 ARG B NE  1 
ATOM   6370  C  CZ  . ARG B 1 378 ? 121.033 143.246 237.871 1.00 84.39  ? 379 ARG B CZ  1 
ATOM   6371  N  NH1 . ARG B 1 378 ? 121.490 143.839 236.787 1.00 84.43  1 379 ARG B NH1 1 
ATOM   6372  N  NH2 . ARG B 1 378 ? 121.828 142.468 238.577 1.00 84.46  ? 379 ARG B NH2 1 
ATOM   6373  N  N   . ASN B 1 379 ? 119.628 141.815 233.294 1.00 87.14  ? 380 ASN B N   1 
ATOM   6374  C  CA  . ASN B 1 379 ? 120.748 142.174 232.447 1.00 87.41  ? 380 ASN B CA  1 
ATOM   6375  C  C   . ASN B 1 379 ? 120.422 142.194 230.972 1.00 87.10  ? 380 ASN B C   1 
ATOM   6376  O  O   . ASN B 1 379 ? 121.195 142.687 230.172 1.00 87.10  ? 380 ASN B O   1 
ATOM   6377  C  CB  . ASN B 1 379 ? 121.909 141.227 232.690 1.00 87.80  ? 380 ASN B CB  1 
ATOM   6378  C  CG  . ASN B 1 379 ? 122.587 141.467 234.009 1.00 88.07  ? 380 ASN B CG  1 
ATOM   6379  O  OD1 . ASN B 1 379 ? 122.441 142.526 234.610 1.00 88.13  ? 380 ASN B OD1 1 
ATOM   6380  N  ND2 . ASN B 1 379 ? 123.344 140.486 234.466 1.00 88.25  ? 380 ASN B ND2 1 
ATOM   6381  N  N   . TYR B 1 380 ? 119.273 141.654 230.610 1.00 79.34  ? 381 TYR B N   1 
ATOM   6382  C  CA  . TYR B 1 380 ? 118.934 141.488 229.213 1.00 78.97  ? 381 TYR B CA  1 
ATOM   6383  C  C   . TYR B 1 380 ? 117.549 142.023 228.895 1.00 78.62  ? 381 TYR B C   1 
ATOM   6384  O  O   . TYR B 1 380 ? 116.853 141.498 228.041 1.00 78.60  ? 381 TYR B O   1 
ATOM   6385  C  CB  . TYR B 1 380 ? 119.044 140.016 228.848 1.00 78.93  ? 381 TYR B CB  1 
ATOM   6386  C  CG  . TYR B 1 380 ? 120.250 139.371 229.463 1.00 78.87  ? 381 TYR B CG  1 
ATOM   6387  C  CD1 . TYR B 1 380 ? 120.147 138.624 230.617 1.00 78.83  ? 381 TYR B CD1 1 
ATOM   6388  C  CD2 . TYR B 1 380 ? 121.496 139.536 228.909 1.00 78.83  ? 381 TYR B CD2 1 
ATOM   6389  C  CE1 . TYR B 1 380 ? 121.246 138.050 231.187 1.00 78.77  ? 381 TYR B CE1 1 
ATOM   6390  C  CE2 . TYR B 1 380 ? 122.596 138.964 229.473 1.00 78.78  ? 381 TYR B CE2 1 
ATOM   6391  C  CZ  . TYR B 1 380 ? 122.469 138.224 230.611 1.00 78.75  ? 381 TYR B CZ  1 
ATOM   6392  O  OH  . TYR B 1 380 ? 123.575 137.652 231.181 1.00 78.71  ? 381 TYR B OH  1 
ATOM   6393  N  N   . MET B 1 381 ? 117.160 143.082 229.585 1.00 75.76  ? 382 MET B N   1 
ATOM   6394  C  CA  . MET B 1 381 ? 115.833 143.636 229.439 1.00 75.47  ? 382 MET B CA  1 
ATOM   6395  C  C   . MET B 1 381 ? 115.593 144.145 228.043 1.00 75.50  ? 382 MET B C   1 
ATOM   6396  O  O   . MET B 1 381 ? 114.491 144.067 227.532 1.00 75.52  ? 382 MET B O   1 
ATOM   6397  C  CB  . MET B 1 381 ? 115.664 144.797 230.398 1.00 75.26  ? 382 MET B CB  1 
ATOM   6398  C  CG  . MET B 1 381 ? 115.507 144.401 231.826 1.00 75.12  ? 382 MET B CG  1 
ATOM   6399  S  SD  . MET B 1 381 ? 113.843 143.884 232.191 1.00 75.01  ? 382 MET B SD  1 
ATOM   6400  C  CE  . MET B 1 381 ? 114.155 142.190 232.555 1.00 74.96  ? 382 MET B CE  1 
ATOM   6401  N  N   . THR B 1 382 ? 116.639 144.670 227.429 1.00 71.86  ? 383 THR B N   1 
ATOM   6402  C  CA  . THR B 1 382 ? 116.528 145.243 226.106 1.00 71.97  ? 383 THR B CA  1 
ATOM   6403  C  C   . THR B 1 382 ? 117.105 144.320 225.056 1.00 72.35  ? 383 THR B C   1 
ATOM   6404  O  O   . THR B 1 382 ? 117.224 144.687 223.902 1.00 72.36  ? 383 THR B O   1 
ATOM   6405  C  CB  . THR B 1 382 ? 117.215 146.598 226.028 1.00 71.79  ? 383 THR B CB  1 
ATOM   6406  O  OG1 . THR B 1 382 ? 118.600 146.455 226.338 1.00 71.77  ? 383 THR B OG1 1 
ATOM   6407  C  CG2 . THR B 1 382 ? 116.598 147.545 227.011 1.00 71.69  ? 383 THR B CG2 1 
ATOM   6408  N  N   . LYS B 1 383 ? 117.468 143.117 225.464 1.00 79.02  ? 384 LYS B N   1 
ATOM   6409  C  CA  . LYS B 1 383 ? 117.981 142.141 224.521 1.00 79.50  ? 384 LYS B CA  1 
ATOM   6410  C  C   . LYS B 1 383 ? 116.984 141.032 224.255 1.00 80.21  ? 384 LYS B C   1 
ATOM   6411  O  O   . LYS B 1 383 ? 115.954 141.270 223.648 1.00 80.36  ? 384 LYS B O   1 
ATOM   6412  C  CB  . LYS B 1 383 ? 119.322 141.578 224.976 1.00 79.35  ? 384 LYS B CB  1 
ATOM   6413  C  CG  . LYS B 1 383 ? 120.474 142.557 224.847 1.00 79.22  ? 384 LYS B CG  1 
ATOM   6414  C  CD  . LYS B 1 383 ? 121.811 141.841 224.801 1.00 79.15  ? 384 LYS B CD  1 
ATOM   6415  C  CE  . LYS B 1 383 ? 122.962 142.801 224.589 1.00 79.10  ? 384 LYS B CE  1 
ATOM   6416  N  NZ  . LYS B 1 383 ? 124.258 142.087 224.529 1.00 79.10  1 384 LYS B NZ  1 
ATOM   6417  N  N   . PHE B 1 384 ? 117.276 139.822 224.705 1.00 76.06  ? 385 PHE B N   1 
ATOM   6418  C  CA  . PHE B 1 384 ? 116.447 138.691 224.327 1.00 76.71  ? 385 PHE B CA  1 
ATOM   6419  C  C   . PHE B 1 384 ? 115.036 138.779 224.862 1.00 77.78  ? 385 PHE B C   1 
ATOM   6420  O  O   . PHE B 1 384 ? 114.131 138.155 224.336 1.00 77.87  ? 385 PHE B O   1 
ATOM   6421  C  CB  . PHE B 1 384 ? 117.101 137.354 224.672 1.00 76.42  ? 385 PHE B CB  1 
ATOM   6422  C  CG  . PHE B 1 384 ? 116.925 136.921 226.093 1.00 76.15  ? 385 PHE B CG  1 
ATOM   6423  C  CD1 . PHE B 1 384 ? 115.826 136.191 226.477 1.00 76.04  ? 385 PHE B CD1 1 
ATOM   6424  C  CD2 . PHE B 1 384 ? 117.888 137.200 227.033 1.00 76.02  ? 385 PHE B CD2 1 
ATOM   6425  C  CE1 . PHE B 1 384 ? 115.676 135.790 227.765 1.00 75.94  ? 385 PHE B CE1 1 
ATOM   6426  C  CE2 . PHE B 1 384 ? 117.739 136.792 228.323 1.00 75.93  ? 385 PHE B CE2 1 
ATOM   6427  C  CZ  . PHE B 1 384 ? 116.632 136.087 228.687 1.00 75.91  ? 385 PHE B CZ  1 
ATOM   6428  N  N   . LEU B 1 385 ? 114.846 139.540 225.924 1.00 75.52  ? 386 LEU B N   1 
ATOM   6429  C  CA  . LEU B 1 385 ? 113.507 139.771 226.422 1.00 76.67  ? 386 LEU B CA  1 
ATOM   6430  C  C   . LEU B 1 385 ? 112.690 140.606 225.456 1.00 78.10  ? 386 LEU B C   1 
ATOM   6431  O  O   . LEU B 1 385 ? 111.474 140.493 225.405 1.00 78.21  ? 386 LEU B O   1 
ATOM   6432  C  CB  . LEU B 1 385 ? 113.545 140.453 227.776 1.00 76.46  ? 386 LEU B CB  1 
ATOM   6433  C  CG  . LEU B 1 385 ? 112.231 140.280 228.521 1.00 76.28  ? 386 LEU B CG  1 
ATOM   6434  C  CD1 . LEU B 1 385 ? 112.037 138.828 228.809 1.00 76.23  ? 386 LEU B CD1 1 
ATOM   6435  C  CD2 . LEU B 1 385 ? 112.205 141.073 229.792 1.00 76.18  ? 386 LEU B CD2 1 
ATOM   6436  N  N   . SER B 1 386 ? 113.370 141.445 224.688 1.00 86.10  ? 387 SER B N   1 
ATOM   6437  C  CA  . SER B 1 386 ? 112.713 142.343 223.752 1.00 87.67  ? 387 SER B CA  1 
ATOM   6438  C  C   . SER B 1 386 ? 112.496 141.691 222.407 1.00 89.12  ? 387 SER B C   1 
ATOM   6439  O  O   . SER B 1 386 ? 113.432 141.191 221.806 1.00 89.19  ? 387 SER B O   1 
ATOM   6440  C  CB  . SER B 1 386 ? 113.553 143.595 223.565 1.00 87.74  ? 387 SER B CB  1 
ATOM   6441  O  OG  . SER B 1 386 ? 113.016 144.417 222.556 1.00 87.82  ? 387 SER B OG  1 
ATOM   6442  N  N   . ASP B 1 387 ? 111.257 141.697 221.931 1.00 97.11  ? 388 ASP B N   1 
ATOM   6443  C  CA  . ASP B 1 387 ? 110.938 141.075 220.654 1.00 98.46  ? 388 ASP B CA  1 
ATOM   6444  C  C   . ASP B 1 387 ? 111.589 141.768 219.473 1.00 99.46  ? 388 ASP B C   1 
ATOM   6445  O  O   . ASP B 1 387 ? 111.974 141.120 218.510 1.00 99.54  ? 388 ASP B O   1 
ATOM   6446  C  CB  . ASP B 1 387 ? 109.433 141.030 220.438 1.00 98.63  ? 388 ASP B CB  1 
ATOM   6447  C  CG  . ASP B 1 387 ? 108.730 140.146 221.430 1.00 98.63  ? 388 ASP B CG  1 
ATOM   6448  O  OD1 . ASP B 1 387 ? 109.202 139.025 221.670 1.00 98.62  ? 388 ASP B OD1 1 
ATOM   6449  O  OD2 . ASP B 1 387 ? 107.698 140.576 221.975 1.00 98.70  1 388 ASP B OD2 1 
ATOM   6450  N  N   . ARG B 1 388 ? 111.718 143.083 219.536 1.00 123.58 ? 389 ARG B N   1 
ATOM   6451  C  CA  . ARG B 1 388 ? 112.307 143.790 218.416 1.00 124.33 ? 389 ARG B CA  1 
ATOM   6452  C  C   . ARG B 1 388 ? 113.766 143.427 218.266 1.00 121.94 ? 389 ARG B C   1 
ATOM   6453  O  O   . ARG B 1 388 ? 114.287 143.387 217.163 1.00 121.84 ? 389 ARG B O   1 
ATOM   6454  C  CB  . ARG B 1 388 ? 112.108 145.304 218.527 1.00 126.71 ? 389 ARG B CB  1 
ATOM   6455  C  CG  . ARG B 1 388 ? 112.855 145.969 219.657 1.00 128.84 ? 389 ARG B CG  1 
ATOM   6456  C  CD  . ARG B 1 388 ? 114.176 146.565 219.192 1.00 130.74 ? 389 ARG B CD  1 
ATOM   6457  N  NE  . ARG B 1 388 ? 115.104 146.775 220.303 1.00 132.62 ? 389 ARG B NE  1 
ATOM   6458  C  CZ  . ARG B 1 388 ? 116.390 147.076 220.158 1.00 134.24 ? 389 ARG B CZ  1 
ATOM   6459  N  NH1 . ARG B 1 388 ? 116.911 147.204 218.946 1.00 134.74 1 389 ARG B NH1 1 
ATOM   6460  N  NH2 . ARG B 1 388 ? 117.154 147.245 221.226 1.00 134.76 ? 389 ARG B NH2 1 
ATOM   6461  N  N   . TRP B 1 389 ? 114.425 143.157 219.383 1.00 84.55  ? 390 TRP B N   1 
ATOM   6462  C  CA  . TRP B 1 389 ? 115.822 142.768 219.351 1.00 82.00  ? 390 TRP B CA  1 
ATOM   6463  C  C   . TRP B 1 389 ? 115.944 141.377 218.770 1.00 81.62  ? 390 TRP B C   1 
ATOM   6464  O  O   . TRP B 1 389 ? 116.845 141.094 217.998 1.00 81.54  ? 390 TRP B O   1 
ATOM   6465  C  CB  . TRP B 1 389 ? 116.417 142.819 220.757 1.00 80.45  ? 390 TRP B CB  1 
ATOM   6466  C  CG  . TRP B 1 389 ? 117.882 142.537 220.838 1.00 78.87  ? 390 TRP B CG  1 
ATOM   6467  C  CD1 . TRP B 1 389 ? 118.889 143.433 220.743 1.00 78.32  ? 390 TRP B CD1 1 
ATOM   6468  C  CD2 . TRP B 1 389 ? 118.494 141.274 221.059 1.00 77.86  ? 390 TRP B CD2 1 
ATOM   6469  N  NE1 . TRP B 1 389 ? 120.092 142.809 220.877 1.00 77.83  ? 390 TRP B NE1 1 
ATOM   6470  C  CE2 . TRP B 1 389 ? 119.872 141.476 221.072 1.00 77.57  ? 390 TRP B CE2 1 
ATOM   6471  C  CE3 . TRP B 1 389 ? 118.006 139.988 221.237 1.00 77.39  ? 390 TRP B CE3 1 
ATOM   6472  C  CZ2 . TRP B 1 389 ? 120.766 140.448 221.257 1.00 77.21  ? 390 TRP B CZ2 1 
ATOM   6473  C  CZ3 . TRP B 1 389 ? 118.894 138.971 221.419 1.00 77.12  ? 390 TRP B CZ3 1 
ATOM   6474  C  CH2 . TRP B 1 389 ? 120.258 139.202 221.429 1.00 77.05  ? 390 TRP B CH2 1 
ATOM   6475  N  N   . MET B 1 390 ? 115.019 140.507 219.139 1.00 80.07  ? 391 MET B N   1 
ATOM   6476  C  CA  . MET B 1 390 ? 115.042 139.146 218.640 1.00 79.89  ? 391 MET B CA  1 
ATOM   6477  C  C   . MET B 1 390 ? 114.766 139.102 217.150 1.00 81.07  ? 391 MET B C   1 
ATOM   6478  O  O   . MET B 1 390 ? 115.259 138.233 216.443 1.00 81.13  ? 391 MET B O   1 
ATOM   6479  C  CB  . MET B 1 390 ? 114.045 138.280 219.404 1.00 78.92  ? 391 MET B CB  1 
ATOM   6480  C  CG  . MET B 1 390 ? 114.428 138.025 220.842 1.00 78.29  ? 391 MET B CG  1 
ATOM   6481  S  SD  . MET B 1 390 ? 115.690 136.773 221.056 1.00 77.68  ? 391 MET B SD  1 
ATOM   6482  C  CE  . MET B 1 390 ? 114.736 135.298 220.827 1.00 77.28  ? 391 MET B CE  1 
ATOM   6483  N  N   . LEU B 1 391 ? 113.970 140.050 216.681 1.00 92.92  ? 392 LEU B N   1 
ATOM   6484  C  CA  . LEU B 1 391 ? 113.672 140.155 215.266 1.00 94.23  ? 392 LEU B CA  1 
ATOM   6485  C  C   . LEU B 1 391 ? 114.869 140.707 214.532 1.00 95.30  ? 392 LEU B C   1 
ATOM   6486  O  O   . LEU B 1 391 ? 115.239 140.231 213.470 1.00 95.38  ? 392 LEU B O   1 
ATOM   6487  C  CB  . LEU B 1 391 ? 112.482 141.084 215.052 1.00 94.44  ? 392 LEU B CB  1 
ATOM   6488  C  CG  . LEU B 1 391 ? 111.098 140.523 215.362 1.00 94.61  ? 392 LEU B CG  1 
ATOM   6489  C  CD1 . LEU B 1 391 ? 110.056 141.612 215.339 1.00 94.68  ? 392 LEU B CD1 1 
ATOM   6490  C  CD2 . LEU B 1 391 ? 110.750 139.459 214.358 1.00 94.71  ? 392 LEU B CD2 1 
ATOM   6491  N  N   . GLN B 1 392 ? 115.467 141.727 215.122 1.00 103.70 ? 393 GLN B N   1 
ATOM   6492  C  CA  . GLN B 1 392 ? 116.585 142.428 214.526 1.00 104.74 ? 393 GLN B CA  1 
ATOM   6493  C  C   . GLN B 1 392 ? 117.794 141.531 214.396 1.00 105.07 ? 393 GLN B C   1 
ATOM   6494  O  O   . GLN B 1 392 ? 118.570 141.658 213.459 1.00 105.11 ? 393 GLN B O   1 
ATOM   6495  C  CB  . GLN B 1 392 ? 116.923 143.645 215.385 1.00 105.31 ? 393 GLN B CB  1 
ATOM   6496  C  CG  . GLN B 1 392 ? 118.154 144.415 214.973 1.00 105.75 ? 393 GLN B CG  1 
ATOM   6497  C  CD  . GLN B 1 392 ? 118.354 145.656 215.822 1.00 106.06 ? 393 GLN B CD  1 
ATOM   6498  O  OE1 . GLN B 1 392 ? 117.527 145.972 216.675 1.00 106.12 ? 393 GLN B OE1 1 
ATOM   6499  N  NE2 . GLN B 1 392 ? 119.452 146.367 215.592 1.00 106.24 ? 393 GLN B NE2 1 
ATOM   6500  N  N   . LYS B 1 393 ? 117.946 140.617 215.343 1.00 94.36  ? 394 LYS B N   1 
ATOM   6501  C  CA  . LYS B 1 393 ? 119.083 139.711 215.349 1.00 94.67  ? 394 LYS B CA  1 
ATOM   6502  C  C   . LYS B 1 393 ? 118.792 138.425 214.597 1.00 95.57  ? 394 LYS B C   1 
ATOM   6503  O  O   . LYS B 1 393 ? 119.655 137.573 214.459 1.00 95.60  ? 394 LYS B O   1 
ATOM   6504  C  CB  . LYS B 1 393 ? 119.531 139.414 216.779 1.00 94.27  ? 394 LYS B CB  1 
ATOM   6505  C  CG  . LYS B 1 393 ? 120.265 140.556 217.454 1.00 93.93  ? 394 LYS B CG  1 
ATOM   6506  C  CD  . LYS B 1 393 ? 121.587 140.814 216.775 1.00 93.69  ? 394 LYS B CD  1 
ATOM   6507  C  CE  . LYS B 1 393 ? 122.183 142.159 217.143 1.00 93.48  ? 394 LYS B CE  1 
ATOM   6508  N  NZ  . LYS B 1 393 ? 123.005 142.104 218.372 1.00 93.39  1 394 LYS B NZ  1 
ATOM   6509  N  N   . GLY B 1 394 ? 117.567 138.285 214.114 1.00 93.00  ? 395 GLY B N   1 
ATOM   6510  C  CA  . GLY B 1 394 ? 117.209 137.133 213.312 1.00 94.10  ? 395 GLY B CA  1 
ATOM   6511  C  C   . GLY B 1 394 ? 116.884 135.864 214.073 1.00 95.44  ? 395 GLY B C   1 
ATOM   6512  O  O   . GLY B 1 394 ? 116.835 134.788 213.492 1.00 95.49  ? 395 GLY B O   1 
ATOM   6513  N  N   . PHE B 1 395 ? 116.682 135.978 215.377 1.00 90.01  ? 396 PHE B N   1 
ATOM   6514  C  CA  . PHE B 1 395 ? 116.351 134.813 216.179 1.00 91.68  ? 396 PHE B CA  1 
ATOM   6515  C  C   . PHE B 1 395 ? 114.879 134.458 216.102 1.00 95.90  ? 396 PHE B C   1 
ATOM   6516  O  O   . PHE B 1 395 ? 114.509 133.296 216.181 1.00 96.17  ? 396 PHE B O   1 
ATOM   6517  C  CB  . PHE B 1 395 ? 116.760 135.034 217.626 1.00 90.01  ? 396 PHE B CB  1 
ATOM   6518  C  CG  . PHE B 1 395 ? 118.232 135.157 217.820 1.00 88.41  ? 396 PHE B CG  1 
ATOM   6519  C  CD1 . PHE B 1 395 ? 119.058 134.099 217.546 1.00 87.70  ? 396 PHE B CD1 1 
ATOM   6520  C  CD2 . PHE B 1 395 ? 118.787 136.324 218.285 1.00 87.59  ? 396 PHE B CD2 1 
ATOM   6521  C  CE1 . PHE B 1 395 ? 120.400 134.207 217.720 1.00 87.12  ? 396 PHE B CE1 1 
ATOM   6522  C  CE2 . PHE B 1 395 ? 120.131 136.431 218.464 1.00 87.11  ? 396 PHE B CE2 1 
ATOM   6523  C  CZ  . PHE B 1 395 ? 120.939 135.371 218.179 1.00 86.94  ? 396 PHE B CZ  1 
ATOM   6524  N  N   . LEU B 1 396 ? 114.038 135.469 215.962 1.00 110.98 ? 397 LEU B N   1 
ATOM   6525  C  CA  . LEU B 1 396 ? 112.619 135.238 215.766 1.00 115.64 ? 397 LEU B CA  1 
ATOM   6526  C  C   . LEU B 1 396 ? 112.246 135.495 214.327 1.00 120.25 ? 397 LEU B C   1 
ATOM   6527  O  O   . LEU B 1 396 ? 112.237 136.639 213.889 1.00 120.42 ? 397 LEU B O   1 
ATOM   6528  C  CB  . LEU B 1 396 ? 111.788 136.176 216.630 1.00 115.88 ? 397 LEU B CB  1 
ATOM   6529  C  CG  . LEU B 1 396 ? 111.399 135.794 218.053 1.00 115.97 ? 397 LEU B CG  1 
ATOM   6530  C  CD1 . LEU B 1 396 ? 110.396 136.802 218.561 1.00 116.04 ? 397 LEU B CD1 1 
ATOM   6531  C  CD2 . LEU B 1 396 ? 110.820 134.400 218.120 1.00 116.13 ? 397 LEU B CD2 1 
ATOM   6532  N  N   . LYS B 1 397 ? 111.948 134.444 213.578 1.00 134.77 ? 398 LYS B N   1 
ATOM   6533  C  CA  . LYS B 1 397 ? 111.393 134.649 212.256 1.00 139.40 ? 398 LYS B CA  1 
ATOM   6534  C  C   . LYS B 1 397 ? 109.909 134.908 212.390 1.00 141.85 ? 398 LYS B C   1 
ATOM   6535  O  O   . LYS B 1 397 ? 109.240 134.287 213.209 1.00 142.13 ? 398 LYS B O   1 
ATOM   6536  C  CB  . LYS B 1 397 ? 111.706 133.466 211.348 1.00 141.36 ? 398 LYS B CB  1 
ATOM   6537  C  CG  . LYS B 1 397 ? 113.194 133.304 211.117 1.00 142.98 ? 398 LYS B CG  1 
ATOM   6538  C  CD  . LYS B 1 397 ? 113.508 133.049 209.662 1.00 144.54 ? 398 LYS B CD  1 
ATOM   6539  C  CE  . LYS B 1 397 ? 113.828 131.591 209.410 1.00 145.60 ? 398 LYS B CE  1 
ATOM   6540  N  NZ  . LYS B 1 397 ? 113.883 131.302 207.954 1.00 146.15 1 398 LYS B NZ  1 
ATOM   6541  N  N   . GLU B 1 398 ? 109.398 135.809 211.563 1.00 138.32 ? 399 GLU B N   1 
ATOM   6542  C  CA  . GLU B 1 398 ? 108.026 136.285 211.678 1.00 140.57 ? 399 GLU B CA  1 
ATOM   6543  C  C   . GLU B 1 398 ? 107.013 135.162 211.551 1.00 143.22 ? 399 GLU B C   1 
ATOM   6544  O  O   . GLU B 1 398 ? 105.946 135.202 212.159 1.00 143.58 ? 399 GLU B O   1 
ATOM   6545  C  CB  . GLU B 1 398 ? 107.759 137.343 210.611 1.00 140.26 ? 399 GLU B CB  1 
ATOM   6546  C  CG  . GLU B 1 398 ? 106.313 137.475 210.202 1.00 139.99 ? 399 GLU B CG  1 
ATOM   6547  C  CD  . GLU B 1 398 ? 105.926 138.904 209.925 1.00 139.88 ? 399 GLU B CD  1 
ATOM   6548  O  OE1 . GLU B 1 398 ? 105.082 139.133 209.035 1.00 139.84 ? 399 GLU B OE1 1 
ATOM   6549  O  OE2 . GLU B 1 398 ? 106.463 139.801 210.605 1.00 139.83 1 399 GLU B OE2 1 
ATOM   6550  N  N   . GLU B 1 399 ? 107.374 134.146 210.782 1.00 144.64 ? 400 GLU B N   1 
ATOM   6551  C  CA  . GLU B 1 399 ? 106.491 133.022 210.521 1.00 147.20 ? 400 GLU B CA  1 
ATOM   6552  C  C   . GLU B 1 399 ? 105.987 132.362 211.793 1.00 149.36 ? 400 GLU B C   1 
ATOM   6553  O  O   . GLU B 1 399 ? 104.792 132.120 211.936 1.00 149.58 ? 400 GLU B O   1 
ATOM   6554  C  CB  . GLU B 1 399 ? 107.208 131.989 209.664 1.00 147.50 ? 400 GLU B CB  1 
ATOM   6555  C  CG  . GLU B 1 399 ? 107.832 132.565 208.409 1.00 147.64 ? 400 GLU B CG  1 
ATOM   6556  C  CD  . GLU B 1 399 ? 108.238 131.491 207.420 1.00 147.77 ? 400 GLU B CD  1 
ATOM   6557  O  OE1 . GLU B 1 399 ? 108.658 130.400 207.861 1.00 147.79 ? 400 GLU B OE1 1 
ATOM   6558  O  OE2 . GLU B 1 399 ? 108.125 131.737 206.200 1.00 147.79 1 400 GLU B OE2 1 
ATOM   6559  N  N   . LEU B 1 401 ? 105.722 133.653 214.898 1.00 125.79 ? 402 LEU B N   1 
ATOM   6560  C  CA  . LEU B 1 401 ? 104.757 134.439 215.651 1.00 126.73 ? 402 LEU B CA  1 
ATOM   6561  C  C   . LEU B 1 401 ? 103.402 134.444 214.957 1.00 126.44 ? 402 LEU B C   1 
ATOM   6562  O  O   . LEU B 1 401 ? 102.364 134.301 215.598 1.00 126.44 ? 402 LEU B O   1 
ATOM   6563  C  CB  . LEU B 1 401 ? 105.260 135.870 215.818 1.00 127.53 ? 402 LEU B CB  1 
ATOM   6564  N  N   . GLU B 1 403 ? 102.138 132.289 213.082 1.00 150.76 ? 404 GLU B N   1 
ATOM   6565  C  CA  . GLU B 1 403 ? 101.534 130.969 212.969 1.00 149.47 ? 404 GLU B CA  1 
ATOM   6566  C  C   . GLU B 1 403 ? 100.876 130.559 214.277 1.00 147.09 ? 404 GLU B C   1 
ATOM   6567  O  O   . GLU B 1 403 ? 99.866  129.864 214.282 1.00 146.96 ? 404 GLU B O   1 
ATOM   6568  C  CB  . GLU B 1 403 ? 102.581 129.935 212.560 1.00 150.24 ? 404 GLU B CB  1 
ATOM   6569  N  N   . LYS B 1 404 ? 101.454 130.995 215.387 1.00 148.51 ? 405 LYS B N   1 
ATOM   6570  C  CA  . LYS B 1 404 ? 100.918 130.662 216.696 1.00 146.21 ? 405 LYS B CA  1 
ATOM   6571  C  C   . LYS B 1 404 ? 99.764  131.591 217.072 1.00 144.70 ? 405 LYS B C   1 
ATOM   6572  O  O   . LYS B 1 404 ? 99.093  131.392 218.083 1.00 144.61 ? 405 LYS B O   1 
ATOM   6573  C  CB  . LYS B 1 404 ? 102.029 130.693 217.748 1.00 145.42 ? 405 LYS B CB  1 
ATOM   6574  C  CG  . LYS B 1 404 ? 103.257 129.864 217.367 1.00 144.71 ? 405 LYS B CG  1 
ATOM   6575  C  CD  . LYS B 1 404 ? 103.709 128.951 218.497 1.00 143.98 ? 405 LYS B CD  1 
ATOM   6576  C  CE  . LYS B 1 404 ? 105.211 128.687 218.443 1.00 143.47 ? 405 LYS B CE  1 
ATOM   6577  N  NZ  . LYS B 1 404 ? 105.957 129.468 219.476 1.00 143.20 1 405 LYS B NZ  1 
ATOM   6578  N  N   . LYS B 1 405 ? 99.559  132.608 216.239 1.00 155.92 ? 406 LYS B N   1 
ATOM   6579  C  CA  . LYS B 1 405 ? 98.537  133.647 216.418 1.00 154.17 ? 406 LYS B CA  1 
ATOM   6580  C  C   . LYS B 1 405 ? 97.114  133.260 215.975 1.00 150.32 ? 406 LYS B C   1 
ATOM   6581  O  O   . LYS B 1 405 ? 96.951  132.377 215.141 1.00 150.10 ? 406 LYS B O   1 
ATOM   6582  C  CB  . LYS B 1 405 ? 98.997  134.920 215.699 1.00 155.92 ? 406 LYS B CB  1 
ATOM   6583  N  N   . PRO B 1 406 ? 96.083  133.936 216.525 1.00 131.09 ? 407 PRO B N   1 
ATOM   6584  C  CA  . PRO B 1 406 ? 94.671  133.645 216.244 1.00 128.14 ? 407 PRO B CA  1 
ATOM   6585  C  C   . PRO B 1 406 ? 94.219  133.966 214.829 1.00 124.42 ? 407 PRO B C   1 
ATOM   6586  O  O   . PRO B 1 406 ? 94.988  134.470 214.021 1.00 124.19 ? 407 PRO B O   1 
ATOM   6587  C  CB  . PRO B 1 406 ? 93.918  134.563 217.213 1.00 128.89 ? 407 PRO B CB  1 
ATOM   6588  C  CG  . PRO B 1 406 ? 94.885  134.928 218.240 1.00 129.71 ? 407 PRO B CG  1 
ATOM   6589  C  CD  . PRO B 1 406 ? 96.207  134.977 217.557 1.00 130.51 ? 407 PRO B CD  1 
ATOM   6590  N  N   . TRP B 1 407 ? 92.958  133.658 214.548 1.00 123.33 ? 408 TRP B N   1 
ATOM   6591  C  CA  . TRP B 1 407 ? 92.384  133.835 213.223 1.00 120.04 ? 408 TRP B CA  1 
ATOM   6592  C  C   . TRP B 1 407 ? 92.291  135.275 212.766 1.00 117.74 ? 408 TRP B C   1 
ATOM   6593  O  O   . TRP B 1 407 ? 92.407  135.564 211.582 1.00 117.51 ? 408 TRP B O   1 
ATOM   6594  C  CB  . TRP B 1 407 ? 90.991  133.216 213.176 1.00 119.38 ? 408 TRP B CB  1 
ATOM   6595  C  CG  . TRP B 1 407 ? 90.013  133.844 214.104 1.00 118.80 ? 408 TRP B CG  1 
ATOM   6596  C  CD1 . TRP B 1 407 ? 89.748  133.473 215.382 1.00 118.52 ? 408 TRP B CD1 1 
ATOM   6597  C  CD2 . TRP B 1 407 ? 89.155  134.950 213.820 1.00 118.33 ? 408 TRP B CD2 1 
ATOM   6598  N  NE1 . TRP B 1 407 ? 88.778  134.282 215.918 1.00 118.32 ? 408 TRP B NE1 1 
ATOM   6599  C  CE2 . TRP B 1 407 ? 88.398  135.196 214.975 1.00 118.28 ? 408 TRP B CE2 1 
ATOM   6600  C  CE3 . TRP B 1 407 ? 88.953  135.753 212.700 1.00 118.13 ? 408 TRP B CE3 1 
ATOM   6601  C  CZ2 . TRP B 1 407 ? 87.459  136.212 215.041 1.00 118.18 ? 408 TRP B CZ2 1 
ATOM   6602  C  CZ3 . TRP B 1 407 ? 88.022  136.757 212.770 1.00 118.03 ? 408 TRP B CZ3 1 
ATOM   6603  C  CH2 . TRP B 1 407 ? 87.287  136.980 213.929 1.00 118.05 ? 408 TRP B CH2 1 
ATOM   6604  N  N   . TRP B 1 408 ? 92.081  136.181 213.707 1.00 114.34 ? 409 TRP B N   1 
ATOM   6605  C  CA  . TRP B 1 408 ? 91.855  137.569 213.355 1.00 112.36 ? 409 TRP B CA  1 
ATOM   6606  C  C   . TRP B 1 408 ? 93.142  138.330 213.119 1.00 111.39 ? 409 TRP B C   1 
ATOM   6607  O  O   . TRP B 1 408 ? 93.114  139.474 212.699 1.00 111.21 ? 409 TRP B O   1 
ATOM   6608  C  CB  . TRP B 1 408 ? 90.990  138.265 214.404 1.00 111.66 ? 409 TRP B CB  1 
ATOM   6609  C  CG  . TRP B 1 408 ? 91.534  138.243 215.790 1.00 110.99 ? 409 TRP B CG  1 
ATOM   6610  C  CD1 . TRP B 1 408 ? 91.214  137.370 216.777 1.00 110.71 ? 409 TRP B CD1 1 
ATOM   6611  C  CD2 . TRP B 1 408 ? 92.473  139.158 216.353 1.00 110.40 ? 409 TRP B CD2 1 
ATOM   6612  N  NE1 . TRP B 1 408 ? 91.904  137.675 217.918 1.00 110.46 ? 409 TRP B NE1 1 
ATOM   6613  C  CE2 . TRP B 1 408 ? 92.687  138.770 217.682 1.00 110.27 ? 409 TRP B CE2 1 
ATOM   6614  C  CE3 . TRP B 1 408 ? 93.159  140.263 215.859 1.00 110.05 ? 409 TRP B CE3 1 
ATOM   6615  C  CZ2 . TRP B 1 408 ? 93.556  139.445 218.521 1.00 109.99 ? 409 TRP B CZ2 1 
ATOM   6616  C  CZ3 . TRP B 1 408 ? 94.019  140.928 216.691 1.00 109.82 ? 409 TRP B CZ3 1 
ATOM   6617  C  CH2 . TRP B 1 408 ? 94.212  140.519 218.008 1.00 109.77 ? 409 TRP B CH2 1 
ATOM   6618  N  N   . TRP B 1 409 ? 94.269  137.686 213.380 1.00 100.52 ? 410 TRP B N   1 
ATOM   6619  C  CA  . TRP B 1 409 ? 95.546  138.379 213.390 1.00 99.67  ? 410 TRP B CA  1 
ATOM   6620  C  C   . TRP B 1 409 ? 95.890  138.978 212.046 1.00 100.91 ? 410 TRP B C   1 
ATOM   6621  O  O   . TRP B 1 409 ? 96.411  140.082 211.965 1.00 100.90 ? 410 TRP B O   1 
ATOM   6622  C  CB  . TRP B 1 409 ? 96.654  137.414 213.798 1.00 98.20  ? 410 TRP B CB  1 
ATOM   6623  C  CG  . TRP B 1 409 ? 97.917  138.082 214.230 1.00 96.73  ? 410 TRP B CG  1 
ATOM   6624  C  CD1 . TRP B 1 409 ? 99.039  138.269 213.493 1.00 96.32  ? 410 TRP B CD1 1 
ATOM   6625  C  CD2 . TRP B 1 409 ? 98.181  138.643 215.506 1.00 95.72  ? 410 TRP B CD2 1 
ATOM   6626  N  NE1 . TRP B 1 409 ? 99.987  138.914 214.229 1.00 95.95  ? 410 TRP B NE1 1 
ATOM   6627  C  CE2 . TRP B 1 409 ? 99.482  139.155 215.475 1.00 95.58  ? 410 TRP B CE2 1 
ATOM   6628  C  CE3 . TRP B 1 409 ? 97.437  138.764 216.676 1.00 95.18  ? 410 TRP B CE3 1 
ATOM   6629  C  CZ2 . TRP B 1 409 ? 100.056 139.776 216.564 1.00 95.14  ? 410 TRP B CZ2 1 
ATOM   6630  C  CZ3 . TRP B 1 409 ? 98.007  139.376 217.753 1.00 94.88  ? 410 TRP B CZ3 1 
ATOM   6631  C  CH2 . TRP B 1 409 ? 99.304  139.877 217.695 1.00 94.86  ? 410 TRP B CH2 1 
ATOM   6632  N  N   . HIS B 1 410 ? 95.571  138.260 210.984 1.00 127.40 ? 411 HIS B N   1 
ATOM   6633  C  CA  . HIS B 1 410 ? 95.870  138.747 209.651 1.00 128.64 ? 411 HIS B CA  1 
ATOM   6634  C  C   . HIS B 1 410 ? 94.615  139.304 209.009 1.00 128.25 ? 411 HIS B C   1 
ATOM   6635  O  O   . HIS B 1 410 ? 94.147  138.800 208.000 1.00 128.27 ? 411 HIS B O   1 
ATOM   6636  C  CB  . HIS B 1 410 ? 96.496  137.648 208.792 1.00 129.88 ? 411 HIS B CB  1 
ATOM   6637  C  CG  . HIS B 1 410 ? 97.864  137.244 209.240 1.00 131.14 ? 411 HIS B CG  1 
ATOM   6638  N  ND1 . HIS B 1 410 ? 99.001  137.924 208.860 1.00 131.77 ? 411 HIS B ND1 1 
ATOM   6639  C  CD2 . HIS B 1 410 ? 98.280  136.235 210.039 1.00 131.92 ? 411 HIS B CD2 1 
ATOM   6640  C  CE1 . HIS B 1 410 ? 100.057 137.350 209.405 1.00 132.23 ? 411 HIS B CE1 1 
ATOM   6641  N  NE2 . HIS B 1 410 ? 99.647  136.322 210.126 1.00 132.33 ? 411 HIS B NE2 1 
ATOM   6642  N  N   . LEU B 1 411 ? 94.072  140.345 209.620 1.00 98.37  ? 412 LEU B N   1 
ATOM   6643  C  CA  . LEU B 1 411 ? 92.922  141.043 209.084 1.00 98.10  ? 412 LEU B CA  1 
ATOM   6644  C  C   . LEU B 1 411 ? 93.190  142.525 209.107 1.00 99.61  ? 412 LEU B C   1 
ATOM   6645  O  O   . LEU B 1 411 ? 93.810  143.032 210.032 1.00 99.47  ? 412 LEU B O   1 
ATOM   6646  C  CB  . LEU B 1 411 ? 91.687  140.765 209.921 1.00 96.78  ? 412 LEU B CB  1 
ATOM   6647  C  CG  . LEU B 1 411 ? 90.961  139.462 209.653 1.00 95.67  ? 412 LEU B CG  1 
ATOM   6648  C  CD1 . LEU B 1 411 ? 89.654  139.458 210.389 1.00 95.26  ? 412 LEU B CD1 1 
ATOM   6649  C  CD2 . LEU B 1 411 ? 90.731  139.315 208.179 1.00 95.38  ? 412 LEU B CD2 1 
ATOM   6650  N  N   . ARG B 1 412 ? 92.719  143.220 208.082 1.00 128.08 ? 413 ARG B N   1 
ATOM   6651  C  CA  . ARG B 1 412 ? 92.890  144.661 207.996 1.00 129.53 ? 413 ARG B CA  1 
ATOM   6652  C  C   . ARG B 1 412 ? 91.988  145.390 208.979 1.00 128.26 ? 413 ARG B C   1 
ATOM   6653  O  O   . ARG B 1 412 ? 90.890  144.944 209.283 1.00 128.21 ? 413 ARG B O   1 
ATOM   6654  C  CB  . ARG B 1 412 ? 92.637  145.159 206.572 1.00 131.60 ? 413 ARG B CB  1 
ATOM   6655  C  CG  . ARG B 1 412 ? 93.610  144.620 205.526 1.00 133.48 ? 413 ARG B CG  1 
ATOM   6656  C  CD  . ARG B 1 412 ? 95.024  145.046 205.834 1.00 134.89 ? 413 ARG B CD  1 
ATOM   6657  N  NE  . ARG B 1 412 ? 95.988  144.738 204.776 1.00 136.53 ? 413 ARG B NE  1 
ATOM   6658  C  CZ  . ARG B 1 412 ? 96.218  145.520 203.728 1.00 137.87 ? 413 ARG B CZ  1 
ATOM   6659  N  NH1 . ARG B 1 412 ? 95.532  146.638 203.587 1.00 138.37 1 413 ARG B NH1 1 
ATOM   6660  N  NH2 . ARG B 1 412 ? 97.114  145.181 202.813 1.00 138.40 ? 413 ARG B NH2 1 
ATOM   6661  N  N   . VAL B 1 413 ? 92.467  146.527 209.461 1.00 105.78 ? 414 VAL B N   1 
ATOM   6662  C  CA  . VAL B 1 413 ? 91.748  147.313 210.444 1.00 104.60 ? 414 VAL B CA  1 
ATOM   6663  C  C   . VAL B 1 413 ? 90.434  147.848 209.889 1.00 104.81 ? 414 VAL B C   1 
ATOM   6664  O  O   . VAL B 1 413 ? 89.477  148.032 210.624 1.00 104.74 ? 414 VAL B O   1 
ATOM   6665  C  CB  . VAL B 1 413 ? 92.642  148.453 210.970 1.00 103.47 ? 414 VAL B CB  1 
ATOM   6666  C  CG1 . VAL B 1 413 ? 93.400  149.067 209.843 1.00 102.93 ? 414 VAL B CG1 1 
ATOM   6667  C  CG2 . VAL B 1 413 ? 91.837  149.502 211.708 1.00 103.16 ? 414 VAL B CG2 1 
ATOM   6668  N  N   . GLN B 1 414 ? 90.369  148.037 208.578 1.00 127.69 ? 415 GLN B N   1 
ATOM   6669  C  CA  . GLN B 1 414 ? 89.196  148.639 207.949 1.00 127.91 ? 415 GLN B CA  1 
ATOM   6670  C  C   . GLN B 1 414 ? 87.945  147.810 208.181 1.00 127.65 ? 415 GLN B C   1 
ATOM   6671  O  O   . GLN B 1 414 ? 86.833  148.317 208.119 1.00 127.66 ? 415 GLN B O   1 
ATOM   6672  C  CB  . GLN B 1 414 ? 89.424  148.838 206.450 1.00 128.28 ? 415 GLN B CB  1 
ATOM   6673  C  CG  . GLN B 1 414 ? 89.682  147.553 205.689 1.00 128.52 ? 415 GLN B CG  1 
ATOM   6674  C  CD  . GLN B 1 414 ? 90.018  147.789 204.233 1.00 128.71 ? 415 GLN B CD  1 
ATOM   6675  O  OE1 . GLN B 1 414 ? 91.087  147.407 203.761 1.00 128.75 ? 415 GLN B OE1 1 
ATOM   6676  N  NE2 . GLN B 1 414 ? 89.103  148.416 203.510 1.00 128.80 ? 415 GLN B NE2 1 
ATOM   6677  N  N   . GLU B 1 415 ? 88.140  146.529 208.461 1.00 133.71 ? 416 GLU B N   1 
ATOM   6678  C  CA  . GLU B 1 415 ? 87.035  145.603 208.649 1.00 133.30 ? 416 GLU B CA  1 
ATOM   6679  C  C   . GLU B 1 415 ? 86.411  145.733 210.031 1.00 132.07 ? 416 GLU B C   1 
ATOM   6680  O  O   . GLU B 1 415 ? 85.424  145.073 210.334 1.00 132.01 ? 416 GLU B O   1 
ATOM   6681  C  CB  . GLU B 1 415 ? 87.510  144.170 208.417 1.00 133.88 ? 416 GLU B CB  1 
ATOM   6682  C  CG  . GLU B 1 415 ? 87.894  143.875 206.980 1.00 134.26 ? 416 GLU B CG  1 
ATOM   6683  C  CD  . GLU B 1 415 ? 88.675  142.586 206.830 1.00 134.45 ? 416 GLU B CD  1 
ATOM   6684  O  OE1 . GLU B 1 415 ? 89.288  142.149 207.822 1.00 134.48 ? 416 GLU B OE1 1 
ATOM   6685  O  OE2 . GLU B 1 415 ? 88.678  142.010 205.723 1.00 134.53 1 416 GLU B OE2 1 
ATOM   6686  N  N   . LEU B 1 416 ? 87.009  146.566 210.874 1.00 113.43 ? 417 LEU B N   1 
ATOM   6687  C  CA  . LEU B 1 416 ? 86.511  146.798 212.223 1.00 112.17 ? 417 LEU B CA  1 
ATOM   6688  C  C   . LEU B 1 416 ? 85.170  147.507 212.285 1.00 110.69 ? 417 LEU B C   1 
ATOM   6689  O  O   . LEU B 1 416 ? 84.447  147.376 213.265 1.00 110.59 ? 417 LEU B O   1 
ATOM   6690  C  CB  . LEU B 1 416 ? 87.524  147.592 213.033 1.00 112.31 ? 417 LEU B CB  1 
ATOM   6691  C  CG  . LEU B 1 416 ? 88.746  146.837 213.529 1.00 112.41 ? 417 LEU B CG  1 
ATOM   6692  C  CD1 . LEU B 1 416 ? 89.674  147.785 214.240 1.00 112.43 ? 417 LEU B CD1 1 
ATOM   6693  C  CD2 . LEU B 1 416 ? 88.333  145.727 214.454 1.00 112.42 ? 417 LEU B CD2 1 
ATOM   6694  N  N   . GLY B 1 417 ? 84.842  148.271 211.253 1.00 106.68 ? 418 GLY B N   1 
ATOM   6695  C  CA  . GLY B 1 417 ? 83.607  149.032 211.257 1.00 105.16 ? 418 GLY B CA  1 
ATOM   6696  C  C   . GLY B 1 417 ? 83.781  150.398 211.878 1.00 103.66 ? 418 GLY B C   1 
ATOM   6697  O  O   . GLY B 1 417 ? 83.104  150.752 212.836 1.00 103.54 ? 418 GLY B O   1 
ATOM   6698  N  N   . LEU B 1 418 ? 84.712  151.158 211.321 1.00 94.83  ? 419 LEU B N   1 
ATOM   6699  C  CA  . LEU B 1 418 ? 85.085  152.473 211.821 1.00 93.50  ? 419 LEU B CA  1 
ATOM   6700  C  C   . LEU B 1 418 ? 84.091  153.579 211.501 1.00 92.78  ? 419 LEU B C   1 
ATOM   6701  O  O   . LEU B 1 418 ? 83.354  153.497 210.536 1.00 92.72  ? 419 LEU B O   1 
ATOM   6702  C  CB  . LEU B 1 418 ? 86.443  152.849 211.251 1.00 93.06  ? 419 LEU B CB  1 
ATOM   6703  C  CG  . LEU B 1 418 ? 87.491  151.782 211.508 1.00 92.72  ? 419 LEU B CG  1 
ATOM   6704  C  CD1 . LEU B 1 418 ? 88.752  152.095 210.751 1.00 92.55  ? 419 LEU B CD1 1 
ATOM   6705  C  CD2 . LEU B 1 418 ? 87.751  151.711 212.986 1.00 92.61  ? 419 LEU B CD2 1 
ATOM   6706  N  N   . SER B 1 419 ? 84.088  154.622 212.319 1.00 104.42 ? 420 SER B N   1 
ATOM   6707  C  CA  . SER B 1 419 ? 83.312  155.818 212.029 1.00 103.80 ? 420 SER B CA  1 
ATOM   6708  C  C   . SER B 1 419 ? 84.150  157.051 212.288 1.00 103.26 ? 420 SER B C   1 
ATOM   6709  O  O   . SER B 1 419 ? 84.750  157.180 213.340 1.00 103.18 ? 420 SER B O   1 
ATOM   6710  C  CB  . SER B 1 419 ? 82.073  155.874 212.907 1.00 103.76 ? 420 SER B CB  1 
ATOM   6711  O  OG  . SER B 1 419 ? 82.412  156.203 214.238 1.00 103.77 ? 420 SER B OG  1 
ATOM   6712  N  N   . ALA B 1 420 ? 84.180  157.968 211.334 1.00 95.72  ? 421 ALA B N   1 
ATOM   6713  C  CA  . ALA B 1 420 ? 85.010  159.153 211.467 1.00 95.27  ? 421 ALA B CA  1 
ATOM   6714  C  C   . ALA B 1 420 ? 84.471  160.121 212.496 1.00 94.91  ? 421 ALA B C   1 
ATOM   6715  O  O   . ALA B 1 420 ? 83.331  160.538 212.408 1.00 94.89  ? 421 ALA B O   1 
ATOM   6716  C  CB  . ALA B 1 420 ? 85.131  159.831 210.156 1.00 95.24  ? 421 ALA B CB  1 
ATOM   6717  N  N   . PRO B 1 421 ? 85.303  160.487 213.475 1.00 98.01  ? 422 PRO B N   1 
ATOM   6718  C  CA  . PRO B 1 421 ? 84.976  161.379 214.582 1.00 97.60  ? 422 PRO B CA  1 
ATOM   6719  C  C   . PRO B 1 421 ? 85.010  162.847 214.215 1.00 96.87  ? 422 PRO B C   1 
ATOM   6720  O  O   . PRO B 1 421 ? 85.605  163.226 213.219 1.00 96.84  ? 422 PRO B O   1 
ATOM   6721  C  CB  . PRO B 1 421 ? 86.090  161.091 215.567 1.00 97.81  ? 422 PRO B CB  1 
ATOM   6722  C  CG  . PRO B 1 421 ? 87.243  160.843 214.704 1.00 97.94  ? 422 PRO B CG  1 
ATOM   6723  C  CD  . PRO B 1 421 ? 86.726  160.120 213.501 1.00 98.02  ? 422 PRO B CD  1 
ATOM   6724  N  N   . LEU B 1 422 ? 84.359  163.663 215.029 1.00 93.22  ? 423 LEU B N   1 
ATOM   6725  C  CA  . LEU B 1 422 ? 84.465  165.100 214.912 1.00 92.39  ? 423 LEU B CA  1 
ATOM   6726  C  C   . LEU B 1 422 ? 85.774  165.570 215.519 1.00 90.96  ? 423 LEU B C   1 
ATOM   6727  O  O   . LEU B 1 422 ? 86.205  165.044 216.527 1.00 90.75  ? 423 LEU B O   1 
ATOM   6728  C  CB  . LEU B 1 422 ? 83.284  165.742 215.622 1.00 92.86  ? 423 LEU B CB  1 
ATOM   6729  C  CG  . LEU B 1 422 ? 82.957  167.199 215.332 1.00 93.24  ? 423 LEU B CG  1 
ATOM   6730  C  CD1 . LEU B 1 422 ? 82.946  167.457 213.848 1.00 93.35  ? 423 LEU B CD1 1 
ATOM   6731  C  CD2 . LEU B 1 422 ? 81.619  167.531 215.926 1.00 93.35  ? 423 LEU B CD2 1 
ATOM   6732  N  N   . THR B 1 423 ? 86.388  166.582 214.922 1.00 100.55 ? 424 THR B N   1 
ATOM   6733  C  CA  . THR B 1 423 ? 87.661  167.107 215.407 1.00 99.16  ? 424 THR B CA  1 
ATOM   6734  C  C   . THR B 1 423 ? 87.499  168.394 216.216 1.00 97.51  ? 424 THR B C   1 
ATOM   6735  O  O   . THR B 1 423 ? 86.518  169.099 216.062 1.00 97.44  ? 424 THR B O   1 
ATOM   6736  C  CB  . THR B 1 423 ? 88.631  167.363 214.245 1.00 99.36  ? 424 THR B CB  1 
ATOM   6737  O  OG1 . THR B 1 423 ? 89.963  167.460 214.748 1.00 99.31  ? 424 THR B OG1 1 
ATOM   6738  C  CG2 . THR B 1 423 ? 88.282  168.651 213.518 1.00 99.49  ? 424 THR B CG2 1 
ATOM   6739  N  N   . VAL B 1 424 ? 88.458  168.695 217.086 1.00 78.51  ? 425 VAL B N   1 
ATOM   6740  C  CA  . VAL B 1 424 ? 88.465  169.965 217.808 1.00 77.05  ? 425 VAL B CA  1 
ATOM   6741  C  C   . VAL B 1 424 ? 89.858  170.563 217.910 1.00 76.12  ? 425 VAL B C   1 
ATOM   6742  O  O   . VAL B 1 424 ? 90.849  169.858 217.869 1.00 76.03  ? 425 VAL B O   1 
ATOM   6743  C  CB  . VAL B 1 424 ? 87.915  169.838 219.232 1.00 76.66  ? 425 VAL B CB  1 
ATOM   6744  C  CG1 . VAL B 1 424 ? 86.506  169.310 219.230 1.00 76.54  ? 425 VAL B CG1 1 
ATOM   6745  C  CG2 . VAL B 1 424 ? 88.810  168.963 220.064 1.00 76.56  ? 425 VAL B CG2 1 
ATOM   6746  N  N   . LEU B 1 425 ? 89.919  171.879 218.026 1.00 73.18  ? 426 LEU B N   1 
ATOM   6747  C  CA  . LEU B 1 425 ? 91.174  172.589 218.192 1.00 72.54  ? 426 LEU B CA  1 
ATOM   6748  C  C   . LEU B 1 425 ? 91.715  172.420 219.597 1.00 72.98  ? 426 LEU B C   1 
ATOM   6749  O  O   . LEU B 1 425 ? 90.957  172.205 220.512 1.00 73.08  ? 426 LEU B O   1 
ATOM   6750  C  CB  . LEU B 1 425 ? 90.967  174.067 217.898 1.00 71.79  ? 426 LEU B CB  1 
ATOM   6751  C  CG  . LEU B 1 425 ? 91.420  174.600 216.547 1.00 71.20  ? 426 LEU B CG  1 
ATOM   6752  C  CD1 . LEU B 1 425 ? 90.965  173.692 215.455 1.00 71.03  ? 426 LEU B CD1 1 
ATOM   6753  C  CD2 . LEU B 1 425 ? 90.877  175.982 216.337 1.00 70.98  ? 426 LEU B CD2 1 
ATOM   6754  N  N   . PRO B 1 426 ? 93.035  172.503 219.769 1.00 81.84  ? 427 PRO B N   1 
ATOM   6755  C  CA  . PRO B 1 426 ? 93.630  172.508 221.103 1.00 82.47  ? 427 PRO B CA  1 
ATOM   6756  C  C   . PRO B 1 426 ? 93.138  173.665 221.941 1.00 83.70  ? 427 PRO B C   1 
ATOM   6757  O  O   . PRO B 1 426 ? 93.071  173.558 223.153 1.00 83.75  ? 427 PRO B O   1 
ATOM   6758  C  CB  . PRO B 1 426 ? 95.120  172.678 220.812 1.00 82.07  ? 427 PRO B CB  1 
ATOM   6759  C  CG  . PRO B 1 426 ? 95.180  173.258 219.473 1.00 81.83  ? 427 PRO B CG  1 
ATOM   6760  C  CD  . PRO B 1 426 ? 94.055  172.658 218.726 1.00 81.74  ? 427 PRO B CD  1 
ATOM   6761  N  N   . THR B 1 427 ? 92.822  174.768 221.284 1.00 83.93  ? 428 THR B N   1 
ATOM   6762  C  CA  . THR B 1 427 ? 92.400  175.984 221.955 1.00 85.34  ? 428 THR B CA  1 
ATOM   6763  C  C   . THR B 1 427 ? 90.924  176.031 222.321 1.00 87.11  ? 428 THR B C   1 
ATOM   6764  O  O   . THR B 1 427 ? 90.473  176.981 222.943 1.00 87.22  ? 428 THR B O   1 
ATOM   6765  C  CB  . THR B 1 427 ? 92.740  177.215 221.129 1.00 85.11  ? 428 THR B CB  1 
ATOM   6766  O  OG1 . THR B 1 427 ? 92.345  176.997 219.775 1.00 85.08  ? 428 THR B OG1 1 
ATOM   6767  C  CG2 . THR B 1 427 ? 94.218  177.471 221.167 1.00 84.97  ? 428 THR B CG2 1 
ATOM   6768  N  N   . ILE B 1 428 ? 90.170  175.017 221.925 1.00 95.43  ? 429 ILE B N   1 
ATOM   6769  C  CA  . ILE B 1 428 ? 88.753  174.970 222.243 1.00 97.23  ? 429 ILE B CA  1 
ATOM   6770  C  C   . ILE B 1 428 ? 88.602  174.858 223.748 1.00 98.59  ? 429 ILE B C   1 
ATOM   6771  O  O   . ILE B 1 428 ? 89.495  174.378 224.423 1.00 98.70  ? 429 ILE B O   1 
ATOM   6772  C  CB  . ILE B 1 428 ? 88.044  173.796 221.539 1.00 97.56  ? 429 ILE B CB  1 
ATOM   6773  C  CG1 . ILE B 1 428 ? 86.527  173.956 221.587 1.00 97.80  ? 429 ILE B CG1 1 
ATOM   6774  C  CG2 . ILE B 1 428 ? 88.427  172.496 222.159 1.00 97.56  ? 429 ILE B CG2 1 
ATOM   6775  C  CD1 . ILE B 1 428 ? 86.007  175.043 220.692 1.00 97.91  ? 429 ILE B CD1 1 
ATOM   6776  N  N   . THR B 1 429 ? 87.504  175.376 224.279 1.00 102.09 ? 430 THR B N   1 
ATOM   6777  C  CA  . THR B 1 429 ? 87.263  175.326 225.713 1.00 103.31 ? 430 THR B CA  1 
ATOM   6778  C  C   . THR B 1 429 ? 86.414  174.138 226.137 1.00 103.89 ? 430 THR B C   1 
ATOM   6779  O  O   . THR B 1 429 ? 85.625  173.622 225.368 1.00 103.96 ? 430 THR B O   1 
ATOM   6780  C  CB  . THR B 1 429 ? 86.645  176.615 226.218 1.00 103.73 ? 430 THR B CB  1 
ATOM   6781  O  OG1 . THR B 1 429 ? 86.405  176.499 227.622 1.00 103.79 ? 430 THR B OG1 1 
ATOM   6782  C  CG2 . THR B 1 429 ? 85.348  176.881 225.516 1.00 103.92 ? 430 THR B CG2 1 
ATOM   6783  N  N   . CYS B 1 430 ? 86.576  173.733 227.385 1.00 107.08 ? 431 CYS B N   1 
ATOM   6784  C  CA  . CYS B 1 430 ? 86.034  172.483 227.893 1.00 107.42 ? 431 CYS B CA  1 
ATOM   6785  C  C   . CYS B 1 430 ? 84.520  172.314 227.772 1.00 107.51 ? 431 CYS B C   1 
ATOM   6786  O  O   . CYS B 1 430 ? 84.018  171.311 227.238 1.00 107.52 ? 431 CYS B O   1 
ATOM   6787  C  CB  . CYS B 1 430 ? 86.429  172.369 229.357 1.00 107.51 ? 431 CYS B CB  1 
ATOM   6788  S  SG  . CYS B 1 430 ? 88.131  171.869 229.642 1.00 107.53 ? 431 CYS B SG  1 
ATOM   6789  N  N   . GLY B 1 431 ? 83.789  173.312 228.238 1.00 91.67  ? 432 GLY B N   1 
ATOM   6790  C  CA  . GLY B 1 431 ? 82.349  173.223 228.244 1.00 91.64  ? 432 GLY B CA  1 
ATOM   6791  C  C   . GLY B 1 431 ? 81.818  173.207 226.838 1.00 91.55  ? 432 GLY B C   1 
ATOM   6792  O  O   . GLY B 1 431 ? 80.807  172.576 226.548 1.00 91.47  ? 432 GLY B O   1 
ATOM   6793  N  N   . HIS B 1 432 ? 82.523  173.892 225.952 1.00 106.47 ? 433 HIS B N   1 
ATOM   6794  C  CA  . HIS B 1 432 ? 82.116  173.944 224.564 1.00 106.33 ? 433 HIS B CA  1 
ATOM   6795  C  C   . HIS B 1 432 ? 82.209  172.575 223.949 1.00 105.52 ? 433 HIS B C   1 
ATOM   6796  O  O   . HIS B 1 432 ? 81.326  172.165 223.214 1.00 105.42 ? 433 HIS B O   1 
ATOM   6797  C  CB  . HIS B 1 432 ? 83.002  174.894 223.782 1.00 106.82 ? 433 HIS B CB  1 
ATOM   6798  C  CG  . HIS B 1 432 ? 82.389  175.368 222.508 1.00 107.28 ? 433 HIS B CG  1 
ATOM   6799  N  ND1 . HIS B 1 432 ? 83.048  176.196 221.631 1.00 107.50 ? 433 HIS B ND1 1 
ATOM   6800  C  CD2 . HIS B 1 432 ? 81.171  175.140 221.970 1.00 107.50 ? 433 HIS B CD2 1 
ATOM   6801  C  CE1 . HIS B 1 432 ? 82.265  176.455 220.600 1.00 107.62 ? 433 HIS B CE1 1 
ATOM   6802  N  NE2 . HIS B 1 432 ? 81.120  175.826 220.782 1.00 107.63 ? 433 HIS B NE2 1 
ATOM   6803  N  N   . THR B 1 433 ? 83.277  171.857 224.262 1.00 98.90  ? 434 THR B N   1 
ATOM   6804  C  CA  . THR B 1 433 ? 83.436  170.534 223.709 1.00 98.13  ? 434 THR B CA  1 
ATOM   6805  C  C   . THR B 1 433 ? 82.375  169.642 224.260 1.00 97.29  ? 434 THR B C   1 
ATOM   6806  O  O   . THR B 1 433 ? 81.903  168.753 223.575 1.00 97.29  ? 434 THR B O   1 
ATOM   6807  C  CB  . THR B 1 433 ? 84.764  169.918 224.066 1.00 98.19  ? 434 THR B CB  1 
ATOM   6808  O  OG1 . THR B 1 433 ? 84.740  169.506 225.434 1.00 98.18  ? 434 THR B OG1 1 
ATOM   6809  C  CG2 . THR B 1 433 ? 85.841  170.908 223.861 1.00 98.27  ? 434 THR B CG2 1 
ATOM   6810  N  N   . ILE B 1 434 ? 81.986  169.875 225.501 1.00 84.93  ? 435 ILE B N   1 
ATOM   6811  C  CA  . ILE B 1 434 ? 80.900  169.076 226.039 1.00 84.15  ? 435 ILE B CA  1 
ATOM   6812  C  C   . ILE B 1 434 ? 79.609  169.322 225.282 1.00 84.19  ? 435 ILE B C   1 
ATOM   6813  O  O   . ILE B 1 434 ? 78.868  168.392 224.961 1.00 84.36  ? 435 ILE B O   1 
ATOM   6814  C  CB  . ILE B 1 434 ? 80.702  169.374 227.499 1.00 83.50  ? 435 ILE B CB  1 
ATOM   6815  C  CG1 . ILE B 1 434 ? 81.726  168.589 228.290 1.00 83.15  ? 435 ILE B CG1 1 
ATOM   6816  C  CG2 . ILE B 1 434 ? 79.320  168.989 227.940 1.00 83.35  ? 435 ILE B CG2 1 
ATOM   6817  C  CD1 . ILE B 1 434 ? 82.043  169.198 229.565 1.00 82.93  ? 435 ILE B CD1 1 
ATOM   6818  N  N   . GLU B 1 435 ? 79.381  170.578 224.931 1.00 105.37 ? 436 GLU B N   1 
ATOM   6819  C  CA  . GLU B 1 435 ? 78.178  170.943 224.208 1.00 105.46 ? 436 GLU B CA  1 
ATOM   6820  C  C   . GLU B 1 435 ? 78.170  170.317 222.828 1.00 105.71 ? 436 GLU B C   1 
ATOM   6821  O  O   . GLU B 1 435 ? 77.166  169.760 222.392 1.00 105.88 ? 436 GLU B O   1 
ATOM   6822  C  CB  . GLU B 1 435 ? 78.075  172.464 224.090 1.00 105.37 ? 436 GLU B CB  1 
ATOM   6823  C  CG  . GLU B 1 435 ? 77.746  173.179 225.389 1.00 105.33 ? 436 GLU B CG  1 
ATOM   6824  C  CD  . GLU B 1 435 ? 77.916  174.682 225.298 1.00 105.31 ? 436 GLU B CD  1 
ATOM   6825  O  OE1 . GLU B 1 435 ? 77.897  175.347 226.350 1.00 105.31 ? 436 GLU B OE1 1 
ATOM   6826  O  OE2 . GLU B 1 435 ? 78.072  175.200 224.178 1.00 105.31 1 436 GLU B OE2 1 
ATOM   6827  N  N   . ILE B 1 436 ? 79.314  170.383 222.160 1.00 82.77  ? 437 ILE B N   1 
ATOM   6828  C  CA  . ILE B 1 436 ? 79.436  169.881 220.808 1.00 83.11  ? 437 ILE B CA  1 
ATOM   6829  C  C   . ILE B 1 436 ? 79.251  168.385 220.808 1.00 84.86  ? 437 ILE B C   1 
ATOM   6830  O  O   . ILE B 1 436 ? 78.472  167.839 220.034 1.00 84.99  ? 437 ILE B O   1 
ATOM   6831  C  CB  . ILE B 1 436 ? 80.817  170.191 220.237 1.00 82.14  ? 437 ILE B CB  1 
ATOM   6832  C  CG1 . ILE B 1 436 ? 81.072  171.696 220.205 1.00 81.65  ? 437 ILE B CG1 1 
ATOM   6833  C  CG2 . ILE B 1 436 ? 80.940  169.634 218.861 1.00 81.89  ? 437 ILE B CG2 1 
ATOM   6834  C  CD1 . ILE B 1 436 ? 80.551  172.404 218.979 1.00 81.42  ? 437 ILE B CD1 1 
ATOM   6835  N  N   . LEU B 1 437 ? 79.956  167.726 221.713 1.00 84.38  ? 438 LEU B N   1 
ATOM   6836  C  CA  . LEU B 1 437 ? 79.935  166.280 221.775 1.00 86.35  ? 438 LEU B CA  1 
ATOM   6837  C  C   . LEU B 1 437 ? 78.575  165.722 222.136 1.00 89.61  ? 438 LEU B C   1 
ATOM   6838  O  O   . LEU B 1 437 ? 78.160  164.706 221.601 1.00 89.85  ? 438 LEU B O   1 
ATOM   6839  C  CB  . LEU B 1 437 ? 80.973  165.776 222.773 1.00 85.47  ? 438 LEU B CB  1 
ATOM   6840  C  CG  . LEU B 1 437 ? 82.432  165.826 222.334 1.00 84.73  ? 438 LEU B CG  1 
ATOM   6841  C  CD1 . LEU B 1 437 ? 83.337  165.342 223.434 1.00 84.50  ? 438 LEU B CD1 1 
ATOM   6842  C  CD2 . LEU B 1 437 ? 82.618  164.992 221.109 1.00 84.54  ? 438 LEU B CD2 1 
ATOM   6843  N  N   . ARG B 1 438 ? 77.864  166.386 223.029 1.00 89.02  ? 439 ARG B N   1 
ATOM   6844  C  CA  . ARG B 1 438 ? 76.546  165.893 223.363 1.00 92.23  ? 439 ARG B CA  1 
ATOM   6845  C  C   . ARG B 1 438 ? 75.579  166.166 222.234 1.00 92.72  ? 439 ARG B C   1 
ATOM   6846  O  O   . ARG B 1 438 ? 74.762  165.325 221.886 1.00 92.85  ? 439 ARG B O   1 
ATOM   6847  C  CB  . ARG B 1 438 ? 76.031  166.524 224.651 1.00 94.57  ? 439 ARG B CB  1 
ATOM   6848  C  CG  . ARG B 1 438 ? 76.595  165.923 225.919 1.00 96.38  ? 439 ARG B CG  1 
ATOM   6849  C  CD  . ARG B 1 438 ? 75.888  166.489 227.132 1.00 98.01  ? 439 ARG B CD  1 
ATOM   6850  N  NE  . ARG B 1 438 ? 76.325  165.887 228.386 1.00 99.27  ? 439 ARG B NE  1 
ATOM   6851  C  CZ  . ARG B 1 438 ? 76.047  164.644 228.755 1.00 100.48 ? 439 ARG B CZ  1 
ATOM   6852  N  NH1 . ARG B 1 438 ? 75.345  163.854 227.963 1.00 100.91 1 439 ARG B NH1 1 
ATOM   6853  N  NH2 . ARG B 1 438 ? 76.479  164.186 229.913 1.00 100.93 ? 439 ARG B NH2 1 
ATOM   6854  N  N   . GLU B 1 439 ? 75.682  167.352 221.655 1.00 123.44 ? 440 GLU B N   1 
ATOM   6855  C  CA  . GLU B 1 439 ? 74.733  167.750 220.631 1.00 123.67 ? 440 GLU B CA  1 
ATOM   6856  C  C   . GLU B 1 439 ? 74.861  166.916 219.373 1.00 122.62 ? 440 GLU B C   1 
ATOM   6857  O  O   . GLU B 1 439 ? 73.888  166.711 218.664 1.00 122.59 ? 440 GLU B O   1 
ATOM   6858  C  CB  . GLU B 1 439 ? 74.877  169.236 220.305 1.00 124.54 ? 440 GLU B CB  1 
ATOM   6859  C  CG  . GLU B 1 439 ? 73.623  169.859 219.731 1.00 125.16 ? 440 GLU B CG  1 
ATOM   6860  C  CD  . GLU B 1 439 ? 73.599  171.361 219.881 1.00 125.46 ? 440 GLU B CD  1 
ATOM   6861  O  OE1 . GLU B 1 439 ? 72.496  171.932 220.003 1.00 125.58 ? 440 GLU B OE1 1 
ATOM   6862  O  OE2 . GLU B 1 439 ? 74.685  171.972 219.878 1.00 125.53 1 440 GLU B OE2 1 
ATOM   6863  N  N   . LYS B 1 440 ? 76.065  166.441 219.089 1.00 110.96 ? 441 LYS B N   1 
ATOM   6864  C  CA  . LYS B 1 440 ? 76.267  165.599 217.921 1.00 109.80 ? 441 LYS B CA  1 
ATOM   6865  C  C   . LYS B 1 440 ? 76.227  164.114 218.232 1.00 108.76 ? 441 LYS B C   1 
ATOM   6866  O  O   . LYS B 1 440 ? 76.298  163.292 217.333 1.00 108.68 ? 441 LYS B O   1 
ATOM   6867  C  CB  . LYS B 1 440 ? 77.567  165.953 217.218 1.00 109.66 ? 441 LYS B CB  1 
ATOM   6868  C  CG  . LYS B 1 440 ? 77.611  167.367 216.696 1.00 109.56 ? 441 LYS B CG  1 
ATOM   6869  C  CD  . LYS B 1 440 ? 76.538  167.618 215.661 1.00 109.46 ? 441 LYS B CD  1 
ATOM   6870  C  CE  . LYS B 1 440 ? 76.756  166.802 214.399 1.00 109.38 ? 441 LYS B CE  1 
ATOM   6871  N  NZ  . LYS B 1 440 ? 76.317  165.389 214.543 1.00 109.35 1 441 LYS B NZ  1 
ATOM   6872  N  N   . GLY B 1 441 ? 76.115  163.770 219.506 1.00 88.17  ? 442 GLY B N   1 
ATOM   6873  C  CA  . GLY B 1 441 ? 75.988  162.381 219.898 1.00 87.19  ? 442 GLY B CA  1 
ATOM   6874  C  C   . GLY B 1 441 ? 77.288  161.610 219.954 1.00 86.21  ? 442 GLY B C   1 
ATOM   6875  O  O   . GLY B 1 441 ? 77.288  160.392 220.070 1.00 86.14  ? 442 GLY B O   1 
ATOM   6876  N  N   . PHE B 1 442 ? 78.397  162.325 219.840 1.00 107.14 ? 443 PHE B N   1 
ATOM   6877  C  CA  . PHE B 1 442 ? 79.727  161.736 219.945 1.00 106.12 ? 443 PHE B CA  1 
ATOM   6878  C  C   . PHE B 1 442 ? 80.228  161.552 221.376 1.00 104.29 ? 443 PHE B C   1 
ATOM   6879  O  O   . PHE B 1 442 ? 79.809  162.261 222.274 1.00 104.21 ? 443 PHE B O   1 
ATOM   6880  C  CB  . PHE B 1 442 ? 80.713  162.567 219.144 1.00 106.72 ? 443 PHE B CB  1 
ATOM   6881  C  CG  . PHE B 1 442 ? 80.590  162.382 217.667 1.00 107.33 ? 443 PHE B CG  1 
ATOM   6882  C  CD1 . PHE B 1 442 ? 79.554  162.959 216.967 1.00 107.63 ? 443 PHE B CD1 1 
ATOM   6883  C  CD2 . PHE B 1 442 ? 81.513  161.630 216.976 1.00 107.59 ? 443 PHE B CD2 1 
ATOM   6884  C  CE1 . PHE B 1 442 ? 79.445  162.786 215.612 1.00 107.81 ? 443 PHE B CE1 1 
ATOM   6885  C  CE2 . PHE B 1 442 ? 81.403  161.457 215.624 1.00 107.76 ? 443 PHE B CE2 1 
ATOM   6886  C  CZ  . PHE B 1 442 ? 80.370  162.035 214.943 1.00 107.85 ? 443 PHE B CZ  1 
ATOM   6887  N  N   . ASN B 1 443 ? 81.120  160.592 221.581 1.00 119.22 ? 444 ASN B N   1 
ATOM   6888  C  CA  . ASN B 1 443 ? 81.677  160.345 222.902 1.00 117.52 ? 444 ASN B CA  1 
ATOM   6889  C  C   . ASN B 1 443 ? 83.113  160.819 223.074 1.00 115.70 ? 444 ASN B C   1 
ATOM   6890  O  O   . ASN B 1 443 ? 83.620  160.879 224.184 1.00 115.58 ? 444 ASN B O   1 
ATOM   6891  C  CB  . ASN B 1 443 ? 81.580  158.862 223.249 1.00 117.58 ? 444 ASN B CB  1 
ATOM   6892  C  CG  . ASN B 1 443 ? 82.352  157.988 222.285 1.00 117.66 ? 444 ASN B CG  1 
ATOM   6893  O  OD1 . ASN B 1 443 ? 82.596  158.376 221.145 1.00 117.64 ? 444 ASN B OD1 1 
ATOM   6894  N  ND2 . ASN B 1 443 ? 82.740  156.799 222.736 1.00 117.66 ? 444 ASN B ND2 1 
ATOM   6895  N  N   . GLN B 1 444 ? 83.767  161.159 221.975 1.00 99.18  ? 445 GLN B N   1 
ATOM   6896  C  CA  . GLN B 1 444 ? 85.165  161.548 222.029 1.00 97.45  ? 445 GLN B CA  1 
ATOM   6897  C  C   . GLN B 1 444 ? 85.591  162.279 220.771 1.00 95.39  ? 445 GLN B C   1 
ATOM   6898  O  O   . GLN B 1 444 ? 84.991  162.111 219.722 1.00 95.29  ? 445 GLN B O   1 
ATOM   6899  C  CB  . GLN B 1 444 ? 86.020  160.312 222.196 1.00 97.78  ? 445 GLN B CB  1 
ATOM   6900  C  CG  . GLN B 1 444 ? 85.880  159.355 221.054 1.00 98.08  ? 445 GLN B CG  1 
ATOM   6901  C  CD  . GLN B 1 444 ? 86.517  158.023 221.326 1.00 98.24  ? 445 GLN B CD  1 
ATOM   6902  O  OE1 . GLN B 1 444 ? 86.888  157.718 222.452 1.00 98.28  ? 445 GLN B OE1 1 
ATOM   6903  N  NE2 . GLN B 1 444 ? 86.651  157.217 220.291 1.00 98.28  ? 445 GLN B NE2 1 
ATOM   6904  N  N   . ALA B 1 445 ? 86.633  163.088 220.880 1.00 75.52  ? 446 ALA B N   1 
ATOM   6905  C  CA  . ALA B 1 445 ? 87.132  163.846 219.749 1.00 73.64  ? 446 ALA B CA  1 
ATOM   6906  C  C   . ALA B 1 445 ? 88.641  163.915 219.768 1.00 72.24  ? 446 ALA B C   1 
ATOM   6907  O  O   . ALA B 1 445 ? 89.226  164.268 220.781 1.00 72.05  ? 446 ALA B O   1 
ATOM   6908  C  CB  . ALA B 1 445 ? 86.556  165.229 219.770 1.00 73.47  ? 446 ALA B CB  1 
ATOM   6909  N  N   . PRO B 1 446 ? 89.281  163.545 218.658 1.00 74.24  ? 447 PRO B N   1 
ATOM   6910  C  CA  . PRO B 1 446 ? 90.705  163.828 218.531 1.00 73.74  ? 447 PRO B CA  1 
ATOM   6911  C  C   . PRO B 1 446 ? 90.965  165.321 218.528 1.00 73.68  ? 447 PRO B C   1 
ATOM   6912  O  O   . PRO B 1 446 ? 90.181  166.073 217.982 1.00 73.63  ? 447 PRO B O   1 
ATOM   6913  C  CB  . PRO B 1 446 ? 91.063  163.204 217.183 1.00 73.50  ? 447 PRO B CB  1 
ATOM   6914  C  CG  . PRO B 1 446 ? 89.802  162.978 216.510 1.00 73.51  ? 447 PRO B CG  1 
ATOM   6915  C  CD  . PRO B 1 446 ? 88.788  162.739 217.541 1.00 73.77  ? 447 PRO B CD  1 
ATOM   6916  N  N   . VAL B 1 447 ? 92.060  165.736 219.142 1.00 74.61  ? 448 VAL B N   1 
ATOM   6917  C  CA  . VAL B 1 447 ? 92.447  167.131 219.144 1.00 74.81  ? 448 VAL B CA  1 
ATOM   6918  C  C   . VAL B 1 447 ? 93.479  167.333 218.073 1.00 75.61  ? 448 VAL B C   1 
ATOM   6919  O  O   . VAL B 1 447 ? 94.603  166.843 218.185 1.00 75.62  ? 448 VAL B O   1 
ATOM   6920  C  CB  . VAL B 1 447 ? 93.032  167.554 220.481 1.00 74.39  ? 448 VAL B CB  1 
ATOM   6921  C  CG1 . VAL B 1 447 ? 93.545  168.955 220.397 1.00 74.26  ? 448 VAL B CG1 1 
ATOM   6922  C  CG2 . VAL B 1 447 ? 91.993  167.455 221.550 1.00 74.26  ? 448 VAL B CG2 1 
ATOM   6923  N  N   . VAL B 1 448 ? 93.070  168.042 217.028 1.00 73.81  ? 449 VAL B N   1 
ATOM   6924  C  CA  . VAL B 1 448 ? 93.901  168.296 215.870 1.00 74.78  ? 449 VAL B CA  1 
ATOM   6925  C  C   . VAL B 1 448 ? 94.148  169.784 215.670 1.00 76.26  ? 449 VAL B C   1 
