data_4L2A
# 
_entry.id   4L2A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4L2A         
RCSB  RCSB080090   
WWPDB D_1000080090 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4L2B . unspecified 
PDB 4L2C . unspecified 
PDB 4L2D . unspecified 
PDB 3LIO . unspecified 
PDB 3LJF . unspecified 
PDB 3LJ9 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4L2A 
_pdbx_database_status.recvd_initial_deposition_date   2013-06-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Merlino, A.'      1 
'Russo Krauss, I.' 2 
'Sica, F.'         3 
# 
_citation.id                        primary 
_citation.title                     
;Structural and denaturation studies of two mutants of a cold adapted superoxide dismutase point to the importance of electrostatic interactions in protein stability.
;
_citation.journal_abbrev            Biochim.Biophys.Acta 
_citation.journal_volume            1844 
_citation.page_first                632 
_citation.page_last                 640 
_citation.year                      2014 
_citation.journal_id_ASTM           BBACAQ 
_citation.country                   NE 
_citation.journal_id_ISSN           0006-3002 
_citation.journal_id_CSD            0113 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24440460 
_citation.pdbx_database_id_DOI      10.1016/j.bbapap.2014.01.007 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Merlino, A.'      1 
primary 'Russo Krauss, I.' 2 
primary 'Castellano, I.'   3 
primary 'Ruocco, M.R.'     4 
primary 'Capasso, A.'      5 
primary 'De Vendittis, E.' 6 
primary 'Rossi, B.'        7 
primary 'Sica, F.'         8 
# 
_cell.entry_id           4L2A 
_cell.length_a           45.622 
_cell.length_b           103.736 
_cell.length_c           50.244 
_cell.angle_alpha        90.00 
_cell.angle_beta         108.29 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4L2A 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Superoxide dismutase [Fe]' 21323.561 2   1.15.1.1 C57R ? ? 
2 non-polymer syn 'FE (III) ION'              55.845    2   ?        ?    ? ? 
3 water       nat water                       18.015    336 ?        ?    ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AFELPSLPYAIDALEPHISKETLEFHHGKHHNTYVVKLNGLIPGTKFENKSLEEIVRSSDGGVFNNAAQIWNHTFYWNSL
SPNGGGAPTGAVADAINAKWGSFDAFKEALNDKAVNNFGSSWTWLVKLADGSLDIVNTSNAATPLTDDGVTPILTVDLWE
HAYYIDYRNVRPDYLKGFWSLVNWEFANANFA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AFELPSLPYAIDALEPHISKETLEFHHGKHHNTYVVKLNGLIPGTKFENKSLEEIVRSSDGGVFNNAAQIWNHTFYWNSL
SPNGGGAPTGAVADAINAKWGSFDAFKEALNDKAVNNFGSSWTWLVKLADGSLDIVNTSNAATPLTDDGVTPILTVDLWE
HAYYIDYRNVRPDYLKGFWSLVNWEFANANFA
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PHE n 
1 3   GLU n 
1 4   LEU n 
1 5   PRO n 
1 6   SER n 
1 7   LEU n 
1 8   PRO n 
1 9   TYR n 
1 10  ALA n 
1 11  ILE n 
1 12  ASP n 
1 13  ALA n 
1 14  LEU n 
1 15  GLU n 
1 16  PRO n 
1 17  HIS n 
1 18  ILE n 
1 19  SER n 
1 20  LYS n 
1 21  GLU n 
1 22  THR n 
1 23  LEU n 
1 24  GLU n 
1 25  PHE n 
1 26  HIS n 
1 27  HIS n 
1 28  GLY n 
1 29  LYS n 
1 30  HIS n 
1 31  HIS n 
1 32  ASN n 
1 33  THR n 
1 34  TYR n 
1 35  VAL n 
1 36  VAL n 
1 37  LYS n 
1 38  LEU n 
1 39  ASN n 
1 40  GLY n 
1 41  LEU n 
1 42  ILE n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  LYS n 
1 47  PHE n 
1 48  GLU n 
1 49  ASN n 
1 50  LYS n 
1 51  SER n 
1 52  LEU n 
1 53  GLU n 
1 54  GLU n 
1 55  ILE n 
1 56  VAL n 
1 57  ARG n 
1 58  SER n 
1 59  SER n 
1 60  ASP n 
1 61  GLY n 
1 62  GLY n 
1 63  VAL n 
1 64  PHE n 
1 65  ASN n 
1 66  ASN n 
1 67  ALA n 
1 68  ALA n 
1 69  GLN n 
1 70  ILE n 
1 71  TRP n 
1 72  ASN n 
1 73  HIS n 
1 74  THR n 
1 75  PHE n 
1 76  TYR n 
1 77  TRP n 
1 78  ASN n 
1 79  SER n 
1 80  LEU n 
1 81  SER n 
1 82  PRO n 
1 83  ASN n 
1 84  GLY n 
1 85  GLY n 
1 86  GLY n 
1 87  ALA n 
1 88  PRO n 
1 89  THR n 
1 90  GLY n 
1 91  ALA n 
1 92  VAL n 
1 93  ALA n 
1 94  ASP n 
1 95  ALA n 
1 96  ILE n 
1 97  ASN n 
1 98  ALA n 
1 99  LYS n 
1 100 TRP n 
1 101 GLY n 
1 102 SER n 
1 103 PHE n 
1 104 ASP n 
1 105 ALA n 
1 106 PHE n 
1 107 LYS n 
1 108 GLU n 
1 109 ALA n 
1 110 LEU n 
1 111 ASN n 
1 112 ASP n 
1 113 LYS n 
1 114 ALA n 
1 115 VAL n 
1 116 ASN n 
1 117 ASN n 
1 118 PHE n 
1 119 GLY n 
1 120 SER n 
1 121 SER n 
1 122 TRP n 
1 123 THR n 
1 124 TRP n 
1 125 LEU n 
1 126 VAL n 
1 127 LYS n 
1 128 LEU n 
1 129 ALA n 
1 130 ASP n 
1 131 GLY n 
1 132 SER n 
1 133 LEU n 
1 134 ASP n 
1 135 ILE n 
1 136 VAL n 
1 137 ASN n 
1 138 THR n 
1 139 SER n 
1 140 ASN n 
1 141 ALA n 
1 142 ALA n 
1 143 THR n 
1 144 PRO n 
1 145 LEU n 
1 146 THR n 
1 147 ASP n 
1 148 ASP n 
1 149 GLY n 
1 150 VAL n 
1 151 THR n 
1 152 PRO n 
1 153 ILE n 
1 154 LEU n 
1 155 THR n 
1 156 VAL n 
1 157 ASP n 
1 158 LEU n 
1 159 TRP n 
1 160 GLU n 
1 161 HIS n 
1 162 ALA n 
1 163 TYR n 
1 164 TYR n 
1 165 ILE n 
1 166 ASP n 
1 167 TYR n 
1 168 ARG n 
1 169 ASN n 
1 170 VAL n 
1 171 ARG n 
1 172 PRO n 
1 173 ASP n 
1 174 TYR n 
1 175 LEU n 
1 176 LYS n 
1 177 GLY n 
1 178 PHE n 
1 179 TRP n 
1 180 SER n 
1 181 LEU n 
1 182 VAL n 
1 183 ASN n 
1 184 TRP n 
1 185 GLU n 
1 186 PHE n 
1 187 ALA n 
1 188 ASN n 
1 189 ALA n 
1 190 ASN n 
1 191 PHE n 
1 192 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'sodB, PSHAa1215' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pseudoalteromonas haloplanktis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     228 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SODF_PSEHT 
_struct_ref.pdbx_db_accession          P84612 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AFELPSLPYAIDALEPHISKETLEFHHGKHHNTYVVKLNGLIPGTKFENKSLEEIVCSSDGGVFNNAAQIWNHTFYWNSL
SPNGGGAPTGAVADAINAKWGSFDAFKEALNDKAVNNFGSSWTWLVKLADGSLDIVNTSNAATPLTDDGVTPILTVDLWE
HAYYIDYRNVRPDYLKGFWSLVNWEFANANFA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4L2A A 1 ? 192 ? P84612 1 ? 192 ? 1 192 
2 1 4L2A B 1 ? 192 ? P84612 1 ? 192 ? 1 192 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4L2A ARG A 57 ? UNP P84612 CYS 57 'ENGINEERED MUTATION' 57 1 
2 4L2A ARG B 57 ? UNP P84612 CYS 57 'ENGINEERED MUTATION' 57 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FE  non-polymer         . 'FE (III) ION'  ? 'Fe 3'           55.845  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4L2A 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.65 