ATOM   6926  O  O   . VAL B 1 448 ? 93.265  170.606 215.840 1.00 76.34  ? 449 VAL B O   1 
ATOM   6927  C  CB  . VAL B 1 448 ? 93.275  167.708 214.600 1.00 74.40  ? 449 VAL B CB  1 
ATOM   6928  C  CG1 . VAL B 1 448 ? 94.229  167.809 213.447 1.00 74.29  ? 449 VAL B CG1 1 
ATOM   6929  C  CG2 . VAL B 1 448 ? 92.909  166.270 214.818 1.00 74.25  ? 449 VAL B CG2 1 
ATOM   6930  N  N   . ASP B 1 449 ? 95.369  170.104 215.278 1.00 108.74 ? 450 ASP B N   1 
ATOM   6931  C  CA  . ASP B 1 449 ? 95.833  171.467 215.116 1.00 110.22 ? 450 ASP B CA  1 
ATOM   6932  C  C   . ASP B 1 449 ? 95.230  172.136 213.900 1.00 110.97 ? 450 ASP B C   1 
ATOM   6933  O  O   . ASP B 1 449 ? 94.695  171.483 213.021 1.00 111.07 ? 450 ASP B O   1 
ATOM   6934  C  CB  . ASP B 1 449 ? 97.349  171.469 214.983 1.00 110.67 ? 450 ASP B CB  1 
ATOM   6935  C  CG  . ASP B 1 449 ? 97.961  172.781 215.375 1.00 110.93 ? 450 ASP B CG  1 
ATOM   6936  O  OD1 . ASP B 1 449 ? 97.427  173.431 216.290 1.00 111.02 ? 450 ASP B OD1 1 
ATOM   6937  O  OD2 . ASP B 1 449 ? 98.980  173.163 214.776 1.00 111.02 1 450 ASP B OD2 1 
ATOM   6938  N  N   . GLU B 1 450 ? 95.304  173.456 213.867 1.00 117.00 ? 451 GLU B N   1 
ATOM   6939  C  CA  . GLU B 1 450 ? 94.879  174.210 212.704 1.00 117.40 ? 451 GLU B CA  1 
ATOM   6940  C  C   . GLU B 1 450 ? 95.699  173.826 211.493 1.00 116.52 ? 451 GLU B C   1 
ATOM   6941  O  O   . GLU B 1 450 ? 95.219  173.894 210.373 1.00 116.52 ? 451 GLU B O   1 
ATOM   6942  C  CB  . GLU B 1 450 ? 95.049  175.701 212.960 1.00 118.31 ? 451 GLU B CB  1 
ATOM   6943  C  CG  . GLU B 1 450 ? 93.825  176.376 213.520 1.00 118.89 ? 451 GLU B CG  1 
ATOM   6944  C  CD  . GLU B 1 450 ? 94.121  177.759 214.034 1.00 119.22 ? 451 GLU B CD  1 
ATOM   6945  O  OE1 . GLU B 1 450 ? 95.274  177.990 214.439 1.00 119.33 ? 451 GLU B OE1 1 
ATOM   6946  O  OE2 . GLU B 1 450 ? 93.207  178.608 214.040 1.00 119.34 1 451 GLU B OE2 1 
ATOM   6947  N  N   . ALA B 1 451 ? 96.936  173.414 211.721 1.00 77.79  ? 452 ALA B N   1 
ATOM   6948  C  CA  . ALA B 1 451 ? 97.802  172.975 210.640 1.00 76.79  ? 452 ALA B CA  1 
ATOM   6949  C  C   . ALA B 1 451 ? 97.573  171.509 210.345 1.00 75.87  ? 452 ALA B C   1 
ATOM   6950  O  O   . ALA B 1 451 ? 98.235  170.922 209.509 1.00 75.80  ? 452 ALA B O   1 
ATOM   6951  C  CB  . ALA B 1 451 ? 99.242  173.225 210.981 1.00 76.74  ? 452 ALA B CB  1 
ATOM   6952  N  N   . GLY B 1 452 ? 96.630  170.913 211.053 1.00 85.68  ? 453 GLY B N   1 
ATOM   6953  C  CA  . GLY B 1 452 ? 96.307  169.520 210.840 1.00 84.84  ? 453 GLY B CA  1 
ATOM   6954  C  C   . GLY B 1 452 ? 97.161  168.529 211.599 1.00 84.06  ? 453 GLY B C   1 
ATOM   6955  O  O   . GLY B 1 452 ? 97.104  167.338 211.337 1.00 83.99  ? 453 GLY B O   1 
ATOM   6956  N  N   . VAL B 1 453 ? 97.965  169.017 212.532 1.00 78.22  ? 454 VAL B N   1 
ATOM   6957  C  CA  . VAL B 1 453 ? 98.715  168.129 213.399 1.00 77.58  ? 454 VAL B CA  1 
ATOM   6958  C  C   . VAL B 1 453 ? 97.826  167.561 214.491 1.00 77.33  ? 454 VAL B C   1 
ATOM   6959  O  O   . VAL B 1 453 ? 97.140  168.295 215.180 1.00 77.38  ? 454 VAL B O   1 
ATOM   6960  C  CB  . VAL B 1 453 ? 99.879  168.858 214.056 1.00 77.27  ? 454 VAL B CB  1 
ATOM   6961  C  CG1 . VAL B 1 453 ? 100.631 167.920 214.964 1.00 77.16  ? 454 VAL B CG1 1 
ATOM   6962  C  CG2 . VAL B 1 453 ? 100.801 169.417 213.008 1.00 77.20  ? 454 VAL B CG2 1 
ATOM   6963  N  N   . ILE B 1 454 ? 97.847  166.248 214.658 1.00 80.33  ? 455 ILE B N   1 
ATOM   6964  C  CA  . ILE B 1 454 ? 97.079  165.638 215.723 1.00 80.12  ? 455 ILE B CA  1 
ATOM   6965  C  C   . ILE B 1 454 ? 97.820  165.803 217.020 1.00 80.01  ? 455 ILE B C   1 
ATOM   6966  O  O   . ILE B 1 454 ? 98.962  165.401 217.148 1.00 79.99  ? 455 ILE B O   1 
ATOM   6967  C  CB  . ILE B 1 454 ? 96.841  164.157 215.486 1.00 80.06  ? 455 ILE B CB  1 
ATOM   6968  C  CG1 . ILE B 1 454 ? 96.165  163.943 214.138 1.00 80.01  ? 455 ILE B CG1 1 
ATOM   6969  C  CG2 . ILE B 1 454 ? 95.971  163.606 216.569 1.00 80.07  ? 455 ILE B CG2 1 
ATOM   6970  C  CD1 . ILE B 1 454 ? 95.891  162.508 213.823 1.00 79.98  ? 455 ILE B CD1 1 
ATOM   6971  N  N   . LEU B 1 455 ? 97.155  166.413 217.982 1.00 77.29  ? 456 LEU B N   1 
ATOM   6972  C  CA  . LEU B 1 455 ? 97.767  166.672 219.260 1.00 77.23  ? 456 LEU B CA  1 
ATOM   6973  C  C   . LEU B 1 455 ? 97.323  165.666 220.286 1.00 77.48  ? 456 LEU B C   1 
ATOM   6974  O  O   . LEU B 1 455 ? 98.042  165.388 221.231 1.00 77.49  ? 456 LEU B O   1 
ATOM   6975  C  CB  . LEU B 1 455 ? 97.422  168.073 219.729 1.00 77.00  ? 456 LEU B CB  1 
ATOM   6976  C  CG  . LEU B 1 455 ? 97.888  169.165 218.789 1.00 76.81  ? 456 LEU B CG  1 
ATOM   6977  C  CD1 . LEU B 1 455 ? 97.758  170.506 219.456 1.00 76.74  ? 456 LEU B CD1 1 
ATOM   6978  C  CD2 . LEU B 1 455 ? 99.309  168.899 218.385 1.00 76.76  ? 456 LEU B CD2 1 
ATOM   6979  N  N   . GLY B 1 456 ? 96.134  165.112 220.116 1.00 84.72  ? 457 GLY B N   1 
ATOM   6980  C  CA  . GLY B 1 456 ? 95.705  164.125 221.082 1.00 84.90  ? 457 GLY B CA  1 
ATOM   6981  C  C   . GLY B 1 456 ? 94.258  163.719 221.063 1.00 84.99  ? 457 GLY B C   1 
ATOM   6982  O  O   . GLY B 1 456 ? 93.676  163.517 220.016 1.00 85.03  ? 457 GLY B O   1 
ATOM   6983  N  N   . MET B 1 457 ? 93.679  163.590 222.245 1.00 92.74  ? 458 MET B N   1 
ATOM   6984  C  CA  . MET B 1 457 ? 92.335  163.070 222.367 1.00 92.71  ? 458 MET B CA  1 
ATOM   6985  C  C   . MET B 1 457 ? 91.631  163.619 223.589 1.00 91.78  ? 458 MET B C   1 
ATOM   6986  O  O   . MET B 1 457 ? 92.248  163.852 224.615 1.00 91.74  ? 458 MET B O   1 
ATOM   6987  C  CB  . MET B 1 457 ? 92.396  161.552 222.461 1.00 93.36  ? 458 MET B CB  1 
ATOM   6988  C  CG  . MET B 1 457 ? 91.068  160.850 222.312 1.00 93.82  ? 458 MET B CG  1 
ATOM   6989  S  SD  . MET B 1 457 ? 90.624  160.592 220.604 1.00 94.23  ? 458 MET B SD  1 
ATOM   6990  C  CE  . MET B 1 457 ? 92.252  160.547 219.900 1.00 94.56  ? 458 MET B CE  1 
ATOM   6991  N  N   . VAL B 1 458 ? 90.328  163.827 223.470 1.00 72.01  ? 459 VAL B N   1 
ATOM   6992  C  CA  . VAL B 1 458 ? 89.510  164.164 224.622 1.00 71.18  ? 459 VAL B CA  1 
ATOM   6993  C  C   . VAL B 1 458 ? 88.233  163.362 224.590 1.00 70.90  ? 459 VAL B C   1 
ATOM   6994  O  O   . VAL B 1 458 ? 87.684  163.110 223.537 1.00 70.95  ? 459 VAL B O   1 
ATOM   6995  C  CB  . VAL B 1 458 ? 89.179  165.647 224.682 1.00 70.77  ? 459 VAL B CB  1 
ATOM   6996  C  CG1 . VAL B 1 458 ? 90.392  166.425 225.072 1.00 70.70  ? 459 VAL B CG1 1 
ATOM   6997  C  CG2 . VAL B 1 458 ? 88.664  166.125 223.363 1.00 70.64  ? 459 VAL B CG2 1 
ATOM   6998  N  N   . THR B 1 459 ? 87.770  162.943 225.755 1.00 73.41  ? 460 THR B N   1 
ATOM   6999  C  CA  . THR B 1 459 ? 86.579  162.126 225.837 1.00 73.28  ? 460 THR B CA  1 
ATOM   7000  C  C   . THR B 1 459 ? 85.559  162.809 226.707 1.00 73.46  ? 460 THR B C   1 
ATOM   7001  O  O   . THR B 1 459 ? 85.904  163.568 227.592 1.00 73.50  ? 460 THR B O   1 
ATOM   7002  C  CB  . THR B 1 459 ? 86.887  160.741 226.398 1.00 73.09  ? 460 THR B CB  1 
ATOM   7003  O  OG1 . THR B 1 459 ? 87.438  160.869 227.707 1.00 73.08  ? 460 THR B OG1 1 
ATOM   7004  C  CG2 . THR B 1 459 ? 87.885  160.035 225.526 1.00 73.01  ? 460 THR B CG2 1 
ATOM   7005  N  N   . LEU B 1 460 ? 84.295  162.548 226.437 1.00 75.10  ? 461 LEU B N   1 
ATOM   7006  C  CA  . LEU B 1 460 ? 83.234  163.209 227.157 1.00 75.41  ? 461 LEU B CA  1 
ATOM   7007  C  C   . LEU B 1 460 ? 83.269  162.873 228.633 1.00 76.34  ? 461 LEU B C   1 
ATOM   7008  O  O   . LEU B 1 460 ? 83.087  163.739 229.482 1.00 76.50  ? 461 LEU B O   1 
ATOM   7009  C  CB  . LEU B 1 460 ? 81.897  162.779 226.572 1.00 74.96  ? 461 LEU B CB  1 
ATOM   7010  C  CG  . LEU B 1 460 ? 80.636  163.245 227.285 1.00 74.63  ? 461 LEU B CG  1 
ATOM   7011  C  CD1 . LEU B 1 460 ? 80.375  164.686 226.983 1.00 74.60  ? 461 LEU B CD1 1 
ATOM   7012  C  CD2 . LEU B 1 460 ? 79.464  162.401 226.877 1.00 74.49  ? 461 LEU B CD2 1 
ATOM   7013  N  N   . GLY B 1 461 ? 83.546  161.617 228.940 1.00 84.62  ? 462 GLY B N   1 
ATOM   7014  C  CA  . GLY B 1 461 ? 83.467  161.162 230.310 1.00 85.63  ? 462 GLY B CA  1 
ATOM   7015  C  C   . GLY B 1 461 ? 84.559  161.716 231.187 1.00 86.68  ? 462 GLY B C   1 
ATOM   7016  O  O   . GLY B 1 461 ? 84.342  162.042 232.346 1.00 86.78  ? 462 GLY B O   1 
ATOM   7017  N  N   . ASN B 1 462 ? 85.741  161.846 230.619 1.00 83.60  ? 463 ASN B N   1 
ATOM   7018  C  CA  . ASN B 1 462 ? 86.855  162.398 231.348 1.00 84.65  ? 463 ASN B CA  1 
ATOM   7019  C  C   . ASN B 1 462 ? 86.597  163.852 231.644 1.00 85.61  ? 463 ASN B C   1 
ATOM   7020  O  O   . ASN B 1 462 ? 86.986  164.373 232.677 1.00 85.69  ? 463 ASN B O   1 
ATOM   7021  C  CB  . ASN B 1 462 ? 88.120  162.247 230.523 1.00 84.67  ? 463 ASN B CB  1 
ATOM   7022  C  CG  . ASN B 1 462 ? 89.365  162.524 231.313 1.00 84.72  ? 463 ASN B CG  1 
ATOM   7023  O  OD1 . ASN B 1 462 ? 89.460  162.179 232.482 1.00 84.70  ? 463 ASN B OD1 1 
ATOM   7024  N  ND2 . ASN B 1 462 ? 90.334  163.150 230.675 1.00 84.78  ? 463 ASN B ND2 1 
ATOM   7025  N  N   . MET B 1 463 ? 85.903  164.498 230.726 1.00 103.96 ? 464 MET B N   1 
ATOM   7026  C  CA  . MET B 1 463 ? 85.566  165.900 230.871 1.00 104.81 ? 464 MET B CA  1 
ATOM   7027  C  C   . MET B 1 463 ? 84.557  166.118 231.970 1.00 104.49 ? 464 MET B C   1 
ATOM   7028  O  O   . MET B 1 463 ? 84.726  166.977 232.830 1.00 104.51 ? 464 MET B O   1 
ATOM   7029  C  CB  . MET B 1 463 ? 84.984  166.423 229.566 1.00 105.62 ? 464 MET B CB  1 
ATOM   7030  C  CG  . MET B 1 463 ? 86.012  166.782 228.541 1.00 106.15 ? 464 MET B CG  1 
ATOM   7031  S  SD  . MET B 1 463 ? 86.947  168.166 229.138 1.00 106.70 ? 464 MET B SD  1 
ATOM   7032  C  CE  . MET B 1 463 ? 85.600  169.180 229.669 1.00 107.10 ? 464 MET B CE  1 
ATOM   7033  N  N   . LEU B 1 464 ? 83.498  165.330 231.938 1.00 85.97  ? 465 LEU B N   1 
ATOM   7034  C  CA  . LEU B 1 464 ? 82.467  165.479 232.932 1.00 85.53  ? 465 LEU B CA  1 
ATOM   7035  C  C   . LEU B 1 464 ? 83.045  165.177 234.285 1.00 85.05  ? 465 LEU B C   1 
ATOM   7036  O  O   . LEU B 1 464 ? 82.764  165.865 235.254 1.00 85.04  ? 465 LEU B O   1 
ATOM   7037  C  CB  . LEU B 1 464 ? 81.323  164.521 232.648 1.00 85.52  ? 465 LEU B CB  1 
ATOM   7038  C  CG  . LEU B 1 464 ? 80.142  165.078 231.869 1.00 85.48  ? 465 LEU B CG  1 
ATOM   7039  C  CD1 . LEU B 1 464 ? 80.555  165.485 230.492 1.00 85.33  ? 465 LEU B CD1 1 
ATOM   7040  C  CD2 . LEU B 1 464 ? 79.065  164.040 231.806 1.00 85.51  ? 465 LEU B CD2 1 
ATOM   7041  N  N   . SER B 1 465 ? 83.898  164.166 234.340 1.00 84.20  ? 466 SER B N   1 
ATOM   7042  C  CA  . SER B 1 465 ? 84.458  163.766 235.613 1.00 83.69  ? 466 SER B CA  1 
ATOM   7043  C  C   . SER B 1 465 ? 85.370  164.836 236.166 1.00 83.38  ? 466 SER B C   1 
ATOM   7044  O  O   . SER B 1 465 ? 85.317  165.146 237.342 1.00 83.33  ? 466 SER B O   1 
ATOM   7045  C  CB  . SER B 1 465 ? 85.208  162.452 235.483 1.00 83.59  ? 466 SER B CB  1 
ATOM   7046  O  OG  . SER B 1 465 ? 85.886  162.148 236.683 1.00 83.48  ? 466 SER B OG  1 
ATOM   7047  N  N   . SER B 1 466 ? 86.192  165.420 235.312 1.00 76.88  ? 467 SER B N   1 
ATOM   7048  C  CA  . SER B 1 466 ? 87.087  166.465 235.773 1.00 76.73  ? 467 SER B CA  1 
ATOM   7049  C  C   . SER B 1 466 ? 86.324  167.703 236.201 1.00 76.91  ? 467 SER B C   1 
ATOM   7050  O  O   . SER B 1 466 ? 86.758  168.428 237.083 1.00 76.91  ? 467 SER B O   1 
ATOM   7051  C  CB  . SER B 1 466 ? 88.112  166.824 234.699 1.00 76.57  ? 467 SER B CB  1 
ATOM   7052  O  OG  . SER B 1 466 ? 88.938  165.725 234.389 1.00 76.52  ? 467 SER B OG  1 
ATOM   7053  N  N   . LEU B 1 467 ? 85.187  167.951 235.571 1.00 86.78  ? 468 LEU B N   1 
ATOM   7054  C  CA  . LEU B 1 467 ? 84.412  169.130 235.915 1.00 87.09  ? 468 LEU B CA  1 
ATOM   7055  C  C   . LEU B 1 467 ? 83.676  168.954 237.224 1.00 87.58  ? 468 LEU B C   1 
ATOM   7056  O  O   . LEU B 1 467 ? 83.656  169.852 238.053 1.00 87.62  ? 468 LEU B O   1 
ATOM   7057  C  CB  . LEU B 1 467 ? 83.419  169.466 234.809 1.00 86.97  ? 468 LEU B CB  1 
ATOM   7058  C  CG  . LEU B 1 467 ? 83.952  170.268 233.630 1.00 86.90  ? 468 LEU B CG  1 
ATOM   7059  C  CD1 . LEU B 1 467 ? 82.882  170.383 232.624 1.00 86.90  ? 468 LEU B CD1 1 
ATOM   7060  C  CD2 . LEU B 1 467 ? 84.370  171.637 234.073 1.00 86.89  ? 468 LEU B CD2 1 
ATOM   7061  N  N   . LEU B 1 468 ? 83.076  167.786 237.404 1.00 90.45  ? 469 LEU B N   1 
ATOM   7062  C  CA  . LEU B 1 468 ? 82.322  167.497 238.610 1.00 90.90  ? 469 LEU B CA  1 
ATOM   7063  C  C   . LEU B 1 468 ? 83.215  167.520 239.827 1.00 90.75  ? 469 LEU B C   1 
ATOM   7064  O  O   . LEU B 1 468 ? 82.781  167.856 240.920 1.00 90.75  ? 469 LEU B O   1 
ATOM   7065  C  CB  . LEU B 1 468 ? 81.667  166.127 238.510 1.00 91.41  ? 469 LEU B CB  1 
ATOM   7066  C  CG  . LEU B 1 468 ? 80.173  166.074 238.233 1.00 91.83  ? 469 LEU B CG  1 
ATOM   7067  C  CD1 . LEU B 1 468 ? 79.847  166.623 236.863 1.00 91.98  ? 469 LEU B CD1 1 
ATOM   7068  C  CD2 . LEU B 1 468 ? 79.702  164.653 238.357 1.00 91.99  ? 469 LEU B CD2 1 
ATOM   7069  N  N   . ALA B 1 469 ? 84.467  167.148 239.634 1.00 84.12  ? 470 ALA B N   1 
ATOM   7070  C  CA  . ALA B 1 469 ? 85.407  167.080 240.731 1.00 83.97  ? 470 ALA B CA  1 
ATOM   7071  C  C   . ALA B 1 469 ? 86.056  168.421 241.004 1.00 83.96  ? 470 ALA B C   1 
ATOM   7072  O  O   . ALA B 1 469 ? 86.780  168.579 241.976 1.00 83.94  ? 470 ALA B O   1 
ATOM   7073  C  CB  . ALA B 1 469 ? 86.446  166.048 240.444 1.00 83.90  ? 470 ALA B CB  1 
ATOM   7074  N  N   . GLY B 1 470 ? 85.806  169.386 240.136 1.00 71.81  ? 471 GLY B N   1 
ATOM   7075  C  CA  . GLY B 1 470 ? 86.374  170.704 240.311 1.00 71.94  ? 471 GLY B CA  1 
ATOM   7076  C  C   . GLY B 1 470 ? 87.800  170.819 239.829 1.00 72.23  ? 471 GLY B C   1 
ATOM   7077  O  O   . GLY B 1 470 ? 88.447  171.840 240.021 1.00 72.23  ? 471 GLY B O   1 
ATOM   7078  N  N   . LYS B 1 471 ? 88.285  169.765 239.187 1.00 91.50  ? 472 LYS B N   1 
ATOM   7079  C  CA  . LYS B 1 471 ? 89.651  169.727 238.686 1.00 91.92  ? 472 LYS B CA  1 
ATOM   7080  C  C   . LYS B 1 471 ? 89.861  170.727 237.570 1.00 92.41  ? 472 LYS B C   1 
ATOM   7081  O  O   . LYS B 1 471 ? 90.978  171.141 237.297 1.00 92.44  ? 472 LYS B O   1 
ATOM   7082  C  CB  . LYS B 1 471 ? 90.003  168.332 238.192 1.00 91.90  ? 472 LYS B CB  1 
ATOM   7083  C  CG  . LYS B 1 471 ? 89.903  167.270 239.251 1.00 91.90  ? 472 LYS B CG  1 
ATOM   7084  C  CD  . LYS B 1 471 ? 90.886  167.507 240.372 1.00 91.92  ? 472 LYS B CD  1 
ATOM   7085  C  CE  . LYS B 1 471 ? 90.649  166.540 241.517 1.00 91.92  ? 472 LYS B CE  1 
ATOM   7086  N  NZ  . LYS B 1 471 ? 91.635  166.672 242.621 1.00 91.97  1 472 LYS B NZ  1 
ATOM   7087  N  N   . VAL B 1 472 ? 88.770  171.123 236.935 1.00 84.66  ? 473 VAL B N   1 
ATOM   7088  C  CA  . VAL B 1 472 ? 88.845  172.004 235.793 1.00 85.22  ? 473 VAL B CA  1 
ATOM   7089  C  C   . VAL B 1 472 ? 87.576  172.834 235.710 1.00 85.89  ? 473 VAL B C   1 
ATOM   7090  O  O   . VAL B 1 472 ? 86.570  172.491 236.310 1.00 85.92  ? 473 VAL B O   1 
ATOM   7091  C  CB  . VAL B 1 472 ? 89.055  171.186 234.519 1.00 85.13  ? 473 VAL B CB  1 
ATOM   7092  C  CG1 . VAL B 1 472 ? 87.770  170.535 234.099 1.00 85.03  ? 473 VAL B CG1 1 
ATOM   7093  C  CG2 . VAL B 1 472 ? 89.594  172.042 233.420 1.00 85.18  ? 473 VAL B CG2 1 
ATOM   7094  N  N   . GLN B 1 473 ? 87.635  173.937 234.978 1.00 100.02 ? 474 GLN B N   1 
ATOM   7095  C  CA  . GLN B 1 473 ? 86.494  174.825 234.819 1.00 100.65 ? 474 GLN B CA  1 
ATOM   7096  C  C   . GLN B 1 473 ? 85.984  174.771 233.391 1.00 100.53 ? 474 GLN B C   1 
ATOM   7097  O  O   . GLN B 1 473 ? 86.735  174.459 232.484 1.00 100.58 ? 474 GLN B O   1 
ATOM   7098  C  CB  . GLN B 1 473 ? 86.898  176.256 235.147 1.00 101.22 ? 474 GLN B CB  1 
ATOM   7099  C  CG  . GLN B 1 473 ? 87.476  176.434 236.516 1.00 101.60 ? 474 GLN B CG  1 
ATOM   7100  C  CD  . GLN B 1 473 ? 86.530  175.997 237.596 1.00 101.90 ? 474 GLN B CD  1 
ATOM   7101  O  OE1 . GLN B 1 473 ? 85.406  176.473 237.683 1.00 101.96 ? 474 GLN B OE1 1 
ATOM   7102  N  NE2 . GLN B 1 473 ? 86.978  175.079 238.428 1.00 102.08 ? 474 GLN B NE2 1 
ATOM   7103  N  N   . PRO B 1 474 ? 84.700  175.073 233.184 1.00 79.70  ? 475 PRO B N   1 
ATOM   7104  C  CA  . PRO B 1 474 ? 84.135  175.053 231.838 1.00 79.83  ? 475 PRO B CA  1 
ATOM   7105  C  C   . PRO B 1 474 ? 84.860  175.995 230.899 1.00 80.39  ? 475 PRO B C   1 
ATOM   7106  O  O   . PRO B 1 474 ? 84.968  175.707 229.721 1.00 80.40  ? 475 PRO B O   1 
ATOM   7107  C  CB  . PRO B 1 474 ? 82.713  175.542 232.063 1.00 79.56  ? 475 PRO B CB  1 
ATOM   7108  C  CG  . PRO B 1 474 ? 82.409  175.173 233.441 1.00 79.45  ? 475 PRO B CG  1 
ATOM   7109  C  CD  . PRO B 1 474 ? 83.670  175.324 234.200 1.00 79.50  ? 475 PRO B CD  1 
ATOM   7110  N  N   . SER B 1 475 ? 85.349  177.110 231.432 1.00 83.99  ? 476 SER B N   1 
ATOM   7111  C  CA  . SER B 1 475 ? 86.044  178.110 230.630 1.00 84.70  ? 476 SER B CA  1 
ATOM   7112  C  C   . SER B 1 475 ? 87.483  177.702 230.339 1.00 85.71  ? 476 SER B C   1 
ATOM   7113  O  O   . SER B 1 475 ? 88.155  178.310 229.505 1.00 85.76  ? 476 SER B O   1 
ATOM   7114  C  CB  . SER B 1 475 ? 86.022  179.467 231.337 1.00 84.57  ? 476 SER B CB  1 
ATOM   7115  O  OG  . SER B 1 475 ? 86.624  179.384 232.618 1.00 84.50  ? 476 SER B OG  1 
ATOM   7116  N  N   . ASP B 1 476 ? 87.950  176.665 231.025 1.00 104.00 ? 477 ASP B N   1 
ATOM   7117  C  CA  . ASP B 1 476 ? 89.339  176.233 230.897 1.00 105.00 ? 477 ASP B CA  1 
ATOM   7118  C  C   . ASP B 1 476 ? 89.670  175.643 229.544 1.00 105.81 ? 477 ASP B C   1 
ATOM   7119  O  O   . ASP B 1 476 ? 88.816  175.094 228.861 1.00 105.87 ? 477 ASP B O   1 
ATOM   7120  C  CB  . ASP B 1 476 ? 89.708  175.217 231.973 1.00 105.07 ? 477 ASP B CB  1 
ATOM   7121  C  CG  . ASP B 1 476 ? 90.187  175.861 233.244 1.00 105.09 ? 477 ASP B CG  1 
ATOM   7122  O  OD1 . ASP B 1 476 ? 90.206  175.175 234.284 1.00 105.12 ? 477 ASP B OD1 1 
ATOM   7123  O  OD2 . ASP B 1 476 ? 90.544  177.053 233.208 1.00 105.15 1 477 ASP B OD2 1 
ATOM   7124  N  N   . GLN B 1 477 ? 90.932  175.772 229.168 1.00 102.56 ? 478 GLN B N   1 
ATOM   7125  C  CA  . GLN B 1 477 ? 91.426  175.187 227.943 1.00 103.22 ? 478 GLN B CA  1 
ATOM   7126  C  C   . GLN B 1 477 ? 91.375  173.672 228.000 1.00 103.30 ? 478 GLN B C   1 
ATOM   7127  O  O   . GLN B 1 477 ? 91.539  173.068 229.047 1.00 103.33 ? 478 GLN B O   1 
ATOM   7128  C  CB  . GLN B 1 477 ? 92.849  175.656 227.675 1.00 103.61 ? 478 GLN B CB  1 
ATOM   7129  C  CG  . GLN B 1 477 ? 92.967  177.123 227.291 1.00 103.83 ? 478 GLN B CG  1 
ATOM   7130  C  CD  . GLN B 1 477 ? 92.810  177.351 225.804 1.00 103.97 ? 478 GLN B CD  1 
ATOM   7131  O  OE1 . GLN B 1 477 ? 92.378  176.468 225.079 1.00 103.82 ? 478 GLN B OE1 1 
ATOM   7132  N  NE2 . GLN B 1 477 ? 93.167  178.537 225.346 1.00 104.08 ? 478 GLN B NE2 1 
ATOM   7133  N  N   . VAL B 1 478 ? 91.136  173.072 226.850 1.00 109.51 ? 479 VAL B N   1 
ATOM   7134  C  CA  . VAL B 1 478 ? 91.000  171.637 226.724 1.00 109.42 ? 479 VAL B CA  1 
ATOM   7135  C  C   . VAL B 1 478 ? 92.313  170.917 226.992 1.00 109.17 ? 479 VAL B C   1 
ATOM   7136  O  O   . VAL B 1 478 ? 92.334  169.761 227.392 1.00 109.13 ? 479 VAL B O   1 
ATOM   7137  C  CB  . VAL B 1 478 ? 90.407  171.310 225.355 1.00 109.48 ? 479 VAL B CB  1 
ATOM   7138  C  CG1 . VAL B 1 478 ? 90.685  169.904 224.942 1.00 109.42 ? 479 VAL B CG1 1 
ATOM   7139  C  CG2 . VAL B 1 478 ? 88.936  171.538 225.412 1.00 109.49 ? 479 VAL B CG2 1 
ATOM   7140  N  N   . GLY B 1 479 ? 93.415  171.632 226.851 1.00 120.25 ? 480 GLY B N   1 
ATOM   7141  C  CA  . GLY B 1 479 ? 94.720  171.022 226.990 1.00 119.81 ? 480 GLY B CA  1 
ATOM   7142  C  C   . GLY B 1 479 ? 94.989  170.552 228.401 1.00 119.23 ? 480 GLY B C   1 
ATOM   7143  O  O   . GLY B 1 479 ? 95.886  169.755 228.642 1.00 119.18 ? 480 GLY B O   1 
ATOM   7144  N  N   . LYS B 1 480 ? 94.207  171.051 229.342 1.00 101.08 ? 481 LYS B N   1 
ATOM   7145  C  CA  . LYS B 1 480 ? 94.333  170.620 230.723 1.00 100.38 ? 481 LYS B CA  1 
ATOM   7146  C  C   . LYS B 1 480 ? 93.973  169.146 230.906 1.00 98.29  ? 481 LYS B C   1 
ATOM   7147  O  O   . LYS B 1 480 ? 94.431  168.504 231.840 1.00 98.15  ? 481 LYS B O   1 
ATOM   7148  C  CB  . LYS B 1 480 ? 93.455  171.488 231.632 1.00 101.52 ? 481 LYS B CB  1 
ATOM   7149  C  CG  . LYS B 1 480 ? 94.051  172.843 232.031 1.00 102.50 ? 481 LYS B CG  1 
ATOM   7150  C  CD  . LYS B 1 480 ? 93.303  173.439 233.221 1.00 103.24 ? 481 LYS B CD  1 
ATOM   7151  C  CE  . LYS B 1 480 ? 94.131  174.462 233.972 1.00 103.76 ? 481 LYS B CE  1 
ATOM   7152  N  NZ  . LYS B 1 480 ? 94.232  175.747 233.245 1.00 103.99 1 481 LYS B NZ  1 
ATOM   7153  N  N   . VAL B 1 481 ? 93.151  168.621 230.004 1.00 84.81  ? 482 VAL B N   1 
ATOM   7154  C  CA  . VAL B 1 481 ? 92.532  167.312 230.190 1.00 82.78  ? 482 VAL B CA  1 
ATOM   7155  C  C   . VAL B 1 481 ? 92.734  166.402 228.978 1.00 81.21  ? 482 VAL B C   1 
ATOM   7156  O  O   . VAL B 1 481 ? 92.229  165.289 228.921 1.00 81.08  ? 482 VAL B O   1 
ATOM   7157  C  CB  . VAL B 1 481 ? 91.031  167.479 230.474 1.00 82.46  ? 482 VAL B CB  1 
ATOM   7158  C  CG1 . VAL B 1 481 ? 90.292  167.701 229.196 1.00 82.37  ? 482 VAL B CG1 1 
ATOM   7159  C  CG2 . VAL B 1 481 ? 90.477  166.285 231.208 1.00 82.31  ? 482 VAL B CG2 1 
ATOM   7160  N  N   . ILE B 1 482 ? 93.487  166.886 228.009 1.00 82.20  ? 483 ILE B N   1 
ATOM   7161  C  CA  . ILE B 1 482 ? 93.723  166.140 226.791 1.00 80.84  ? 483 ILE B CA  1 
ATOM   7162  C  C   . ILE B 1 482 ? 94.558  164.889 227.020 1.00 79.88  ? 483 ILE B C   1 
ATOM   7163  O  O   . ILE B 1 482 ? 95.474  164.886 227.823 1.00 79.79  ? 483 ILE B O   1 
ATOM   7164  C  CB  . ILE B 1 482 ? 94.396  167.040 225.762 1.00 80.57  ? 483 ILE B CB  1 
ATOM   7165  C  CG1 . ILE B 1 482 ? 94.618  166.308 224.451 1.00 80.37  ? 483 ILE B CG1 1 
ATOM   7166  C  CG2 . ILE B 1 482 ? 95.698  167.563 226.289 1.00 80.62  ? 483 ILE B CG2 1 
ATOM   7167  C  CD1 . ILE B 1 482 ? 95.225  167.176 223.400 1.00 80.27  ? 483 ILE B CD1 1 
ATOM   7168  N  N   . TYR B 1 483 ? 94.224  163.817 226.319 1.00 80.04  ? 484 TYR B N   1 
ATOM   7169  C  CA  . TYR B 1 483 ? 95.049  162.629 226.325 1.00 79.29  ? 484 TYR B CA  1 
ATOM   7170  C  C   . TYR B 1 483 ? 96.127  162.790 225.271 1.00 79.69  ? 484 TYR B C   1 
ATOM   7171  O  O   . TYR B 1 483 ? 95.881  162.589 224.093 1.00 79.65  ? 484 TYR B O   1 
ATOM   7172  C  CB  . TYR B 1 483 ? 94.222  161.394 226.008 1.00 78.52  ? 484 TYR B CB  1 
ATOM   7173  C  CG  . TYR B 1 483 ? 93.142  161.063 226.999 1.00 77.81  ? 484 TYR B CG  1 
ATOM   7174  C  CD1 . TYR B 1 483 ? 93.249  161.412 228.324 1.00 77.44  ? 484 TYR B CD1 1 
ATOM   7175  C  CD2 . TYR B 1 483 ? 92.014  160.391 226.601 1.00 77.44  ? 484 TYR B CD2 1 
ATOM   7176  C  CE1 . TYR B 1 483 ? 92.255  161.099 229.217 1.00 77.20  ? 484 TYR B CE1 1 
ATOM   7177  C  CE2 . TYR B 1 483 ? 91.025  160.075 227.480 1.00 77.20  ? 484 TYR B CE2 1 
ATOM   7178  C  CZ  . TYR B 1 483 ? 91.146  160.429 228.784 1.00 77.13  ? 484 TYR B CZ  1 
ATOM   7179  O  OH  . TYR B 1 483 ? 90.138  160.100 229.647 1.00 77.15  ? 484 TYR B OH  1 
ATOM   7180  N  N   . LYS B 1 484 ? 97.323  163.164 225.702 1.00 88.01  ? 485 LYS B N   1 
ATOM   7181  C  CA  . LYS B 1 484 ? 98.417  163.468 224.788 1.00 88.45  ? 485 LYS B CA  1 
ATOM   7182  C  C   . LYS B 1 484 ? 98.998  162.276 224.026 1.00 88.57  ? 485 LYS B C   1 
ATOM   7183  O  O   . LYS B 1 484 ? 99.607  162.451 222.981 1.00 88.57  ? 485 LYS B O   1 
ATOM   7184  C  CB  . LYS B 1 484 ? 99.537  164.189 225.533 1.00 88.72  ? 485 LYS B CB  1 
ATOM   7185  C  CG  . LYS B 1 484 ? 99.112  165.443 226.267 1.00 88.98  ? 485 LYS B CG  1 
ATOM   7186  C  CD  . LYS B 1 484 ? 99.725  166.684 225.651 1.00 89.20  ? 485 LYS B CD  1 
ATOM   7187  C  CE  . LYS B 1 484 ? 99.766  167.835 226.636 1.00 89.38  ? 485 LYS B CE  1 
ATOM   7188  N  NZ  . LYS B 1 484 ? 100.604 167.513 227.816 1.00 89.46  1 485 LYS B NZ  1 
ATOM   7189  N  N   . GLN B 1 485 ? 98.827  161.071 224.551 1.00 79.30  ? 486 GLN B N   1 
ATOM   7190  C  CA  . GLN B 1 485 ? 99.510  159.912 223.990 1.00 79.51  ? 486 GLN B CA  1 
ATOM   7191  C  C   . GLN B 1 485 ? 98.649  159.027 223.097 1.00 80.26  ? 486 GLN B C   1 
ATOM   7192  O  O   . GLN B 1 485 ? 97.586  158.583 223.496 1.00 80.30  ? 486 GLN B O   1 
ATOM   7193  C  CB  . GLN B 1 485 ? 100.136 159.086 225.111 1.00 79.08  ? 486 GLN B CB  1 
ATOM   7194  C  CG  . GLN B 1 485 ? 100.975 157.933 224.637 1.00 78.81  ? 486 GLN B CG  1 
ATOM   7195  C  CD  . GLN B 1 485 ? 101.770 157.297 225.748 1.00 78.62  ? 486 GLN B CD  1 
ATOM   7196  O  OE1 . GLN B 1 485 ? 102.174 157.962 226.691 1.00 78.59  ? 486 GLN B OE1 1 
ATOM   7197  N  NE2 . GLN B 1 485 ? 101.998 156.000 225.642 1.00 78.52  ? 486 GLN B NE2 1 
ATOM   7198  N  N   . PHE B 1 486 ? 99.140  158.758 221.891 1.00 79.73  ? 487 PHE B N   1 
ATOM   7199  C  CA  . PHE B 1 486 ? 98.433  157.932 220.919 1.00 80.58  ? 487 PHE B CA  1 
ATOM   7200  C  C   . PHE B 1 486 ? 99.352  157.439 219.809 1.00 81.99  ? 487 PHE B C   1 
ATOM   7201  O  O   . PHE B 1 486 ? 100.482 157.884 219.685 1.00 82.08  ? 487 PHE B O   1 
ATOM   7202  C  CB  . PHE B 1 486 ? 97.297  158.715 220.288 1.00 80.21  ? 487 PHE B CB  1 
ATOM   7203  C  CG  . PHE B 1 486 ? 97.757  159.824 219.415 1.00 79.83  ? 487 PHE B CG  1 
ATOM   7204  C  CD1 . PHE B 1 486 ? 98.046  161.052 219.945 1.00 79.66  ? 487 PHE B CD1 1 
ATOM   7205  C  CD2 . PHE B 1 486 ? 97.903  159.641 218.067 1.00 79.66  ? 487 PHE B CD2 1 
ATOM   7206  C  CE1 . PHE B 1 486 ? 98.468  162.069 219.150 1.00 79.54  ? 487 PHE B CE1 1 
ATOM   7207  C  CE2 . PHE B 1 486 ? 98.329  160.656 217.275 1.00 79.55  ? 487 PHE B CE2 1 
ATOM   7208  C  CZ  . PHE B 1 486 ? 98.613  161.871 217.817 1.00 79.49  ? 487 PHE B CZ  1 
ATOM   7209  N  N   . LYS B 1 487 ? 98.840  156.535 218.986 1.00 88.37  ? 488 LYS B N   1 
ATOM   7210  C  CA  . LYS B 1 487 ? 99.578  156.021 217.847 1.00 89.90  ? 488 LYS B CA  1 
ATOM   7211  C  C   . LYS B 1 487 ? 98.695  156.047 216.608 1.00 91.04  ? 488 LYS B C   1 
ATOM   7212  O  O   . LYS B 1 487 ? 97.504  155.790 216.691 1.00 91.08  ? 488 LYS B O   1 
ATOM   7213  C  CB  . LYS B 1 487 ? 100.027 154.596 218.133 1.00 90.22  ? 488 LYS B CB  1 
ATOM   7214  C  CG  . LYS B 1 487 ? 100.938 153.986 217.094 1.00 90.51  ? 488 LYS B CG  1 
ATOM   7215  C  CD  . LYS B 1 487 ? 102.277 154.655 217.095 1.00 90.70  ? 488 LYS B CD  1 
ATOM   7216  C  CE  . LYS B 1 487 ? 103.265 153.928 216.212 1.00 90.87  ? 488 LYS B CE  1 
ATOM   7217  N  NZ  . LYS B 1 487 ? 103.857 152.762 216.899 1.00 90.95  1 488 LYS B NZ  1 
ATOM   7218  N  N   . GLN B 1 488 ? 99.280  156.379 215.462 1.00 98.93  ? 489 GLN B N   1 
ATOM   7219  C  CA  . GLN B 1 488 ? 98.550  156.402 214.198 1.00 100.06 ? 489 GLN B CA  1 
ATOM   7220  C  C   . GLN B 1 488 ? 98.633  155.084 213.448 1.00 100.91 ? 489 GLN B C   1 
ATOM   7221  O  O   . GLN B 1 488 ? 99.625  154.383 213.545 1.00 100.96 ? 489 GLN B O   1 
ATOM   7222  C  CB  . GLN B 1 488 ? 99.088  157.510 213.301 1.00 100.29 ? 489 GLN B CB  1 
ATOM   7223  C  CG  . GLN B 1 488 ? 99.027  158.884 213.914 1.00 100.43 ? 489 GLN B CG  1 
ATOM   7224  C  CD  . GLN B 1 488 ? 99.394  159.973 212.936 1.00 100.56 ? 489 GLN B CD  1 
ATOM   7225  O  OE1 . GLN B 1 488 ? 99.568  159.720 211.752 1.00 100.59 ? 489 GLN B OE1 1 
ATOM   7226  N  NE2 . GLN B 1 488 ? 99.517  161.193 213.428 1.00 100.62 ? 489 GLN B NE2 1 
ATOM   7227  N  N   . ILE B 1 489 ? 97.606  154.759 212.673 1.00 96.14  ? 490 ILE B N   1 
ATOM   7228  C  CA  . ILE B 1 489 ? 97.653  153.573 211.828 1.00 96.96  ? 490 ILE B CA  1 
ATOM   7229  C  C   . ILE B 1 489 ? 96.923  153.739 210.515 1.00 98.12  ? 490 ILE B C   1 
ATOM   7230  O  O   . ILE B 1 489 ? 95.965  154.485 210.419 1.00 98.14  ? 490 ILE B O   1 
ATOM   7231  C  CB  . ILE B 1 489 ? 97.035  152.356 212.499 1.00 96.68  ? 490 ILE B CB  1 
ATOM   7232  C  CG1 . ILE B 1 489 ? 95.823  152.754 213.320 1.00 96.53  ? 490 ILE B CG1 1 
ATOM   7233  C  CG2 . ILE B 1 489 ? 98.026  151.678 213.365 1.00 96.55  ? 490 ILE B CG2 1 
ATOM   7234  C  CD1 . ILE B 1 489 ? 95.023  151.579 213.777 1.00 96.46  ? 490 ILE B CD1 1 
ATOM   7235  N  N   . ARG B 1 490 ? 97.393  153.026 209.501 1.00 116.77 ? 491 ARG B N   1 
ATOM   7236  C  CA  . ARG B 1 490 ? 96.755  153.010 208.196 1.00 117.83 ? 491 ARG B CA  1 
ATOM   7237  C  C   . ARG B 1 490 ? 95.521  152.132 208.194 1.00 117.59 ? 491 ARG B C   1 
ATOM   7238  O  O   . ARG B 1 490 ? 95.412  151.222 208.995 1.00 117.69 ? 491 ARG B O   1 
ATOM   7239  C  CB  . ARG B 1 490 ? 97.744  152.544 207.130 1.00 118.98 ? 491 ARG B CB  1 
ATOM   7240  C  CG  . ARG B 1 490 ? 98.750  153.605 206.726 1.00 119.91 ? 491 ARG B CG  1 
ATOM   7241  C  CD  . ARG B 1 490 ? 99.737  153.098 205.690 1.00 120.72 ? 491 ARG B CD  1 
ATOM   7242  N  NE  . ARG B 1 490 ? 100.816 152.321 206.291 1.00 121.35 ? 491 ARG B NE  1 
ATOM   7243  C  CZ  . ARG B 1 490 ? 101.970 152.836 206.702 1.00 121.95 ? 491 ARG B CZ  1 
ATOM   7244  N  NH1 . ARG B 1 490 ? 102.202 154.135 206.582 1.00 122.17 1 491 ARG B NH1 1 
ATOM   7245  N  NH2 . ARG B 1 490 ? 102.893 152.050 207.237 1.00 122.18 ? 491 ARG B NH2 1 
ATOM   7246  N  N   . LEU B 1 491 ? 94.595  152.416 207.287 1.00 95.65  ? 492 LEU B N   1 
ATOM   7247  C  CA  . LEU B 1 491 ? 93.414  151.585 207.095 1.00 95.38  ? 492 LEU B CA  1 
ATOM   7248  C  C   . LEU B 1 491 ? 93.824  150.200 206.638 1.00 95.71  ? 492 LEU B C   1 
ATOM   7249  O  O   . LEU B 1 491 ? 93.087  149.233 206.777 1.00 95.85  ? 492 LEU B O   1 
ATOM   7250  C  CB  . LEU B 1 491 ? 92.496  152.209 206.048 1.00 94.89  ? 492 LEU B CB  1 
ATOM   7251  C  CG  . LEU B 1 491 ? 91.483  153.257 206.501 1.00 94.47  ? 492 LEU B CG  1 
ATOM   7252  C  CD1 . LEU B 1 491 ? 91.020  154.100 205.335 1.00 94.33  ? 492 LEU B CD1 1 
ATOM   7253  C  CD2 . LEU B 1 491 ? 90.302  152.584 207.155 1.00 94.29  ? 492 LEU B CD2 1 
ATOM   7254  N  N   . THR B 1 492 ? 95.010  150.130 206.061 1.00 104.90 ? 493 THR B N   1 
ATOM   7255  C  CA  . THR B 1 492 ? 95.545  148.902 205.515 1.00 105.12 ? 493 THR B CA  1 
ATOM   7256  C  C   . THR B 1 492 ? 96.425  148.125 206.487 1.00 105.24 ? 493 THR B C   1 
ATOM   7257  O  O   . THR B 1 492 ? 97.088  147.178 206.095 1.00 105.39 ? 493 THR B O   1 
ATOM   7258  C  CB  . THR B 1 492 ? 96.328  149.183 204.224 1.00 105.12 ? 493 THR B CB  1 
ATOM   7259  O  OG1 . THR B 1 492 ? 97.222  150.278 204.425 1.00 105.11 ? 493 THR B OG1 1 
ATOM   7260  C  CG2 . THR B 1 492 ? 95.370  149.536 203.111 1.00 105.12 ? 493 THR B CG2 1 
ATOM   7261  N  N   . ASP B 1 493 ? 96.481  148.557 207.740 1.00 102.90 ? 494 ASP B N   1 
ATOM   7262  C  CA  . ASP B 1 493 ? 97.265  147.845 208.745 1.00 102.80 ? 494 ASP B CA  1 
ATOM   7263  C  C   . ASP B 1 493 ? 96.573  146.604 209.282 1.00 102.53 ? 494 ASP B C   1 
ATOM   7264  O  O   . ASP B 1 493 ? 95.353  146.551 209.353 1.00 102.64 ? 494 ASP B O   1 
ATOM   7265  C  CB  . ASP B 1 493 ? 97.632  148.774 209.889 1.00 102.90 ? 494 ASP B CB  1 
ATOM   7266  C  CG  . ASP B 1 493 ? 98.876  149.562 209.610 1.00 102.95 ? 494 ASP B CG  1 
ATOM   7267  O  OD1 . ASP B 1 493 ? 99.834  148.978 209.076 1.00 102.98 ? 494 ASP B OD1 1 
ATOM   7268  O  OD2 . ASP B 1 493 ? 98.898  150.765 209.923 1.00 102.97 1 494 ASP B OD2 1 
ATOM   7269  N  N   . THR B 1 494 ? 97.361  145.607 209.665 1.00 105.93 ? 495 THR B N   1 
ATOM   7270  C  CA  . THR B 1 494 ? 96.816  144.360 210.187 1.00 105.56 ? 495 THR B CA  1 
ATOM   7271  C  C   . THR B 1 494 ? 96.341  144.485 211.622 1.00 105.09 ? 495 THR B C   1 
ATOM   7272  O  O   . THR B 1 494 ? 96.868  145.282 212.381 1.00 105.02 ? 495 THR B O   1 
ATOM   7273  C  CB  . THR B 1 494 ? 97.819  143.202 210.065 1.00 105.62 ? 495 THR B CB  1 
ATOM   7274  O  OG1 . THR B 1 494 ? 97.330  142.068 210.790 1.00 105.68 ? 495 THR B OG1 1 
ATOM   7275  C  CG2 . THR B 1 494 ? 99.160  143.601 210.624 1.00 105.64 ? 495 THR B CG2 1 
ATOM   7276  N  N   . LEU B 1 495 ? 95.349  143.683 211.990 1.00 99.86  ? 496 LEU B N   1 
ATOM   7277  C  CA  . LEU B 1 495 ? 94.783  143.730 213.334 1.00 99.40  ? 496 LEU B CA  1 
ATOM   7278  C  C   . LEU B 1 495 ? 95.792  143.364 214.405 1.00 99.10  ? 496 LEU B C   1 
ATOM   7279  O  O   . LEU B 1 495 ? 95.723  143.852 215.527 1.00 99.06  ? 496 LEU B O   1 
ATOM   7280  C  CB  . LEU B 1 495 ? 93.578  142.807 213.448 1.00 99.30  ? 496 LEU B CB  1 
ATOM   7281  C  CG  . LEU B 1 495 ? 92.282  143.353 212.872 1.00 99.12  ? 496 LEU B CG  1 
ATOM   7282  C  CD1 . LEU B 1 495 ? 91.141  142.435 213.215 1.00 99.05  ? 496 LEU B CD1 1 
ATOM   7283  C  CD2 . LEU B 1 495 ? 92.021  144.721 213.411 1.00 99.06  ? 496 LEU B CD2 1 
ATOM   7284  N  N   . GLY B 1 496 ? 96.736  142.506 214.058 1.00 102.14 ? 497 GLY B N   1 
ATOM   7285  C  CA  . GLY B 1 496 ? 97.755  142.119 215.004 1.00 101.81 ? 497 GLY B CA  1 
ATOM   7286  C  C   . GLY B 1 496 ? 98.671  143.283 215.291 1.00 101.40 ? 497 GLY B C   1 
ATOM   7287  O  O   . GLY B 1 496 ? 99.127  143.461 216.412 1.00 101.35 ? 497 GLY B O   1 
ATOM   7288  N  N   . ARG B 1 497 ? 98.931  144.086 214.270 1.00 103.12 ? 498 ARG B N   1 
ATOM   7289  C  CA  . ARG B 1 497 ? 99.751  145.264 214.440 1.00 102.72 ? 498 ARG B CA  1 
ATOM   7290  C  C   . ARG B 1 497 ? 99.052  146.194 215.399 1.00 101.79 ? 498 ARG B C   1 
ATOM   7291  O  O   . ARG B 1 497 ? 99.676  146.830 216.244 1.00 101.67 ? 498 ARG B O   1 
ATOM   7292  C  CB  . ARG B 1 497 ? 99.925  145.963 213.102 1.00 103.12 ? 498 ARG B CB  1 
ATOM   7293  C  CG  . ARG B 1 497 ? 100.585 147.312 213.186 1.00 103.47 ? 498 ARG B CG  1 
ATOM   7294  C  CD  . ARG B 1 497 ? 102.080 147.189 213.077 1.00 103.72 ? 498 ARG B CD  1 
ATOM   7295  N  NE  . ARG B 1 497 ? 102.742 148.475 213.245 1.00 103.97 ? 498 ARG B NE  1 
ATOM   7296  C  CZ  . ARG B 1 497 ? 103.323 148.874 214.368 1.00 104.16 ? 498 ARG B CZ  1 
ATOM   7297  N  NH1 . ARG B 1 497 ? 103.335 148.084 215.424 1.00 104.23 1 498 ARG B NH1 1 
ATOM   7298  N  NH2 . ARG B 1 497 ? 103.901 150.061 214.428 1.00 104.23 ? 498 ARG B NH2 1 
ATOM   7299  N  N   . LEU B 1 498 ? 97.736  146.242 215.292 1.00 94.89  ? 499 LEU B N   1 
ATOM   7300  C  CA  . LEU B 1 498 ? 96.967  147.058 216.199 1.00 94.00  ? 499 LEU B CA  1 
ATOM   7301  C  C   . LEU B 1 498 ? 97.099  146.504 217.598 1.00 93.29  ? 499 LEU B C   1 
ATOM   7302  O  O   . LEU B 1 498 ? 97.234  147.249 218.554 1.00 93.06  ? 499 LEU B O   1 
ATOM   7303  C  CB  . LEU B 1 498 ? 95.502  147.080 215.781 1.00 93.89  ? 499 LEU B CB  1 
ATOM   7304  C  CG  . LEU B 1 498 ? 94.528  147.678 216.793 1.00 93.77  ? 499 LEU B CG  1 
ATOM   7305  C  CD1 . LEU B 1 498 ? 94.665  149.173 216.841 1.00 93.75  ? 499 LEU B CD1 1 
ATOM   7306  C  CD2 . LEU B 1 498 ? 93.105  147.282 216.479 1.00 93.72  ? 499 LEU B CD2 1 
ATOM   7307  N  N   . SER B 1 499 ? 97.099  145.186 217.716 1.00 88.09  ? 500 SER B N   1 
ATOM   7308  C  CA  . SER B 1 499 ? 97.202  144.577 219.029 1.00 87.51  ? 500 SER B CA  1 
ATOM   7309  C  C   . SER B 1 499 ? 98.544  144.865 219.676 1.00 86.95  ? 500 SER B C   1 
ATOM   7310  O  O   . SER B 1 499 ? 98.629  145.024 220.882 1.00 86.84  ? 500 SER B O   1 
ATOM   7311  C  CB  . SER B 1 499 ? 96.956  143.076 218.952 1.00 87.54  ? 500 SER B CB  1 
ATOM   7312  O  OG  . SER B 1 499 ? 96.611  142.554 220.220 1.00 87.58  ? 500 SER B OG  1 
ATOM   7313  N  N   . HIS B 1 500 ? 99.594  144.938 218.871 1.00 105.61 ? 501 HIS B N   1 
ATOM   7314  C  CA  . HIS B 1 500 ? 100.892 145.326 219.392 1.00 105.08 ? 501 HIS B CA  1 
ATOM   7315  C  C   . HIS B 1 500 ? 100.891 146.771 219.817 1.00 103.70 ? 501 HIS B C   1 
ATOM   7316  O  O   . HIS B 1 500 ? 101.505 147.140 220.804 1.00 103.57 ? 501 HIS B O   1 
ATOM   7317  C  CB  . HIS B 1 500 ? 101.989 145.112 218.356 1.00 105.69 ? 501 HIS B CB  1 
ATOM   7318  C  CG  . HIS B 1 500 ? 102.574 143.739 218.377 1.00 106.28 ? 501 HIS B CG  1 
ATOM   7319  N  ND1 . HIS B 1 500 ? 103.139 143.190 219.505 1.00 106.54 ? 501 HIS B ND1 1 
ATOM   7320  C  CD2 . HIS B 1 500 ? 102.680 142.803 217.408 1.00 106.58 ? 501 HIS B CD2 1 
ATOM   7321  C  CE1 . HIS B 1 500 ? 103.562 141.970 219.233 1.00 106.71 ? 501 HIS B CE1 1 
ATOM   7322  N  NE2 . HIS B 1 500 ? 103.296 141.711 217.966 1.00 106.72 ? 501 HIS B NE2 1 
ATOM   7323  N  N   . ILE B 1 501 ? 100.202 147.598 219.054 1.00 93.30  ? 502 ILE B N   1 
ATOM   7324  C  CA  . ILE B 1 501 ? 100.144 149.006 219.377 1.00 92.02  ? 502 ILE B CA  1 
ATOM   7325  C  C   . ILE B 1 501 ? 99.386  149.243 220.666 1.00 90.55  ? 502 ILE B C   1 
ATOM   7326  O  O   . ILE B 1 501 ? 99.689  150.154 221.420 1.00 90.43  ? 502 ILE B O   1 
ATOM   7327  C  CB  . ILE B 1 501 ? 99.529  149.784 218.230 1.00 92.20  ? 502 ILE B CB  1 
ATOM   7328  C  CG1 . ILE B 1 501 ? 100.495 149.767 217.061 1.00 92.33  ? 502 ILE B CG1 1 
ATOM   7329  C  CG2 . ILE B 1 501 ? 99.242  151.202 218.628 1.00 92.23  ? 502 ILE B CG2 1 
ATOM   7330  C  CD1 . ILE B 1 501 ? 100.066 150.594 215.927 1.00 92.42  ? 502 ILE B CD1 1 
ATOM   7331  N  N   . LEU B 1 502 ? 98.435  148.374 220.951 1.00 73.92  ? 503 LEU B N   1 
ATOM   7332  C  CA  . LEU B 1 502 ? 97.584  148.571 222.104 1.00 72.65  ? 503 LEU B CA  1 
ATOM   7333  C  C   . LEU B 1 502 ? 98.258  148.161 223.392 1.00 72.53  ? 503 LEU B C   1 
ATOM   7334  O  O   . LEU B 1 502 ? 97.736  148.387 224.467 1.00 72.44  ? 503 LEU B O   1 
ATOM   7335  C  CB  . LEU B 1 502 ? 96.264  147.848 221.919 1.00 71.86  ? 503 LEU B CB  1 
ATOM   7336  C  CG  . LEU B 1 502 ? 95.471  148.466 220.780 1.00 71.25  ? 503 LEU B CG  1 
ATOM   7337  C  CD1 . LEU B 1 502 ? 94.202  147.715 220.544 1.00 71.00  ? 503 LEU B CD1 1 
ATOM   7338  C  CD2 . LEU B 1 502 ? 95.189  149.913 221.061 1.00 71.03  ? 503 LEU B CD2 1 
ATOM   7339  N  N   . GLU B 1 503 ? 99.424  147.553 223.275 1.00 86.15  ? 504 GLU B N   1 
ATOM   7340  C  CA  . GLU B 1 503 ? 100.229 147.231 224.437 1.00 86.12  ? 504 GLU B CA  1 
ATOM   7341  C  C   . GLU B 1 503 ? 101.046 148.421 224.930 1.00 86.07  ? 504 GLU B C   1 
ATOM   7342  O  O   . GLU B 1 503 ? 101.662 148.357 225.979 1.00 86.03  ? 504 GLU B O   1 
ATOM   7343  C  CB  . GLU B 1 503 ? 101.133 146.035 224.144 1.00 86.12  ? 504 GLU B CB  1 
ATOM   7344  C  CG  . GLU B 1 503 ? 100.373 144.748 223.895 1.00 86.14  ? 504 GLU B CG  1 
ATOM   7345  C  CD  . GLU B 1 503 ? 101.270 143.545 223.698 1.00 86.15  ? 504 GLU B CD  1 
ATOM   7346  O  OE1 . GLU B 1 503 ? 102.427 143.718 223.280 1.00 86.16  ? 504 GLU B OE1 1 
ATOM   7347  O  OE2 . GLU B 1 503 ? 100.811 142.421 223.969 1.00 86.15  1 504 GLU B OE2 1 
ATOM   7348  N  N   . MET B 1 504 ? 101.052 149.505 224.169 1.00 88.02  ? 505 MET B N   1 
ATOM   7349  C  CA  . MET B 1 504 ? 101.774 150.700 224.577 1.00 88.07  ? 505 MET B CA  1 
ATOM   7350  C  C   . MET B 1 504 ? 100.884 151.926 224.635 1.00 87.77  ? 505 MET B C   1 
ATOM   7351  O  O   . MET B 1 504 ? 101.150 152.857 225.383 1.00 87.76  ? 505 MET B O   1 
ATOM   7352  C  CB  . MET B 1 504 ? 102.947 150.974 223.643 1.00 88.33  ? 505 MET B CB  1 
ATOM   7353  C  CG  . MET B 1 504 ? 104.091 150.010 223.779 1.00 88.51  ? 505 MET B CG  1 
ATOM   7354  S  SD  . MET B 1 504 ? 104.879 150.087 225.380 1.00 88.68  ? 505 MET B SD  1 
ATOM   7355  C  CE  . MET B 1 504 ? 106.228 148.962 225.100 1.00 88.81  ? 505 MET B CE  1 
ATOM   7356  N  N   . ASP B 1 505 ? 99.831  151.932 223.832 1.00 78.81  ? 506 ASP B N   1 
ATOM   7357  C  CA  . ASP B 1 505 ? 98.939  153.075 223.777 1.00 78.60  ? 506 ASP B CA  1 
ATOM   7358  C  C   . ASP B 1 505 ? 97.492  152.641 223.910 1.00 78.65  ? 506 ASP B C   1 
ATOM   7359  O  O   . ASP B 1 505 ? 97.124  151.556 223.501 1.00 78.65  ? 506 ASP B O   1 
ATOM   7360  C  CB  . ASP B 1 505 ? 99.130  153.840 222.471 1.00 78.46  ? 506 ASP B CB  1 
ATOM   7361  C  CG  . ASP B 1 505 ? 100.552 154.294 222.260 1.00 78.41  ? 506 ASP B CG  1 
ATOM   7362  O  OD1 . ASP B 1 505 ? 100.939 155.334 222.808 1.00 78.41  ? 506 ASP B OD1 1 
ATOM   7363  O  OD2 . ASP B 1 505 ? 101.286 153.620 221.524 1.00 78.38  1 506 ASP B OD2 1 
ATOM   7364  N  N   . HIS B 1 506 ? 96.676  153.498 224.500 1.00 71.94  ? 507 HIS B N   1 
ATOM   7365  C  CA  . HIS B 1 506 ? 95.259  153.230 224.640 1.00 72.10  ? 507 HIS B CA  1 
ATOM   7366  C  C   . HIS B 1 506 ? 94.540  153.506 223.343 1.00 73.33  ? 507 HIS B C   1 
ATOM   7367  O  O   . HIS B 1 506 ? 93.664  152.764 222.941 1.00 73.41  ? 507 HIS B O   1 
ATOM   7368  C  CB  . HIS B 1 506 ? 94.675  154.099 225.747 1.00 71.40  ? 507 HIS B CB  1 
ATOM   7369  C  CG  . HIS B 1 506 ? 93.201  153.942 225.929 1.00 70.82  ? 507 HIS B CG  1 
ATOM   7370  N  ND1 . HIS B 1 506 ? 92.315  154.968 225.704 1.00 70.57  ? 507 HIS B ND1 1 
ATOM   7371  C  CD2 . HIS B 1 506 ? 92.459  152.884 226.323 1.00 70.67  ? 507 HIS B CD2 1 
ATOM   7372  C  CE1 . HIS B 1 506 ? 91.089  154.548 225.945 1.00 70.42  ? 507 HIS B CE1 1 
ATOM   7373  N  NE2 . HIS B 1 506 ? 91.148  153.287 226.323 1.00 70.48  ? 507 HIS B NE2 1 
ATOM   7374  N  N   . PHE B 1 507 ? 94.926  154.588 222.689 1.00 93.12  ? 508 PHE B N   1 
ATOM   7375  C  CA  . PHE B 1 507 ? 94.286  155.006 221.456 1.00 94.40  ? 508 PHE B CA  1 
ATOM   7376  C  C   . PHE B 1 507 ? 95.099  154.682 220.226 1.00 95.26  ? 508 PHE B C   1 
ATOM   7377  O  O   . PHE B 1 507 ? 96.302  154.864 220.198 1.00 95.33  ? 508 PHE B O   1 
ATOM   7378  C  CB  . PHE B 1 507 ? 94.043  156.508 221.466 1.00 94.72  ? 508 PHE B CB  1 
ATOM   7379  C  CG  . PHE B 1 507 ? 92.979  156.940 222.404 1.00 94.99  ? 508 PHE B CG  1 
ATOM   7380  C  CD1 . PHE B 1 507 ? 93.288  157.657 223.526 1.00 95.13  ? 508 PHE B CD1 1 
ATOM   7381  C  CD2 . PHE B 1 507 ? 91.666  156.634 222.161 1.00 95.18  ? 508 PHE B CD2 1 
ATOM   7382  C  CE1 . PHE B 1 507 ? 92.309  158.056 224.387 1.00 95.21  ? 508 PHE B CE1 1 
ATOM   7383  C  CE2 . PHE B 1 507 ? 90.683  157.039 223.023 1.00 95.26  ? 508 PHE B CE2 1 
ATOM   7384  C  CZ  . PHE B 1 507 ? 91.008  157.749 224.137 1.00 95.28  ? 508 PHE B CZ  1 
ATOM   7385  N  N   . ALA B 1 508 ? 94.414  154.229 219.193 1.00 85.95  ? 509 ALA B N   1 
ATOM   7386  C  CA  . ALA B 1 508 ? 95.015  154.096 217.891 1.00 86.77  ? 509 ALA B CA  1 
ATOM   7387  C  C   . ALA B 1 508 ? 94.155  154.848 216.904 1.00 87.47  ? 509 ALA B C   1 
ATOM   7388  O  O   . ALA B 1 508 ? 93.020  154.475 216.662 1.00 87.53  ? 509 ALA B O   1 
ATOM   7389  C  CB  . ALA B 1 508 ? 95.091  152.665 217.510 1.00 86.82  ? 509 ALA B CB  1 
ATOM   7390  N  N   . LEU B 1 509 ? 94.695  155.920 216.343 1.00 85.48  ? 510 LEU B N   1 
ATOM   7391  C  CA  . LEU B 1 509 ? 93.975  156.690 215.348 1.00 86.15  ? 510 LEU B CA  1 
ATOM   7392  C  C   . LEU B 1 509 ? 94.266  156.168 213.967 1.00 87.04  ? 510 LEU B C   1 
ATOM   7393  O  O   . LEU B 1 509 ? 95.405  156.182 213.521 1.00 87.11  ? 510 LEU B O   1 
ATOM   7394  C  CB  . LEU B 1 509 ? 94.376  158.154 215.412 1.00 86.02  ? 510 LEU B CB  1 
ATOM   7395  C  CG  . LEU B 1 509 ? 94.087  158.848 216.728 1.00 85.88  ? 510 LEU B CG  1 
ATOM   7396  C  CD1 . LEU B 1 509 ? 94.188  160.340 216.577 1.00 85.82  ? 510 LEU B CD1 1 
ATOM   7397  C  CD2 . LEU B 1 509 ? 92.724  158.455 217.169 1.00 85.82  ? 510 LEU B CD2 1 
ATOM   7398  N  N   . VAL B 1 510 ? 93.231  155.706 213.284 1.00 82.80  ? 511 VAL B N   1 
ATOM   7399  C  CA  . VAL B 1 510 ? 93.385  155.343 211.894 1.00 83.81  ? 511 VAL B CA  1 
ATOM   7400  C  C   . VAL B 1 510 ? 93.249  156.609 211.062 1.00 85.68  ? 511 VAL B C   1 
ATOM   7401  O  O   . VAL B 1 510 ? 92.303  157.362 211.217 1.00 85.75  ? 511 VAL B O   1 
ATOM   7402  C  CB  . VAL B 1 510 ? 92.416  154.228 211.481 1.00 83.13  ? 511 VAL B CB  1 
ATOM   7403  C  CG1 . VAL B 1 510 ? 91.035  154.542 211.936 1.00 82.91  ? 511 VAL B CG1 1 
ATOM   7404  C  CG2 . VAL B 1 510 ? 92.462  154.005 210.001 1.00 82.95  ? 511 VAL B CG2 1 
ATOM   7405  N  N   . VAL B 1 511 ? 94.215  156.830 210.178 1.00 103.36 ? 512 VAL B N   1 
ATOM   7406  C  CA  . VAL B 1 511 ? 94.468  158.144 209.602 1.00 105.38 ? 512 VAL B CA  1 
ATOM   7407  C  C   . VAL B 1 511 ? 94.781  158.058 208.106 1.00 107.15 ? 512 VAL B C   1 
ATOM   7408  O  O   . VAL B 1 511 ? 95.258  157.038 207.628 1.00 107.27 ? 512 VAL B O   1 
ATOM   7409  C  CB  . VAL B 1 511 ? 95.635  158.814 210.370 1.00 105.63 ? 512 VAL B CB  1 
ATOM   7410  C  CG1 . VAL B 1 511 ? 96.224  159.985 209.625 1.00 105.78 ? 512 VAL B CG1 1 
ATOM   7411  C  CG2 . VAL B 1 511 ? 95.171  159.259 211.723 1.00 105.61 ? 512 VAL B CG2 1 
ATOM   7412  N  N   . HIS B 1 512 ? 94.473  159.124 207.371 1.00 116.63 ? 513 HIS B N   1 
ATOM   7413  C  CA  . HIS B 1 512 ? 94.789  159.225 205.952 1.00 118.41 ? 513 HIS B CA  1 
ATOM   7414  C  C   . HIS B 1 512 ? 96.265  159.440 205.675 1.00 119.38 ? 513 HIS B C   1 
ATOM   7415  O  O   . HIS B 1 512 ? 96.997  159.949 206.510 1.00 119.55 ? 513 HIS B O   1 
ATOM   7416  C  CB  . HIS B 1 512 ? 94.002  160.366 205.316 1.00 118.97 ? 513 HIS B CB  1 
ATOM   7417  C  CG  . HIS B 1 512 ? 94.026  160.351 203.821 1.00 119.60 ? 513 HIS B CG  1 
ATOM   7418  N  ND1 . HIS B 1 512 ? 93.765  159.216 203.089 1.00 119.83 ? 513 HIS B ND1 1 
ATOM   7419  C  CD2 . HIS B 1 512 ? 94.283  161.329 202.924 1.00 119.95 ? 513 HIS B CD2 1 
ATOM   7420  C  CE1 . HIS B 1 512 ? 93.857  159.496 201.802 1.00 119.98 ? 513 HIS B CE1 1 
ATOM   7421  N  NE2 . HIS B 1 512 ? 94.170  160.771 201.675 1.00 120.01 ? 513 HIS B NE2 1 
ATOM   7422  N  N   . GLU B 1 513 ? 96.698  159.037 204.490 1.00 113.29 ? 514 GLU B N   1 
ATOM   7423  C  CA  . GLU B 1 513 ? 98.056  159.298 204.051 1.00 113.99 ? 514 GLU B CA  1 
ATOM   7424  C  C   . GLU B 1 513 ? 98.078  160.512 203.139 1.00 114.57 ? 514 GLU B C   1 
ATOM   7425  O  O   . GLU B 1 513 ? 98.685  161.526 203.464 1.00 114.91 ? 514 GLU B O   1 
ATOM   7426  C  CB  . GLU B 1 513 ? 98.622  158.081 203.323 1.00 114.14 ? 514 GLU B CB  1 
ATOM   7427  N  N   . ARG B 1 526 ? 97.782  163.120 208.498 1.00 131.17 ? 527 ARG B N   1 
ATOM   7428  C  CA  . ARG B 1 526 ? 96.774  164.000 207.928 1.00 131.04 ? 527 ARG B CA  1 
ATOM   7429  C  C   . ARG B 1 526 ? 95.901  164.577 209.027 1.00 127.11 ? 527 ARG B C   1 
ATOM   7430  O  O   . ARG B 1 526 ? 96.026  164.217 210.189 1.00 126.97 ? 527 ARG B O   1 
ATOM   7431  C  CB  . ARG B 1 526 ? 95.903  163.237 206.924 1.00 133.76 ? 527 ARG B CB  1 
ATOM   7432  C  CG  . ARG B 1 526 ? 95.146  164.111 205.934 1.00 136.06 ? 527 ARG B CG  1 
ATOM   7433  C  CD  . ARG B 1 526 ? 96.100  164.893 205.064 1.00 137.83 ? 527 ARG B CD  1 
ATOM   7434  N  NE  . ARG B 1 526 ? 96.878  164.001 204.211 1.00 139.32 ? 527 ARG B NE  1 
ATOM   7435  C  CZ  . ARG B 1 526 ? 97.831  164.404 203.377 1.00 140.70 ? 527 ARG B CZ  1 
ATOM   7436  N  NH1 . ARG B 1 526 ? 98.137  165.690 203.277 1.00 141.36 1 527 ARG B NH1 1 
ATOM   7437  N  NH2 . ARG B 1 526 ? 98.483  163.522 202.640 1.00 141.02 ? 527 ARG B NH2 1 
ATOM   7438  N  N   . GLN B 1 527 ? 95.029  165.492 208.637 1.00 110.94 ? 528 GLN B N   1 
ATOM   7439  C  CA  . GLN B 1 527 ? 93.993  166.034 209.489 1.00 106.96 ? 528 GLN B CA  1 
ATOM   7440  C  C   . GLN B 1 527 ? 92.855  165.038 209.562 1.00 103.81 ? 528 GLN B C   1 
ATOM   7441  O  O   . GLN B 1 527 ? 91.949  165.159 210.377 1.00 103.58 ? 528 GLN B O   1 
ATOM   7442  C  CB  . GLN B 1 527 ? 93.485  167.319 208.850 1.00 106.31 ? 528 GLN B CB  1 
ATOM   7443  C  CG  . GLN B 1 527 ? 92.371  168.021 209.574 1.00 105.78 ? 528 GLN B CG  1 
ATOM   7444  C  CD  . GLN B 1 527 ? 91.662  169.001 208.687 1.00 105.41 ? 528 GLN B CD  1 
ATOM   7445  O  OE1 . GLN B 1 527 ? 91.767  170.206 208.868 1.00 105.33 ? 528 GLN B OE1 1 
ATOM   7446  N  NE2 . GLN B 1 527 ? 90.937  168.487 207.713 1.00 105.23 ? 528 GLN B NE2 1 
ATOM   7447  N  N   . MET B 1 528 ? 92.908  164.041 208.694 1.00 120.97 ? 529 MET B N   1 
ATOM   7448  C  CA  . MET B 1 528 ? 91.762  163.179 208.486 1.00 117.75 ? 529 MET B CA  1 
ATOM   7449  C  C   . MET B 1 528 ? 91.808  161.877 209.274 1.00 114.19 ? 529 MET B C   1 
ATOM   7450  O  O   . MET B 1 528 ? 92.545  160.955 208.943 1.00 113.88 ? 529 MET B O   1 
ATOM   7451  C  CB  . MET B 1 528 ? 91.588  162.904 207.002 1.00 118.15 ? 529 MET B CB  1 
ATOM   7452  C  CG  . MET B 1 528 ? 90.367  162.094 206.672 1.00 118.44 ? 529 MET B CG  1 
ATOM   7453  S  SD  . MET B 1 528 ? 90.148  161.939 204.904 1.00 118.72 ? 529 MET B SD  1 
ATOM   7454  C  CE  . MET B 1 528 ? 89.811  163.636 204.494 1.00 118.92 ? 529 MET B CE  1 
ATOM   7455  N  N   . VAL B 1 529 ? 90.999  161.821 210.320 1.00 91.32  ? 530 VAL B N   1 
ATOM   7456  C  CA  . VAL B 1 529 ? 90.913  160.656 211.173 1.00 88.38  ? 530 VAL B CA  1 
ATOM   7457  C  C   . VAL B 1 529 ? 89.720  159.820 210.785 1.00 86.75  ? 530 VAL B C   1 
ATOM   7458  O  O   . VAL B 1 529 ? 88.589  160.193 211.035 1.00 86.62  ? 530 VAL B O   1 
ATOM   7459  C  CB  . VAL B 1 529 ? 90.773  161.071 212.630 1.00 87.40  ? 530 VAL B CB  1 
ATOM   7460  C  CG1 . VAL B 1 529 ? 90.598  159.857 213.512 1.00 87.04  ? 530 VAL B CG1 1 
ATOM   7461  C  CG2 . VAL B 1 529 ? 91.980  161.873 213.054 1.00 87.18  ? 530 VAL B CG2 1 
ATOM   7462  N  N   . PHE B 1 530 ? 89.979  158.688 210.152 1.00 95.70  ? 531 PHE B N   1 
ATOM   7463  C  CA  . PHE B 1 530 ? 88.915  157.788 209.743 1.00 94.40  ? 531 PHE B CA  1 
ATOM   7464  C  C   . PHE B 1 530 ? 88.258  157.116 210.937 1.00 93.08  ? 531 PHE B C   1 
ATOM   7465  O  O   . PHE B 1 530 ? 87.130  156.650 210.851 1.00 93.02  ? 531 PHE B O   1 
ATOM   7466  C  CB  . PHE B 1 530 ? 89.444  156.742 208.765 1.00 94.46  ? 531 PHE B CB  1 
ATOM   7467  C  CG  . PHE B 1 530 ? 89.870  157.305 207.450 1.00 94.57  ? 531 PHE B CG  1 
ATOM   7468  C  CD1 . PHE B 1 530 ? 88.947  157.570 206.471 1.00 94.59  ? 531 PHE B CD1 1 
ATOM   7469  C  CD2 . PHE B 1 530 ? 91.192  157.561 207.189 1.00 94.65  ? 531 PHE B CD2 1 
ATOM   7470  C  CE1 . PHE B 1 530 ? 89.338  158.085 205.265 1.00 94.64  ? 531 PHE B CE1 1 
ATOM   7471  C  CE2 . PHE B 1 530 ? 91.583  158.073 205.985 1.00 94.74  ? 531 PHE B CE2 1 
ATOM   7472  C  CZ  . PHE B 1 530 ? 90.660  158.337 205.023 1.00 94.72  ? 531 PHE B CZ  1 
ATOM   7473  N  N   . GLY B 1 531 ? 88.974  157.058 212.052 1.00 107.30 ? 532 GLY B N   1 
ATOM   7474  C  CA  . GLY B 1 531 ? 88.423  156.465 213.253 1.00 105.94 ? 532 GLY B CA  1 
ATOM   7475  C  C   . GLY B 1 531 ? 89.360  156.364 214.436 1.00 104.61 ? 532 GLY B C   1 
ATOM   7476  O  O   . GLY B 1 531 ? 90.555  156.605 214.329 1.00 104.54 ? 532 GLY B O   1 
ATOM   7477  N  N   . VAL B 1 532 ? 88.790  155.998 215.576 1.00 79.08  ? 533 VAL B N   1 
ATOM   7478  C  CA  . VAL B 1 532 ? 89.547  155.806 216.794 1.00 77.93  ? 533 VAL B CA  1 
ATOM   7479  C  C   . VAL B 1 532 ? 89.334  154.389 217.261 1.00 77.70  ? 533 VAL B C   1 
ATOM   7480  O  O   . VAL B 1 532 ? 88.212  153.928 217.326 1.00 77.67  ? 533 VAL B O   1 
ATOM   7481  C  CB  . VAL B 1 532 ? 89.066  156.750 217.884 1.00 77.20  ? 533 VAL B CB  1 
ATOM   7482  C  CG1 . VAL B 1 532 ? 89.821  156.507 219.149 1.00 76.97  ? 533 VAL B CG1 1 
ATOM   7483  C  CG2 . VAL B 1 532 ? 89.243  158.172 217.452 1.00 77.01  ? 533 VAL B CG2 1 
ATOM   7484  N  N   . VAL B 1 533 ? 90.416  153.695 217.581 1.00 99.60  ? 534 VAL B N   1 
ATOM   7485  C  CA  . VAL B 1 533 ? 90.318  152.307 218.003 1.00 99.50  ? 534 VAL B CA  1 
ATOM   7486  C  C   . VAL B 1 533 ? 90.980  152.077 219.345 1.00 99.19  ? 534 VAL B C   1 
ATOM   7487  O  O   . VAL B 1 533 ? 92.104  152.498 219.566 1.00 99.17  ? 534 VAL B O   1 
ATOM   7488  C  CB  . VAL B 1 533 ? 90.982  151.373 216.998 1.00 99.68  ? 534 VAL B CB  1 
ATOM   7489  C  CG1 . VAL B 1 533 ? 90.584  149.965 217.286 1.00 99.75  ? 534 VAL B CG1 1 
ATOM   7490  C  CG2 . VAL B 1 533 ? 90.572  151.730 215.608 1.00 99.74  ? 534 VAL B CG2 1 
ATOM   7491  N  N   . THR B 1 534 ? 90.271  151.401 220.238 1.00 81.82  ? 535 THR B N   1 
ATOM   7492  C  CA  . THR B 1 534 ? 90.840  151.000 221.507 1.00 81.56  ? 535 THR B CA  1 
ATOM   7493  C  C   . THR B 1 534 ? 90.801  149.501 221.591 1.00 81.54  ? 535 THR B C   1 
ATOM   7494  O  O   . THR B 1 534 ? 90.312  148.844 220.694 1.00 81.55  ? 535 THR B O   1 
ATOM   7495  C  CB  . THR B 1 534 ? 90.069  151.562 222.683 1.00 81.40  ? 535 THR B CB  1 
ATOM   7496  O  OG1 . THR B 1 534 ? 88.756  151.004 222.695 1.00 81.39  ? 535 THR B OG1 1 
ATOM   7497  C  CG2 . THR B 1 534 ? 89.977  153.056 222.585 1.00 81.30  ? 535 THR B CG2 1 
ATOM   7498  N  N   . ALA B 1 535 ? 91.337  148.956 222.668 1.00 87.16  ? 536 ALA B N   1 
ATOM   7499  C  CA  . ALA B 1 535 ? 91.364  147.518 222.829 1.00 87.20  ? 536 ALA B CA  1 
ATOM   7500  C  C   . ALA B 1 535 ? 89.964  146.971 222.949 1.00 87.47  ? 536 ALA B C   1 
ATOM   7501  O  O   . ALA B 1 535 ? 89.684  145.870 222.508 1.00 87.48  ? 536 ALA B O   1 
ATOM   7502  C  CB  . ALA B 1 535 ? 92.173  147.148 224.042 1.00 87.09  ? 536 ALA B CB  1 
ATOM   7503  N  N   . ILE B 1 536 ? 89.083  147.756 223.549 1.00 86.74  ? 537 ILE B N   1 
ATOM   7504  C  CA  . ILE B 1 536 ? 87.710  147.337 223.754 1.00 87.08  ? 537 ILE B CA  1 
ATOM   7505  C  C   . ILE B 1 536 ? 86.968  147.207 222.443 1.00 87.49  ? 537 ILE B C   1 
ATOM   7506  O  O   . ILE B 1 536 ? 86.125  146.337 222.282 1.00 87.61  ? 537 ILE B O   1 
ATOM   7507  C  CB  . ILE B 1 536 ? 86.986  148.320 224.662 1.00 87.03  ? 537 ILE B CB  1 
ATOM   7508  C  CG1 . ILE B 1 536 ? 87.605  148.275 226.047 1.00 87.01  ? 537 ILE B CG1 1 
ATOM   7509  C  CG2 . ILE B 1 536 ? 85.529  147.990 224.765 1.00 87.02  ? 537 ILE B CG2 1 
ATOM   7510  C  CD1 . ILE B 1 536 ? 86.931  149.161 227.022 1.00 87.02  ? 537 ILE B CD1 1 
ATOM   7511  N  N   . ASP B 1 537 ? 87.315  148.049 221.486 1.00 90.22  ? 538 ASP B N   1 
ATOM   7512  C  CA  . ASP B 1 537 ? 86.701  147.965 220.177 1.00 90.64  ? 538 ASP B CA  1 
ATOM   7513  C  C   . ASP B 1 537 ? 87.124  146.688 219.475 1.00 91.25  ? 538 ASP B C   1 
ATOM   7514  O  O   . ASP B 1 537 ? 86.309  145.995 218.878 1.00 91.34  ? 538 ASP B O   1 
ATOM   7515  C  CB  . ASP B 1 537 ? 87.095  149.173 219.334 1.00 90.55  ? 538 ASP B CB  1 
ATOM   7516  C  CG  . ASP B 1 537 ? 86.626  150.470 219.927 1.00 90.50  ? 538 ASP B CG  1 
ATOM   7517  O  OD1 . ASP B 1 537 ? 87.425  151.422 219.982 1.00 90.49  ? 538 ASP B OD1 1 
ATOM   7518  O  OD2 . ASP B 1 537 ? 85.457  150.539 220.339 1.00 90.50  1 538 ASP B OD2 1 
ATOM   7519  N  N   . LEU B 1 538 ? 88.409  146.380 219.565 1.00 79.39  ? 539 LEU B N   1 
ATOM   7520  C  CA  . LEU B 1 538 ? 88.961  145.201 218.932 1.00 80.06  ? 539 LEU B CA  1 
ATOM   7521  C  C   . LEU B 1 538 ? 88.347  143.971 219.546 1.00 81.64  ? 539 LEU B C   1 
ATOM   7522  O  O   . LEU B 1 538 ? 88.034  142.999 218.864 1.00 81.93  ? 539 LEU B O   1 
ATOM   7523  C  CB  . LEU B 1 538 ? 90.472  145.184 219.138 1.00 79.40  ? 539 LEU B CB  1 
ATOM   7524  C  CG  . LEU B 1 538 ? 91.250  143.938 218.736 1.00 78.89  ? 539 LEU B CG  1 
ATOM   7525  C  CD1 . LEU B 1 538 ? 91.045  143.681 217.280 1.00 78.74  ? 539 LEU B CD1 1 
ATOM   7526  C  CD2 . LEU B 1 538 ? 92.716  144.109 219.034 1.00 78.74  ? 539 LEU B CD2 1 
ATOM   7527  N  N   . LEU B 1 539 ? 88.142  144.034 220.849 1.00 86.88  ? 540 LEU B N   1 
ATOM   7528  C  CA  . LEU B 1 539 ? 87.566  142.918 221.555 1.00 88.62  ? 540 LEU B CA  1 
ATOM   7529  C  C   . LEU B 1 539 ? 86.144  142.741 221.107 1.00 91.18  ? 540 LEU B C   1 
ATOM   7530  O  O   . LEU B 1 539 ? 85.698  141.630 220.892 1.00 91.51  ? 540 LEU B O   1 
ATOM   7531  C  CB  . LEU B 1 539 ? 87.595  143.161 223.055 1.00 88.06  ? 540 LEU B CB  1 
ATOM   7532  C  CG  . LEU B 1 539 ? 87.023  142.037 223.910 1.00 87.58  ? 540 LEU B CG  1 
ATOM   7533  C  CD1 . LEU B 1 539 ? 87.842  140.790 223.746 1.00 87.45  ? 540 LEU B CD1 1 
ATOM   7534  C  CD2 . LEU B 1 539 ? 86.995  142.448 225.352 1.00 87.41  ? 540 LEU B CD2 1 
ATOM   7535  N  N   . ASN B 1 540 ? 85.436  143.851 220.946 1.00 107.23 ? 541 ASN B N   1 
ATOM   7536  C  CA  . ASN B 1 540 ? 84.043  143.792 220.542 1.00 109.85 ? 541 ASN B CA  1 
ATOM   7537  C  C   . ASN B 1 540 ? 83.899  143.201 219.163 1.00 112.43 ? 541 ASN B C   1 
ATOM   7538  O  O   . ASN B 1 540 ? 82.987  142.431 218.900 1.00 112.89 ? 541 ASN B O   1 
ATOM   7539  C  CB  . ASN B 1 540 ? 83.423  145.184 220.553 1.00 109.94 ? 541 ASN B CB  1 
ATOM   7540  C  CG  . ASN B 1 540 ? 83.093  145.662 221.938 1.00 109.95 ? 541 ASN B CG  1 
ATOM   7541  O  OD1 . ASN B 1 540 ? 82.771  144.872 222.818 1.00 110.02 ? 541 ASN B OD1 1 
ATOM   7542  N  ND2 . ASN B 1 540 ? 83.161  146.966 222.141 1.00 110.08 ? 541 ASN B ND2 1 
ATOM   7543  N  N   . PHE B 1 541 ? 84.830  143.543 218.290 1.00 101.84 ? 542 PHE B N   1 
ATOM   7544  C  CA  . PHE B 1 541 ? 84.783  143.042 216.935 1.00 104.48 ? 542 PHE B CA  1 
ATOM   7545  C  C   . PHE B 1 541 ? 85.026  141.558 216.934 1.00 107.46 ? 542 PHE B C   1 
ATOM   7546  O  O   . PHE B 1 541 ? 84.253  140.797 216.365 1.00 108.03 ? 542 PHE B O   1 
ATOM   7547  C  CB  . PHE B 1 541 ? 85.838  143.734 216.084 1.00 104.25 ? 542 PHE B CB  1 
ATOM   7548  C  CG  . PHE B 1 541 ? 86.090  143.069 214.769 1.00 103.99 ? 542 PHE B CG  1 
ATOM   7549  C  CD1 . PHE B 1 541 ? 85.238  143.259 213.710 1.00 103.89 ? 542 PHE B CD1 1 
ATOM   7550  C  CD2 . PHE B 1 541 ? 87.190  142.271 214.588 1.00 103.87 ? 542 PHE B CD2 1 
ATOM   7551  C  CE1 . PHE B 1 541 ? 85.474  142.658 212.505 1.00 103.80 ? 542 PHE B CE1 1 
ATOM   7552  C  CE2 . PHE B 1 541 ? 87.426  141.669 213.385 1.00 103.79 ? 542 PHE B CE2 1 
ATOM   7553  C  CZ  . PHE B 1 541 ? 86.568  141.863 212.344 1.00 103.77 ? 542 PHE B CZ  1 
ATOM   7554  N  N   . VAL B 1 542 ? 86.087  141.138 217.608 1.00 123.57 ? 543 VAL B N   1 
ATOM   7555  C  CA  . VAL B 1 542 ? 86.435  139.731 217.590 1.00 126.48 ? 543 VAL B CA  1 
ATOM   7556  C  C   . VAL B 1 542 ? 85.332  138.909 218.224 1.00 129.00 ? 543 VAL B C   1 
ATOM   7557  O  O   . VAL B 1 542 ? 84.907  137.897 217.677 1.00 129.52 ? 543 VAL B O   1 
ATOM   7558  C  CB  . VAL B 1 542 ? 87.765  139.471 218.308 1.00 126.82 ? 543 VAL B CB  1 
ATOM   7559  C  CG1 . VAL B 1 542 ? 87.914  138.012 218.636 1.00 126.99 ? 543 VAL B CG1 1 
ATOM   7560  C  CG2 . VAL B 1 542 ? 88.914  139.921 217.443 1.00 126.81 ? 543 VAL B CG2 1 
ATOM   7561  N  N   . ALA B 1 543 ? 84.839  139.368 219.363 1.00 130.91 ? 544 ALA B N   1 
ATOM   7562  C  CA  . ALA B 1 543 ? 83.809  138.637 220.077 1.00 133.18 ? 544 ALA B CA  1 
ATOM   7563  C  C   . ALA B 1 543 ? 82.505  138.586 219.303 1.00 135.34 ? 544 ALA B C   1 
ATOM   7564  O  O   . ALA B 1 543 ? 81.772  137.609 219.389 1.00 135.71 ? 544 ALA B O   1 
ATOM   7565  C  CB  . ALA B 1 543 ? 83.586  139.245 221.437 1.00 133.19 ? 544 ALA B CB  1 
ATOM   7566  N  N   . ALA B 1 544 ? 82.208  139.635 218.546 1.00 139.25 ? 545 ALA B N   1 
ATOM   7567  C  CA  . ALA B 1 544 ? 80.997  139.623 217.741 1.00 141.30 ? 545 ALA B CA  1 
ATOM   7568  C  C   . ALA B 1 544 ? 81.152  138.625 216.619 1.00 143.55 ? 545 ALA B C   1 
ATOM   7569  O  O   . ALA B 1 544 ? 80.236  137.874 216.314 1.00 143.72 ? 545 ALA B O   1 
ATOM   7570  C  CB  . ALA B 1 544 ? 80.709  140.992 217.184 1.00 141.13 ? 545 ALA B CB  1 
ATOM   7571  N  N   . GLN B 1 545 ? 82.331  138.613 216.015 1.00 140.65 ? 546 GLN B N   1 
ATOM   7572  C  CA  . GLN B 1 545 ? 82.598  137.685 214.929 1.00 142.83 ? 546 GLN B CA  1 
ATOM   7573  C  C   . GLN B 1 545 ? 82.570  136.245 215.425 1.00 145.32 ? 546 GLN B C   1 
ATOM   7574  O  O   . GLN B 1 545 ? 82.284  135.330 214.666 1.00 145.55 ? 546 GLN B O   1 
ATOM   7575  C  CB  . GLN B 1 545 ? 83.943  137.995 214.267 1.00 142.57 ? 546 GLN B CB  1 
ATOM   7576  C  CG  . GLN B 1 545 ? 84.020  139.357 213.611 1.00 142.37 ? 546 GLN B CG  1 
ATOM   7577  C  CD  . GLN B 1 545 ? 83.383  139.386 212.245 1.00 142.37 ? 546 GLN B CD  1 
ATOM   7578  O  OE1 . GLN B 1 545 ? 83.502  138.439 211.475 1.00 142.35 ? 546 GLN B OE1 1 
ATOM   7579  N  NE2 . GLN B 1 545 ? 82.704  140.479 211.934 1.00 142.33 ? 546 GLN B NE2 1 
ATOM   7580  N  N   . GLU B 1 546 ? 82.888  136.045 216.695 1.00 146.47 ? 547 GLU B N   1 
ATOM   7581  C  CA  . GLU B 1 546 ? 82.879  134.704 217.254 1.00 148.83 ? 547 GLU B CA  1 
ATOM   7582  C  C   . GLU B 1 546 ? 81.491  134.095 217.363 1.00 150.48 ? 547 GLU B C   1 
ATOM   7583  O  O   . GLU B 1 546 ? 81.342  132.881 217.288 1.00 150.69 ? 547 GLU B O   1 
ATOM   7584  C  CB  . GLU B 1 546 ? 83.574  134.673 218.611 1.00 149.22 ? 547 GLU B CB  1 
ATOM   7585  C  CG  . GLU B 1 546 ? 85.090  134.647 218.528 1.00 149.34 ? 547 GLU B CG  1 
ATOM   7586  C  CD  . GLU B 1 546 ? 85.739  134.493 219.885 1.00 149.44 ? 547 GLU B CD  1 
ATOM   7587  O  OE1 . GLU B 1 546 ? 85.027  134.618 220.901 1.00 149.48 ? 547 GLU B OE1 1 
ATOM   7588  O  OE2 . GLU B 1 546 ? 86.957  134.243 219.941 1.00 149.01 1 547 GLU B OE2 1 
ATOM   7589  N  N   . ARG B 1 547 ? 80.471  134.926 217.531 1.00 149.65 ? 548 ARG B N   1 
ATOM   7590  C  CA  . ARG B 1 547 ? 79.117  134.407 217.698 1.00 150.91 ? 548 ARG B CA  1 
ATOM   7591  C  C   . ARG B 1 547 ? 78.447  134.102 216.363 1.00 150.28 ? 548 ARG B C   1 
ATOM   7592  O  O   . ARG B 1 547 ? 77.484  134.756 215.979 1.00 150.28 ? 548 ARG B O   1 
ATOM   7593  C  CB  . ARG B 1 547 ? 78.260  135.370 218.523 1.00 152.49 ? 548 ARG B CB  1 
ATOM   7594  C  CG  . ARG B 1 547 ? 78.613  135.392 220.006 1.00 153.73 ? 548 ARG B CG  1 
ATOM   7595  C  CD  . ARG B 1 547 ? 77.699  136.321 220.801 1.00 154.76 ? 548 ARG B CD  1 
ATOM   7596  N  NE  . ARG B 1 547 ? 77.942  137.733 220.516 1.00 155.47 ? 548 ARG B NE  1 
ATOM   7597  C  CZ  . ARG B 1 547 ? 78.829  138.487 221.162 1.00 156.16 ? 548 ARG B CZ  1 
ATOM   7598  N  NH1 . ARG B 1 547 ? 78.983  139.761 220.835 1.00 156.42 1 548 ARG B NH1 1 
ATOM   7599  N  NH2 . ARG B 1 547 ? 79.565  137.966 222.131 1.00 156.36 ? 548 ARG B NH2 1 
ATOM   7600  N  N   . ASP B 1 548 ? 78.961  133.088 215.677 1.00 156.20 ? 549 ASP B N   1 
ATOM   7601  C  CA  . ASP B 1 548 ? 78.451  132.677 214.375 1.00 155.54 ? 549 ASP B CA  1 
ATOM   7602  C  C   . ASP B 1 548 ? 78.422  131.159 214.246 1.00 155.21 ? 549 ASP B C   1 
ATOM   7603  O  O   . ASP B 1 548 ? 77.417  130.587 213.822 1.00 155.16 ? 549 ASP B O   1 
ATOM   7604  C  CB  . ASP B 1 548 ? 79.318  133.251 213.255 1.00 155.34 ? 549 ASP B CB  1 
ATOM   7605  C  CG  . ASP B 1 548 ? 79.048  134.718 212.998 1.00 155.25 ? 549 ASP B CG  1 
ATOM   7606  O  OD1 . ASP B 1 548 ? 79.567  135.243 211.991 1.00 155.20 ? 549 ASP B OD1 1 
ATOM   7607  O  OD2 . ASP B 1 548 ? 78.318  135.344 213.790 1.00 155.22 1 549 ASP B OD2 1 
ATOM   7608  N  N   . GLN B 1 549 ? 79.535  130.523 214.610 1.00 158.54 ? 550 GLN B N   1 
ATOM   7609  C  CA  . GLN B 1 549 ? 79.732  129.081 214.441 1.00 158.33 ? 550 GLN B CA  1 
ATOM   7610  C  C   . GLN B 1 549 ? 78.537  128.220 214.844 1.00 158.30 ? 550 GLN B C   1 
ATOM   7611  O  O   . GLN B 1 549 ? 77.992  127.480 214.022 1.00 158.28 ? 550 GLN B O   1 
ATOM   7612  C  CB  . GLN B 1 549 ? 80.979  128.620 215.204 1.00 158.21 ? 550 GLN B CB  1 
ATOM   7613  C  CG  . GLN B 1 549 ? 82.305  128.893 214.497 1.00 158.15 ? 550 GLN B CG  1 
ATOM   7614  C  CD  . GLN B 1 549 ? 82.723  130.349 214.552 1.00 158.11 ? 550 GLN B CD  1 
ATOM   7615  O  OE1 . GLN B 1 549 ? 81.939  131.246 214.240 1.00 158.10 ? 550 GLN B OE1 1 
ATOM   7616  N  NE2 . GLN B 1 549 ? 83.968  130.592 214.952 1.00 158.08 ? 550 GLN B NE2 1 
ATOM   7617  N  N   . TRP C 1 42  ? 156.331 121.304 180.734 1.00 126.79 ? 43  TRP C N   1 
ATOM   7618  C  CA  . TRP C 1 42  ? 155.054 121.842 181.183 1.00 122.41 ? 43  TRP C CA  1 
ATOM   7619  C  C   . TRP C 1 42  ? 154.947 123.333 180.952 1.00 117.98 ? 43  TRP C C   1 
ATOM   7620  O  O   . TRP C 1 42  ? 155.589 124.121 181.635 1.00 117.72 ? 43  TRP C O   1 
ATOM   7621  C  CB  . TRP C 1 42  ? 154.854 121.574 182.664 1.00 122.56 ? 43  TRP C CB  1 
ATOM   7622  C  CG  . TRP C 1 42  ? 153.652 122.256 183.207 1.00 122.66 ? 43  TRP C CG  1 
ATOM   7623  C  CD1 . TRP C 1 42  ? 152.363 122.005 182.877 1.00 122.63 ? 43  TRP C CD1 1 
ATOM   7624  C  CD2 . TRP C 1 42  ? 153.620 123.298 184.184 1.00 122.85 ? 43  TRP C CD2 1 
ATOM   7625  N  NE1 . TRP C 1 42  ? 151.523 122.822 183.584 1.00 122.75 ? 43  TRP C NE1 1 
ATOM   7626  C  CE2 . TRP C 1 42  ? 152.272 123.628 184.394 1.00 122.87 ? 43  TRP C CE2 1 
ATOM   7627  C  CE3 . TRP C 1 42  ? 154.598 123.981 184.902 1.00 122.94 ? 43  TRP C CE3 1 
ATOM   7628  C  CZ2 . TRP C 1 42  ? 151.876 124.606 185.289 1.00 122.94 ? 43  TRP C CZ2 1 
ATOM   7629  C  CZ3 . TRP C 1 42  ? 154.202 124.955 185.792 1.00 122.98 ? 43  TRP C CZ3 1 
ATOM   7630  C  CH2 . TRP C 1 42  ? 152.852 125.256 185.979 1.00 122.95 ? 43  TRP C CH2 1 
ATOM   7631  N  N   . ILE C 1 43  ? 154.123 123.721 179.995 1.00 104.67 ? 44  ILE C N   1 
ATOM   7632  C  CA  . ILE C 1 43  ? 153.937 125.128 179.706 1.00 100.67 ? 44  ILE C CA  1 
ATOM   7633  C  C   . ILE C 1 43  ? 152.852 125.728 180.584 1.00 98.46  ? 44  ILE C C   1 
ATOM   7634  O  O   . ILE C 1 43  ? 151.771 125.180 180.706 1.00 98.23  ? 44  ILE C O   1 
ATOM   7635  C  CB  . ILE C 1 43  ? 153.599 125.330 178.240 1.00 99.32  ? 44  ILE C CB  1 
ATOM   7636  C  CG1 . ILE C 1 43  ? 154.636 124.623 177.377 1.00 98.61  ? 44  ILE C CG1 1 
ATOM   7637  C  CG2 . ILE C 1 43  ? 153.586 126.786 177.910 1.00 98.93  ? 44  ILE C CG2 1 
ATOM   7638  C  CD1 . ILE C 1 43  ? 154.372 124.713 175.909 1.00 98.20  ? 44  ILE C CD1 1 
ATOM   7639  N  N   . ARG C 1 44  ? 153.150 126.863 181.198 1.00 108.53 ? 45  ARG C N   1 
ATOM   7640  C  CA  . ARG C 1 44  ? 152.208 127.529 182.083 1.00 106.58 ? 45  ARG C CA  1 
ATOM   7641  C  C   . ARG C 1 44  ? 151.053 128.181 181.342 1.00 103.80 ? 45  ARG C C   1 
ATOM   7642  O  O   . ARG C 1 44  ? 151.259 128.974 180.435 1.00 103.51 ? 45  ARG C O   1 
ATOM   7643  C  CB  . ARG C 1 44  ? 152.929 128.582 182.919 1.00 107.47 ? 45  ARG C CB  1 
ATOM   7644  C  CG  . ARG C 1 44  ? 153.629 128.033 184.129 1.00 108.35 ? 45  ARG C CG  1 
ATOM   7645  C  CD  . ARG C 1 44  ? 154.169 129.139 185.006 1.00 109.02 ? 45  ARG C CD  1 
ATOM   7646  N  NE  . ARG C 1 44  ? 154.409 128.671 186.364 1.00 109.56 ? 45  ARG C NE  1 
ATOM   7647  C  CZ  . ARG C 1 44  ? 153.620 128.946 187.391 1.00 110.00 ? 45  ARG C CZ  1 
ATOM   7648  N  NH1 . ARG C 1 44  ? 153.906 128.480 188.595 1.00 110.20 1 45  ARG C NH1 1 
ATOM   7649  N  NH2 . ARG C 1 44  ? 152.549 129.695 187.212 1.00 110.12 ? 45  ARG C NH2 1 
ATOM   7650  N  N   . PRO C 1 45  ? 149.828 127.847 181.740 1.00 82.41  ? 46  PRO C N   1 
ATOM   7651  C  CA  . PRO C 1 45  ? 148.601 128.463 181.251 1.00 80.88  ? 46  PRO C CA  1 
ATOM   7652  C  C   . PRO C 1 45  ? 148.510 129.936 181.587 1.00 79.53  ? 46  PRO C C   1 
ATOM   7653  O  O   . PRO C 1 45  ? 147.774 130.665 180.943 1.00 79.27  ? 46  PRO C O   1 
ATOM   7654  C  CB  . PRO C 1 45  ? 147.519 127.685 181.978 1.00 80.89  ? 46  PRO C CB  1 
ATOM   7655  C  CG  . PRO C 1 45  ? 148.150 127.254 183.201 1.00 81.14  ? 46  PRO C CG  1 
ATOM   7656  C  CD  . PRO C 1 45  ? 149.557 126.931 182.853 1.00 81.68  ? 46  PRO C CD  1 
ATOM   7657  N  N   . ASP C 1 46  ? 149.202 130.353 182.634 1.00 94.29  ? 47  ASP C N   1 
ATOM   7658  C  CA  . ASP C 1 46  ? 149.083 131.712 183.127 1.00 93.27  ? 47  ASP C CA  1 
ATOM   7659  C  C   . ASP C 1 46  ? 150.232 132.606 182.737 1.00 92.81  ? 47  ASP C C   1 
ATOM   7660  O  O   . ASP C 1 46  ? 150.420 133.657 183.326 1.00 92.75  ? 47  ASP C O   1 
ATOM   7661  C  CB  . ASP C 1 46  ? 148.944 131.714 184.640 1.00 93.04  ? 47  ASP C CB  1 
ATOM   7662  C  CG  . ASP C 1 46  ? 150.213 131.314 185.336 1.00 93.00  ? 47  ASP C CG  1 
ATOM   7663  O  OD1 . ASP C 1 46  ? 150.935 130.455 184.806 1.00 92.99  ? 47  ASP C OD1 1 
ATOM   7664  O  OD2 . ASP C 1 46  ? 150.487 131.860 186.419 1.00 92.95  1 47  ASP C OD2 1 
ATOM   7665  N  N   . ALA C 1 47  ? 151.012 132.185 181.757 1.00 89.10  ? 48  ALA C N   1 
ATOM   7666  C  CA  . ALA C 1 47  ? 152.145 132.974 181.309 1.00 88.80  ? 48  ALA C CA  1 
ATOM   7667  C  C   . ALA C 1 47  ? 151.649 134.257 180.685 1.00 88.81  ? 48  ALA C C   1 
ATOM   7668  O  O   . ALA C 1 47  ? 150.594 134.275 180.071 1.00 88.69  ? 48  ALA C O   1 
ATOM   7669  C  CB  . ALA C 1 47  ? 152.959 132.194 180.316 1.00 88.68  ? 48  ALA C CB  1 
ATOM   7670  N  N   . PRO C 1 48  ? 152.397 135.348 180.868 1.00 89.49  ? 49  PRO C N   1 
ATOM   7671  C  CA  . PRO C 1 48  ? 151.974 136.628 180.311 1.00 89.81  ? 49  PRO C CA  1 
ATOM   7672  C  C   . PRO C 1 48  ? 151.916 136.567 178.805 1.00 90.55  ? 49  PRO C C   1 
ATOM   7673  O  O   . PRO C 1 48  ? 152.751 135.923 178.186 1.00 90.50  ? 49  PRO C O   1 
ATOM   7674  C  CB  . PRO C 1 48  ? 153.078 137.576 180.757 1.00 89.53  ? 49  PRO C CB  1 
ATOM   7675  C  CG  . PRO C 1 48  ? 154.240 136.710 180.986 1.00 89.38  ? 49  PRO C CG  1 
ATOM   7676  C  CD  . PRO C 1 48  ? 153.700 135.448 181.532 1.00 89.36  ? 49  PRO C CD  1 
ATOM   7677  N  N   . SER C 1 49  ? 150.933 137.240 178.227 1.00 89.73  ? 50  SER C N   1 
ATOM   7678  C  CA  . SER C 1 49  ? 150.710 137.177 176.796 1.00 90.64  ? 50  SER C CA  1 
ATOM   7679  C  C   . SER C 1 49  ? 151.812 137.853 176.006 1.00 91.83  ? 50  SER C C   1 
ATOM   7680  O  O   . SER C 1 49  ? 152.317 138.898 176.397 1.00 91.91  ? 50  SER C O   1 
ATOM   7681  C  CB  . SER C 1 49  ? 149.369 137.803 176.445 1.00 90.50  ? 50  SER C CB  1 
ATOM   7682  O  OG  . SER C 1 49  ? 149.162 137.780 175.050 1.00 90.40  ? 50  SER C OG  1 
ATOM   7683  N  N   . ARG C 1 50  ? 152.185 137.241 174.893 1.00 92.62  ? 51  ARG C N   1 
ATOM   7684  C  CA  . ARG C 1 50  ? 153.149 137.840 173.995 1.00 93.69  ? 51  ARG C CA  1 
ATOM   7685  C  C   . ARG C 1 50  ? 152.516 138.682 172.892 1.00 93.06  ? 51  ARG C C   1 
ATOM   7686  O  O   . ARG C 1 50  ? 153.221 139.283 172.096 1.00 93.04  ? 51  ARG C O   1 
ATOM   7687  C  CB  . ARG C 1 50  ? 154.058 136.773 173.405 1.00 95.15  ? 51  ARG C CB  1 
ATOM   7688  C  CG  . ARG C 1 50  ? 154.995 136.153 174.408 1.00 96.70  ? 51  ARG C CG  1 
ATOM   7689  C  CD  . ARG C 1 50  ? 155.959 135.204 173.748 1.00 97.97  ? 51  ARG C CD  1 
ATOM   7690  N  NE  . ARG C 1 50  ? 155.257 134.131 173.061 1.00 98.97  ? 51  ARG C NE  1 
ATOM   7691  C  CZ  . ARG C 1 50  ? 154.923 132.981 173.629 1.00 100.02 ? 51  ARG C CZ  1 
ATOM   7692  N  NH1 . ARG C 1 50  ? 155.234 132.756 174.894 1.00 100.40 1 51  ARG C NH1 1 
ATOM   7693  N  NH2 . ARG C 1 50  ? 154.281 132.055 172.933 1.00 100.42 ? 51  ARG C NH2 1 
ATOM   7694  N  N   . CYS C 1 51  ? 151.191 138.730 172.848 1.00 88.78  ? 52  CYS C N   1 
ATOM   7695  C  CA  . CYS C 1 51  ? 150.491 139.468 171.802 1.00 88.11  ? 52  CYS C CA  1 
ATOM   7696  C  C   . CYS C 1 51  ? 150.808 140.948 171.878 1.00 87.67  ? 52  CYS C C   1 
ATOM   7697  O  O   . CYS C 1 51  ? 150.886 141.514 172.956 1.00 87.62  ? 52  CYS C O   1 
ATOM   7698  C  CB  . CYS C 1 51  ? 148.982 139.261 171.911 1.00 87.99  ? 52  CYS C CB  1 
ATOM   7699  S  SG  . CYS C 1 51  ? 147.999 139.864 170.528 1.00 87.81  ? 52  CYS C SG  1 
ATOM   7700  N  N   . THR C 1 52  ? 150.988 141.571 170.723 1.00 92.10  ? 53  THR C N   1 
ATOM   7701  C  CA  . THR C 1 52  ? 151.346 142.978 170.662 1.00 91.80  ? 53  THR C CA  1 
ATOM   7702  C  C   . THR C 1 52  ? 150.198 143.837 170.179 1.00 91.96  ? 53  THR C C   1 
ATOM   7703  O  O   . THR C 1 52  ? 150.402 144.953 169.732 1.00 91.94  ? 53  THR C O   1 
ATOM   7704  C  CB  . THR C 1 52  ? 152.548 143.217 169.762 1.00 91.50  ? 53  THR C CB  1 
ATOM   7705  O  OG1 . THR C 1 52  ? 152.244 142.770 168.439 1.00 91.47  ? 53  THR C OG1 1 
ATOM   7706  C  CG2 . THR C 1 52  ? 153.747 142.461 170.285 1.00 91.36  ? 53  THR C CG2 1 
ATOM   7707  N  N   . TRP C 1 53  ? 148.992 143.298 170.246 1.00 93.13  ? 54  TRP C N   1 
ATOM   7708  C  CA  . TRP C 1 53  ? 147.800 144.059 169.922 1.00 93.37  ? 54  TRP C CA  1 
ATOM   7709  C  C   . TRP C 1 53  ? 147.616 145.194 170.899 1.00 95.24  ? 54  TRP C C   1 
ATOM   7710  O  O   . TRP C 1 53  ? 147.874 145.051 172.085 1.00 95.35  ? 54  TRP C O   1 
ATOM   7711  C  CB  . TRP C 1 53  ? 146.570 143.159 169.994 1.00 92.19  ? 54  TRP C CB  1 
ATOM   7712  C  CG  . TRP C 1 53  ? 145.271 143.850 169.703 1.00 91.03  ? 54  TRP C CG  1 
ATOM   7713  C  CD1 . TRP C 1 53  ? 144.638 143.914 168.511 1.00 90.50  ? 54  TRP C CD1 1 
ATOM   7714  C  CD2 . TRP C 1 53  ? 144.440 144.547 170.632 1.00 90.39  ? 54  TRP C CD2 1 
ATOM   7715  N  NE1 . TRP C 1 53  ? 143.473 144.612 168.627 1.00 90.24  ? 54  TRP C NE1 1 
ATOM   7716  C  CE2 . TRP C 1 53  ? 143.328 145.013 169.925 1.00 90.11  ? 54  TRP C CE2 1 
ATOM   7717  C  CE3 . TRP C 1 53  ? 144.532 144.825 171.992 1.00 90.12  ? 54  TRP C CE3 1 
ATOM   7718  C  CZ2 . TRP C 1 53  ? 142.323 145.740 170.524 1.00 89.91  ? 54  TRP C CZ2 1 
ATOM   7719  C  CZ3 . TRP C 1 53  ? 143.537 145.549 172.583 1.00 89.90  ? 54  TRP C CZ3 1 
ATOM   7720  C  CH2 . TRP C 1 53  ? 142.445 145.999 171.854 1.00 89.80  ? 54  TRP C CH2 1 
ATOM   7721  N  N   . GLN C 1 54  ? 147.152 146.323 170.393 1.00 116.91 ? 55  GLN C N   1 
ATOM   7722  C  CA  . GLN C 1 54  ? 146.702 147.403 171.244 1.00 118.84 ? 55  GLN C CA  1 
ATOM   7723  C  C   . GLN C 1 54  ? 145.674 148.193 170.474 1.00 120.06 ? 55  GLN C C   1 
ATOM   7724  O  O   . GLN C 1 54  ? 145.694 148.210 169.251 1.00 120.21 ? 55  GLN C O   1 
ATOM   7725  C  CB  . GLN C 1 54  ? 147.861 148.286 171.704 1.00 119.44 ? 55  GLN C CB  1 
ATOM   7726  C  CG  . GLN C 1 54  ? 148.790 148.737 170.606 1.00 119.86 ? 55  GLN C CG  1 
ATOM   7727  C  CD  . GLN C 1 54  ? 150.009 149.452 171.138 1.00 120.25 ? 55  GLN C CD  1 
ATOM   7728  O  OE1 . GLN C 1 54  ? 150.044 149.867 172.295 1.00 120.30 ? 55  GLN C OE1 1 
ATOM   7729  N  NE2 . GLN C 1 54  ? 151.026 149.596 170.295 1.00 120.48 ? 55  GLN C NE2 1 
ATOM   7730  N  N   . LEU C 1 55  ? 144.756 148.821 171.193 1.00 98.98  ? 56  LEU C N   1 
ATOM   7731  C  CA  . LEU C 1 55  ? 143.639 149.478 170.551 1.00 100.17 ? 56  LEU C CA  1 
ATOM   7732  C  C   . LEU C 1 55  ? 144.145 150.582 169.656 1.00 101.53 ? 56  LEU C C   1 
ATOM   7733  O  O   . LEU C 1 55  ? 144.867 151.465 170.094 1.00 101.63 ? 56  LEU C O   1 
ATOM   7734  C  CB  . LEU C 1 55  ? 142.690 150.032 171.601 1.00 100.04 ? 56  LEU C CB  1 
ATOM   7735  C  CG  . LEU C 1 55  ? 141.443 150.713 171.056 1.00 99.93  ? 56  LEU C CG  1 
ATOM   7736  C  CD1 . LEU C 1 55  ? 140.770 149.820 170.060 1.00 99.90  ? 56  LEU C CD1 1 
ATOM   7737  C  CD2 . LEU C 1 55  ? 140.487 151.061 172.175 1.00 99.89  ? 56  LEU C CD2 1 
ATOM   7738  N  N   . GLY C 1 56  ? 143.725 150.544 168.401 1.00 107.59 ? 57  GLY C N   1 
ATOM   7739  C  CA  . GLY C 1 56  ? 144.199 151.485 167.410 1.00 109.00 ? 57  GLY C CA  1 
ATOM   7740  C  C   . GLY C 1 56  ? 145.034 150.888 166.294 1.00 110.46 ? 57  GLY C C   1 
ATOM   7741  O  O   . GLY C 1 56  ? 145.113 151.463 165.216 1.00 110.57 ? 57  GLY C O   1 
ATOM   7742  N  N   . ARG C 1 57  ? 145.642 149.734 166.530 1.00 120.41 ? 58  ARG C N   1 
ATOM   7743  C  CA  . ARG C 1 57  ? 146.435 149.098 165.491 1.00 121.86 ? 58  ARG C CA  1 
ATOM   7744  C  C   . ARG C 1 57  ? 145.526 148.656 164.362 1.00 123.30 ? 58  ARG C C   1 
ATOM   7745  O  O   . ARG C 1 57  ? 144.461 148.107 164.604 1.00 123.42 ? 58  ARG C O   1 
ATOM   7746  C  CB  . ARG C 1 57  ? 147.185 147.885 166.037 1.00 121.84 ? 58  ARG C CB  1 
ATOM   7747  C  CG  . ARG C 1 57  ? 148.219 148.183 167.096 1.00 121.77 ? 58  ARG C CG  1 
ATOM   7748  C  CD  . ARG C 1 57  ? 149.529 148.636 166.507 1.00 121.76 ? 58  ARG C CD  1 
ATOM   7749  N  NE  . ARG C 1 57  ? 150.235 147.561 165.819 1.00 121.73 ? 58  ARG C NE  1 
ATOM   7750  C  CZ  . ARG C 1 57  ? 151.102 146.742 166.402 1.00 121.69 ? 58  ARG C CZ  1 
ATOM   7751  N  NH1 . ARG C 1 57  ? 151.707 145.800 165.695 1.00 121.68 1 58  ARG C NH1 1 
ATOM   7752  N  NH2 . ARG C 1 57  ? 151.365 146.864 167.693 1.00 121.66 ? 58  ARG C NH2 1 
ATOM   7753  N  N   . PRO C 1 58  ? 145.943 148.906 163.119 1.00 120.78 ? 59  PRO C N   1 
ATOM   7754  C  CA  . PRO C 1 58  ? 145.217 148.451 161.931 1.00 121.53 ? 59  PRO C CA  1 
ATOM   7755  C  C   . PRO C 1 58  ? 145.156 146.936 161.862 1.00 121.99 ? 59  PRO C C   1 
ATOM   7756  O  O   . PRO C 1 58  ? 146.088 146.272 162.291 1.00 121.68 ? 59  PRO C O   1 
ATOM   7757  C  CB  . PRO C 1 58  ? 146.063 148.990 160.781 1.00 121.67 ? 59  PRO C CB  1 
ATOM   7758  C  CG  . PRO C 1 58  ? 146.823 150.121 161.366 1.00 121.58 ? 59  PRO C CG  1 
ATOM   7759  C  CD  . PRO C 1 58  ? 147.115 149.719 162.765 1.00 121.26 ? 59  PRO C CD  1 
ATOM   7760  N  N   . ALA C 1 59  ? 144.067 146.403 161.328 1.00 113.91 ? 60  ALA C N   1 
ATOM   7761  C  CA  . ALA C 1 59  ? 143.881 144.962 161.231 1.00 114.22 ? 60  ALA C CA  1 
ATOM   7762  C  C   . ALA C 1 59  ? 144.896 144.312 160.308 1.00 113.97 ? 60  ALA C C   1 
ATOM   7763  O  O   . ALA C 1 59  ? 145.186 143.127 160.425 1.00 113.94 ? 60  ALA C O   1 
ATOM   7764  C  CB  . ALA C 1 59  ? 142.484 144.649 160.767 1.00 114.46 ? 60  ALA C CB  1 
ATOM   7765  N  N   . SER C 1 60  ? 145.423 145.093 159.380 1.00 133.35 ? 61  SER C N   1 
ATOM   7766  C  CA  . SER C 1 60  ? 146.411 144.602 158.436 1.00 132.77 ? 61  SER C CA  1 
ATOM   7767  C  C   . SER C 1 60  ? 147.705 144.195 159.123 1.00 131.37 ? 61  SER C C   1 
ATOM   7768  O  O   . SER C 1 60  ? 148.435 143.341 158.631 1.00 131.33 ? 61  SER C O   1 
ATOM   7769  C  CB  . SER C 1 60  ? 146.695 145.662 157.374 1.00 133.15 ? 61  SER C CB  1 
ATOM   7770  O  OG  . SER C 1 60  ? 147.112 146.877 157.965 1.00 133.29 ? 61  SER C OG  1 
ATOM   7771  N  N   . GLU C 1 61  ? 147.985 144.811 160.263 1.00 123.24 ? 62  GLU C N   1 
ATOM   7772  C  CA  . GLU C 1 61  ? 149.232 144.572 160.967 1.00 121.55 ? 62  GLU C CA  1 
ATOM   7773  C  C   . GLU C 1 61  ? 149.256 143.234 161.680 1.00 118.65 ? 62  GLU C C   1 
ATOM   7774  O  O   . GLU C 1 61  ? 150.308 142.770 162.102 1.00 118.20 ? 62  GLU C O   1 
ATOM   7775  C  CB  . GLU C 1 61  ? 149.508 145.695 161.958 1.00 122.45 ? 62  GLU C CB  1 
ATOM   7776  C  CG  . GLU C 1 61  ? 149.838 147.017 161.307 1.00 123.05 ? 62  GLU C CG  1 
ATOM   7777  C  CD  . GLU C 1 61  ? 150.184 148.092 162.313 1.00 123.34 ? 62  GLU C CD  1 
ATOM   7778  O  OE1 . GLU C 1 61  ? 150.520 147.741 163.461 1.00 123.43 ? 62  GLU C OE1 1 
ATOM   7779  O  OE2 . GLU C 1 61  ? 150.116 149.287 161.959 1.00 123.47 1 62  GLU C OE2 1 
ATOM   7780  N  N   . SER C 1 62  ? 148.091 142.618 161.814 1.00 103.61 ? 63  SER C N   1 
ATOM   7781  C  CA  . SER C 1 62  ? 147.968 141.352 162.524 1.00 100.86 ? 63  SER C CA  1 
ATOM   7782  C  C   . SER C 1 62  ? 148.628 140.205 161.787 1.00 98.75  ? 63  SER C C   1 
ATOM   7783  O  O   . SER C 1 62  ? 148.483 140.070 160.577 1.00 98.60  ? 63  SER C O   1 
ATOM   7784  C  CB  . SER C 1 62  ? 146.502 141.015 162.762 1.00 100.83 ? 63  SER C CB  1 
ATOM   7785  O  OG  . SER C 1 62  ? 146.387 139.793 163.453 1.00 100.81 ? 63  SER C OG  1 
ATOM   7786  N  N   . PRO C 1 63  ? 149.361 139.372 162.520 1.00 87.69  ? 64  PRO C N   1 
ATOM   7787  C  CA  . PRO C 1 63  ? 150.018 138.184 161.995 1.00 86.64  ? 64  PRO C CA  1 
ATOM   7788  C  C   . PRO C 1 63  ? 149.071 137.007 161.907 1.00 85.71  ? 64  PRO C C   1 
ATOM   7789  O  O   . PRO C 1 63  ? 149.375 136.045 161.225 1.00 85.62  ? 64  PRO C O   1 
ATOM   7790  C  CB  . PRO C 1 63  ? 151.067 137.898 163.052 1.00 86.57  ? 64  PRO C CB  1 
ATOM   7791  C  CG  . PRO C 1 63  ? 150.429 138.323 164.291 1.00 86.57  ? 64  PRO C CG  1 
ATOM   7792  C  CD  . PRO C 1 63  ? 149.612 139.526 163.956 1.00 86.80  ? 64  PRO C CD  1 
ATOM   7793  N  N   . HIS C 1 64  ? 147.947 137.082 162.603 1.00 78.47  ? 65  HIS C N   1 
ATOM   7794  C  CA  . HIS C 1 64  ? 147.040 135.950 162.709 1.00 77.86  ? 65  HIS C CA  1 
ATOM   7795  C  C   . HIS C 1 64  ? 146.233 135.707 161.449 1.00 80.14  ? 65  HIS C C   1 
ATOM   7796  O  O   . HIS C 1 64  ? 145.925 136.630 160.709 1.00 80.23  ? 65  HIS C O   1 
ATOM   7797  C  CB  . HIS C 1 64  ? 146.083 136.135 163.884 1.00 75.79  ? 65  HIS C CB  1 
ATOM   7798  C  CG  . HIS C 1 64  ? 146.755 136.506 165.163 1.00 73.79  ? 65  HIS C CG  1 
ATOM   7799  N  ND1 . HIS C 1 64  ? 147.618 135.663 165.828 1.00 72.86  ? 65  HIS C ND1 1 
ATOM   7800  C  CD2 . HIS C 1 64  ? 146.678 137.632 165.916 1.00 72.57  ? 65  HIS C CD2 1 
ATOM   7801  C  CE1 . HIS C 1 64  ? 148.047 136.257 166.923 1.00 72.10  ? 65  HIS C CE1 1 
ATOM   7802  N  NE2 . HIS C 1 64  ? 147.500 137.445 167.002 1.00 71.88  ? 65  HIS C NE2 1 
ATOM   7803  N  N   . HIS C 1 65  ? 145.887 134.447 161.218 1.00 121.00 ? 66  HIS C N   1 
ATOM   7804  C  CA  . HIS C 1 65  ? 144.976 134.083 160.147 1.00 123.52 ? 66  HIS C CA  1 
ATOM   7805  C  C   . HIS C 1 65  ? 143.553 134.308 160.607 1.00 124.63 ? 66  HIS C C   1 
ATOM   7806  O  O   . HIS C 1 65  ? 143.120 133.738 161.596 1.00 124.75 ? 66  HIS C O   1 
ATOM   7807  C  CB  . HIS C 1 65  ? 145.176 132.618 159.763 1.00 124.56 ? 66  HIS C CB  1 
ATOM   7808  C  CG  . HIS C 1 65  ? 144.055 132.039 158.959 1.00 125.62 ? 66  HIS C CG  1 
ATOM   7809  N  ND1 . HIS C 1 65  ? 143.737 132.486 157.696 1.00 126.07 ? 66  HIS C ND1 1 
ATOM   7810  C  CD2 . HIS C 1 65  ? 143.184 131.041 159.233 1.00 126.13 ? 66  HIS C CD2 1 
ATOM   7811  C  CE1 . HIS C 1 65  ? 142.715 131.793 157.229 1.00 126.38 ? 66  HIS C CE1 1 
ATOM   7812  N  NE2 . HIS C 1 65  ? 142.359 130.910 158.143 1.00 126.39 ? 66  HIS C NE2 1 
ATOM   7813  N  N   . HIS C 1 66  ? 142.826 135.150 159.891 1.00 97.48  ? 67  HIS C N   1 
ATOM   7814  C  CA  . HIS C 1 66  ? 141.437 135.412 160.220 1.00 98.60  ? 67  HIS C CA  1 
ATOM   7815  C  C   . HIS C 1 66  ? 140.494 134.642 159.315 1.00 100.26 ? 67  HIS C C   1 
ATOM   7816  O  O   . HIS C 1 66  ? 140.789 134.434 158.149 1.00 100.35 ? 67  HIS C O   1 
ATOM   7817  C  CB  . HIS C 1 66  ? 141.156 136.904 160.133 1.00 98.22  ? 67  HIS C CB  1 
ATOM   7818  C  CG  . HIS C 1 66  ? 141.888 137.707 161.155 1.00 97.81  ? 67  HIS C CG  1 
ATOM   7819  N  ND1 . HIS C 1 66  ? 141.361 137.987 162.392 1.00 97.62  ? 67  HIS C ND1 1 
ATOM   7820  C  CD2 . HIS C 1 66  ? 143.113 138.275 161.128 1.00 97.65  ? 67  HIS C CD2 1 
ATOM   7821  C  CE1 . HIS C 1 66  ? 142.229 138.700 163.085 1.00 97.54  ? 67  HIS C CE1 1 
ATOM   7822  N  NE2 . HIS C 1 66  ? 143.299 138.892 162.339 1.00 97.56  ? 67  HIS C NE2 1 
ATOM   7823  N  N   . THR C 1 67  ? 139.359 134.220 159.855 1.00 105.71 ? 68  THR C N   1 
ATOM   7824  C  CA  . THR C 1 67  ? 138.372 133.507 159.057 1.00 107.39 ? 68  THR C CA  1 
ATOM   7825  C  C   . THR C 1 67  ? 137.067 134.259 158.974 1.00 109.26 ? 68  THR C C   1 
ATOM   7826  O  O   . THR C 1 67  ? 136.503 134.642 159.986 1.00 109.16 ? 68  THR C O   1 
ATOM   7827  C  CB  . THR C 1 67  ? 138.062 132.129 159.625 1.00 107.24 ? 68  THR C CB  1 
ATOM   7828  O  OG1 . THR C 1 67  ? 137.578 132.265 160.962 1.00 107.24 ? 68  THR C OG1 1 
ATOM   7829  C  CG2 . THR C 1 67  ? 139.304 131.261 159.619 1.00 107.10 ? 68  THR C CG2 1 
ATOM   7830  N  N   . ALA C 1 68  ? 136.590 134.466 157.755 1.00 142.95 ? 69  ALA C N   1 
ATOM   7831  C  CA  . ALA C 1 68  ? 135.301 135.100 157.540 1.00 144.74 ? 69  ALA C CA  1 
ATOM   7832  C  C   . ALA C 1 68  ? 134.183 134.125 157.826 1.00 145.71 ? 69  ALA C C   1 
ATOM   7833  O  O   . ALA C 1 68  ? 134.268 132.963 157.450 1.00 145.84 ? 69  ALA C O   1 
ATOM   7834  C  CB  . ALA C 1 68  ? 135.198 135.603 156.124 1.00 145.14 ? 69  ALA C CB  1 
ATOM   7835  N  N   . PRO C 1 69  ? 133.128 134.596 158.492 1.00 121.52 ? 70  PRO C N   1 
ATOM   7836  C  CA  . PRO C 1 69  ? 131.929 133.779 158.660 1.00 121.51 ? 70  PRO C CA  1 
ATOM   7837  C  C   . PRO C 1 69  ? 131.340 133.460 157.300 1.00 120.64 ? 70  PRO C C   1 
ATOM   7838  O  O   . PRO C 1 69  ? 131.416 134.286 156.399 1.00 120.67 ? 70  PRO C O   1 
ATOM   7839  C  CB  . PRO C 1 69  ? 130.989 134.703 159.426 1.00 121.99 ? 70  PRO C CB  1 
ATOM   7840  C  CG  . PRO C 1 69  ? 131.890 135.612 160.167 1.00 122.14 ? 70  PRO C CG  1 
ATOM   7841  C  CD  . PRO C 1 69  ? 133.072 135.833 159.284 1.00 122.00 ? 70  PRO C CD  1 
ATOM   7842  N  N   . ALA C 1 70  ? 130.775 132.269 157.154 1.00 125.90 ? 71  ALA C N   1 
ATOM   7843  C  CA  . ALA C 1 70  ? 130.249 131.830 155.873 1.00 124.56 ? 71  ALA C CA  1 
ATOM   7844  C  C   . ALA C 1 70  ? 128.753 131.578 155.942 1.00 122.40 ? 71  ALA C C   1 
ATOM   7845  O  O   . ALA C 1 70  ? 128.238 131.189 156.982 1.00 122.30 ? 71  ALA C O   1 
ATOM   7846  C  CB  . ALA C 1 70  ? 130.966 130.585 155.432 1.00 124.95 ? 71  ALA C CB  1 
ATOM   7847  N  N   . LYS C 1 71  ? 128.056 131.805 154.834 1.00 129.49 ? 72  LYS C N   1 
ATOM   7848  C  CA  . LYS C 1 71  ? 126.636 131.486 154.759 1.00 127.08 ? 72  LYS C CA  1 
ATOM   7849  C  C   . LYS C 1 71  ? 126.410 129.989 154.873 1.00 122.69 ? 72  LYS C C   1 
ATOM   7850  O  O   . LYS C 1 71  ? 127.139 129.198 154.289 1.00 122.39 ? 72  LYS C O   1 
ATOM   7851  C  CB  . LYS C 1 71  ? 126.039 131.982 153.444 1.00 128.78 ? 72  LYS C CB  1 
ATOM   7852  C  CG  . LYS C 1 71  ? 126.051 133.486 153.274 1.00 130.26 ? 72  LYS C CG  1 
ATOM   7853  C  CD  . LYS C 1 71  ? 125.487 133.888 151.911 1.00 131.42 ? 72  LYS C CD  1 
ATOM   7854  C  CE  . LYS C 1 71  ? 125.667 135.378 151.650 1.00 132.23 ? 72  LYS C CE  1 
ATOM   7855  N  NZ  . LYS C 1 71  ? 125.096 135.787 150.340 1.00 132.63 1 72  LYS C NZ  1 
ATOM   7856  N  N   . SER C 1 72  ? 125.390 129.607 155.627 1.00 110.97 ? 73  SER C N   1 
ATOM   7857  C  CA  . SER C 1 72  ? 125.036 128.208 155.766 1.00 107.07 ? 73  SER C CA  1 
ATOM   7858  C  C   . SER C 1 72  ? 124.317 127.694 154.530 1.00 103.35 ? 73  SER C C   1 
ATOM   7859  O  O   . SER C 1 72  ? 123.374 128.308 154.054 1.00 103.07 ? 73  SER C O   1 
ATOM   7860  C  CB  . SER C 1 72  ? 124.178 127.999 157.009 1.00 107.11 ? 73  SER C CB  1 
ATOM   7861  O  OG  . SER C 1 72  ? 124.890 128.373 158.174 1.00 107.26 ? 73  SER C OG  1 
ATOM   7862  N  N   . PRO C 1 73  ? 124.780 126.562 154.003 1.00 76.76  ? 74  PRO C N   1 
ATOM   7863  C  CA  . PRO C 1 73  ? 124.215 125.841 152.868 1.00 74.65  ? 74  PRO C CA  1 
ATOM   7864  C  C   . PRO C 1 73  ? 122.878 125.199 153.190 1.00 72.73  ? 74  PRO C C   1 
ATOM   7865  O  O   . PRO C 1 73  ? 122.549 125.038 154.353 1.00 72.58  ? 74  PRO C O   1 
ATOM   7866  C  CB  . PRO C 1 73  ? 125.264 124.776 152.587 1.00 74.71  ? 74  PRO C CB  1 
ATOM   7867  C  CG  . PRO C 1 73  ? 125.931 124.582 153.851 1.00 75.10  ? 74  PRO C CG  1 
ATOM   7868  C  CD  . PRO C 1 73  ? 125.993 125.902 154.499 1.00 75.81  ? 74  PRO C CD  1 
ATOM   7869  N  N   . LYS C 1 74  ? 122.105 124.880 152.160 1.00 88.22  ? 75  LYS C N   1 
ATOM   7870  C  CA  . LYS C 1 74  ? 120.812 124.252 152.337 1.00 86.59  ? 75  LYS C CA  1 
ATOM   7871  C  C   . LYS C 1 74  ? 120.936 122.952 153.105 1.00 84.47  ? 75  LYS C C   1 
ATOM   7872  O  O   . LYS C 1 74  ? 120.165 122.691 154.017 1.00 84.31  ? 75  LYS C O   1 
ATOM   7873  C  CB  . LYS C 1 74  ? 120.183 123.957 150.979 1.00 87.07  ? 75  LYS C CB  1 
ATOM   7874  C  CG  . LYS C 1 74  ? 119.745 125.161 150.195 1.00 87.59  ? 75  LYS C CG  1 
ATOM   7875  C  CD  . LYS C 1 74  ? 118.815 124.746 149.080 1.00 87.98  ? 75  LYS C CD  1 
ATOM   7876  C  CE  . LYS C 1 74  ? 118.174 125.939 148.404 1.00 88.28  ? 75  LYS C CE  1 
ATOM   7877  N  NZ  . LYS C 1 74  ? 118.988 126.454 147.278 1.00 88.42  1 75  LYS C NZ  1 
ATOM   7878  N  N   . ILE C 1 75  ? 121.924 122.147 152.748 1.00 73.20  ? 76  ILE C N   1 
ATOM   7879  C  CA  . ILE C 1 75  ? 122.161 120.888 153.429 1.00 71.26  ? 76  ILE C CA  1 
ATOM   7880  C  C   . ILE C 1 75  ? 123.530 120.927 154.049 1.00 69.81  ? 76  ILE C C   1 
ATOM   7881  O  O   . ILE C 1 75  ? 124.488 121.273 153.391 1.00 69.67  ? 76  ILE C O   1 
ATOM   7882  C  CB  . ILE C 1 75  ? 122.124 119.719 152.461 1.00 70.94  ? 76  ILE C CB  1 
ATOM   7883  C  CG1 . ILE C 1 75  ? 120.751 119.598 151.819 1.00 70.78  ? 76  ILE C CG1 1 
ATOM   7884  C  CG2 . ILE C 1 75  ? 122.467 118.446 153.171 1.00 70.85  ? 76  ILE C CG2 1 
ATOM   7885  C  CD1 . ILE C 1 75  ? 120.677 118.532 150.774 1.00 70.69  ? 76  ILE C CD1 1 
ATOM   7886  N  N   . LEU C 1 76  ? 123.620 120.566 155.318 1.00 66.30  ? 77  LEU C N   1 
ATOM   7887  C  CA  . LEU C 1 76  ? 124.878 120.613 156.041 1.00 65.18  ? 77  LEU C CA  1 
ATOM   7888  C  C   . LEU C 1 76  ? 125.659 119.327 155.872 1.00 65.05  ? 77  LEU C C   1 
ATOM   7889  O  O   . LEU C 1 76  ? 125.150 118.263 156.168 1.00 65.04  ? 77  LEU C O   1 
ATOM   7890  C  CB  . LEU C 1 76  ? 124.619 120.874 157.519 1.00 64.43  ? 77  LEU C CB  1 
ATOM   7891  C  CG  . LEU C 1 76  ? 124.440 122.313 158.006 1.00 63.85  ? 77  LEU C CG  1 
ATOM   7892  C  CD1 . LEU C 1 76  ? 123.371 123.037 157.251 1.00 63.65  ? 77  LEU C CD1 1 
ATOM   7893  C  CD2 . LEU C 1 76  ? 124.111 122.326 159.468 1.00 63.63  ? 77  LEU C CD2 1 
ATOM   7894  N  N   . PRO C 1 77  ? 126.894 119.419 155.368 1.00 62.27  ? 78  PRO C N   1 
ATOM   7895  C  CA  . PRO C 1 77  ? 127.752 118.252 155.182 1.00 62.42  ? 78  PRO C CA  1 
ATOM   7896  C  C   . PRO C 1 77  ? 128.015 117.497 156.470 1.00 62.83  ? 78  PRO C C   1 
ATOM   7897  O  O   . PRO C 1 77  ? 128.154 116.288 156.454 1.00 62.91  ? 78  PRO C O   1 
ATOM   7898  C  CB  . PRO C 1 77  ? 129.034 118.849 154.614 1.00 62.24  ? 78  PRO C CB  1 
ATOM   7899  C  CG  . PRO C 1 77  ? 128.975 120.266 154.926 1.00 62.14  ? 78  PRO C CG  1 
ATOM   7900  C  CD  . PRO C 1 77  ? 127.562 120.653 154.946 1.00 62.15  ? 78  PRO C CD  1 
ATOM   7901  N  N   . ASP C 1 78  ? 128.089 118.223 157.574 1.00 81.86  ? 79  ASP C N   1 
ATOM   7902  C  CA  . ASP C 1 78  ? 128.133 117.615 158.891 1.00 82.27  ? 79  ASP C CA  1 
ATOM   7903  C  C   . ASP C 1 78  ? 127.679 118.587 159.958 1.00 82.56  ? 79  ASP C C   1 
ATOM   7904  O  O   . ASP C 1 78  ? 127.526 119.764 159.701 1.00 82.60  ? 79  ASP C O   1 
ATOM   7905  C  CB  . ASP C 1 78  ? 129.511 117.048 159.212 1.00 82.36  ? 79  ASP C CB  1 
ATOM   7906  C  CG  . ASP C 1 78  ? 130.591 118.095 159.228 1.00 82.40  ? 79  ASP C CG  1 
ATOM   7907  O  OD1 . ASP C 1 78  ? 130.431 119.111 159.916 1.00 82.42  ? 79  ASP C OD1 1 
ATOM   7908  O  OD2 . ASP C 1 78  ? 131.617 117.894 158.554 1.00 82.42  1 79  ASP C OD2 1 
ATOM   7909  N  N   . ILE C 1 79  ? 127.476 118.080 161.163 1.00 70.61  ? 80  ILE C N   1 
ATOM   7910  C  CA  . ILE C 1 79  ? 126.906 118.867 162.244 1.00 70.85  ? 80  ILE C CA  1 
ATOM   7911  C  C   . ILE C 1 79  ? 127.824 119.996 162.694 1.00 70.99  ? 80  ILE C C   1 
ATOM   7912  O  O   . ILE C 1 79  ? 127.377 120.971 163.274 1.00 70.99  ? 80  ILE C O   1 
ATOM   7913  C  CB  . ILE C 1 79  ? 126.517 117.971 163.432 1.00 70.94  ? 80  ILE C CB  1 
ATOM   7914  C  CG1 . ILE C 1 79  ? 125.564 118.694 164.377 1.00 71.00  ? 80  ILE C CG1 1 
ATOM   7915  C  CG2 . ILE C 1 79  ? 127.733 117.508 164.164 1.00 70.95  ? 80  ILE C CG2 1 
ATOM   7916  C  CD1 . ILE C 1 79  ? 124.275 119.089 163.748 1.00 71.04  ? 80  ILE C CD1 1 
ATOM   7917  N  N   . LEU C 1 80  ? 129.107 119.880 162.404 1.00 67.33  ? 81  LEU C N   1 
ATOM   7918  C  CA  . LEU C 1 80  ? 130.056 120.891 162.830 1.00 67.49  ? 81  LEU C CA  1 
ATOM   7919  C  C   . LEU C 1 80  ? 129.789 122.222 162.163 1.00 68.29  ? 81  LEU C C   1 
ATOM   7920  O  O   . LEU C 1 80  ? 130.223 123.254 162.639 1.00 68.34  ? 81  LEU C O   1 
ATOM   7921  C  CB  . LEU C 1 80  ? 131.483 120.441 162.558 1.00 67.02  ? 81  LEU C CB  1 
ATOM   7922  C  CG  . LEU C 1 80  ? 131.920 119.189 163.305 1.00 66.62  ? 81  LEU C CG  1 
ATOM   7923  C  CD1 . LEU C 1 80  ? 133.306 118.780 162.908 1.00 66.47  ? 81  LEU C CD1 1 
ATOM   7924  C  CD2 . LEU C 1 80  ? 131.853 119.443 164.775 1.00 66.50  ? 81  LEU C CD2 1 
ATOM   7925  N  N   . LYS C 1 81  ? 129.079 122.199 161.050 1.00 78.31  ? 82  LYS C N   1 
ATOM   7926  C  CA  . LYS C 1 81  ? 128.707 123.436 160.394 1.00 79.06  ? 82  LYS C CA  1 
ATOM   7927  C  C   . LYS C 1 81  ? 127.579 124.118 161.137 1.00 78.89  ? 82  LYS C C   1 
ATOM   7928  O  O   . LYS C 1 81  ? 127.284 125.272 160.891 1.00 78.90  ? 82  LYS C O   1 
ATOM   7929  C  CB  . LYS C 1 81  ? 128.328 123.201 158.937 1.00 79.76  ? 82  LYS C CB  1 
ATOM   7930  C  CG  . LYS C 1 81  ? 129.501 123.264 157.978 1.00 80.37  ? 82  LYS C CG  1 
ATOM   7931  C  CD  . LYS C 1 81  ? 130.478 122.126 158.213 1.00 80.90  ? 82  LYS C CD  1 
ATOM   7932  C  CE  . LYS C 1 81  ? 131.851 122.418 157.645 1.00 81.34  ? 82  LYS C CE  1 
ATOM   7933  N  NZ  . LYS C 1 81  ? 132.887 121.507 158.202 1.00 81.56  1 82  LYS C NZ  1 
ATOM   7934  N  N   . LYS C 1 82  ? 126.947 123.398 162.052 1.00 76.04  ? 83  LYS C N   1 
ATOM   7935  C  CA  . LYS C 1 82  ? 125.907 123.982 162.886 1.00 75.87  ? 83  LYS C CA  1 
ATOM   7936  C  C   . LYS C 1 82  ? 126.543 124.571 164.129 1.00 75.46  ? 83  LYS C C   1 
ATOM   7937  O  O   . LYS C 1 82  ? 126.187 124.255 165.248 1.00 75.42  ? 83  LYS C O   1 
ATOM   7938  C  CB  . LYS C 1 82  ? 124.836 122.941 163.225 1.00 76.06  ? 83  LYS C CB  1 
ATOM   7939  C  CG  . LYS C 1 82  ? 123.609 123.455 163.959 1.00 76.26  ? 83  LYS C CG  1 
ATOM   7940  C  CD  . LYS C 1 82  ? 122.984 124.639 163.284 1.00 76.41  ? 83  LYS C CD  1 
ATOM   7941  C  CE  . LYS C 1 82  ? 121.779 125.151 164.057 1.00 76.54  ? 83  LYS C CE  1 
ATOM   7942  N  NZ  . LYS C 1 82  ? 122.144 125.680 165.387 1.00 76.59  1 83  LYS C NZ  1 
ATOM   7943  N  N   . ILE C 1 83  ? 127.512 125.440 163.909 1.00 65.72  ? 84  ILE C N   1 
ATOM   7944  C  CA  . ILE C 1 83  ? 128.157 126.163 164.983 1.00 65.40  ? 84  ILE C CA  1 
ATOM   7945  C  C   . ILE C 1 83  ? 128.251 127.610 164.561 1.00 66.29  ? 84  ILE C C   1 
ATOM   7946  O  O   . ILE C 1 83  ? 128.743 127.915 163.491 1.00 66.32  ? 84  ILE C O   1 
ATOM   7947  C  CB  . ILE C 1 83  ? 129.550 125.617 165.254 1.00 64.48  ? 84  ILE C CB  1 
ATOM   7948  C  CG1 . ILE C 1 83  ? 129.458 124.209 165.811 1.00 63.99  ? 84  ILE C CG1 1 
ATOM   7949  C  CG2 . ILE C 1 83  ? 130.269 126.473 166.240 1.00 64.25  ? 84  ILE C CG2 1 
ATOM   7950  C  CD1 . ILE C 1 83  ? 130.772 123.529 165.892 1.00 63.75  ? 84  ILE C CD1 1 
ATOM   7951  N  N   . GLY C 1 84  ? 127.784 128.502 165.419 1.00 59.90  ? 85  GLY C N   1 
ATOM   7952  C  CA  . GLY C 1 84  ? 127.644 129.897 165.071 1.00 60.98  ? 85  GLY C CA  1 
ATOM   7953  C  C   . GLY C 1 84  ? 126.256 130.251 164.588 1.00 62.12  ? 85  GLY C C   1 
ATOM   7954  O  O   . GLY C 1 84  ? 125.374 129.414 164.560 1.00 62.24  ? 85  GLY C O   1 
ATOM   7955  N  N   . ASP C 1 85  ? 126.079 131.511 164.214 1.00 101.04 ? 86  ASP C N   1 
ATOM   7956  C  CA  . ASP C 1 85  ? 124.792 132.051 163.799 1.00 101.94 ? 86  ASP C CA  1 
ATOM   7957  C  C   . ASP C 1 85  ? 123.729 131.833 164.857 1.00 101.95 ? 86  ASP C C   1 
ATOM   7958  O  O   . ASP C 1 85  ? 122.593 131.502 164.557 1.00 102.00 ? 86  ASP C O   1 
ATOM   7959  C  CB  . ASP C 1 85  ? 124.353 131.471 162.455 1.00 102.47 ? 86  ASP C CB  1 
ATOM   7960  C  CG  . ASP C 1 85  ? 125.277 131.860 161.321 1.00 102.73 ? 86  ASP C CG  1 
ATOM   7961  O  OD1 . ASP C 1 85  ? 125.311 131.141 160.301 1.00 102.88 ? 86  ASP C OD1 1 
ATOM   7962  O  OD2 . ASP C 1 85  ? 125.975 132.881 161.447 1.00 102.83 1 86  ASP C OD2 1 
ATOM   7963  N  N   . THR C 1 86  ? 124.120 132.015 166.105 1.00 73.13  ? 87  THR C N   1 
ATOM   7964  C  CA  . THR C 1 86  ? 123.221 131.843 167.219 1.00 72.95  ? 87  THR C CA  1 
ATOM   7965  C  C   . THR C 1 86  ? 122.274 133.013 167.333 1.00 72.85  ? 87  THR C C   1 
ATOM   7966  O  O   . THR C 1 86  ? 122.653 134.135 167.071 1.00 72.86  ? 87  THR C O   1 
ATOM   7967  C  CB  . THR C 1 86  ? 124.007 131.686 168.497 1.00 72.86  ? 87  THR C CB  1 
ATOM   7968  O  OG1 . THR C 1 86  ? 124.801 132.850 168.703 1.00 72.78  ? 87  THR C OG1 1 
ATOM   7969  C  CG2 . THR C 1 86  ? 124.913 130.510 168.384 1.00 72.81  ? 87  THR C CG2 1 
ATOM   7970  N  N   . PRO C 1 87  ? 121.031 132.748 167.725 1.00 73.64  ? 88  PRO C N   1 
ATOM   7971  C  CA  . PRO C 1 87  ? 119.976 133.748 167.839 1.00 73.70  ? 88  PRO C CA  1 
ATOM   7972  C  C   . PRO C 1 87  ? 120.236 134.829 168.865 1.00 73.95  ? 88  PRO C C   1 
ATOM   7973  O  O   . PRO C 1 87  ? 120.841 134.574 169.889 1.00 73.95  ? 88  PRO C O   1 
ATOM   7974  C  CB  . PRO C 1 87  ? 118.777 132.921 168.278 1.00 73.57  ? 88  PRO C CB  1 
ATOM   7975  C  CG  . PRO C 1 87  ? 119.344 131.744 168.890 1.00 73.51  ? 88  PRO C CG  1 
ATOM   7976  C  CD  . PRO C 1 87  ? 120.544 131.424 168.117 1.00 73.54  ? 88  PRO C CD  1 
ATOM   7977  N  N   . MET C 1 88  ? 119.767 136.032 168.574 1.00 81.01  ? 89  MET C N   1 
ATOM   7978  C  CA  . MET C 1 88  ? 119.773 137.120 169.535 1.00 81.30  ? 89  MET C CA  1 
ATOM   7979  C  C   . MET C 1 88  ? 118.345 137.397 169.970 1.00 81.15  ? 89  MET C C   1 
ATOM   7980  O  O   . MET C 1 88  ? 117.568 137.956 169.223 1.00 81.16  ? 89  MET C O   1 
ATOM   7981  C  CB  . MET C 1 88  ? 120.382 138.370 168.915 1.00 81.65  ? 89  MET C CB  1 
ATOM   7982  C  CG  . MET C 1 88  ? 120.468 139.546 169.848 1.00 81.89  ? 89  MET C CG  1 
ATOM   7983  S  SD  . MET C 1 88  ? 121.901 139.514 170.913 1.00 82.12  ? 89  MET C SD  1 
ATOM   7984  C  CE  . MET C 1 88  ? 123.160 139.993 169.762 1.00 82.28  ? 89  MET C CE  1 
ATOM   7985  N  N   . VAL C 1 89  ? 118.000 136.993 171.181 1.00 68.25  ? 90  VAL C N   1 
ATOM   7986  C  CA  . VAL C 1 89  ? 116.627 137.079 171.648 1.00 68.19  ? 90  VAL C CA  1 
ATOM   7987  C  C   . VAL C 1 89  ? 116.426 138.174 172.667 1.00 68.85  ? 90  VAL C C   1 
ATOM   7988  O  O   . VAL C 1 89  ? 117.263 138.391 173.508 1.00 68.84  ? 90  VAL C O   1 
ATOM   7989  C  CB  . VAL C 1 89  ? 116.216 135.778 172.297 1.00 67.63  ? 90  VAL C CB  1 
ATOM   7990  C  CG1 . VAL C 1 89  ? 114.741 135.765 172.542 1.00 67.46  ? 90  VAL C CG1 1 
ATOM   7991  C  CG2 . VAL C 1 89  ? 116.600 134.636 171.413 1.00 67.44  ? 90  VAL C CG2 1 
ATOM   7992  N  N   . ARG C 1 90  ? 115.299 138.861 172.602 1.00 85.93  ? 91  ARG C N   1 
ATOM   7993  C  CA  . ARG C 1 90  ? 115.016 139.926 173.549 1.00 86.75  ? 91  ARG C CA  1 
ATOM   7994  C  C   . ARG C 1 90  ? 114.456 139.419 174.862 1.00 86.79  ? 91  ARG C C   1 
ATOM   7995  O  O   . ARG C 1 90  ? 113.573 138.579 174.886 1.00 86.80  ? 91  ARG C O   1 
ATOM   7996  C  CB  . ARG C 1 90  ? 114.040 140.914 172.935 1.00 87.45  ? 91  ARG C CB  1 
ATOM   7997  C  CG  . ARG C 1 90  ? 113.536 141.950 173.885 1.00 88.05  ? 91  ARG C CG  1 
ATOM   7998  C  CD  . ARG C 1 90  ? 112.587 142.873 173.184 1.00 88.55  ? 91  ARG C CD  1 
ATOM   7999  N  NE  . ARG C 1 90  ? 113.220 143.466 172.019 1.00 88.96  ? 91  ARG C NE  1 
ATOM   8000  C  CZ  . ARG C 1 90  ? 112.559 143.901 170.960 1.00 89.39  ? 91  ARG C CZ  1 
ATOM   8001  N  NH1 . ARG C 1 90  ? 111.242 143.802 170.926 1.00 89.52  1 91  ARG C NH1 1 
ATOM   8002  N  NH2 . ARG C 1 90  ? 113.216 144.428 169.939 1.00 89.52  ? 91  ARG C NH2 1 
ATOM   8003  N  N   . ILE C 1 91  ? 114.972 139.954 175.957 1.00 73.46  ? 92  ILE C N   1 
ATOM   8004  C  CA  . ILE C 1 91  ? 114.467 139.641 177.279 1.00 73.49  ? 92  ILE C CA  1 
ATOM   8005  C  C   . ILE C 1 91  ? 113.309 140.561 177.594 1.00 73.87  ? 92  ILE C C   1 
ATOM   8006  O  O   . ILE C 1 91  ? 113.467 141.764 177.648 1.00 73.88  ? 92  ILE C O   1 
ATOM   8007  C  CB  . ILE C 1 91  ? 115.546 139.844 178.327 1.00 73.23  ? 92  ILE C CB  1 
ATOM   8008  C  CG1 . ILE C 1 91  ? 116.795 139.060 177.957 1.00 73.08  ? 92  ILE C CG1 1 
ATOM   8009  C  CG2 . ILE C 1 91  ? 115.047 139.426 179.677 1.00 73.17  ? 92  ILE C CG2 1 
ATOM   8010  C  CD1 . ILE C 1 91  ? 116.590 137.607 177.938 1.00 73.01  ? 92  ILE C CD1 1 
ATOM   8011  N  N   . ASN C 1 92  ? 112.139 139.993 177.811 1.00 82.27  ? 93  ASN C N   1 
ATOM   8012  C  CA  . ASN C 1 92  ? 110.938 140.800 177.905 1.00 82.64  ? 93  ASN C CA  1 
ATOM   8013  C  C   . ASN C 1 92  ? 110.453 141.132 179.308 1.00 82.88  ? 93  ASN C C   1 
ATOM   8014  O  O   . ASN C 1 92  ? 109.787 142.136 179.507 1.00 82.90  ? 93  ASN C O   1 
ATOM   8015  C  CB  . ASN C 1 92  ? 109.815 140.147 177.106 1.00 82.71  ? 93  ASN C CB  1 
ATOM   8016  C  CG  . ASN C 1 92  ? 110.065 140.184 175.620 1.00 82.75  ? 93  ASN C CG  1 
ATOM   8017  O  OD1 . ASN C 1 92  ? 110.345 141.233 175.055 1.00 82.77  ? 93  ASN C OD1 1 
ATOM   8018  N  ND2 . ASN C 1 92  ? 109.973 139.034 174.978 1.00 82.76  ? 93  ASN C ND2 1 
ATOM   8019  N  N   . LYS C 1 93  ? 110.783 140.296 180.281 1.00 87.47  ? 94  LYS C N   1 
ATOM   8020  C  CA  . LYS C 1 93  ? 110.233 140.465 181.618 1.00 87.69  ? 94  LYS C CA  1 
ATOM   8021  C  C   . LYS C 1 93  ? 111.259 140.781 182.684 1.00 87.68  ? 94  LYS C C   1 
ATOM   8022  O  O   . LYS C 1 93  ? 111.043 141.655 183.510 1.00 87.67  ? 94  LYS C O   1 
ATOM   8023  C  CB  . LYS C 1 93  ? 109.452 139.222 182.041 1.00 87.90  ? 94  LYS C CB  1 
ATOM   8024  C  CG  . LYS C 1 93  ? 108.217 138.926 181.223 1.00 88.10  ? 94  LYS C CG  1 
ATOM   8025  C  CD  . LYS C 1 93  ? 107.584 137.636 181.688 1.00 88.28  ? 94  LYS C CD  1 
ATOM   8026  C  CE  . LYS C 1 93  ? 106.600 137.099 180.686 1.00 88.41  ? 94  LYS C CE  1 
ATOM   8027  N  NZ  . LYS C 1 93  ? 106.362 135.656 180.920 1.00 88.48  1 94  LYS C NZ  1 
ATOM   8028  N  N   . ILE C 1 94  ? 112.370 140.061 182.674 1.00 77.61  ? 95  ILE C N   1 
ATOM   8029  C  CA  . ILE C 1 94  ? 113.324 140.147 183.763 1.00 77.66  ? 95  ILE C CA  1 
ATOM   8030  C  C   . ILE C 1 94  ? 113.915 141.537 183.927 1.00 78.73  ? 95  ILE C C   1 
ATOM   8031  O  O   . ILE C 1 94  ? 114.085 142.019 185.047 1.00 78.77  ? 95  ILE C O   1 
ATOM   8032  C  CB  . ILE C 1 94  ? 114.455 139.144 183.562 1.00 76.86  ? 95  ILE C CB  1 
ATOM   8033  C  CG1 . ILE C 1 94  ? 113.917 137.734 183.696 1.00 76.41  ? 95  ILE C CG1 1 
ATOM   8034  C  CG2 . ILE C 1 94  ? 115.541 139.343 184.571 1.00 76.68  ? 95  ILE C CG2 1 
ATOM   8035  C  CD1 . ILE C 1 94  ? 114.952 136.678 183.504 1.00 76.15  ? 95  ILE C CD1 1 
ATOM   8036  N  N   . GLY C 1 95  ? 114.164 142.216 182.818 1.00 78.36  ? 96  GLY C N   1 