_exptl_crystal.density_percent_sol   53.53 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'PEG 8K 23%, ammonium sulphate 0.2 M, sodium cacodilate 0.1 M, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2007-10-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ELETTRA BEAMLINE 5.2R' 
_diffrn_source.pdbx_synchrotron_site       ELETTRA 
_diffrn_source.pdbx_synchrotron_beamline   5.2R 
_diffrn_source.pdbx_wavelength             1.00 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4L2A 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             28.000 
_reflns.d_resolution_high            2.060 
_reflns.number_obs                   27167 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            0.074 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.06 
_reflns_shell.d_res_low              2.13 
_reflns_shell.percent_possible_all   90.4 
_reflns_shell.Rmerge_I_obs           0.235 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.0 
_reflns_shell.pdbx_redundancy        3.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4L2A 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     25921 
_refine.ls_number_reflns_all                     27167 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.00 
_refine.ls_d_res_high                            2.06 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.190 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.190 
_refine.ls_R_factor_R_free                       0.240 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  2571 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3032 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             336 
_refine_hist.number_atoms_total               3370 
_refine_hist.d_res_high                       2.06 
_refine_hist.d_res_low                        28.00 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    4L2A 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  4L2A 
_struct.title                     
'X-ray structure of the C57R mutant of the iron superoxide dismutase from Pseudoalteromonas haloplanktis (crystal form II)' 
_struct.pdbx_descriptor           'Superoxide dismutase [Fe] (E.C.1.15.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4L2A 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'Superoxide dismutase, C57R mutant, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 19  ? HIS A 27  ? SER A 19  HIS A 27  1 ? 9  
HELX_P HELX_P2  2  LYS A 29  ? ILE A 42  ? LYS A 29  ILE A 42  1 ? 14 
HELX_P HELX_P3  3  SER A 51  ? ARG A 57  ? SER A 51  ARG A 57  1 ? 7  
HELX_P HELX_P4  4  ASP A 60  ? SER A 79  ? ASP A 60  SER A 79  1 ? 20 
HELX_P HELX_P5  5  THR A 89  ? GLY A 101 ? THR A 89  GLY A 101 1 ? 13 
HELX_P HELX_P6  6  SER A 102 ? ASN A 116 ? SER A 102 ASN A 116 1 ? 15 
HELX_P HELX_P7  7  THR A 143 ? ASP A 147 ? THR A 143 ASP A 147 5 ? 5  
HELX_P HELX_P8  8  TRP A 159 ? ALA A 162 ? TRP A 159 ALA A 162 5 ? 4  
HELX_P HELX_P9  9  TYR A 163 ? ARG A 168 ? TYR A 163 ARG A 168 1 ? 6  
HELX_P HELX_P10 10 VAL A 170 ? VAL A 182 ? VAL A 170 VAL A 182 1 ? 13 
HELX_P HELX_P11 11 ASN A 183 ? ALA A 192 ? ASN A 183 ALA A 192 1 ? 10 
HELX_P HELX_P12 12 SER B 19  ? HIS B 27  ? SER B 19  HIS B 27  1 ? 9  
HELX_P HELX_P13 13 LYS B 29  ? ILE B 42  ? LYS B 29  ILE B 42  1 ? 14 
HELX_P HELX_P14 14 SER B 51  ? ARG B 57  ? SER B 51  ARG B 57  1 ? 7  
HELX_P HELX_P15 15 ASP B 60  ? SER B 79  ? ASP B 60  SER B 79  1 ? 20 
HELX_P HELX_P16 16 THR B 89  ? GLY B 101 ? THR B 89  GLY B 101 1 ? 13 
HELX_P HELX_P17 17 SER B 102 ? ASN B 116 ? SER B 102 ASN B 116 1 ? 15 
HELX_P HELX_P18 18 THR B 143 ? ASP B 147 ? THR B 143 ASP B 147 5 ? 5  
HELX_P HELX_P19 19 TRP B 159 ? ALA B 162 ? TRP B 159 ALA B 162 5 ? 4  
HELX_P HELX_P20 20 TYR B 163 ? ARG B 168 ? TYR B 163 ARG B 168 1 ? 6  
HELX_P HELX_P21 21 VAL B 170 ? VAL B 182 ? VAL B 170 VAL B 182 1 ? 13 
HELX_P HELX_P22 22 ASN B 183 ? ALA B 192 ? ASN B 183 ALA B 192 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B ASP 157 OD2 ? ? ? 1_555 D FE  . FE ? ? B ASP 157  B FE  5001 1_555 ? ? ? ? ? ? ? 1.974 ? 
metalc2  metalc ? ? A ASP 157 OD2 ? ? ? 1_555 C FE  . FE ? ? A ASP 157  A FE  5000 1_555 ? ? ? ? ? ? ? 1.983 ? 
metalc3  metalc ? ? B HIS 73  NE2 ? ? ? 1_555 D FE  . FE ? ? B HIS 73   B FE  5001 1_555 ? ? ? ? ? ? ? 2.007 ? 
metalc4  metalc ? ? A HIS 73  NE2 ? ? ? 1_555 C FE  . FE ? ? A HIS 73   A FE  5000 1_555 ? ? ? ? ? ? ? 2.012 ? 
metalc5  metalc ? ? A HIS 161 NE2 ? ? ? 1_555 C FE  . FE ? ? A HIS 161  A FE  5000 1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc6  metalc ? ? A HIS 26  NE2 ? ? ? 1_555 C FE  . FE ? ? A HIS 26   A FE  5000 1_555 ? ? ? ? ? ? ? 2.134 ? 
metalc7  metalc ? ? B HIS 161 NE2 ? ? ? 1_555 D FE  . FE ? ? B HIS 161  B FE  5001 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc8  metalc ? ? B HIS 26  NE2 ? ? ? 1_555 D FE  . FE ? ? B HIS 26   B FE  5001 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc9  metalc ? ? C FE  .   FE  ? ? ? 1_555 E HOH . O  ? ? A FE  5000 A HOH 5101 1_555 ? ? ? ? ? ? ? 2.215 ? 
metalc10 metalc ? ? D FE  .   FE  ? ? ? 1_555 F HOH . O  ? ? B FE  5001 B HOH 5102 1_555 ? ? ? ? ? ? ? 2.321 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 15 A . ? GLU 15 A PRO 16 A ? PRO 16 A 1 0.48  
2 GLU 15 B . ? GLU 15 B PRO 16 B ? PRO 16 B 1 -0.48 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 133 ? SER A 139 ? LEU A 133 SER A 139 
A 2 SER A 121 ? LYS A 127 ? SER A 121 LYS A 127 
A 3 THR A 151 ? ASP A 157 ? THR A 151 ASP A 157 
B 1 LEU B 133 ? SER B 139 ? LEU B 133 SER B 139 
B 2 SER B 121 ? LYS B 127 ? SER B 121 LYS B 127 
B 3 THR B 151 ? ASP B 157 ? THR B 151 ASP B 157 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 136 ? O VAL A 136 N TRP A 124 ? N TRP A 124 
A 2 3 N LYS A 127 ? N LYS A 127 O THR A 151 ? O THR A 151 
B 1 2 O VAL B 136 ? O VAL B 136 N TRP B 124 ? N TRP B 124 
B 2 3 N LYS B 127 ? N LYS B 127 O THR B 151 ? O THR B 151 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FE A 5000' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FE B 5001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 HIS A 26  ? HIS A 26   . ? 1_555 ? 