ATOM   8037  C  CA  . GLY C 1 95  ? 114.739 143.538 182.906 1.00 79.57  ? 96  GLY C CA  1 
ATOM   8038  C  C   . GLY C 1 95  ? 113.781 144.538 183.499 1.00 80.78  ? 96  GLY C C   1 
ATOM   8039  O  O   . GLY C 1 95  ? 114.154 145.343 184.332 1.00 80.90  ? 96  GLY C O   1 
ATOM   8040  N  N   . LYS C 1 96  ? 112.529 144.471 183.083 1.00 101.77 ? 97  LYS C N   1 
ATOM   8041  C  CA  . LYS C 1 96  ? 111.527 145.368 183.620 1.00 102.79 ? 97  LYS C CA  1 
ATOM   8042  C  C   . LYS C 1 96  ? 111.226 145.049 185.072 1.00 101.74 ? 97  LYS C C   1 
ATOM   8043  O  O   . LYS C 1 96  ? 110.856 145.920 185.840 1.00 101.73 ? 97  LYS C O   1 
ATOM   8044  C  CB  . LYS C 1 96  ? 110.265 145.342 182.763 1.00 104.52 ? 97  LYS C CB  1 
ATOM   8045  C  CG  . LYS C 1 96  ? 110.548 145.638 181.302 1.00 106.05 ? 97  LYS C CG  1 
ATOM   8046  C  CD  . LYS C 1 96  ? 109.282 145.852 180.481 1.00 107.30 ? 97  LYS C CD  1 
ATOM   8047  C  CE  . LYS C 1 96  ? 109.601 146.050 178.997 1.00 108.17 ? 97  LYS C CE  1 
ATOM   8048  N  NZ  . LYS C 1 96  ? 110.609 147.126 178.767 1.00 108.55 1 97  LYS C NZ  1 
ATOM   8049  N  N   . LYS C 1 97  ? 111.395 143.792 185.443 1.00 88.59  ? 98  LYS C N   1 
ATOM   8050  C  CA  . LYS C 1 97  ? 111.190 143.377 186.813 1.00 87.54  ? 98  LYS C CA  1 
ATOM   8051  C  C   . LYS C 1 97  ? 112.210 144.031 187.721 1.00 86.65  ? 98  LYS C C   1 
ATOM   8052  O  O   . LYS C 1 97  ? 111.940 144.268 188.897 1.00 86.57  ? 98  LYS C O   1 
ATOM   8053  C  CB  . LYS C 1 97  ? 111.307 141.862 186.915 1.00 87.42  ? 98  LYS C CB  1 
ATOM   8054  C  CG  . LYS C 1 97  ? 110.901 141.266 188.253 1.00 87.32  ? 98  LYS C CG  1 
ATOM   8055  C  CD  . LYS C 1 97  ? 111.268 139.793 188.321 1.00 87.25  ? 98  LYS C CD  1 
ATOM   8056  C  CE  . LYS C 1 97  ? 110.459 139.044 189.359 1.00 87.20  ? 98  LYS C CE  1 
ATOM   8057  N  NZ  . LYS C 1 97  ? 110.742 139.521 190.728 1.00 87.18  1 98  LYS C NZ  1 
ATOM   8058  N  N   . PHE C 1 98  ? 113.390 144.314 187.182 1.00 80.33  ? 99  PHE C N   1 
ATOM   8059  C  CA  . PHE C 1 98  ? 114.444 144.910 187.986 1.00 79.57  ? 99  PHE C CA  1 
ATOM   8060  C  C   . PHE C 1 98  ? 114.678 146.364 187.640 1.00 80.21  ? 99  PHE C C   1 
ATOM   8061  O  O   . PHE C 1 98  ? 115.676 146.948 188.028 1.00 80.19  ? 99  PHE C O   1 
ATOM   8062  C  CB  . PHE C 1 98  ? 115.732 144.119 187.851 1.00 78.59  ? 99  PHE C CB  1 
ATOM   8063  C  CG  . PHE C 1 98  ? 115.718 142.828 188.592 1.00 77.67  ? 99  PHE C CG  1 
ATOM   8064  C  CD1 . PHE C 1 98  ? 115.178 141.705 188.025 1.00 77.21  ? 99  PHE C CD1 1 
ATOM   8065  C  CD2 . PHE C 1 98  ? 116.233 142.743 189.859 1.00 77.14  ? 99  PHE C CD2 1 
ATOM   8066  C  CE1 . PHE C 1 98  ? 115.153 140.525 188.705 1.00 76.87  ? 99  PHE C CE1 1 
ATOM   8067  C  CE2 . PHE C 1 98  ? 116.212 141.564 190.540 1.00 76.85  ? 99  PHE C CE2 1 
ATOM   8068  C  CZ  . PHE C 1 98  ? 115.669 140.454 189.961 1.00 76.73  ? 99  PHE C CZ  1 
ATOM   8069  N  N   . GLY C 1 99  ? 113.744 146.942 186.903 1.00 87.06  ? 100 GLY C N   1 
ATOM   8070  C  CA  . GLY C 1 99  ? 113.759 148.365 186.641 1.00 87.78  ? 100 GLY C CA  1 
ATOM   8071  C  C   . GLY C 1 99  ? 114.656 148.889 185.541 1.00 88.54  ? 100 GLY C C   1 
ATOM   8072  O  O   . GLY C 1 99  ? 114.920 150.078 185.485 1.00 88.61  ? 100 GLY C O   1 
ATOM   8073  N  N   . LEU C 1 100 ? 115.150 148.020 184.678 1.00 84.15  ? 101 LEU C N   1 
ATOM   8074  C  CA  . LEU C 1 100 ? 115.915 148.491 183.539 1.00 84.88  ? 101 LEU C CA  1 
ATOM   8075  C  C   . LEU C 1 100 ? 115.056 149.301 182.600 1.00 85.30  ? 101 LEU C C   1 
ATOM   8076  O  O   . LEU C 1 100 ? 113.931 148.937 182.309 1.00 85.35  ? 101 LEU C O   1 
ATOM   8077  C  CB  . LEU C 1 100 ? 116.514 147.328 182.774 1.00 85.09  ? 101 LEU C CB  1 
ATOM   8078  C  CG  . LEU C 1 100 ? 117.639 146.602 183.481 1.00 85.24  ? 101 LEU C CG  1 
ATOM   8079  C  CD1 . LEU C 1 100 ? 118.303 145.668 182.517 1.00 85.29  ? 101 LEU C CD1 1 
ATOM   8080  C  CD2 . LEU C 1 100 ? 118.619 147.602 184.015 1.00 85.30  ? 101 LEU C CD2 1 
ATOM   8081  N  N   . LYS C 1 101 ? 115.600 150.401 182.112 1.00 98.65  ? 102 LYS C N   1 
ATOM   8082  C  CA  . LYS C 1 101 ? 114.891 151.205 181.144 1.00 98.94  ? 102 LYS C CA  1 
ATOM   8083  C  C   . LYS C 1 101 ? 115.315 150.810 179.746 1.00 98.36  ? 102 LYS C C   1 
ATOM   8084  O  O   . LYS C 1 101 ? 114.629 151.101 178.779 1.00 98.35  ? 102 LYS C O   1 
ATOM   8085  C  CB  . LYS C 1 101 ? 115.182 152.684 181.361 1.00 99.62  ? 102 LYS C CB  1 
ATOM   8086  C  CG  . LYS C 1 101 ? 115.161 153.143 182.800 1.00 100.16 ? 102 LYS C CG  1 
ATOM   8087  C  CD  . LYS C 1 101 ? 115.503 154.619 182.890 1.00 100.58 ? 102 LYS C CD  1 
ATOM   8088  C  CE  . LYS C 1 101 ? 116.251 154.944 184.161 1.00 100.85 ? 102 LYS C CE  1 
ATOM   8089  N  NZ  . LYS C 1 101 ? 115.451 154.590 185.358 1.00 100.98 1 102 LYS C NZ  1 
ATOM   8090  N  N   . CYS C 1 102 ? 116.452 150.138 179.650 1.00 93.22  ? 103 CYS C N   1 
ATOM   8091  C  CA  . CYS C 1 102 ? 117.053 149.815 178.364 1.00 92.52  ? 103 CYS C CA  1 
ATOM   8092  C  C   . CYS C 1 102 ? 116.501 148.544 177.746 1.00 91.52  ? 103 CYS C C   1 
ATOM   8093  O  O   . CYS C 1 102 ? 115.783 147.801 178.390 1.00 91.49  ? 103 CYS C O   1 
ATOM   8094  C  CB  . CYS C 1 102 ? 118.563 149.692 178.510 1.00 92.65  ? 103 CYS C CB  1 
ATOM   8095  S  SG  . CYS C 1 102 ? 119.094 148.296 179.482 1.00 92.72  ? 103 CYS C SG  1 
ATOM   8096  N  N   . GLU C 1 103 ? 116.819 148.314 176.480 1.00 94.17  ? 104 GLU C N   1 
ATOM   8097  C  CA  . GLU C 1 103 ? 116.526 147.043 175.841 1.00 93.06  ? 104 GLU C CA  1 
ATOM   8098  C  C   . GLU C 1 103 ? 117.562 146.024 176.285 1.00 91.53  ? 104 GLU C C   1 
ATOM   8099  O  O   . GLU C 1 103 ? 118.748 146.242 176.125 1.00 91.47  ? 104 GLU C O   1 
ATOM   8100  C  CB  . GLU C 1 103 ? 116.567 147.202 174.320 1.00 93.38  ? 104 GLU C CB  1 
ATOM   8101  C  CG  . GLU C 1 103 ? 116.145 145.977 173.524 1.00 93.60  ? 104 GLU C CG  1 
ATOM   8102  C  CD  . GLU C 1 103 ? 116.323 146.144 172.023 1.00 93.71  ? 104 GLU C CD  1 
ATOM   8103  O  OE1 . GLU C 1 103 ? 117.258 146.848 171.603 1.00 93.76  ? 104 GLU C OE1 1 
ATOM   8104  O  OE2 . GLU C 1 103 ? 115.529 145.570 171.255 1.00 93.76  1 104 GLU C OE2 1 
ATOM   8105  N  N   . LEU C 1 104 ? 117.118 144.904 176.839 1.00 82.94  ? 105 LEU C N   1 
ATOM   8106  C  CA  . LEU C 1 104 ? 118.046 143.862 177.255 1.00 81.40  ? 105 LEU C CA  1 
ATOM   8107  C  C   . LEU C 1 104 ? 118.012 142.692 176.291 1.00 80.04  ? 105 LEU C C   1 
ATOM   8108  O  O   . LEU C 1 104 ? 116.985 142.061 176.119 1.00 79.95  ? 105 LEU C O   1 
ATOM   8109  C  CB  . LEU C 1 104 ? 117.726 143.377 178.662 1.00 81.28  ? 105 LEU C CB  1 
ATOM   8110  C  CG  . LEU C 1 104 ? 118.717 142.372 179.229 1.00 81.18  ? 105 LEU C CG  1 
ATOM   8111  C  CD1 . LEU C 1 104 ? 120.053 143.018 179.409 1.00 81.15  ? 105 LEU C CD1 1 
ATOM   8112  C  CD2 . LEU C 1 104 ? 118.225 141.821 180.533 1.00 81.14  ? 105 LEU C CD2 1 
ATOM   8113  N  N   . LEU C 1 105 ? 119.142 142.405 175.663 1.00 81.12  ? 106 LEU C N   1 
ATOM   8114  C  CA  . LEU C 1 105 ? 119.216 141.336 174.685 1.00 79.90  ? 106 LEU C CA  1 
ATOM   8115  C  C   . LEU C 1 105 ? 120.115 140.204 175.128 1.00 78.80  ? 106 LEU C C   1 
ATOM   8116  O  O   . LEU C 1 105 ? 121.090 140.415 175.827 1.00 78.71  ? 106 LEU C O   1 
ATOM   8117  C  CB  . LEU C 1 105 ? 119.721 141.873 173.362 1.00 79.86  ? 106 LEU C CB  1 
ATOM   8118  C  CG  . LEU C 1 105 ? 118.915 142.992 172.725 1.00 79.87  ? 106 LEU C CG  1 
ATOM   8119  C  CD1 . LEU C 1 105 ? 119.553 143.372 171.422 1.00 79.86  ? 106 LEU C CD1 1 
ATOM   8120  C  CD2 . LEU C 1 105 ? 117.493 142.562 172.521 1.00 79.84  ? 106 LEU C CD2 1 
ATOM   8121  N  N   . ALA C 1 106 ? 119.787 138.998 174.692 1.00 66.15  ? 107 ALA C N   1 
ATOM   8122  C  CA  . ALA C 1 106 ? 120.542 137.814 175.048 1.00 65.25  ? 107 ALA C CA  1 
ATOM   8123  C  C   . ALA C 1 106 ? 121.041 137.059 173.830 1.00 64.84  ? 107 ALA C C   1 
ATOM   8124  O  O   . ALA C 1 106 ? 120.276 136.679 172.967 1.00 64.76  ? 107 ALA C O   1 
ATOM   8125  C  CB  . ALA C 1 106 ? 119.704 136.910 175.907 1.00 65.02  ? 107 ALA C CB  1 
ATOM   8126  N  N   . LYS C 1 107 ? 122.343 136.836 173.786 1.00 70.71  ? 108 LYS C N   1 
ATOM   8127  C  CA  . LYS C 1 107 ? 122.969 136.066 172.730 1.00 70.49  ? 108 LYS C CA  1 
ATOM   8128  C  C   . LYS C 1 107 ? 122.966 134.613 173.139 1.00 70.82  ? 108 LYS C C   1 
ATOM   8129  O  O   . LYS C 1 107 ? 123.770 134.190 173.947 1.00 70.83  ? 108 LYS C O   1 
ATOM   8130  C  CB  . LYS C 1 107 ? 124.393 136.560 172.526 1.00 70.13  ? 108 LYS C CB  1 
ATOM   8131  C  CG  . LYS C 1 107 ? 125.191 135.840 171.475 1.00 69.84  ? 108 LYS C CG  1 
ATOM   8132  C  CD  . LYS C 1 107 ? 124.635 136.042 170.099 1.00 69.65  ? 108 LYS C CD  1 
ATOM   8133  C  CE  . LYS C 1 107 ? 125.662 135.714 169.049 1.00 69.53  ? 108 LYS C CE  1 
ATOM   8134  N  NZ  . LYS C 1 107 ? 125.025 135.351 167.768 1.00 69.47  1 108 LYS C NZ  1 
ATOM   8135  N  N   . CYS C 1 108 ? 122.048 133.847 172.572 1.00 78.98  ? 109 CYS C N   1 
ATOM   8136  C  CA  . CYS C 1 108 ? 121.777 132.500 173.042 1.00 79.32  ? 109 CYS C CA  1 
ATOM   8137  C  C   . CYS C 1 108 ? 122.701 131.467 172.451 1.00 79.54  ? 109 CYS C C   1 
ATOM   8138  O  O   . CYS C 1 108 ? 122.433 130.909 171.404 1.00 79.60  ? 109 CYS C O   1 
ATOM   8139  C  CB  . CYS C 1 108 ? 120.336 132.134 172.741 1.00 79.39  ? 109 CYS C CB  1 
ATOM   8140  S  SG  . CYS C 1 108 ? 119.154 133.112 173.642 1.00 79.42  ? 109 CYS C SG  1 
ATOM   8141  N  N   . GLU C 1 109 ? 123.786 131.196 173.151 1.00 81.55  ? 110 GLU C N   1 
ATOM   8142  C  CA  . GLU C 1 109 ? 124.835 130.355 172.615 1.00 81.66  ? 110 GLU C CA  1 
ATOM   8143  C  C   . GLU C 1 109 ? 124.582 128.867 172.771 1.00 81.39  ? 110 GLU C C   1 
ATOM   8144  O  O   . GLU C 1 109 ? 125.320 128.053 172.248 1.00 81.39  ? 110 GLU C O   1 
ATOM   8145  C  CB  . GLU C 1 109 ? 126.169 130.736 173.233 1.00 81.90  ? 110 GLU C CB  1 
ATOM   8146  C  CG  . GLU C 1 109 ? 127.299 130.735 172.246 1.00 82.03  ? 110 GLU C CG  1 
ATOM   8147  C  CD  . GLU C 1 109 ? 127.223 131.865 171.268 1.00 82.09  ? 110 GLU C CD  1 
ATOM   8148  O  OE1 . GLU C 1 109 ? 126.694 132.922 171.636 1.00 82.11  ? 110 GLU C OE1 1 
ATOM   8149  O  OE2 . GLU C 1 109 ? 127.694 131.696 170.131 1.00 82.09  1 110 GLU C OE2 1 
ATOM   8150  N  N   . PHE C 1 110 ? 123.526 128.507 173.476 1.00 76.79  ? 111 PHE C N   1 
ATOM   8151  C  CA  . PHE C 1 110 ? 123.264 127.106 173.733 1.00 76.45  ? 111 PHE C CA  1 
ATOM   8152  C  C   . PHE C 1 110 ? 122.630 126.406 172.546 1.00 75.84  ? 111 PHE C C   1 
ATOM   8153  O  O   . PHE C 1 110 ? 122.359 125.219 172.591 1.00 75.81  ? 111 PHE C O   1 
ATOM   8154  C  CB  . PHE C 1 110 ? 122.432 126.915 174.998 1.00 76.64  ? 111 PHE C CB  1 
ATOM   8155  C  CG  . PHE C 1 110 ? 121.226 127.787 175.076 1.00 76.82  ? 111 PHE C CG  1 
ATOM   8156  C  CD1 . PHE C 1 110 ? 120.040 127.389 174.525 1.00 76.89  ? 111 PHE C CD1 1 
ATOM   8157  C  CD2 . PHE C 1 110 ? 121.273 128.990 175.727 1.00 76.91  ? 111 PHE C CD2 1 
ATOM   8158  C  CE1 . PHE C 1 110 ? 118.934 128.183 174.604 1.00 76.94  ? 111 PHE C CE1 1 
ATOM   8159  C  CE2 . PHE C 1 110 ? 120.168 129.784 175.805 1.00 76.95  ? 111 PHE C CE2 1 
ATOM   8160  C  CZ  . PHE C 1 110 ? 118.998 129.380 175.243 1.00 76.97  ? 111 PHE C CZ  1 
ATOM   8161  N  N   . PHE C 1 111 ? 122.379 127.156 171.486 1.00 69.61  ? 112 PHE C N   1 
ATOM   8162  C  CA  . PHE C 1 111 ? 121.832 126.585 170.269 1.00 69.04  ? 112 PHE C CA  1 
ATOM   8163  C  C   . PHE C 1 111 ? 122.890 126.005 169.344 1.00 68.70  ? 112 PHE C C   1 
ATOM   8164  O  O   . PHE C 1 111 ? 122.576 125.475 168.295 1.00 68.66  ? 112 PHE C O   1 
ATOM   8165  C  CB  . PHE C 1 111 ? 120.965 127.596 169.534 1.00 68.89  ? 112 PHE C CB  1 
ATOM   8166  C  CG  . PHE C 1 111 ? 119.628 127.790 170.154 1.00 68.79  ? 112 PHE C CG  1 
ATOM   8167  C  CD1 . PHE C 1 111 ? 119.355 128.906 170.893 1.00 68.73  ? 112 PHE C CD1 1 
ATOM   8168  C  CD2 . PHE C 1 111 ? 118.655 126.842 170.015 1.00 68.73  ? 112 PHE C CD2 1 
ATOM   8169  C  CE1 . PHE C 1 111 ? 118.142 129.079 171.466 1.00 68.72  ? 112 PHE C CE1 1 
ATOM   8170  C  CE2 . PHE C 1 111 ? 117.442 127.014 170.590 1.00 68.71  ? 112 PHE C CE2 1 
ATOM   8171  C  CZ  . PHE C 1 111 ? 117.187 128.133 171.318 1.00 68.72  ? 112 PHE C CZ  1 
ATOM   8172  N  N   . ASN C 1 112 ? 124.145 126.106 169.740 1.00 65.76  ? 113 ASN C N   1 
ATOM   8173  C  CA  . ASN C 1 112 ? 125.225 125.483 168.999 1.00 65.55  ? 113 ASN C CA  1 
ATOM   8174  C  C   . ASN C 1 112 ? 125.121 123.981 169.097 1.00 65.81  ? 113 ASN C C   1 
ATOM   8175  O  O   . ASN C 1 112 ? 124.494 123.469 170.004 1.00 65.80  ? 113 ASN C O   1 
ATOM   8176  C  CB  . ASN C 1 112 ? 126.576 125.957 169.506 1.00 65.24  ? 113 ASN C CB  1 
ATOM   8177  C  CG  . ASN C 1 112 ? 126.933 127.316 169.001 1.00 65.02  ? 113 ASN C CG  1 
ATOM   8178  O  OD1 . ASN C 1 112 ? 126.627 127.663 167.876 1.00 64.98  ? 113 ASN C OD1 1 
ATOM   8179  N  ND2 . ASN C 1 112 ? 127.584 128.097 169.831 1.00 64.89  ? 113 ASN C ND2 1 
ATOM   8180  N  N   . ALA C 1 113 ? 125.713 123.280 168.141 1.00 70.57  ? 114 ALA C N   1 
ATOM   8181  C  CA  . ALA C 1 113 ? 125.518 121.844 168.003 1.00 70.90  ? 114 ALA C CA  1 
ATOM   8182  C  C   . ALA C 1 113 ? 125.837 121.039 169.249 1.00 71.20  ? 114 ALA C C   1 
ATOM   8183  O  O   . ALA C 1 113 ? 125.130 120.099 169.571 1.00 71.23  ? 114 ALA C O   1 
ATOM   8184  C  CB  . ALA C 1 113 ? 126.340 121.335 166.861 1.00 70.91  ? 114 ALA C CB  1 
ATOM   8185  N  N   . GLY C 1 114 ? 126.895 121.404 169.953 1.00 79.26  ? 115 GLY C N   1 
ATOM   8186  C  CA  . GLY C 1 114 ? 127.240 120.720 171.181 1.00 79.49  ? 115 GLY C CA  1 
ATOM   8187  C  C   . GLY C 1 114 ? 126.526 121.285 172.383 1.00 79.64  ? 115 GLY C C   1 
ATOM   8188  O  O   . GLY C 1 114 ? 126.574 120.722 173.466 1.00 79.71  ? 115 GLY C O   1 
ATOM   8189  N  N   . GLY C 1 115 ? 125.840 122.397 172.176 1.00 78.64  ? 116 GLY C N   1 
ATOM   8190  C  CA  . GLY C 1 115 ? 125.073 123.035 173.225 1.00 78.65  ? 116 GLY C CA  1 
ATOM   8191  C  C   . GLY C 1 115 ? 125.745 124.128 174.035 1.00 78.57  ? 116 GLY C C   1 
ATOM   8192  O  O   . GLY C 1 115 ? 125.165 124.631 174.982 1.00 78.58  ? 116 GLY C O   1 
ATOM   8193  N  N   . SER C 1 116 ? 126.954 124.511 173.667 1.00 67.44  ? 117 SER C N   1 
ATOM   8194  C  CA  . SER C 1 116 ? 127.680 125.509 174.430 1.00 64.89  ? 117 SER C CA  1 
ATOM   8195  C  C   . SER C 1 116 ? 128.475 126.430 173.538 1.00 67.59  ? 117 SER C C   1 
ATOM   8196  O  O   . SER C 1 116 ? 128.675 126.160 172.374 1.00 70.83  ? 117 SER C O   1 
ATOM   8197  C  CB  . SER C 1 116 ? 128.617 124.844 175.427 1.00 73.39  ? 117 SER C CB  1 
ATOM   8198  O  OG  . SER C 1 116 ? 129.695 124.222 174.774 1.00 85.31  ? 117 SER C OG  1 
ATOM   8199  N  N   . VAL C 1 117 ? 128.926 127.533 174.108 1.00 73.33  ? 118 VAL C N   1 
ATOM   8200  C  CA  . VAL C 1 117 ? 129.747 128.496 173.400 1.00 71.39  ? 118 VAL C CA  1 
ATOM   8201  C  C   . VAL C 1 117 ? 131.077 127.881 173.020 1.00 74.49  ? 118 VAL C C   1 
ATOM   8202  O  O   . VAL C 1 117 ? 131.734 128.310 172.102 1.00 70.59  ? 118 VAL C O   1 
ATOM   8203  C  CB  . VAL C 1 117 ? 129.948 129.765 174.251 1.00 72.18  ? 118 VAL C CB  1 
ATOM   8204  C  CG1 . VAL C 1 117 ? 130.577 129.420 175.567 1.00 74.82  ? 118 VAL C CG1 1 
ATOM   8205  C  CG2 . VAL C 1 117 ? 130.770 130.788 173.522 1.00 53.54  ? 118 VAL C CG2 1 
ATOM   8206  N  N   . LYS C 1 118 ? 131.467 126.850 173.735 1.00 70.56  ? 119 LYS C N   1 
ATOM   8207  C  CA  . LYS C 1 118 ? 132.745 126.223 173.510 1.00 79.53  ? 119 LYS C CA  1 
ATOM   8208  C  C   . LYS C 1 118 ? 132.846 125.510 172.179 1.00 82.35  ? 119 LYS C C   1 
ATOM   8209  O  O   . LYS C 1 118 ? 133.934 125.234 171.709 1.00 80.68  ? 119 LYS C O   1 
ATOM   8210  C  CB  . LYS C 1 118 ? 133.041 125.261 174.634 1.00 82.52  ? 119 LYS C CB  1 
ATOM   8211  C  CG  . LYS C 1 118 ? 133.254 125.922 175.945 1.00 75.64  ? 119 LYS C CG  1 
ATOM   8212  C  CD  . LYS C 1 118 ? 134.414 126.829 175.904 1.00 72.75  ? 119 LYS C CD  1 
ATOM   8213  C  CE  . LYS C 1 118 ? 134.848 127.145 177.282 1.00 69.57  ? 119 LYS C CE  1 
ATOM   8214  N  NZ  . LYS C 1 118 ? 133.880 128.096 177.767 1.00 72.84  1 119 LYS C NZ  1 
ATOM   8215  N  N   . ASP C 1 119 ? 131.713 125.205 171.571 1.00 93.88  ? 120 ASP C N   1 
ATOM   8216  C  CA  . ASP C 1 119 ? 131.728 124.515 170.300 1.00 87.58  ? 120 ASP C CA  1 
ATOM   8217  C  C   . ASP C 1 119 ? 132.451 125.368 169.278 1.00 89.31  ? 120 ASP C C   1 
ATOM   8218  O  O   . ASP C 1 119 ? 133.047 124.859 168.350 1.00 90.57  ? 120 ASP C O   1 
ATOM   8219  C  CB  . ASP C 1 119 ? 130.308 124.197 169.823 1.00 95.08  ? 120 ASP C CB  1 
ATOM   8220  C  CG  . ASP C 1 119 ? 129.516 123.384 170.821 1.00 92.30  ? 120 ASP C CG  1 
ATOM   8221  O  OD1 . ASP C 1 119 ? 130.120 122.813 171.742 1.00 97.06  ? 120 ASP C OD1 1 
ATOM   8222  O  OD2 . ASP C 1 119 ? 128.281 123.314 170.685 1.00 98.01  1 120 ASP C OD2 1 
ATOM   8223  N  N   . ARG C 1 120 ? 132.410 126.675 169.473 1.00 70.72  ? 121 ARG C N   1 
ATOM   8224  C  CA  . ARG C 1 120 ? 133.080 127.589 168.567 1.00 75.36  ? 121 ARG C CA  1 
ATOM   8225  C  C   . ARG C 1 120 ? 134.580 127.410 168.586 1.00 72.98  ? 121 ARG C C   1 
ATOM   8226  O  O   . ARG C 1 120 ? 135.169 127.105 167.567 1.00 79.10  ? 121 ARG C O   1 
ATOM   8227  C  CB  . ARG C 1 120 ? 132.749 129.049 168.893 1.00 64.83  ? 121 ARG C CB  1 
ATOM   8228  C  CG  . ARG C 1 120 ? 131.393 129.551 168.445 1.00 65.96  ? 121 ARG C CG  1 
ATOM   8229  C  CD  . ARG C 1 120 ? 131.219 131.003 168.843 1.00 79.38  ? 121 ARG C CD  1 
ATOM   8230  N  NE  . ARG C 1 120 ? 129.868 131.523 168.693 1.00 70.13  ? 121 ARG C NE  1 
ATOM   8231  C  CZ  . ARG C 1 120 ? 129.451 132.223 167.653 1.00 69.14  ? 121 ARG C CZ  1 
ATOM   8232  N  NH1 . ARG C 1 120 ? 130.272 132.474 166.663 1.00 61.19  1 121 ARG C NH1 1 
ATOM   8233  N  NH2 . ARG C 1 120 ? 128.214 132.662 167.607 1.00 72.39  ? 121 ARG C NH2 1 
ATOM   8234  N  N   . ILE C 1 121 ? 135.201 127.598 169.731 1.00 66.44  ? 122 ILE C N   1 
ATOM   8235  C  CA  . ILE C 1 121 ? 136.645 127.504 169.780 1.00 66.22  ? 122 ILE C CA  1 
ATOM   8236  C  C   . ILE C 1 121 ? 137.114 126.096 169.479 1.00 66.60  ? 122 ILE C C   1 
ATOM   8237  O  O   . ILE C 1 121 ? 138.144 125.905 168.850 1.00 66.68  ? 122 ILE C O   1 
ATOM   8238  C  CB  . ILE C 1 121 ? 137.217 128.014 171.106 1.00 65.73  ? 122 ILE C CB  1 
ATOM   8239  C  CG1 . ILE C 1 121 ? 136.902 127.058 172.245 1.00 65.46  ? 122 ILE C CG1 1 
ATOM   8240  C  CG2 . ILE C 1 121 ? 136.660 129.364 171.409 1.00 65.65  ? 122 ILE C CG2 1 
ATOM   8241  C  CD1 . ILE C 1 121 ? 137.588 127.397 173.521 1.00 65.30  ? 122 ILE C CD1 1 
ATOM   8242  N  N   . SER C 1 122 ? 136.307 125.114 169.846 1.00 74.86  ? 123 SER C N   1 
ATOM   8243  C  CA  . SER C 1 122 ? 136.692 123.735 169.645 1.00 75.26  ? 123 SER C CA  1 
ATOM   8244  C  C   . SER C 1 122 ? 136.895 123.470 168.180 1.00 75.65  ? 123 SER C C   1 
ATOM   8245  O  O   . SER C 1 122 ? 137.837 122.803 167.787 1.00 75.71  ? 123 SER C O   1 
ATOM   8246  C  CB  . SER C 1 122 ? 135.609 122.801 170.159 1.00 75.26  ? 123 SER C CB  1 
ATOM   8247  O  OG  . SER C 1 122 ? 135.548 122.813 171.563 1.00 75.25  ? 123 SER C OG  1 
ATOM   8248  N  N   . LEU C 1 123 ? 136.025 124.029 167.364 1.00 66.13  ? 124 LEU C N   1 
ATOM   8249  C  CA  . LEU C 1 123 ? 136.163 123.835 165.950 1.00 66.52  ? 124 LEU C CA  1 
ATOM   8250  C  C   . LEU C 1 123 ? 137.400 124.570 165.495 1.00 66.94  ? 124 LEU C C   1 
ATOM   8251  O  O   . LEU C 1 123 ? 138.262 124.007 164.836 1.00 67.00  ? 124 LEU C O   1 
ATOM   8252  C  CB  . LEU C 1 123 ? 134.931 124.357 165.238 1.00 66.49  ? 124 LEU C CB  1 
ATOM   8253  C  CG  . LEU C 1 123 ? 134.880 124.125 163.739 1.00 66.46  ? 124 LEU C CG  1 
ATOM   8254  C  CD1 . LEU C 1 123 ? 135.049 122.665 163.442 1.00 66.45  ? 124 LEU C CD1 1 
ATOM   8255  C  CD2 . LEU C 1 123 ? 133.575 124.631 163.187 1.00 66.45  ? 124 LEU C CD2 1 
ATOM   8256  N  N   . ARG C 1 124 ? 137.524 125.812 165.926 1.00 72.99  ? 125 ARG C N   1 
ATOM   8257  C  CA  . ARG C 1 124 ? 138.541 126.685 165.383 1.00 73.42  ? 125 ARG C CA  1 
ATOM   8258  C  C   . ARG C 1 124 ? 139.902 126.148 165.740 1.00 73.70  ? 125 ARG C C   1 
ATOM   8259  O  O   . ARG C 1 124 ? 140.765 125.993 164.886 1.00 73.72  ? 125 ARG C O   1 
ATOM   8260  C  CB  . ARG C 1 124 ? 138.353 128.091 165.934 1.00 73.53  ? 125 ARG C CB  1 
ATOM   8261  C  CG  . ARG C 1 124 ? 139.400 129.089 165.529 1.00 73.64  ? 125 ARG C CG  1 
ATOM   8262  C  CD  . ARG C 1 124 ? 139.319 129.452 164.078 1.00 73.72  ? 125 ARG C CD  1 
ATOM   8263  N  NE  . ARG C 1 124 ? 140.257 130.513 163.748 1.00 73.80  ? 125 ARG C NE  1 
ATOM   8264  C  CZ  . ARG C 1 124 ? 139.917 131.779 163.585 1.00 73.85  ? 125 ARG C CZ  1 
ATOM   8265  N  NH1 . ARG C 1 124 ? 138.659 132.141 163.703 1.00 73.86  1 125 ARG C NH1 1 
ATOM   8266  N  NH2 . ARG C 1 124 ? 140.834 132.678 163.290 1.00 73.87  ? 125 ARG C NH2 1 
ATOM   8267  N  N   . MET C 1 125 ? 140.046 125.760 166.995 1.00 74.82  ? 126 MET C N   1 
ATOM   8268  C  CA  . MET C 1 125 ? 141.308 125.264 167.484 1.00 75.13  ? 126 MET C CA  1 
ATOM   8269  C  C   . MET C 1 125 ? 141.709 124.033 166.725 1.00 75.64  ? 126 MET C C   1 
ATOM   8270  O  O   . MET C 1 125 ? 142.883 123.811 166.482 1.00 75.75  ? 126 MET C O   1 
ATOM   8271  C  CB  . MET C 1 125 ? 141.211 124.946 168.974 1.00 74.98  ? 126 MET C CB  1 
ATOM   8272  C  CG  . MET C 1 125 ? 141.737 126.041 169.864 1.00 74.90  ? 126 MET C CG  1 
ATOM   8273  S  SD  . MET C 1 125 ? 141.086 126.049 171.527 1.00 74.86  ? 126 MET C SD  1 
ATOM   8274  C  CE  . MET C 1 125 ? 141.596 124.459 172.099 1.00 74.87  ? 126 MET C CE  1 
ATOM   8275  N  N   . ILE C 1 126 ? 140.734 123.239 166.317 1.00 73.73  ? 127 ILE C N   1 
ATOM   8276  C  CA  . ILE C 1 126 ? 141.078 122.041 165.593 1.00 74.27  ? 127 ILE C CA  1 
ATOM   8277  C  C   . ILE C 1 126 ? 141.470 122.413 164.192 1.00 74.86  ? 127 ILE C C   1 
ATOM   8278  O  O   . ILE C 1 126 ? 142.498 121.975 163.688 1.00 74.97  ? 127 ILE C O   1 
ATOM   8279  C  CB  . ILE C 1 126 ? 139.940 121.042 165.572 1.00 74.22  ? 127 ILE C CB  1 
ATOM   8280  C  CG1 . ILE C 1 126 ? 139.869 120.329 166.903 1.00 74.18  ? 127 ILE C CG1 1 
ATOM   8281  C  CG2 . ILE C 1 126 ? 140.178 120.006 164.526 1.00 74.22  ? 127 ILE C CG2 1 
ATOM   8282  C  CD1 . ILE C 1 126 ? 138.892 119.212 166.925 1.00 74.17  ? 127 ILE C CD1 1 
ATOM   8283  N  N   . GLU C 1 127 ? 140.684 123.287 163.586 1.00 88.29  ? 128 GLU C N   1 
ATOM   8284  C  CA  . GLU C 1 127 ? 140.891 123.571 162.188 1.00 88.83  ? 128 GLU C CA  1 
ATOM   8285  C  C   . GLU C 1 127 ? 142.232 124.227 161.996 1.00 89.07  ? 128 GLU C C   1 
ATOM   8286  O  O   . GLU C 1 127 ? 143.007 123.815 161.144 1.00 89.20  ? 128 GLU C O   1 
ATOM   8287  C  CB  . GLU C 1 127 ? 139.763 124.433 161.637 1.00 89.06  ? 128 GLU C CB  1 
ATOM   8288  C  CG  . GLU C 1 127 ? 138.541 123.634 161.255 1.00 89.21  ? 128 GLU C CG  1 
ATOM   8289  C  CD  . GLU C 1 127 ? 137.413 124.494 160.749 1.00 89.32  ? 128 GLU C CD  1 
ATOM   8290  O  OE1 . GLU C 1 127 ? 136.451 123.941 160.186 1.00 89.36  ? 128 GLU C OE1 1 
ATOM   8291  O  OE2 . GLU C 1 127 ? 137.481 125.725 160.915 1.00 89.35  1 128 GLU C OE2 1 
ATOM   8292  N  N   . ASP C 1 128 ? 142.542 125.191 162.849 1.00 74.19  ? 129 ASP C N   1 
ATOM   8293  C  CA  . ASP C 1 128 ? 143.809 125.873 162.739 1.00 74.43  ? 129 ASP C CA  1 
ATOM   8294  C  C   . ASP C 1 128 ? 144.934 124.880 162.924 1.00 75.08  ? 129 ASP C C   1 
ATOM   8295  O  O   . ASP C 1 128 ? 145.926 124.929 162.208 1.00 75.13  ? 129 ASP C O   1 
ATOM   8296  C  CB  . ASP C 1 128 ? 143.919 126.980 163.780 1.00 74.21  ? 129 ASP C CB  1 
ATOM   8297  C  CG  . ASP C 1 128 ? 143.018 128.151 163.486 1.00 74.09  ? 129 ASP C CG  1 
ATOM   8298  O  OD1 . ASP C 1 128 ? 142.721 128.915 164.422 1.00 74.05  ? 129 ASP C OD1 1 
ATOM   8299  O  OD2 . ASP C 1 128 ? 142.606 128.318 162.327 1.00 74.08  1 129 ASP C OD2 1 
ATOM   8300  N  N   . ALA C 1 129 ? 144.747 123.929 163.827 1.00 70.48  ? 130 ALA C N   1 
ATOM   8301  C  CA  . ALA C 1 129 ? 145.803 122.977 164.090 1.00 71.34  ? 130 ALA C CA  1 
ATOM   8302  C  C   . ALA C 1 129 ? 146.019 122.145 162.859 1.00 72.81  ? 130 ALA C C   1 
ATOM   8303  O  O   . ALA C 1 129 ? 147.148 121.854 162.479 1.00 72.90  ? 130 ALA C O   1 
ATOM   8304  C  CB  . ALA C 1 129 ? 145.442 122.105 165.244 1.00 71.06  ? 130 ALA C CB  1 
ATOM   8305  N  N   . GLU C 1 130 ? 144.924 121.803 162.201 1.00 76.30  ? 131 GLU C N   1 
ATOM   8306  C  CA  . GLU C 1 130 ? 145.014 120.985 161.019 1.00 77.94  ? 131 GLU C CA  1 
ATOM   8307  C  C   . GLU C 1 130 ? 145.740 121.744 159.938 1.00 80.16  ? 131 GLU C C   1 
ATOM   8308  O  O   . GLU C 1 130 ? 146.455 121.162 159.144 1.00 80.35  ? 131 GLU C O   1 
ATOM   8309  C  CB  . GLU C 1 130 ? 143.626 120.570 160.549 1.00 77.52  ? 131 GLU C CB  1 
ATOM   8310  C  CG  . GLU C 1 130 ? 142.960 119.533 161.424 1.00 77.23  ? 131 GLU C CG  1 
ATOM   8311  C  CD  . GLU C 1 130 ? 141.541 119.238 161.009 1.00 77.08  ? 131 GLU C CD  1 
ATOM   8312  O  OE1 . GLU C 1 130 ? 140.980 118.235 161.480 1.00 77.00  ? 131 GLU C OE1 1 
ATOM   8313  O  OE2 . GLU C 1 130 ? 140.986 120.013 160.218 1.00 77.04  1 131 GLU C OE2 1 
ATOM   8314  N  N   . ARG C 1 131 ? 145.568 123.055 159.917 1.00 88.46  ? 132 ARG C N   1 
ATOM   8315  C  CA  . ARG C 1 131 ? 146.237 123.852 158.911 1.00 90.55  ? 132 ARG C CA  1 
ATOM   8316  C  C   . ARG C 1 131 ? 147.691 124.074 159.280 1.00 89.26  ? 132 ARG C C   1 
ATOM   8317  O  O   . ARG C 1 131 ? 148.511 124.346 158.423 1.00 89.22  ? 132 ARG C O   1 
ATOM   8318  C  CB  . ARG C 1 131 ? 145.507 125.176 158.689 1.00 93.44  ? 132 ARG C CB  1 
ATOM   8319  C  CG  . ARG C 1 131 ? 144.110 124.997 158.150 1.00 96.07  ? 132 ARG C CG  1 
ATOM   8320  C  CD  . ARG C 1 131 ? 143.326 126.296 158.059 1.00 98.47  ? 132 ARG C CD  1 
ATOM   8321  N  NE  . ARG C 1 131 ? 141.925 126.043 157.725 1.00 100.50 ? 132 ARG C NE  1 
ATOM   8322  C  CZ  . ARG C 1 131 ? 140.977 126.972 157.686 1.00 102.32 ? 132 ARG C CZ  1 
ATOM   8323  N  NH1 . ARG C 1 131 ? 141.268 128.231 157.961 1.00 102.87 1 132 ARG C NH1 1 
ATOM   8324  N  NH2 . ARG C 1 131 ? 139.734 126.640 157.370 1.00 102.91 ? 132 ARG C NH2 1 
ATOM   8325  N  N   . ASP C 1 132 ? 148.005 123.957 160.564 1.00 92.02  ? 133 ASP C N   1 
ATOM   8326  C  CA  . ASP C 1 132 ? 149.378 124.105 161.025 1.00 90.72  ? 133 ASP C CA  1 
ATOM   8327  C  C   . ASP C 1 132 ? 150.202 122.924 160.595 1.00 89.17  ? 133 ASP C C   1 
ATOM   8328  O  O   . ASP C 1 132 ? 151.412 122.999 160.484 1.00 89.07  ? 133 ASP C O   1 
ATOM   8329  C  CB  . ASP C 1 132 ? 149.425 124.215 162.542 1.00 90.86  ? 133 ASP C CB  1 
ATOM   8330  C  CG  . ASP C 1 132 ? 149.065 125.584 163.034 1.00 90.95  ? 133 ASP C CG  1 
ATOM   8331  O  OD1 . ASP C 1 132 ? 149.245 126.549 162.276 1.00 90.99  ? 133 ASP C OD1 1 
ATOM   8332  O  OD2 . ASP C 1 132 ? 148.609 125.702 164.183 1.00 90.98  1 133 ASP C OD2 1 
ATOM   8333  N  N   . GLY C 1 133 ? 149.523 121.819 160.359 1.00 81.52  ? 134 GLY C N   1 
ATOM   8334  C  CA  . GLY C 1 133 ? 150.190 120.580 160.056 1.00 80.01  ? 134 GLY C CA  1 
ATOM   8335  C  C   . GLY C 1 133 ? 150.579 119.858 161.320 1.00 78.55  ? 134 GLY C C   1 
ATOM   8336  O  O   . GLY C 1 133 ? 151.151 118.783 161.270 1.00 78.42  ? 134 GLY C O   1 
ATOM   8337  N  N   . THR C 1 134 ? 150.269 120.453 162.460 1.00 75.96  ? 135 THR C N   1 
ATOM   8338  C  CA  . THR C 1 134 ? 150.582 119.829 163.728 1.00 74.71  ? 135 THR C CA  1 
ATOM   8339  C  C   . THR C 1 134 ? 149.669 118.655 164.004 1.00 73.79  ? 135 THR C C   1 
ATOM   8340  O  O   . THR C 1 134 ? 150.110 117.616 164.465 1.00 73.71  ? 135 THR C O   1 
ATOM   8341  C  CB  . THR C 1 134 ? 150.481 120.826 164.875 1.00 74.50  ? 135 THR C CB  1 
ATOM   8342  O  OG1 . THR C 1 134 ? 149.183 121.413 164.875 1.00 74.47  ? 135 THR C OG1 1 
ATOM   8343  C  CG2 . THR C 1 134 ? 151.502 121.920 164.714 1.00 74.42  ? 135 THR C CG2 1 
ATOM   8344  N  N   . LEU C 1 135 ? 148.392 118.819 163.700 1.00 75.82  ? 136 LEU C N   1 
ATOM   8345  C  CA  . LEU C 1 135 ? 147.425 117.765 163.942 1.00 75.00  ? 136 LEU C CA  1 
ATOM   8346  C  C   . LEU C 1 135 ? 147.264 116.855 162.736 1.00 74.32  ? 136 LEU C C   1 
ATOM   8347  O  O   . LEU C 1 135 ? 146.829 117.276 161.679 1.00 74.25  ? 136 LEU C O   1 
ATOM   8348  C  CB  . LEU C 1 135 ? 146.081 118.366 164.365 1.00 74.93  ? 136 LEU C CB  1 
ATOM   8349  C  CG  . LEU C 1 135 ? 144.939 117.455 164.835 1.00 74.89  ? 136 LEU C CG  1 
ATOM   8350  C  CD1 . LEU C 1 135 ? 145.373 116.514 165.928 1.00 74.88  ? 136 LEU C CD1 1 
ATOM   8351  C  CD2 . LEU C 1 135 ? 143.783 118.289 165.313 1.00 74.88  ? 136 LEU C CD2 1 
ATOM   8352  N  N   . LYS C 1 136 ? 147.609 115.592 162.924 1.00 73.52  ? 137 LYS C N   1 
ATOM   8353  C  CA  . LYS C 1 136 ? 147.591 114.606 161.861 1.00 73.02  ? 137 LYS C CA  1 
ATOM   8354  C  C   . LYS C 1 136 ? 146.369 113.730 162.002 1.00 73.48  ? 137 LYS C C   1 
ATOM   8355  O  O   . LYS C 1 136 ? 145.812 113.626 163.075 1.00 73.53  ? 137 LYS C O   1 
ATOM   8356  C  CB  . LYS C 1 136 ? 148.846 113.747 161.937 1.00 72.21  ? 137 LYS C CB  1 
ATOM   8357  C  CG  . LYS C 1 136 ? 150.116 114.535 162.098 1.00 71.58  ? 137 LYS C CG  1 
ATOM   8358  C  CD  . LYS C 1 136 ? 151.322 113.638 162.188 1.00 71.08  ? 137 LYS C CD  1 
ATOM   8359  C  CE  . LYS C 1 136 ? 151.421 112.977 163.535 1.00 70.77  ? 137 LYS C CE  1 
ATOM   8360  N  NZ  . LYS C 1 136 ? 151.763 113.945 164.601 1.00 70.60  1 137 LYS C NZ  1 
ATOM   8361  N  N   . PRO C 1 137 ? 145.924 113.116 160.909 1.00 80.43  ? 138 PRO C N   1 
ATOM   8362  C  CA  . PRO C 1 137 ? 144.776 112.231 161.039 1.00 80.77  ? 138 PRO C CA  1 
ATOM   8363  C  C   . PRO C 1 137 ? 145.078 111.087 161.976 1.00 81.14  ? 138 PRO C C   1 
ATOM   8364  O  O   . PRO C 1 137 ? 146.177 110.565 161.962 1.00 81.18  ? 138 PRO C O   1 
ATOM   8365  C  CB  . PRO C 1 137 ? 144.613 111.694 159.625 1.00 80.72  ? 138 PRO C CB  1 
ATOM   8366  C  CG  . PRO C 1 137 ? 145.150 112.747 158.780 1.00 80.65  ? 138 PRO C CG  1 
ATOM   8367  C  CD  . PRO C 1 137 ? 146.301 113.321 159.510 1.00 80.54  ? 138 PRO C CD  1 
ATOM   8368  N  N   . GLY C 1 138 ? 144.097 110.711 162.785 1.00 78.64  ? 139 GLY C N   1 
ATOM   8369  C  CA  . GLY C 1 138 ? 144.243 109.627 163.733 1.00 78.92  ? 139 GLY C CA  1 
ATOM   8370  C  C   . GLY C 1 138 ? 144.878 110.019 165.051 1.00 79.11  ? 139 GLY C C   1 
ATOM   8371  O  O   . GLY C 1 138 ? 145.006 109.203 165.950 1.00 79.14  ? 139 GLY C O   1 
ATOM   8372  N  N   . ASP C 1 139 ? 145.256 111.279 165.177 1.00 75.52  ? 140 ASP C N   1 
ATOM   8373  C  CA  . ASP C 1 139 ? 145.965 111.747 166.356 1.00 75.56  ? 140 ASP C CA  1 
ATOM   8374  C  C   . ASP C 1 139 ? 145.102 111.866 167.596 1.00 75.37  ? 140 ASP C C   1 
ATOM   8375  O  O   . ASP C 1 139 ? 143.889 111.951 167.516 1.00 75.38  ? 140 ASP C O   1 
ATOM   8376  C  CB  . ASP C 1 139 ? 146.674 113.068 166.077 1.00 75.67  ? 140 ASP C CB  1 
ATOM   8377  C  CG  . ASP C 1 139 ? 148.044 112.877 165.484 1.00 75.70  ? 140 ASP C CG  1 
ATOM   8378  O  OD1 . ASP C 1 139 ? 148.358 111.752 165.071 1.00 75.70  ? 140 ASP C OD1 1 
ATOM   8379  O  OD2 . ASP C 1 139 ? 148.808 113.855 165.429 1.00 75.69  1 140 ASP C OD2 1 
ATOM   8380  N  N   . THR C 1 140 ? 145.749 111.822 168.750 1.00 72.59  ? 141 THR C N   1 
ATOM   8381  C  CA  . THR C 1 140 ? 145.067 112.000 170.015 1.00 72.30  ? 141 THR C CA  1 
ATOM   8382  C  C   . THR C 1 140 ? 145.068 113.450 170.464 1.00 71.82  ? 141 THR C C   1 
ATOM   8383  O  O   . THR C 1 140 ? 146.084 114.123 170.433 1.00 71.81  ? 141 THR C O   1 
ATOM   8384  C  CB  . THR C 1 140 ? 145.706 111.153 171.111 1.00 72.41  ? 141 THR C CB  1 
ATOM   8385  O  OG1 . THR C 1 140 ? 145.799 109.796 170.679 1.00 72.43  ? 141 THR C OG1 1 
ATOM   8386  C  CG2 . THR C 1 140 ? 144.879 111.200 172.347 1.00 72.47  ? 141 THR C CG2 1 
ATOM   8387  N  N   . ILE C 1 141 ? 143.911 113.915 170.902 1.00 79.52  ? 142 ILE C N   1 
ATOM   8388  C  CA  . ILE C 1 141 ? 143.756 115.253 171.427 1.00 79.00  ? 142 ILE C CA  1 
ATOM   8389  C  C   . ILE C 1 141 ? 143.466 115.160 172.899 1.00 78.56  ? 142 ILE C C   1 
ATOM   8390  O  O   . ILE C 1 141 ? 142.532 114.506 173.298 1.00 78.53  ? 142 ILE C O   1 
ATOM   8391  C  CB  . ILE C 1 141 ? 142.576 115.948 170.777 1.00 78.95  ? 142 ILE C CB  1 
ATOM   8392  C  CG1 . ILE C 1 141 ? 142.865 116.206 169.309 1.00 78.92  ? 142 ILE C CG1 1 
ATOM   8393  C  CG2 . ILE C 1 141 ? 142.295 117.241 171.458 1.00 78.93  ? 142 ILE C CG2 1 
ATOM   8394  C  CD1 . ILE C 1 141 ? 141.693 116.747 168.573 1.00 78.91  ? 142 ILE C CD1 1 
ATOM   8395  N  N   . ILE C 1 142 ? 144.286 115.808 173.707 1.00 67.38  ? 143 ILE C N   1 
ATOM   8396  C  CA  . ILE C 1 142 ? 144.076 115.859 175.134 1.00 66.98  ? 143 ILE C CA  1 
ATOM   8397  C  C   . ILE C 1 142 ? 143.716 117.270 175.491 1.00 67.07  ? 143 ILE C C   1 
ATOM   8398  O  O   . ILE C 1 142 ? 144.335 118.197 175.013 1.00 67.12  ? 143 ILE C O   1 
ATOM   8399  C  CB  . ILE C 1 142 ? 145.345 115.464 175.876 1.00 66.60  ? 143 ILE C CB  1 
ATOM   8400  C  CG1 . ILE C 1 142 ? 145.678 114.011 175.585 1.00 66.40  ? 143 ILE C CG1 1 
ATOM   8401  C  CG2 . ILE C 1 142 ? 145.173 115.646 177.346 1.00 66.50  ? 143 ILE C CG2 1 
ATOM   8402  C  CD1 . ILE C 1 142 ? 147.038 113.614 175.993 1.00 66.32  ? 143 ILE C CD1 1 
ATOM   8403  N  N   . GLU C 1 143 ? 142.706 117.445 176.327 1.00 80.94  ? 144 GLU C N   1 
ATOM   8404  C  CA  . GLU C 1 143 ? 142.324 118.793 176.718 1.00 81.00  ? 144 GLU C CA  1 
ATOM   8405  C  C   . GLU C 1 143 ? 141.849 118.914 178.145 1.00 80.62  ? 144 GLU C C   1 
ATOM   8406  O  O   . GLU C 1 143 ? 140.915 118.237 178.542 1.00 80.61  ? 144 GLU C O   1 
ATOM   8407  C  CB  . GLU C 1 143 ? 141.252 119.337 175.783 1.00 81.31  ? 144 GLU C CB  1 
ATOM   8408  C  CG  . GLU C 1 143 ? 140.938 120.800 176.002 1.00 81.52  ? 144 GLU C CG  1 
ATOM   8409  C  CD  . GLU C 1 143 ? 142.047 121.709 175.541 1.00 81.62  ? 144 GLU C CD  1 
ATOM   8410  O  OE1 . GLU C 1 143 ? 142.110 122.863 175.998 1.00 81.69  ? 144 GLU C OE1 1 
ATOM   8411  O  OE2 . GLU C 1 143 ? 142.859 121.268 174.713 1.00 81.68  1 144 GLU C OE2 1 
ATOM   8412  N  N   . PRO C 1 144 ? 142.524 119.749 178.937 1.00 70.82  ? 145 PRO C N   1 
ATOM   8413  C  CA  . PRO C 1 144 ? 141.953 120.203 180.196 1.00 70.51  ? 145 PRO C CA  1 
ATOM   8414  C  C   . PRO C 1 144 ? 140.719 121.046 179.929 1.00 70.13  ? 145 PRO C C   1 
ATOM   8415  O  O   . PRO C 1 144 ? 140.759 121.857 179.024 1.00 70.12  ? 145 PRO C O   1 
ATOM   8416  C  CB  . PRO C 1 144 ? 143.064 121.065 180.767 1.00 70.58  ? 145 PRO C CB  1 
ATOM   8417  C  CG  . PRO C 1 144 ? 143.787 121.549 179.609 1.00 70.65  ? 145 PRO C CG  1 
ATOM   8418  C  CD  . PRO C 1 144 ? 143.756 120.470 178.608 1.00 70.74  ? 145 PRO C CD  1 
ATOM   8419  N  N   . THR C 1 145 ? 139.672 120.918 180.734 1.00 68.03  ? 146 THR C N   1 
ATOM   8420  C  CA  . THR C 1 145 ? 138.457 121.687 180.477 1.00 67.70  ? 146 THR C CA  1 
ATOM   8421  C  C   . THR C 1 145 ? 137.462 121.685 181.617 1.00 67.55  ? 146 THR C C   1 
ATOM   8422  O  O   . THR C 1 145 ? 137.515 120.839 182.491 1.00 67.56  ? 146 THR C O   1 
ATOM   8423  C  CB  . THR C 1 145 ? 137.722 121.173 179.246 1.00 67.55  ? 146 THR C CB  1 
ATOM   8424  O  OG1 . THR C 1 145 ? 136.582 121.996 178.999 1.00 67.51  ? 146 THR C OG1 1 
ATOM   8425  C  CG2 . THR C 1 145 ? 137.262 119.777 179.475 1.00 67.48  ? 146 THR C CG2 1 
ATOM   8426  N  N   . SER C 1 146 ? 136.549 122.646 181.596 1.00 78.92  ? 147 SER C N   1 
ATOM   8427  C  CA  . SER C 1 146 ? 135.416 122.634 182.502 1.00 78.75  ? 147 SER C CA  1 
ATOM   8428  C  C   . SER C 1 146 ? 134.373 121.668 181.998 1.00 78.42  ? 147 SER C C   1 
ATOM   8429  O  O   . SER C 1 146 ? 133.443 121.330 182.703 1.00 78.50  ? 147 SER C O   1 
ATOM   8430  C  CB  . SER C 1 146 ? 134.795 124.016 182.610 1.00 78.82  ? 147 SER C CB  1 
ATOM   8431  O  OG  . SER C 1 146 ? 135.666 124.918 183.247 1.00 78.85  ? 147 SER C OG  1 
ATOM   8432  N  N   . GLY C 1 147 ? 134.525 121.235 180.760 1.00 76.53  ? 148 GLY C N   1 
ATOM   8433  C  CA  . GLY C 1 147 ? 133.600 120.291 180.184 1.00 76.07  ? 148 GLY C CA  1 
ATOM   8434  C  C   . GLY C 1 147 ? 133.072 120.666 178.827 1.00 75.53  ? 148 GLY C C   1 
ATOM   8435  O  O   . GLY C 1 147 ? 133.032 119.844 177.929 1.00 75.50  ? 148 GLY C O   1 
ATOM   8436  N  N   . ASN C 1 148 ? 132.650 121.905 178.667 1.00 64.84  ? 149 ASN C N   1 
ATOM   8437  C  CA  . ASN C 1 148 ? 132.051 122.300 177.415 1.00 64.34  ? 149 ASN C CA  1 
ATOM   8438  C  C   . ASN C 1 148 ? 133.009 122.293 176.231 1.00 63.99  ? 149 ASN C C   1 
ATOM   8439  O  O   . ASN C 1 148 ? 132.650 121.834 175.155 1.00 63.94  ? 149 ASN C O   1 
ATOM   8440  C  CB  . ASN C 1 148 ? 131.365 123.646 177.565 1.00 64.25  ? 149 ASN C CB  1 
ATOM   8441  C  CG  . ASN C 1 148 ? 130.057 123.544 178.278 1.00 64.21  ? 149 ASN C CG  1 
ATOM   8442  O  OD1 . ASN C 1 148 ? 129.397 122.520 178.241 1.00 64.18  ? 149 ASN C OD1 1 
ATOM   8443  N  ND2 . ASN C 1 148 ? 129.668 124.612 178.927 1.00 64.18  ? 149 ASN C ND2 1 
ATOM   8444  N  N   . THR C 1 149 ? 134.232 122.766 176.428 1.00 61.22  ? 150 THR C N   1 
ATOM   8445  C  CA  . THR C 1 149 ? 135.231 122.689 175.373 1.00 60.96  ? 150 THR C CA  1 
ATOM   8446  C  C   . THR C 1 149 ? 135.520 121.241 175.124 1.00 61.05  ? 150 THR C C   1 
ATOM   8447  O  O   . THR C 1 149 ? 135.815 120.831 174.020 1.00 61.04  ? 150 THR C O   1 
ATOM   8448  C  CB  . THR C 1 149 ? 136.552 123.359 175.760 1.00 60.70  ? 150 THR C CB  1 
ATOM   8449  O  OG1 . THR C 1 149 ? 136.339 124.731 176.054 1.00 60.75  ? 150 THR C OG1 1 
ATOM   8450  C  CG2 . THR C 1 149 ? 137.516 123.300 174.631 1.00 60.55  ? 150 THR C CG2 1 
ATOM   8451  N  N   . GLY C 1 150 ? 135.415 120.460 176.179 1.00 67.10  ? 151 GLY C N   1 
ATOM   8452  C  CA  . GLY C 1 150 ? 135.685 119.052 176.090 1.00 67.32  ? 151 GLY C CA  1 
ATOM   8453  C  C   . GLY C 1 150 ? 134.620 118.384 175.281 1.00 67.56  ? 151 GLY C C   1 
ATOM   8454  O  O   . GLY C 1 150 ? 134.890 117.465 174.537 1.00 67.58  ? 151 GLY C O   1 
ATOM   8455  N  N   . ILE C 1 151 ? 133.396 118.856 175.427 1.00 71.79  ? 152 ILE C N   1 
ATOM   8456  C  CA  . ILE C 1 151 ? 132.308 118.319 174.640 1.00 72.05  ? 152 ILE C CA  1 
ATOM   8457  C  C   . ILE C 1 151 ? 132.443 118.703 173.182 1.00 72.13  ? 152 ILE C C   1 
ATOM   8458  O  O   . ILE C 1 151 ? 132.236 117.885 172.301 1.00 72.16  ? 152 ILE C O   1 
ATOM   8459  C  CB  . ILE C 1 151 ? 130.951 118.759 175.184 1.00 72.21  ? 152 ILE C CB  1 
ATOM   8460  C  CG1 . ILE C 1 151 ? 130.626 117.989 176.451 1.00 72.30  ? 152 ILE C CG1 1 
ATOM   8461  C  CG2 . ILE C 1 151 ? 129.866 118.485 174.196 1.00 72.24  ? 152 ILE C CG2 1 
ATOM   8462  C  CD1 . ILE C 1 151 ? 129.346 118.411 177.087 1.00 72.35  ? 152 ILE C CD1 1 
ATOM   8463  N  N   . GLY C 1 152 ? 132.829 119.938 172.919 1.00 70.78  ? 153 GLY C N   1 
ATOM   8464  C  CA  . GLY C 1 152 ? 132.962 120.353 171.542 1.00 70.82  ? 153 GLY C CA  1 
ATOM   8465  C  C   . GLY C 1 152 ? 134.089 119.633 170.848 1.00 70.84  ? 153 GLY C C   1 
ATOM   8466  O  O   . GLY C 1 152 ? 133.978 119.231 169.701 1.00 70.85  ? 153 GLY C O   1 
ATOM   8467  N  N   . LEU C 1 153 ? 135.176 119.436 171.569 1.00 68.22  ? 154 LEU C N   1 
ATOM   8468  C  CA  . LEU C 1 153 ? 136.310 118.737 171.019 1.00 68.23  ? 154 LEU C CA  1 
ATOM   8469  C  C   . LEU C 1 153 ? 136.016 117.277 170.842 1.00 68.27  ? 154 LEU C C   1 
ATOM   8470  O  O   . LEU C 1 153 ? 136.446 116.682 169.886 1.00 68.26  ? 154 LEU C O   1 
ATOM   8471  C  CB  . LEU C 1 153 ? 137.531 118.907 171.909 1.00 68.23  ? 154 LEU C CB  1 
ATOM   8472  C  CG  . LEU C 1 153 ? 138.235 120.253 171.834 1.00 68.24  ? 154 LEU C CG  1 
ATOM   8473  C  CD1 . LEU C 1 153 ? 139.352 120.305 172.827 1.00 68.26  ? 154 LEU C CD1 1 
ATOM   8474  C  CD2 . LEU C 1 153 ? 138.766 120.462 170.460 1.00 68.23  ? 154 LEU C CD2 1 
ATOM   8475  N  N   . ALA C 1 154 ? 135.295 116.689 171.777 1.00 60.53  ? 155 ALA C N   1 
ATOM   8476  C  CA  . ALA C 1 154 ? 134.967 115.287 171.659 1.00 60.64  ? 155 ALA C CA  1 
ATOM   8477  C  C   . ALA C 1 154 ? 134.031 115.058 170.495 1.00 60.91  ? 155 ALA C C   1 
ATOM   8478  O  O   . ALA C 1 154 ? 134.076 114.033 169.832 1.00 60.92  ? 155 ALA C O   1 
ATOM   8479  C  CB  . ALA C 1 154 ? 134.365 114.793 172.924 1.00 60.56  ? 155 ALA C CB  1 
ATOM   8480  N  N   . LEU C 1 155 ? 133.192 116.046 170.243 1.00 74.80  ? 156 LEU C N   1 
ATOM   8481  C  CA  . LEU C 1 155 ? 132.236 115.990 169.159 1.00 75.12  ? 156 LEU C CA  1 
ATOM   8482  C  C   . LEU C 1 155 ? 132.959 116.063 167.829 1.00 74.69  ? 156 LEU C C   1 
ATOM   8483  O  O   . LEU C 1 155 ? 132.781 115.223 166.947 1.00 74.69  ? 156 LEU C O   1 
ATOM   8484  C  CB  . LEU C 1 155 ? 131.284 117.169 169.307 1.00 75.71  ? 156 LEU C CB  1 
ATOM   8485  C  CG  . LEU C 1 155 ? 130.184 117.413 168.294 1.00 76.25  ? 156 LEU C CG  1 
ATOM   8486  C  CD1 . LEU C 1 155 ? 129.347 116.218 168.233 1.00 76.43  ? 156 LEU C CD1 1 
ATOM   8487  C  CD2 . LEU C 1 155 ? 129.353 118.570 168.735 1.00 76.43  ? 156 LEU C CD2 1 
ATOM   8488  N  N   . ALA C 1 156 ? 133.822 117.056 167.707 1.00 63.73  ? 157 ALA C N   1 
ATOM   8489  C  CA  . ALA C 1 156 ? 134.585 117.213 166.492 1.00 63.34  ? 157 ALA C CA  1 
ATOM   8490  C  C   . ALA C 1 156 ? 135.489 116.029 166.274 1.00 63.15  ? 157 ALA C C   1 
ATOM   8491  O  O   . ALA C 1 156 ? 135.754 115.655 165.155 1.00 63.11  ? 157 ALA C O   1 
ATOM   8492  C  CB  . ALA C 1 156 ? 135.386 118.463 166.547 1.00 63.25  ? 157 ALA C CB  1 
ATOM   8493  N  N   . ALA C 1 157 ? 135.976 115.445 167.351 1.00 62.11  ? 158 ALA C N   1 
ATOM   8494  C  CA  . ALA C 1 157 ? 136.830 114.283 167.243 1.00 62.09  ? 158 ALA C CA  1 
ATOM   8495  C  C   . ALA C 1 157 ? 136.046 113.100 166.756 1.00 62.47  ? 158 ALA C C   1 
ATOM   8496  O  O   . ALA C 1 157 ? 136.550 112.279 166.009 1.00 62.48  ? 158 ALA C O   1 
ATOM   8497  C  CB  . ALA C 1 157 ? 137.448 113.969 168.566 1.00 61.94  ? 158 ALA C CB  1 
ATOM   8498  N  N   . ALA C 1 158 ? 134.803 113.011 167.200 1.00 61.28  ? 159 ALA C N   1 
ATOM   8499  C  CA  . ALA C 1 158 ? 133.956 111.914 166.800 1.00 61.88  ? 159 ALA C CA  1 
ATOM   8500  C  C   . ALA C 1 158 ? 133.662 112.011 165.332 1.00 62.92  ? 159 ALA C C   1 
ATOM   8501  O  O   . ALA C 1 158 ? 133.562 111.013 164.639 1.00 63.00  ? 159 ALA C O   1 
ATOM   8502  C  CB  . ALA C 1 158 ? 132.689 111.939 167.578 1.00 61.67  ? 159 ALA C CB  1 
ATOM   8503  N  N   . VAL C 1 159 ? 133.543 113.232 164.848 1.00 76.14  ? 160 VAL C N   1 
ATOM   8504  C  CA  . VAL C 1 159 ? 133.258 113.419 163.441 1.00 77.30  ? 160 VAL C CA  1 
ATOM   8505  C  C   . VAL C 1 159 ? 134.486 113.230 162.568 1.00 78.31  ? 160 VAL C C   1 
ATOM   8506  O  O   . VAL C 1 159 ? 134.458 112.503 161.588 1.00 78.41  ? 160 VAL C O   1 
ATOM   8507  C  CB  . VAL C 1 159 ? 132.655 114.797 163.195 1.00 77.45  ? 160 VAL C CB  1 
ATOM   8508  C  CG1 . VAL C 1 159 ? 132.612 115.093 161.736 1.00 77.52  ? 160 VAL C CG1 1 
ATOM   8509  C  CG2 . VAL C 1 159 ? 131.276 114.851 163.764 1.00 77.46  ? 160 VAL C CG2 1 
ATOM   8510  N  N   . ARG C 1 160 ? 135.576 113.873 162.952 1.00 80.32  ? 161 ARG C N   1 
ATOM   8511  C  CA  . ARG C 1 160 ? 136.778 113.913 162.138 1.00 81.25  ? 161 ARG C CA  1 
ATOM   8512  C  C   . ARG C 1 160 ? 137.762 112.793 162.419 1.00 81.29  ? 161 ARG C C   1 
ATOM   8513  O  O   . ARG C 1 160 ? 138.809 112.725 161.803 1.00 81.31  ? 161 ARG C O   1 
ATOM   8514  C  CB  . ARG C 1 160 ? 137.460 115.278 162.236 1.00 82.02  ? 161 ARG C CB  1 
ATOM   8515  C  CG  . ARG C 1 160 ? 136.609 116.416 161.729 1.00 82.69  ? 161 ARG C CG  1 
ATOM   8516  C  CD  . ARG C 1 160 ? 137.426 117.594 161.254 1.00 83.31  ? 161 ARG C CD  1 
ATOM   8517  N  NE  . ARG C 1 160 ? 136.565 118.660 160.753 1.00 83.84  ? 161 ARG C NE  1 
ATOM   8518  C  CZ  . ARG C 1 160 ? 136.999 119.805 160.245 1.00 84.30  ? 161 ARG C CZ  1 
ATOM   8519  N  NH1 . ARG C 1 160 ? 138.292 120.050 160.157 1.00 84.46  1 161 ARG C NH1 1 
ATOM   8520  N  NH2 . ARG C 1 160 ? 136.134 120.708 159.820 1.00 84.44  ? 161 ARG C NH2 1 
ATOM   8521  N  N   . GLY C 1 161 ? 137.417 111.910 163.341 1.00 63.96  ? 162 GLY C N   1 
ATOM   8522  C  CA  . GLY C 1 161 ? 138.238 110.746 163.599 1.00 63.98  ? 162 GLY C CA  1 
ATOM   8523  C  C   . GLY C 1 161 ? 139.485 110.893 164.442 1.00 64.01  ? 162 GLY C C   1 
ATOM   8524  O  O   . GLY C 1 161 ? 140.470 110.218 164.206 1.00 64.01  ? 162 GLY C O   1 
ATOM   8525  N  N   . TYR C 1 162 ? 139.463 111.805 165.398 1.00 79.34  ? 163 TYR C N   1 
ATOM   8526  C  CA  . TYR C 1 162 ? 140.540 111.912 166.363 1.00 79.40  ? 163 TYR C CA  1 
ATOM   8527  C  C   . TYR C 1 162 ? 140.212 111.187 167.653 1.00 79.33  ? 163 TYR C C   1 
ATOM   8528  O  O   . TYR C 1 162 ? 139.064 111.129 168.058 1.00 79.28  ? 163 TYR C O   1 
ATOM   8529  C  CB  . TYR C 1 162 ? 140.800 113.371 166.682 1.00 79.51  ? 163 TYR C CB  1 
ATOM   8530  C  CG  . TYR C 1 162 ? 141.185 114.205 165.496 1.00 79.65  ? 163 TYR C CG  1 
ATOM   8531  C  CD1 . TYR C 1 162 ? 140.326 115.150 164.977 1.00 79.71  ? 163 TYR C CD1 1 
ATOM   8532  C  CD2 . TYR C 1 162 ? 142.412 114.053 164.899 1.00 79.74  ? 163 TYR C CD2 1 
ATOM   8533  C  CE1 . TYR C 1 162 ? 140.680 115.913 163.901 1.00 79.78  ? 163 TYR C CE1 1 
ATOM   8534  C  CE2 . TYR C 1 162 ? 142.771 114.810 163.826 1.00 79.79  ? 163 TYR C CE2 1 
ATOM   8535  C  CZ  . TYR C 1 162 ? 141.903 115.737 163.329 1.00 79.81  ? 163 TYR C CZ  1 
ATOM   8536  O  OH  . TYR C 1 162 ? 142.267 116.493 162.249 1.00 79.86  ? 163 TYR C OH  1 
ATOM   8537  N  N   . ARG C 1 163 ? 141.223 110.626 168.296 1.00 78.36  ? 164 ARG C N   1 
ATOM   8538  C  CA  . ARG C 1 163 ? 141.062 110.122 169.650 1.00 78.28  ? 164 ARG C CA  1 
ATOM   8539  C  C   . ARG C 1 163 ? 140.939 111.317 170.571 1.00 78.03  ? 164 ARG C C   1 
ATOM   8540  O  O   . ARG C 1 163 ? 141.598 112.314 170.363 1.00 78.02  ? 164 ARG C O   1 
ATOM   8541  C  CB  . ARG C 1 163 ? 142.261 109.266 170.050 1.00 78.40  ? 164 ARG C CB  1 
ATOM   8542  C  CG  . ARG C 1 163 ? 142.122 108.542 171.372 1.00 78.49  ? 164 ARG C CG  1 
ATOM   8543  C  CD  . ARG C 1 163 ? 143.433 107.921 171.782 1.00 78.57  ? 164 ARG C CD  1 
ATOM   8544  N  NE  . ARG C 1 163 ? 143.382 107.270 173.083 1.00 78.62  ? 164 ARG C NE  1 
ATOM   8545  C  CZ  . ARG C 1 163 ? 144.457 106.921 173.777 1.00 78.67  ? 164 ARG C CZ  1 
ATOM   8546  N  NH1 . ARG C 1 163 ? 145.659 107.171 173.299 1.00 78.69  1 164 ARG C NH1 1 
ATOM   8547  N  NH2 . ARG C 1 163 ? 144.330 106.329 174.950 1.00 78.69  ? 164 ARG C NH2 1 
ATOM   8548  N  N   . CYS C 1 164 ? 140.106 111.224 171.596 1.00 75.21  ? 165 CYS C N   1 
ATOM   8549  C  CA  . CYS C 1 164 ? 139.866 112.373 172.453 1.00 74.89  ? 165 CYS C CA  1 
ATOM   8550  C  C   . CYS C 1 164 ? 139.896 112.037 173.934 1.00 74.49  ? 165 CYS C C   1 
ATOM   8551  O  O   . CYS C 1 164 ? 139.136 111.213 174.410 1.00 74.47  ? 165 CYS C O   1 
ATOM   8552  C  CB  . CYS C 1 164 ? 138.541 113.033 172.090 1.00 74.93  ? 165 CYS C CB  1 
ATOM   8553  S  SG  . CYS C 1 164 ? 138.230 114.595 172.896 1.00 74.89  ? 165 CYS C SG  1 
ATOM   8554  N  N   . ILE C 1 165 ? 140.789 112.702 174.651 1.00 76.75  ? 166 ILE C N   1 
ATOM   8555  C  CA  . ILE C 1 165 ? 140.943 112.535 176.082 1.00 76.27  ? 166 ILE C CA  1 
ATOM   8556  C  C   . ILE C 1 165 ? 140.683 113.833 176.819 1.00 75.33  ? 166 ILE C C   1 
ATOM   8557  O  O   . ILE C 1 165 ? 141.384 114.820 176.644 1.00 75.27  ? 166 ILE C O   1 
ATOM   8558  C  CB  . ILE C 1 165 ? 142.340 112.044 176.430 1.00 76.65  ? 166 ILE C CB  1 
ATOM   8559  C  CG1 . ILE C 1 165 ? 142.537 110.629 175.906 1.00 76.86  ? 166 ILE C CG1 1 
ATOM   8560  C  CG2 . ILE C 1 165 ? 142.541 112.073 177.915 1.00 76.73  ? 166 ILE C CG2 1 
ATOM   8561  C  CD1 . ILE C 1 165 ? 143.916 110.102 176.104 1.00 76.98  ? 166 ILE C CD1 1 
ATOM   8562  N  N   . ILE C 1 166 ? 139.660 113.814 177.654 1.00 68.36  ? 167 ILE C N   1 
ATOM   8563  C  CA  . ILE C 1 166 ? 139.230 114.993 178.372 1.00 67.48  ? 167 ILE C CA  1 
ATOM   8564  C  C   . ILE C 1 166 ? 139.684 114.931 179.810 1.00 67.42  ? 167 ILE C C   1 
ATOM   8565  O  O   . ILE C 1 166 ? 139.521 113.921 180.460 1.00 67.40  ? 167 ILE C O   1 
ATOM   8566  C  CB  . ILE C 1 166 ? 137.710 115.092 178.340 1.00 66.89  ? 167 ILE C CB  1 
ATOM   8567  C  CG1 . ILE C 1 166 ? 137.231 115.294 176.912 1.00 66.59  ? 167 ILE C CG1 1 
ATOM   8568  C  CG2 . ILE C 1 166 ? 137.223 116.206 179.204 1.00 66.73  ? 167 ILE C CG2 1 
ATOM   8569  C  CD1 . ILE C 1 166 ? 137.954 116.358 176.192 1.00 66.45  ? 167 ILE C CD1 1 
ATOM   8570  N  N   . VAL C 1 167 ? 140.246 116.020 180.307 1.00 63.65  ? 168 VAL C N   1 
ATOM   8571  C  CA  . VAL C 1 167 ? 140.655 116.095 181.696 1.00 63.72  ? 168 VAL C CA  1 
ATOM   8572  C  C   . VAL C 1 167 ? 139.890 117.191 182.407 1.00 64.13  ? 168 VAL C C   1 
ATOM   8573  O  O   . VAL C 1 167 ? 140.106 118.363 182.150 1.00 64.16  ? 168 VAL C O   1 
ATOM   8574  C  CB  . VAL C 1 167 ? 142.138 116.383 181.809 1.00 63.47  ? 168 VAL C CB  1 
ATOM   8575  C  CG1 . VAL C 1 167 ? 142.548 116.389 183.241 1.00 63.40  ? 168 VAL C CG1 1 
ATOM   8576  C  CG2 . VAL C 1 167 ? 142.922 115.354 181.052 1.00 63.39  ? 168 VAL C CG2 1 
ATOM   8577  N  N   . MET C 1 168 ? 138.982 116.809 183.295 1.00 74.82  ? 169 MET C N   1 
ATOM   8578  C  CA  . MET C 1 168 ? 138.148 117.794 183.979 1.00 75.29  ? 169 MET C CA  1 
ATOM   8579  C  C   . MET C 1 168 ? 138.049 117.566 185.484 1.00 75.66  ? 169 MET C C   1 
ATOM   8580  O  O   . MET C 1 168 ? 138.192 116.453 185.961 1.00 75.67  ? 169 MET C O   1 
ATOM   8581  C  CB  . MET C 1 168 ? 136.757 117.873 183.333 1.00 75.39  ? 169 MET C CB  1 
ATOM   8582  C  CG  . MET C 1 168 ? 135.878 116.673 183.559 1.00 75.45  ? 169 MET C CG  1 
ATOM   8583  S  SD  . MET C 1 168 ? 134.432 116.571 182.501 1.00 75.59  ? 169 MET C SD  1 
ATOM   8584  C  CE  . MET C 1 168 ? 133.686 118.124 182.845 1.00 75.64  ? 169 MET C CE  1 
ATOM   8585  N  N   . PRO C 1 169 ? 137.826 118.638 186.239 1.00 70.69  ? 170 PRO C N   1 
ATOM   8586  C  CA  . PRO C 1 169 ? 137.735 118.597 187.691 1.00 71.09  ? 170 PRO C CA  1 
ATOM   8587  C  C   . PRO C 1 169 ? 136.567 117.763 188.193 1.00 71.75  ? 170 PRO C C   1 
ATOM   8588  O  O   . PRO C 1 169 ? 135.570 117.651 187.509 1.00 71.79  ? 170 PRO C O   1 
ATOM   8589  C  CB  . PRO C 1 169 ? 137.558 120.061 188.052 1.00 70.90  ? 170 PRO C CB  1 
ATOM   8590  C  CG  . PRO C 1 169 ? 138.204 120.778 186.978 1.00 70.76  ? 170 PRO C CG  1 
ATOM   8591  C  CD  . PRO C 1 169 ? 137.888 120.021 185.758 1.00 70.69  ? 170 PRO C CD  1 
ATOM   8592  N  N   . GLU C 1 170 ? 136.713 117.162 189.367 1.00 80.34  ? 171 GLU C N   1 