2  AC1 5 HIS A 73  ? HIS A 73   . ? 1_555 ? 
3  AC1 5 ASP A 157 ? ASP A 157  . ? 1_555 ? 
4  AC1 5 HIS A 161 ? HIS A 161  . ? 1_555 ? 
5  AC1 5 HOH E .   ? HOH A 5101 . ? 1_555 ? 
6  AC2 5 HIS B 26  ? HIS B 26   . ? 1_555 ? 
7  AC2 5 HIS B 73  ? HIS B 73   . ? 1_555 ? 
8  AC2 5 ASP B 157 ? ASP B 157  . ? 1_555 ? 
9  AC2 5 HIS B 161 ? HIS B 161  . ? 1_555 ? 
10 AC2 5 HOH F .   ? HOH B 5102 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4L2A 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4L2A 
_atom_sites.fract_transf_matrix[1][1]   0.021919 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.007245 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009640 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020962 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 1   ? 20.471  11.172  -15.819 1.00 38.57 ? 1    ALA A N   1 
ATOM   2    C  CA  . ALA A 1 1   ? 19.921  10.377  -14.682 1.00 37.32 ? 1    ALA A CA  1 
ATOM   3    C  C   . ALA A 1 1   ? 20.267  11.105  -13.372 1.00 37.05 ? 1    ALA A C   1 
ATOM   4    O  O   . ALA A 1 1   ? 21.062  12.076  -13.365 1.00 37.66 ? 1    ALA A O   1 
ATOM   5    C  CB  . ALA A 1 1   ? 20.540  8.981   -14.686 1.00 36.27 ? 1    ALA A CB  1 
ATOM   6    N  N   . PHE A 1 2   ? 19.724  10.608  -12.267 1.00 34.87 ? 2    PHE A N   1 
ATOM   7    C  CA  . PHE A 1 2   ? 19.936  11.238  -10.979 1.00 32.59 ? 2    PHE A CA  1 
ATOM   8    C  C   . PHE A 1 2   ? 21.285  10.999  -10.344 1.00 32.71 ? 2    PHE A C   1 
ATOM   9    O  O   . PHE A 1 2   ? 21.889  9.947   -10.462 1.00 32.01 ? 2    PHE A O   1 
ATOM   10   C  CB  . PHE A 1 2   ? 18.858  10.777  -10.028 1.00 30.87 ? 2    PHE A CB  1 
ATOM   11   C  CG  . PHE A 1 2   ? 17.488  11.110  -10.480 1.00 30.74 ? 2    PHE A CG  1 
ATOM   12   C  CD1 . PHE A 1 2   ? 17.007  12.424  -10.375 1.00 30.37 ? 2    PHE A CD1 1 
ATOM   13   C  CD2 . PHE A 1 2   ? 16.668  10.135  -11.011 1.00 28.31 ? 2    PHE A CD2 1 
ATOM   14   C  CE1 . PHE A 1 2   ? 15.736  12.748  -10.797 1.00 30.20 ? 2    PHE A CE1 1 
ATOM   15   C  CE2 . PHE A 1 2   ? 15.402  10.453  -11.428 1.00 30.18 ? 2    PHE A CE2 1 
ATOM   16   C  CZ  . PHE A 1 2   ? 14.934  11.764  -11.324 1.00 29.57 ? 2    PHE A CZ  1 
ATOM   17   N  N   . GLU A 1 3   ? 21.741  11.982  -9.605  1.00 32.79 ? 3    GLU A N   1 
ATOM   18   C  CA  . GLU A 1 3   ? 23.001  11.831  -8.942  1.00 33.55 ? 3    GLU A CA  1 
ATOM   19   C  C   . GLU A 1 3   ? 22.882  12.061  -7.466  1.00 32.21 ? 3    GLU A C   1 
ATOM   20   O  O   . GLU A 1 3   ? 21.906  12.681  -7.006  1.00 31.75 ? 3    GLU A O   1 
ATOM   21   C  CB  . GLU A 1 3   ? 23.958  12.805  -9.535  1.00 36.40 ? 3    GLU A CB  1 
ATOM   22   C  CG  . GLU A 1 3   ? 23.949  12.672  -11.020 1.00 40.88 ? 3    GLU A CG  1 
ATOM   23   C  CD  . GLU A 1 3   ? 25.150  13.316  -11.636 1.00 43.79 ? 3    GLU A CD  1 
ATOM   24   O  OE1 . GLU A 1 3   ? 25.477  14.466  -11.224 1.00 45.98 ? 3    GLU A OE1 1 
ATOM   25   O  OE2 . GLU A 1 3   ? 25.745  12.677  -12.541 1.00 46.41 ? 3    GLU A OE2 1 
ATOM   26   N  N   . LEU A 1 4   ? 23.883  11.584  -6.727  1.00 30.33 ? 4    LEU A N   1 
ATOM   27   C  CA  . LEU A 1 4   ? 23.904  11.764  -5.279  1.00 27.80 ? 4    LEU A CA  1 
ATOM   28   C  C   . LEU A 1 4   ? 24.340  13.189  -5.006  1.00 26.34 ? 4    LEU A C   1 
ATOM   29   O  O   . LEU A 1 4   ? 25.413  13.592  -5.445  1.00 25.63 ? 4    LEU A O   1 
ATOM   30   C  CB  . LEU A 1 4   ? 24.878  10.753  -4.621  1.00 27.55 ? 4    LEU A CB  1 
ATOM   31   C  CG  . LEU A 1 4   ? 25.129  10.867  -3.116  1.00 28.34 ? 4    LEU A CG  1 
ATOM   32   C  CD1 . LEU A 1 4   ? 23.894  10.439  -2.351  1.00 27.83 ? 4    LEU A CD1 1 
ATOM   33   C  CD2 . LEU A 1 4   ? 26.342  10.036  -2.705  1.00 26.65 ? 4    LEU A CD2 1 
ATOM   34   N  N   . PRO A 1 5   ? 23.521  13.989  -4.292  1.00 25.40 ? 5    PRO A N   1 
ATOM   35   C  CA  . PRO A 1 5   ? 23.985  15.369  -4.035  1.00 25.22 ? 5    PRO A CA  1 
ATOM   36   C  C   . PRO A 1 5   ? 25.107  15.336  -3.003  1.00 24.96 ? 5    PRO A C   1 
ATOM   37   O  O   . PRO A 1 5   ? 25.208  14.386  -2.188  1.00 23.29 ? 5    PRO A O   1 
ATOM   38   C  CB  . PRO A 1 5   ? 22.769  16.100  -3.433  1.00 26.73 ? 5    PRO A CB  1 
ATOM   39   C  CG  . PRO A 1 5   ? 21.555  15.133  -3.688  1.00 29.41 ? 5    PRO A CG  1 
ATOM   40   C  CD  . PRO A 1 5   ? 22.164  13.728  -3.759  1.00 25.98 ? 5    PRO A CD  1 
ATOM   41   N  N   . SER A 1 6   ? 25.935  16.371  -3.042  1.00 23.51 ? 6    SER A N   1 
ATOM   42   C  CA  . SER A 1 6   ? 27.009  16.502  -2.084  1.00 24.24 ? 6    SER A CA  1 
ATOM   43   C  C   . SER A 1 6   ? 26.380  16.860  -0.749  1.00 22.66 ? 6    SER A C   1 
ATOM   44   O  O   . SER A 1 6   ? 25.347  17.510  -0.678  1.00 22.61 ? 6    SER A O   1 
ATOM   45   C  CB  . SER A 1 6   ? 27.930  17.638  -2.432  1.00 23.25 ? 6    SER A CB  1 
ATOM   46   O  OG  . SER A 1 6   ? 28.351  17.484  -3.751  1.00 29.20 ? 6    SER A OG  1 
ATOM   47   N  N   . LEU A 1 7   ? 27.008  16.409  0.298   1.00 20.96 ? 7    LEU A N   1 
ATOM   48   C  CA  . LEU A 1 7   ? 26.578  16.754  1.648   1.00 20.67 ? 7    LEU A CA  1 
ATOM   49   C  C   . LEU A 1 7   ? 26.805  18.308  1.764   1.00 18.80 ? 7    LEU A C   1 
ATOM   50   O  O   . LEU A 1 7   ? 27.785  18.832  1.240   1.00 20.24 ? 7    LEU A O   1 
ATOM   51   C  CB  . LEU A 1 7   ? 27.490  15.931  2.588   1.00 20.97 ? 7    LEU A CB  1 
ATOM   52   C  CG  . LEU A 1 7   ? 27.016  15.079  3.788   1.00 23.39 ? 7    LEU A CG  1 
ATOM   53   C  CD1 . LEU A 1 7   ? 25.683  14.469  3.577   1.00 20.08 ? 7    LEU A CD1 1 
ATOM   54   C  CD2 . LEU A 1 7   ? 28.102  14.003  4.122   1.00 21.45 ? 7    LEU A CD2 1 
ATOM   55   N  N   . PRO A 1 8   ? 25.929  19.065  2.457   1.00 19.36 ? 8    PRO A N   1 
ATOM   56   C  CA  . PRO A 1 8   ? 26.119  20.542  2.568   1.00 17.95 ? 8    PRO A CA  1 
ATOM   57   C  C   . PRO A 1 8   ? 27.234  21.011  3.523   1.00 18.78 ? 8    PRO A C   1 
ATOM   58   O  O   . PRO A 1 8   ? 27.378  22.207  3.814   1.00 18.06 ? 8    PRO A O   1 
ATOM   59   C  CB  . PRO A 1 8   ? 24.770  21.045  3.110   1.00 18.78 ? 8    PRO A CB  1 
ATOM   60   C  CG  . PRO A 1 8   ? 23.811  19.965  2.846   1.00 21.59 ? 8    PRO A CG  1 
ATOM   61   C  CD  . PRO A 1 8   ? 24.611  18.653  2.970   1.00 17.35 ? 8    PRO A CD  1 
ATOM   62   N  N   . TYR A 1 9   ? 28.000  20.056  4.048   1.00 18.12 ? 9    TYR A N   1 
ATOM   63   C  CA  . TYR A 1 9   ? 29.012  20.362  5.050   1.00 17.66 ? 9    TYR A CA  1 
ATOM   64   C  C   . TYR A 1 9   ? 30.081  19.251  5.063   1.00 18.13 ? 9    TYR A C   1 
ATOM   65   O  O   . TYR A 1 9   ? 29.870  18.183  4.486   1.00 17.89 ? 9    TYR A O   1 
ATOM   66   C  CB  . TYR A 1 9   ? 28.334  20.480  6.431   1.00 16.53 ? 9    TYR A CB  1 
ATOM   67   C  CG  . TYR A 1 9   ? 27.103  19.576  6.631   1.00 17.47 ? 9    TYR A CG  1 
ATOM   68   C  CD1 . TYR A 1 9   ? 27.213  18.187  6.834   1.00 14.96 ? 9    TYR A CD1 1 
ATOM   69   C  CD2 . TYR A 1 9   ? 25.818  20.116  6.552   1.00 16.30 ? 9    TYR A CD2 1 
ATOM   70   C  CE1 . TYR A 1 9   ? 26.049  17.381  6.925   1.00 18.35 ? 9    TYR A CE1 1 
ATOM   71   C  CE2 . TYR A 1 9   ? 24.665  19.315  6.656   1.00 15.94 ? 9    TYR A CE2 1 
ATOM   72   C  CZ  . TYR A 1 9   ? 24.785  17.961  6.824   1.00 15.71 ? 9    TYR A CZ  1 
ATOM   73   O  OH  . TYR A 1 9   ? 23.642  17.208  6.788   1.00 17.32 ? 9    TYR A OH  1 
ATOM   74   N  N   . ALA A 1 10  ? 31.205  19.494  5.717   1.00 18.82 ? 10   ALA A N   1 
ATOM   75   C  CA  . ALA A 1 10  ? 32.268  18.456  5.772   1.00 18.26 ? 10   ALA A CA  1 
ATOM   76   C  C   . ALA A 1 10  ? 31.798  17.200  6.526   1.00 19.23 ? 10   ALA A C   1 
ATOM   77   O  O   . ALA A 1 10  ? 30.972  17.256  7.484   1.00 17.91 ? 10   ALA A O   1 
ATOM   78   C  CB  . ALA A 1 10  ? 33.515  19.017  6.413   1.00 18.65 ? 10   ALA A CB  1 
ATOM   79   N  N   . ILE A 1 11  ? 32.345  16.072  6.082   1.00 19.30 ? 11   ILE A N   1 
ATOM   80   C  CA  . ILE A 1 11  ? 32.002  14.782  6.595   1.00 20.29 ? 11   ILE A CA  1 
ATOM   81   C  C   . ILE A 1 11  ? 32.111  14.701  8.127   1.00 19.97 ? 11   ILE A C   1 
ATOM   82   O  O   . ILE A 1 11  ? 31.475  13.834  8.750   1.00 21.29 ? 11   ILE A O   1 
ATOM   83   C  CB  . ILE A 1 11  ? 32.871  13.668  5.885   1.00 22.67 ? 11   ILE A CB  1 
ATOM   84   C  CG1 . ILE A 1 11  ? 32.268  12.281  6.109   1.00 22.41 ? 11   ILE A CG1 1 
ATOM   85   C  CG2 . ILE A 1 11  ? 34.298  13.717  6.403   1.00 22.27 ? 11   ILE A CG2 1 
ATOM   86   C  CD1 . ILE A 1 11  ? 31.027  12.013  5.227   1.00 24.71 ? 11   ILE A CD1 1 
ATOM   87   N  N   . ASP A 1 12  ? 32.877  15.591  8.742   1.00 20.31 ? 12   ASP A N   1 
ATOM   88   C  CA  . ASP A 1 12  ? 33.005  15.554  10.187  1.00 21.24 ? 12   ASP A CA  1 
ATOM   89   C  C   . ASP A 1 12  ? 32.400  16.773  10.869  1.00 21.10 ? 12   ASP A C   1 
ATOM   90   O  O   . ASP A 1 12  ? 32.517  16.942  12.070  1.00 18.68 ? 12   ASP A O   1 
ATOM   91   C  CB  . ASP A 1 12  ? 34.473  15.435  10.579  1.00 24.32 ? 12   ASP A CB  1 
ATOM   92   C  CG  . ASP A 1 12  ? 35.285  16.561  10.057  1.00 28.09 ? 12   ASP A CG  1 
ATOM   93   O  OD1 . ASP A 1 12  ? 34.758  17.438  9.335   1.00 28.39 ? 12   ASP A OD1 1 
ATOM   94   O  OD2 . ASP A 1 12  ? 36.476  16.569  10.372  1.00 29.26 ? 12   ASP A OD2 1 
ATOM   95   N  N   . ALA A 1 13  ? 31.673  17.583  10.108  1.00 20.61 ? 13   ALA A N   1 
ATOM   96   C  CA  . ALA A 1 13  ? 31.111  18.822  10.642  1.00 21.22 ? 13   ALA A CA  1 
ATOM   97   C  C   . ALA A 1 13  ? 30.008  18.638  11.664  1.00 20.70 ? 13   ALA A C   1 
ATOM   98   O  O   . ALA A 1 13  ? 29.707  19.559  12.402  1.00 22.14 ? 13   ALA A O   1 
ATOM   99   C  CB  . ALA A 1 13  ? 30.567  19.723  9.448   1.00 19.69 ? 13   ALA A CB  1 
ATOM   100  N  N   . LEU A 1 14  ? 29.382  17.471  11.709  1.00 19.35 ? 14   LEU A N   1 
ATOM   101  C  CA  . LEU A 1 14  ? 28.268  17.310  12.645  1.00 18.56 ? 14   LEU A CA  1 
ATOM   102  C  C   . LEU A 1 14  ? 28.752  16.712  13.946  1.00 18.87 ? 14   LEU A C   1 
ATOM   103  O  O   . LEU A 1 14  ? 27.969  16.477  14.841  1.00 16.58 ? 14   LEU A O   1 
ATOM   104  C  CB  . LEU A 1 14  ? 27.230  16.370  12.033  1.00 17.61 ? 14   LEU A CB  1 
ATOM   105  C  CG  . LEU A 1 14  ? 26.737  16.934  10.690  1.00 16.58 ? 14   LEU A CG  1 
ATOM   106  C  CD1 . LEU A 1 14  ? 25.478  16.179  10.332  1.00 13.58 ? 14   LEU A CD1 1 
ATOM   107  C  CD2 . LEU A 1 14  ? 26.441  18.457  10.794  1.00 14.99 ? 14   LEU A CD2 1 
ATOM   108  N  N   . GLU A 1 15  ? 30.045  16.424  14.025  1.00 19.37 ? 15   GLU A N   1 
ATOM   109  C  CA  . GLU A 1 15  ? 30.576  15.806  15.225  1.00 20.79 ? 15   GLU A CA  1 
ATOM   110  C  C   . GLU A 1 15  ? 30.422  16.785  16.376  1.00 20.62 ? 15   GLU A C   1 
ATOM   111  O  O   . GLU A 1 15  ? 30.510  17.976  16.204  1.00 20.09 ? 15   GLU A O   1 