ATOM   8593  C  CA  . GLU C 1 170 ? 135.710 116.255 189.916 1.00 80.98  ? 171 GLU C CA  1 
ATOM   8594  C  C   . GLU C 1 170 ? 134.377 116.918 190.243 1.00 81.24  ? 171 GLU C C   1 
ATOM   8595  O  O   . GLU C 1 170 ? 133.362 116.257 190.383 1.00 81.27  ? 171 GLU C O   1 
ATOM   8596  C  CB  . GLU C 1 170 ? 136.261 115.542 191.150 1.00 81.31  ? 171 GLU C CB  1 
ATOM   8597  C  CG  . GLU C 1 170 ? 136.605 116.455 192.308 1.00 81.54  ? 171 GLU C CG  1 
ATOM   8598  C  CD  . GLU C 1 170 ? 137.461 115.781 193.365 1.00 81.74  ? 171 GLU C CD  1 
ATOM   8599  O  OE1 . GLU C 1 170 ? 137.747 114.578 193.219 1.00 81.87  ? 171 GLU C OE1 1 
ATOM   8600  O  OE2 . GLU C 1 170 ? 137.858 116.464 194.334 1.00 81.89  1 171 GLU C OE2 1 
ATOM   8601  N  N   . LYS C 1 171 ? 134.398 118.230 190.393 1.00 72.99  ? 172 LYS C N   1 
ATOM   8602  C  CA  . LYS C 1 171 ? 133.203 119.003 190.687 1.00 73.20  ? 172 LYS C CA  1 
ATOM   8603  C  C   . LYS C 1 171 ? 132.183 119.019 189.560 1.00 74.09  ? 172 LYS C C   1 
ATOM   8604  O  O   . LYS C 1 171 ? 130.989 119.113 189.800 1.00 74.13  ? 172 LYS C O   1 
ATOM   8605  C  CB  . LYS C 1 171 ? 133.619 120.432 191.032 1.00 72.64  ? 172 LYS C CB  1 
ATOM   8606  C  CG  . LYS C 1 171 ? 132.812 121.522 190.391 1.00 72.10  ? 172 LYS C CG  1 
ATOM   8607  C  CD  . LYS C 1 171 ? 133.493 122.864 190.527 1.00 71.66  ? 172 LYS C CD  1 
ATOM   8608  C  CE  . LYS C 1 171 ? 132.740 123.929 189.778 1.00 71.35  ? 172 LYS C CE  1 
ATOM   8609  N  NZ  . LYS C 1 171 ? 133.352 125.256 189.933 1.00 71.20  1 172 LYS C NZ  1 
ATOM   8610  N  N   . MET C 1 172 ? 132.654 118.909 188.328 1.00 83.45  ? 173 MET C N   1 
ATOM   8611  C  CA  . MET C 1 172 ? 131.800 119.114 187.172 1.00 84.26  ? 173 MET C CA  1 
ATOM   8612  C  C   . MET C 1 172 ? 130.764 118.026 187.008 1.00 84.54  ? 173 MET C C   1 
ATOM   8613  O  O   . MET C 1 172 ? 130.992 116.887 187.375 1.00 84.58  ? 173 MET C O   1 
ATOM   8614  C  CB  . MET C 1 172 ? 132.635 119.227 185.911 1.00 84.62  ? 173 MET C CB  1 
ATOM   8615  C  CG  . MET C 1 172 ? 133.731 120.253 185.975 1.00 84.89  ? 173 MET C CG  1 
ATOM   8616  S  SD  . MET C 1 172 ? 133.144 121.918 186.203 1.00 85.15  ? 173 MET C SD  1 
ATOM   8617  C  CE  . MET C 1 172 ? 134.694 122.774 186.319 1.00 85.39  ? 173 MET C CE  1 
ATOM   8618  N  N   . SER C 1 173 ? 129.633 118.392 186.421 1.00 78.27  ? 174 SER C N   1 
ATOM   8619  C  CA  . SER C 1 173 ? 128.444 117.553 186.412 1.00 78.46  ? 174 SER C CA  1 
ATOM   8620  C  C   . SER C 1 173 ? 128.588 116.247 185.671 1.00 78.58  ? 174 SER C C   1 
ATOM   8621  O  O   . SER C 1 173 ? 129.293 116.155 184.688 1.00 78.59  ? 174 SER C O   1 
ATOM   8622  C  CB  . SER C 1 173 ? 127.270 118.314 185.825 1.00 78.47  ? 174 SER C CB  1 
ATOM   8623  O  OG  . SER C 1 173 ? 127.406 118.413 184.430 1.00 78.44  ? 174 SER C OG  1 
ATOM   8624  N  N   . SER C 1 174 ? 127.890 115.237 186.163 1.00 78.09  ? 175 SER C N   1 
ATOM   8625  C  CA  . SER C 1 174 ? 127.916 113.918 185.575 1.00 78.14  ? 175 SER C CA  1 
ATOM   8626  C  C   . SER C 1 174 ? 127.275 113.897 184.208 1.00 78.08  ? 175 SER C C   1 
ATOM   8627  O  O   . SER C 1 174 ? 127.526 113.000 183.419 1.00 78.03  ? 175 SER C O   1 
ATOM   8628  C  CB  . SER C 1 174 ? 127.206 112.935 186.486 1.00 78.19  ? 175 SER C CB  1 
ATOM   8629  O  OG  . SER C 1 174 ? 125.872 113.330 186.681 1.00 78.19  ? 175 SER C OG  1 
ATOM   8630  N  N   . GLU C 1 175 ? 126.424 114.873 183.934 1.00 92.84  ? 176 GLU C N   1 
ATOM   8631  C  CA  . GLU C 1 175 ? 125.781 114.953 182.636 1.00 92.66  ? 176 GLU C CA  1 
ATOM   8632  C  C   . GLU C 1 175 ? 126.812 115.155 181.543 1.00 91.76  ? 176 GLU C C   1 
ATOM   8633  O  O   . GLU C 1 175 ? 126.734 114.558 180.471 1.00 91.68  ? 176 GLU C O   1 
ATOM   8634  C  CB  . GLU C 1 175 ? 124.783 116.108 182.619 1.00 93.13  ? 176 GLU C CB  1 
ATOM   8635  C  CG  . GLU C 1 175 ? 123.478 115.850 183.356 1.00 93.41  ? 176 GLU C CG  1 
ATOM   8636  C  CD  . GLU C 1 175 ? 123.543 116.174 184.830 1.00 93.50  ? 176 GLU C CD  1 
ATOM   8637  O  OE1 . GLU C 1 175 ? 124.649 116.164 185.393 1.00 93.55  ? 176 GLU C OE1 1 
ATOM   8638  O  OE2 . GLU C 1 175 ? 122.485 116.441 185.431 1.00 93.49  1 176 GLU C OE2 1 
ATOM   8639  N  N   . LYS C 1 176 ? 127.807 115.972 181.839 1.00 76.65  ? 177 LYS C N   1 
ATOM   8640  C  CA  . LYS C 1 176 ? 128.871 116.216 180.894 1.00 75.73  ? 177 LYS C CA  1 
ATOM   8641  C  C   . LYS C 1 176 ? 129.648 114.945 180.661 1.00 74.86  ? 177 LYS C C   1 
ATOM   8642  O  O   . LYS C 1 176 ? 130.122 114.695 179.574 1.00 74.73  ? 177 LYS C O   1 
ATOM   8643  C  CB  . LYS C 1 176 ? 129.807 117.303 181.416 1.00 75.69  ? 177 LYS C CB  1 
ATOM   8644  C  CG  . LYS C 1 176 ? 129.159 118.651 181.604 1.00 75.65  ? 177 LYS C CG  1 
ATOM   8645  C  CD  . LYS C 1 176 ? 130.155 119.687 182.082 1.00 75.57  ? 177 LYS C CD  1 
ATOM   8646  C  CE  . LYS C 1 176 ? 129.486 121.005 182.366 1.00 75.51  ? 177 LYS C CE  1 
ATOM   8647  N  NZ  . LYS C 1 176 ? 130.419 121.992 182.936 1.00 75.50  1 177 LYS C NZ  1 
ATOM   8648  N  N   . VAL C 1 177 ? 129.762 114.132 181.696 1.00 65.10  ? 178 VAL C N   1 
ATOM   8649  C  CA  . VAL C 1 177 ? 130.491 112.888 181.595 1.00 64.36  ? 178 VAL C CA  1 
ATOM   8650  C  C   . VAL C 1 177 ? 129.732 111.893 180.749 1.00 64.19  ? 178 VAL C C   1 
ATOM   8651  O  O   . VAL C 1 177 ? 130.317 111.173 179.960 1.00 64.16  ? 178 VAL C O   1 
ATOM   8652  C  CB  . VAL C 1 177 ? 130.753 112.291 182.978 1.00 63.91  ? 178 VAL C CB  1 
ATOM   8653  C  CG1 . VAL C 1 177 ? 131.365 110.922 182.862 1.00 63.77  ? 178 VAL C CG1 1 
ATOM   8654  C  CG2 . VAL C 1 177 ? 131.649 113.194 183.770 1.00 63.76  ? 178 VAL C CG2 1 
ATOM   8655  N  N   . ASP C 1 178 ? 128.419 111.861 180.907 1.00 95.87  ? 179 ASP C N   1 
ATOM   8656  C  CA  . ASP C 1 178 ? 127.608 110.944 180.134 1.00 95.70  ? 179 ASP C CA  1 
ATOM   8657  C  C   . ASP C 1 178 ? 127.660 111.320 178.675 1.00 95.21  ? 179 ASP C C   1 
ATOM   8658  O  O   . ASP C 1 178 ? 127.740 110.460 177.802 1.00 95.19  ? 179 ASP C O   1 
ATOM   8659  C  CB  . ASP C 1 178 ? 126.167 110.972 180.619 1.00 95.91  ? 179 ASP C CB  1 
ATOM   8660  C  CG  . ASP C 1 178 ? 126.007 110.394 181.995 1.00 96.05  ? 179 ASP C CG  1 
ATOM   8661  O  OD1 . ASP C 1 178 ? 126.877 109.615 182.420 1.00 96.12  ? 179 ASP C OD1 1 
ATOM   8662  O  OD2 . ASP C 1 178 ? 125.000 110.710 182.656 1.00 96.09  1 179 ASP C OD2 1 
ATOM   8663  N  N   . VAL C 1 179 ? 127.661 112.618 178.415 1.00 69.41  ? 180 VAL C N   1 
ATOM   8664  C  CA  . VAL C 1 179 ? 127.726 113.093 177.048 1.00 68.94  ? 180 VAL C CA  1 
ATOM   8665  C  C   . VAL C 1 179 ? 129.078 112.812 176.428 1.00 68.78  ? 180 VAL C C   1 
ATOM   8666  O  O   . VAL C 1 179 ? 129.167 112.322 175.315 1.00 68.72  ? 180 VAL C O   1 
ATOM   8667  C  CB  . VAL C 1 179 ? 127.424 114.581 176.973 1.00 68.72  ? 180 VAL C CB  1 
ATOM   8668  C  CG1 . VAL C 1 179 ? 127.740 115.103 175.614 1.00 68.61  ? 180 VAL C CG1 1 
ATOM   8669  C  CG2 . VAL C 1 179 ? 125.982 114.831 177.287 1.00 68.69  ? 180 VAL C CG2 1 
ATOM   8670  N  N   . LEU C 1 180 ? 130.132 113.093 177.170 1.00 70.66  ? 181 LEU C N   1 
ATOM   8671  C  CA  . LEU C 1 180 ? 131.476 112.849 176.686 1.00 70.60  ? 181 LEU C CA  1 
ATOM   8672  C  C   . LEU C 1 180 ? 131.719 111.379 176.441 1.00 70.99  ? 181 LEU C C   1 
ATOM   8673  O  O   . LEU C 1 180 ? 132.424 111.000 175.520 1.00 71.01  ? 181 LEU C O   1 
ATOM   8674  C  CB  . LEU C 1 180 ? 132.482 113.352 177.708 1.00 70.28  ? 181 LEU C CB  1 
ATOM   8675  C  CG  . LEU C 1 180 ? 132.619 114.859 177.781 1.00 70.00  ? 181 LEU C CG  1 
ATOM   8676  C  CD1 . LEU C 1 180 ? 133.317 115.261 179.039 1.00 69.89  ? 181 LEU C CD1 1 
ATOM   8677  C  CD2 . LEU C 1 180 ? 133.382 115.337 176.593 1.00 69.90  ? 181 LEU C CD2 1 
ATOM   8678  N  N   . ARG C 1 181 ? 131.122 110.552 177.279 1.00 83.67  ? 182 ARG C N   1 
ATOM   8679  C  CA  . ARG C 1 181 ? 131.274 109.124 177.161 1.00 84.09  ? 182 ARG C CA  1 
ATOM   8680  C  C   . ARG C 1 181 ? 130.535 108.640 175.938 1.00 83.24  ? 182 ARG C C   1 
ATOM   8681  O  O   . ARG C 1 181 ? 130.984 107.738 175.253 1.00 83.18  ? 182 ARG C O   1 
ATOM   8682  C  CB  . ARG C 1 181 ? 130.755 108.448 178.429 1.00 85.19  ? 182 ARG C CB  1 
ATOM   8683  C  CG  . ARG C 1 181 ? 131.041 106.969 178.532 1.00 86.12  ? 182 ARG C CG  1 
ATOM   8684  C  CD  . ARG C 1 181 ? 131.302 106.542 179.966 1.00 86.89  ? 182 ARG C CD  1 
ATOM   8685  N  NE  . ARG C 1 181 ? 130.229 106.918 180.877 1.00 87.51  ? 182 ARG C NE  1 
ATOM   8686  C  CZ  . ARG C 1 181 ? 130.279 106.751 182.191 1.00 88.16  ? 182 ARG C CZ  1 
ATOM   8687  N  NH1 . ARG C 1 181 ? 131.352 106.223 182.748 1.00 88.36  1 182 ARG C NH1 1 
ATOM   8688  N  NH2 . ARG C 1 181 ? 129.262 107.121 182.949 1.00 88.37  ? 182 ARG C NH2 1 
ATOM   8689  N  N   . ALA C 1 182 ? 129.400 109.258 175.657 1.00 65.32  ? 183 ALA C N   1 
ATOM   8690  C  CA  . ALA C 1 182 ? 128.626 108.896 174.480 1.00 64.54  ? 183 ALA C CA  1 
ATOM   8691  C  C   . ALA C 1 182 ? 129.292 109.312 173.187 1.00 63.93  ? 183 ALA C C   1 
ATOM   8692  O  O   . ALA C 1 182 ? 129.053 108.723 172.150 1.00 63.86  ? 183 ALA C O   1 
ATOM   8693  C  CB  . ALA C 1 182 ? 127.253 109.483 174.561 1.00 64.49  ? 183 ALA C CB  1 
ATOM   8694  N  N   . LEU C 1 183 ? 130.121 110.340 173.252 1.00 66.20  ? 184 LEU C N   1 
ATOM   8695  C  CA  . LEU C 1 183 ? 130.797 110.845 172.071 1.00 65.78  ? 184 LEU C CA  1 
ATOM   8696  C  C   . LEU C 1 183 ? 132.035 110.034 171.775 1.00 66.27  ? 184 LEU C C   1 
ATOM   8697  O  O   . LEU C 1 183 ? 132.683 110.225 170.763 1.00 66.26  ? 184 LEU C O   1 
ATOM   8698  C  CB  . LEU C 1 183 ? 131.160 112.310 172.244 1.00 65.17  ? 184 LEU C CB  1 
ATOM   8699  C  CG  . LEU C 1 183 ? 129.996 113.282 172.281 1.00 64.71  ? 184 LEU C CG  1 
ATOM   8700  C  CD1 . LEU C 1 183 ? 130.468 114.633 172.686 1.00 64.54  ? 184 LEU C CD1 1 
ATOM   8701  C  CD2 . LEU C 1 183 ? 129.352 113.350 170.940 1.00 64.58  ? 184 LEU C CD2 1 
ATOM   8702  N  N   . GLY C 1 184 ? 132.357 109.118 172.672 1.00 59.90  ? 185 GLY C N   1 
ATOM   8703  C  CA  . GLY C 1 184 ? 133.506 108.257 172.501 1.00 60.60  ? 185 GLY C CA  1 
ATOM   8704  C  C   . GLY C 1 184 ? 134.787 108.757 173.118 1.00 61.44  ? 185 GLY C C   1 
ATOM   8705  O  O   . GLY C 1 184 ? 135.847 108.210 172.872 1.00 61.48  ? 185 GLY C O   1 
ATOM   8706  N  N   . ALA C 1 185 ? 134.687 109.805 173.918 1.00 73.91  ? 186 ALA C N   1 
ATOM   8707  C  CA  . ALA C 1 185 ? 135.850 110.387 174.573 1.00 74.90  ? 186 ALA C CA  1 
ATOM   8708  C  C   . ALA C 1 185 ? 136.250 109.685 175.852 1.00 75.87  ? 186 ALA C C   1 
ATOM   8709  O  O   . ALA C 1 185 ? 135.412 109.315 176.649 1.00 75.95  ? 186 ALA C O   1 
ATOM   8710  C  CB  . ALA C 1 185 ? 135.602 111.831 174.858 1.00 74.91  ? 186 ALA C CB  1 
ATOM   8711  N  N   . GLU C 1 186 ? 137.548 109.515 176.047 1.00 85.09  ? 187 GLU C N   1 
ATOM   8712  C  CA  . GLU C 1 186 ? 138.076 109.030 177.311 1.00 85.86  ? 187 GLU C CA  1 
ATOM   8713  C  C   . GLU C 1 186 ? 138.066 110.140 178.346 1.00 85.75  ? 187 GLU C C   1 
ATOM   8714  O  O   . GLU C 1 186 ? 138.246 111.299 178.023 1.00 85.78  ? 187 GLU C O   1 
ATOM   8715  C  CB  . GLU C 1 186 ? 139.482 108.474 177.116 1.00 86.51  ? 187 GLU C CB  1 
ATOM   8716  C  CG  . GLU C 1 186 ? 139.529 107.296 176.174 1.00 86.90  ? 187 GLU C CG  1 
ATOM   8717  C  CD  . GLU C 1 186 ? 140.920 106.959 175.727 1.00 87.13  ? 187 GLU C CD  1 
ATOM   8718  O  OE1 . GLU C 1 186 ? 141.071 106.402 174.627 1.00 87.21  ? 187 GLU C OE1 1 
ATOM   8719  O  OE2 . GLU C 1 186 ? 141.867 107.244 176.476 1.00 87.18  1 187 GLU C OE2 1 
ATOM   8720  N  N   . ILE C 1 187 ? 137.870 109.785 179.603 1.00 81.58  ? 188 ILE C N   1 
ATOM   8721  C  CA  . ILE C 1 187 ? 137.678 110.798 180.622 1.00 81.27  ? 188 ILE C CA  1 
ATOM   8722  C  C   . ILE C 1 187 ? 138.598 110.604 181.809 1.00 80.26  ? 188 ILE C C   1 
ATOM   8723  O  O   . ILE C 1 187 ? 138.774 109.502 182.296 1.00 80.23  ? 188 ILE C O   1 
ATOM   8724  C  CB  . ILE C 1 187 ? 136.221 110.822 181.094 1.00 81.81  ? 188 ILE C CB  1 
ATOM   8725  C  CG1 . ILE C 1 187 ? 135.302 111.114 179.917 1.00 82.08  ? 188 ILE C CG1 1 
ATOM   8726  C  CG2 . ILE C 1 187 ? 136.013 111.867 182.139 1.00 81.94  ? 188 ILE C CG2 1 
ATOM   8727  C  CD1 . ILE C 1 187 ? 133.858 111.068 180.249 1.00 82.20  ? 188 ILE C CD1 1 
ATOM   8728  N  N   . VAL C 1 188 ? 139.187 111.702 182.257 1.00 68.93  ? 189 VAL C N   1 
ATOM   8729  C  CA  . VAL C 1 188 ? 140.060 111.720 183.412 1.00 67.95  ? 189 VAL C CA  1 
ATOM   8730  C  C   . VAL C 1 188 ? 139.618 112.855 184.308 1.00 67.32  ? 189 VAL C C   1 
ATOM   8731  O  O   . VAL C 1 188 ? 139.330 113.944 183.839 1.00 67.24  ? 189 VAL C O   1 
ATOM   8732  C  CB  . VAL C 1 188 ? 141.521 111.948 182.999 1.00 67.70  ? 189 VAL C CB  1 
ATOM   8733  C  CG1 . VAL C 1 188 ? 142.398 112.095 184.202 1.00 67.60  ? 189 VAL C CG1 1 
ATOM   8734  C  CG2 . VAL C 1 188 ? 142.010 110.811 182.155 1.00 67.65  ? 189 VAL C CG2 1 
ATOM   8735  N  N   . ARG C 1 189 ? 139.549 112.597 185.603 1.00 68.47  ? 190 ARG C N   1 
ATOM   8736  C  CA  . ARG C 1 189 ? 139.096 113.613 186.531 1.00 68.02  ? 190 ARG C CA  1 
ATOM   8737  C  C   . ARG C 1 189 ? 140.203 114.093 187.448 1.00 68.42  ? 190 ARG C C   1 
ATOM   8738  O  O   . ARG C 1 189 ? 141.153 113.379 187.701 1.00 68.41  ? 190 ARG C O   1 
ATOM   8739  C  CB  . ARG C 1 189 ? 137.913 113.109 187.353 1.00 67.43  ? 190 ARG C CB  1 
ATOM   8740  C  CG  . ARG C 1 189 ? 136.772 112.557 186.540 1.00 67.00  ? 190 ARG C CG  1 
ATOM   8741  C  CD  . ARG C 1 189 ? 136.219 113.561 185.564 1.00 66.61  ? 190 ARG C CD  1 
ATOM   8742  N  NE  . ARG C 1 189 ? 135.459 114.633 186.191 1.00 66.31  ? 190 ARG C NE  1 
ATOM   8743  C  CZ  . ARG C 1 189 ? 134.203 114.525 186.595 1.00 66.05  ? 190 ARG C CZ  1 
ATOM   8744  N  NH1 . ARG C 1 189 ? 133.560 113.386 186.461 1.00 65.96  1 190 ARG C NH1 1 
ATOM   8745  N  NH2 . ARG C 1 189 ? 133.594 115.557 187.143 1.00 65.96  ? 190 ARG C NH2 1 
ATOM   8746  N  N   . THR C 1 190 ? 140.077 115.319 187.935 1.00 68.51  ? 191 THR C N   1 
ATOM   8747  C  CA  . THR C 1 190 ? 141.031 115.851 188.893 1.00 69.10  ? 191 THR C CA  1 
ATOM   8748  C  C   . THR C 1 190 ? 140.331 116.475 190.085 1.00 70.19  ? 191 THR C C   1 
ATOM   8749  O  O   . THR C 1 190 ? 139.209 116.931 189.967 1.00 70.26  ? 191 THR C O   1 
ATOM   8750  C  CB  . THR C 1 190 ? 141.934 116.894 188.258 1.00 68.77  ? 191 THR C CB  1 
ATOM   8751  O  OG1 . THR C 1 190 ? 141.142 117.963 187.745 1.00 68.74  ? 191 THR C OG1 1 
ATOM   8752  C  CG2 . THR C 1 190 ? 142.716 116.285 187.145 1.00 68.60  ? 191 THR C CG2 1 
ATOM   8753  N  N   . PRO C 1 191 ? 140.991 116.486 191.246 1.00 72.42  ? 192 PRO C N   1 
ATOM   8754  C  CA  . PRO C 1 191 ? 140.367 117.107 192.404 1.00 73.48  ? 192 PRO C CA  1 
ATOM   8755  C  C   . PRO C 1 191 ? 140.101 118.578 192.190 1.00 75.02  ? 192 PRO C C   1 
ATOM   8756  O  O   . PRO C 1 191 ? 140.919 119.268 191.618 1.00 75.19  ? 192 PRO C O   1 
ATOM   8757  C  CB  . PRO C 1 191 ? 141.406 116.908 193.500 1.00 73.11  ? 192 PRO C CB  1 
ATOM   8758  C  CG  . PRO C 1 191 ? 142.633 116.502 192.819 1.00 72.81  ? 192 PRO C CG  1 
ATOM   8759  C  CD  . PRO C 1 191 ? 142.226 115.791 191.612 1.00 72.56  ? 192 PRO C CD  1 
ATOM   8760  N  N   . THR C 1 192 ? 138.960 119.040 192.684 1.00 71.73  ? 193 THR C N   1 
ATOM   8761  C  CA  . THR C 1 192 ? 138.473 120.381 192.408 1.00 73.22  ? 193 THR C CA  1 
ATOM   8762  C  C   . THR C 1 192 ? 139.332 121.456 193.022 1.00 74.10  ? 193 THR C C   1 
ATOM   8763  O  O   . THR C 1 192 ? 139.542 122.507 192.437 1.00 74.23  ? 193 THR C O   1 
ATOM   8764  C  CB  . THR C 1 192 ? 137.064 120.553 192.960 1.00 73.63  ? 193 THR C CB  1 
ATOM   8765  O  OG1 . THR C 1 192 ? 136.231 119.510 192.462 1.00 73.63  ? 193 THR C OG1 1 
ATOM   8766  C  CG2 . THR C 1 192 ? 136.494 121.872 192.551 1.00 73.86  ? 193 THR C CG2 1 
ATOM   8767  N  N   . ASN C 1 193 ? 139.839 121.179 194.208 1.00 93.46  ? 194 ASN C N   1 
ATOM   8768  C  CA  . ASN C 1 193 ? 140.545 122.185 194.966 1.00 94.11  ? 194 ASN C CA  1 
ATOM   8769  C  C   . ASN C 1 193 ? 142.031 122.180 194.688 1.00 94.19  ? 194 ASN C C   1 
ATOM   8770  O  O   . ASN C 1 193 ? 142.786 122.914 195.310 1.00 94.23  ? 194 ASN C O   1 
ATOM   8771  C  CB  . ASN C 1 193 ? 140.249 122.049 196.459 1.00 94.50  ? 194 ASN C CB  1 
ATOM   8772  C  CG  . ASN C 1 193 ? 140.616 120.700 197.008 1.00 94.74  ? 194 ASN C CG  1 
ATOM   8773  O  OD1 . ASN C 1 193 ? 141.607 120.110 196.611 1.00 94.79  ? 194 ASN C OD1 1 
ATOM   8774  N  ND2 . ASN C 1 193 ? 139.817 120.203 197.931 1.00 94.91  ? 194 ASN C ND2 1 
ATOM   8775  N  N   . ALA C 1 194 ? 142.451 121.326 193.769 1.00 86.05  ? 195 ALA C N   1 
ATOM   8776  C  CA  . ALA C 1 194 ? 143.852 121.244 193.413 1.00 85.97  ? 195 ALA C CA  1 
ATOM   8777  C  C   . ALA C 1 194 ? 144.331 122.550 192.819 1.00 85.85  ? 195 ALA C C   1 
ATOM   8778  O  O   . ALA C 1 194 ? 143.672 123.118 191.966 1.00 85.81  ? 195 ALA C O   1 
ATOM   8779  C  CB  . ALA C 1 194 ? 144.060 120.129 192.434 1.00 85.96  ? 195 ALA C CB  1 
ATOM   8780  N  N   . ARG C 1 195 ? 145.487 123.018 193.271 1.00 80.81  ? 196 ARG C N   1 
ATOM   8781  C  CA  . ARG C 1 195 ? 146.084 124.232 192.745 1.00 80.69  ? 196 ARG C CA  1 
ATOM   8782  C  C   . ARG C 1 195 ? 146.555 123.979 191.335 1.00 80.80  ? 196 ARG C C   1 
ATOM   8783  O  O   . ARG C 1 195 ? 147.022 122.897 191.029 1.00 80.78  ? 196 ARG C O   1 
ATOM   8784  C  CB  . ARG C 1 195 ? 147.272 124.657 193.602 1.00 80.52  ? 196 ARG C CB  1 
ATOM   8785  C  CG  . ARG C 1 195 ? 146.932 125.101 194.996 1.00 80.39  ? 196 ARG C CG  1 
ATOM   8786  C  CD  . ARG C 1 195 ? 146.693 126.582 195.049 1.00 80.29  ? 196 ARG C CD  1 
ATOM   8787  N  NE  . ARG C 1 195 ? 147.816 127.319 194.499 1.00 80.22  ? 196 ARG C NE  1 
ATOM   8788  C  CZ  . ARG C 1 195 ? 147.754 128.582 194.112 1.00 80.17  ? 196 ARG C CZ  1 
ATOM   8789  N  NH1 . ARG C 1 195 ? 146.622 129.251 194.211 1.00 80.23  1 196 ARG C NH1 1 
ATOM   8790  N  NH2 . ARG C 1 195 ? 148.822 129.175 193.618 1.00 80.13  ? 196 ARG C NH2 1 
ATOM   8791  N  N   . PHE C 1 196 ? 146.456 124.984 190.480 1.00 78.04  ? 197 PHE C N   1 
ATOM   8792  C  CA  . PHE C 1 196 ? 146.865 124.822 189.098 1.00 78.15  ? 197 PHE C CA  1 
ATOM   8793  C  C   . PHE C 1 196 ? 148.354 124.552 188.982 1.00 78.56  ? 197 PHE C C   1 
ATOM   8794  O  O   . PHE C 1 196 ? 148.795 123.902 188.051 1.00 78.60  ? 197 PHE C O   1 
ATOM   8795  C  CB  . PHE C 1 196 ? 146.468 126.036 188.270 1.00 77.91  ? 197 PHE C CB  1 
ATOM   8796  C  CG  . PHE C 1 196 ? 147.347 127.213 188.471 1.00 77.65  ? 197 PHE C CG  1 
ATOM   8797  C  CD1 . PHE C 1 196 ? 148.288 127.548 187.534 1.00 77.54  ? 197 PHE C CD1 1 
ATOM   8798  C  CD2 . PHE C 1 196 ? 147.236 127.985 189.596 1.00 77.47  ? 197 PHE C CD2 1 
ATOM   8799  C  CE1 . PHE C 1 196 ? 149.093 128.628 187.714 1.00 77.45  ? 197 PHE C CE1 1 
ATOM   8800  C  CE2 . PHE C 1 196 ? 148.044 129.068 189.778 1.00 77.40  ? 197 PHE C CE2 1 
ATOM   8801  C  CZ  . PHE C 1 196 ? 148.974 129.388 188.837 1.00 77.41  ? 197 PHE C CZ  1 
ATOM   8802  N  N   . ASP C 1 197 ? 149.123 125.052 189.939 1.00 94.17  ? 198 ASP C N   1 
ATOM   8803  C  CA  . ASP C 1 197 ? 150.548 124.782 190.010 1.00 94.46  ? 198 ASP C CA  1 
ATOM   8804  C  C   . ASP C 1 197 ? 150.832 123.316 190.236 1.00 94.17  ? 198 ASP C C   1 
ATOM   8805  O  O   . ASP C 1 197 ? 151.834 122.791 189.778 1.00 94.19  ? 198 ASP C O   1 
ATOM   8806  C  CB  . ASP C 1 197 ? 151.154 125.511 191.198 1.00 94.79  ? 198 ASP C CB  1 
ATOM   8807  C  CG  . ASP C 1 197 ? 151.166 126.997 191.036 1.00 94.94  ? 198 ASP C CG  1 
ATOM   8808  O  OD1 . ASP C 1 197 ? 151.520 127.473 189.946 1.00 95.00  ? 198 ASP C OD1 1 
ATOM   8809  O  OD2 . ASP C 1 197 ? 150.839 127.695 192.014 1.00 94.99  1 198 ASP C OD2 1 
ATOM   8810  N  N   . SER C 1 198 ? 149.948 122.661 190.970 1.00 86.56  ? 199 SER C N   1 
ATOM   8811  C  CA  . SER C 1 198 ? 150.197 121.312 191.436 1.00 86.14  ? 199 SER C CA  1 
ATOM   8812  C  C   . SER C 1 198 ? 150.068 120.303 190.325 1.00 85.57  ? 199 SER C C   1 
ATOM   8813  O  O   . SER C 1 198 ? 149.399 120.551 189.344 1.00 85.55  ? 199 SER C O   1 
ATOM   8814  C  CB  . SER C 1 198 ? 149.248 120.959 192.572 1.00 86.21  ? 199 SER C CB  1 
ATOM   8815  O  OG  . SER C 1 198 ? 147.954 120.724 192.083 1.00 86.26  ? 199 SER C OG  1 
ATOM   8816  N  N   . PRO C 1 199 ? 150.742 119.166 190.463 1.00 76.24  ? 200 PRO C N   1 
ATOM   8817  C  CA  . PRO C 1 199 ? 150.615 118.068 189.512 1.00 75.84  ? 200 PRO C CA  1 
ATOM   8818  C  C   . PRO C 1 199 ? 149.208 117.526 189.374 1.00 75.38  ? 200 PRO C C   1 
ATOM   8819  O  O   . PRO C 1 199 ? 148.894 116.982 188.336 1.00 75.36  ? 200 PRO C O   1 
ATOM   8820  C  CB  . PRO C 1 199 ? 151.559 117.009 190.066 1.00 75.89  ? 200 PRO C CB  1 
ATOM   8821  C  CG  . PRO C 1 199 ? 151.839 117.415 191.441 1.00 75.98  ? 200 PRO C CG  1 
ATOM   8822  C  CD  . PRO C 1 199 ? 151.768 118.882 191.470 1.00 76.10  ? 200 PRO C CD  1 
ATOM   8823  N  N   . GLU C 1 200 ? 148.395 117.615 190.412 1.00 93.50  ? 201 GLU C N   1 
ATOM   8824  C  CA  . GLU C 1 200 ? 147.065 117.012 190.385 1.00 93.01  ? 201 GLU C CA  1 
ATOM   8825  C  C   . GLU C 1 200 ? 145.990 117.821 189.674 1.00 92.02  ? 201 GLU C C   1 
ATOM   8826  O  O   . GLU C 1 200 ? 144.874 117.354 189.527 1.00 91.92  ? 201 GLU C O   1 
ATOM   8827  C  CB  . GLU C 1 200 ? 146.592 116.657 191.791 1.00 93.34  ? 201 GLU C CB  1 
ATOM   8828  C  CG  . GLU C 1 200 ? 147.424 115.609 192.468 1.00 93.58  ? 201 GLU C CG  1 
ATOM   8829  C  CD  . GLU C 1 200 ? 148.685 116.170 193.054 1.00 93.69  ? 201 GLU C CD  1 
ATOM   8830  O  OE1 . GLU C 1 200 ? 148.690 117.367 193.379 1.00 93.75  ? 201 GLU C OE1 1 
ATOM   8831  O  OE2 . GLU C 1 200 ? 149.673 115.418 193.182 1.00 93.76  1 201 GLU C OE2 1 
ATOM   8832  N  N   . SER C 1 201 ? 146.315 119.037 189.255 1.00 76.30  ? 202 SER C N   1 
ATOM   8833  C  CA  . SER C 1 201 ? 145.352 119.904 188.582 1.00 75.35  ? 202 SER C CA  1 
ATOM   8834  C  C   . SER C 1 201 ? 145.071 119.428 187.176 1.00 74.33  ? 202 SER C C   1 
ATOM   8835  O  O   . SER C 1 201 ? 145.858 118.693 186.607 1.00 74.24  ? 202 SER C O   1 
ATOM   8836  C  CB  . SER C 1 201 ? 145.840 121.338 188.549 1.00 75.40  ? 202 SER C CB  1 
ATOM   8837  O  OG  . SER C 1 201 ? 146.869 121.489 187.605 1.00 75.44  ? 202 SER C OG  1 
ATOM   8838  N  N   . HIS C 1 202 ? 143.936 119.829 186.623 1.00 72.98  ? 203 HIS C N   1 
ATOM   8839  C  CA  . HIS C 1 202 ? 143.547 119.345 185.310 1.00 72.10  ? 203 HIS C CA  1 
ATOM   8840  C  C   . HIS C 1 202 ? 144.535 119.719 184.227 1.00 71.64  ? 203 HIS C C   1 
ATOM   8841  O  O   . HIS C 1 202 ? 144.788 118.945 183.315 1.00 71.57  ? 203 HIS C O   1 
ATOM   8842  C  CB  . HIS C 1 202 ? 142.129 119.794 184.948 1.00 71.82  ? 203 HIS C CB  1 
ATOM   8843  C  CG  . HIS C 1 202 ? 141.971 121.268 184.788 1.00 71.59  ? 203 HIS C CG  1 
ATOM   8844  N  ND1 . HIS C 1 202 ? 142.440 122.171 185.711 1.00 71.47  ? 203 HIS C ND1 1 
ATOM   8845  C  CD2 . HIS C 1 202 ? 141.364 121.993 183.824 1.00 71.45  ? 203 HIS C CD2 1 
ATOM   8846  C  CE1 . HIS C 1 202 ? 142.142 123.392 185.314 1.00 71.40  ? 203 HIS C CE1 1 
ATOM   8847  N  NE2 . HIS C 1 202 ? 141.490 123.312 184.170 1.00 71.39  ? 203 HIS C NE2 1 
ATOM   8848  N  N   . VAL C 1 203 ? 145.127 120.889 184.353 1.00 67.31  ? 204 VAL C N   1 
ATOM   8849  C  CA  . VAL C 1 203 ? 146.151 121.292 183.423 1.00 66.93  ? 204 VAL C CA  1 
ATOM   8850  C  C   . VAL C 1 203 ? 147.382 120.422 183.583 1.00 66.65  ? 204 VAL C C   1 
ATOM   8851  O  O   . VAL C 1 203 ? 147.970 119.949 182.611 1.00 66.66  ? 204 VAL C O   1 
ATOM   8852  C  CB  . VAL C 1 203 ? 146.524 122.736 183.664 1.00 66.87  ? 204 VAL C CB  1 
ATOM   8853  C  CG1 . VAL C 1 203 ? 147.721 123.101 182.849 1.00 66.87  ? 204 VAL C CG1 1 
ATOM   8854  C  CG2 . VAL C 1 203 ? 145.378 123.611 183.308 1.00 66.85  ? 204 VAL C CG2 1 
ATOM   8855  N  N   . GLY C 1 204 ? 147.755 120.174 184.823 1.00 69.14  ? 205 GLY C N   1 
ATOM   8856  C  CA  . GLY C 1 204 ? 148.955 119.422 185.066 1.00 68.95  ? 205 GLY C CA  1 
ATOM   8857  C  C   . GLY C 1 204 ? 148.789 118.004 184.611 1.00 68.85  ? 205 GLY C C   1 
ATOM   8858  O  O   . GLY C 1 204 ? 149.663 117.438 183.979 1.00 68.87  ? 205 GLY C O   1 
ATOM   8859  N  N   . VAL C 1 205 ? 147.637 117.435 184.910 1.00 73.15  ? 206 VAL C N   1 
ATOM   8860  C  CA  . VAL C 1 205 ? 147.372 116.070 184.516 1.00 73.17  ? 206 VAL C CA  1 
ATOM   8861  C  C   . VAL C 1 205 ? 147.320 115.968 183.012 1.00 73.38  ? 206 VAL C C   1 
ATOM   8862  O  O   . VAL C 1 205 ? 147.763 114.986 182.437 1.00 73.38  ? 206 VAL C O   1 
ATOM   8863  C  CB  . VAL C 1 205 ? 146.072 115.552 185.141 1.00 73.03  ? 206 VAL C CB  1 
ATOM   8864  C  CG1 . VAL C 1 205 ? 145.725 114.194 184.605 1.00 72.95  ? 206 VAL C CG1 1 
ATOM   8865  C  CG2 . VAL C 1 205 ? 146.221 115.479 186.624 1.00 73.07  ? 206 VAL C CG2 1 
ATOM   8866  N  N   . ALA C 1 206 ? 146.824 117.012 182.369 1.00 57.07  ? 207 ALA C N   1 
ATOM   8867  C  CA  . ALA C 1 206 ? 146.769 117.001 180.926 1.00 57.57  ? 207 ALA C CA  1 
ATOM   8868  C  C   . ALA C 1 206 ? 148.161 116.930 180.346 1.00 58.92  ? 207 ALA C C   1 
ATOM   8869  O  O   . ALA C 1 206 ? 148.434 116.137 179.455 1.00 58.99  ? 207 ALA C O   1 
ATOM   8870  C  CB  . ALA C 1 206 ? 146.068 118.223 180.429 1.00 57.17  ? 207 ALA C CB  1 
ATOM   8871  N  N   . TRP C 1 207 ? 149.055 117.751 180.872 1.00 79.93  ? 208 TRP C N   1 
ATOM   8872  C  CA  . TRP C 1 207 ? 150.412 117.750 180.363 1.00 81.51  ? 208 TRP C CA  1 
ATOM   8873  C  C   . TRP C 1 207 ? 151.136 116.452 180.645 1.00 82.09  ? 208 TRP C C   1 
ATOM   8874  O  O   . TRP C 1 207 ? 151.873 115.938 179.805 1.00 82.17  ? 208 TRP C O   1 
ATOM   8875  C  CB  . TRP C 1 207 ? 151.182 118.923 180.939 1.00 82.38  ? 208 TRP C CB  1 
ATOM   8876  C  CG  . TRP C 1 207 ? 150.892 120.174 180.227 1.00 83.22  ? 208 TRP C CG  1 
ATOM   8877  C  CD1 . TRP C 1 207 ? 150.008 121.137 180.584 1.00 83.54  ? 208 TRP C CD1 1 
ATOM   8878  C  CD2 . TRP C 1 207 ? 151.476 120.596 179.004 1.00 83.86  ? 208 TRP C CD2 1 
ATOM   8879  N  NE1 . TRP C 1 207 ? 150.010 122.145 179.662 1.00 83.85  ? 208 TRP C NE1 1 
ATOM   8880  C  CE2 . TRP C 1 207 ? 150.908 121.834 178.679 1.00 84.06  ? 208 TRP C CE2 1 
ATOM   8881  C  CE3 . TRP C 1 207 ? 152.431 120.049 178.153 1.00 84.18  ? 208 TRP C CE3 1 
ATOM   8882  C  CZ2 . TRP C 1 207 ? 151.263 122.533 177.542 1.00 84.39  ? 208 TRP C CZ2 1 
ATOM   8883  C  CZ3 . TRP C 1 207 ? 152.780 120.740 177.029 1.00 84.41  ? 208 TRP C CZ3 1 
ATOM   8884  C  CH2 . TRP C 1 207 ? 152.200 121.969 176.729 1.00 84.51  ? 208 TRP C CH2 1 
ATOM   8885  N  N   . ARG C 1 208 ? 150.894 115.900 181.820 1.00 84.14  ? 209 ARG C N   1 
ATOM   8886  C  CA  . ARG C 1 208 ? 151.537 114.659 182.187 1.00 84.69  ? 209 ARG C CA  1 
ATOM   8887  C  C   . ARG C 1 208 ? 151.054 113.518 181.324 1.00 84.59  ? 209 ARG C C   1 
ATOM   8888  O  O   . ARG C 1 208 ? 151.794 112.587 181.053 1.00 84.60  ? 209 ARG C O   1 
ATOM   8889  C  CB  . ARG C 1 208 ? 151.325 114.354 183.665 1.00 85.24  ? 209 ARG C CB  1 
ATOM   8890  C  CG  . ARG C 1 208 ? 152.147 115.226 184.580 1.00 85.66  ? 209 ARG C CG  1 
ATOM   8891  C  CD  . ARG C 1 208 ? 152.078 114.742 186.002 1.00 86.02  ? 209 ARG C CD  1 
ATOM   8892  N  NE  . ARG C 1 208 ? 150.761 114.955 186.590 1.00 86.25  ? 209 ARG C NE  1 
ATOM   8893  C  CZ  . ARG C 1 208 ? 150.332 114.371 187.703 1.00 86.47  ? 209 ARG C CZ  1 
ATOM   8894  N  NH1 . ARG C 1 208 ? 151.110 113.522 188.347 1.00 86.60  1 209 ARG C NH1 1 
ATOM   8895  N  NH2 . ARG C 1 208 ? 149.122 114.629 188.165 1.00 86.41  ? 209 ARG C NH2 1 
ATOM   8896  N  N   . LEU C 1 209 ? 149.809 113.596 180.883 1.00 72.59  ? 210 LEU C N   1 
ATOM   8897  C  CA  . LEU C 1 209 ? 149.292 112.602 179.968 1.00 72.51  ? 210 LEU C CA  1 
ATOM   8898  C  C   . LEU C 1 209 ? 149.916 112.786 178.608 1.00 73.27  ? 210 LEU C C   1 
ATOM   8899  O  O   . LEU C 1 209 ? 150.273 111.826 177.949 1.00 73.29  ? 210 LEU C O   1 
ATOM   8900  C  CB  . LEU C 1 209 ? 147.777 112.720 179.853 1.00 71.89  ? 210 LEU C CB  1 
ATOM   8901  C  CG  . LEU C 1 209 ? 146.920 112.273 181.029 1.00 71.39  ? 210 LEU C CG  1 
ATOM   8902  C  CD1 . LEU C 1 209 ? 145.482 112.616 180.775 1.00 71.20  ? 210 LEU C CD1 1 
ATOM   8903  C  CD2 . LEU C 1 209 ? 147.072 110.800 181.240 1.00 71.25  ? 210 LEU C CD2 1 
ATOM   8904  N  N   . LYS C 1 210 ? 150.056 114.033 178.190 1.00 79.65  ? 211 LYS C N   1 
ATOM   8905  C  CA  . LYS C 1 210 ? 150.575 114.307 176.863 1.00 80.44  ? 211 LYS C CA  1 
ATOM   8906  C  C   . LYS C 1 210 ? 151.987 113.801 176.735 1.00 80.65  ? 211 LYS C C   1 
ATOM   8907  O  O   . LYS C 1 210 ? 152.385 113.319 175.688 1.00 80.67  ? 211 LYS C O   1 
ATOM   8908  C  CB  . LYS C 1 210 ? 150.524 115.804 176.572 1.00 80.88  ? 211 LYS C CB  1 
ATOM   8909  C  CG  . LYS C 1 210 ? 151.045 116.219 175.212 1.00 81.29  ? 211 LYS C CG  1 
ATOM   8910  C  CD  . LYS C 1 210 ? 152.495 116.630 175.274 1.00 81.57  ? 211 LYS C CD  1 
ATOM   8911  C  CE  . LYS C 1 210 ? 153.066 116.927 173.911 1.00 81.81  ? 211 LYS C CE  1 
ATOM   8912  N  NZ  . LYS C 1 210 ? 152.659 118.263 173.433 1.00 81.91  1 211 LYS C NZ  1 
ATOM   8913  N  N   . ASN C 1 211 ? 152.744 113.896 177.814 1.00 86.46  ? 212 ASN C N   1 
ATOM   8914  C  CA  . ASN C 1 211 ? 154.123 113.443 177.767 1.00 86.57  ? 212 ASN C CA  1 
ATOM   8915  C  C   . ASN C 1 211 ? 154.283 111.942 177.592 1.00 86.18  ? 212 ASN C C   1 
ATOM   8916  O  O   . ASN C 1 211 ? 155.278 111.484 177.051 1.00 86.19  ? 212 ASN C O   1 
ATOM   8917  C  CB  . ASN C 1 211 ? 154.896 113.929 178.985 1.00 86.88  ? 212 ASN C CB  1 
ATOM   8918  C  CG  . ASN C 1 211 ? 155.148 115.409 178.949 1.00 87.08  ? 212 ASN C CG  1 
ATOM   8919  O  OD1 . ASN C 1 211 ? 155.119 116.027 177.892 1.00 87.12  ? 212 ASN C OD1 1 
ATOM   8920  N  ND2 . ASN C 1 211 ? 155.400 115.988 180.106 1.00 87.21  ? 212 ASN C ND2 1 
ATOM   8921  N  N   . GLU C 1 212 ? 153.305 111.180 178.058 1.00 94.43  ? 213 GLU C N   1 
ATOM   8922  C  CA  . GLU C 1 212 ? 153.368 109.728 177.968 1.00 93.88  ? 213 GLU C CA  1 
ATOM   8923  C  C   . GLU C 1 212 ? 152.721 109.144 176.721 1.00 92.56  ? 213 GLU C C   1 
ATOM   8924  O  O   . GLU C 1 212 ? 152.898 107.974 176.422 1.00 92.49  ? 213 GLU C O   1 
ATOM   8925  C  CB  . GLU C 1 212 ? 152.755 109.088 179.212 1.00 94.42  ? 213 GLU C CB  1 
ATOM   8926  C  CG  . GLU C 1 212 ? 153.414 109.489 180.511 1.00 94.76  ? 213 GLU C CG  1 
ATOM   8927  C  CD  . GLU C 1 212 ? 154.814 108.975 180.628 1.00 94.91  ? 213 GLU C CD  1 
ATOM   8928  O  OE1 . GLU C 1 212 ? 155.036 107.785 180.343 1.00 94.99  ? 213 GLU C OE1 1 
ATOM   8929  O  OE2 . GLU C 1 212 ? 155.699 109.763 180.996 1.00 94.97  1 213 GLU C OE2 1 
ATOM   8930  N  N   . ILE C 1 213 ? 151.968 109.954 175.997 1.00 75.69  ? 214 ILE C N   1 
ATOM   8931  C  CA  . ILE C 1 213 ? 151.248 109.460 174.836 1.00 74.41  ? 214 ILE C CA  1 
ATOM   8932  C  C   . ILE C 1 213 ? 151.779 109.999 173.523 1.00 74.16  ? 214 ILE C C   1 
ATOM   8933  O  O   . ILE C 1 213 ? 151.786 111.196 173.293 1.00 74.14  ? 214 ILE C O   1 
ATOM   8934  C  CB  . ILE C 1 213 ? 149.762 109.759 174.927 1.00 73.60  ? 214 ILE C CB  1 
ATOM   8935  C  CG1 . ILE C 1 213 ? 149.192 109.178 176.208 1.00 73.17  ? 214 ILE C CG1 1 
ATOM   8936  C  CG2 . ILE C 1 213 ? 149.044 109.158 173.763 1.00 73.41  ? 214 ILE C CG2 1 
ATOM   8937  C  CD1 . ILE C 1 213 ? 147.764 109.553 176.453 1.00 72.94  ? 214 ILE C CD1 1 
ATOM   8938  N  N   . PRO C 1 214 ? 152.240 109.101 172.659 1.00 66.54  ? 215 PRO C N   1 
ATOM   8939  C  CA  . PRO C 1 214 ? 152.680 109.420 171.308 1.00 66.68  ? 215 PRO C CA  1 
ATOM   8940  C  C   . PRO C 1 214 ? 151.542 109.967 170.468 1.00 67.22  ? 215 PRO C C   1 
ATOM   8941  O  O   . PRO C 1 214 ? 150.406 109.564 170.649 1.00 67.24  ? 215 PRO C O   1 
ATOM   8942  C  CB  . PRO C 1 214 ? 153.105 108.064 170.762 1.00 66.41  ? 215 PRO C CB  1 
ATOM   8943  C  CG  . PRO C 1 214 ? 153.385 107.250 171.941 1.00 66.29  ? 215 PRO C CG  1 
ATOM   8944  C  CD  . PRO C 1 214 ? 152.425 107.682 172.971 1.00 66.32  ? 215 PRO C CD  1 
ATOM   8945  N  N   . ASN C 1 215 ? 151.861 110.877 169.556 1.00 79.00  ? 216 ASN C N   1 
ATOM   8946  C  CA  . ASN C 1 215 ? 150.882 111.498 168.676 1.00 79.51  ? 216 ASN C CA  1 
ATOM   8947  C  C   . ASN C 1 215 ? 149.760 112.178 169.429 1.00 79.61  ? 216 ASN C C   1 
ATOM   8948  O  O   . ASN C 1 215 ? 148.622 112.163 168.997 1.00 79.64  ? 216 ASN C O   1 
ATOM   8949  C  CB  . ASN C 1 215 ? 150.297 110.484 167.701 1.00 79.80  ? 216 ASN C CB  1 
ATOM   8950  C  CG  . ASN C 1 215 ? 151.229 110.159 166.574 1.00 80.02  ? 216 ASN C CG  1 
ATOM   8951  O  OD1 . ASN C 1 215 ? 152.128 110.926 166.265 1.00 80.08  ? 216 ASN C OD1 1 
ATOM   8952  N  ND2 . ASN C 1 215 ? 151.016 109.020 165.942 1.00 80.17  ? 216 ASN C ND2 1 
ATOM   8953  N  N   . SER C 1 216 ? 150.087 112.779 170.560 1.00 75.51  ? 217 SER C N   1 
ATOM   8954  C  CA  . SER C 1 216 ? 149.091 113.479 171.344 1.00 75.53  ? 217 SER C CA  1 
ATOM   8955  C  C   . SER C 1 216 ? 149.379 114.959 171.375 1.00 75.43  ? 217 SER C C   1 
ATOM   8956  O  O   . SER C 1 216 ? 150.525 115.370 171.385 1.00 75.43  ? 217 SER C O   1 
ATOM   8957  C  CB  . SER C 1 216 ? 149.046 112.930 172.759 1.00 75.58  ? 217 SER C CB  1 
ATOM   8958  O  OG  . SER C 1 216 ? 150.263 113.170 173.426 1.00 75.61  ? 217 SER C OG  1 
ATOM   8959  N  N   . HIS C 1 217 ? 148.324 115.757 171.393 1.00 73.30  ? 218 HIS C N   1 
ATOM   8960  C  CA  . HIS C 1 217 ? 148.467 117.198 171.415 1.00 73.20  ? 218 HIS C CA  1 
ATOM   8961  C  C   . HIS C 1 217 ? 147.555 117.804 172.451 1.00 73.39  ? 218 HIS C C   1 
ATOM   8962  O  O   . HIS C 1 217 ? 146.458 117.339 172.654 1.00 73.38  ? 218 HIS C O   1 
ATOM   8963  C  CB  . HIS C 1 217 ? 148.097 117.792 170.062 1.00 72.99  ? 218 HIS C CB  1 
ATOM   8964  C  CG  . HIS C 1 217 ? 148.770 117.134 168.907 1.00 72.81  ? 218 HIS C CG  1 
ATOM   8965  N  ND1 . HIS C 1 217 ? 150.047 117.452 168.513 1.00 72.73  ? 218 HIS C ND1 1 
ATOM   8966  C  CD2 . HIS C 1 217 ? 148.341 116.175 168.059 1.00 72.72  ? 218 HIS C CD2 1 
ATOM   8967  C  CE1 . HIS C 1 217 ? 150.379 116.711 167.474 1.00 72.68  ? 218 HIS C CE1 1 
ATOM   8968  N  NE2 . HIS C 1 217 ? 149.361 115.929 167.178 1.00 72.68  ? 218 HIS C NE2 1 
ATOM   8969  N  N   . ILE C 1 218 ? 148.020 118.849 173.111 1.00 76.34  ? 219 ILE C N   1 
ATOM   8970  C  CA  . ILE C 1 218 ? 147.154 119.673 173.923 1.00 76.59  ? 219 ILE C CA  1 
ATOM   8971  C  C   . ILE C 1 218 ? 146.965 120.961 173.172 1.00 77.46  ? 219 ILE C C   1 
ATOM   8972  O  O   . ILE C 1 218 ? 147.886 121.747 173.043 1.00 77.50  ? 219 ILE C O   1 
ATOM   8973  C  CB  . ILE C 1 218 ? 147.775 119.998 175.268 1.00 76.11  ? 219 ILE C CB  1 
ATOM   8974  C  CG1 . ILE C 1 218 ? 147.994 118.726 176.068 1.00 75.84  ? 219 ILE C CG1 1 
ATOM   8975  C  CG2 . ILE C 1 218 ? 146.884 120.925 176.040 1.00 76.00  ? 219 ILE C CG2 1 
ATOM   8976  C  CD1 . ILE C 1 218 ? 148.766 118.951 177.309 1.00 75.70  ? 219 ILE C CD1 1 
ATOM   8977  N  N   . LEU C 1 219 ? 145.772 121.163 172.646 1.00 89.11  ? 220 LEU C N   1 
ATOM   8978  C  CA  . LEU C 1 219 ? 145.467 122.374 171.919 1.00 89.89  ? 220 LEU C CA  1 
ATOM   8979  C  C   . LEU C 1 219 ? 145.526 123.567 172.853 1.00 89.81  ? 220 LEU C C   1 
ATOM   8980  O  O   . LEU C 1 219 ? 145.856 124.669 172.442 1.00 89.83  ? 220 LEU C O   1 
ATOM   8981  C  CB  . LEU C 1 219 ? 144.093 122.251 171.279 1.00 90.49  ? 220 LEU C CB  1 
ATOM   8982  C  CG  . LEU C 1 219 ? 143.928 121.098 170.299 1.00 91.05  ? 220 LEU C CG  1 
ATOM   8983  C  CD1 . LEU C 1 219 ? 142.514 121.024 169.817 1.00 91.27  ? 220 LEU C CD1 1 
ATOM   8984  C  CD2 . LEU C 1 219 ? 144.857 121.298 169.144 1.00 91.22  ? 220 LEU C CD2 1 
ATOM   8985  N  N   . ASP C 1 220 ? 145.216 123.322 174.117 1.00 84.93  ? 221 ASP C N   1 
ATOM   8986  C  CA  . ASP C 1 220 ? 145.334 124.307 175.187 1.00 84.75  ? 221 ASP C CA  1 
ATOM   8987  C  C   . ASP C 1 220 ? 144.519 125.570 174.993 1.00 84.30  ? 221 ASP C C   1 
ATOM   8988  O  O   . ASP C 1 220 ? 145.009 126.562 174.481 1.00 84.27  ? 221 ASP C O   1 
ATOM   8989  C  CB  . ASP C 1 220 ? 146.795 124.667 175.428 1.00 84.92  ? 221 ASP C CB  1 
ATOM   8990  C  CG  . ASP C 1 220 ? 147.053 125.109 176.845 1.00 85.01  ? 221 ASP C CG  1 
ATOM   8991  O  OD1 . ASP C 1 220 ? 148.177 124.910 177.333 1.00 85.06  ? 221 ASP C OD1 1 
ATOM   8992  O  OD2 . ASP C 1 220 ? 146.127 125.639 177.479 1.00 85.01  1 221 ASP C OD2 1 
ATOM   8993  N  N   . GLN C 1 221 ? 143.279 125.535 175.453 1.00 76.90  ? 222 GLN C N   1 
ATOM   8994  C  CA  . GLN C 1 221 ? 142.381 126.664 175.317 1.00 76.45  ? 222 GLN C CA  1 
ATOM   8995  C  C   . GLN C 1 221 ? 142.851 127.881 176.085 1.00 76.37  ? 222 GLN C C   1 
ATOM   8996  O  O   . GLN C 1 221 ? 142.451 128.993 175.788 1.00 76.34  ? 222 GLN C O   1 
ATOM   8997  C  CB  . GLN C 1 221 ? 140.971 126.280 175.759 1.00 76.16  ? 222 GLN C CB  1 
ATOM   8998  C  CG  . GLN C 1 221 ? 140.870 125.760 177.157 1.00 75.92  ? 222 GLN C CG  1 
ATOM   8999  C  CD  . GLN C 1 221 ? 139.460 125.426 177.553 1.00 75.71  ? 222 GLN C CD  1 
ATOM   9000  O  OE1 . GLN C 1 221 ? 138.513 125.986 177.036 1.00 75.57  ? 222 GLN C OE1 1 
ATOM   9001  N  NE2 . GLN C 1 221 ? 139.315 124.498 178.470 1.00 75.59  ? 222 GLN C NE2 1 
ATOM   9002  N  N   . TYR C 1 222 ? 143.677 127.663 177.094 1.00 74.58  ? 223 TYR C N   1 
ATOM   9003  C  CA  . TYR C 1 222 ? 144.163 128.750 177.923 1.00 74.56  ? 223 TYR C CA  1 
ATOM   9004  C  C   . TYR C 1 222 ? 145.242 129.575 177.245 1.00 75.42  ? 223 TYR C C   1 
ATOM   9005  O  O   . TYR C 1 222 ? 145.507 130.699 177.636 1.00 75.39  ? 223 TYR C O   1 
ATOM   9006  C  CB  . TYR C 1 222 ? 144.656 128.204 179.258 1.00 73.92  ? 223 TYR C CB  1 
ATOM   9007  C  CG  . TYR C 1 222 ? 143.616 127.395 179.977 1.00 73.29  ? 223 TYR C CG  1 
ATOM   9008  C  CD1 . TYR C 1 222 ? 142.564 128.006 180.621 1.00 72.96  ? 223 TYR C CD1 1 
ATOM   9009  C  CD2 . TYR C 1 222 ? 143.677 126.021 179.997 1.00 72.94  ? 223 TYR C CD2 1 
ATOM   9010  C  CE1 . TYR C 1 222 ? 141.610 127.273 181.264 1.00 72.70  ? 223 TYR C CE1 1 
ATOM   9011  C  CE2 . TYR C 1 222 ? 142.725 125.283 180.639 1.00 72.73  ? 223 TYR C CE2 1 
ATOM   9012  C  CZ  . TYR C 1 222 ? 141.693 125.913 181.272 1.00 72.64  ? 223 TYR C CZ  1 
ATOM   9013  O  OH  . TYR C 1 222 ? 140.734 125.180 181.920 1.00 72.57  ? 223 TYR C OH  1 
ATOM   9014  N  N   . ARG C 1 223 ? 145.848 129.019 176.208 1.00 98.01  ? 224 ARG C N   1 
ATOM   9015  C  CA  . ARG C 1 223 ? 146.968 129.674 175.555 1.00 98.81  ? 224 ARG C CA  1 
ATOM   9016  C  C   . ARG C 1 223 ? 146.728 129.900 174.074 1.00 97.90  ? 224 ARG C C   1 
ATOM   9017  O  O   . ARG C 1 223 ? 147.260 130.837 173.498 1.00 97.85  ? 224 ARG C O   1 
ATOM   9018  C  CB  . ARG C 1 223 ? 148.235 128.846 175.722 1.00 100.31 ? 224 ARG C CB  1 
ATOM   9019  C  CG  . ARG C 1 223 ? 148.598 128.539 177.141 1.00 101.54 ? 224 ARG C CG  1 
ATOM   9020  C  CD  . ARG C 1 223 ? 149.710 127.519 177.208 1.00 102.60 ? 224 ARG C CD  1 
ATOM   9021  N  NE  . ARG C 1 223 ? 150.874 127.945 176.450 1.00 103.37 ? 224 ARG C NE  1 
ATOM   9022  C  CZ  . ARG C 1 223 ? 151.294 127.367 175.333 1.00 104.19 ? 224 ARG C CZ  1 
ATOM   9023  N  NH1 . ARG C 1 223 ? 152.367 127.838 174.718 1.00 104.45 1 224 ARG C NH1 1 
ATOM   9024  N  NH2 . ARG C 1 223 ? 150.651 126.321 174.837 1.00 104.38 ? 224 ARG C NH2 1 
ATOM   9025  N  N   . ASN C 1 224 ? 145.956 129.018 173.452 1.00 83.85  ? 225 ASN C N   1 
ATOM   9026  C  CA  . ASN C 1 224 ? 145.745 129.074 172.011 1.00 82.90  ? 225 ASN C CA  1 
ATOM   9027  C  C   . ASN C 1 224 ? 144.990 130.308 171.557 1.00 81.97  ? 225 ASN C C   1 
ATOM   9028  O  O   . ASN C 1 224 ? 143.955 130.646 172.098 1.00 81.78  ? 225 ASN C O   1 
ATOM   9029  C  CB  . ASN C 1 224 ? 145.015 127.821 171.548 1.00 82.89  ? 225 ASN C CB  1 
ATOM   9030  C  CG  . ASN C 1 224 ? 145.154 127.581 170.077 1.00 82.88  ? 225 ASN C CG  1 
ATOM   9031  O  OD1 . ASN C 1 224 ? 145.255 128.511 169.292 1.00 82.88  ? 225 ASN C OD1 1 
ATOM   9032  N  ND2 . ASN C 1 224 ? 145.157 126.324 169.689 1.00 82.86  ? 225 ASN C ND2 1 
ATOM   9033  N  N   . ALA C 1 225 ? 145.496 130.952 170.520 1.00 65.78  ? 226 ALA C N   1 
ATOM   9034  C  CA  . ALA C 1 225 ? 144.909 132.184 170.034 1.00 64.99  ? 226 ALA C CA  1 
ATOM   9035  C  C   . ALA C 1 225 ? 143.612 131.944 169.320 1.00 64.63  ? 226 ALA C C   1 
ATOM   9036  O  O   . ALA C 1 225 ? 142.794 132.836 169.183 1.00 64.49  ? 226 ALA C O   1 
ATOM   9037  C  CB  . ALA C 1 225 ? 145.867 132.886 169.132 1.00 64.83  ? 226 ALA C CB  1 
ATOM   9038  N  N   . SER C 1 226 ? 143.430 130.716 168.870 1.00 74.75  ? 227 SER C N   1 
ATOM   9039  C  CA  . SER C 1 226 ? 142.269 130.356 168.094 1.00 74.50  ? 227 SER C CA  1 
ATOM   9040  C  C   . SER C 1 226 ? 141.030 130.551 168.936 1.00 74.25  ? 227 SER C C   1 
ATOM   9041  O  O   . SER C 1 226 ? 139.950 130.811 168.427 1.00 74.20  ? 227 SER C O   1 
ATOM   9042  C  CB  . SER C 1 226 ? 142.392 128.913 167.628 1.00 74.49  ? 227 SER C CB  1 
ATOM   9043  O  OG  . SER C 1 226 ? 143.559 128.742 166.854 1.00 74.52  ? 227 SER C OG  1 
ATOM   9044  N  N   . ASN C 1 227 ? 141.207 130.457 170.241 1.00 74.21  ? 228 ASN C N   1 
ATOM   9045  C  CA  . ASN C 1 227 ? 140.113 130.643 171.173 1.00 73.96  ? 228 ASN C CA  1 
ATOM   9046  C  C   . ASN C 1 227 ? 139.552 132.066 171.139 1.00 73.61  ? 228 ASN C C   1 
ATOM   9047  O  O   . ASN C 1 227 ? 138.439 132.252 170.686 1.00 73.55  ? 228 ASN C O   1 
ATOM   9048  C  CB  . ASN C 1 227 ? 140.533 130.148 172.569 1.00 74.02  ? 228 ASN C CB  1 
ATOM   9049  C  CG  . ASN C 1 227 ? 139.569 130.523 173.664 1.00 74.05  ? 228 ASN C CG  1 
ATOM   9050  O  OD1 . ASN C 1 227 ? 138.457 130.959 173.426 1.00 73.98  ? 228 ASN C OD1 1 
ATOM   9051  N  ND2 . ASN C 1 227 ? 140.002 130.329 174.890 1.00 74.08  ? 228 ASN C ND2 1 
ATOM   9052  N  N   . PRO C 1 228 ? 140.294 133.070 171.615 1.00 71.45  ? 229 PRO C N   1 
ATOM   9053  C  CA  . PRO C 1 228 ? 139.720 134.401 171.461 1.00 71.13  ? 229 PRO C CA  1 
ATOM   9054  C  C   . PRO C 1 228 ? 139.467 134.818 170.023 1.00 70.73  ? 229 PRO C C   1 
ATOM   9055  O  O   . PRO C 1 228 ? 138.531 135.555 169.764 1.00 70.70  ? 229 PRO C O   1 
ATOM   9056  C  CB  . PRO C 1 228 ? 140.751 135.301 172.119 1.00 71.21  ? 229 PRO C CB  1 
ATOM   9057  C  CG  . PRO C 1 228 ? 141.979 134.581 172.020 1.00 71.32  ? 229 PRO C CG  1 
ATOM   9058  C  CD  . PRO C 1 228 ? 141.658 133.153 172.153 1.00 71.41  ? 229 PRO C CD  1 
ATOM   9059  N  N   . LEU C 1 229 ? 140.301 134.358 169.099 1.00 75.61  ? 230 LEU C N   1 
ATOM   9060  C  CA  . LEU C 1 229 ? 140.161 134.750 167.704 1.00 75.21  ? 230 LEU C CA  1 
ATOM   9061  C  C   . LEU C 1 229 ? 138.876 134.260 167.086 1.00 74.73  ? 230 LEU C C   1 
ATOM   9062  O  O   . LEU C 1 229 ? 138.358 134.874 166.167 1.00 74.71  ? 230 LEU C O   1 
ATOM   9063  C  CB  . LEU C 1 229 ? 141.333 134.255 166.870 1.00 75.28  ? 230 LEU C CB  1 
ATOM   9064  C  CG  . LEU C 1 229 ? 142.585 135.117 166.873 1.00 75.34  ? 230 LEU C CG  1 
ATOM   9065  C  CD1 . LEU C 1 229 ? 143.682 134.435 166.117 1.00 75.35  ? 230 LEU C CD1 1 
ATOM   9066  C  CD2 . LEU C 1 229 ? 142.283 136.444 166.256 1.00 75.34  ? 230 LEU C CD2 1 
ATOM   9067  N  N   . ALA C 1 230 ? 138.367 133.142 167.572 1.00 68.90  ? 231 ALA C N   1 
ATOM   9068  C  CA  . ALA C 1 230 ? 137.104 132.655 167.071 1.00 68.46  ? 231 ALA C CA  1 
ATOM   9069  C  C   . ALA C 1 230 ? 136.007 133.647 167.383 1.00 68.10  ? 231 ALA C C   1 
ATOM   9070  O  O   . ALA C 1 230 ? 135.145 133.916 166.562 1.00 68.07  ? 231 ALA C O   1 
ATOM   9071  C  CB  . ALA C 1 230 ? 136.789 131.337 167.694 1.00 68.42  ? 231 ALA C CB  1 
ATOM   9072  N  N   . HIS C 1 231 ? 136.069 134.217 168.572 1.00 72.27  ? 232 HIS C N   1 
ATOM   9073  C  CA  . HIS C 1 231 ? 135.055 135.150 169.003 1.00 72.00  ? 232 HIS C CA  1 
ATOM   9074  C  C   . HIS C 1 231 ? 135.262 136.518 168.410 1.00 72.25  ? 232 HIS C C   1 
ATOM   9075  O  O   . HIS C 1 231 ? 134.322 137.269 168.235 1.00 72.28  ? 232 HIS C O   1 
ATOM   9076  C  CB  . HIS C 1 231 ? 135.026 135.222 170.516 1.00 71.65  ? 232 HIS C CB  1 
ATOM   9077  C  CG  . HIS C 1 231 ? 134.615 133.946 171.162 1.00 71.34  ? 232 HIS C CG  1 
ATOM   9078  N  ND1 . HIS C 1 231 ? 133.353 133.419 171.022 1.00 71.21  ? 232 HIS C ND1 1 
ATOM   9079  C  CD2 . HIS C 1 231 ? 135.298 133.084 171.944 1.00 71.18  ? 232 HIS C CD2 1 
ATOM   9080  C  CE1 . HIS C 1 231 ? 133.276 132.288 171.693 1.00 71.12  ? 232 HIS C CE1 1 
ATOM   9081  N  NE2 . HIS C 1 231 ? 134.443 132.062 172.263 1.00 71.11  ? 232 HIS C NE2 1 
ATOM   9082  N  N   . TYR C 1 232 ? 136.506 136.840 168.109 1.00 70.98  ? 233 TYR C N   1 
ATOM   9083  C  CA  . TYR C 1 232 ? 136.825 138.082 167.437 1.00 71.29  ? 233 TYR C CA  1 
ATOM   9084  C  C   . TYR C 1 232 ? 136.325 138.064 166.002 1.00 71.98  ? 233 TYR C C   1 
ATOM   9085  O  O   . TYR C 1 232 ? 135.788 139.042 165.515 1.00 72.08  ? 233 TYR C O   1 
ATOM   9086  C  CB  . TYR C 1 232 ? 138.335 138.307 167.482 1.00 71.05  ? 233 TYR C CB  1 
ATOM   9087  C  CG  . TYR C 1 232 ? 138.821 139.582 166.841 1.00 70.83  ? 233 TYR C CG  1 
ATOM   9088  C  CD1 . TYR C 1 232 ? 138.818 140.770 167.531 1.00 70.74  ? 233 TYR C CD1 1 
ATOM   9089  C  CD2 . TYR C 1 232 ? 139.306 139.586 165.555 1.00 70.73  ? 233 TYR C CD2 1 
ATOM   9090  C  CE1 . TYR C 1 232 ? 139.265 141.924 166.952 1.00 70.68  ? 233 TYR C CE1 1 
ATOM   9091  C  CE2 . TYR C 1 232 ? 139.754 140.735 164.969 1.00 70.69  ? 233 TYR C CE2 1 
ATOM   9092  C  CZ  . TYR C 1 232 ? 139.735 141.904 165.669 1.00 70.68  ? 233 TYR C CZ  1 
ATOM   9093  O  OH  . TYR C 1 232 ? 140.190 143.058 165.080 1.00 70.73  ? 233 TYR C OH  1 
ATOM   9094  N  N   . ASP C 1 233 ? 136.484 136.932 165.334 1.00 73.45  ? 234 ASP C N   1 
ATOM   9095  C  CA  . ASP C 1 233 ? 136.118 136.820 163.932 1.00 74.15  ? 234 ASP C CA  1 
ATOM   9096  C  C   . ASP C 1 233 ? 134.647 136.546 163.696 1.00 74.76  ? 234 ASP C C   1 
ATOM   9097  O  O   . ASP C 1 233 ? 134.059 137.095 162.777 1.00 74.83  ? 234 ASP C O   1 
ATOM   9098  C  CB  . ASP C 1 233 ? 136.931 135.724 163.254 1.00 74.23  ? 234 ASP C CB  1 
ATOM   9099  C  CG  . ASP C 1 233 ? 138.365 136.098 163.064 1.00 74.29  ? 234 ASP C CG  1 
ATOM   9100  O  OD1 . ASP C 1 233 ? 138.677 137.292 163.142 1.00 74.26  ? 234 ASP C OD1 1 
ATOM   9101  O  OD2 . ASP C 1 233 ? 139.180 135.194 162.822 1.00 74.28  1 234 ASP C OD2 1 
ATOM   9102  N  N   . THR C 1 234 ? 134.053 135.693 164.518 1.00 72.42  ? 235 THR C N   1 
ATOM   9103  C  CA  . THR C 1 234 ? 132.682 135.264 164.277 1.00 72.99  ? 235 THR C CA  1 
ATOM   9104  C  C   . THR C 1 234 ? 131.661 135.824 165.259 1.00 73.43  ? 235 THR C C   1 
ATOM   9105  O  O   . THR C 1 234 ? 130.715 136.476 164.859 1.00 73.49  ? 235 THR C O   1 
ATOM   9106  C  CB  . THR C 1 234 ? 132.557 133.732 164.200 1.00 73.05  ? 235 THR C CB  1 
ATOM   9107  O  OG1 . THR C 1 234 ? 132.845 133.159 165.473 1.00 73.04  ? 235 THR C OG1 1 
ATOM   9108  C  CG2 . THR C 1 234 ? 133.512 133.173 163.191 1.00 73.06  ? 235 THR C CG2 1 
ATOM   9109  N  N   . THR C 1 235 ? 131.850 135.575 166.542 1.00 70.22  ? 236 THR C N   1 
ATOM   9110  C  CA  . THR C 1 235 ? 130.847 135.953 167.520 1.00 70.62  ? 236 THR C CA  1 
ATOM   9111  C  C   . THR C 1 235 ? 130.594 137.452 167.572 1.00 71.09  ? 236 THR C C   1 
ATOM   9112  O  O   . THR C 1 235 ? 129.453 137.896 167.586 1.00 71.14  ? 236 THR C O   1 
ATOM   9113  C  CB  . THR C 1 235 ? 131.244 135.483 168.915 1.00 70.55  ? 236 THR C CB  1 
ATOM   9114  O  OG1 . THR C 1 235 ? 131.679 134.125 168.857 1.00 70.48  ? 236 THR C OG1 1 
ATOM   9115  C  CG2 . THR C 1 235 ? 130.077 135.576 169.839 1.00 70.56  ? 236 THR C CG2 1 
ATOM   9116  N  N   . ALA C 1 236 ? 131.661 138.232 167.586 1.00 71.55  ? 237 ALA C N   1 
ATOM   9117  C  CA  . ALA C 1 236 ? 131.528 139.676 167.632 1.00 71.99  ? 237 ALA C CA  1 
ATOM   9118  C  C   . ALA C 1 236 ? 130.917 140.247 166.367 1.00 72.35  ? 237 ALA C C   1 
ATOM   9119  O  O   . ALA C 1 236 ? 130.192 141.226 166.413 1.00 72.39  ? 237 ALA C O   1 
ATOM   9120  C  CB  . ALA C 1 236 ? 132.861 140.307 167.899 1.00 72.03  ? 237 ALA C CB  1 
ATOM   9121  N  N   . ASP C 1 237 ? 131.216 139.626 165.235 1.00 92.44  ? 238 ASP C N   1 
ATOM   9122  C  CA  . ASP C 1 237 ? 130.646 140.046 163.967 1.00 92.66  ? 238 ASP C CA  1 
ATOM   9123  C  C   . ASP C 1 237 ? 129.157 139.784 163.950 1.00 92.49  ? 238 ASP C C   1 
ATOM   9124  O  O   . ASP C 1 237 ? 128.385 140.574 163.423 1.00 92.50  ? 238 ASP C O   1 
ATOM   9125  C  CB  . ASP C 1 237 ? 131.305 139.294 162.812 1.00 92.90  ? 238 ASP C CB  1 
ATOM   9126  C  CG  . ASP C 1 237 ? 132.567 139.960 162.319 1.00 93.02  ? 238 ASP C CG  1 
ATOM   9127  O  OD1 . ASP C 1 237 ? 133.047 140.893 162.981 1.00 93.06  ? 238 ASP C OD1 1 
ATOM   9128  O  OD2 . ASP C 1 237 ? 133.086 139.546 161.266 1.00 93.09  1 238 ASP C OD2 1 
ATOM   9129  N  N   . GLU C 1 238 ? 128.760 138.669 164.544 1.00 73.76  ? 239 GLU C N   1 
ATOM   9130  C  CA  . GLU C 1 238 ? 127.363 138.320 164.607 1.00 73.54  ? 239 GLU C CA  1 
ATOM   9131  C  C   . GLU C 1 238 ? 126.645 139.297 165.499 1.00 73.55  ? 239 GLU C C   1 
ATOM   9132  O  O   . GLU C 1 238 ? 125.563 139.758 165.173 1.00 73.62  ? 239 GLU C O   1 
ATOM   9133  C  CB  . GLU C 1 238 ? 127.181 136.909 165.147 1.00 73.35  ? 239 GLU C CB  1 
ATOM   9134  C  CG  . GLU C 1 238 ? 127.627 135.818 164.222 1.00 73.24  ? 239 GLU C CG  1 
ATOM   9135  C  CD  . GLU C 1 238 ? 127.510 134.449 164.840 1.00 73.16  ? 239 GLU C CD  1 
ATOM   9136  O  OE1 . GLU C 1 238 ? 128.289 133.561 164.461 1.00 73.14  ? 239 GLU C OE1 1 
ATOM   9137  O  OE2 . GLU C 1 238 ? 126.640 134.257 165.701 1.00 73.15  1 239 GLU C OE2 1 
ATOM   9138  N  N   . ILE C 1 239 ? 127.261 139.630 166.621 1.00 76.03  ? 240 ILE C N   1 
ATOM   9139  C  CA  . ILE C 1 239 ? 126.632 140.558 167.537 1.00 76.06  ? 240 ILE C CA  1 
ATOM   9140  C  C   . ILE C 1 239 ? 126.489 141.922 166.901 1.00 76.64  ? 240 ILE C C   1 
ATOM   9141  O  O   . ILE C 1 239 ? 125.460 142.566 167.034 1.00 76.74  ? 240 ILE C O   1 
ATOM   9142  C  CB  . ILE C 1 239 ? 127.427 140.691 168.825 1.00 75.64  ? 240 ILE C CB  1 
ATOM   9143  C  CG1 . ILE C 1 239 ? 127.437 139.367 169.571 1.00 75.42  ? 240 ILE C CG1 1 
ATOM   9144  C  CG2 . ILE C 1 239 ? 126.820 141.734 169.705 1.00 75.55  ? 240 ILE C CG2 1 
ATOM   9145  C  CD1 . ILE C 1 239 ? 128.320 139.369 170.775 1.00 75.30  ? 240 ILE C CD1 1 
ATOM   9146  N  N   . LEU C 1 240 ? 127.517 142.356 166.188 1.00 75.86  ? 241 LEU C N   1 
ATOM   9147  C  CA  . LEU C 1 240 ? 127.471 143.654 165.541 1.00 76.48  ? 241 LEU C CA  1 