ATOM   112  C  CB  . GLU A 1 15  ? 32.059  15.462  15.026  1.00 22.70 ? 15   GLU A CB  1 
ATOM   113  C  CG  . GLU A 1 15  ? 32.327  14.441  13.961  1.00 25.73 ? 15   GLU A CG  1 
ATOM   114  C  CD  . GLU A 1 15  ? 32.451  13.051  14.510  1.00 29.65 ? 15   GLU A CD  1 
ATOM   115  O  OE1 . GLU A 1 15  ? 31.894  12.809  15.645  1.00 33.17 ? 15   GLU A OE1 1 
ATOM   116  O  OE2 . GLU A 1 15  ? 33.085  12.205  13.816  1.00 29.12 ? 15   GLU A OE2 1 
ATOM   117  N  N   . PRO A 1 16  ? 30.214  16.290  17.584  1.00 21.36 ? 16   PRO A N   1 
ATOM   118  C  CA  . PRO A 1 16  ? 30.116  14.892  17.992  1.00 22.13 ? 16   PRO A CA  1 
ATOM   119  C  C   . PRO A 1 16  ? 28.607  14.466  18.061  1.00 22.78 ? 16   PRO A C   1 
ATOM   120  O  O   . PRO A 1 16  ? 28.253  13.500  18.747  1.00 25.14 ? 16   PRO A O   1 
ATOM   121  C  CB  . PRO A 1 16  ? 30.770  14.915  19.369  1.00 20.60 ? 16   PRO A CB  1 
ATOM   122  C  CG  . PRO A 1 16  ? 30.183  16.230  19.953  1.00 21.71 ? 16   PRO A CG  1 
ATOM   123  C  CD  . PRO A 1 16  ? 30.268  17.195  18.756  1.00 21.66 ? 16   PRO A CD  1 
ATOM   124  N  N   . HIS A 1 17  ? 27.709  15.156  17.363  1.00 19.95 ? 17   HIS A N   1 
ATOM   125  C  CA  . HIS A 1 17  ? 26.291  14.740  17.477  1.00 18.43 ? 17   HIS A CA  1 
ATOM   126  C  C   . HIS A 1 17  ? 25.986  13.612  16.521  1.00 17.45 ? 17   HIS A C   1 
ATOM   127  O  O   . HIS A 1 17  ? 25.247  12.698  16.861  1.00 18.85 ? 17   HIS A O   1 
ATOM   128  C  CB  . HIS A 1 17  ? 25.395  15.961  17.275  1.00 17.16 ? 17   HIS A CB  1 
ATOM   129  C  CG  . HIS A 1 17  ? 25.834  17.110  18.117  1.00 18.15 ? 17   HIS A CG  1 
ATOM   130  N  ND1 . HIS A 1 17  ? 25.765  17.077  19.499  1.00 14.46 ? 17   HIS A ND1 1 
ATOM   131  C  CD2 . HIS A 1 17  ? 26.487  18.261  17.794  1.00 16.40 ? 17   HIS A CD2 1 
ATOM   132  C  CE1 . HIS A 1 17  ? 26.352  18.154  19.990  1.00 14.84 ? 17   HIS A CE1 1 
ATOM   133  N  NE2 . HIS A 1 17  ? 26.803  18.887  18.976  1.00 18.10 ? 17   HIS A NE2 1 
ATOM   134  N  N   . ILE A 1 18  ? 26.515  13.679  15.304  1.00 15.97 ? 18   ILE A N   1 
ATOM   135  C  CA  . ILE A 1 18  ? 26.329  12.595  14.350  1.00 16.77 ? 18   ILE A CA  1 
ATOM   136  C  C   . ILE A 1 18  ? 27.755  12.356  13.806  1.00 16.74 ? 18   ILE A C   1 
ATOM   137  O  O   . ILE A 1 18  ? 28.433  13.311  13.334  1.00 15.68 ? 18   ILE A O   1 
ATOM   138  C  CB  . ILE A 1 18  ? 25.399  12.965  13.225  1.00 16.77 ? 18   ILE A CB  1 
ATOM   139  C  CG1 . ILE A 1 18  ? 23.966  13.129  13.785  1.00 17.38 ? 18   ILE A CG1 1 
ATOM   140  C  CG2 . ILE A 1 18  ? 25.532  11.881  12.097  1.00 17.66 ? 18   ILE A CG2 1 
ATOM   141  C  CD1 . ILE A 1 18  ? 22.947  13.581  12.678  1.00 15.67 ? 18   ILE A CD1 1 
ATOM   142  N  N   . SER A 1 19  ? 28.201  11.104  13.811  1.00 16.91 ? 19   SER A N   1 
ATOM   143  C  CA  . SER A 1 19  ? 29.594  10.859  13.431  1.00 16.78 ? 19   SER A CA  1 
ATOM   144  C  C   . SER A 1 19  ? 29.988  10.866  11.977  1.00 18.21 ? 19   SER A C   1 
ATOM   145  O  O   . SER A 1 19  ? 29.157  10.656  11.079  1.00 17.96 ? 19   SER A O   1 
ATOM   146  C  CB  . SER A 1 19  ? 30.066  9.536   14.083  1.00 16.14 ? 19   SER A CB  1 
ATOM   147  O  OG  . SER A 1 19  ? 29.562  8.420   13.386  1.00 14.72 ? 19   SER A OG  1 
ATOM   148  N  N   . LYS A 1 20  ? 31.299  11.067  11.752  1.00 17.65 ? 20   LYS A N   1 
ATOM   149  C  CA  . LYS A 1 20  ? 31.850  10.998  10.417  1.00 18.22 ? 20   LYS A CA  1 
ATOM   150  C  C   . LYS A 1 20  ? 31.487  9.616   9.863   1.00 18.02 ? 20   LYS A C   1 
ATOM   151  O  O   . LYS A 1 20  ? 31.106  9.464   8.704   1.00 17.59 ? 20   LYS A O   1 
ATOM   152  C  CB  . LYS A 1 20  ? 33.385  11.115  10.464  1.00 20.37 ? 20   LYS A CB  1 
ATOM   153  C  CG  . LYS A 1 20  ? 34.069  10.696  9.196   1.00 22.21 ? 20   LYS A CG  1 
ATOM   154  C  CD  . LYS A 1 20  ? 35.535  11.005  9.254   1.00 22.14 ? 20   LYS A CD  1 
ATOM   155  C  CE  . LYS A 1 20  ? 36.187  10.522  7.980   1.00 24.61 ? 20   LYS A CE  1 
ATOM   156  N  NZ  . LYS A 1 20  ? 37.705  10.471  8.174   1.00 27.33 ? 20   LYS A NZ  1 
ATOM   157  N  N   . GLU A 1 21  ? 31.586  8.580   10.699  1.00 18.42 ? 21   GLU A N   1 
ATOM   158  C  CA  . GLU A 1 21  ? 31.268  7.239   10.189  1.00 16.49 ? 21   GLU A CA  1 
ATOM   159  C  C   . GLU A 1 21  ? 29.796  7.135   9.784   1.00 16.99 ? 21   GLU A C   1 
ATOM   160  O  O   . GLU A 1 21  ? 29.431  6.557   8.721   1.00 17.92 ? 21   GLU A O   1 
ATOM   161  C  CB  . GLU A 1 21  ? 31.554  6.159   11.234  1.00 17.07 ? 21   GLU A CB  1 
ATOM   162  C  CG  . GLU A 1 21  ? 31.493  4.750   10.603  1.00 17.06 ? 21   GLU A CG  1 
ATOM   163  C  CD  . GLU A 1 21  ? 31.642  3.608   11.678  1.00 16.58 ? 21   GLU A CD  1 
ATOM   164  O  OE1 . GLU A 1 21  ? 32.009  3.884   12.829  1.00 16.23 ? 21   GLU A OE1 1 
ATOM   165  O  OE2 . GLU A 1 21  ? 31.352  2.444   11.344  1.00 16.09 ? 21   GLU A OE2 1 
ATOM   166  N  N   . THR A 1 22  ? 28.931  7.678   10.631  1.00 17.61 ? 22   THR A N   1 
ATOM   167  C  CA  . THR A 1 22  ? 27.494  7.582   10.258  1.00 17.73 ? 22   THR A CA  1 
ATOM   168  C  C   . THR A 1 22  ? 27.256  8.257   8.873   1.00 17.84 ? 22   THR A C   1 
ATOM   169  O  O   . THR A 1 22  ? 26.520  7.718   8.026   1.00 18.40 ? 22   THR A O   1 
ATOM   170  C  CB  . THR A 1 22  ? 26.584  8.247   11.379  1.00 15.70 ? 22   THR A CB  1 
ATOM   171  O  OG1 . THR A 1 22  ? 26.604  7.448   12.578  1.00 13.80 ? 22   THR A OG1 1 
ATOM   172  C  CG2 . THR A 1 22  ? 25.141  8.409   10.909  1.00 15.02 ? 22   THR A CG2 1 
ATOM   173  N  N   . LEU A 1 23  ? 27.864  9.437   8.664   1.00 18.09 ? 23   LEU A N   1 
ATOM   174  C  CA  . LEU A 1 23  ? 27.697  10.194  7.413   1.00 18.01 ? 23   LEU A CA  1 
ATOM   175  C  C   . LEU A 1 23  ? 28.198  9.392   6.215   1.00 18.88 ? 23   LEU A C   1 
ATOM   176  O  O   . LEU A 1 23  ? 27.576  9.331   5.127   1.00 17.85 ? 23   LEU A O   1 
ATOM   177  C  CB  . LEU A 1 23  ? 28.448  11.567  7.536   1.00 17.70 ? 23   LEU A CB  1 
ATOM   178  C  CG  . LEU A 1 23  ? 27.786  12.527  8.560   1.00 19.74 ? 23   LEU A CG  1 
ATOM   179  C  CD1 . LEU A 1 23  ? 28.321  13.943  8.396   1.00 17.72 ? 23   LEU A CD1 1 
ATOM   180  C  CD2 . LEU A 1 23  ? 26.219  12.494  8.321   1.00 17.38 ? 23   LEU A CD2 1 
ATOM   181  N  N   . GLU A 1 24  ? 29.334  8.745   6.408   1.00 18.72 ? 24   GLU A N   1 
ATOM   182  C  CA  . GLU A 1 24  ? 29.941  7.940   5.314   1.00 20.84 ? 24   GLU A CA  1 
ATOM   183  C  C   . GLU A 1 24  ? 28.997  6.821   4.965   1.00 19.61 ? 24   GLU A C   1 
ATOM   184  O  O   . GLU A 1 24  ? 28.718  6.563   3.794   1.00 18.73 ? 24   GLU A O   1 
ATOM   185  C  CB  . GLU A 1 24  ? 31.289  7.366   5.771   1.00 23.12 ? 24   GLU A CB  1 
ATOM   186  C  CG  . GLU A 1 24  ? 32.363  8.400   5.786   1.00 27.86 ? 24   GLU A CG  1 
ATOM   187  C  CD  . GLU A 1 24  ? 33.660  7.840   6.338   1.00 30.91 ? 24   GLU A CD  1 
ATOM   188  O  OE1 . GLU A 1 24  ? 34.709  8.451   6.055   1.00 34.64 ? 24   GLU A OE1 1 
ATOM   189  O  OE2 . GLU A 1 24  ? 33.622  6.813   7.060   1.00 31.40 ? 24   GLU A OE2 1 
ATOM   190  N  N   . PHE A 1 25  ? 28.442  6.164   5.985   1.00 20.58 ? 25   PHE A N   1 
ATOM   191  C  CA  . PHE A 1 25  ? 27.471  5.127   5.603   1.00 18.98 ? 25   PHE A CA  1 
ATOM   192  C  C   . PHE A 1 25  ? 26.124  5.684   5.137   1.00 18.42 ? 25   PHE A C   1 
ATOM   193  O  O   . PHE A 1 25  ? 25.596  5.287   4.115   1.00 18.11 ? 25   PHE A O   1 
ATOM   194  C  CB  . PHE A 1 25  ? 27.225  4.166   6.760   1.00 17.92 ? 25   PHE A CB  1 
ATOM   195  C  CG  . PHE A 1 25  ? 28.288  3.136   6.890   1.00 17.80 ? 25   PHE A CG  1 
ATOM   196  C  CD1 . PHE A 1 25  ? 28.309  2.035   6.022   1.00 16.27 ? 25   PHE A CD1 1 
ATOM   197  C  CD2 . PHE A 1 25  ? 29.306  3.291   7.814   1.00 16.72 ? 25   PHE A CD2 1 
ATOM   198  C  CE1 . PHE A 1 25  ? 29.321  1.079   6.046   1.00 15.69 ? 25   PHE A CE1 1 
ATOM   199  C  CE2 . PHE A 1 25  ? 30.374  2.320   7.865   1.00 19.51 ? 25   PHE A CE2 1 
ATOM   200  C  CZ  . PHE A 1 25  ? 30.376  1.214   6.975   1.00 17.74 ? 25   PHE A CZ  1 
ATOM   201  N  N   . HIS A 1 26  ? 25.574  6.616   5.902   1.00 18.23 ? 26   HIS A N   1 
ATOM   202  C  CA  . HIS A 1 26  ? 24.239  7.099   5.604   1.00 18.65 ? 26   HIS A CA  1 
ATOM   203  C  C   . HIS A 1 26  ? 24.126  7.803   4.287   1.00 19.14 ? 26   HIS A C   1 
ATOM   204  O  O   . HIS A 1 26  ? 23.212  7.515   3.526   1.00 20.36 ? 26   HIS A O   1 
ATOM   205  C  CB  . HIS A 1 26  ? 23.764  7.994   6.729   1.00 16.58 ? 26   HIS A CB  1 
ATOM   206  C  CG  . HIS A 1 26  ? 22.280  8.138   6.808   1.00 15.84 ? 26   HIS A CG  1 
ATOM   207  N  ND1 . HIS A 1 26  ? 21.653  8.702   7.912   1.00 14.12 ? 26   HIS A ND1 1 
ATOM   208  C  CD2 . HIS A 1 26  ? 21.288  7.767   5.950   1.00 14.25 ? 26   HIS A CD2 1 
ATOM   209  C  CE1 . HIS A 1 26  ? 20.341  8.655   7.735   1.00 13.22 ? 26   HIS A CE1 1 
ATOM   210  N  NE2 . HIS A 1 26  ? 20.092  8.095   6.562   1.00 13.07 ? 26   HIS A NE2 1 
ATOM   211  N  N   . HIS A 1 27  ? 25.043  8.726   4.024   1.00 20.53 ? 27   HIS A N   1 
ATOM   212  C  CA  . HIS A 1 27  ? 25.029  9.479   2.773   1.00 22.14 ? 27   HIS A CA  1 
ATOM   213  C  C   . HIS A 1 27  ? 25.689  8.652   1.664   1.00 22.97 ? 27   HIS A C   1 
ATOM   214  O  O   . HIS A 1 27  ? 25.091  8.393   0.593   1.00 19.71 ? 27   HIS A O   1 
ATOM   215  C  CB  . HIS A 1 27  ? 25.780  10.785  2.988   1.00 22.82 ? 27   HIS A CB  1 
ATOM   216  C  CG  . HIS A 1 27  ? 26.159  11.482  1.724   1.00 24.92 ? 27   HIS A CG  1 
ATOM   217  N  ND1 . HIS A 1 27  ? 25.239  12.123  0.917   1.00 25.71 ? 27   HIS A ND1 1 
ATOM   218  C  CD2 . HIS A 1 27  ? 27.363  11.665  1.142   1.00 22.52 ? 27   HIS A CD2 1 
ATOM   219  C  CE1 . HIS A 1 27  ? 25.863  12.669  -0.108  1.00 23.99 ? 27   HIS A CE1 1 
ATOM   220  N  NE2 . HIS A 1 27  ? 27.151  12.411  0.007   1.00 25.79 ? 27   HIS A NE2 1 
ATOM   221  N  N   . GLY A 1 28  ? 26.916  8.201   1.956   1.00 22.72 ? 28   GLY A N   1 
ATOM   222  C  CA  . GLY A 1 28  ? 27.687  7.434   0.974   1.00 23.84 ? 28   GLY A CA  1 
ATOM   223  C  C   . GLY A 1 28  ? 27.148  6.056   0.537   1.00 22.54 ? 28   GLY A C   1 
ATOM   224  O  O   . GLY A 1 28  ? 27.409  5.624   -0.576  1.00 23.39 ? 28   GLY A O   1 
ATOM   225  N  N   . LYS A 1 29  ? 26.470  5.323   1.399   1.00 21.60 ? 29   LYS A N   1 
ATOM   226  C  CA  . LYS A 1 29  ? 25.934  4.035   0.977   1.00 21.91 ? 29   LYS A CA  1 
ATOM   227  C  C   . LYS A 1 29  ? 24.412  4.077   0.870   1.00 23.27 ? 29   LYS A C   1 
ATOM   228  O  O   . LYS A 1 29  ? 23.853  3.884   -0.202  1.00 25.14 ? 29   LYS A O   1 
ATOM   229  C  CB  . LYS A 1 29  ? 26.310  2.932   1.971   1.00 23.12 ? 29   LYS A CB  1 
ATOM   230  C  CG  . LYS A 1 29  ? 27.813  2.690   2.167   1.00 26.27 ? 29   LYS A CG  1 