ATOM   9148  C  C   . LEU C 1 240 ? 126.451 143.702 164.431 1.00 77.58  ? 241 LEU C C   1 
ATOM   9149  O  O   . LEU C 1 240 ? 125.795 144.712 164.224 1.00 77.72  ? 241 LEU C O   1 
ATOM   9150  C  CB  . LEU C 1 240 ? 128.837 144.027 164.988 1.00 76.14  ? 241 LEU C CB  1 
ATOM   9151  C  CG  . LEU C 1 240 ? 129.872 144.532 165.984 1.00 75.85  ? 241 LEU C CG  1 
ATOM   9152  C  CD1 . LEU C 1 240 ? 131.184 144.738 165.287 1.00 75.75  ? 241 LEU C CD1 1 
ATOM   9153  C  CD2 . LEU C 1 240 ? 129.419 145.817 166.615 1.00 75.78  ? 241 LEU C CD2 1 
ATOM   9154  N  N   . GLN C 1 241 ? 126.310 142.597 163.720 1.00 102.25 ? 242 GLN C N   1 
ATOM   9155  C  CA  . GLN C 1 241 ? 125.386 142.547 162.606 1.00 103.34 ? 242 GLN C CA  1 
ATOM   9156  C  C   . GLN C 1 241 ? 123.947 142.486 163.071 1.00 103.50 ? 242 GLN C C   1 
ATOM   9157  O  O   . GLN C 1 241 ? 123.074 143.115 162.495 1.00 103.54 ? 242 GLN C O   1 
ATOM   9158  C  CB  . GLN C 1 241 ? 125.702 141.350 161.720 1.00 104.10 ? 242 GLN C CB  1 
ATOM   9159  C  CG  . GLN C 1 241 ? 124.779 141.205 160.546 1.00 104.70 ? 242 GLN C CG  1 
ATOM   9160  C  CD  . GLN C 1 241 ? 125.185 140.077 159.644 1.00 105.13 ? 242 GLN C CD  1 
ATOM   9161  O  OE1 . GLN C 1 241 ? 126.239 139.476 159.828 1.00 105.21 ? 242 GLN C OE1 1 
ATOM   9162  N  NE2 . GLN C 1 241 ? 124.350 139.776 158.658 1.00 105.38 ? 242 GLN C NE2 1 
ATOM   9163  N  N   . GLN C 1 242 ? 123.702 141.714 164.117 1.00 71.21  ? 243 GLN C N   1 
ATOM   9164  C  CA  . GLN C 1 242 ? 122.365 141.581 164.657 1.00 71.36  ? 243 GLN C CA  1 
ATOM   9165  C  C   . GLN C 1 242 ? 121.870 142.861 165.293 1.00 72.59  ? 243 GLN C C   1 
ATOM   9166  O  O   . GLN C 1 242 ? 120.684 143.124 165.326 1.00 72.67  ? 243 GLN C O   1 
ATOM   9167  C  CB  . GLN C 1 242 ? 122.321 140.434 165.655 1.00 70.50  ? 243 GLN C CB  1 
ATOM   9168  C  CG  . GLN C 1 242 ? 122.341 139.082 165.000 1.00 69.88  ? 243 GLN C CG  1 
ATOM   9169  C  CD  . GLN C 1 242 ? 122.483 137.951 165.974 1.00 69.40  ? 243 GLN C CD  1 
ATOM   9170  O  OE1 . GLN C 1 242 ? 123.314 137.991 166.865 1.00 69.33  ? 243 GLN C OE1 1 
ATOM   9171  N  NE2 . GLN C 1 242 ? 121.672 136.928 165.808 1.00 69.16  ? 243 GLN C NE2 1 
ATOM   9172  N  N   . CYS C 1 243 ? 122.796 143.656 165.803 1.00 92.93  ? 244 CYS C N   1 
ATOM   9173  C  CA  . CYS C 1 243 ? 122.456 144.888 166.498 1.00 94.20  ? 244 CYS C CA  1 
ATOM   9174  C  C   . CYS C 1 243 ? 122.542 146.120 165.613 1.00 95.49  ? 244 CYS C C   1 
ATOM   9175  O  O   . CYS C 1 243 ? 122.348 147.228 166.079 1.00 95.59  ? 244 CYS C O   1 
ATOM   9176  C  CB  . CYS C 1 243 ? 123.343 145.068 167.726 1.00 94.21  ? 244 CYS C CB  1 
ATOM   9177  S  SG  . CYS C 1 243 ? 123.050 143.876 169.025 1.00 94.13  ? 244 CYS C SG  1 
ATOM   9178  N  N   . ASP C 1 244 ? 122.843 145.914 164.341 1.00 96.36  ? 245 ASP C N   1 
ATOM   9179  C  CA  . ASP C 1 244 ? 123.016 146.998 163.384 1.00 97.48  ? 245 ASP C CA  1 
ATOM   9180  C  C   . ASP C 1 244 ? 124.112 147.956 163.792 1.00 98.21  ? 245 ASP C C   1 
ATOM   9181  O  O   . ASP C 1 244 ? 124.082 149.121 163.438 1.00 98.29  ? 245 ASP C O   1 
ATOM   9182  C  CB  . ASP C 1 244 ? 121.715 147.774 163.182 1.00 97.71  ? 245 ASP C CB  1 
ATOM   9183  C  CG  . ASP C 1 244 ? 120.647 146.959 162.497 1.00 97.81  ? 245 ASP C CG  1 
ATOM   9184  O  OD1 . ASP C 1 244 ? 120.913 146.420 161.407 1.00 97.86  ? 245 ASP C OD1 1 
ATOM   9185  O  OD2 . ASP C 1 244 ? 119.536 146.855 163.050 1.00 97.87  1 245 ASP C OD2 1 
ATOM   9186  N  N   . GLY C 1 245 ? 125.079 147.469 164.550 1.00 79.46  ? 246 GLY C N   1 
ATOM   9187  C  CA  . GLY C 1 245 ? 126.226 148.270 164.920 1.00 80.11  ? 246 GLY C CA  1 
ATOM   9188  C  C   . GLY C 1 245 ? 125.993 149.088 166.168 1.00 80.66  ? 246 GLY C C   1 
ATOM   9189  O  O   . GLY C 1 245 ? 126.923 149.578 166.787 1.00 80.72  ? 246 GLY C O   1 
ATOM   9190  N  N   . LYS C 1 246 ? 124.733 149.214 166.549 1.00 101.68 ? 247 LYS C N   1 
ATOM   9191  C  CA  . LYS C 1 246 ? 124.361 150.008 167.700 1.00 102.04 ? 247 LYS C CA  1 
ATOM   9192  C  C   . LYS C 1 246 ? 124.335 149.143 168.934 1.00 100.99 ? 247 LYS C C   1 
ATOM   9193  O  O   . LYS C 1 246 ? 123.572 148.198 169.013 1.00 100.89 ? 247 LYS C O   1 
ATOM   9194  C  CB  . LYS C 1 246 ? 122.996 150.645 167.470 1.00 103.23 ? 247 LYS C CB  1 
ATOM   9195  C  CG  . LYS C 1 246 ? 122.950 151.556 166.255 1.00 104.18 ? 247 LYS C CG  1 
ATOM   9196  C  CD  . LYS C 1 246 ? 121.588 152.208 166.077 1.00 104.93 ? 247 LYS C CD  1 
ATOM   9197  C  CE  . LYS C 1 246 ? 120.536 151.225 165.574 1.00 105.41 ? 247 LYS C CE  1 
ATOM   9198  N  NZ  . LYS C 1 246 ? 120.757 150.830 164.155 1.00 105.67 1 247 LYS C NZ  1 
ATOM   9199  N  N   . LEU C 1 247 ? 125.163 149.486 169.911 1.00 90.50  ? 248 LEU C N   1 
ATOM   9200  C  CA  . LEU C 1 247 ? 125.365 148.637 171.072 1.00 89.40  ? 248 LEU C CA  1 
ATOM   9201  C  C   . LEU C 1 247 ? 125.990 149.413 172.218 1.00 88.27  ? 248 LEU C C   1 
ATOM   9202  O  O   . LEU C 1 247 ? 127.064 149.970 172.069 1.00 88.20  ? 248 LEU C O   1 
ATOM   9203  C  CB  . LEU C 1 247 ? 126.267 147.481 170.683 1.00 89.39  ? 248 LEU C CB  1 
ATOM   9204  C  CG  . LEU C 1 247 ? 126.547 146.475 171.772 1.00 89.33  ? 248 LEU C CG  1 
ATOM   9205  C  CD1 . LEU C 1 247 ? 125.249 146.053 172.356 1.00 89.24  ? 248 LEU C CD1 1 
ATOM   9206  C  CD2 . LEU C 1 247 ? 127.249 145.301 171.188 1.00 89.36  ? 248 LEU C CD2 1 
ATOM   9207  N  N   . ASP C 1 248 ? 125.314 149.449 173.358 1.00 84.87  ? 249 ASP C N   1 
ATOM   9208  C  CA  . ASP C 1 248 ? 125.749 150.276 174.475 1.00 83.77  ? 249 ASP C CA  1 
ATOM   9209  C  C   . ASP C 1 248 ? 126.522 149.562 175.580 1.00 82.54  ? 249 ASP C C   1 
ATOM   9210  O  O   . ASP C 1 248 ? 127.364 150.159 176.236 1.00 82.48  ? 249 ASP C O   1 
ATOM   9211  C  CB  . ASP C 1 248 ? 124.552 150.999 175.073 1.00 83.83  ? 249 ASP C CB  1 
ATOM   9212  C  CG  . ASP C 1 248 ? 123.932 151.970 174.117 1.00 83.90  ? 249 ASP C CG  1 
ATOM   9213  O  OD1 . ASP C 1 248 ? 124.322 153.147 174.145 1.00 83.91  ? 249 ASP C OD1 1 
ATOM   9214  O  OD2 . ASP C 1 248 ? 123.058 151.562 173.336 1.00 83.90  1 249 ASP C OD2 1 
ATOM   9215  N  N   . MET C 1 249 ? 126.225 148.289 175.795 1.00 89.60  ? 250 MET C N   1 
ATOM   9216  C  CA  . MET C 1 249 ? 126.869 147.533 176.859 1.00 88.34  ? 250 MET C CA  1 
ATOM   9217  C  C   . MET C 1 249 ? 126.857 146.055 176.547 1.00 86.57  ? 250 MET C C   1 
ATOM   9218  O  O   . MET C 1 249 ? 125.903 145.546 175.989 1.00 86.50  ? 250 MET C O   1 
ATOM   9219  C  CB  . MET C 1 249 ? 126.172 147.789 178.197 1.00 88.77  ? 250 MET C CB  1 
ATOM   9220  C  CG  . MET C 1 249 ? 126.623 146.888 179.328 1.00 89.05  ? 250 MET C CG  1 
ATOM   9221  S  SD  . MET C 1 249 ? 125.903 147.298 180.911 1.00 89.33  ? 250 MET C SD  1 
ATOM   9222  C  CE  . MET C 1 249 ? 126.728 148.832 181.245 1.00 89.49  ? 250 MET C CE  1 
ATOM   9223  N  N   . LEU C 1 250 ? 127.930 145.367 176.906 1.00 82.21  ? 251 LEU C N   1 
ATOM   9224  C  CA  . LEU C 1 250 ? 127.994 143.930 176.739 1.00 80.45  ? 251 LEU C CA  1 
ATOM   9225  C  C   . LEU C 1 250 ? 128.403 143.295 178.038 1.00 79.14  ? 251 LEU C C   1 
ATOM   9226  O  O   . LEU C 1 250 ? 129.412 143.650 178.603 1.00 79.04  ? 251 LEU C O   1 
ATOM   9227  C  CB  . LEU C 1 250 ? 129.011 143.555 175.678 1.00 80.14  ? 251 LEU C CB  1 
ATOM   9228  C  CG  . LEU C 1 250 ? 129.142 142.053 175.466 1.00 79.87  ? 251 LEU C CG  1 
ATOM   9229  C  CD1 . LEU C 1 250 ? 128.468 141.652 174.189 1.00 79.79  ? 251 LEU C CD1 1 
ATOM   9230  C  CD2 . LEU C 1 250 ? 130.575 141.646 175.451 1.00 79.77  ? 251 LEU C CD2 1 
ATOM   9231  N  N   . VAL C 1 251 ? 127.612 142.345 178.507 1.00 80.98  ? 252 VAL C N   1 
ATOM   9232  C  CA  . VAL C 1 251 ? 127.917 141.653 179.737 1.00 79.80  ? 252 VAL C CA  1 
ATOM   9233  C  C   . VAL C 1 251 ? 128.268 140.213 179.444 1.00 78.67  ? 252 VAL C C   1 
ATOM   9234  O  O   . VAL C 1 251 ? 127.519 139.493 178.771 1.00 78.58  ? 252 VAL C O   1 
ATOM   9235  C  CB  . VAL C 1 251 ? 126.741 141.715 180.709 1.00 79.79  ? 252 VAL C CB  1 
ATOM   9236  C  CG1 . VAL C 1 251 ? 127.142 141.167 182.046 1.00 79.78  ? 252 VAL C CG1 1 
ATOM   9237  C  CG2 . VAL C 1 251 ? 126.274 143.134 180.861 1.00 79.82  ? 252 VAL C CG2 1 
ATOM   9238  N  N   . ALA C 1 252 ? 129.417 139.798 179.960 1.00 65.79  ? 253 ALA C N   1 
ATOM   9239  C  CA  . ALA C 1 252 ? 129.890 138.448 179.732 1.00 64.81  ? 253 ALA C CA  1 
ATOM   9240  C  C   . ALA C 1 252 ? 130.612 137.855 180.927 1.00 64.10  ? 253 ALA C C   1 
ATOM   9241  O  O   . ALA C 1 252 ? 131.445 138.495 181.550 1.00 64.03  ? 253 ALA C O   1 
ATOM   9242  C  CB  . ALA C 1 252 ? 130.776 138.418 178.529 1.00 64.68  ? 253 ALA C CB  1 
ATOM   9243  N  N   . SER C 1 253 ? 130.263 136.621 181.253 1.00 74.38  ? 254 SER C N   1 
ATOM   9244  C  CA  . SER C 1 253 ? 130.967 135.877 182.274 1.00 73.82  ? 254 SER C CA  1 
ATOM   9245  C  C   . SER C 1 253 ? 132.271 135.349 181.722 1.00 73.30  ? 254 SER C C   1 
ATOM   9246  O  O   . SER C 1 253 ? 132.361 135.014 180.557 1.00 73.27  ? 254 SER C O   1 
ATOM   9247  C  CB  . SER C 1 253 ? 130.106 134.739 182.801 1.00 73.81  ? 254 SER C CB  1 
ATOM   9248  O  OG  . SER C 1 253 ? 129.697 133.885 181.761 1.00 73.83  ? 254 SER C OG  1 
ATOM   9249  N  N   . VAL C 1 254 ? 133.272 135.241 182.583 1.00 75.17  ? 255 VAL C N   1 
ATOM   9250  C  CA  . VAL C 1 254 ? 134.631 134.965 182.154 1.00 74.75  ? 255 VAL C CA  1 
ATOM   9251  C  C   . VAL C 1 254 ? 135.193 133.681 182.733 1.00 74.58  ? 255 VAL C C   1 
ATOM   9252  O  O   . VAL C 1 254 ? 135.082 133.419 183.915 1.00 74.56  ? 255 VAL C O   1 
ATOM   9253  C  CB  . VAL C 1 254 ? 135.550 136.118 182.547 1.00 74.55  ? 255 VAL C CB  1 
ATOM   9254  C  CG1 . VAL C 1 254 ? 136.950 135.855 182.091 1.00 74.49  ? 255 VAL C CG1 1 
ATOM   9255  C  CG2 . VAL C 1 254 ? 135.051 137.390 181.950 1.00 74.51  ? 255 VAL C CG2 1 
ATOM   9256  N  N   . GLY C 1 255 ? 135.805 132.884 181.873 1.00 66.78  ? 256 GLY C N   1 
ATOM   9257  C  CA  . GLY C 1 255 ? 136.470 131.670 182.276 1.00 66.69  ? 256 GLY C CA  1 
ATOM   9258  C  C   . GLY C 1 255 ? 137.873 131.697 181.741 1.00 66.62  ? 256 GLY C C   1 
ATOM   9259  O  O   . GLY C 1 255 ? 138.773 132.167 182.405 1.00 66.62  ? 256 GLY C O   1 
ATOM   9260  N  N   . THR C 1 256 ? 138.058 131.179 180.536 1.00 63.87  ? 257 THR C N   1 
ATOM   9261  C  CA  . THR C 1 256 ? 139.322 131.313 179.830 1.00 63.86  ? 257 THR C CA  1 
ATOM   9262  C  C   . THR C 1 256 ? 139.518 132.751 179.423 1.00 64.05  ? 257 THR C C   1 
ATOM   9263  O  O   . THR C 1 256 ? 140.627 133.211 179.230 1.00 64.15  ? 257 THR C O   1 
ATOM   9264  C  CB  . THR C 1 256 ? 139.368 130.455 178.573 1.00 63.74  ? 257 THR C CB  1 
ATOM   9265  O  OG1 . THR C 1 256 ? 138.405 130.936 177.638 1.00 63.75  ? 257 THR C OG1 1 
ATOM   9266  C  CG2 . THR C 1 256 ? 139.065 129.025 178.897 1.00 63.69  ? 257 THR C CG2 1 
ATOM   9267  N  N   . GLY C 1 257 ? 138.411 133.458 179.305 1.00 73.95  ? 258 GLY C N   1 
ATOM   9268  C  CA  . GLY C 1 257 ? 138.431 134.847 178.920 1.00 74.12  ? 258 GLY C CA  1 
ATOM   9269  C  C   . GLY C 1 257 ? 138.378 135.102 177.439 1.00 74.24  ? 258 GLY C C   1 
ATOM   9270  O  O   . GLY C 1 257 ? 138.358 136.240 177.011 1.00 74.28  ? 258 GLY C O   1 
ATOM   9271  N  N   . GLY C 1 258 ? 138.329 134.044 176.650 1.00 71.88  ? 259 GLY C N   1 
ATOM   9272  C  CA  . GLY C 1 258 ? 138.362 134.197 175.214 1.00 71.95  ? 259 GLY C CA  1 
ATOM   9273  C  C   . GLY C 1 258 ? 137.162 134.909 174.642 1.00 71.99  ? 259 GLY C C   1 
ATOM   9274  O  O   . GLY C 1 258 ? 137.295 135.711 173.727 1.00 72.02  ? 259 GLY C O   1 
ATOM   9275  N  N   . THR C 1 259 ? 135.994 134.655 175.209 1.00 63.17  ? 260 THR C N   1 
ATOM   9276  C  CA  . THR C 1 259 ? 134.781 135.247 174.684 1.00 63.17  ? 260 THR C CA  1 
ATOM   9277  C  C   . THR C 1 259 ? 134.799 136.740 174.892 1.00 63.24  ? 260 THR C C   1 
ATOM   9278  O  O   . THR C 1 259 ? 134.655 137.517 173.952 1.00 63.31  ? 260 THR C O   1 
ATOM   9279  C  CB  . THR C 1 259 ? 133.549 134.682 175.374 1.00 63.12  ? 260 THR C CB  1 
ATOM   9280  O  OG1 . THR C 1 259 ? 133.507 133.268 175.188 1.00 63.14  ? 260 THR C OG1 1 
ATOM   9281  C  CG2 . THR C 1 259 ? 132.306 135.285 174.797 1.00 63.10  ? 260 THR C CG2 1 
ATOM   9282  N  N   . ILE C 1 260 ? 135.019 137.143 176.130 1.00 65.24  ? 261 ILE C N   1 
ATOM   9283  C  CA  . ILE C 1 260 ? 135.019 138.552 176.435 1.00 65.32  ? 261 ILE C CA  1 
ATOM   9284  C  C   . ILE C 1 260 ? 136.188 139.246 175.781 1.00 65.68  ? 261 ILE C C   1 
ATOM   9285  O  O   . ILE C 1 260 ? 136.090 140.396 175.430 1.00 65.76  ? 261 ILE C O   1 
ATOM   9286  C  CB  . ILE C 1 260 ? 134.993 138.825 177.944 1.00 65.11  ? 261 ILE C CB  1 
ATOM   9287  C  CG1 . ILE C 1 260 ? 134.655 140.285 178.196 1.00 65.00  ? 261 ILE C CG1 1 
ATOM   9288  C  CG2 . ILE C 1 260 ? 136.301 138.475 178.583 1.00 65.07  ? 261 ILE C CG2 1 
ATOM   9289  C  CD1 . ILE C 1 260 ? 134.436 140.604 179.615 1.00 64.94  ? 261 ILE C CD1 1 
ATOM   9290  N  N   . THR C 1 261 ? 137.284 138.538 175.575 1.00 65.67  ? 262 THR C N   1 
ATOM   9291  C  CA  . THR C 1 261 ? 138.445 139.173 174.987 1.00 66.09  ? 262 THR C CA  1 
ATOM   9292  C  C   . THR C 1 261 ? 138.262 139.448 173.513 1.00 66.63  ? 262 THR C C   1 
ATOM   9293  O  O   . THR C 1 261 ? 138.462 140.565 173.059 1.00 66.69  ? 262 THR C O   1 
ATOM   9294  C  CB  . THR C 1 261 ? 139.694 138.341 175.188 1.00 66.02  ? 262 THR C CB  1 
ATOM   9295  O  OG1 . THR C 1 261 ? 140.011 138.303 176.580 1.00 66.01  ? 262 THR C OG1 1 
ATOM   9296  C  CG2 . THR C 1 261 ? 140.844 138.948 174.443 1.00 65.98  ? 262 THR C CG2 1 
ATOM   9297  N  N   . GLY C 1 262 ? 137.849 138.438 172.764 1.00 73.90  ? 263 GLY C N   1 
ATOM   9298  C  CA  . GLY C 1 262 ? 137.684 138.632 171.343 1.00 74.46  ? 263 GLY C CA  1 
ATOM   9299  C  C   . GLY C 1 262 ? 136.554 139.587 171.058 1.00 75.00  ? 263 GLY C C   1 
ATOM   9300  O  O   . GLY C 1 262 ? 136.665 140.486 170.212 1.00 75.04  ? 263 GLY C O   1 
ATOM   9301  N  N   . ILE C 1 263 ? 135.478 139.439 171.816 1.00 72.58  ? 264 ILE C N   1 
ATOM   9302  C  CA  . ILE C 1 263 ? 134.341 140.299 171.594 1.00 73.09  ? 264 ILE C CA  1 
ATOM   9303  C  C   . ILE C 1 263 ? 134.682 141.720 171.954 1.00 73.26  ? 264 ILE C C   1 
ATOM   9304  O  O   . ILE C 1 263 ? 134.345 142.639 171.232 1.00 73.33  ? 264 ILE C O   1 
ATOM   9305  C  CB  . ILE C 1 263 ? 133.133 139.877 172.408 1.00 73.34  ? 264 ILE C CB  1 
ATOM   9306  C  CG1 . ILE C 1 263 ? 132.571 138.566 171.890 1.00 73.45  ? 264 ILE C CG1 1 
ATOM   9307  C  CG2 . ILE C 1 263 ? 132.055 140.901 172.291 1.00 73.44  ? 264 ILE C CG2 1 
ATOM   9308  C  CD1 . ILE C 1 263 ? 131.381 138.109 172.657 1.00 73.51  ? 264 ILE C CD1 1 
ATOM   9309  N  N   . ALA C 1 264 ? 135.361 141.906 173.071 1.00 68.98  ? 265 ALA C N   1 
ATOM   9310  C  CA  . ALA C 1 264 ? 135.676 143.252 173.497 1.00 69.15  ? 265 ALA C CA  1 
ATOM   9311  C  C   . ALA C 1 264 ? 136.668 143.924 172.595 1.00 69.42  ? 265 ALA C C   1 
ATOM   9312  O  O   . ALA C 1 264 ? 136.601 145.119 172.404 1.00 69.60  ? 265 ALA C O   1 
ATOM   9313  C  CB  . ALA C 1 264 ? 136.172 143.269 174.905 1.00 69.08  ? 265 ALA C CB  1 
ATOM   9314  N  N   . ARG C 1 265 ? 137.596 143.165 172.039 1.00 70.91  ? 266 ARG C N   1 
ATOM   9315  C  CA  . ARG C 1 265 ? 138.559 143.783 171.154 1.00 71.19  ? 266 ARG C CA  1 
ATOM   9316  C  C   . ARG C 1 265 ? 137.861 144.256 169.895 1.00 72.12  ? 266 ARG C C   1 
ATOM   9317  O  O   . ARG C 1 265 ? 137.983 145.425 169.503 1.00 72.27  ? 266 ARG C O   1 
ATOM   9318  C  CB  . ARG C 1 265 ? 139.723 142.841 170.842 1.00 70.69  ? 266 ARG C CB  1 
ATOM   9319  C  CG  . ARG C 1 265 ? 140.781 142.794 171.926 1.00 70.28  ? 266 ARG C CG  1 
ATOM   9320  C  CD  . ARG C 1 265 ? 141.975 141.943 171.546 1.00 69.93  ? 266 ARG C CD  1 
ATOM   9321  N  NE  . ARG C 1 265 ? 143.014 141.976 172.566 1.00 69.67  ? 266 ARG C NE  1 
ATOM   9322  C  CZ  . ARG C 1 265 ? 144.154 141.307 172.497 1.00 69.46  ? 266 ARG C CZ  1 
ATOM   9323  N  NH1 . ARG C 1 265 ? 144.410 140.545 171.457 1.00 69.43  1 266 ARG C NH1 1 
ATOM   9324  N  NH2 . ARG C 1 265 ? 145.036 141.399 173.471 1.00 69.39  ? 266 ARG C NH2 1 
ATOM   9325  N  N   . LYS C 1 266 ? 137.073 143.381 169.281 1.00 71.84  ? 267 LYS C N   1 
ATOM   9326  C  CA  . LYS C 1 266 ? 136.403 143.831 168.073 1.00 72.83  ? 267 LYS C CA  1 
ATOM   9327  C  C   . LYS C 1 266 ? 135.412 144.945 168.348 1.00 74.36  ? 267 LYS C C   1 
ATOM   9328  O  O   . LYS C 1 266 ? 135.248 145.844 167.550 1.00 74.52  ? 267 LYS C O   1 
ATOM   9329  C  CB  . LYS C 1 266 ? 135.731 142.685 167.328 1.00 72.41  ? 267 LYS C CB  1 
ATOM   9330  C  CG  . LYS C 1 266 ? 134.982 143.137 166.097 1.00 72.10  ? 267 LYS C CG  1 
ATOM   9331  C  CD  . LYS C 1 266 ? 135.055 142.131 164.988 1.00 71.83  ? 267 LYS C CD  1 
ATOM   9332  C  CE  . LYS C 1 266 ? 136.425 142.077 164.384 1.00 71.66  ? 267 LYS C CE  1 
ATOM   9333  N  NZ  . LYS C 1 266 ? 136.506 141.044 163.333 1.00 71.57  1 267 LYS C NZ  1 
ATOM   9334  N  N   . LEU C 1 267 ? 134.769 144.901 169.499 1.00 83.71  ? 268 LEU C N   1 
ATOM   9335  C  CA  . LEU C 1 267 ? 133.813 145.936 169.848 1.00 85.27  ? 268 LEU C CA  1 
ATOM   9336  C  C   . LEU C 1 267 ? 134.484 147.277 170.116 1.00 86.67  ? 268 LEU C C   1 
ATOM   9337  O  O   . LEU C 1 267 ? 133.952 148.317 169.767 1.00 86.95  ? 268 LEU C O   1 
ATOM   9338  C  CB  . LEU C 1 267 ? 132.973 145.499 171.049 1.00 85.41  ? 268 LEU C CB  1 
ATOM   9339  C  CG  . LEU C 1 267 ? 131.503 145.179 170.793 1.00 85.53  ? 268 LEU C CG  1 
ATOM   9340  C  CD1 . LEU C 1 267 ? 131.367 144.239 169.640 1.00 85.60  ? 268 LEU C CD1 1 
ATOM   9341  C  CD2 . LEU C 1 267 ? 130.877 144.580 172.014 1.00 85.59  ? 268 LEU C CD2 1 
ATOM   9342  N  N   . LYS C 1 268 ? 135.657 147.250 170.732 1.00 84.56  ? 269 LYS C N   1 
ATOM   9343  C  CA  . LYS C 1 268 ? 136.382 148.475 171.000 1.00 85.86  ? 269 LYS C CA  1 
ATOM   9344  C  C   . LYS C 1 268 ? 136.818 149.068 169.696 1.00 87.11  ? 269 LYS C C   1 
ATOM   9345  O  O   . LYS C 1 268 ? 136.904 150.275 169.558 1.00 87.23  ? 269 LYS C O   1 
ATOM   9346  C  CB  . LYS C 1 268 ? 137.602 148.215 171.876 1.00 85.88  ? 269 LYS C CB  1 
ATOM   9347  C  CG  . LYS C 1 268 ? 137.299 148.027 173.345 1.00 85.85  ? 269 LYS C CG  1 
ATOM   9348  C  CD  . LYS C 1 268 ? 136.871 149.323 174.007 1.00 85.90  ? 269 LYS C CD  1 
ATOM   9349  C  CE  . LYS C 1 268 ? 136.416 149.107 175.443 1.00 85.91  ? 269 LYS C CE  1 
ATOM   9350  N  NZ  . LYS C 1 268 ? 137.503 148.666 176.344 1.00 85.90  1 269 LYS C NZ  1 
ATOM   9351  N  N   . GLU C 1 269 ? 137.093 148.216 168.723 1.00 94.03  ? 270 GLU C N   1 
ATOM   9352  C  CA  . GLU C 1 269 ? 137.492 148.740 167.431 1.00 95.18  ? 270 GLU C CA  1 
ATOM   9353  C  C   . GLU C 1 269 ? 136.325 149.279 166.607 1.00 95.85  ? 270 GLU C C   1 
ATOM   9354  O  O   . GLU C 1 269 ? 136.431 150.341 166.005 1.00 95.93  ? 270 GLU C O   1 
ATOM   9355  C  CB  . GLU C 1 269 ? 138.261 147.686 166.638 1.00 95.52  ? 270 GLU C CB  1 
ATOM   9356  C  CG  . GLU C 1 269 ? 139.574 147.290 167.261 1.00 95.71  ? 270 GLU C CG  1 
ATOM   9357  C  CD  . GLU C 1 269 ? 140.177 146.063 166.628 1.00 95.82  ? 270 GLU C CD  1 
ATOM   9358  O  OE1 . GLU C 1 269 ? 139.576 145.525 165.682 1.00 95.75  ? 270 GLU C OE1 1 
ATOM   9359  O  OE2 . GLU C 1 269 ? 141.253 145.630 167.080 1.00 95.86  1 270 GLU C OE2 1 
ATOM   9360  N  N   . LYS C 1 270 ? 135.215 148.550 166.586 1.00 89.00  ? 271 LYS C N   1 
ATOM   9361  C  CA  . LYS C 1 270 ? 134.113 148.870 165.688 1.00 89.52  ? 271 LYS C CA  1 
ATOM   9362  C  C   . LYS C 1 270 ? 132.921 149.535 166.357 1.00 89.86  ? 271 LYS C C   1 
ATOM   9363  O  O   . LYS C 1 270 ? 131.974 149.914 165.685 1.00 89.91  ? 271 LYS C O   1 
ATOM   9364  C  CB  . LYS C 1 270 ? 133.638 147.621 164.947 1.00 89.62  ? 271 LYS C CB  1 
ATOM   9365  C  CG  . LYS C 1 270 ? 134.704 146.908 164.143 1.00 89.68  ? 271 LYS C CG  1 
ATOM   9366  C  CD  . LYS C 1 270 ? 135.418 147.843 163.195 1.00 89.72  ? 271 LYS C CD  1 
ATOM   9367  C  CE  . LYS C 1 270 ? 136.388 147.103 162.292 1.00 89.74  ? 271 LYS C CE  1 
ATOM   9368  N  NZ  . LYS C 1 270 ? 135.702 146.410 161.177 1.00 89.75  1 271 LYS C NZ  1 
ATOM   9369  N  N   . CYS C 1 271 ? 132.957 149.670 167.674 1.00 98.95  ? 272 CYS C N   1 
ATOM   9370  C  CA  . CYS C 1 271 ? 131.850 150.280 168.407 1.00 99.24  ? 272 CYS C CA  1 
ATOM   9371  C  C   . CYS C 1 271 ? 132.355 150.793 169.739 1.00 99.42  ? 272 CYS C C   1 
ATOM   9372  O  O   . CYS C 1 271 ? 131.989 150.282 170.785 1.00 99.40  ? 272 CYS C O   1 
ATOM   9373  C  CB  . CYS C 1 271 ? 130.738 149.256 168.635 1.00 99.31  ? 272 CYS C CB  1 
ATOM   9374  S  SG  . CYS C 1 271 ? 129.248 149.885 169.416 1.00 99.33  ? 272 CYS C SG  1 
ATOM   9375  N  N   . PRO C 1 272 ? 133.183 151.833 169.696 1.00 106.76 ? 273 PRO C N   1 
ATOM   9376  C  CA  . PRO C 1 272 ? 134.010 152.281 170.817 1.00 106.74 ? 273 PRO C CA  1 
ATOM   9377  C  C   . PRO C 1 272 ? 133.229 152.651 172.065 1.00 106.46 ? 273 PRO C C   1 
ATOM   9378  O  O   . PRO C 1 272 ? 133.738 152.494 173.165 1.00 106.46 ? 273 PRO C O   1 
ATOM   9379  C  CB  . PRO C 1 272 ? 134.734 153.502 170.252 1.00 106.89 ? 273 PRO C CB  1 
ATOM   9380  C  CG  . PRO C 1 272 ? 133.924 153.934 169.111 1.00 106.95 ? 273 PRO C CG  1 
ATOM   9381  C  CD  . PRO C 1 272 ? 133.346 152.703 168.526 1.00 106.90 ? 273 PRO C CD  1 
ATOM   9382  N  N   . GLY C 1 273 ? 132.011 153.141 171.904 1.00 92.54  ? 274 GLY C N   1 
ATOM   9383  C  CA  . GLY C 1 273 ? 131.263 153.609 173.050 1.00 92.14  ? 274 GLY C CA  1 
ATOM   9384  C  C   . GLY C 1 273 ? 130.738 152.505 173.942 1.00 91.66  ? 274 GLY C C   1 
ATOM   9385  O  O   . GLY C 1 273 ? 130.379 152.753 175.085 1.00 91.63  ? 274 GLY C O   1 
ATOM   9386  N  N   . CYS C 1 274 ? 130.701 151.285 173.423 1.00 93.32  ? 275 CYS C N   1 
ATOM   9387  C  CA  . CYS C 1 274 ? 130.183 150.157 174.178 1.00 92.69  ? 275 CYS C CA  1 
ATOM   9388  C  C   . CYS C 1 274 ? 131.019 149.875 175.409 1.00 91.85  ? 275 CYS C C   1 
ATOM   9389  O  O   . CYS C 1 274 ? 132.236 149.857 175.348 1.00 91.82  ? 275 CYS C O   1 
ATOM   9390  C  CB  . CYS C 1 274 ? 130.126 148.912 173.298 1.00 92.79  ? 275 CYS C CB  1 
ATOM   9391  S  SG  . CYS C 1 274 ? 129.427 147.464 174.090 1.00 92.79  ? 275 CYS C SG  1 
ATOM   9392  N  N   . ARG C 1 275 ? 130.350 149.648 176.529 1.00 101.59 ? 276 ARG C N   1 
ATOM   9393  C  CA  . ARG C 1 275 ? 131.034 149.304 177.758 1.00 100.57 ? 276 ARG C CA  1 
ATOM   9394  C  C   . ARG C 1 275 ? 131.110 147.802 177.924 1.00 98.04  ? 276 ARG C C   1 
ATOM   9395  O  O   . ARG C 1 275 ? 130.136 147.098 177.705 1.00 97.88  ? 276 ARG C O   1 
ATOM   9396  C  CB  . ARG C 1 275 ? 130.320 149.913 178.957 1.00 101.90 ? 276 ARG C CB  1 
ATOM   9397  C  CG  . ARG C 1 275 ? 130.410 151.416 179.045 1.00 102.98 ? 276 ARG C CG  1 
ATOM   9398  C  CD  . ARG C 1 275 ? 130.071 151.903 180.443 1.00 103.90 ? 276 ARG C CD  1 
ATOM   9399  N  NE  . ARG C 1 275 ? 131.203 151.787 181.357 1.00 104.62 ? 276 ARG C NE  1 
ATOM   9400  C  CZ  . ARG C 1 275 ? 131.095 151.663 182.674 1.00 105.35 ? 276 ARG C CZ  1 
ATOM   9401  N  NH1 . ARG C 1 275 ? 129.901 151.621 183.244 1.00 105.57 1 276 ARG C NH1 1 
ATOM   9402  N  NH2 . ARG C 1 275 ? 132.184 151.570 183.417 1.00 105.57 ? 276 ARG C NH2 1 
ATOM   9403  N  N   . ILE C 1 276 ? 132.272 147.316 178.332 1.00 84.48  ? 277 ILE C N   1 
ATOM   9404  C  CA  . ILE C 1 276 ? 132.489 145.892 178.497 1.00 82.10  ? 277 ILE C CA  1 
ATOM   9405  C  C   . ILE C 1 276 ? 132.448 145.500 179.952 1.00 79.88  ? 277 ILE C C   1 
ATOM   9406  O  O   . ILE C 1 276 ? 133.297 145.898 180.727 1.00 79.72  ? 277 ILE C O   1 
ATOM   9407  C  CB  . ILE C 1 276 ? 133.838 145.482 177.944 1.00 82.06  ? 277 ILE C CB  1 
ATOM   9408  C  CG1 . ILE C 1 276 ? 133.943 145.874 176.479 1.00 82.05  ? 277 ILE C CG1 1 
ATOM   9409  C  CG2 . ILE C 1 276 ? 134.027 144.004 178.091 1.00 82.04  ? 277 ILE C CG2 1 
ATOM   9410  C  CD1 . ILE C 1 276 ? 132.951 145.186 175.614 1.00 82.05  ? 277 ILE C CD1 1 
ATOM   9411  N  N   . ILE C 1 277 ? 131.459 144.701 180.313 1.00 66.40  ? 278 ILE C N   1 
ATOM   9412  C  CA  . ILE C 1 277 ? 131.263 144.288 181.687 1.00 64.49  ? 278 ILE C CA  1 
ATOM   9413  C  C   . ILE C 1 277 ? 131.583 142.818 181.888 1.00 64.42  ? 278 ILE C C   1 
ATOM   9414  O  O   . ILE C 1 277 ? 130.956 141.950 181.295 1.00 64.36  ? 278 ILE C O   1 
ATOM   9415  C  CB  . ILE C 1 277 ? 129.833 144.529 182.113 1.00 63.20  ? 278 ILE C CB  1 
ATOM   9416  C  CG1 . ILE C 1 277 ? 129.450 145.983 181.880 1.00 62.55  ? 278 ILE C CG1 1 
ATOM   9417  C  CG2 . ILE C 1 277 ? 129.659 144.174 183.545 1.00 62.86  ? 278 ILE C CG2 1 
ATOM   9418  C  CD1 . ILE C 1 277 ? 130.263 146.948 182.653 1.00 62.26  ? 278 ILE C CD1 1 
ATOM   9419  N  N   . GLY C 1 278 ? 132.561 142.544 182.738 1.00 75.10  ? 279 GLY C N   1 
ATOM   9420  C  CA  . GLY C 1 278 ? 132.985 141.182 182.990 1.00 75.28  ? 279 GLY C CA  1 
ATOM   9421  C  C   . GLY C 1 278 ? 132.439 140.634 184.284 1.00 75.60  ? 279 GLY C C   1 
ATOM   9422  O  O   . GLY C 1 278 ? 132.332 141.352 185.259 1.00 75.61  ? 279 GLY C O   1 
ATOM   9423  N  N   . VAL C 1 279 ? 132.096 139.353 184.297 1.00 69.04  ? 280 VAL C N   1 
ATOM   9424  C  CA  . VAL C 1 279 ? 131.550 138.734 185.497 1.00 69.51  ? 280 VAL C CA  1 
ATOM   9425  C  C   . VAL C 1 279 ? 132.402 137.598 186.030 1.00 70.36  ? 280 VAL C C   1 
ATOM   9426  O  O   . VAL C 1 279 ? 132.682 136.652 185.327 1.00 70.41  ? 280 VAL C O   1 
ATOM   9427  C  CB  . VAL C 1 279 ? 130.165 138.186 185.233 1.00 69.24  ? 280 VAL C CB  1 
ATOM   9428  C  CG1 . VAL C 1 279 ? 129.596 137.613 186.490 1.00 69.17  ? 280 VAL C CG1 1 
ATOM   9429  C  CG2 . VAL C 1 279 ? 129.278 139.268 184.706 1.00 69.17  ? 280 VAL C CG2 1 
ATOM   9430  N  N   . ASP C 1 280 ? 132.797 137.689 187.291 1.00 85.83  ? 281 ASP C N   1 
ATOM   9431  C  CA  . ASP C 1 280 ? 133.664 136.686 187.888 1.00 86.75  ? 281 ASP C CA  1 
ATOM   9432  C  C   . ASP C 1 280 ? 133.033 136.179 189.171 1.00 87.55  ? 281 ASP C C   1 
ATOM   9433  O  O   . ASP C 1 280 ? 132.564 136.960 189.976 1.00 87.54  ? 281 ASP C O   1 
ATOM   9434  C  CB  . ASP C 1 280 ? 135.036 137.303 188.172 1.00 86.84  ? 281 ASP C CB  1 
ATOM   9435  C  CG  . ASP C 1 280 ? 136.098 136.277 188.493 1.00 86.91  ? 281 ASP C CG  1 
ATOM   9436  O  OD1 . ASP C 1 280 ? 136.885 136.510 189.424 1.00 86.92  ? 281 ASP C OD1 1 
ATOM   9437  O  OD2 . ASP C 1 280 ? 136.170 135.249 187.809 1.00 86.94  1 281 ASP C OD2 1 
ATOM   9438  N  N   . PRO C 1 281 ? 132.997 134.860 189.352 1.00 74.76  ? 282 PRO C N   1 
ATOM   9439  C  CA  . PRO C 1 281 ? 132.446 134.233 190.550 1.00 75.38  ? 282 PRO C CA  1 
ATOM   9440  C  C   . PRO C 1 281 ? 133.249 134.549 191.795 1.00 76.10  ? 282 PRO C C   1 
ATOM   9441  O  O   . PRO C 1 281 ? 134.451 134.733 191.711 1.00 76.16  ? 282 PRO C O   1 
ATOM   9442  C  CB  . PRO C 1 281 ? 132.543 132.747 190.230 1.00 75.26  ? 282 PRO C CB  1 
ATOM   9443  C  CG  . PRO C 1 281 ? 133.645 132.642 189.295 1.00 75.09  ? 282 PRO C CG  1 
ATOM   9444  C  CD  . PRO C 1 281 ? 133.615 133.870 188.462 1.00 74.92  ? 282 PRO C CD  1 
ATOM   9445  N  N   . GLU C 1 282 ? 132.594 134.611 192.942 1.00 100.19 ? 283 GLU C N   1 
ATOM   9446  C  CA  . GLU C 1 282 ? 133.324 134.716 194.187 1.00 100.75 ? 283 GLU C CA  1 
ATOM   9447  C  C   . GLU C 1 282 ? 134.160 133.463 194.356 1.00 100.52 ? 283 GLU C C   1 
ATOM   9448  O  O   . GLU C 1 282 ? 133.695 132.368 194.105 1.00 100.54 ? 283 GLU C O   1 
ATOM   9449  C  CB  . GLU C 1 282 ? 132.362 134.898 195.362 1.00 101.35 ? 283 GLU C CB  1 
ATOM   9450  C  CG  . GLU C 1 282 ? 131.919 136.335 195.569 1.00 101.70 ? 283 GLU C CG  1 
ATOM   9451  C  CD  . GLU C 1 282 ? 130.708 136.474 196.478 1.00 101.92 ? 283 GLU C CD  1 
ATOM   9452  O  OE1 . GLU C 1 282 ? 129.988 137.491 196.367 1.00 101.99 ? 283 GLU C OE1 1 
ATOM   9453  O  OE2 . GLU C 1 282 ? 130.472 135.571 197.300 1.00 101.96 1 283 GLU C OE2 1 
ATOM   9454  N  N   . GLY C 1 283 ? 135.394 133.631 194.801 1.00 78.86  ? 284 GLY C N   1 
ATOM   9455  C  CA  . GLY C 1 283 ? 136.325 132.527 194.906 1.00 78.50  ? 284 GLY C CA  1 
ATOM   9456  C  C   . GLY C 1 283 ? 137.332 132.508 193.782 1.00 78.02  ? 284 GLY C C   1 
ATOM   9457  O  O   . GLY C 1 283 ? 138.338 131.821 193.853 1.00 77.97  ? 284 GLY C O   1 
ATOM   9458  N  N   . SER C 1 284 ? 137.058 133.280 192.741 1.00 85.40  ? 285 SER C N   1 
ATOM   9459  C  CA  . SER C 1 284 ? 137.965 133.414 191.610 1.00 84.91  ? 285 SER C CA  1 
ATOM   9460  C  C   . SER C 1 284 ? 138.828 134.656 191.742 1.00 84.49  ? 285 SER C C   1 
ATOM   9461  O  O   . SER C 1 284 ? 138.503 135.559 192.496 1.00 84.41  ? 285 SER C O   1 
ATOM   9462  C  CB  . SER C 1 284 ? 137.175 133.467 190.310 1.00 84.87  ? 285 SER C CB  1 
ATOM   9463  O  OG  . SER C 1 284 ? 138.014 133.742 189.212 1.00 84.86  ? 285 SER C OG  1 
ATOM   9464  N  N   . ILE C 1 285 ? 139.934 134.694 191.008 1.00 73.17  ? 286 ILE C N   1 
ATOM   9465  C  CA  . ILE C 1 285 ? 140.848 135.829 191.057 1.00 72.89  ? 286 ILE C CA  1 
ATOM   9466  C  C   . ILE C 1 285 ? 140.935 136.625 189.771 1.00 73.38  ? 286 ILE C C   1 
ATOM   9467  O  O   . ILE C 1 285 ? 141.775 137.498 189.647 1.00 73.38  ? 286 ILE C O   1 
ATOM   9468  C  CB  . ILE C 1 285 ? 142.267 135.396 191.405 1.00 72.28  ? 286 ILE C CB  1 
ATOM   9469  C  CG1 . ILE C 1 285 ? 142.772 134.402 190.371 1.00 71.95  ? 286 ILE C CG1 1 
ATOM   9470  C  CG2 . ILE C 1 285 ? 142.319 134.804 192.789 1.00 72.16  ? 286 ILE C CG2 1 
ATOM   9471  C  CD1 . ILE C 1 285 ? 144.235 134.474 190.143 1.00 71.76  ? 286 ILE C CD1 1 
ATOM   9472  N  N   . LEU C 1 286 ? 140.086 136.313 188.807 1.00 78.72  ? 287 LEU C N   1 
ATOM   9473  C  CA  . LEU C 1 286 ? 140.156 136.965 187.512 1.00 79.30  ? 287 LEU C CA  1 
ATOM   9474  C  C   . LEU C 1 286 ? 139.849 138.445 187.571 1.00 80.24  ? 287 LEU C C   1 
ATOM   9475  O  O   . LEU C 1 286 ? 140.377 139.226 186.795 1.00 80.30  ? 287 LEU C O   1 
ATOM   9476  C  CB  . LEU C 1 286 ? 139.197 136.307 186.533 1.00 79.09  ? 287 LEU C CB  1 
ATOM   9477  C  CG  . LEU C 1 286 ? 139.443 134.849 186.198 1.00 78.91  ? 287 LEU C CG  1 
ATOM   9478  C  CD1 . LEU C 1 286 ? 138.444 134.395 185.192 1.00 78.86  ? 287 LEU C CD1 1 
ATOM   9479  C  CD2 . LEU C 1 286 ? 140.818 134.685 185.656 1.00 78.88  ? 287 LEU C CD2 1 
ATOM   9480  N  N   . ALA C 1 287 ? 139.001 138.830 188.505 1.00 74.73  ? 288 ALA C N   1 
ATOM   9481  C  CA  . ALA C 1 287 ? 138.467 140.176 188.524 1.00 75.87  ? 288 ALA C CA  1 
ATOM   9482  C  C   . ALA C 1 287 ? 139.479 141.245 188.897 1.00 77.37  ? 288 ALA C C   1 
ATOM   9483  O  O   . ALA C 1 287 ? 140.452 140.984 189.585 1.00 77.53  ? 288 ALA C O   1 
ATOM   9484  C  CB  . ALA C 1 287 ? 137.281 140.240 189.437 1.00 75.68  ? 288 ALA C CB  1 
ATOM   9485  N  N   . GLU C 1 288 ? 139.235 142.455 188.420 1.00 93.96  ? 289 GLU C N   1 
ATOM   9486  C  CA  . GLU C 1 288 ? 140.015 143.606 188.821 1.00 95.61  ? 289 GLU C CA  1 
ATOM   9487  C  C   . GLU C 1 288 ? 139.087 144.710 189.287 1.00 96.89  ? 289 GLU C C   1 
ATOM   9488  O  O   . GLU C 1 288 ? 137.987 144.851 188.775 1.00 96.88  ? 289 GLU C O   1 
ATOM   9489  C  CB  . GLU C 1 288 ? 140.839 144.114 187.648 1.00 95.80  ? 289 GLU C CB  1 
ATOM   9490  C  CG  . GLU C 1 288 ? 141.914 143.172 187.175 1.00 95.89  ? 289 GLU C CG  1 
ATOM   9491  C  CD  . GLU C 1 288 ? 142.877 143.829 186.215 1.00 96.00  ? 289 GLU C CD  1 
ATOM   9492  O  OE1 . GLU C 1 288 ? 142.433 144.603 185.349 1.00 96.03  ? 289 GLU C OE1 1 
ATOM   9493  O  OE2 . GLU C 1 288 ? 144.088 143.579 186.337 1.00 96.01  1 289 GLU C OE2 1 
ATOM   9494  N  N   . PRO C 1 289 ? 139.532 145.515 190.251 1.00 83.33  ? 290 PRO C N   1 
ATOM   9495  C  CA  . PRO C 1 289 ? 140.789 145.474 190.994 1.00 84.31  ? 290 PRO C CA  1 
ATOM   9496  C  C   . PRO C 1 289 ? 140.864 144.310 191.961 1.00 85.68  ? 290 PRO C C   1 
ATOM   9497  O  O   . PRO C 1 289 ? 139.846 143.731 192.290 1.00 85.76  ? 290 PRO C O   1 
ATOM   9498  C  CB  . PRO C 1 289 ? 140.775 146.791 191.757 1.00 84.14  ? 290 PRO C CB  1 
ATOM   9499  C  CG  . PRO C 1 289 ? 139.371 147.098 191.925 1.00 83.88  ? 290 PRO C CG  1 
ATOM   9500  C  CD  . PRO C 1 289 ? 138.705 146.651 190.676 1.00 83.60  ? 290 PRO C CD  1 
ATOM   9501  N  N   . GLU C 1 290 ? 142.069 143.988 192.410 1.00 111.38 ? 291 GLU C N   1 
ATOM   9502  C  CA  . GLU C 1 290 ? 142.331 142.806 193.221 1.00 112.64 ? 291 GLU C CA  1 
ATOM   9503  C  C   . GLU C 1 290 ? 141.528 142.804 194.516 1.00 112.82 ? 291 GLU C C   1 
ATOM   9504  O  O   . GLU C 1 290 ? 141.229 141.752 195.067 1.00 112.92 ? 291 GLU C O   1 
ATOM   9505  C  CB  . GLU C 1 290 ? 143.825 142.733 193.540 1.00 113.35 ? 291 GLU C CB  1 
ATOM   9506  C  CG  . GLU C 1 290 ? 144.251 141.518 194.330 1.00 113.84 ? 291 GLU C CG  1 
ATOM   9507  C  CD  . GLU C 1 290 ? 144.155 140.237 193.536 1.00 114.06 ? 291 GLU C CD  1 
ATOM   9508  O  OE1 . GLU C 1 290 ? 144.400 140.275 192.315 1.00 114.17 ? 291 GLU C OE1 1 
ATOM   9509  O  OE2 . GLU C 1 290 ? 143.834 139.189 194.130 1.00 114.17 1 291 GLU C OE2 1 
ATOM   9510  N  N   . GLU C 1 291 ? 141.158 143.985 194.983 1.00 107.36 ? 292 GLU C N   1 
ATOM   9511  C  CA  . GLU C 1 291 ? 140.416 144.116 196.220 1.00 107.39 ? 292 GLU C CA  1 
ATOM   9512  C  C   . GLU C 1 291 ? 139.096 143.362 196.166 1.00 107.08 ? 292 GLU C C   1 
ATOM   9513  O  O   . GLU C 1 291 ? 138.595 142.905 197.184 1.00 107.04 ? 292 GLU C O   1 
ATOM   9514  C  CB  . GLU C 1 291 ? 140.143 145.589 196.489 1.00 107.65 ? 292 GLU C CB  1 
ATOM   9515  C  CG  . GLU C 1 291 ? 141.354 146.385 196.906 1.00 107.82 ? 292 GLU C CG  1 
ATOM   9516  C  CD  . GLU C 1 291 ? 142.177 146.895 195.755 1.00 107.89 ? 292 GLU C CD  1 
ATOM   9517  O  OE1 . GLU C 1 291 ? 141.618 147.543 194.854 1.00 107.91 ? 292 GLU C OE1 1 
ATOM   9518  O  OE2 . GLU C 1 291 ? 143.399 146.662 195.761 1.00 107.93 1 292 GLU C OE2 1 
ATOM   9519  N  N   . LEU C 1 292 ? 138.534 143.246 194.970 1.00 79.17  ? 293 LEU C N   1 
ATOM   9520  C  CA  . LEU C 1 292 ? 137.293 142.514 194.760 1.00 79.02  ? 293 LEU C CA  1 
ATOM   9521  C  C   . LEU C 1 292 ? 137.426 141.020 194.977 1.00 81.27  ? 293 LEU C C   1 
ATOM   9522  O  O   . LEU C 1 292 ? 136.460 140.355 195.305 1.00 81.19  ? 293 LEU C O   1 
ATOM   9523  C  CB  . LEU C 1 292 ? 136.769 142.766 193.354 1.00 77.24  ? 293 LEU C CB  1 
ATOM   9524  C  CG  . LEU C 1 292 ? 136.097 144.101 193.081 1.00 75.82  ? 293 LEU C CG  1 
ATOM   9525  C  CD1 . LEU C 1 292 ? 135.925 144.298 191.607 1.00 75.33  ? 293 LEU C CD1 1 
ATOM   9526  C  CD2 . LEU C 1 292 ? 134.764 144.158 193.773 1.00 75.35  ? 293 LEU C CD2 1 
ATOM   9527  N  N   . ASN C 1 293 ? 138.624 140.492 194.787 1.00 92.20  ? 294 ASN C N   1 
ATOM   9528  C  CA  . ASN C 1 293 ? 138.820 139.054 194.802 1.00 94.87  ? 294 ASN C CA  1 
ATOM   9529  C  C   . ASN C 1 293 ? 138.915 138.486 196.192 1.00 98.81  ? 294 ASN C C   1 
ATOM   9530  O  O   . ASN C 1 293 ? 138.919 137.280 196.383 1.00 99.17  ? 294 ASN C O   1 
ATOM   9531  C  CB  . ASN C 1 293 ? 140.072 138.677 194.019 1.00 94.12  ? 294 ASN C CB  1 
ATOM   9532  C  CG  . ASN C 1 293 ? 139.947 138.976 192.557 1.00 93.47  ? 294 ASN C CG  1 
ATOM   9533  O  OD1 . ASN C 1 293 ? 138.858 138.965 192.009 1.00 93.15  ? 294 ASN C OD1 1 
ATOM   9534  N  ND2 . ASN C 1 293 ? 141.064 139.245 191.911 1.00 93.20  ? 294 ASN C ND2 1 
ATOM   9535  N  N   . GLN C 1 294 ? 138.995 139.364 197.169 1.00 125.44 ? 295 GLN C N   1 
ATOM   9536  C  CA  . GLN C 1 294 ? 139.222 138.940 198.533 1.00 129.58 ? 295 GLN C CA  1 
ATOM   9537  C  C   . GLN C 1 294 ? 137.990 138.312 199.143 1.00 132.46 ? 295 GLN C C   1 
ATOM   9538  O  O   . GLN C 1 294 ? 136.958 138.955 199.267 1.00 132.73 ? 295 GLN C O   1 
ATOM   9539  C  CB  . GLN C 1 294 ? 139.679 140.137 199.335 1.00 130.57 ? 295 GLN C CB  1 
ATOM   9540  C  CG  . GLN C 1 294 ? 140.860 140.818 198.671 1.00 131.23 ? 295 GLN C CG  1 
ATOM   9541  C  CD  . GLN C 1 294 ? 142.142 140.037 198.841 1.00 131.84 ? 295 GLN C CD  1 
ATOM   9542  O  OE1 . GLN C 1 294 ? 142.250 139.191 199.729 1.00 131.96 ? 295 GLN C OE1 1 
ATOM   9543  N  NE2 . GLN C 1 294 ? 143.124 140.314 197.992 1.00 132.18 ? 295 GLN C NE2 1 
ATOM   9544  N  N   . THR C 1 295 ? 138.121 137.052 199.547 1.00 119.84 ? 296 THR C N   1 
ATOM   9545  C  CA  . THR C 1 295 ? 136.966 136.238 199.914 1.00 122.55 ? 296 THR C CA  1 
ATOM   9546  C  C   . THR C 1 295 ? 137.302 135.089 200.858 1.00 124.73 ? 296 THR C C   1 
ATOM   9547  O  O   . THR C 1 295 ? 138.448 134.662 200.956 1.00 124.96 ? 296 THR C O   1 
ATOM   9548  C  CB  . THR C 1 295 ? 136.336 135.618 198.679 1.00 122.85 ? 296 THR C CB  1 
ATOM   9549  O  OG1 . THR C 1 295 ? 135.251 134.774 199.076 1.00 122.95 ? 296 THR C OG1 1 
ATOM   9550  C  CG2 . THR C 1 295 ? 137.371 134.789 197.936 1.00 122.87 ? 296 THR C CG2 1 
ATOM   9551  N  N   . GLN C 1 297 ? 135.408 132.011 200.713 1.00 150.99 ? 298 GLN C N   1 
ATOM   9552  C  CA  . GLN C 1 297 ? 135.185 130.836 199.883 1.00 149.44 ? 298 GLN C CA  1 
ATOM   9553  C  C   . GLN C 1 297 ? 136.244 130.721 198.794 1.00 145.18 ? 298 GLN C C   1 
ATOM   9554  O  O   . GLN C 1 297 ? 136.776 131.723 198.338 1.00 144.76 ? 298 GLN C O   1 
ATOM   9555  C  CB  . GLN C 1 297 ? 133.797 130.905 199.253 1.00 151.35 ? 298 GLN C CB  1 
ATOM   9556  C  CG  . GLN C 1 297 ? 132.671 130.977 200.270 1.00 152.71 ? 298 GLN C CG  1 
ATOM   9557  C  CD  . GLN C 1 297 ? 131.307 131.071 199.625 1.00 153.57 ? 298 GLN C CD  1 
ATOM   9558  O  OE1 . GLN C 1 297 ? 131.185 131.446 198.461 1.00 153.75 ? 298 GLN C OE1 1 
ATOM   9559  N  NE2 . GLN C 1 297 ? 130.270 130.726 200.380 1.00 154.17 ? 298 GLN C NE2 1 
ATOM   9560  N  N   . THR C 1 298 ? 136.556 129.499 198.378 1.00 132.51 ? 299 THR C N   1 
ATOM   9561  C  CA  . THR C 1 298 ? 137.484 129.312 197.270 1.00 128.45 ? 299 THR C CA  1 
ATOM   9562  C  C   . THR C 1 298 ? 136.920 128.426 196.167 1.00 123.77 ? 299 THR C C   1 
ATOM   9563  O  O   . THR C 1 298 ? 137.288 128.577 195.011 1.00 123.45 ? 299 THR C O   1 
ATOM   9564  C  CB  . THR C 1 298 ? 138.847 128.775 197.732 1.00 128.91 ? 299 THR C CB  1 
ATOM   9565  O  OG1 . THR C 1 298 ? 139.692 128.585 196.594 1.00 128.96 ? 299 THR C OG1 1 
ATOM   9566  C  CG2 . THR C 1 298 ? 138.690 127.454 198.461 1.00 129.15 ? 299 THR C CG2 1 
ATOM   9567  N  N   . THR C 1 299 ? 136.039 127.498 196.526 1.00 115.67 ? 300 THR C N   1 
ATOM   9568  C  CA  . THR C 1 299 ? 135.312 126.704 195.536 1.00 111.25 ? 300 THR C CA  1 
ATOM   9569  C  C   . THR C 1 299 ? 133.842 127.085 195.492 1.00 106.75 ? 300 THR C C   1 
ATOM   9570  O  O   . THR C 1 299 ? 133.291 127.574 196.470 1.00 106.46 ? 300 THR C O   1 
ATOM   9571  C  CB  . THR C 1 299 ? 135.417 125.216 195.802 1.00 111.46 ? 300 THR C CB  1 
ATOM   9572  O  OG1 . THR C 1 299 ? 135.052 124.952 197.158 1.00 111.46 ? 300 THR C OG1 1 
ATOM   9573  C  CG2 . THR C 1 299 ? 136.824 124.745 195.563 1.00 111.69 ? 300 THR C CG2 1 
ATOM   9574  N  N   . TYR C 1 300 ? 133.210 126.847 194.352 1.00 84.50  ? 301 TYR C N   1 
ATOM   9575  C  CA  . TYR C 1 300 ? 131.836 127.259 194.140 1.00 80.71  ? 301 TYR C CA  1 
ATOM   9576  C  C   . TYR C 1 300 ? 131.132 126.305 193.211 1.00 78.32  ? 301 TYR C C   1 
ATOM   9577  O  O   . TYR C 1 300 ? 131.765 125.621 192.429 1.00 78.03  ? 301 TYR C O   1 
ATOM   9578  C  CB  . TYR C 1 300 ? 131.786 128.668 193.569 1.00 79.78  ? 301 TYR C CB  1 
ATOM   9579  C  CG  . TYR C 1 300 ? 132.819 128.931 192.513 1.00 78.92  ? 301 TYR C CG  1 
ATOM   9580  C  CD1 . TYR C 1 300 ? 132.589 128.603 191.200 1.00 78.40  ? 301 TYR C CD1 1 
ATOM   9581  C  CD2 . TYR C 1 300 ? 134.022 129.509 192.831 1.00 78.39  ? 301 TYR C CD2 1 
ATOM   9582  C  CE1 . TYR C 1 300 ? 133.529 128.837 190.244 1.00 78.03  ? 301 TYR C CE1 1 
ATOM   9583  C  CE2 . TYR C 1 300 ? 134.961 129.743 191.881 1.00 78.05  ? 301 TYR C CE2 1 
ATOM   9584  C  CZ  . TYR C 1 300 ? 134.711 129.408 190.590 1.00 77.91  ? 301 TYR C CZ  1 
ATOM   9585  O  OH  . TYR C 1 300 ? 135.658 129.648 189.638 1.00 77.62  ? 301 TYR C OH  1 
ATOM   9586  N  N   . GLU C 1 301 ? 129.816 126.244 193.327 1.00 82.74  ? 302 GLU C N   1 
ATOM   9587  C  CA  . GLU C 1 301 ? 129.028 125.293 192.564 1.00 80.77  ? 302 GLU C CA  1 
ATOM   9588  C  C   . GLU C 1 301 ? 128.884 125.582 191.078 1.00 79.04  ? 302 GLU C C   1 
ATOM   9589  O  O   . GLU C 1 301 ? 128.710 124.665 190.293 1.00 78.87  ? 302 GLU C O   1 
ATOM   9590  C  CB  . GLU C 1 301 ? 127.662 125.122 193.210 1.00 80.68  ? 302 GLU C CB  1 
ATOM   9591  C  CG  . GLU C 1 301 ? 127.721 124.634 194.641 1.00 80.68  ? 302 GLU C CG  1 
ATOM   9592  C  CD  . GLU C 1 301 ? 128.172 123.202 194.755 1.00 80.66  ? 302 GLU C CD  1 
ATOM   9593  O  OE1 . GLU C 1 301 ? 128.120 122.482 193.745 1.00 80.64  ? 302 GLU C OE1 1 
ATOM   9594  O  OE2 . GLU C 1 301 ? 128.579 122.792 195.855 1.00 80.63  1 302 GLU C OE2 1 
ATOM   9595  N  N   . VAL C 1 302 ? 128.953 126.846 190.692 1.00 73.96  ? 303 VAL C N   1 
ATOM   9596  C  CA  . VAL C 1 302 ? 128.778 127.211 189.295 1.00 72.50  ? 303 VAL C CA  1 
ATOM   9597  C  C   . VAL C 1 302 ? 129.906 126.683 188.440 1.00 71.57  ? 303 VAL C C   1 
ATOM   9598  O  O   . VAL C 1 302 ? 131.060 126.793 188.801 1.00 71.53  ? 303 VAL C O   1 
ATOM   9599  C  CB  . VAL C 1 302 ? 128.654 128.723 189.132 1.00 72.15  ? 303 VAL C CB  1 
ATOM   9600  C  CG1 . VAL C 1 302 ? 128.721 129.114 187.691 1.00 72.00  ? 303 VAL C CG1 1 
ATOM   9601  C  CG2 . VAL C 1 302 ? 127.360 129.191 189.713 1.00 72.10  ? 303 VAL C CG2 1 
ATOM   9602  N  N   . GLU C 1 303 ? 129.558 126.116 187.294 1.00 78.06  ? 304 GLU C N   1 
ATOM   9603  C  CA  . GLU C 1 303 ? 130.529 125.494 186.412 1.00 77.25  ? 304 GLU C CA  1 
ATOM   9604  C  C   . GLU C 1 303 ? 130.848 126.347 185.199 1.00 76.52  ? 304 GLU C C   1 
ATOM   9605  O  O   . GLU C 1 303 ? 129.984 127.010 184.655 1.00 76.47  ? 304 GLU C O   1 
ATOM   9606  C  CB  . GLU C 1 303 ? 130.019 124.130 185.959 1.00 77.21  ? 304 GLU C CB  1 
ATOM   9607  C  CG  . GLU C 1 303 ? 129.755 123.174 187.095 1.00 77.22  ? 304 GLU C CG  1 
ATOM   9608  C  CD  . GLU C 1 303 ? 129.135 121.873 186.655 1.00 77.23  ? 304 GLU C CD  1 
ATOM   9609  O  OE1 . GLU C 1 303 ? 128.156 121.445 187.287 1.00 77.24  ? 304 GLU C OE1 1 
ATOM   9610  O  OE2 . GLU C 1 303 ? 129.629 121.268 185.694 1.00 77.23  1 304 GLU C OE2 1 
ATOM   9611  N  N   . GLY C 1 304 ? 132.103 126.319 184.782 1.00 66.86  ? 305 GLY C N   1 
ATOM   9612  C  CA  . GLY C 1 304 ? 132.517 126.936 183.541 1.00 66.23  ? 305 GLY C CA  1 
ATOM   9613  C  C   . GLY C 1 304 ? 133.110 128.321 183.604 1.00 65.65  ? 305 GLY C C   1 
ATOM   9614  O  O   . GLY C 1 304 ? 133.676 128.783 182.633 1.00 65.59  ? 305 GLY C O   1 
ATOM   9615  N  N   . ILE C 1 305 ? 133.006 128.978 184.747 1.00 65.01  ? 306 ILE C N   1 
ATOM   9616  C  CA  . ILE C 1 305 ? 133.595 130.295 184.911 1.00 64.59  ? 306 ILE C CA  1 
ATOM   9617  C  C   . ILE C 1 305 ? 134.486 130.374 186.136 1.00 64.87  ? 306 ILE C C   1 
ATOM   9618  O  O   . ILE C 1 305 ? 134.295 129.654 187.096 1.00 64.92  ? 306 ILE C O   1 
ATOM   9619  C  CB  . ILE C 1 305 ? 132.537 131.398 185.010 1.00 64.06  ? 306 ILE C CB  1 
ATOM   9620  C  CG1 . ILE C 1 305 ? 131.538 131.083 186.113 1.00 63.80  ? 306 ILE C CG1 1 
ATOM   9621  C  CG2 . ILE C 1 305 ? 131.823 131.562 183.713 1.00 63.96  ? 306 ILE C CG2 1 
ATOM   9622  C  CD1 . ILE C 1 305 ? 130.665 132.240 186.477 1.00 63.66  ? 306 ILE C CD1 1 
ATOM   9623  N  N   . GLY C 1 306 ? 135.477 131.251 186.083 1.00 64.80  ? 307 GLY C N   1 
ATOM   9624  C  CA  . GLY C 1 306 ? 136.352 131.504 187.208 1.00 65.23  ? 307 GLY C CA  1 
ATOM   9625  C  C   . GLY C 1 306 ? 137.560 130.603 187.253 1.00 65.72  ? 307 GLY C C   1 
ATOM   9626  O  O   . GLY C 1 306 ? 137.488 129.449 186.871 1.00 65.71  ? 307 GLY C O   1 
ATOM   9627  N  N   . TYR C 1 307 ? 138.670 131.133 187.747 1.00 72.12  ? 308 TYR C N   1 
ATOM   9628  C  CA  . TYR C 1 307 ? 139.913 130.378 187.828 1.00 72.67  ? 308 TYR C CA  1 
ATOM   9629  C  C   . TYR C 1 307 ? 140.871 130.907 188.888 1.00 73.34  ? 308 TYR C C   1 
ATOM   9630  O  O   . TYR C 1 307 ? 140.781 132.049 189.301 1.00 73.37  ? 308 TYR C O   1 
ATOM   9631  C  CB  . TYR C 1 307 ? 140.623 130.366 186.480 1.00 72.59  ? 308 TYR C CB  1 
ATOM   9632  C  CG  . TYR C 1 307 ? 140.143 129.313 185.510 1.00 72.51  ? 308 TYR C CG  1 
ATOM   9633  C  CD1 . TYR C 1 307 ? 139.571 129.664 184.308 1.00 72.49  ? 308 TYR C CD1 1 
ATOM   9634  C  CD2 . TYR C 1 307 ? 140.277 127.974 185.793 1.00 72.49  ? 308 TYR C CD2 1 
ATOM   9635  C  CE1 . TYR C 1 307 ? 139.143 128.719 183.425 1.00 72.49  ? 308 TYR C CE1 1 
ATOM   9636  C  CE2 . TYR C 1 307 ? 139.851 127.025 184.913 1.00 72.48  ? 308 TYR C CE2 1 
ATOM   9637  C  CZ  . TYR C 1 307 ? 139.285 127.400 183.731 1.00 72.49  ? 308 TYR C CZ  1 
ATOM   9638  O  OH  . TYR C 1 307 ? 138.858 126.447 182.845 1.00 72.50  ? 308 TYR C OH  1 
ATOM   9639  N  N   . ASP C 1 308 ? 141.790 130.054 189.318 1.00 79.60  ? 309 ASP C N   1 
ATOM   9640  C  CA  . ASP C 1 308 ? 142.798 130.426 190.300 1.00 80.19  ? 309 ASP C CA  1 
ATOM   9641  C  C   . ASP C 1 308 ? 144.081 130.909 189.651 1.00 80.53  ? 309 ASP C C   1 
ATOM   9642  O  O   . ASP C 1 308 ? 145.119 130.980 190.287 1.00 80.57  ? 309 ASP C O   1 
ATOM   9643  C  CB  . ASP C 1 308 ? 143.074 129.283 191.281 1.00 80.37  ? 309 ASP C CB  1 
ATOM   9644  C  CG  . ASP C 1 308 ? 143.508 128.012 190.602 1.00 80.45  ? 309 ASP C CG  1 
ATOM   9645  O  OD1 . ASP C 1 308 ? 143.100 127.780 189.456 1.00 80.49  ? 309 ASP C OD1 1 
ATOM   9646  O  OD2 . ASP C 1 308 ? 144.252 127.234 191.229 1.00 80.54  1 309 ASP C OD2 1 
ATOM   9647  N  N   . PHE C 1 309 ? 144.003 131.212 188.368 1.00 74.29  ? 310 PHE C N   1 
ATOM   9648  C  CA  . PHE C 1 309 ? 145.121 131.769 187.634 1.00 74.55  ? 310 PHE C CA  1 
ATOM   9649  C  C   . PHE C 1 309 ? 144.568 132.573 186.486 1.00 74.55  ? 310 PHE C C   1 
ATOM   9650  O  O   . PHE C 1 309 ? 143.443 132.369 186.082 1.00 74.58  ? 310 PHE C O   1 
ATOM   9651  C  CB  . PHE C 1 309 ? 146.019 130.663 187.100 1.00 74.72  ? 310 PHE C CB  1 
ATOM   9652  C  CG  . PHE C 1 309 ? 145.378 129.827 186.052 1.00 74.83  ? 310 PHE C CG  1 
ATOM   9653  C  CD1 . PHE C 1 309 ? 145.571 130.097 184.724 1.00 74.89  ? 310 PHE C CD1 1 
ATOM   9654  C  CD2 . PHE C 1 309 ? 144.575 128.771 186.395 1.00 74.88  ? 310 PHE C CD2 1 
ATOM   9655  C  CE1 . PHE C 1 309 ? 144.975 129.333 183.767 1.00 74.92  ? 310 PHE C CE1 1 
ATOM   9656  C  CE2 . PHE C 1 309 ? 143.979 128.009 185.439 1.00 74.91  ? 310 PHE C CE2 1 
ATOM   9657  C  CZ  . PHE C 1 309 ? 144.181 128.290 184.124 1.00 74.92  ? 310 PHE C CZ  1 
ATOM   9658  N  N   . ILE C 1 310 ? 145.362 133.484 185.954 1.00 75.57  ? 311 ILE C N   1 
ATOM   9659  C  CA  . ILE C 1 310 ? 144.909 134.306 184.854 1.00 75.52  ? 311 ILE C CA  1 
ATOM   9660  C  C   . ILE C 1 310 ? 145.365 133.695 183.554 1.00 75.40  ? 311 ILE C C   1 
ATOM   9661  O  O   . ILE C 1 310 ? 146.551 133.630 183.290 1.00 75.54  ? 311 ILE C O   1 
ATOM   9662  C  CB  . ILE C 1 310 ? 145.515 135.696 184.951 1.00 75.57  ? 311 ILE C CB  1 
ATOM   9663  C  CG1 . ILE C 1 310 ? 145.282 136.273 186.341 1.00 75.60  ? 311 ILE C CG1 1 
ATOM   9664  C  CG2 . ILE C 1 310 ? 144.939 136.602 183.896 1.00 75.58  ? 311 ILE C CG2 1 
ATOM   9665  C  CD1 . ILE C 1 310 ? 143.846 136.508 186.655 1.00 75.61  ? 311 ILE C CD1 1 
ATOM   9666  N  N   . PRO C 1 311 ? 144.417 133.251 182.727 1.00 72.47  ? 312 PRO C N   1 
ATOM   9667  C  CA  . PRO C 1 311 ? 144.745 132.619 181.456 1.00 72.30  ? 312 PRO C CA  1 
ATOM   9668  C  C   . PRO C 1 311 ? 145.435 133.574 180.504 1.00 72.05  ? 312 PRO C C   1 
ATOM   9669  O  O   . PRO C 1 311 ? 145.128 134.754 180.500 1.00 72.05  ? 312 PRO C O   1 
ATOM   9670  C  CB  . PRO C 1 311 ? 143.380 132.210 180.920 1.00 72.35  ? 312 PRO C CB  1 
ATOM   9671  C  CG  . PRO C 1 311 ? 142.517 132.153 182.088 1.00 72.40  ? 312 PRO C CG  1 
ATOM   9672  C  CD  . PRO C 1 311 ? 142.972 133.251 182.960 1.00 72.44  ? 312 PRO C CD  1 
ATOM   9673  N  N   . THR C 1 312 ? 146.347 133.051 179.697 1.00 76.82  ? 313 THR C N   1 
ATOM   9674  C  CA  . THR C 1 312 ? 147.140 133.861 178.791 1.00 76.59  ? 313 THR C CA  1 
ATOM   9675  C  C   . THR C 1 312 ? 146.267 134.563 177.771 1.00 76.36  ? 313 THR C C   1 
ATOM   9676  O  O   . THR C 1 312 ? 146.514 135.702 177.412 1.00 76.41  ? 313 THR C O   1 
ATOM   9677  C  CB  . THR C 1 312 ? 148.147 132.983 178.038 1.00 76.63  ? 313 THR C CB  1 
ATOM   9678  O  OG1 . THR C 1 312 ? 148.979 132.296 178.971 1.00 76.63  ? 313 THR C OG1 1 
ATOM   9679  C  CG2 . THR C 1 312 ? 149.015 133.809 177.151 1.00 76.70  ? 313 THR C CG2 1 
ATOM   9680  N  N   . VAL C 1 313 ? 145.224 133.888 177.321 1.00 65.79  ? 314 VAL C N   1 
ATOM   9681  C  CA  . VAL C 1 313 ? 144.359 134.462 176.311 1.00 65.69  ? 314 VAL C CA  1 
ATOM   9682  C  C   . VAL C 1 313 ? 143.518 135.601 176.849 1.00 66.49  ? 314 VAL C C   1 
ATOM   9683  O  O   . VAL C 1 313 ? 143.066 136.442 176.099 1.00 66.53  ? 314 VAL C O   1 
ATOM   9684  C  CB  . VAL C 1 313 ? 143.465 133.410 175.661 1.00 65.03  ? 314 VAL C CB  1 
ATOM   9685  C  CG1 . VAL C 1 313 ? 144.291 132.440 174.876 1.00 64.82  ? 314 VAL C CG1 1 
ATOM   9686  C  CG2 . VAL C 1 313 ? 142.673 132.682 176.699 1.00 64.83  ? 314 VAL C CG2 1 
ATOM   9687  N  N   . LEU C 1 314 ? 143.299 135.621 178.152 1.00 77.66  ? 315 LEU C N   1 
ATOM   9688  C  CA  . LEU C 1 314 ? 142.529 136.690 178.757 1.00 78.65  ? 315 LEU C CA  1 
ATOM   9689  C  C   . LEU C 1 314 ? 143.261 138.015 178.684 1.00 79.84  ? 315 LEU C C   1 
ATOM   9690  O  O   . LEU C 1 314 ? 144.444 138.084 178.967 1.00 79.94  ? 315 LEU C O   1 
ATOM   9691  C  CB  . LEU C 1 314 ? 142.206 136.353 180.208 1.00 78.52  ? 315 LEU C CB  1 
ATOM   9692  C  CG  . LEU C 1 314 ? 141.482 137.427 181.009 1.00 78.44  ? 315 LEU C CG  1 
ATOM   9693  C  CD1 . LEU C 1 314 ? 140.216 137.837 180.316 1.00 78.41  ? 315 LEU C CD1 1 
ATOM   9694  C  CD2 . LEU C 1 314 ? 141.175 136.918 182.385 1.00 78.42  ? 315 LEU C CD2 1 
ATOM   9695  N  N   . ASP C 1 315 ? 142.534 139.068 178.333 1.00 79.12  ? 316 ASP C N   1 
ATOM   9696  C  CA  . ASP C 1 315 ? 143.065 140.421 178.320 1.00 80.39  ? 316 ASP C CA  1 
ATOM   9697  C  C   . ASP C 1 315 ? 142.203 141.287 179.191 1.00 81.47  ? 316 ASP C C   1 
ATOM   9698  O  O   . ASP C 1 315 ? 141.142 141.719 178.792 1.00 81.57  ? 316 ASP C O   1 
ATOM   9699  C  CB  . ASP C 1 315 ? 143.088 140.991 176.906 1.00 80.50  ? 316 ASP C CB  1 
ATOM   9700  C  CG  . ASP C 1 315 ? 143.601 142.413 176.855 1.00 80.57  ? 316 ASP C CG  1 
ATOM   9701  O  OD1 . ASP C 1 315 ? 143.657 142.983 175.751 1.00 80.60  ? 316 ASP C OD1 1 
ATOM   9702  O  OD2 . ASP C 1 315 ? 143.941 142.970 177.911 1.00 80.61  1 316 ASP C OD2 1 
ATOM   9703  N  N   . ARG C 1 316 ? 142.677 141.553 180.390 1.00 84.06  ? 317 ARG C N   1 