ATOM   231  C  CD  . LYS A 1 29  ? 28.502  2.187   0.948   1.00 28.08 ? 29   LYS A CD  1 
ATOM   232  C  CE  . LYS A 1 29  ? 29.928  1.711   1.348   1.00 30.08 ? 29   LYS A CE  1 
ATOM   233  N  NZ  . LYS A 1 29  ? 30.649  1.264   0.116   1.00 29.71 ? 29   LYS A NZ  1 
ATOM   234  N  N   . HIS A 1 30  ? 23.701  4.338   1.977   1.00 21.95 ? 30   HIS A N   1 
ATOM   235  C  CA  . HIS A 1 30  ? 22.238  4.276   1.853   1.00 20.43 ? 30   HIS A CA  1 
ATOM   236  C  C   . HIS A 1 30  ? 21.658  5.270   0.821   1.00 20.55 ? 30   HIS A C   1 
ATOM   237  O  O   . HIS A 1 30  ? 20.989  4.864   -0.090  1.00 20.00 ? 30   HIS A O   1 
ATOM   238  C  CB  . HIS A 1 30  ? 21.570  4.514   3.212   1.00 19.23 ? 30   HIS A CB  1 
ATOM   239  C  CG  . HIS A 1 30  ? 21.843  3.443   4.216   1.00 17.60 ? 30   HIS A CG  1 
ATOM   240  N  ND1 . HIS A 1 30  ? 21.068  2.314   4.332   1.00 15.60 ? 30   HIS A ND1 1 
ATOM   241  C  CD2 . HIS A 1 30  ? 22.841  3.307   5.114   1.00 16.13 ? 30   HIS A CD2 1 
ATOM   242  C  CE1 . HIS A 1 30  ? 21.569  1.528   5.265   1.00 16.92 ? 30   HIS A CE1 1 
ATOM   243  N  NE2 . HIS A 1 30  ? 22.645  2.112   5.760   1.00 16.50 ? 30   HIS A NE2 1 
ATOM   244  N  N   . HIS A 1 31  ? 21.868  6.572   1.028   1.00 20.26 ? 31   HIS A N   1 
ATOM   245  C  CA  . HIS A 1 31  ? 21.361  7.586   0.096   1.00 20.92 ? 31   HIS A CA  1 
ATOM   246  C  C   . HIS A 1 31  ? 21.802  7.210   -1.310  1.00 21.30 ? 31   HIS A C   1 
ATOM   247  O  O   . HIS A 1 31  ? 20.995  7.151   -2.200  1.00 20.06 ? 31   HIS A O   1 
ATOM   248  C  CB  . HIS A 1 31  ? 21.930  8.964   0.431   1.00 20.32 ? 31   HIS A CB  1 
ATOM   249  C  CG  . HIS A 1 31  ? 21.110  10.098  -0.116  1.00 20.07 ? 31   HIS A CG  1 
ATOM   250  N  ND1 . HIS A 1 31  ? 21.339  11.413  0.237   1.00 21.03 ? 31   HIS A ND1 1 
ATOM   251  C  CD2 . HIS A 1 31  ? 20.088  10.121  -1.014  1.00 19.13 ? 31   HIS A CD2 1 
ATOM   252  C  CE1 . HIS A 1 31  ? 20.494  12.197  -0.420  1.00 20.08 ? 31   HIS A CE1 1 
ATOM   253  N  NE2 . HIS A 1 31  ? 19.724  11.440  -1.178  1.00 18.76 ? 31   HIS A NE2 1 
ATOM   254  N  N   . ASN A 1 32  ? 23.104  6.982   -1.485  1.00 22.13 ? 32   ASN A N   1 
ATOM   255  C  CA  . ASN A 1 32  ? 23.609  6.577   -2.810  1.00 23.60 ? 32   ASN A CA  1 
ATOM   256  C  C   . ASN A 1 32  ? 22.858  5.348   -3.401  1.00 22.95 ? 32   ASN A C   1 
ATOM   257  O  O   . ASN A 1 32  ? 22.405  5.308   -4.554  1.00 22.62 ? 32   ASN A O   1 
ATOM   258  C  CB  . ASN A 1 32  ? 25.110  6.265   -2.715  1.00 24.59 ? 32   ASN A CB  1 
ATOM   259  C  CG  . ASN A 1 32  ? 25.730  6.115   -4.073  1.00 26.62 ? 32   ASN A CG  1 
ATOM   260  O  OD1 . ASN A 1 32  ? 25.650  7.038   -4.904  1.00 27.62 ? 32   ASN A OD1 1 
ATOM   261  N  ND2 . ASN A 1 32  ? 26.296  4.947   -4.339  1.00 23.37 ? 32   ASN A ND2 1 
ATOM   262  N  N   . THR A 1 33  ? 22.663  4.337   -2.579  1.00 22.77 ? 33   THR A N   1 
ATOM   263  C  CA  . THR A 1 33  ? 21.945  3.174   -3.067  1.00 21.69 ? 33   THR A CA  1 
ATOM   264  C  C   . THR A 1 33  ? 20.583  3.502   -3.601  1.00 21.30 ? 33   THR A C   1 
ATOM   265  O  O   . THR A 1 33  ? 20.194  3.002   -4.678  1.00 20.88 ? 33   THR A O   1 
ATOM   266  C  CB  . THR A 1 33  ? 21.853  2.114   -2.005  1.00 20.92 ? 33   THR A CB  1 
ATOM   267  O  OG1 . THR A 1 33  ? 23.123  1.482   -1.907  1.00 21.45 ? 33   THR A OG1 1 
ATOM   268  C  CG2 . THR A 1 33  ? 20.817  1.098   -2.343  1.00 21.13 ? 33   THR A CG2 1 
ATOM   269  N  N   . TYR A 1 34  ? 19.804  4.329   -2.906  1.00 22.29 ? 34   TYR A N   1 
ATOM   270  C  CA  . TYR A 1 34  ? 18.492  4.645   -3.492  1.00 22.65 ? 34   TYR A CA  1 
ATOM   271  C  C   . TYR A 1 34  ? 18.686  5.311   -4.852  1.00 23.51 ? 34   TYR A C   1 
ATOM   272  O  O   . TYR A 1 34  ? 17.873  5.154   -5.760  1.00 24.54 ? 34   TYR A O   1 
ATOM   273  C  CB  . TYR A 1 34  ? 17.669  5.595   -2.609  1.00 23.32 ? 34   TYR A CB  1 
ATOM   274  C  CG  . TYR A 1 34  ? 17.310  5.020   -1.224  1.00 22.40 ? 34   TYR A CG  1 
ATOM   275  C  CD1 . TYR A 1 34  ? 16.396  3.957   -1.109  1.00 21.95 ? 34   TYR A CD1 1 
ATOM   276  C  CD2 . TYR A 1 34  ? 17.933  5.531   -0.037  1.00 21.35 ? 34   TYR A CD2 1 
ATOM   277  C  CE1 . TYR A 1 34  ? 16.103  3.426   0.117   1.00 23.47 ? 34   TYR A CE1 1 
ATOM   278  C  CE2 . TYR A 1 34  ? 17.665  4.996   1.206   1.00 21.03 ? 34   TYR A CE2 1 
ATOM   279  C  CZ  . TYR A 1 34  ? 16.745  3.944   1.295   1.00 23.15 ? 34   TYR A CZ  1 
ATOM   280  O  OH  . TYR A 1 34  ? 16.395  3.389   2.549   1.00 25.48 ? 34   TYR A OH  1 
ATOM   281  N  N   . VAL A 1 35  ? 19.736  6.094   -4.985  1.00 24.01 ? 35   VAL A N   1 
ATOM   282  C  CA  . VAL A 1 35  ? 19.913  6.755   -6.258  1.00 24.74 ? 35   VAL A CA  1 
ATOM   283  C  C   . VAL A 1 35  ? 20.253  5.712   -7.353  1.00 26.11 ? 35   VAL A C   1 
ATOM   284  O  O   . VAL A 1 35  ? 19.648  5.741   -8.424  1.00 26.26 ? 35   VAL A O   1 
ATOM   285  C  CB  . VAL A 1 35  ? 21.029  7.800   -6.185  1.00 23.44 ? 35   VAL A CB  1 
ATOM   286  C  CG1 . VAL A 1 35  ? 21.290  8.351   -7.626  1.00 24.68 ? 35   VAL A CG1 1 
ATOM   287  C  CG2 . VAL A 1 35  ? 20.673  8.899   -5.139  1.00 20.60 ? 35   VAL A CG2 1 
ATOM   288  N  N   . VAL A 1 36  ? 21.198  4.803   -7.094  1.00 25.83 ? 36   VAL A N   1 
ATOM   289  C  CA  . VAL A 1 36  ? 21.507  3.816   -8.111  1.00 28.38 ? 36   VAL A CA  1 