ATOM   9704  C  CA  . ARG C 1 316 ? 141.887 142.274 181.358 1.00 84.98  ? 317 ARG C CA  1 
ATOM   9705  C  C   . ARG C 1 316 ? 141.869 143.762 181.072 1.00 85.09  ? 317 ARG C C   1 
ATOM   9706  O  O   . ARG C 1 316 ? 141.125 144.504 181.688 1.00 85.12  ? 317 ARG C O   1 
ATOM   9707  C  CB  . ARG C 1 316 ? 142.408 141.988 182.760 1.00 85.64  ? 317 ARG C CB  1 
ATOM   9708  C  CG  . ARG C 1 316 ? 142.436 140.521 183.087 1.00 86.14  ? 317 ARG C CG  1 
ATOM   9709  C  CD  . ARG C 1 316 ? 143.523 140.201 184.069 1.00 86.60  ? 317 ARG C CD  1 
ATOM   9710  N  NE  . ARG C 1 316 ? 143.040 140.170 185.439 1.00 86.95  ? 317 ARG C NE  1 
ATOM   9711  C  CZ  . ARG C 1 316 ? 143.832 140.105 186.496 1.00 87.30  ? 317 ARG C CZ  1 
ATOM   9712  N  NH1 . ARG C 1 316 ? 145.137 140.078 186.331 1.00 87.39  1 317 ARG C NH1 1 
ATOM   9713  N  NH2 . ARG C 1 316 ? 143.321 140.078 187.714 1.00 87.43  ? 317 ARG C NH2 1 
ATOM   9714  N  N   . THR C 1 317 ? 142.713 144.202 180.154 1.00 86.89  ? 318 THR C N   1 
ATOM   9715  C  CA  . THR C 1 317 ? 142.756 145.609 179.801 1.00 86.87  ? 318 THR C CA  1 
ATOM   9716  C  C   . THR C 1 317 ? 141.496 146.081 179.111 1.00 86.53  ? 318 THR C C   1 
ATOM   9717  O  O   . THR C 1 317 ? 141.105 147.226 179.254 1.00 86.53  ? 318 THR C O   1 
ATOM   9718  C  CB  . THR C 1 317 ? 143.957 145.935 178.911 1.00 87.07  ? 318 THR C CB  1 
ATOM   9719  O  OG1 . THR C 1 317 ? 143.781 145.327 177.632 1.00 87.08  ? 318 THR C OG1 1 
ATOM   9720  C  CG2 . THR C 1 317 ? 145.231 145.416 179.531 1.00 87.17  ? 318 THR C CG2 1 
ATOM   9721  N  N   . VAL C 1 318 ? 140.860 145.198 178.354 1.00 89.63  ? 319 VAL C N   1 
ATOM   9722  C  CA  . VAL C 1 318 ? 139.683 145.585 177.588 1.00 89.21  ? 319 VAL C CA  1 
ATOM   9723  C  C   . VAL C 1 318 ? 138.375 145.476 178.349 1.00 88.56  ? 319 VAL C C   1 
ATOM   9724  O  O   . VAL C 1 318 ? 137.335 145.875 177.853 1.00 88.51  ? 319 VAL C O   1 
ATOM   9725  C  CB  . VAL C 1 318 ? 139.575 144.828 176.267 1.00 89.40  ? 319 VAL C CB  1 
ATOM   9726  C  CG1 . VAL C 1 318 ? 140.704 145.222 175.357 1.00 89.47  ? 319 VAL C CG1 1 
ATOM   9727  C  CG2 . VAL C 1 318 ? 139.593 143.354 176.508 1.00 89.47  ? 319 VAL C CG2 1 
ATOM   9728  N  N   . VAL C 1 319 ? 138.425 144.941 179.554 1.00 72.53  ? 320 VAL C N   1 
ATOM   9729  C  CA  . VAL C 1 319 ? 137.241 144.896 180.382 1.00 71.95  ? 320 VAL C CA  1 
ATOM   9730  C  C   . VAL C 1 319 ? 137.116 146.177 181.170 1.00 71.95  ? 320 VAL C C   1 
ATOM   9731  O  O   . VAL C 1 319 ? 137.910 146.442 182.052 1.00 71.93  ? 320 VAL C O   1 
ATOM   9732  C  CB  . VAL C 1 319 ? 137.309 143.745 181.357 1.00 71.49  ? 320 VAL C CB  1 
ATOM   9733  C  CG1 . VAL C 1 319 ? 136.067 143.712 182.194 1.00 71.32  ? 320 VAL C CG1 1 
ATOM   9734  C  CG2 . VAL C 1 319 ? 137.472 142.458 180.613 1.00 71.37  ? 320 VAL C CG2 1 
ATOM   9735  N  N   . ASP C 1 320 ? 136.123 146.984 180.837 1.00 84.46  ? 321 ASP C N   1 
ATOM   9736  C  CA  . ASP C 1 320 ? 135.958 148.272 181.482 1.00 84.46  ? 321 ASP C CA  1 
ATOM   9737  C  C   . ASP C 1 320 ? 135.606 148.187 182.964 1.00 84.23  ? 321 ASP C C   1 
ATOM   9738  O  O   . ASP C 1 320 ? 136.059 148.999 183.753 1.00 84.24  ? 321 ASP C O   1 
ATOM   9739  C  CB  . ASP C 1 320 ? 134.920 149.101 180.736 1.00 84.60  ? 321 ASP C CB  1 
ATOM   9740  C  CG  . ASP C 1 320 ? 135.329 149.403 179.323 1.00 84.70  ? 321 ASP C CG  1 
ATOM   9741  O  OD1 . ASP C 1 320 ? 136.522 149.650 179.097 1.00 84.73  ? 321 ASP C OD1 1 
ATOM   9742  O  OD2 . ASP C 1 320 ? 134.461 149.392 178.434 1.00 84.76  1 321 ASP C OD2 1 
ATOM   9743  N  N   . LYS C 1 321 ? 134.827 147.188 183.347 1.00 80.67  ? 322 LYS C N   1 
ATOM   9744  C  CA  . LYS C 1 321 ? 134.454 147.024 184.743 1.00 80.36  ? 322 LYS C CA  1 
ATOM   9745  C  C   . LYS C 1 321 ? 134.089 145.588 185.064 1.00 79.47  ? 322 LYS C C   1 
ATOM   9746  O  O   . LYS C 1 321 ? 133.508 144.888 184.244 1.00 79.41  ? 322 LYS C O   1 
ATOM   9747  C  CB  . LYS C 1 321 ? 133.296 147.952 185.109 1.00 80.84  ? 322 LYS C CB  1 
ATOM   9748  C  CG  . LYS C 1 321 ? 132.904 147.933 186.583 1.00 81.24  ? 322 LYS C CG  1 
ATOM   9749  C  CD  . LYS C 1 321 ? 131.781 148.906 186.879 1.00 81.59  ? 322 LYS C CD  1 
ATOM   9750  C  CE  . LYS C 1 321 ? 131.467 148.975 188.351 1.00 81.82  ? 322 LYS C CE  1 
ATOM   9751  N  NZ  . LYS C 1 321 ? 130.352 149.918 188.621 1.00 81.94  1 322 LYS C NZ  1 
ATOM   9752  N  N   . TRP C 1 322 ? 134.439 145.159 186.271 1.00 78.89  ? 323 TRP C N   1 
ATOM   9753  C  CA  . TRP C 1 322 ? 134.171 143.809 186.736 1.00 78.01  ? 323 TRP C CA  1 
ATOM   9754  C  C   . TRP C 1 322 ? 133.079 143.771 187.792 1.00 77.30  ? 323 TRP C C   1 
ATOM   9755  O  O   . TRP C 1 322 ? 132.883 144.719 188.530 1.00 77.24  ? 323 TRP C O   1 
ATOM   9756  C  CB  . TRP C 1 322 ? 135.437 143.186 187.317 1.00 77.90  ? 323 TRP C CB  1 
ATOM   9757  C  CG  . TRP C 1 322 ? 136.506 142.879 186.332 1.00 77.79  ? 323 TRP C CG  1 
ATOM   9758  C  CD1 . TRP C 1 322 ? 137.491 143.706 185.918 1.00 77.73  ? 323 TRP C CD1 1 
ATOM   9759  C  CD2 . TRP C 1 322 ? 136.710 141.643 185.654 1.00 77.66  ? 323 TRP C CD2 1 
ATOM   9760  N  NE1 . TRP C 1 322 ? 138.294 143.071 185.013 1.00 77.66  ? 323 TRP C NE1 1 
ATOM   9761  C  CE2 . TRP C 1 322 ? 137.833 141.797 184.835 1.00 77.61  ? 323 TRP C CE2 1 
ATOM   9762  C  CE3 . TRP C 1 322 ? 136.045 140.421 185.655 1.00 77.59  ? 323 TRP C CE3 1 
ATOM   9763  C  CZ2 . TRP C 1 322 ? 138.308 140.780 184.029 1.00 77.54  ? 323 TRP C CZ2 1 
ATOM   9764  C  CZ3 . TRP C 1 322 ? 136.517 139.417 184.857 1.00 77.51  ? 323 TRP C CZ3 1 
ATOM   9765  C  CH2 . TRP C 1 322 ? 137.637 139.600 184.053 1.00 77.50  ? 323 TRP C CH2 1 
ATOM   9766  N  N   . PHE C 1 323 ? 132.380 142.651 187.863 1.00 71.67  ? 324 PHE C N   1 
ATOM   9767  C  CA  . PHE C 1 323 ? 131.405 142.414 188.907 1.00 71.05  ? 324 PHE C CA  1 
ATOM   9768  C  C   . PHE C 1 323 ? 131.593 141.013 189.454 1.00 70.77  ? 324 PHE C C   1 
ATOM   9769  O  O   . PHE C 1 323 ? 131.887 140.084 188.714 1.00 70.75  ? 324 PHE C O   1 
ATOM   9770  C  CB  . PHE C 1 323 ? 129.998 142.524 188.346 1.00 70.83  ? 324 PHE C CB  1 
ATOM   9771  C  CG  . PHE C 1 323 ? 129.472 143.922 188.257 1.00 70.65  ? 324 PHE C CG  1 
ATOM   9772  C  CD1 . PHE C 1 323 ? 128.619 144.412 189.214 1.00 70.54  ? 324 PHE C CD1 1 
ATOM   9773  C  CD2 . PHE C 1 323 ? 129.793 144.726 187.196 1.00 70.53  ? 324 PHE C CD2 1 
ATOM   9774  C  CE1 . PHE C 1 323 ? 128.123 145.678 189.124 1.00 70.47  ? 324 PHE C CE1 1 
ATOM   9775  C  CE2 . PHE C 1 323 ? 129.294 145.995 187.103 1.00 70.47  ? 324 PHE C CE2 1 
ATOM   9776  C  CZ  . PHE C 1 323 ? 128.461 146.470 188.067 1.00 70.45  ? 324 PHE C CZ  1 
ATOM   9777  N  N   . LYS C 1 324 ? 131.429 140.862 190.757 1.00 66.68  ? 325 LYS C N   1 
ATOM   9778  C  CA  . LYS C 1 324 ? 131.487 139.552 191.373 1.00 66.56  ? 325 LYS C CA  1 
ATOM   9779  C  C   . LYS C 1 324 ? 130.109 138.931 191.464 1.00 67.25  ? 325 LYS C C   1 
ATOM   9780  O  O   . LYS C 1 324 ? 129.133 139.617 191.701 1.00 67.26  ? 325 LYS C O   1 
ATOM   9781  C  CB  . LYS C 1 324 ? 132.129 139.635 192.752 1.00 66.03  ? 325 LYS C CB  1 
ATOM   9782  C  CG  . LYS C 1 324 ? 133.628 139.777 192.731 1.00 65.63  ? 325 LYS C CG  1 
ATOM   9783  C  CD  . LYS C 1 324 ? 134.292 138.466 192.416 1.00 65.38  ? 325 LYS C CD  1 
ATOM   9784  C  CE  . LYS C 1 324 ? 135.786 138.608 192.342 1.00 65.23  ? 325 LYS C CE  1 
ATOM   9785  N  NZ  . LYS C 1 324 ? 136.486 137.315 192.180 1.00 65.09  1 325 LYS C NZ  1 
ATOM   9786  N  N   . SER C 1 325 ? 130.036 137.621 191.287 1.00 70.40  ? 326 SER C N   1 
ATOM   9787  C  CA  . SER C 1 325 ? 128.770 136.919 191.390 1.00 71.28  ? 326 SER C CA  1 
ATOM   9788  C  C   . SER C 1 325 ? 128.902 135.738 192.330 1.00 72.53  ? 326 SER C C   1 
ATOM   9789  O  O   . SER C 1 325 ? 129.998 135.264 192.577 1.00 72.62  ? 326 SER C O   1 
ATOM   9790  C  CB  . SER C 1 325 ? 128.308 136.438 190.023 1.00 71.11  ? 326 SER C CB  1 
ATOM   9791  O  OG  . SER C 1 325 ? 129.119 135.388 189.548 1.00 71.02  ? 326 SER C OG  1 
ATOM   9792  N  N   . ASN C 1 326 ? 127.778 135.272 192.860 1.00 81.63  ? 327 ASN C N   1 
ATOM   9793  C  CA  . ASN C 1 326 ? 127.762 134.097 193.720 1.00 83.00  ? 327 ASN C CA  1 
ATOM   9794  C  C   . ASN C 1 326 ? 126.818 133.039 193.207 1.00 84.47  ? 327 ASN C C   1 
ATOM   9795  O  O   . ASN C 1 326 ? 126.095 133.269 192.256 1.00 84.57  ? 327 ASN C O   1 
ATOM   9796  C  CB  . ASN C 1 326 ? 127.395 134.461 195.152 1.00 83.01  ? 327 ASN C CB  1 
ATOM   9797  C  CG  . ASN C 1 326 ? 126.032 135.070 195.266 1.00 82.99  ? 327 ASN C CG  1 
ATOM   9798  O  OD1 . ASN C 1 326 ? 125.029 134.417 195.029 1.00 83.15  ? 327 ASN C OD1 1 
ATOM   9799  N  ND2 . ASN C 1 326 ? 125.984 136.327 195.655 1.00 83.02  ? 327 ASN C ND2 1 
ATOM   9800  N  N   . ASP C 1 327 ? 126.836 131.873 193.839 1.00 71.13  ? 328 ASP C N   1 
ATOM   9801  C  CA  . ASP C 1 327 ? 126.022 130.755 193.394 1.00 72.65  ? 328 ASP C CA  1 
ATOM   9802  C  C   . ASP C 1 327 ? 124.522 130.988 193.507 1.00 74.16  ? 328 ASP C C   1 
ATOM   9803  O  O   . ASP C 1 327 ? 123.758 130.591 192.635 1.00 74.22  ? 328 ASP C O   1 
ATOM   9804  C  CB  . ASP C 1 327 ? 126.395 129.496 194.166 1.00 72.67  ? 328 ASP C CB  1 
ATOM   9805  C  CG  . ASP C 1 327 ? 127.756 128.976 193.809 1.00 72.59  ? 328 ASP C CG  1 
ATOM   9806  O  OD1 . ASP C 1 327 ? 128.305 128.165 194.577 1.00 72.58  ? 328 ASP C OD1 1 
ATOM   9807  O  OD2 . ASP C 1 327 ? 128.282 129.377 192.761 1.00 72.57  1 328 ASP C OD2 1 
ATOM   9808  N  N   . GLU C 1 328 ? 124.106 131.657 194.568 1.00 113.41 ? 329 GLU C N   1 
ATOM   9809  C  CA  . GLU C 1 328 ? 122.692 131.855 194.808 1.00 114.77 ? 329 GLU C CA  1 
ATOM   9810  C  C   . GLU C 1 328 ? 122.105 132.717 193.717 1.00 114.40 ? 329 GLU C C   1 
ATOM   9811  O  O   . GLU C 1 328 ? 121.047 132.414 193.178 1.00 114.28 ? 329 GLU C O   1 
ATOM   9812  C  CB  . GLU C 1 328 ? 122.476 132.497 196.176 1.00 116.05 ? 329 GLU C CB  1 
ATOM   9813  C  CG  . GLU C 1 328 ? 121.022 132.755 196.527 1.00 116.87 ? 329 GLU C CG  1 
ATOM   9814  C  CD  . GLU C 1 328 ? 120.823 133.141 197.983 1.00 117.28 ? 329 GLU C CD  1 
ATOM   9815  O  OE1 . GLU C 1 328 ? 119.678 133.039 198.469 1.00 117.44 ? 329 GLU C OE1 1 
ATOM   9816  O  OE2 . GLU C 1 328 ? 121.803 133.546 198.642 1.00 117.38 1 329 GLU C OE2 1 
ATOM   9817  N  N   . GLU C 1 329 ? 122.824 133.771 193.365 1.00 105.03 ? 330 GLU C N   1 
ATOM   9818  C  CA  . GLU C 1 329 ? 122.376 134.676 192.333 1.00 104.36 ? 330 GLU C CA  1 
ATOM   9819  C  C   . GLU C 1 329 ? 122.285 133.925 191.041 1.00 102.51 ? 330 GLU C C   1 
ATOM   9820  O  O   . GLU C 1 329 ? 121.342 134.087 190.281 1.00 102.26 ? 330 GLU C O   1 
ATOM   9821  C  CB  . GLU C 1 329 ? 123.398 135.786 192.135 1.00 105.17 ? 330 GLU C CB  1 
ATOM   9822  C  CG  . GLU C 1 329 ? 123.310 136.935 193.092 1.00 105.74 ? 330 GLU C CG  1 
ATOM   9823  C  CD  . GLU C 1 329 ? 124.354 137.988 192.804 1.00 106.01 ? 330 GLU C CD  1 
ATOM   9824  O  OE1 . GLU C 1 329 ? 125.377 137.646 192.179 1.00 106.10 ? 330 GLU C OE1 1 
ATOM   9825  O  OE2 . GLU C 1 329 ? 124.151 139.155 193.194 1.00 106.13 1 330 GLU C OE2 1 
ATOM   9826  N  N   . ALA C 1 330 ? 123.269 133.075 190.812 1.00 76.69  ? 331 ALA C N   1 
ATOM   9827  C  CA  . ALA C 1 330 ? 123.406 132.435 189.528 1.00 74.77  ? 331 ALA C CA  1 
ATOM   9828  C  C   . ALA C 1 330 ? 122.264 131.495 189.294 1.00 72.93  ? 331 ALA C C   1 
ATOM   9829  O  O   . ALA C 1 330 ? 121.597 131.567 188.278 1.00 72.68  ? 331 ALA C O   1 
ATOM   9830  C  CB  . ALA C 1 330 ? 124.696 131.695 189.464 1.00 74.74  ? 331 ALA C CB  1 
ATOM   9831  N  N   . PHE C 1 331 ? 122.030 130.612 190.248 1.00 74.63  ? 332 PHE C N   1 
ATOM   9832  C  CA  . PHE C 1 331 ? 120.966 129.639 190.100 1.00 73.03  ? 332 PHE C CA  1 
ATOM   9833  C  C   . PHE C 1 331 ? 119.580 130.263 190.157 1.00 72.21  ? 332 PHE C C   1 
ATOM   9834  O  O   . PHE C 1 331 ? 118.676 129.854 189.427 1.00 72.11  ? 332 PHE C O   1 
ATOM   9835  C  CB  . PHE C 1 331 ? 121.140 128.528 191.124 1.00 72.50  ? 332 PHE C CB  1 
ATOM   9836  C  CG  . PHE C 1 331 ? 122.434 127.800 190.987 1.00 72.03  ? 332 PHE C CG  1 
ATOM   9837  C  CD1 . PHE C 1 331 ? 122.976 127.580 189.747 1.00 71.76  ? 332 PHE C CD1 1 
ATOM   9838  C  CD2 . PHE C 1 331 ? 123.117 127.358 192.091 1.00 71.76  ? 332 PHE C CD2 1 
ATOM   9839  C  CE1 . PHE C 1 331 ? 124.157 126.922 189.609 1.00 71.58  ? 332 PHE C CE1 1 
ATOM   9840  C  CE2 . PHE C 1 331 ? 124.302 126.704 191.953 1.00 71.59  ? 332 PHE C CE2 1 
ATOM   9841  C  CZ  . PHE C 1 331 ? 124.822 126.488 190.711 1.00 71.53  ? 332 PHE C CZ  1 
ATOM   9842  N  N   . THR C 1 332 ? 119.432 131.292 190.978 1.00 74.31  ? 333 THR C N   1 
ATOM   9843  C  CA  . THR C 1 332 ? 118.159 131.971 191.078 1.00 73.61  ? 333 THR C CA  1 
ATOM   9844  C  C   . THR C 1 332 ? 117.814 132.562 189.737 1.00 73.14  ? 333 THR C C   1 
ATOM   9845  O  O   . THR C 1 332 ? 116.727 132.351 189.212 1.00 73.11  ? 333 THR C O   1 
ATOM   9846  C  CB  . THR C 1 332 ? 118.222 133.112 192.086 1.00 73.50  ? 333 THR C CB  1 
ATOM   9847  O  OG1 . THR C 1 332 ? 118.525 132.589 193.380 1.00 73.52  ? 333 THR C OG1 1 
ATOM   9848  C  CG2 . THR C 1 332 ? 116.905 133.828 192.151 1.00 73.42  ? 333 THR C CG2 1 
ATOM   9849  N  N   . PHE C 1 333 ? 118.759 133.299 189.177 1.00 72.76  ? 334 PHE C N   1 
ATOM   9850  C  CA  . PHE C 1 333 ? 118.536 133.930 187.897 1.00 72.42  ? 334 PHE C CA  1 
ATOM   9851  C  C   . PHE C 1 333 ? 118.419 132.975 186.742 1.00 72.67  ? 334 PHE C C   1 
ATOM   9852  O  O   . PHE C 1 333 ? 117.702 133.248 185.813 1.00 72.72  ? 334 PHE C O   1 
ATOM   9853  C  CB  . PHE C 1 333 ? 119.591 134.978 187.611 1.00 72.03  ? 334 PHE C CB  1 
ATOM   9854  C  CG  . PHE C 1 333 ? 119.254 136.314 188.151 1.00 71.69  ? 334 PHE C CG  1 
ATOM   9855  C  CD1 . PHE C 1 333 ? 119.569 136.642 189.441 1.00 71.54  ? 334 PHE C CD1 1 
ATOM   9856  C  CD2 . PHE C 1 333 ? 118.609 137.236 187.375 1.00 71.49  ? 334 PHE C CD2 1 
ATOM   9857  C  CE1 . PHE C 1 333 ? 119.258 137.863 189.938 1.00 71.41  ? 334 PHE C CE1 1 
ATOM   9858  C  CE2 . PHE C 1 333 ? 118.295 138.461 187.872 1.00 71.39  ? 334 PHE C CE2 1 
ATOM   9859  C  CZ  . PHE C 1 333 ? 118.621 138.775 189.152 1.00 71.36  ? 334 PHE C CZ  1 
ATOM   9860  N  N   . ALA C 1 334 ? 119.114 131.854 186.786 1.00 64.62  ? 335 ALA C N   1 
ATOM   9861  C  CA  . ALA C 1 334 ? 118.985 130.909 185.699 1.00 64.98  ? 335 ALA C CA  1 
ATOM   9862  C  C   . ALA C 1 334 ? 117.585 130.353 185.697 1.00 65.64  ? 335 ALA C C   1 
ATOM   9863  O  O   . ALA C 1 334 ? 116.933 130.258 184.655 1.00 65.65  ? 335 ALA C O   1 
ATOM   9864  C  CB  . ALA C 1 334 ? 119.981 129.804 185.850 1.00 64.86  ? 335 ALA C CB  1 
ATOM   9865  N  N   . ARG C 1 335 ? 117.105 130.016 186.883 1.00 71.94  ? 336 ARG C N   1 
ATOM   9866  C  CA  . ARG C 1 335 ? 115.758 129.495 186.999 1.00 72.66  ? 336 ARG C CA  1 
ATOM   9867  C  C   . ARG C 1 335 ? 114.760 130.539 186.568 1.00 72.87  ? 336 ARG C C   1 
ATOM   9868  O  O   . ARG C 1 335 ? 113.737 130.229 185.986 1.00 72.88  ? 336 ARG C O   1 
ATOM   9869  C  CB  . ARG C 1 335 ? 115.476 129.063 188.429 1.00 73.08  ? 336 ARG C CB  1 
ATOM   9870  C  CG  . ARG C 1 335 ? 116.194 127.819 188.847 1.00 73.47  ? 336 ARG C CG  1 
ATOM   9871  C  CD  . ARG C 1 335 ? 115.834 127.441 190.249 1.00 73.85  ? 336 ARG C CD  1 
ATOM   9872  N  NE  . ARG C 1 335 ? 115.784 126.001 190.413 1.00 74.18  ? 336 ARG C NE  1 
ATOM   9873  C  CZ  . ARG C 1 335 ? 114.909 125.381 191.186 1.00 74.50  ? 336 ARG C CZ  1 
ATOM   9874  N  NH1 . ARG C 1 335 ? 114.923 124.066 191.278 1.00 74.63  1 336 ARG C NH1 1 
ATOM   9875  N  NH2 . ARG C 1 335 ? 114.021 126.081 191.863 1.00 74.59  ? 336 ARG C NH2 1 
ATOM   9876  N  N   . MET C 1 336 ? 115.075 131.789 186.853 1.00 88.65  ? 337 MET C N   1 
ATOM   9877  C  CA  . MET C 1 336 ? 114.238 132.890 186.422 1.00 88.82  ? 337 MET C CA  1 
ATOM   9878  C  C   . MET C 1 336 ? 114.236 133.026 184.910 1.00 88.04  ? 337 MET C C   1 
ATOM   9879  O  O   . MET C 1 336 ? 113.234 133.376 184.316 1.00 88.04  ? 337 MET C O   1 
ATOM   9880  C  CB  . MET C 1 336 ? 114.721 134.190 187.066 1.00 89.57  ? 337 MET C CB  1 
ATOM   9881  C  CG  . MET C 1 336 ? 113.765 135.348 186.951 1.00 90.09  ? 337 MET C CG  1 
ATOM   9882  S  SD  . MET C 1 336 ? 114.382 136.830 187.729 1.00 90.59  ? 337 MET C SD  1 
ATOM   9883  C  CE  . MET C 1 336 ? 114.745 136.205 189.350 1.00 90.85  ? 337 MET C CE  1 
ATOM   9884  N  N   . LEU C 1 337 ? 115.364 132.733 184.286 1.00 74.48  ? 338 LEU C N   1 
ATOM   9885  C  CA  . LEU C 1 337 ? 115.471 132.839 182.852 1.00 73.67  ? 338 LEU C CA  1 
ATOM   9886  C  C   . LEU C 1 337 ? 114.553 131.812 182.260 1.00 72.77  ? 338 LEU C C   1 
ATOM   9887  O  O   . LEU C 1 337 ? 113.834 132.079 181.308 1.00 72.72  ? 338 LEU C O   1 
ATOM   9888  C  CB  . LEU C 1 337 ? 116.899 132.555 182.403 1.00 73.74  ? 338 LEU C CB  1 
ATOM   9889  C  CG  . LEU C 1 337 ? 117.818 133.684 181.947 1.00 73.82  ? 338 LEU C CG  1 
ATOM   9890  C  CD1 . LEU C 1 337 ? 117.033 134.775 181.285 1.00 73.85  ? 338 LEU C CD1 1 
ATOM   9891  C  CD2 . LEU C 1 337 ? 118.605 134.238 183.091 1.00 73.83  ? 338 LEU C CD2 1 
ATOM   9892  N  N   . ILE C 1 338 ? 114.551 130.632 182.852 1.00 62.00  ? 339 ILE C N   1 
ATOM   9893  C  CA  . ILE C 1 338 ? 113.706 129.588 182.323 1.00 61.22  ? 339 ILE C CA  1 
ATOM   9894  C  C   . ILE C 1 338 ? 112.240 129.897 182.537 1.00 61.80  ? 339 ILE C C   1 
ATOM   9895  O  O   . ILE C 1 338 ? 111.457 129.846 181.610 1.00 61.82  ? 339 ILE C O   1 
ATOM   9896  C  CB  . ILE C 1 338 ? 114.038 128.251 182.946 1.00 60.19  ? 339 ILE C CB  1 
ATOM   9897  C  CG1 . ILE C 1 338 ? 115.482 127.895 182.656 1.00 59.65  ? 339 ILE C CG1 1 
ATOM   9898  C  CG2 . ILE C 1 338 ? 113.160 127.189 182.385 1.00 59.94  ? 339 ILE C CG2 1 
ATOM   9899  C  CD1 . ILE C 1 338 ? 115.935 126.687 183.360 1.00 59.37  ? 339 ILE C CD1 1 
ATOM   9900  N  N   . ALA C 1 339 ? 111.875 130.249 183.757 1.00 67.84  ? 340 ALA C N   1 
ATOM   9901  C  CA  . ALA C 1 339 ? 110.477 130.473 184.085 1.00 68.64  ? 340 ALA C CA  1 
ATOM   9902  C  C   . ALA C 1 339 ? 109.858 131.676 183.402 1.00 69.78  ? 340 ALA C C   1 
ATOM   9903  O  O   . ALA C 1 339 ? 108.677 131.686 183.098 1.00 69.88  ? 340 ALA C O   1 
ATOM   9904  C  CB  . ALA C 1 339 ? 110.311 130.588 185.567 1.00 68.48  ? 340 ALA C CB  1 
ATOM   9905  N  N   . GLN C 1 340 ? 110.662 132.694 183.153 1.00 80.29  ? 341 GLN C N   1 
ATOM   9906  C  CA  . GLN C 1 340 ? 110.123 133.943 182.663 1.00 81.43  ? 341 GLN C CA  1 
ATOM   9907  C  C   . GLN C 1 340 ? 110.346 134.124 181.186 1.00 82.04  ? 341 GLN C C   1 
ATOM   9908  O  O   . GLN C 1 340 ? 109.457 134.556 180.479 1.00 82.13  ? 341 GLN C O   1 
ATOM   9909  C  CB  . GLN C 1 340 ? 110.760 135.111 183.397 1.00 81.82  ? 341 GLN C CB  1 
ATOM   9910  C  CG  . GLN C 1 340 ? 110.708 135.013 184.891 1.00 82.06  ? 341 GLN C CG  1 
ATOM   9911  C  CD  . GLN C 1 340 ? 109.460 135.594 185.468 1.00 82.27  ? 341 GLN C CD  1 
ATOM   9912  O  OE1 . GLN C 1 340 ? 108.523 135.909 184.753 1.00 82.31  ? 341 GLN C OE1 1 
ATOM   9913  N  NE2 . GLN C 1 340 ? 109.438 135.746 186.776 1.00 82.40  ? 341 GLN C NE2 1 
ATOM   9914  N  N   . GLU C 1 341 ? 111.548 133.819 180.723 1.00 95.53  ? 342 GLU C N   1 
ATOM   9915  C  CA  . GLU C 1 341 ? 111.891 134.065 179.332 1.00 95.89  ? 342 GLU C CA  1 
ATOM   9916  C  C   . GLU C 1 341 ? 111.859 132.823 178.466 1.00 95.12  ? 342 GLU C C   1 
ATOM   9917  O  O   . GLU C 1 341 ? 111.875 132.914 177.246 1.00 95.09  ? 342 GLU C O   1 
ATOM   9918  C  CB  . GLU C 1 341 ? 113.248 134.740 179.236 1.00 96.65  ? 342 GLU C CB  1 
ATOM   9919  C  CG  . GLU C 1 341 ? 113.336 136.012 180.031 1.00 97.15  ? 342 GLU C CG  1 
ATOM   9920  C  CD  . GLU C 1 341 ? 112.390 137.076 179.539 1.00 97.41  ? 342 GLU C CD  1 
ATOM   9921  O  OE1 . GLU C 1 341 ? 112.074 137.089 178.337 1.00 97.51  ? 342 GLU C OE1 1 
ATOM   9922  O  OE2 . GLU C 1 341 ? 111.959 137.905 180.358 1.00 97.56  1 342 GLU C OE2 1 
ATOM   9923  N  N   . GLY C 1 342 ? 111.801 131.664 179.096 1.00 71.74  ? 343 GLY C N   1 
ATOM   9924  C  CA  . GLY C 1 342 ? 111.733 130.428 178.356 1.00 70.86  ? 343 GLY C CA  1 
ATOM   9925  C  C   . GLY C 1 342 ? 113.057 130.002 177.780 1.00 69.93  ? 343 GLY C C   1 
ATOM   9926  O  O   . GLY C 1 342 ? 113.120 129.182 176.884 1.00 69.89  ? 343 GLY C O   1 
ATOM   9927  N  N   . LEU C 1 343 ? 114.124 130.585 178.290 1.00 73.52  ? 344 LEU C N   1 
ATOM   9928  C  CA  . LEU C 1 343 ? 115.457 130.269 177.819 1.00 72.62  ? 344 LEU C CA  1 
ATOM   9929  C  C   . LEU C 1 343 ? 116.078 129.154 178.640 1.00 72.17  ? 344 LEU C C   1 
ATOM   9930  O  O   . LEU C 1 343 ? 116.354 129.320 179.811 1.00 72.11  ? 344 LEU C O   1 
ATOM   9931  C  CB  . LEU C 1 343 ? 116.329 131.512 177.881 1.00 72.30  ? 344 LEU C CB  1 
ATOM   9932  C  CG  . LEU C 1 343 ? 115.817 132.720 177.114 1.00 72.06  ? 344 LEU C CG  1 
ATOM   9933  C  CD1 . LEU C 1 343 ? 116.614 133.934 177.458 1.00 71.95  ? 344 LEU C CD1 1 
ATOM   9934  C  CD2 . LEU C 1 343 ? 115.922 132.449 175.658 1.00 71.99  ? 344 LEU C CD2 1 
ATOM   9935  N  N   . LEU C 1 344 ? 116.314 128.017 178.009 1.00 63.29  ? 345 LEU C N   1 
ATOM   9936  C  CA  . LEU C 1 344 ? 116.838 126.861 178.705 1.00 62.98  ? 345 LEU C CA  1 
ATOM   9937  C  C   . LEU C 1 344 ? 118.346 126.898 178.833 1.00 63.31  ? 345 LEU C C   1 
ATOM   9938  O  O   . LEU C 1 344 ? 119.051 126.135 178.197 1.00 63.31  ? 345 LEU C O   1 
ATOM   9939  C  CB  . LEU C 1 344 ? 116.410 125.598 177.987 1.00 62.53  ? 345 LEU C CB  1 
ATOM   9940  C  CG  . LEU C 1 344 ? 114.907 125.431 177.928 1.00 62.15  ? 345 LEU C CG  1 
ATOM   9941  C  CD1 . LEU C 1 344 ? 114.561 124.214 177.125 1.00 62.01  ? 345 LEU C CD1 1 
ATOM   9942  C  CD2 . LEU C 1 344 ? 114.367 125.314 179.316 1.00 62.03  ? 345 LEU C CD2 1 
ATOM   9943  N  N   . CYS C 1 345 ? 118.828 127.780 179.692 1.00 88.35  ? 346 CYS C N   1 
ATOM   9944  C  CA  . CYS C 1 345 ? 120.247 128.059 179.807 1.00 88.66  ? 346 CYS C CA  1 
ATOM   9945  C  C   . CYS C 1 345 ? 120.830 127.634 181.145 1.00 88.86  ? 346 CYS C C   1 
ATOM   9946  O  O   . CYS C 1 345 ? 120.106 127.390 182.090 1.00 88.89  ? 346 CYS C O   1 
ATOM   9947  C  CB  . CYS C 1 345 ? 120.490 129.542 179.584 1.00 88.72  ? 346 CYS C CB  1 
ATOM   9948  S  SG  . CYS C 1 345 ? 119.641 130.605 180.745 1.00 88.74  ? 346 CYS C SG  1 
ATOM   9949  N  N   . GLY C 1 346 ? 122.152 127.562 181.211 1.00 67.05  ? 347 GLY C N   1 
ATOM   9950  C  CA  . GLY C 1 346 ? 122.850 127.105 182.395 1.00 67.23  ? 347 GLY C CA  1 
ATOM   9951  C  C   . GLY C 1 346 ? 123.159 128.158 183.434 1.00 67.44  ? 347 GLY C C   1 
ATOM   9952  O  O   . GLY C 1 346 ? 122.658 129.260 183.371 1.00 67.45  ? 347 GLY C O   1 
ATOM   9953  N  N   . GLY C 1 347 ? 123.991 127.803 184.399 1.00 68.41  ? 348 GLY C N   1 
ATOM   9954  C  CA  . GLY C 1 347 ? 124.245 128.658 185.539 1.00 68.67  ? 348 GLY C CA  1 
ATOM   9955  C  C   . GLY C 1 347 ? 125.048 129.910 185.286 1.00 68.98  ? 348 GLY C C   1 
ATOM   9956  O  O   . GLY C 1 347 ? 124.795 130.944 185.886 1.00 69.00  ? 348 GLY C O   1 
ATOM   9957  N  N   . SER C 1 348 ? 126.020 129.829 184.398 1.00 75.04  ? 349 SER C N   1 
ATOM   9958  C  CA  . SER C 1 348 ? 126.822 130.995 184.086 1.00 75.32  ? 349 SER C CA  1 
ATOM   9959  C  C   . SER C 1 348 ? 125.972 132.058 183.427 1.00 75.58  ? 349 SER C C   1 
ATOM   9960  O  O   . SER C 1 348 ? 126.228 133.252 183.561 1.00 75.61  ? 349 SER C O   1 
ATOM   9961  C  CB  . SER C 1 348 ? 127.978 130.619 183.184 1.00 75.33  ? 349 SER C CB  1 
ATOM   9962  O  OG  . SER C 1 348 ? 127.510 130.001 182.014 1.00 75.30  ? 349 SER C OG  1 
ATOM   9963  N  N   . ALA C 1 349 ? 124.953 131.614 182.711 1.00 76.76  ? 350 ALA C N   1 
ATOM   9964  C  CA  . ALA C 1 349 ? 124.037 132.530 182.070 1.00 76.94  ? 350 ALA C CA  1 
ATOM   9965  C  C   . ALA C 1 349 ? 123.309 133.302 183.139 1.00 76.96  ? 350 ALA C C   1 
ATOM   9966  O  O   . ALA C 1 349 ? 123.052 134.496 183.008 1.00 76.98  ? 350 ALA C O   1 
ATOM   9967  C  CB  . ALA C 1 349 ? 123.066 131.766 181.232 1.00 77.01  ? 350 ALA C CB  1 
ATOM   9968  N  N   . GLY C 1 350 ? 123.023 132.615 184.230 1.00 72.59  ? 351 GLY C N   1 
ATOM   9969  C  CA  . GLY C 1 350 ? 122.358 133.232 185.347 1.00 72.54  ? 351 GLY C CA  1 
ATOM   9970  C  C   . GLY C 1 350 ? 123.268 134.205 186.044 1.00 72.47  ? 351 GLY C C   1 
ATOM   9971  O  O   . GLY C 1 350 ? 122.828 135.255 186.471 1.00 72.47  ? 351 GLY C O   1 
ATOM   9972  N  N   . SER C 1 351 ? 124.547 133.873 186.134 1.00 70.53  ? 352 SER C N   1 
ATOM   9973  C  CA  . SER C 1 351 ? 125.491 134.773 186.763 1.00 70.48  ? 352 SER C CA  1 
ATOM   9974  C  C   . SER C 1 351 ? 125.524 136.049 185.975 1.00 70.50  ? 352 SER C C   1 
ATOM   9975  O  O   . SER C 1 351 ? 125.504 137.156 186.517 1.00 70.49  ? 352 SER C O   1 
ATOM   9976  C  CB  . SER C 1 351 ? 126.879 134.162 186.732 1.00 70.45  ? 352 SER C CB  1 
ATOM   9977  O  OG  . SER C 1 351 ? 126.920 132.946 187.437 1.00 70.49  ? 352 SER C OG  1 
ATOM   9978  N  N   . THR C 1 352 ? 125.513 135.869 184.668 1.00 72.89  ? 353 THR C N   1 
ATOM   9979  C  CA  . THR C 1 352 ? 125.671 136.966 183.750 1.00 72.96  ? 353 THR C CA  1 
ATOM   9980  C  C   . THR C 1 352 ? 124.487 137.907 183.805 1.00 73.13  ? 353 THR C C   1 
ATOM   9981  O  O   . THR C 1 352 ? 124.644 139.115 183.910 1.00 73.14  ? 353 THR C O   1 
ATOM   9982  C  CB  . THR C 1 352 ? 125.848 136.432 182.338 1.00 72.89  ? 353 THR C CB  1 
ATOM   9983  O  OG1 . THR C 1 352 ? 126.876 135.440 182.337 1.00 72.85  ? 353 THR C OG1 1 
ATOM   9984  C  CG2 . THR C 1 352 ? 126.235 137.533 181.405 1.00 72.86  ? 353 THR C CG2 1 
ATOM   9985  N  N   . VAL C 1 353 ? 123.291 137.351 183.747 1.00 72.49  ? 354 VAL C N   1 
ATOM   9986  C  CA  . VAL C 1 353 ? 122.106 138.184 183.810 1.00 72.68  ? 354 VAL C CA  1 
ATOM   9987  C  C   . VAL C 1 353 ? 121.956 138.845 185.173 1.00 72.91  ? 354 VAL C C   1 
ATOM   9988  O  O   . VAL C 1 353 ? 121.519 139.997 185.289 1.00 72.93  ? 354 VAL C O   1 
ATOM   9989  C  CB  . VAL C 1 353 ? 120.873 137.370 183.446 1.00 72.64  ? 354 VAL C CB  1 
ATOM   9990  C  CG1 . VAL C 1 353 ? 119.623 138.159 183.680 1.00 72.63  ? 354 VAL C CG1 1 
ATOM   9991  C  CG2 . VAL C 1 353 ? 120.962 136.953 182.008 1.00 72.61  ? 354 VAL C CG2 1 
ATOM   9992  N  N   . ALA C 1 354 ? 122.383 138.129 186.199 1.00 76.76  ? 355 ALA C N   1 
ATOM   9993  C  CA  . ALA C 1 354 ? 122.312 138.648 187.546 1.00 76.95  ? 355 ALA C CA  1 
ATOM   9994  C  C   . ALA C 1 354 ? 123.184 139.866 187.680 1.00 77.04  ? 355 ALA C C   1 
ATOM   9995  O  O   . ALA C 1 354 ? 122.850 140.793 188.397 1.00 77.06  ? 355 ALA C O   1 
ATOM   9996  C  CB  . ALA C 1 354 ? 122.746 137.607 188.523 1.00 77.00  ? 355 ALA C CB  1 
ATOM   9997  N  N   . VAL C 1 355 ? 124.308 139.879 186.985 1.00 79.81  ? 356 VAL C N   1 
ATOM   9998  C  CA  . VAL C 1 355 ? 125.096 141.095 186.988 1.00 79.83  ? 356 VAL C CA  1 
ATOM   9999  C  C   . VAL C 1 355 ? 124.456 142.156 186.120 1.00 79.82  ? 356 VAL C C   1 
ATOM   10000 O  O   . VAL C 1 355 ? 124.437 143.326 186.477 1.00 79.83  ? 356 VAL C O   1 
ATOM   10001 C  CB  . VAL C 1 355 ? 126.533 140.849 186.544 1.00 79.86  ? 356 VAL C CB  1 
ATOM   10002 C  CG1 . VAL C 1 355 ? 127.208 142.149 186.201 1.00 79.86  ? 356 VAL C CG1 1 
ATOM   10003 C  CG2 . VAL C 1 355 ? 127.290 140.150 187.634 1.00 79.87  ? 356 VAL C CG2 1 
ATOM   10004 N  N   . ALA C 1 356 ? 123.893 141.741 184.998 1.00 69.43  ? 357 ALA C N   1 
ATOM   10005 C  CA  . ALA C 1 356 ? 123.404 142.705 184.034 1.00 69.44  ? 357 ALA C CA  1 
ATOM   10006 C  C   . ALA C 1 356 ? 122.291 143.575 184.578 1.00 69.58  ? 357 ALA C C   1 
ATOM   10007 O  O   . ALA C 1 356 ? 122.223 144.757 184.271 1.00 69.65  ? 357 ALA C O   1 
ATOM   10008 C  CB  . ALA C 1 356 ? 122.949 142.007 182.798 1.00 69.38  ? 357 ALA C CB  1 
ATOM   10009 N  N   . VAL C 1 357 ? 121.443 143.013 185.423 1.00 77.17  ? 358 VAL C N   1 
ATOM   10010 C  CA  . VAL C 1 357 ? 120.366 143.821 185.981 1.00 77.37  ? 358 VAL C CA  1 
ATOM   10011 C  C   . VAL C 1 357 ? 120.886 144.896 186.917 1.00 77.95  ? 358 VAL C C   1 
ATOM   10012 O  O   . VAL C 1 357 ? 120.190 145.847 187.221 1.00 78.03  ? 358 VAL C O   1 
ATOM   10013 C  CB  . VAL C 1 357 ? 119.293 142.985 186.685 1.00 77.06  ? 358 VAL C CB  1 
ATOM   10014 C  CG1 . VAL C 1 357 ? 118.480 142.222 185.682 1.00 76.96  ? 358 VAL C CG1 1 
ATOM   10015 C  CG2 . VAL C 1 357 ? 119.919 142.054 187.666 1.00 76.97  ? 358 VAL C CG2 1 
ATOM   10016 N  N   . LYS C 1 358 ? 122.110 144.729 187.390 1.00 80.25  ? 359 LYS C N   1 
ATOM   10017 C  CA  . LYS C 1 358 ? 122.747 145.751 188.199 1.00 80.91  ? 359 LYS C CA  1 
ATOM   10018 C  C   . LYS C 1 358 ? 123.511 146.739 187.337 1.00 81.64  ? 359 LYS C C   1 
ATOM   10019 O  O   . LYS C 1 358 ? 123.305 147.941 187.419 1.00 81.72  ? 359 LYS C O   1 
ATOM   10020 C  CB  . LYS C 1 358 ? 123.704 145.122 189.207 1.00 80.92  ? 359 LYS C CB  1 
ATOM   10021 C  CG  . LYS C 1 358 ? 123.037 144.263 190.241 1.00 80.94  ? 359 LYS C CG  1 
ATOM   10022 C  CD  . LYS C 1 358 ? 123.993 143.849 191.336 1.00 80.99  ? 359 LYS C CD  1 
ATOM   10023 C  CE  . LYS C 1 358 ? 124.441 142.424 191.174 1.00 81.03  ? 359 LYS C CE  1 
ATOM   10024 N  NZ  . LYS C 1 358 ? 124.943 141.874 192.449 1.00 81.06  1 359 LYS C NZ  1 
ATOM   10025 N  N   . ALA C 1 359 ? 124.397 146.220 186.505 1.00 76.36  ? 360 ALA C N   1 
ATOM   10026 C  CA  . ALA C 1 359 ? 125.295 147.057 185.736 1.00 77.15  ? 360 ALA C CA  1 
ATOM   10027 C  C   . ALA C 1 359 ? 124.571 147.928 184.743 1.00 78.17  ? 360 ALA C C   1 
ATOM   10028 O  O   . ALA C 1 359 ? 125.038 149.000 184.401 1.00 78.24  ? 360 ALA C O   1 
ATOM   10029 C  CB  . ALA C 1 359 ? 126.303 146.205 185.029 1.00 77.06  ? 360 ALA C CB  1 
ATOM   10030 N  N   . ALA C 1 360 ? 123.424 147.465 184.277 1.00 84.57  ? 361 ALA C N   1 
ATOM   10031 C  CA  . ALA C 1 360 ? 122.718 148.175 183.224 1.00 85.71  ? 361 ALA C CA  1 
ATOM   10032 C  C   . ALA C 1 360 ? 121.791 149.257 183.747 1.00 87.06  ? 361 ALA C C   1 
ATOM   10033 O  O   . ALA C 1 360 ? 121.076 149.887 182.984 1.00 87.20  ? 361 ALA C O   1 
ATOM   10034 C  CB  . ALA C 1 360 ? 121.960 147.209 182.356 1.00 85.62  ? 361 ALA C CB  1 
ATOM   10035 N  N   . GLN C 1 361 ? 121.787 149.458 185.053 1.00 79.52  ? 362 GLN C N   1 
ATOM   10036 C  CA  . GLN C 1 361 ? 120.906 150.446 185.643 1.00 80.90  ? 362 GLN C CA  1 
ATOM   10037 C  C   . GLN C 1 361 ? 121.227 151.845 185.148 1.00 82.64  ? 362 GLN C C   1 
ATOM   10038 O  O   . GLN C 1 361 ? 120.348 152.685 185.048 1.00 82.76  ? 362 GLN C O   1 
ATOM   10039 C  CB  . GLN C 1 361 ? 120.991 150.395 187.163 1.00 80.66  ? 362 GLN C CB  1 
ATOM   10040 C  CG  . GLN C 1 361 ? 120.393 149.163 187.772 1.00 80.45  ? 362 GLN C CG  1 
ATOM   10041 C  CD  . GLN C 1 361 ? 118.898 149.196 187.780 1.00 80.38  ? 362 GLN C CD  1 
ATOM   10042 O  OE1 . GLN C 1 361 ? 118.298 150.220 188.057 1.00 80.36  ? 362 GLN C OE1 1 
ATOM   10043 N  NE2 . GLN C 1 361 ? 118.281 148.071 187.474 1.00 80.32  ? 362 GLN C NE2 1 
ATOM   10044 N  N   . GLU C 1 362 ? 122.491 152.089 184.834 1.00 99.77  ? 363 GLU C N   1 
ATOM   10045 C  CA  . GLU C 1 362 ? 122.916 153.409 184.383 1.00 101.48 ? 363 GLU C CA  1 
ATOM   10046 C  C   . GLU C 1 362 ? 122.362 153.746 183.011 1.00 102.72 ? 363 GLU C C   1 
ATOM   10047 O  O   . GLU C 1 362 ? 122.195 154.906 182.658 1.00 102.83 ? 363 GLU C O   1 
ATOM   10048 C  CB  . GLU C 1 362 ? 124.444 153.527 184.388 1.00 101.88 ? 363 GLU C CB  1 
ATOM   10049 C  CG  . GLU C 1 362 ? 125.178 152.615 183.416 1.00 102.12 ? 363 GLU C CG  1 
ATOM   10050 C  CD  . GLU C 1 362 ? 126.676 152.865 183.395 1.00 102.28 ? 363 GLU C CD  1 
ATOM   10051 O  OE1 . GLU C 1 362 ? 127.215 153.326 184.414 1.00 102.34 ? 363 GLU C OE1 1 
ATOM   10052 O  OE2 . GLU C 1 362 ? 127.319 152.610 182.361 1.00 102.33 1 363 GLU C OE2 1 
ATOM   10053 N  N   . LEU C 1 363 ? 122.077 152.710 182.241 1.00 93.87  ? 364 LEU C N   1 
ATOM   10054 C  CA  . LEU C 1 363 ? 121.596 152.872 180.884 1.00 95.12  ? 364 LEU C CA  1 
ATOM   10055 C  C   . LEU C 1 363 ? 120.182 153.394 180.900 1.00 97.09  ? 364 LEU C C   1 
ATOM   10056 O  O   . LEU C 1 363 ? 119.467 153.207 181.873 1.00 97.22  ? 364 LEU C O   1 
ATOM   10057 C  CB  . LEU C 1 363 ? 121.645 151.541 180.156 1.00 94.51  ? 364 LEU C CB  1 
ATOM   10058 C  CG  . LEU C 1 363 ? 122.889 151.211 179.345 1.00 93.98  ? 364 LEU C CG  1 
ATOM   10059 C  CD1 . LEU C 1 363 ? 124.134 151.456 180.130 1.00 93.82  ? 364 LEU C CD1 1 
ATOM   10060 C  CD2 . LEU C 1 363 ? 122.827 149.774 178.924 1.00 93.82  ? 364 LEU C CD2 1 
ATOM   10061 N  N   . GLN C 1 364 ? 119.779 154.064 179.830 1.00 120.14 ? 365 GLN C N   1 
ATOM   10062 C  CA  . GLN C 1 364 ? 118.415 154.562 179.738 1.00 121.92 ? 365 GLN C CA  1 
ATOM   10063 C  C   . GLN C 1 364 ? 117.760 154.205 178.421 1.00 122.33 ? 365 GLN C C   1 
ATOM   10064 O  O   . GLN C 1 364 ? 118.359 153.541 177.593 1.00 122.36 ? 365 GLN C O   1 
ATOM   10065 C  CB  . GLN C 1 364 ? 118.369 156.064 179.971 1.00 122.99 ? 365 GLN C CB  1 
ATOM   10066 C  CG  . GLN C 1 364 ? 119.456 156.822 179.274 1.00 123.71 ? 365 GLN C CG  1 
ATOM   10067 C  CD  . GLN C 1 364 ? 119.622 158.209 179.840 1.00 124.31 ? 365 GLN C CD  1 
ATOM   10068 O  OE1 . GLN C 1 364 ? 119.036 158.541 180.867 1.00 124.39 ? 365 GLN C OE1 1 
ATOM   10069 N  NE2 . GLN C 1 364 ? 120.422 159.029 179.173 1.00 124.63 ? 365 GLN C NE2 1 
ATOM   10070 N  N   . GLU C 1 365 ? 116.526 154.660 178.237 1.00 123.16 ? 366 GLU C N   1 
ATOM   10071 C  CA  . GLU C 1 365 ? 115.693 154.209 177.131 1.00 123.09 ? 366 GLU C CA  1 
ATOM   10072 C  C   . GLU C 1 365 ? 116.310 154.505 175.784 1.00 121.27 ? 366 GLU C C   1 
ATOM   10073 O  O   . GLU C 1 365 ? 116.875 155.565 175.570 1.00 121.25 ? 366 GLU C O   1 
ATOM   10074 C  CB  . GLU C 1 365 ? 114.303 154.841 177.214 1.00 124.34 ? 366 GLU C CB  1 
ATOM   10075 C  CG  . GLU C 1 365 ? 113.509 154.436 178.444 1.00 125.15 ? 366 GLU C CG  1 
ATOM   10076 C  CD  . GLU C 1 365 ? 112.098 154.994 178.452 1.00 125.59 ? 366 GLU C CD  1 
ATOM   10077 O  OE1 . GLU C 1 365 ? 111.796 155.859 177.606 1.00 125.75 ? 366 GLU C OE1 1 
ATOM   10078 O  OE2 . GLU C 1 365 ? 111.289 154.567 179.302 1.00 125.75 1 366 GLU C OE2 1 
ATOM   10079 N  N   . GLY C 1 366 ? 116.194 153.548 174.878 1.00 98.31  ? 367 GLY C N   1 
ATOM   10080 C  CA  . GLY C 1 366 ? 116.757 153.668 173.552 1.00 96.26  ? 367 GLY C CA  1 
ATOM   10081 C  C   . GLY C 1 366 ? 118.132 153.044 173.450 1.00 94.06  ? 367 GLY C C   1 
ATOM   10082 O  O   . GLY C 1 366 ? 118.630 152.791 172.361 1.00 93.92  ? 367 GLY C O   1 
ATOM   10083 N  N   . GLN C 1 367 ? 118.746 152.794 174.596 1.00 93.51  ? 368 GLN C N   1 
ATOM   10084 C  CA  . GLN C 1 367 ? 120.022 152.102 174.647 1.00 91.39  ? 368 GLN C CA  1 
ATOM   10085 C  C   . GLN C 1 367 ? 119.795 150.609 174.788 1.00 89.54  ? 368 GLN C C   1 
ATOM   10086 O  O   . GLN C 1 367 ? 118.708 150.184 175.147 1.00 89.40  ? 368 GLN C O   1 
ATOM   10087 C  CB  . GLN C 1 367 ? 120.861 152.610 175.814 1.00 91.17  ? 368 GLN C CB  1 
ATOM   10088 C  CG  . GLN C 1 367 ? 121.336 154.039 175.686 1.00 91.06  ? 368 GLN C CG  1 
ATOM   10089 C  CD  . GLN C 1 367 ? 122.113 154.497 176.892 1.00 90.90  ? 368 GLN C CD  1 
ATOM   10090 O  OE1 . GLN C 1 367 ? 121.577 154.587 177.991 1.00 90.87  ? 368 GLN C OE1 1 
ATOM   10091 N  NE2 . GLN C 1 367 ? 123.385 154.782 176.697 1.00 90.83  ? 368 GLN C NE2 1 
ATOM   10092 N  N   . ARG C 1 368 ? 120.817 149.810 174.499 1.00 87.08  ? 369 ARG C N   1 
ATOM   10093 C  CA  . ARG C 1 368 ? 120.684 148.365 174.627 1.00 85.38  ? 369 ARG C CA  1 
ATOM   10094 C  C   . ARG C 1 368 ? 121.876 147.661 175.263 1.00 83.77  ? 369 ARG C C   1 
ATOM   10095 O  O   . ARG C 1 368 ? 123.019 148.024 175.044 1.00 83.67  ? 369 ARG C O   1 
ATOM   10096 C  CB  . ARG C 1 368 ? 120.349 147.717 173.282 1.00 85.34  ? 369 ARG C CB  1 
ATOM   10097 C  CG  . ARG C 1 368 ? 121.474 147.668 172.287 1.00 85.35  ? 369 ARG C CG  1 
ATOM   10098 C  CD  . ARG C 1 368 ? 121.173 146.660 171.207 1.00 85.31  ? 369 ARG C CD  1 
ATOM   10099 N  NE  . ARG C 1 368 ? 119.864 146.878 170.613 1.00 85.29  ? 369 ARG C NE  1 
ATOM   10100 C  CZ  . ARG C 1 368 ? 119.665 147.204 169.345 1.00 85.29  ? 369 ARG C CZ  1 
ATOM   10101 N  NH1 . ARG C 1 368 ? 120.689 147.342 168.531 1.00 85.29  1 369 ARG C NH1 1 
ATOM   10102 N  NH2 . ARG C 1 368 ? 118.440 147.386 168.893 1.00 85.29  ? 369 ARG C NH2 1 
ATOM   10103 N  N   . CYS C 1 369 ? 121.575 146.640 176.054 1.00 84.66  ? 370 CYS C N   1 
ATOM   10104 C  CA  . CYS C 1 369 ? 122.580 145.829 176.707 1.00 83.15  ? 370 CYS C CA  1 
ATOM   10105 C  C   . CYS C 1 369 ? 122.469 144.391 176.253 1.00 81.79  ? 370 CYS C C   1 
ATOM   10106 O  O   . CYS C 1 369 ? 121.419 143.786 176.349 1.00 81.66  ? 370 CYS C O   1 
ATOM   10107 C  CB  . CYS C 1 369 ? 122.404 145.894 178.215 1.00 83.10  ? 370 CYS C CB  1 
ATOM   10108 S  SG  . CYS C 1 369 ? 123.517 144.837 179.131 1.00 83.05  ? 370 CYS C SG  1 
ATOM   10109 N  N   . VAL C 1 370 ? 123.567 143.852 175.753 1.00 76.84  ? 371 VAL C N   1 
ATOM   10110 C  CA  . VAL C 1 370 ? 123.612 142.483 175.286 1.00 75.65  ? 371 VAL C CA  1 
ATOM   10111 C  C   . VAL C 1 370 ? 124.250 141.589 176.323 1.00 74.71  ? 371 VAL C C   1 
ATOM   10112 O  O   . VAL C 1 370 ? 125.246 141.945 176.911 1.00 74.66  ? 371 VAL C O   1 
ATOM   10113 C  CB  . VAL C 1 370 ? 124.415 142.397 173.997 1.00 75.48  ? 371 VAL C CB  1 
ATOM   10114 C  CG1 . VAL C 1 370 ? 124.856 140.986 173.723 1.00 75.38  ? 371 VAL C CG1 1 
ATOM   10115 C  CG2 . VAL C 1 370 ? 123.602 142.913 172.858 1.00 75.51  ? 371 VAL C CG2 1 
ATOM   10116 N  N   . VAL C 1 371 ? 123.681 140.415 176.538 1.00 80.32  ? 372 VAL C N   1 
ATOM   10117 C  CA  . VAL C 1 371 ? 124.197 139.493 177.531 1.00 79.42  ? 372 VAL C CA  1 
ATOM   10118 C  C   . VAL C 1 371 ? 124.549 138.165 176.896 1.00 78.23  ? 372 VAL C C   1 
ATOM   10119 O  O   . VAL C 1 371 ? 123.797 137.658 176.085 1.00 78.15  ? 372 VAL C O   1 
ATOM   10120 C  CB  . VAL C 1 371 ? 123.156 139.281 178.620 1.00 79.67  ? 372 VAL C CB  1 
ATOM   10121 C  CG1 . VAL C 1 371 ? 123.365 137.981 179.320 1.00 79.74  ? 372 VAL C CG1 1 
ATOM   10122 C  CG2 . VAL C 1 371 ? 123.223 140.404 179.593 1.00 79.79  ? 372 VAL C CG2 1 
ATOM   10123 N  N   . ILE C 1 372 ? 125.700 137.601 177.240 1.00 69.75  ? 373 ILE C N   1 
ATOM   10124 C  CA  . ILE C 1 372 ? 126.034 136.283 176.706 1.00 68.62  ? 373 ILE C CA  1 
ATOM   10125 C  C   . ILE C 1 372 ? 125.457 135.146 177.548 1.00 68.35  ? 373 ILE C C   1 
ATOM   10126 O  O   . ILE C 1 372 ? 125.534 135.177 178.760 1.00 68.29  ? 373 ILE C O   1 
ATOM   10127 C  CB  . ILE C 1 372 ? 127.538 136.108 176.570 1.00 68.02  ? 373 ILE C CB  1 
ATOM   10128 C  CG1 . ILE C 1 372 ? 128.143 137.316 175.878 1.00 67.71  ? 373 ILE C CG1 1 
ATOM   10129 C  CG2 . ILE C 1 372 ? 127.853 134.878 175.782 1.00 67.86  ? 373 ILE C CG2 1 
ATOM   10130 C  CD1 . ILE C 1 372 ? 127.590 137.567 174.528 1.00 67.58  ? 373 ILE C CD1 1 
ATOM   10131 N  N   . LEU C 1 373 ? 124.926 134.119 176.893 1.00 68.81  ? 374 LEU C N   1 
ATOM   10132 C  CA  . LEU C 1 373 ? 124.312 132.988 177.573 1.00 68.64  ? 374 LEU C CA  1 
ATOM   10133 C  C   . LEU C 1 373 ? 124.960 131.706 177.110 1.00 68.60  ? 374 LEU C C   1 
ATOM   10134 O  O   . LEU C 1 373 ? 124.469 131.060 176.206 1.00 68.61  ? 374 LEU C O   1 
ATOM   10135 C  CB  . LEU C 1 373 ? 122.835 132.913 177.261 1.00 68.59  ? 374 LEU C CB  1 
ATOM   10136 C  CG  . LEU C 1 373 ? 121.987 134.100 177.655 1.00 68.56  ? 374 LEU C CG  1 
ATOM   10137 C  CD1 . LEU C 1 373 ? 120.547 133.717 177.557 1.00 68.55  ? 374 LEU C CD1 1 
ATOM   10138 C  CD2 . LEU C 1 373 ? 122.318 134.533 179.043 1.00 68.58  ? 374 LEU C CD2 1 
ATOM   10139 N  N   . PRO C 1 374 ? 126.080 131.346 177.738 1.00 65.12  ? 375 PRO C N   1 
ATOM   10140 C  CA  . PRO C 1 374 ? 127.062 130.351 177.313 1.00 65.25  ? 375 PRO C CA  1 
ATOM   10141 C  C   . PRO C 1 374 ? 126.599 128.914 177.092 1.00 65.60  ? 375 PRO C C   1 
ATOM   10142 O  O   . PRO C 1 374 ? 127.126 128.285 176.192 1.00 65.64  ? 375 PRO C O   1 
ATOM   10143 C  CB  . PRO C 1 374 ? 128.082 130.389 178.442 1.00 65.11  ? 375 PRO C CB  1 
ATOM   10144 C  CG  . PRO C 1 374 ? 127.913 131.693 179.054 1.00 65.03  ? 375 PRO C CG  1 
ATOM   10145 C  CD  . PRO C 1 374 ? 126.479 131.976 178.997 1.00 65.03  ? 375 PRO C CD  1 
ATOM   10146 N  N   . ASP C 1 375 ? 125.655 128.393 177.863 1.00 69.87  ? 376 ASP C N   1 
ATOM   10147 C  CA  . ASP C 1 375 ? 125.295 126.987 177.696 1.00 70.27  ? 376 ASP C CA  1 
ATOM   10148 C  C   . ASP C 1 375 ? 123.912 126.590 178.170 1.00 70.71  ? 376 ASP C C   1 
ATOM   10149 O  O   . ASP C 1 375 ? 123.222 127.362 178.809 1.00 70.74  ? 376 ASP C O   1 
ATOM   10150 C  CB  . ASP C 1 375 ? 126.355 126.066 178.301 1.00 70.28  ? 376 ASP C CB  1 
ATOM   10151 C  CG  . ASP C 1 375 ? 126.226 125.910 179.793 1.00 70.28  ? 376 ASP C CG  1 
ATOM   10152 O  OD1 . ASP C 1 375 ? 125.698 126.820 180.450 1.00 70.31  ? 376 ASP C OD1 1 
ATOM   10153 O  OD2 . ASP C 1 375 ? 126.675 124.874 180.314 1.00 70.36  1 376 ASP C OD2 1 
ATOM   10154 N  N   . SER C 1 376 ? 123.521 125.367 177.836 1.00 68.49  ? 377 SER C N   1 
ATOM   10155 C  CA  . SER C 1 376 ? 122.173 124.876 178.080 1.00 68.95  ? 377 SER C CA  1 
ATOM   10156 C  C   . SER C 1 376 ? 121.983 124.188 179.411 1.00 69.43  ? 377 SER C C   1 
ATOM   10157 O  O   . SER C 1 376 ? 122.933 123.850 180.087 1.00 69.45  ? 377 SER C O   1 
ATOM   10158 C  CB  . SER C 1 376 ? 121.734 123.924 176.975 1.00 68.94  ? 377 SER C CB  1 
ATOM   10159 O  OG  . SER C 1 376 ? 122.245 122.636 177.199 1.00 68.94  ? 377 SER C OG  1 
ATOM   10160 N  N   . VAL C 1 377 ? 120.726 123.959 179.754 1.00 69.14  ? 378 VAL C N   1 
ATOM   10161 C  CA  . VAL C 1 377 ? 120.359 123.297 180.988 1.00 69.63  ? 378 VAL C CA  1 
ATOM   10162 C  C   . VAL C 1 377 ? 120.714 121.840 180.962 1.00 70.33  ? 378 VAL C C   1 
ATOM   10163 O  O   . VAL C 1 377 ? 120.689 121.195 181.984 1.00 70.41  ? 378 VAL C O   1 
ATOM   10164 C  CB  . VAL C 1 377 ? 118.864 123.390 181.254 1.00 69.47  ? 378 VAL C CB  1 
ATOM   10165 C  CG1 . VAL C 1 377 ? 118.509 124.750 181.734 1.00 69.38  ? 378 VAL C CG1 1 
ATOM   10166 C  CG2 . VAL C 1 377 ? 118.094 123.066 180.015 1.00 69.42  ? 378 VAL C CG2 1 
ATOM   10167 N  N   . ARG C 1 378 ? 121.043 121.321 179.793 1.00 77.09  ? 379 ARG C N   1 
ATOM   10168 C  CA  . ARG C 1 378 ? 121.295 119.898 179.637 1.00 77.79  ? 379 ARG C CA  1 
ATOM   10169 C  C   . ARG C 1 378 ? 122.392 119.433 180.567 1.00 77.78  ? 379 ARG C C   1 
ATOM   10170 O  O   . ARG C 1 378 ? 122.354 118.326 181.073 1.00 77.83  ? 379 ARG C O   1 
ATOM   10171 C  CB  . ARG C 1 378 ? 121.669 119.583 178.184 1.00 78.38  ? 379 ARG C CB  1 
ATOM   10172 C  CG  . ARG C 1 378 ? 122.398 118.264 177.979 1.00 78.87  ? 379 ARG C CG  1 
ATOM   10173 C  CD  . ARG C 1 378 ? 122.560 117.873 176.515 1.00 79.22  ? 379 ARG C CD  1 
ATOM   10174 N  NE  . ARG C 1 378 ? 123.471 118.717 175.750 1.00 79.47  ? 379 ARG C NE  1 
ATOM   10175 C  CZ  . ARG C 1 378 ? 124.738 118.932 176.063 1.00 79.70  ? 379 ARG C CZ  1 
ATOM   10176 N  NH1 . ARG C 1 378 ? 125.252 118.385 177.143 1.00 79.76  1 379 ARG C NH1 1 
ATOM   10177 N  NH2 . ARG C 1 378 ? 125.488 119.705 175.305 1.00 79.75  ? 379 ARG C NH2 1 
ATOM   10178 N  N   . ASN C 1 379 ? 123.345 120.307 180.833 1.00 75.31  ? 380 ASN C N   1 
ATOM   10179 C  CA  . ASN C 1 379 ? 124.476 119.958 181.668 1.00 75.27  ? 380 ASN C CA  1 
ATOM   10180 C  C   . ASN C 1 379 ? 124.161 119.932 183.147 1.00 75.20  ? 380 ASN C C   1 
ATOM   10181 O  O   . ASN C 1 379 ? 124.937 119.429 183.938 1.00 75.24  ? 380 ASN C O   1 
ATOM   10182 C  CB  . ASN C 1 379 ? 125.634 120.913 181.412 1.00 75.28  ? 380 ASN C CB  1 
ATOM   10183 C  CG  . ASN C 1 379 ? 126.284 120.692 180.078 1.00 75.29  ? 380 ASN C CG  1 
ATOM   10184 O  OD1 . ASN C 1 379 ? 126.143 119.637 179.475 1.00 75.31  ? 380 ASN C OD1 1 
ATOM   10185 N  ND2 . ASN C 1 379 ? 127.011 121.685 179.610 1.00 75.30  ? 380 ASN C ND2 1 
ATOM   10186 N  N   . TYR C 1 380 ? 123.016 120.470 183.522 1.00 71.73  ? 381 TYR C N   1 
ATOM   10187 C  CA  . TYR C 1 380 ? 122.717 120.654 184.924 1.00 71.64  ? 381 TYR C CA  1 
ATOM   10188 C  C   . TYR C 1 380 ? 121.360 120.105 185.310 1.00 71.84  ? 381 TYR C C   1 
ATOM   10189 O  O   . TYR C 1 380 ? 120.715 120.615 186.210 1.00 71.85  ? 381 TYR C O   1 
ATOM   10190 C  CB  . TYR C 1 380 ? 122.806 122.134 185.259 1.00 71.41  ? 381 TYR C CB  1 
ATOM   10191 C  CG  . TYR C 1 380 ? 124.006 122.791 184.640 1.00 71.17  ? 381 TYR C CG  1 
ATOM   10192 C  CD1 . TYR C 1 380 ? 123.890 123.544 183.496 1.00 71.04  ? 381 TYR C CD1 1 
ATOM   10193 C  CD2 . TYR C 1 380 ? 125.261 122.633 185.185 1.00 71.04  ? 381 TYR C CD2 1 
ATOM   10194 C  CE1 . TYR C 1 380 ? 124.984 124.131 182.925 1.00 70.94  ? 381 TYR C CE1 1 
ATOM   10195 C  CE2 . TYR C 1 380 ? 126.355 123.217 184.617 1.00 70.94  ? 381 TYR C CE2 1 
ATOM   10196 C  CZ  . TYR C 1 380 ? 126.212 123.963 183.488 1.00 70.91  ? 381 TYR C CZ  1 
ATOM   10197 O  OH  . TYR C 1 380 ? 127.307 124.549 182.914 1.00 70.88  ? 381 TYR C OH  1 
ATOM   10198 N  N   . MET C 1 381 ? 120.941 119.050 184.629 1.00 82.16  ? 382 MET C N   1 
ATOM   10199 C  CA  . MET C 1 381 ? 119.604 118.516 184.799 1.00 82.25  ? 382 MET C CA  1 
ATOM   10200 C  C   . MET C 1 381 ? 119.364 118.033 186.203 1.00 81.63  ? 382 MET C C   1 
ATOM   10201 O  O   . MET C 1 381 ? 118.274 118.157 186.727 1.00 81.61  ? 382 MET C O   1 
ATOM   10202 C  CB  . MET C 1 381 ? 119.403 117.342 183.859 1.00 82.75  ? 382 MET C CB  1 
ATOM   10203 C  CG  . MET C 1 381 ? 119.246 117.716 182.420 1.00 83.10  ? 382 MET C CG  1 
ATOM   10204 S  SD  . MET C 1 381 ? 117.577 118.206 182.037 1.00 83.40  ? 382 MET C SD  1 
ATOM   10205 C  CE  . MET C 1 381 ? 117.866 119.885 181.580 1.00 83.59  ? 382 MET C CE  1 
ATOM   10206 N  N   . THR C 1 382 ? 120.401 117.491 186.814 1.00 75.82  ? 383 THR C N   1 
ATOM   10207 C  CA  . THR C 1 382 ? 120.271 116.921 188.136 1.00 75.17  ? 383 THR C CA  1 
ATOM   10208 C  C   . THR C 1 382 ? 120.835 117.846 189.196 1.00 74.45  ? 383 THR C C   1 
ATOM   10209 O  O   . THR C 1 382 ? 120.927 117.487 190.357 1.00 74.39  ? 383 THR C O   1 
ATOM   10210 C  CB  . THR C 1 382 ? 120.954 115.566 188.215 1.00 75.21  ? 383 THR C CB  1 
ATOM   10211 O  OG1 . THR C 1 382 ? 122.341 115.715 187.917 1.00 75.27  ? 383 THR C OG1 1 
ATOM   10212 C  CG2 . THR C 1 382 ? 120.337 114.621 187.221 1.00 75.25  ? 383 THR C CG2 1 
ATOM   10213 N  N   . LYS C 1 383 ? 121.211 119.044 188.784 1.00 72.58  ? 384 LYS C N   1 
ATOM   10214 C  CA  . LYS C 1 383 ? 121.756 120.013 189.709 1.00 71.99  ? 384 LYS C CA  1 
ATOM   10215 C  C   . LYS C 1 383 ? 120.787 121.140 189.998 1.00 72.35  ? 384 LYS C C   1 
ATOM   10216 O  O   . LYS C 1 383 ? 119.783 120.928 190.649 1.00 72.49  ? 384 LYS C O   1 
ATOM   10217 C  CB  . LYS C 1 383 ? 123.083 120.550 189.203 1.00 71.24  ? 384 LYS C CB  1 
ATOM   10218 C  CG  . LYS C 1 383 ? 124.212 119.551 189.285 1.00 70.62  ? 384 LYS C CG  1 
ATOM   10219 C  CD  . LYS C 1 383 ? 125.545 120.248 189.247 1.00 70.08  ? 384 LYS C CD  1 
ATOM   10220 C  CE  . LYS C 1 383 ? 126.680 119.288 189.421 1.00 69.71  ? 384 LYS C CE  1 
ATOM   10221 N  NZ  . LYS C 1 383 ? 127.966 120.004 189.346 1.00 69.54  1 384 LYS C NZ  1 
ATOM   10222 N  N   . PHE C 1 384 ? 121.077 122.339 189.518 1.00 74.24  ? 385 PHE C N   1 
ATOM   10223 C  CA  . PHE C 1 384 ? 120.253 123.483 189.877 1.00 74.63  ? 385 PHE C CA  1 
ATOM   10224 C  C   . PHE C 1 384 ? 118.840 123.378 189.353 1.00 75.93  ? 385 PHE C C   1 
ATOM   10225 O  O   . PHE C 1 384 ? 117.928 123.988 189.880 1.00 76.00  ? 385 PHE C O   1 
ATOM   10226 C  CB  . PHE C 1 384 ? 120.908 124.817 189.497 1.00 74.03  ? 385 PHE C CB  1 
ATOM   10227 C  CG  . PHE C 1 384 ? 120.736 125.215 188.061 1.00 73.49  ? 385 PHE C CG  1 
ATOM   10228 C  CD1 . PHE C 1 384 ? 119.627 125.917 187.651 1.00 73.23  ? 385 PHE C CD1 1 
ATOM   10229 C  CD2 . PHE C 1 384 ? 121.710 124.935 187.135 1.00 73.20  ? 385 PHE C CD2 1 
ATOM   10230 C  CE1 . PHE C 1 384 ? 119.478 126.289 186.352 1.00 73.04  ? 385 PHE C CE1 1 
ATOM   10231 C  CE2 . PHE C 1 384 ? 121.559 125.311 185.834 1.00 73.05  ? 385 PHE C CE2 1 
ATOM   10232 C  CZ  . PHE C 1 384 ? 120.442 125.989 185.446 1.00 72.99  ? 385 PHE C CZ  1 
ATOM   10233 N  N   . LEU C 1 385 ? 118.660 122.614 188.294 1.00 74.55  ? 386 LEU C N   1 
ATOM   10234 C  CA  . LEU C 1 385 ? 117.330 122.369 187.787 1.00 76.01  ? 386 LEU C CA  1 
ATOM   10235 C  C   . LEU C 1 385 ? 116.517 121.546 188.766 1.00 78.10  ? 386 LEU C C   1 
ATOM   10236 O  O   . LEU C 1 385 ? 115.298 121.648 188.814 1.00 78.25  ? 386 LEU C O   1 
ATOM   10237 C  CB  . LEU C 1 385 ? 117.392 121.661 186.448 1.00 75.58  ? 386 LEU C CB  1 
ATOM   10238 C  CG  . LEU C 1 385 ? 116.086 121.805 185.686 1.00 75.22  ? 386 LEU C CG  1 
ATOM   10239 C  CD1 . LEU C 1 385 ? 115.884 123.249 185.363 1.00 75.11  ? 386 LEU C CD1 1 
ATOM   10240 C  CD2 . LEU C 1 385 ? 116.096 120.981 184.440 1.00 75.11  ? 386 LEU C CD2 1 
ATOM   10241 N  N   . SER C 1 386 ? 117.202 120.718 189.543 1.00 94.51  ? 387 SER C N   1 
ATOM   10242 C  CA  . SER C 1 386 ? 116.545 119.839 190.495 1.00 96.82  ? 387 SER C CA  1 
ATOM   10243 C  C   . SER C 1 386 ? 116.321 120.537 191.812 1.00 98.87  ? 387 SER C C   1 
ATOM   10244 O  O   . SER C 1 386 ? 117.241 121.100 192.381 1.00 98.99  ? 387 SER C O   1 
ATOM   10245 C  CB  . SER C 1 386 ? 117.396 118.600 190.726 1.00 96.99  ? 387 SER C CB  1 
ATOM   10246 O  OG  . SER C 1 386 ? 116.877 117.809 191.772 1.00 97.10  ? 387 SER C OG  1 
ATOM   10247 N  N   . ASP C 1 387 ? 115.093 120.495 192.303 1.00 98.22  ? 388 ASP C N   1 
ATOM   10248 C  CA  . ASP C 1 387 ? 114.780 121.142 193.559 1.00 100.08 ? 388 ASP C CA  1 
ATOM   10249 C  C   . ASP C 1 387 ? 115.485 120.479 194.725 1.00 101.31 ? 388 ASP C C   1 
ATOM   10250 O  O   . ASP C 1 387 ? 115.906 121.145 195.662 1.00 101.43 ? 388 ASP C O   1 
ATOM   10251 C  CB  . ASP C 1 387 ? 113.277 121.123 193.798 1.00 100.44 ? 388 ASP C CB  1 
ATOM   10252 C  CG  . ASP C 1 387 ? 112.519 121.934 192.786 1.00 100.53 ? 388 ASP C CG  1 
ATOM   10253 O  OD1 . ASP C 1 387 ? 112.912 123.082 192.531 1.00 100.65 ? 388 ASP C OD1 1 
ATOM   10254 O  OD2 . ASP C 1 387 ? 111.525 121.421 192.244 1.00 100.64 1 388 ASP C OD2 1 
ATOM   10255 N  N   . ARG C 1 388 ? 115.617 119.163 194.672 1.00 130.38 ? 389 ARG C N   1 
ATOM   10256 C  CA  . ARG C 1 388 ? 116.207 118.461 195.795 1.00 131.26 ? 389 ARG C CA  1 
ATOM   10257 C  C   . ARG C 1 388 ? 117.667 118.817 195.949 1.00 128.57 ? 389 ARG C C   1 
ATOM   10258 O  O   . ARG C 1 388 ? 118.178 118.880 197.056 1.00 128.43 ? 389 ARG C O   1 
ATOM   10259 C  CB  . ARG C 1 388 ? 115.994 116.943 195.693 1.00 133.95 ? 389 ARG C CB  1 
ATOM   10260 C  CG  . ARG C 1 388 ? 116.702 116.254 194.549 1.00 136.36 ? 389 ARG C CG  1 
ATOM   10261 C  CD  . ARG C 1 388 ? 118.011 115.624 195.002 1.00 138.49 ? 389 ARG C CD  1 
ATOM   10262 N  NE  . ARG C 1 388 ? 118.918 115.384 193.881 1.00 140.59 ? 389 ARG C NE  1 
ATOM   10263 C  CZ  . ARG C 1 388 ? 120.203 115.067 194.008 1.00 142.40 ? 389 ARG C CZ  1 
ATOM   10264 N  NH1 . ARG C 1 388 ? 120.747 114.950 195.212 1.00 142.91 1 389 ARG C NH1 1 
ATOM   10265 N  NH2 . ARG C 1 388 ? 120.946 114.870 192.928 1.00 143.00 ? 389 ARG C NH2 1 
ATOM   10266 N  N   . TRP C 1 389 ? 118.330 119.071 194.833 1.00 78.61  ? 390 TRP C N   1 
ATOM   10267 C  CA  . TRP C 1 389 ? 119.730 119.438 194.865 1.00 75.71  ? 390 TRP C CA  1 
ATOM   10268 C  C   . TRP C 1 389 ? 119.863 120.833 195.428 1.00 75.82  ? 390 TRP C C   1 
ATOM   10269 O  O   . TRP C 1 389 ? 120.771 121.122 196.191 1.00 75.77  ? 390 TRP C O   1 
ATOM   10270 C  CB  . TRP C 1 389 ? 120.317 119.366 193.459 1.00 73.56  ? 390 TRP C CB  1 
ATOM   10271 C  CG  . TRP C 1 389 ? 121.775 119.657 193.360 1.00 71.35  ? 390 TRP C CG  1 
ATOM   10272 C  CD1 . TRP C 1 389 ? 122.785 118.766 193.425 1.00 70.59  ? 390 TRP C CD1 1 
ATOM   10273 C  CD2 . TRP C 1 389 ? 122.380 120.927 193.142 1.00 69.97  ? 390 TRP C CD2 1 
ATOM   10274 N  NE1 . TRP C 1 389 ? 123.984 119.395 193.277 1.00 69.91  ? 390 TRP C NE1 1 
ATOM   10275 C  CE2 . TRP C 1 389 ? 123.759 120.729 193.102 1.00 69.55  ? 390 TRP C CE2 1 
ATOM   10276 C  CE3 . TRP C 1 389 ? 121.885 122.215 192.984 1.00 69.30  ? 390 TRP C CE3 1 
ATOM   10277 C  CZ2 . TRP C 1 389 ? 124.644 121.759 192.912 1.00 69.04  ? 390 TRP C CZ2 1 
ATOM   10278 C  CZ3 . TRP C 1 389 ? 122.767 123.234 192.798 1.00 68.91  ? 390 TRP C CZ3 1 
ATOM   10279 C  CH2 . TRP C 1 389 ? 124.129 123.005 192.761 1.00 68.83  ? 390 TRP C CH2 1 
ATOM   10280 N  N   . MET C 1 390 ? 118.942 121.703 195.049 1.00 84.92  ? 391 MET C N   1 
ATOM   10281 C  CA  . MET C 1 390 ? 118.971 123.074 195.517 1.00 85.12  ? 391 MET C CA  1 
ATOM   10282 C  C   . MET C 1 390 ? 118.709 123.162 197.005 1.00 85.99  ? 391 MET C C   1 
ATOM   10283 O  O   . MET C 1 390 ? 119.241 124.027 197.692 1.00 86.03  ? 391 MET C O   1 
ATOM   10284 C  CB  . MET C 1 390 ? 117.955 123.909 194.752 1.00 84.65  ? 391 MET C CB  1 
ATOM   10285 C  CG  . MET C 1 390 ? 118.328 124.143 193.314 1.00 84.33  ? 391 MET C CG  1 
ATOM   10286 S  SD  . MET C 1 390 ? 119.567 125.417 193.104 1.00 84.00  ? 391 MET C SD  1 
ATOM   10287 C  CE  . MET C 1 390 ? 118.576 126.871 193.317 1.00 83.82  ? 391 MET C CE  1 
ATOM   10288 N  N   . LEU C 1 391 ? 117.879 122.255 197.495 1.00 94.40  ? 392 LEU C N   1 
ATOM   10289 C  CA  . LEU C 1 391 ? 117.577 122.198 198.908 1.00 95.32  ? 392 LEU C CA  1 
ATOM   10290 C  C   . LEU C 1 391 ? 118.778 121.647 199.649 1.00 96.00  ? 392 LEU C C   1 
ATOM   10291 O  O   . LEU C 1 391 ? 119.188 122.167 200.678 1.00 96.05  ? 392 LEU C O   1 
ATOM   10292 C  CB  . LEU C 1 391 ? 116.366 121.299 199.144 1.00 95.51  ? 392 LEU C CB  1 
ATOM   10293 C  CG  . LEU C 1 391 ? 114.978 121.836 198.805 1.00 95.66  ? 392 LEU C CG  1 
ATOM   10294 C  CD1 . LEU C 1 391 ? 113.948 120.728 198.848 1.00 95.71  ? 392 LEU C CD1 1 
ATOM   10295 C  CD2 . LEU C 1 391 ? 114.606 122.918 199.776 1.00 95.74  ? 392 LEU C CD2 1 
ATOM   10296 N  N   . GLN C 1 392 ? 119.341 120.586 199.091 1.00 102.81 ? 393 GLN C N   1 
ATOM   10297 C  CA  . GLN C 1 392 ? 120.457 119.874 199.686 1.00 103.45 ? 393 GLN C CA  1 
ATOM   10298 C  C   . GLN C 1 392 ? 121.692 120.753 199.761 1.00 103.27 ? 393 GLN C C   1 
ATOM   10299 O  O   . GLN C 1 392 ? 122.497 120.630 200.675 1.00 103.26 ? 393 GLN C O   1 
ATOM   10300 C  CB  . GLN C 1 392 ? 120.738 118.625 198.851 1.00 104.10 ? 393 GLN C CB  1 
ATOM   10301 C  CG  . GLN C 1 392 ? 121.950 117.827 199.231 1.00 104.61 ? 393 GLN C CG  1 
ATOM   10302 C  CD  . GLN C 1 392 ? 122.100 116.598 198.362 1.00 104.99 ? 393 GLN C CD  1 
ATOM   10303 O  OE1 . GLN C 1 392 ? 121.264 116.336 197.501 1.00 105.11 ? 393 GLN C OE1 1 
ATOM   10304 N  NE2 . GLN C 1 392 ? 123.165 115.835 198.582 1.00 105.20 ? 393 GLN C NE2 1 
ATOM   10305 N  N   . LYS C 1 393 ? 121.833 121.646 198.791 1.00 89.88  ? 394 LYS C N   1 
ATOM   10306 C  CA  . LYS C 1 393 ? 122.957 122.566 198.754 1.00 89.73  ? 394 LYS C CA  1 
ATOM   10307 C  C   . LYS C 1 393 ? 122.656 123.854 199.496 1.00 90.82  ? 394 LYS C C   1 
ATOM   10308 O  O   . LYS C 1 393 ? 123.506 124.724 199.612 1.00 90.82  ? 394 LYS C O   1 
ATOM   10309 C  CB  . LYS C 1 393 ? 123.372 122.859 197.314 1.00 88.88  ? 394 LYS C CB  1 
ATOM   10310 C  CG  . LYS C 1 393 ? 124.123 121.731 196.637 1.00 88.15  ? 394 LYS C CG  1 
ATOM   10311 C  CD  . LYS C 1 393 ? 125.464 121.509 197.292 1.00 87.62  ? 394 LYS C CD  1 
ATOM   10312 C  CE  . LYS C 1 393 ? 126.061 120.154 196.964 1.00 87.20  ? 394 LYS C CE  1 
ATOM   10313 N  NZ  . LYS C 1 393 ? 126.850 120.172 195.716 1.00 87.01  1 394 LYS C NZ  1 
ATOM   10314 N  N   . GLY C 1 394 ? 121.436 123.981 199.989 1.00 76.86  ? 395 GLY C N   1 
ATOM   10315 C  CA  . GLY C 1 394 ? 121.080 125.129 200.794 1.00 78.25  ? 395 GLY C CA  1 
ATOM   10316 C  C   . GLY C 1 394 ? 120.767 126.388 200.022 1.00 79.92  ? 395 GLY C C   1 
ATOM   10317 O  O   . GLY C 1 394 ? 120.722 127.473 200.587 1.00 79.98  ? 395 GLY C O   1 
ATOM   10318 N  N   . PHE C 1 395 ? 120.574 126.259 198.720 1.00 93.44  ? 396 PHE C N   1 
ATOM   10319 C  CA  . PHE C 1 395 ? 120.223 127.417 197.918 1.00 95.50  ? 396 PHE C CA  1 
ATOM   10320 C  C   . PHE C 1 395 ? 118.746 127.744 198.027 1.00 99.58  ? 396 PHE C C   1 
ATOM   10321 O  O   . PHE C 1 395 ? 118.354 128.900 197.953 1.00 99.86  ? 396 PHE C O   1 
ATOM   10322 C  CB  . PHE C 1 395 ? 120.631 127.212 196.465 1.00 94.20  ? 396 PHE C CB  1 
ATOM   10323 C  CG  . PHE C 1 395 ? 122.108 127.117 196.267 1.00 92.94  ? 396 PHE C CG  1 
ATOM   10324 C  CD1 . PHE C 1 395 ? 122.921 128.174 196.577 1.00 92.39  ? 396 PHE C CD1 1 
ATOM   10325 C  CD2 . PHE C 1 395 ? 122.682 125.972 195.770 1.00 92.32  ? 396 PHE C CD2 1 
ATOM   10326 C  CE1 . PHE C 1 395 ? 124.265 128.087 196.403 1.00 91.92  ? 396 PHE C CE1 1 
ATOM   10327 C  CE2 . PHE C 1 395 ? 124.027 125.889 195.594 1.00 91.93  ? 396 PHE C CE2 1 
ATOM   10328 C  CZ  . PHE C 1 395 ? 124.819 126.945 195.912 1.00 91.79  ? 396 PHE C CZ  1 
ATOM   10329 N  N   . LEU C 1 396 ? 117.928 126.718 198.212 1.00 120.30 ? 397 LEU C N   1 
ATOM   10330 C  CA  . LEU C 1 396 ? 116.506 126.919 198.439 1.00 124.74 ? 397 LEU C CA  1 
ATOM   10331 C  C   . LEU C 1 396 ? 116.138 126.695 199.894 1.00 128.80 ? 397 LEU C C   1 
ATOM   10332 O  O   . LEU C 1 396 ? 116.218 125.578 200.393 1.00 128.94 ? 397 LEU C O   1 
ATOM   10333 C  CB  . LEU C 1 396 ? 115.677 125.966 197.586 1.00 125.24 ? 397 LEU C CB  1 
ATOM   10334 C  CG  . LEU C 1 396 ? 115.283 126.405 196.186 1.00 125.55 ? 397 LEU C CG  1 
ATOM   10335 C  CD1 . LEU C 1 396 ? 114.297 125.414 195.617 1.00 125.69 ? 397 LEU C CD1 1 
ATOM   10336 C  CD2 . LEU C 1 396 ? 114.680 127.778 196.233 1.00 125.77 ? 397 LEU C CD2 1 
ATOM   10337 N  N   . LYS C 1 397 ? 115.746 127.757 200.582 1.00 132.05 ? 398 LYS C N   1 
ATOM   10338 C  CA  . LYS C 1 397 ? 115.163 127.607 201.899 1.00 136.11 ? 398 LYS C CA  1 
ATOM   10339 C  C   . LYS C 1 397 ? 113.768 127.039 201.731 1.00 138.79 ? 398 LYS C C   1 
ATOM   10340 O  O   . LYS C 1 397 ? 113.080 127.367 200.773 1.00 139.08 ? 398 LYS C O   1 
ATOM   10341 C  CB  . LYS C 1 397 ? 115.112 128.953 202.607 1.00 137.37 ? 398 LYS C CB  1 
ATOM   10342 C  CG  . LYS C 1 397 ? 116.466 129.619 202.736 1.00 138.37 ? 398 LYS C CG  1 
ATOM   10343 C  CD  . LYS C 1 397 ? 116.341 131.010 203.332 1.00 139.36 ? 398 LYS C CD  1 
ATOM   10344 C  CE  . LYS C 1 397 ? 117.687 131.710 203.392 1.00 140.02 ? 398 LYS C CE  1 
ATOM   10345 N  NZ  . LYS C 1 397 ? 117.567 133.110 203.889 1.00 140.36 1 398 LYS C NZ  1 
ATOM   10346 N  N   . GLU C 1 398 ? 113.352 126.191 202.663 1.00 142.07 ? 399 GLU C N   1 
ATOM   10347 C  CA  . GLU C 1 398 ? 112.033 125.575 202.595 1.00 144.59 ? 399 GLU C CA  1 
ATOM   10348 C  C   . GLU C 1 398 ? 110.903 126.588 202.692 1.00 147.57 ? 399 GLU C C   1 
ATOM   10349 O  O   . GLU C 1 398 ? 109.873 126.437 202.045 1.00 147.97 ? 399 GLU C O   1 
ATOM   10350 C  CB  . GLU C 1 398 ? 111.872 124.545 203.712 1.00 144.24 ? 399 GLU C CB  1 
ATOM   10351 C  CG  . GLU C 1 398 ? 110.505 123.893 203.748 1.00 143.95 ? 399 GLU C CG  1 
ATOM   10352 C  CD  . GLU C 1 398 ? 110.279 123.062 204.995 1.00 143.83 ? 399 GLU C CD  1 
ATOM   10353 O  OE1 . GLU C 1 398 ? 111.222 122.918 205.799 1.00 143.79 ? 399 GLU C OE1 1 
ATOM   10354 O  OE2 . GLU C 1 398 ? 109.154 122.553 205.176 1.00 143.78 1 399 GLU C OE2 1 
ATOM   10355 N  N   . GLU C 1 399 ? 111.111 127.634 203.479 1.00 158.73 ? 400 GLU C N   1 
ATOM   10356 C  CA  . GLU C 1 399 ? 110.065 128.613 203.735 1.00 161.59 ? 400 GLU C CA  1 
ATOM   10357 C  C   . GLU C 1 399 ? 109.628 129.303 202.458 1.00 163.65 ? 400 GLU C C   1 
ATOM   10358 O  O   . GLU C 1 399 ? 108.440 129.516 202.239 1.00 163.89 ? 400 GLU C O   1 
ATOM   10359 C  CB  . GLU C 1 399 ? 110.542 129.655 204.744 1.00 162.19 ? 400 GLU C CB  1 
ATOM   10360 C  CG  . GLU C 1 399 ? 111.052 129.074 206.054 1.00 162.49 ? 400 GLU C CG  1 
ATOM   10361 C  CD  . GLU C 1 399 ? 111.680 130.128 206.949 1.00 162.69 ? 400 GLU C CD  1 
ATOM   10362 O  OE1 . GLU C 1 399 ? 112.123 131.175 206.425 1.00 162.76 ? 400 GLU C OE1 1 
ATOM   10363 O  OE2 . GLU C 1 399 ? 111.737 129.911 208.178 1.00 162.68 1 400 GLU C OE2 1 
ATOM   10364 N  N   . LEU C 1 401 ? 109.985 128.492 199.385 1.00 142.85 ? 402 LEU C N   1 
ATOM   10365 C  CA  . LEU C 1 401 ? 109.145 127.647 198.549 1.00 143.47 ? 402 LEU C CA  1 
ATOM   10366 C  C   . LEU C 1 401 ? 107.693 127.719 198.999 1.00 143.49 ? 402 LEU C C   1 
ATOM   10367 O  O   . LEU C 1 401 ? 106.817 128.107 198.231 1.00 143.52 ? 402 LEU C O   1 
ATOM   10368 C  CB  . LEU C 1 401 ? 109.627 126.198 198.596 1.00 143.79 ? 402 LEU C CB  1 
ATOM   10369 C  CG  . LEU C 1 401 ? 110.220 125.620 197.312 1.00 144.05 ? 402 LEU C CG  1 
ATOM   10370 C  CD1 . LEU C 1 401 ? 110.201 124.102 197.367 1.00 144.15 ? 402 LEU C CD1 1 
ATOM   10371 C  CD2 . LEU C 1 401 ? 109.476 126.132 196.086 1.00 144.13 ? 402 LEU C CD2 1 
ATOM   10372 N  N   . LYS C 1 404 ? 105.397 130.911 198.477 1.00 129.93 ? 405 LYS C N   1 
ATOM   10373 C  CA  . LYS C 1 404 ? 104.883 131.172 197.140 1.00 127.63 ? 405 LYS C CA  1 
ATOM   10374 C  C   . LYS C 1 404 ? 103.597 130.381 196.901 1.00 126.50 ? 405 LYS C C   1 
ATOM   10375 O  O   . LYS C 1 404 ? 102.835 130.671 195.984 1.00 126.43 ? 405 LYS C O   1 
ATOM   10376 C  CB  . LYS C 1 404 ? 105.943 130.813 196.090 1.00 126.54 ? 405 LYS C CB  1 
ATOM   10377 C  CG  . LYS C 1 404 ? 105.911 131.677 194.830 1.00 125.57 ? 405 LYS C CG  1 
ATOM   10378 C  CD  . LYS C 1 404 ? 107.273 131.747 194.142 1.00 124.62 ? 405 LYS C CD  1 
ATOM   10379 C  CE  . LYS C 1 404 ? 108.239 132.659 194.890 1.00 123.97 ? 405 LYS C CE  1 
ATOM   10380 N  NZ  . LYS C 1 404 ? 109.519 132.857 194.150 1.00 123.63 1 405 LYS C NZ  1 
ATOM   10381 N  N   . LYS C 1 405 ? 103.374 129.386 197.752 1.00 160.46 ? 406 LYS C N   1 
ATOM   10382 C  CA  . LYS C 1 405 ? 102.305 128.389 197.615 1.00 159.12 ? 406 LYS C CA  1 
ATOM   10383 C  C   . LYS C 1 405 ? 100.893 128.775 198.106 1.00 155.61 ? 406 LYS C C   1 
ATOM   10384 O  O   . LYS C 1 405 ? 100.751 129.657 198.946 1.00 155.40 ? 406 LYS C O   1 
ATOM   10385 C  CB  . LYS C 1 405 ? 102.784 127.088 198.254 1.00 160.95 ? 406 LYS C CB  1 
ATOM   10386 C  CG  . LYS C 1 405 ? 103.971 126.497 197.524 1.00 162.57 ? 406 LYS C CG  1 
ATOM   10387 C  CD  . LYS C 1 405 ? 104.810 125.656 198.450 1.00 163.90 ? 406 LYS C CD  1 
ATOM   10388 C  CE  . LYS C 1 405 ? 105.986 125.023 197.729 1.00 164.95 ? 406 LYS C CE  1 
ATOM   10389 N  NZ  . LYS C 1 405 ? 106.879 124.295 198.683 1.00 165.48 1 406 LYS C NZ  1 
ATOM   10390 N  N   . PRO C 1 406 ? 99.847  128.106 197.577 1.00 129.93 ? 407 PRO C N   1 
ATOM   10391 C  CA  . PRO C 1 406 ? 98.442  128.402 197.891 1.00 127.40 ? 407 PRO C CA  1 
ATOM   10392 C  C   . PRO C 1 406 ? 98.027  128.066 199.313 1.00 124.38 ? 407 PRO C C   1 
ATOM   10393 O  O   . PRO C 1 406 ? 98.815  127.527 200.077 1.00 124.19 ? 407 PRO C O   1 
ATOM   10394 C  CB  . PRO C 1 406 ? 97.667  127.490 196.935 1.00 127.92 ? 407 PRO C CB  1 
ATOM   10395 C  CG  . PRO C 1 406 ? 98.617  127.109 195.897 1.00 128.58 ? 407 PRO C CG  1 
ATOM   10396 C  CD  . PRO C 1 406 ? 99.943  127.051 196.559 1.00 129.32 ? 407 PRO C CD  1 
ATOM   10397 N  N   . TRP C 1 407 ? 96.783  128.390 199.648 1.00 117.01 ? 408 TRP C N   1 
ATOM   10398 C  CA  . TRP C 1 407 ? 96.261  128.210 200.997 1.00 114.39 ? 408 TRP C CA  1 
ATOM   10399 C  C   . TRP C 1 407 ? 96.183  126.761 201.447 1.00 113.28 ? 408 TRP C C   1 
ATOM   10400 O  O   . TRP C 1 407 ? 96.320  126.460 202.627 1.00 113.14 ? 408 TRP C O   1 
ATOM   10401 C  CB  . TRP C 1 407 ? 94.875  128.842 201.109 1.00 113.32 ? 408 TRP C CB  1 
ATOM   10402 C  CG  . TRP C 1 407 ? 93.844  128.214 200.234 1.00 112.30 ? 408 TRP C CG  1 
ATOM   10403 C  CD1 . TRP C 1 407 ? 93.486  128.606 198.986 1.00 111.84 ? 408 TRP C CD1 1 
ATOM   10404 C  CD2 . TRP C 1 407 ? 93.025  127.083 200.549 1.00 111.52 ? 408 TRP C CD2 1 
ATOM   10405 N  NE1 . TRP C 1 407 ? 92.499  127.788 198.498 1.00 111.48 ? 408 TRP C NE1 1 
ATOM   10406 C  CE2 . TRP C 1 407 ? 92.200  126.844 199.443 1.00 111.30 ? 408 TRP C CE2 1 
ATOM   10407 C  CE3 . TRP C 1 407 ? 92.912  126.249 201.662 1.00 111.18 ? 408 TRP C CE3 1 
ATOM   10408 C  CZ2 . TRP C 1 407 ? 91.280  125.805 199.416 1.00 111.04 ? 408 TRP C CZ2 1 
ATOM   10409 C  CZ3 . TRP C 1 407 ? 91.998  125.220 201.628 1.00 110.97 ? 408 TRP C CZ3 1 
ATOM   10410 C  CH2 . TRP C 1 407 ? 91.198  125.006 200.518 1.00 110.93 ? 408 TRP C CH2 1 
ATOM   10411 N  N   . TRP C 1 408 ? 95.962  125.863 200.501 1.00 116.09 ? 409 TRP C N   1 
ATOM   10412 C  CA  . TRP C 1 408 ? 95.735  124.471 200.837 1.00 115.14 ? 409 TRP C CA  1 
ATOM   10413 C  C   . TRP C 1 408 ? 97.020  123.701 201.032 1.00 114.73 ? 409 TRP C C   1 
ATOM   10414 O  O   . TRP C 1 408 ? 96.998  122.543 201.419 1.00 114.54 ? 409 TRP C O   1 
ATOM   10415 C  CB  . TRP C 1 408 ? 94.857  123.796 199.788 1.00 114.76 ? 409 TRP C CB  1 
ATOM   10416 C  CG  . TRP C 1 408 ? 95.406  123.819 198.406 1.00 114.37 ? 409 TRP C CG  1 
ATOM   10417 C  CD1 . TRP C 1 408 ? 95.099  124.698 197.422 1.00 114.23 ? 409 TRP C CD1 1 
ATOM   10418 C  CD2 . TRP C 1 408 ? 96.342  122.902 197.845 1.00 113.99 ? 409 TRP C CD2 1 
ATOM   10419 N  NE1 . TRP C 1 408 ? 95.792  124.395 196.282 1.00 114.08 ? 409 TRP C NE1 1 
ATOM   10420 C  CE2 . TRP C 1 408 ? 96.565  123.293 196.520 1.00 113.93 ? 409 TRP C CE2 1 
ATOM   10421 C  CE3 . TRP C 1 408 ? 97.020  121.791 198.340 1.00 113.69 ? 409 TRP C CE3 1 
ATOM   10422 C  CZ2 . TRP C 1 408 ? 97.431  122.618 195.685 1.00 113.73 ? 409 TRP C CZ2 1 
ATOM   10423 C  CZ3 . TRP C 1 408 ? 97.879  121.123 197.510 1.00 113.53 ? 409 TRP C CZ3 1 
ATOM   10424 C  CH2 . TRP C 1 408 ? 98.079  121.535 196.197 1.00 113.52 ? 409 TRP C CH2 1 
ATOM   10425 N  N   . TRP C 1 409 ? 98.143  124.347 200.762 1.00 115.45 ? 410 TRP C N   1 
ATOM   10426 C  CA  . TRP C 1 409 ? 99.410  123.642 200.750 1.00 115.12 ? 410 TRP C CA  1 
ATOM   10427 C  C   . TRP C 1 409 ? 99.748  123.071 202.108 1.00 114.77 ? 410 TRP C C   1 
ATOM   10428 O  O   . TRP C 1 409 ? 100.259 121.964 202.217 1.00 114.69 ? 410 TRP C O   1 
ATOM   10429 C  CB  . TRP C 1 409 ? 100.523 124.588 200.315 1.00 115.11 ? 410 TRP C CB  1 
ATOM   10430 C  CG  . TRP C 1 409 ? 101.768 123.887 199.913 1.00 115.11 ? 410 TRP C CG  1 
ATOM   10431 C  CD1 . TRP C 1 409 ? 102.871 123.674 200.672 1.00 115.21 ? 410 TRP C CD1 1 
ATOM   10432 C  CD2 . TRP C 1 409 ? 102.033 123.298 198.649 1.00 115.08 ? 410 TRP C CD2 1 
ATOM   10433 N  NE1 . TRP C 1 409 ? 103.811 122.987 199.958 1.00 115.26 ? 410 TRP C NE1 1 
ATOM   10434 C  CE2 . TRP C 1 409 ? 103.316 122.744 198.708 1.00 115.12 ? 410 TRP C CE2 1 
ATOM   10435 C  CE3 . TRP C 1 409 ? 101.305 123.185 197.469 1.00 115.01 ? 410 TRP C CE3 1 
ATOM   10436 C  CZ2 . TRP C 1 409 ? 103.887 122.090 197.634 1.00 115.10 ? 410 TRP C CZ2 1 
ATOM   10437 C  CZ3 . TRP C 1 409 ? 101.873 122.538 196.406 1.00 114.98 ? 410 TRP C CZ3 1 
ATOM   10438 C  CH2 . TRP C 1 409 ? 103.149 121.997 196.492 1.00 115.00 ? 410 TRP C CH2 1 
ATOM   10439 N  N   . HIS C 1 410 ? 99.426  123.817 203.151 1.00 129.41 ? 411 HIS C N   1 
ATOM   10440 C  CA  . HIS C 1 410 ? 99.759  123.391 204.498 1.00 129.02 ? 411 HIS C CA  1 
ATOM   10441 C  C   . HIS C 1 410 ? 98.538  122.820 205.200 1.00 126.79 ? 411 HIS C C   1 
ATOM   10442 O  O   . HIS C 1 410 ? 98.095  123.334 206.221 1.00 126.63 ? 411 HIS C O   1 
ATOM   10443 C  CB  . HIS C 1 410 ? 100.364 124.545 205.297 1.00 130.41 ? 411 HIS C CB  1 
ATOM   10444 C  CG  . HIS C 1 410 ? 101.701 124.993 204.793 1.00 131.86 ? 411 HIS C CG  1 
ATOM   10445 N  ND1 . HIS C 1 410 ? 102.878 124.388 205.172 1.00 132.58 ? 411 HIS C ND1 1 
ATOM   10446 C  CD2 . HIS C 1 410 ? 102.044 125.991 203.946 1.00 132.69 ? 411 HIS C CD2 1 
ATOM   10447 C  CE1 . HIS C 1 410 ? 103.892 124.994 204.578 1.00 133.17 ? 411 HIS C CE1 1 
ATOM   10448 N  NE2 . HIS C 1 410 ? 103.412 125.969 203.829 1.00 133.20 ? 411 HIS C NE2 1 
ATOM   10449 N  N   . LEU C 1 411 ? 97.998  121.752 204.629 1.00 97.18  ? 412 LEU C N   1 
ATOM   10450 C  CA  . LEU C 1 411 ? 96.869  121.051 205.205 1.00 95.33  ? 412 LEU C CA  1 
ATOM   10451 C  C   . LEU C 1 411 ? 97.161  119.574 205.196 1.00 95.39  ? 412 LEU C C   1 
ATOM   10452 O  O   . LEU C 1 411 ? 97.839  119.075 204.314 1.00 95.29  ? 412 LEU C O   1 
ATOM   10453 C  CB  . LEU C 1 411 ? 95.606  121.302 204.398 1.00 93.81  ? 412 LEU C CB  1 
ATOM   10454 C  CG  . LEU C 1 411 ? 94.631  122.348 204.912 1.00 92.61  ? 412 LEU C CG  1 
ATOM   10455 C  CD1 . LEU C 1 411 ? 95.231  123.726 204.829 1.00 92.20  ? 412 LEU C CD1 1 
ATOM   10456 C  CD2 . LEU C 1 411 ? 93.352  122.287 204.119 1.00 92.14  ? 412 LEU C CD2 1 
ATOM   10457 N  N   . ARG C 1 412 ? 96.651  118.877 206.196 1.00 115.49 ? 413 ARG C N   1 
ATOM   10458 C  CA  . ARG C 1 412 ? 96.831  117.444 206.287 1.00 115.79 ? 413 ARG C CA  1 
ATOM   10459 C  C   . ARG C 1 412 ? 95.947  116.694 205.301 1.00 116.09 ? 413 ARG C C   1 
ATOM   10460 O  O   . ARG C 1 412 ? 94.864  117.147 204.952 1.00 116.12 ? 413 ARG C O   1 
ATOM   10461 C  CB  . ARG C 1 412 ? 96.584  116.980 207.716 1.00 115.86 ? 413 ARG C CB  1 
ATOM   10462 C  CG  . ARG C 1 412 ? 97.522  117.622 208.714 1.00 115.98 ? 413 ARG C CG  1 
ATOM   10463 C  CD  . ARG C 1 412 ? 98.953  117.269 208.385 1.00 116.11 ? 413 ARG C CD  1 
ATOM   10464 N  NE  . ARG C 1 412 ? 99.933  118.065 209.118 1.00 116.27 ? 413 ARG C NE  1 
ATOM   10465 C  CZ  . ARG C 1 412 ? 100.499 117.696 210.260 1.00 116.41 ? 413 ARG C CZ  1 
ATOM   10466 N  NH1 . ARG C 1 412 ? 100.177 116.544 210.820 1.00 116.45 1 413 ARG C NH1 1 
ATOM   10467 N  NH2 . ARG C 1 412 ? 101.384 118.485 210.844 1.00 116.46 ? 413 ARG C NH2 1 
ATOM   10468 N  N   . VAL C 1 413 ? 96.431  115.546 204.849 1.00 101.93 ? 414 VAL C N   1 
ATOM   10469 C  CA  . VAL C 1 413 ? 95.716  114.729 203.883 1.00 102.35 ? 414 VAL C CA  1 
ATOM   10470 C  C   . VAL C 1 413 ? 94.408  114.183 204.449 1.00 103.49 ? 414 VAL C C   1 
ATOM   10471 O  O   . VAL C 1 413 ? 93.452  113.968 203.721 1.00 103.60 ? 414 VAL C O   1 
ATOM   10472 C  CB  . VAL C 1 413 ? 96.628  113.608 203.352 1.00 101.80 ? 414 VAL C CB  1 
ATOM   10473 C  CG1 . VAL C 1 413 ? 97.493  113.099 204.446 1.00 101.63 ? 414 VAL C CG1 1 
ATOM   10474 C  CG2 . VAL C 1 413 ? 95.832  112.478 202.731 1.00 101.60 ? 414 VAL C CG2 1 
ATOM   10475 N  N   . GLN C 1 414 ? 94.350  114.027 205.763 1.00 115.81 ? 415 GLN C N   1 
ATOM   10476 C  CA  . GLN C 1 414 ? 93.188  113.438 206.418 1.00 116.95 ? 415 GLN C CA  1 
ATOM   10477 C  C   . GLN C 1 414 ? 91.942  114.258 206.175 1.00 117.99 ? 415 GLN C C   1 
ATOM   10478 O  O   . GLN C 1 414 ? 90.828  113.758 206.282 1.00 118.10 ? 415 GLN C O   1 
ATOM   10479 C  CB  . GLN C 1 414 ? 93.423  113.310 207.921 1.00 117.09 ? 415 GLN C CB  1 
ATOM   10480 C  CG  . GLN C 1 414 ? 93.667  114.627 208.624 1.00 117.20 ? 415 GLN C CG  1 
ATOM   10481 C  CD  . GLN C 1 414 ? 94.036  114.451 210.082 1.00 117.30 ? 415 GLN C CD  1 
ATOM   10482 O  OE1 . GLN C 1 414 ? 95.093  114.892 210.525 1.00 117.31 ? 415 GLN C OE1 1 
ATOM   10483 N  NE2 . GLN C 1 414 ? 93.160  113.809 210.836 1.00 117.34 ? 415 GLN C NE2 1 
ATOM   10484 N  N   . GLU C 1 415 ? 92.138  115.524 205.844 1.00 137.53 ? 416 GLU C N   1 
ATOM   10485 C  CA  . GLU C 1 415 ? 91.033  116.439 205.625 1.00 138.39 ? 416 GLU C CA  1 
ATOM   10486 C  C   . GLU C 1 415 ? 90.399  116.273 204.249 1.00 138.47 ? 416 GLU C C   1 
ATOM   10487 O  O   . GLU C 1 415 ? 89.408  116.921 203.930 1.00 138.45 ? 416 GLU C O   1 
ATOM   10488 C  CB  . GLU C 1 415 ? 91.495  117.881 205.844 1.00 138.95 ? 416 GLU C CB  1 
ATOM   10489 C  CG  . GLU C 1 415 ? 91.781  118.218 207.302 1.00 139.29 ? 416 GLU C CG  1 
ATOM   10490 C  CD  . GLU C 1 415 ? 92.547  119.513 207.477 1.00 139.48 ? 416 GLU C CD  1 
ATOM   10491 O  OE1 . GLU C 1 415 ? 93.289  119.886 206.550 1.00 139.49 ? 416 GLU C OE1 1 
ATOM   10492 O  OE2 . GLU C 1 415 ? 92.411  120.156 208.540 1.00 139.54 1 416 GLU C OE2 1 
ATOM   10493 N  N   . LEU C 1 416 ? 90.986  115.419 203.425 1.00 113.84 ? 417 LEU C N   1 
ATOM   10494 C  CA  . LEU C 1 416 ? 90.460  115.182 202.091 1.00 113.69 ? 417 LEU C CA  1 
ATOM   10495 C  C   . LEU C 1 416 ? 89.111  114.494 202.086 1.00 112.45 ? 417 LEU C C   1 
ATOM   10496 O  O   . LEU C 1 416 ? 88.356  114.614 201.131 1.00 112.40 ? 417 LEU C O   1 
ATOM   10497 C  CB  . LEU C 1 416 ? 91.443  114.371 201.260 1.00 114.42 ? 417 LEU C CB  1 
ATOM   10498 C  CG  . LEU C 1 416 ? 92.644  115.143 200.729 1.00 115.00 ? 417 LEU C CG  1 
ATOM   10499 C  CD1 . LEU C 1 416 ? 93.563  114.226 199.965 1.00 115.23 ? 417 LEU C CD1 1 
ATOM   10500 C  CD2 . LEU C 1 416 ? 92.194  116.268 199.843 1.00 115.09 ? 417 LEU C CD2 1 
ATOM   10501 N  N   . GLY C 1 417 ? 88.810  113.760 203.147 1.00 110.42 ? 418 GLY C N   1 
ATOM   10502 C  CA  . GLY C 1 417 ? 87.581  112.992 203.191 1.00 109.02 ? 418 GLY C CA  1 
ATOM   10503 C  C   . GLY C 1 417 ? 87.753  111.637 202.544 1.00 107.55 ? 418 GLY C C   1 
ATOM   10504 O  O   . GLY C 1 417 ? 87.053  111.279 201.605 1.00 107.45 ? 418 GLY C O   1 
ATOM   10505 N  N   . LEU C 1 418 ? 88.714  110.889 203.060 1.00 108.18 ? 419 LEU C N   1 
ATOM   10506 C  CA  . LEU C 1 418 ? 89.089  109.595 202.520 1.00 106.83 ? 419 LEU C CA  1 
ATOM   10507 C  C   . LEU C 1 418 ? 88.100  108.490 202.847 1.00 105.85 ? 419 LEU C C   1 
ATOM   10508 O  O   . LEU C 1 418 ? 87.368  108.581 203.815 1.00 105.77 ? 419 LEU C O   1 
ATOM   10509 C  CB  . LEU C 1 418 ? 90.465  109.214 203.043 1.00 106.58 ? 419 LEU C CB  1 
ATOM   10510 C  CG  . LEU C 1 418 ? 91.546  110.249 202.772 1.00 106.41 ? 419 LEU C CG  1 
ATOM   10511 C  CD1 . LEU C 1 418 ? 92.822  109.829 203.441 1.00 106.31 ? 419 LEU C CD1 1 
ATOM   10512 C  CD2 . LEU C 1 418 ? 91.746  110.397 201.284 1.00 106.35 ? 419 LEU C CD2 1 
ATOM   10513 N  N   . SER C 1 419 ? 88.083  107.449 202.026 1.00 91.17  ? 420 SER C N   1 
ATOM   10514 C  CA  . SER C 1 419 ? 87.315  106.254 202.329 1.00 90.47  ? 420 SER C CA  1 
ATOM   10515 C  C   . SER C 1 419 ? 88.182  105.029 202.117 1.00 90.33  ? 420 SER C C   1 
ATOM   10516 O  O   . SER C 1 419 ? 88.846  104.915 201.103 1.00 90.29  ? 420 SER C O   1 
ATOM   10517 C  CB  . SER C 1 419 ? 86.084  106.168 201.435 1.00 90.20  ? 420 SER C CB  1 
ATOM   10518 O  OG  . SER C 1 419 ? 86.440  105.847 200.109 1.00 90.13  ? 420 SER C OG  1 
ATOM   10519 N  N   . ALA C 1 420 ? 88.175  104.110 203.073 1.00 100.91 ? 421 ALA C N   1 
ATOM   10520 C  CA  . ALA C 1 420 ? 88.975  102.899 202.959 1.00 101.01 ? 421 ALA C CA  1 
ATOM   10521 C  C   . ALA C 1 420 ? 88.390  101.929 201.956 1.00 101.31 ? 421 ALA C C   1 
ATOM   10522 O  O   . ALA C 1 420 ? 87.244  101.530 202.076 1.00 101.33 ? 421 ALA C O   1 
ATOM   10523 C  CB  . ALA C 1 420 ? 89.109  102.238 204.295 1.00 100.92 ? 421 ALA C CB  1 
ATOM   10524 N  N   . PRO C 1 421 ? 89.191  101.539 200.964 1.00 117.85 ? 422 PRO C N   1 
ATOM   10525 C  CA  . PRO C 1 421 ? 88.820  100.660 199.863 1.00 117.88 ? 422 PRO C CA  1 
ATOM   10526 C  C   . PRO C 1 421 ? 88.897  99.198  200.231 1.00 117.60 ? 422 PRO C C   1 
ATOM   10527 O  O   . PRO C 1 421 ? 89.517  98.850  201.222 1.00 117.60 ? 422 PRO C O   1 
ATOM   10528 C  CB  . PRO C 1 421 ? 89.880  100.974 198.825 1.00 118.07 ? 422 PRO C CB  1 
ATOM   10529 C  CG  . PRO C 1 421 ? 91.072  101.232 199.633 1.00 118.11 ? 422 PRO C CG  1 
ATOM   10530 C  CD  . PRO C 1 421 ? 90.605  101.925 200.877 1.00 118.04 ? 422 PRO C CD  1 
ATOM   10531 N  N   . LEU C 1 422 ? 88.257  98.355  199.436 1.00 114.60 ? 423 LEU C N   1 
ATOM   10532 C  CA  . LEU C 1 422 ? 88.405  96.923  199.578 1.00 114.18 ? 423 LEU C CA  1 
ATOM   10533 C  C   . LEU C 1 422 ? 89.702  96.461  198.939 1.00 113.14 ? 423 LEU C C   1 
ATOM   10534 O  O   . LEU C 1 422 ? 90.085  96.948  197.892 1.00 112.91 ? 423 LEU C O   1 
ATOM   10535 C  CB  . LEU C 1 422 ? 87.230  96.226  198.914 1.00 114.69 ? 423 LEU C CB  1 
ATOM   10536 C  CG  . LEU C 1 422 ? 87.095  94.748  199.229 1.00 115.13 ? 423 LEU C CG  1 
ATOM   10537 C  CD1 . LEU C 1 422 ? 87.049  94.544  200.723 1.00 115.22 ? 423 LEU C CD1 1 
ATOM   10538 C  CD2 . LEU C 1 422 ? 85.844  94.218  198.596 1.00 115.37 ? 423 LEU C CD2 1 
ATOM   10539 N  N   . THR C 1 423 ? 90.355  95.491  199.558 1.00 102.21 ? 424 THR C N   1 
ATOM   10540 C  CA  . THR C 1 423 ? 91.624  94.969  199.072 1.00 101.24 ? 424 THR C CA  1 
ATOM   10541 C  C   . THR C 1 423 ? 91.421  93.655  198.325 1.00 100.48 ? 424 THR C C   1 
ATOM   10542 O  O   . THR C 1 423 ? 90.499  92.918  198.624 1.00 100.43 ? 424 THR C O   1 
ATOM   10543 C  CB  . THR C 1 423 ? 92.591  94.778  200.253 1.00 101.07 ? 424 THR C CB  1 
ATOM   10544 O  OG1 . THR C 1 423 ? 93.199  96.032  200.574 1.00 101.06 ? 424 THR C OG1 1 
ATOM   10545 C  CG2 . THR C 1 423 ? 93.666  93.777  199.943 1.00 100.95 ? 424 THR C CG2 1 
ATOM   10546 N  N   . VAL C 1 424 ? 92.264  93.369  197.340 1.00 107.00 ? 425 VAL C N   1 
ATOM   10547 C  CA  . VAL C 1 424 ? 92.215  92.089  196.649 1.00 106.31 ? 425 VAL C CA  1 
ATOM   10548 C  C   . VAL C 1 424 ? 93.595  91.470  196.493 1.00 105.63 ? 425 VAL C C   1 
ATOM   10549 O  O   . VAL C 1 424 ? 94.600  92.162  196.520 1.00 105.53 ? 425 VAL C O   1 
ATOM   10550 C  CB  . VAL C 1 424 ? 91.602  92.223  195.256 1.00 106.32 ? 425 VAL C CB  1 
ATOM   10551 C  CG1 . VAL C 1 424 ? 90.242  92.869  195.330 1.00 106.33 ? 425 VAL C CG1 1 
ATOM   10552 C  CG2 . VAL C 1 424 ? 92.506  93.027  194.369 1.00 106.31 ? 425 VAL C CG2 1 
ATOM   10553 N  N   . LEU C 1 425 ? 93.630  90.154  196.347 1.00 94.12  ? 426 LEU C N   1 
ATOM   10554 C  CA  . LEU C 1 425 ? 94.866  89.435  196.090 1.00 93.62  ? 426 LEU C CA  1 
ATOM   10555 C  C   . LEU C 1 425 ? 95.335  89.604  194.655 1.00 94.00  ? 426 LEU C C   1 
ATOM   10556 O  O   . LEU C 1 425 ? 94.530  89.801  193.769 1.00 94.04  ? 426 LEU C O   1 
ATOM   10557 C  CB  . LEU C 1 425 ? 94.684  87.953  196.386 1.00 92.95  ? 426 LEU C CB  1 
ATOM   10558 C  CG  . LEU C 1 425 ? 94.645  87.537  197.846 1.00 92.41  ? 426 LEU C CG  1 
ATOM   10559 C  CD1 . LEU C 1 425 ? 94.921  86.058  197.960 1.00 92.22  ? 426 LEU C CD1 1 
ATOM   10560 C  CD2 . LEU C 1 425 ? 95.671  88.313  198.615 1.00 92.22  ? 426 LEU C CD2 1 
ATOM   10561 N  N   . PRO C 1 426 ? 96.647  89.522  194.420 1.00 105.05 ? 427 PRO C N   1 
ATOM   10562 C  CA  . PRO C 1 426 ? 97.159  89.523  193.051 1.00 105.43 ? 427 PRO C CA  1 
ATOM   10563 C  C   . PRO C 1 426 ? 96.600  88.366  192.253 1.00 106.06 ? 427 PRO C C   1 
ATOM   10564 O  O   . PRO C 1 426 ? 96.441  88.479  191.048 1.00 106.10 ? 427 PRO C O   1 
ATOM   10565 C  CB  . PRO C 1 426 ? 98.661  89.336  193.244 1.00 105.26 ? 427 PRO C CB  1 
ATOM   10566 C  CG  . PRO C 1 426 ? 98.806  88.745  194.586 1.00 105.14 ? 427 PRO C CG  1 
ATOM   10567 C  CD  . PRO C 1 426 ? 97.727  89.359  195.401 1.00 105.06 ? 427 PRO C CD  1 
ATOM   10568 N  N   . THR C 1 427 ? 96.321  87.262  192.930 1.00 100.94 ? 428 THR C N   1 
ATOM   10569 C  CA  . THR C 1 427 ? 95.880  86.033  192.282 1.00 101.58 ? 428 THR C CA  1 
ATOM   10570 C  C   . THR C 1 427 ? 94.387  85.966  192.000 1.00 102.23 ? 428 THR C C   1 
ATOM   10571 O  O   . THR C 1 427 ? 93.913  85.009  191.405 1.00 102.26 ? 428 THR C O   1 
ATOM   10572 C  CB  . THR C 1 427 ? 96.282  84.807  193.094 1.00 101.59 ? 428 THR C CB  1 
ATOM   10573 O  OG1 . THR C 1 427 ? 96.000  85.044  194.473 1.00 101.58 ? 428 THR C OG1 1 
ATOM   10574 C  CG2 . THR C 1 427 ? 97.750  84.544  192.940 1.00 101.58 ? 428 THR C CG2 1 
ATOM   10575 N  N   . ILE C 1 428 ? 93.645  86.968  192.443 1.00 92.17  ? 429 ILE C N   1 
ATOM   10576 C  CA  . ILE C 1 428 ? 92.218  87.000  192.182 1.00 92.90  ? 429 ILE C CA  1 
ATOM   10577 C  C   . ILE C 1 428 ? 92.002  87.139  190.685 1.00 94.43  ? 429 ILE C C   1 
ATOM   10578 O  O   . ILE C 1 428 ? 92.853  87.659  189.979 1.00 94.53  ? 429 ILE C O   1 
ATOM   10579 C  CB  . ILE C 1 428 ? 91.524  88.140  192.937 1.00 92.26  ? 429 ILE C CB  1 
ATOM   10580 C  CG1 . ILE C 1 428 ? 90.009  87.986  192.896 1.00 91.92  ? 429 ILE C CG1 1 
ATOM   10581 C  CG2 . ILE C 1 428 ? 91.890  89.452  192.348 1.00 92.12  ? 429 ILE C CG2 1 
ATOM   10582 C  CD1 . ILE C 1 428 ? 89.284  89.083  193.615 1.00 91.72  ? 429 ILE C CD1 1 
ATOM   10583 N  N   . THR C 1 429 ? 90.897  86.600  190.192 1.00 113.25 ? 430 THR C N   1 
ATOM   10584 C  CA  . THR C 1 429 ? 90.603  86.649  188.769 1.00 114.84 ? 430 THR C CA  1 
ATOM   10585 C  C   . THR C 1 429 ? 89.760  87.850  188.381 1.00 116.07 ? 430 THR C C   1 
ATOM   10586 O  O   . THR C 1 429 ? 88.994  88.367  189.176 1.00 116.28 ? 430 THR C O   1 
ATOM   10587 C  CB  . THR C 1 429 ? 89.952  85.356  188.278 1.00 115.10 ? 430 THR C CB  1 
ATOM   10588 O  OG1 . THR C 1 429 ? 89.671  85.469  186.881 1.00 115.15 ? 430 THR C OG1 1 
ATOM   10589 C  CG2 . THR C 1 429 ? 88.675  85.097  189.012 1.00 115.22 ? 430 THR C CG2 1 
ATOM   10590 N  N   . CYS C 1 430 ? 89.896  88.262  187.130 1.00 117.71 ? 431 CYS C N   1 
ATOM   10591 C  CA  . CYS C 1 430 ? 89.405  89.545  186.650 1.00 118.70 ? 431 CYS C CA  1 
ATOM   10592 C  C   . CYS C 1 430 ? 87.901  89.788  186.768 1.00 119.42 ? 431 CYS C C   1 
ATOM   10593 O  O   . CYS C 1 430 ? 87.455  90.802  187.324 1.00 119.49 ? 431 CYS C O   1 
ATOM   10594 C  CB  . CYS C 1 430 ? 89.829  89.683  185.199 1.00 118.84 ? 431 CYS C CB  1 
ATOM   10595 S  SG  . CYS C 1 430 ? 91.567  90.085  184.987 1.00 118.84 ? 431 CYS C SG  1 
ATOM   10596 N  N   . GLY C 1 431 ? 87.113  88.843  186.279 1.00 108.42 ? 432 GLY C N   1 
ATOM   10597 C  CA  . GLY C 1 431 ? 85.677  89.016  186.281 1.00 108.99 ? 432 GLY C CA  1 
ATOM   10598 C  C   . GLY C 1 431 ? 85.144  88.978  187.691 1.00 109.48 ? 432 GLY C C   1 
ATOM   10599 O  O   . GLY C 1 431 ? 84.140  89.608  188.014 1.00 109.51 ? 432 GLY C O   1 
ATOM   10600 N  N   . HIS C 1 432 ? 85.848  88.244  188.540 1.00 124.76 ? 433 HIS C N   1 
ATOM   10601 C  CA  . HIS C 1 432 ? 85.478  88.123  189.933 1.00 125.16 ? 433 HIS C CA  1 
ATOM   10602 C  C   . HIS C 1 432 ? 85.607  89.481  190.589 1.00 124.94 ? 433 HIS C C   1 
ATOM   10603 O  O   . HIS C 1 432 ? 84.725  89.911  191.320 1.00 124.86 ? 433 HIS C O   1 
ATOM   10604 C  CB  . HIS C 1 432 ? 86.413  87.140  190.614 1.00 125.60 ? 433 HIS C CB  1 
ATOM   10605 C  CG  . HIS C 1 432 ? 85.824  86.461  191.803 1.00 126.08 ? 433 HIS C CG  1 
ATOM   10606 N  ND1 . HIS C 1 432 ? 86.530  85.559  192.566 1.00 126.31 ? 433 HIS C ND1 1 
ATOM   10607 C  CD2 . HIS C 1 432 ? 84.594  86.541  192.359 1.00 126.30 ? 433 HIS C CD2 1 
ATOM   10608 C  CE1 . HIS C 1 432 ? 85.762  85.117  193.546 1.00 126.42 ? 433 HIS C CE1 1 
ATOM   10609 N  NE2 . HIS C 1 432 ? 84.582  85.697  193.442 1.00 126.42 ? 433 HIS C NE2 1 
ATOM   10610 N  N   . THR C 1 433 ? 86.699  90.170  190.292 1.00 118.60 ? 434 THR C N   1 
ATOM   10611 C  CA  . THR C 1 433 ? 86.912  91.497  190.836 1.00 118.34 ? 434 THR C CA  1 
ATOM   10612 C  C   . THR C 1 433 ? 85.887  92.458  190.307 1.00 117.96 ? 434 THR C C   1 
ATOM   10613 O  O   . THR C 1 433 ? 85.460  93.363  191.014 1.00 117.95 ? 434 THR C O   1 
ATOM   10614 C  CB  . THR C 1 433 ? 88.259  92.055  190.435 1.00 118.40 ? 434 THR C CB  1 
ATOM   10615 O  OG1 . THR C 1 433 ? 88.214  92.444  189.060 1.00 118.37 ? 434 THR C OG1 1 
ATOM   10616 C  CG2 . THR C 1 433 ? 89.311  91.023  190.618 1.00 118.41 ? 434 THR C CG2 1 
ATOM   10617 N  N   . ILE C 1 434 ? 85.488  92.265  189.058 1.00 108.77 ? 435 ILE C N   1 
ATOM   10618 C  CA  . ILE C 1 434 ? 84.463  93.131  188.500 1.00 108.33 ? 435 ILE C CA  1 
ATOM   10619 C  C   . ILE C 1 434 ? 83.172  92.971  189.281 1.00 108.09 ? 435 ILE C C   1 
ATOM   10620 O  O   . ILE C 1 434 ? 82.519  93.950  189.654 1.00 108.07 ? 435 ILE C O   1 
ATOM   10621 C  CB  . ILE C 1 434 ? 84.221  92.803  187.037 1.00 108.15 ? 435 ILE C CB  1 
ATOM   10622 C  CG1 . ILE C 1 434 ? 85.274  93.493  186.187 1.00 107.98 ? 435 ILE C CG1 1 
ATOM   10623 C  CG2 . ILE C 1 434 ? 82.847  93.253  186.611 1.00 108.14 ? 435 ILE C CG2 1 
ATOM   10624 C  CD1 . ILE C 1 434 ? 85.473  92.864  184.869 1.00 107.80 ? 435 ILE C CD1 1 
ATOM   10625 N  N   . GLU C 1 435 ? 82.842  91.724  189.583 1.00 134.93 ? 436 GLU C N   1 
ATOM   10626 C  CA  . GLU C 1 435 ? 81.632  91.441  190.328 1.00 134.64 ? 436 GLU C CA  1 
ATOM   10627 C  C   . GLU C 1 435 ? 81.697  91.999  191.737 1.00 133.94 ? 436 GLU C C   1 
ATOM   10628 O  O   . GLU C 1 435 ? 80.732  92.579  192.211 1.00 133.97 ? 436 GLU C O   1 
ATOM   10629 C  CB  . GLU C 1 435 ? 81.369  89.939  190.359 1.00 134.98 ? 436 GLU C CB  1 
ATOM   10630 C  CG  . GLU C 1 435 ? 80.999  89.356  189.011 1.00 135.24 ? 436 GLU C CG  1 
ATOM   10631 C  CD  . GLU C 1 435 ? 81.055  87.843  188.990 1.00 135.37 ? 436 GLU C CD  1 
ATOM   10632 O  OE1 . GLU C 1 435 ? 81.090  87.234  190.080 1.00 135.42 ? 436 GLU C OE1 1 
ATOM   10633 O  OE2 . GLU C 1 435 ? 81.070  87.263  187.884 1.00 135.43 1 436 GLU C OE2 1 
ATOM   10634 N  N   . ILE C 1 436 ? 82.845  91.864  192.390 1.00 99.02  ? 437 ILE C N   1 
ATOM   10635 C  CA  . ILE C 1 436 ? 82.984  92.343  193.757 1.00 98.40  ? 437 ILE C CA  1 
ATOM   10636 C  C   . ILE C 1 436 ? 82.828  93.850  193.795 1.00 99.94  ? 437 ILE C C   1 
ATOM   10637 O  O   . ILE C 1 436 ? 82.033  94.404  194.571 1.00 100.00 ? 437 ILE C O   1 
ATOM   10638 C  CB  . ILE C 1 436 ? 84.365  91.998  194.332 1.00 96.86  ? 437 ILE C CB  1 
ATOM   10639 C  CG1 . ILE C 1 436 ? 84.615  90.488  194.334 1.00 96.08  ? 437 ILE C CG1 1 
ATOM   10640 C  CG2 . ILE C 1 436 ? 84.486  92.521  195.728 1.00 96.45  ? 437 ILE C CG2 1 
ATOM   10641 C  CD1 . ILE C 1 436 ? 84.104  89.759  195.554 1.00 95.70  ? 437 ILE C CD1 1 
ATOM   10642 N  N   . LEU C 1 437 ? 83.570  94.509  192.914 1.00 117.88 ? 438 LEU C N   1 
ATOM   10643 C  CA  . LEU C 1 437 ? 83.624  95.959  192.899 1.00 119.60 ? 438 LEU C CA  1 
ATOM   10644 C  C   . LEU C 1 437 ? 82.285  96.572  192.559 1.00 122.07 ? 438 LEU C C   1 
ATOM   10645 O  O   . LEU C 1 437 ? 81.882  97.554  193.167 1.00 122.22 ? 438 LEU C O   1 
ATOM   10646 C  CB  . LEU C 1 437 ? 84.679  96.445  191.904 1.00 119.09 ? 438 LEU C CB  1 
ATOM   10647 C  CG  . LEU C 1 437 ? 86.156  96.330  192.282 1.00 118.63 ? 438 LEU C CG  1 
ATOM   10648 C  CD1 . LEU C 1 437 ? 87.018  96.813  191.150 1.00 118.51 ? 438 LEU C CD1 1 
ATOM   10649 C  CD2 . LEU C 1 437 ? 86.439  97.125  193.515 1.00 118.51 ? 438 LEU C CD2 1 
ATOM   10650 N  N   . ARG C 1 438 ? 81.587  95.997  191.589 1.00 108.31 ? 439 ARG C N   1 
ATOM   10651 C  CA  . ARG C 1 438 ? 80.273  96.519  191.256 1.00 110.62 ? 439 ARG C CA  1 
ATOM   10652 C  C   . ARG C 1 438 ? 79.268  96.235  192.354 1.00 110.18 ? 439 ARG C C   1 
ATOM   10653 O  O   . ARG C 1 438 ? 78.417  97.062  192.656 1.00 110.23 ? 439 ARG C O   1 
ATOM   10654 C  CB  . ARG C 1 438 ? 79.770  95.931  189.944 1.00 112.89 ? 439 ARG C CB  1 
ATOM   10655 C  CG  . ARG C 1 438 ? 80.371  96.549  188.700 1.00 114.83 ? 439 ARG C CG  1 
ATOM   10656 C  CD  . ARG C 1 438 ? 79.793  95.906  187.450 1.00 116.37 ? 439 ARG C CD  1 
ATOM   10657 N  NE  . ARG C 1 438 ? 80.219  96.571  186.225 1.00 117.54 ? 439 ARG C NE  1 
ATOM   10658 C  CZ  . ARG C 1 438 ? 79.754  97.746  185.813 1.00 118.34 ? 439 ARG C CZ  1 
ATOM   10659 N  NH1 . ARG C 1 438 ? 78.853  98.391  186.533 1.00 118.83 1 439 ARG C NH1 1 
ATOM   10660 N  NH2 . ARG C 1 438 ? 80.194  98.278  184.687 1.00 118.60 ? 439 ARG C NH2 1 
ATOM   10661 N  N   . GLU C 1 439 ? 79.378  95.057  192.955 1.00 119.63 ? 440 GLU C N   1 
ATOM   10662 C  CA  . GLU C 1 439 ? 78.411  94.638  193.957 1.00 119.02 ? 440 GLU C CA  1 
ATOM   10663 C  C   . GLU C 1 439 ? 78.470  95.529  195.176 1.00 117.98 ? 440 GLU C C   1 
ATOM   10664 O  O   . GLU C 1 439 ? 77.458  95.767  195.821 1.00 117.92 ? 440 GLU C O   1 
ATOM   10665 C  CB  . GLU C 1 439 ? 78.638  93.184  194.358 1.00 119.29 ? 440 GLU C CB  1 
ATOM   10666 C  CG  . GLU C 1 439 ? 77.413  92.500  194.902 1.00 119.49 ? 440 GLU C CG  1 
ATOM   10667 C  CD  . GLU C 1 439 ? 77.520  91.000  194.834 1.00 119.58 ? 440 GLU C CD  1 
ATOM   10668 O  OE1 . GLU C 1 439 ? 78.654  90.490  194.910 1.00 119.61 ? 440 GLU C OE1 1 
ATOM   10669 O  OE2 . GLU C 1 439 ? 76.476  90.330  194.692 1.00 119.62 1 440 GLU C OE2 1 
ATOM   10670 N  N   . LYS C 1 440 ? 79.659  96.025  195.496 1.00 117.43 ? 441 LYS C N   1 
ATOM   10671 C  CA  . LYS C 1 440 ? 79.775  96.970  196.602 1.00 116.34 ? 441 LYS C CA  1 
ATOM   10672 C  C   . LYS C 1 440 ? 79.754  98.434  196.193 1.00 115.19 ? 441 LYS C C   1 
ATOM   10673 O  O   . LYS C 1 440 ? 79.768  99.318  197.042 1.00 115.14 ? 441 LYS C O   1 
ATOM   10674 C  CB  . LYS C 1 440 ? 81.012  96.679  197.428 1.00 116.31 ? 441 LYS C CB  1 
ATOM   10675 C  CG  . LYS C 1 440 ? 80.924  95.386  198.183 1.00 116.30 ? 441 LYS C CG  1 
ATOM   10676 C  CD  . LYS C 1 440 ? 79.895  95.463  199.295 1.00 116.22 ? 441 LYS C CD  1 
ATOM   10677 C  CE  . LYS C 1 440 ? 79.978  94.229  200.177 1.00 116.19 ? 441 LYS C CE  1 
ATOM   10678 N  NZ  . LYS C 1 440 ? 79.151  94.339  201.411 1.00 116.21 1 441 LYS C NZ  1 
ATOM   10679 N  N   . GLY C 1 441 ? 79.717  98.686  194.891 1.00 137.18 ? 442 GLY C N   1 
ATOM   10680 C  CA  . GLY C 1 441 ? 79.703  100.044 194.381 1.00 136.02 ? 442 GLY C CA  1 
ATOM   10681 C  C   . GLY C 1 441 ? 81.066  100.701 194.322 1.00 134.79 ? 442 GLY C C   1 
ATOM   10682 O  O   . GLY C 1 441 ? 81.167  101.910 194.132 1.00 134.72 ? 442 GLY C O   1 
ATOM   10683 N  N   . PHE C 1 442 ? 82.112  99.911  194.528 1.00 119.31 ? 443 PHE C N   1 
ATOM   10684 C  CA  . PHE C 1 442 ? 83.484  100.392 194.398 1.00 118.01 ? 443 PHE C CA  1 
ATOM   10685 C  C   . PHE C 1 442 ? 83.961  100.447 192.948 1.00 115.91 ? 443 PHE C C   1 
ATOM   10686 O  O   . PHE C 1 442 ? 83.518  99.663  192.122 1.00 115.87 ? 443 PHE C O   1 
ATOM   10687 C  CB  . PHE C 1 442 ? 84.423  99.534  195.245 1.00 118.59 ? 443 PHE C CB  1 
ATOM   10688 C  CG  . PHE C 1 442 ? 84.342  99.821  196.714 1.00 119.17 ? 443 PHE C CG  1 
ATOM   10689 C  CD1 . PHE C 1 442 ? 83.277  99.376  197.459 1.00 119.43 ? 443 PHE C CD1 1 
ATOM   10690 C  CD2 . PHE C 1 442 ? 85.331  100.539 197.345 1.00 119.44 ? 443 PHE C CD2 1 
ATOM   10691 C  CE1 . PHE C 1 442 ? 83.198  99.643  198.801 1.00 119.61 ? 443 PHE C CE1 1 
ATOM   10692 C  CE2 . PHE C 1 442 ? 85.254  100.809 198.688 1.00 119.59 ? 443 PHE C CE2 1 
ATOM   10693 C  CZ  . PHE C 1 442 ? 84.186  100.361 199.414 1.00 119.66 ? 443 PHE C CZ  1 
ATOM   10694 N  N   . ASN C 1 443 ? 84.867  101.371 192.647 1.00 104.93 ? 444 ASN C N   1 
ATOM   10695 C  CA  . ASN C 1 443 ? 85.397  101.490 191.298 1.00 102.98 ? 444 ASN C CA  1 
ATOM   10696 C  C   . ASN C 1 443 ? 86.870  101.138 191.170 1.00 101.02 ? 444 ASN C C   1 
ATOM   10697 O  O   . ASN C 1 443 ? 87.405  101.086 190.070 1.00 100.75 ? 444 ASN C O   1 
ATOM   10698 C  CB  . ASN C 1 443 ? 85.131  102.883 190.739 1.00 103.00 ? 444 ASN C CB  1 
ATOM   10699 C  CG  . ASN C 1 443 ? 85.713  103.966 191.599 1.00 103.05 ? 444 ASN C CG  1 
ATOM   10700 O  OD1 . ASN C 1 443 ? 86.020  103.740 192.765 1.00 103.04 ? 444 ASN C OD1 1 
ATOM   10701 N  ND2 . ASN C 1 443 ? 85.866  105.156 191.036 1.00 103.03 ? 444 ASN C ND2 1 
ATOM   10702 N  N   . GLN C 1 444 ? 87.521  100.878 192.293 1.00 100.75 ? 445 GLN C N   1 
ATOM   10703 C  CA  . GLN C 1 444 ? 88.928  100.508 192.277 1.00 99.01  ? 445 GLN C CA  1 
ATOM   10704 C  C   . GLN C 1 444 ? 89.348  99.816  193.562 1.00 97.47  ? 445 GLN C C   1 
ATOM   10705 O  O   . GLN C 1 444 ? 88.742  100.013 194.603 1.00 97.37  ? 445 GLN C O   1 
ATOM   10706 C  CB  . GLN C 1 444 ? 89.778  101.745 192.077 1.00 98.86  ? 445 GLN C CB  1 
ATOM   10707 C  CG  . GLN C 1 444 ? 89.671  102.717 193.206 1.00 98.80  ? 445 GLN C CG  1 
ATOM   10708 C  CD  . GLN C 1 444 ? 90.343  104.022 192.907 1.00 98.67  ? 445 GLN C CD  1 
ATOM   10709 O  OE1 . GLN C 1 444 ? 90.723  104.289 191.774 1.00 98.70  ? 445 GLN C OE1 1 
ATOM   10710 N  NE2 . GLN C 1 444 ? 90.496  104.850 193.922 1.00 98.61  ? 445 GLN C NE2 1 
ATOM   10711 N  N   . ALA C 1 445 ? 90.392  99.004  193.486 1.00 93.64  ? 446 ALA C N   1 
ATOM   10712 C  CA  . ALA C 1 445 ? 90.888  98.285  194.647 1.00 92.25  ? 446 ALA C CA  1 
ATOM   10713 C  C   . ALA C 1 445 ? 92.390  98.133  194.604 1.00 91.01  ? 446 ALA C C   1 
ATOM   10714 O  O   . ALA C 1 445 ? 92.941  97.722  193.591 1.00 90.89  ? 446 ALA C O   1 
ATOM   10715 C  CB  . ALA C 1 445 ? 90.247  96.933  194.719 1.00 92.23  ? 446 ALA C CB  1 
ATOM   10716 N  N   . PRO C 1 446 ? 93.064  98.494  195.695 1.00 75.50  ? 447 PRO C N   1 
ATOM   10717 C  CA  . PRO C 1 446 ? 94.485  98.194  195.785 1.00 75.08  ? 447 PRO C CA  1 
ATOM   10718 C  C   . PRO C 1 446 ? 94.738  96.706  195.774 1.00 75.22  ? 447 PRO C C   1 
ATOM   10719 O  O   . PRO C 1 446 ? 93.956  95.954  196.319 1.00 75.17  ? 447 PRO C O   1 
ATOM   10720 C  CB  . PRO C 1 446 ? 94.887  98.807  197.124 1.00 74.79  ? 447 PRO C CB  1 
ATOM   10721 C  CG  . PRO C 1 446 ? 93.648  99.072  197.825 1.00 74.76  ? 447 PRO C CG  1 
ATOM   10722 C  CD  . PRO C 1 446 ? 92.617  99.326  196.812 1.00 75.02  ? 447 PRO C CD  1 
ATOM   10723 N  N   . VAL C 1 447 ? 95.831  96.295  195.154 1.00 90.47  ? 448 VAL C N   1 
ATOM   10724 C  CA  . VAL C 1 447 ? 96.224  94.903  195.146 1.00 90.89  ? 448 VAL C CA  1 
ATOM   10725 C  C   . VAL C 1 447 ? 97.271  94.680  196.203 1.00 91.94  ? 448 VAL C C   1 
ATOM   10726 O  O   . VAL C 1 447 ? 98.405  95.156  196.077 1.00 91.94  ? 448 VAL C O   1 
ATOM   10727 C  CB  . VAL C 1 447 ? 96.804  94.486  193.810 1.00 90.48  ? 448 VAL C CB  1 
ATOM   10728 C  CG1 . VAL C 1 447 ? 97.361  93.098  193.904 1.00 90.35  ? 448 VAL C CG1 1 
ATOM   10729 C  CG2 . VAL C 1 447 ? 95.751  94.537  192.760 1.00 90.36  ? 448 VAL C CG2 1 
ATOM   10730 N  N   . VAL C 1 448 ? 96.871  93.964  197.249 1.00 89.76  ? 449 VAL C N   1 
ATOM   10731 C  CA  . VAL C 1 448 ? 97.728  93.676  198.385 1.00 91.10  ? 449 VAL C CA  1 
ATOM   10732 C  C   . VAL C 1 448 ? 97.926  92.183  198.550 1.00 93.59  ? 449 VAL C C   1 
ATOM   10733 O  O   . VAL C 1 448 ? 97.013  91.398  198.360 1.00 93.77  ? 449 VAL C O   1 
ATOM   10734 C  CB  . VAL C 1 448 ? 97.145  94.242  199.681 1.00 90.28  ? 449 VAL C CB  1 
ATOM   10735 C  CG1 . VAL C 1 448 ? 98.123  94.091  200.819 1.00 90.09  ? 449 VAL C CG1 1 
ATOM   10736 C  CG2 . VAL C 1 448 ? 96.790  95.691  199.499 1.00 89.94  ? 449 VAL C CG2 1 
ATOM   10737 N  N   . ASP C 1 449 ? 99.139  91.814  198.922 1.00 120.93 ? 450 ASP C N   1 
ATOM   10738 C  CA  . ASP C 1 449 ? 99.561  90.434  199.026 1.00 123.63 ? 450 ASP C CA  1 
ATOM   10739 C  C   . ASP C 1 449 ? 98.999  89.746  200.249 1.00 125.71 ? 450 ASP C C   1 
ATOM   10740 O  O   . ASP C 1 449 ? 98.511  90.392  201.162 1.00 125.88 ? 450 ASP C O   1 
ATOM   10741 C  CB  . ASP C 1 449 ? 101.072 90.390  199.098 1.00 123.97 ? 450 ASP C CB  1 
ATOM   10742 C  CG  . ASP C 1 449 ? 101.628 89.056  198.718 1.00 124.26 ? 450 ASP C CG  1 
ATOM   10743 O  OD1 . ASP C 1 449 ? 101.019 88.387  197.866 1.00 124.34 ? 450 ASP C OD1 1 
ATOM   10744 O  OD2 . ASP C 1 449 ? 102.680 88.675  199.265 1.00 124.35 1 450 ASP C OD2 1 
ATOM   10745 N  N   . GLU C 1 450 ? 99.062  88.423  200.248 1.00 124.04 ? 451 GLU C N   1 
ATOM   10746 C  CA  . GLU C 1 450 ? 98.661  87.628  201.394 1.00 125.75 ? 451 GLU C CA  1 
ATOM   10747 C  C   . GLU C 1 450 ? 99.490  87.995  202.598 1.00 124.89 ? 451 GLU C C   1 
ATOM   10748 O  O   . GLU C 1 450 ? 99.026  87.905  203.726 1.00 124.94 ? 451 GLU C O   1 
ATOM   10749 C  CB  . GLU C 1 450 ? 98.883  86.151  201.108 1.00 127.59 ? 451 GLU C CB  1 
ATOM   10750 C  CG  . GLU C 1 450 ? 97.737  85.460  200.431 1.00 128.83 ? 451 GLU C CG  1 
ATOM   10751 C  CD  . GLU C 1 450 ? 98.087  84.045  200.048 1.00 129.45 ? 451 GLU C CD  1 
ATOM   10752 O  OE1 . GLU C 1 450 ? 99.294  83.752  199.971 1.00 129.65 ? 451 GLU C OE1 1 
ATOM   10753 O  OE2 . GLU C 1 450 ? 97.166  83.233  199.817 1.00 129.69 1 451 GLU C OE2 1 
ATOM   10754 N  N   . ALA C 1 451 ? 100.727 88.396  202.354 1.00 96.23  ? 452 ALA C N   1 
ATOM   10755 C  CA  . ALA C 1 451 ? 101.625 88.796  203.421 1.00 94.98  ? 452 ALA C CA  1 
ATOM   10756 C  C   . ALA C 1 451 ? 101.404 90.248  203.768 1.00 93.34  ? 452 ALA C C   1 
ATOM   10757 O  O   . ALA C 1 451 ? 102.051 90.793  204.648 1.00 93.27  ? 452 ALA C O   1 
ATOM   10758 C  CB  . ALA C 1 451 ? 103.052 88.564  203.022 1.00 95.12  ? 452 ALA C CB  1 
ATOM   10759 N  N   . GLY C 1 452 ? 100.489 90.879  203.054 1.00 115.79 ? 453 GLY C N   1 
ATOM   10760 C  CA  . GLY C 1 452 ? 100.133 92.247  203.353 1.00 114.07 ? 453 GLY C CA  1 
ATOM   10761 C  C   . GLY C 1 452 ? 100.996 93.311  202.716 1.00 112.33 ? 453 GLY C C   1 
ATOM   10762 O  O   . GLY C 1 452 ? 100.856 94.486  203.032 1.00 112.21 ? 453 GLY C O   1 
ATOM   10763 N  N   . VAL C 1 453 ? 101.903 92.916  201.835 1.00 97.52  ? 454 VAL C N   1 
ATOM   10764 C  CA  . VAL C 1 453 ? 102.633 93.905  201.067 1.00 95.84  ? 454 VAL C CA  1 
ATOM   10765 C  C   . VAL C 1 453 ? 101.798 94.359  199.885 1.00 94.31  ? 454 VAL C C   1 
ATOM   10766 O  O   . VAL C 1 453 ? 101.237 93.551  199.167 1.00 94.29  ? 454 VAL C O   1 
ATOM   10767 C  CB  . VAL C 1 453 ? 104.011 93.392  200.613 1.00 95.77  ? 454 VAL C CB  1 
ATOM   10768 C  CG1 . VAL C 1 453 ? 103.911 92.018  200.020 1.00 95.83  ? 454 VAL C CG1 1 
ATOM   10769 C  CG2 . VAL C 1 453 ? 104.634 94.349  199.627 1.00 95.71  ? 454 VAL C CG2 1 
ATOM   10770 N  N   . ILE C 1 454 ? 101.709 95.666  199.696 1.00 88.08  ? 455 ILE C N   1 
ATOM   10771 C  CA  . ILE C 1 454 ? 100.921 96.213  198.616 1.00 86.64  ? 455 ILE C CA  1 
ATOM   10772 C  C   . ILE C 1 454 ? 101.651 96.047  197.312 1.00 85.77  ? 455 ILE C C   1 
ATOM   10773 O  O   . ILE C 1 454 ? 102.791 96.459  197.183 1.00 85.68  ? 455 ILE C O   1 
ATOM   10774 C  CB  . ILE C 1 454 ? 100.666 97.688  198.830 1.00 86.24  ? 455 ILE C CB  1 
ATOM   10775 C  CG1 . ILE C 1 454 ? 100.108 97.922  200.228 1.00 86.02  ? 455 ILE C CG1 1 
ATOM   10776 C  CG2 . ILE C 1 454 ? 99.717  98.199  197.787 1.00 86.14  ? 455 ILE C CG2 1 
ATOM   10777 C  CD1 . ILE C 1 454 ? 99.853  99.365  200.553 1.00 85.91  ? 455 ILE C CD1 1 
ATOM   10778 N  N   . LEU C 1 455 ? 100.987 95.439  196.342 1.00 83.10  ? 456 LEU C N   1 
ATOM   10779 C  CA  . LEU C 1 455 ? 101.594 95.200  195.046 1.00 82.40  ? 456 LEU C CA  1 
ATOM   10780 C  C   . LEU C 1 455 ? 101.200 96.234  194.021 1.00 82.34  ? 456 LEU C C   1 
ATOM   10781 O  O   . LEU C 1 455 ? 101.926 96.473  193.070 1.00 82.31  ? 456 LEU C O   1 
ATOM   10782 C  CB  . LEU C 1 455 ? 101.220 93.825  194.525 1.00 81.97  ? 456 LEU C CB  1 
ATOM   10783 C  CG  . LEU C 1 455 ? 101.689 92.658  195.363 1.00 81.63  ? 456 LEU C CG  1 
ATOM   10784 C  CD1 . LEU C 1 455 ? 101.563 91.393  194.562 1.00 81.51  ? 456 LEU C CD1 1 
ATOM   10785 C  CD2 . LEU C 1 455 ? 103.109 92.879  195.794 1.00 81.53  ? 456 LEU C CD2 1 
ATOM   10786 N  N   . GLY C 1 456 ? 100.037 96.839  194.194 1.00 92.48  ? 457 GLY C N   1 
ATOM   10787 C  CA  . GLY C 1 456 ? 99.648  97.855  193.242 1.00 92.51  ? 457 GLY C CA  1 
ATOM   10788 C  C   . GLY C 1 456 ? 98.217  98.310  193.299 1.00 92.59  ? 457 GLY C C   1 
ATOM   10789 O  O   . GLY C 1 456 ? 97.634  98.431  194.359 1.00 92.60  ? 457 GLY C O   1 
ATOM   10790 N  N   . MET C 1 457 ? 97.648  98.562  192.135 1.00 94.02  ? 458 MET C N   1 
ATOM   10791 C  CA  . MET C 1 457 ? 96.328  99.140  192.067 1.00 94.14  ? 458 MET C CA  1 
ATOM   10792 C  C   . MET C 1 457 ? 95.556  98.594  190.890 1.00 94.01  ? 458 MET C C   1 
ATOM   10793 O  O   . MET C 1 457 ? 96.125  98.281  189.858 1.00 94.00  ? 458 MET C O   1 
ATOM   10794 C  CB  . MET C 1 457 ? 96.447  100.645 191.940 1.00 94.36  ? 458 MET C CB  1 
ATOM   10795 C  CG  . MET C 1 457 ? 95.204  101.378 192.322 1.00 94.56  ? 458 MET C CG  1 
ATOM   10796 S  SD  . MET C 1 457 ? 94.895  101.312 194.078 1.00 94.79  ? 458 MET C SD  1 
ATOM   10797 C  CE  . MET C 1 457 ? 93.282  102.043 194.108 1.00 95.01  ? 458 MET C CE  1 
ATOM   10798 N  N   . VAL C 1 458 ? 94.245  98.487  191.049 1.00 81.30  ? 459 VAL C N   1 
ATOM   10799 C  CA  . VAL C 1 458 ? 93.415  97.927  190.002 1.00 81.28  ? 459 VAL C CA  1 
ATOM   10800 C  C   . VAL C 1 458 ? 92.109  98.689  189.881 1.00 81.34  ? 459 VAL C C   1 
ATOM   10801 O  O   . VAL C 1 458 ? 91.531  99.082  190.873 1.00 81.40  ? 459 VAL C O   1 
ATOM   10802 C  CB  . VAL C 1 458 ? 93.188  96.445  190.260 1.00 81.31  ? 459 VAL C CB  1 
ATOM   10803 C  CG1 . VAL C 1 458 ? 91.875  95.987  189.713 1.00 81.59  ? 459 VAL C CG1 1 
ATOM   10804 C  CG2 . VAL C 1 458 ? 94.304  95.662  189.649 1.00 81.26  ? 459 VAL C CG2 1 
ATOM   10805 N  N   . THR C 1 459 ? 91.658  98.910  188.652 1.00 83.91  ? 460 THR C N   1 
ATOM   10806 C  CA  . THR C 1 459 ? 90.512  99.770  188.393 1.00 84.12  ? 460 THR C CA  1 
ATOM   10807 C  C   . THR C 1 459 ? 89.425  99.065  187.596 1.00 84.66  ? 460 THR C C   1 
ATOM   10808 O  O   . THR C 1 459 ? 89.712  98.254  186.733 1.00 84.82  ? 460 THR C O   1 
ATOM   10809 C  CB  . THR C 1 459 ? 90.959  101.032 187.662 1.00 83.92  ? 460 THR C CB  1 
ATOM   10810 O  OG1 . THR C 1 459 ? 91.438  101.978 188.615 1.00 83.89  ? 460 THR C OG1 1 
ATOM   10811 C  CG2 . THR C 1 459 ? 89.827  101.657 186.913 1.00 83.85  ? 460 THR C CG2 1 
ATOM   10812 N  N   . LEU C 1 460 ? 88.173  99.374  187.906 1.00 84.57  ? 461 LEU C N   1 
ATOM   10813 C  CA  . LEU C 1 460 ? 87.035  98.787  187.220 1.00 85.09  ? 461 LEU C CA  1 
ATOM   10814 C  C   . LEU C 1 460 ? 87.009  99.127  185.742 1.00 86.07  ? 461 LEU C C   1 
ATOM   10815 O  O   . LEU