ATOM   290  C  C   . VAL A 1 36  ? 20.248  3.020   -8.424  1.00 28.99 ? 36   VAL A C   1 
ATOM   291  O  O   . VAL A 1 36  ? 19.873  2.864   -9.596  1.00 30.54 ? 36   VAL A O   1 
ATOM   292  C  CB  . VAL A 1 36  ? 22.626  2.838   -7.672  1.00 29.28 ? 36   VAL A CB  1 
ATOM   293  C  CG1 . VAL A 1 36  ? 23.954  3.530   -7.698  1.00 29.23 ? 36   VAL A CG1 1 
ATOM   294  C  CG2 . VAL A 1 36  ? 22.355  2.354   -6.277  1.00 30.65 ? 36   VAL A CG2 1 
ATOM   295  N  N   . LYS A 1 37  ? 19.527  2.591   -7.395  1.00 28.77 ? 37   LYS A N   1 
ATOM   296  C  CA  . LYS A 1 37  ? 18.331  1.797   -7.642  1.00 30.27 ? 37   LYS A CA  1 
ATOM   297  C  C   . LYS A 1 37  ? 17.331  2.490   -8.519  1.00 29.27 ? 37   LYS A C   1 
ATOM   298  O  O   . LYS A 1 37  ? 16.818  1.879   -9.423  1.00 29.85 ? 37   LYS A O   1 
ATOM   299  C  CB  . LYS A 1 37  ? 17.658  1.333   -6.335  1.00 31.80 ? 37   LYS A CB  1 
ATOM   300  C  CG  . LYS A 1 37  ? 18.281  0.068   -5.772  1.00 35.26 ? 37   LYS A CG  1 
ATOM   301  C  CD  . LYS A 1 37  ? 17.402  -0.535  -4.665  1.00 38.15 ? 37   LYS A CD  1 
ATOM   302  C  CE  . LYS A 1 37  ? 17.843  -1.960  -4.271  1.00 40.45 ? 37   LYS A CE  1 
ATOM   303  N  NZ  . LYS A 1 37  ? 19.325  -2.092  -4.116  1.00 40.34 ? 37   LYS A NZ  1 
ATOM   304  N  N   . LEU A 1 38  ? 17.021  3.753   -8.239  1.00 28.16 ? 38   LEU A N   1 
ATOM   305  C  CA  . LEU A 1 38  ? 16.047  4.487   -9.079  1.00 28.13 ? 38   LEU A CA  1 
ATOM   306  C  C   . LEU A 1 38  ? 16.545  4.575   -10.520 1.00 27.90 ? 38   LEU A C   1 
ATOM   307  O  O   . LEU A 1 38  ? 15.799  4.322   -11.441 1.00 28.63 ? 38   LEU A O   1 
ATOM   308  C  CB  . LEU A 1 38  ? 15.790  5.932   -8.579  1.00 24.45 ? 38   LEU A CB  1 
ATOM   309  C  CG  . LEU A 1 38  ? 14.752  6.706   -9.419  1.00 23.03 ? 38   LEU A CG  1 
ATOM   310  C  CD1 . LEU A 1 38  ? 13.435  6.043   -9.218  1.00 21.58 ? 38   LEU A CD1 1 
ATOM   311  C  CD2 . LEU A 1 38  ? 14.648  8.159   -9.016  1.00 21.68 ? 38   LEU A CD2 1 
ATOM   312  N  N   . ASN A 1 39  ? 17.788  4.989   -10.690 1.00 28.56 ? 39   ASN A N   1 
ATOM   313  C  CA  . ASN A 1 39  ? 18.363  5.100   -12.023 1.00 30.64 ? 39   ASN A CA  1 
ATOM   314  C  C   . ASN A 1 39  ? 18.268  3.745   -12.742 1.00 32.63 ? 39   ASN A C   1 
ATOM   315  O  O   . ASN A 1 39  ? 18.144  3.715   -13.939 1.00 35.22 ? 39   ASN A O   1 
ATOM   316  C  CB  . ASN A 1 39  ? 19.839  5.507   -11.931 1.00 28.89 ? 39   ASN A CB  1 
ATOM   317  C  CG  . ASN A 1 39  ? 20.018  6.999   -11.657 1.00 27.81 ? 39   ASN A CG  1 
ATOM   318  O  OD1 . ASN A 1 39  ? 21.079  7.448   -11.184 1.00 25.83 ? 39   ASN A OD1 1 
ATOM   319  N  ND2 . ASN A 1 39  ? 19.000  7.769   -11.980 1.00 25.76 ? 39   ASN A ND2 1 
ATOM   320  N  N   . GLY A 1 40  ? 18.337  2.633   -12.003 1.00 33.98 ? 40   GLY A N   1 
ATOM   321  C  CA  . GLY A 1 40  ? 18.258  1.333   -12.621 1.00 34.13 ? 40   GLY A CA  1 
ATOM   322  C  C   . GLY A 1 40  ? 16.818  0.964   -12.922 1.00 34.80 ? 40   GLY A C   1 
ATOM   323  O  O   . GLY A 1 40  ? 16.564  0.060   -13.716 1.00 36.56 ? 40   GLY A O   1 
ATOM   324  N  N   . LEU A 1 41  ? 15.870  1.688   -12.347 1.00 34.47 ? 41   LEU A N   1 
ATOM   325  C  CA  . LEU A 1 41  ? 14.451  1.381   -12.557 1.00 33.26 ? 41   LEU A CA  1 
ATOM   326  C  C   . LEU A 1 41  ? 13.695  2.243   -13.585 1.00 33.07 ? 41   LEU A C   1 
ATOM   327  O  O   . LEU A 1 41  ? 12.688  1.817   -14.154 1.00 31.32 ? 41   LEU A O   1 
ATOM   328  C  CB  . LEU A 1 41  ? 13.682  1.506   -11.222 1.00 33.43 ? 41   LEU A CB  1 
ATOM   329  C  CG  . LEU A 1 41  ? 13.796  0.470   -10.066 1.00 33.13 ? 41   LEU A CG  1 
ATOM   330  C  CD1 . LEU A 1 41  ? 12.959  0.912   -8.821  1.00 30.73 ? 41   LEU A CD1 1 
ATOM   331  C  CD2 . LEU A 1 41  ? 13.299  -0.868  -10.555 1.00 31.79 ? 41   LEU A CD2 1 
ATOM   332  N  N   . ILE A 1 42  ? 14.142  3.471   -13.784 1.00 34.15 ? 42   ILE A N   1 
ATOM   333  C  CA  . ILE A 1 42  ? 13.422  4.333   -14.690 1.00 35.70 ? 42   ILE A CA  1 
ATOM   334  C  C   . ILE A 1 42  ? 13.741  4.211   -16.187 1.00 36.42 ? 42   ILE A C   1 
ATOM   335  O  O   . ILE A 1 42  ? 12.888  4.531   -17.001 1.00 35.74 ? 42   ILE A O   1 
ATOM   336  C  CB  . ILE A 1 42  ? 13.590  5.810   -14.295 1.00 36.20 ? 42   ILE A CB  1 
ATOM   337  C  CG1 . ILE A 1 42  ? 15.094  6.157   -14.287 1.00 36.44 ? 42   ILE A CG1 1 
ATOM   338  C  CG2 . ILE A 1 42  ? 12.905  6.065   -12.926 1.00 36.31 ? 42   ILE A CG2 1 
ATOM   339  C  CD1 . ILE A 1 42  ? 15.439  7.630   -14.034 1.00 37.71 ? 42   ILE A CD1 1 
ATOM   340  N  N   . PRO A 1 43  ? 14.944  3.721   -16.567 1.00 36.77 ? 43   PRO A N   1 
ATOM   341  C  CA  . PRO A 1 43  ? 15.168  3.668   -18.026 1.00 37.08 ? 43   PRO A CA  1 
ATOM   342  C  C   . PRO A 1 43  ? 14.060  3.007   -18.827 1.00 37.64 ? 43   PRO A C   1 
ATOM   343  O  O   . PRO A 1 43  ? 13.471  1.997   -18.396 1.00 38.22 ? 43   PRO A O   1 
ATOM   344  C  CB  . PRO A 1 43  ? 16.544  3.004   -18.192 1.00 37.47 ? 43   PRO A CB  1 
ATOM   345  C  CG  . PRO A 1 43  ? 16.880  2.419   -16.856 1.00 38.54 ? 43   PRO A CG  1 
ATOM   346  C  CD  . PRO A 1 43  ? 16.056  3.152   -15.800 1.00 36.78 ? 43   PRO A CD  1 
ATOM   347  N  N   . GLY A 1 44  ? 13.757  3.648   -19.963 1.00 38.70 ? 44   GLY A N   1 
ATOM   348  C  CA  . GLY A 1 44  ? 12.710  3.204   -20.876 1.00 38.81 ? 44   GLY A CA  1 
ATOM   349  C  C   . GLY A 1 44  ? 11.365  3.070   -20.188 1.00 38.78 ? 44   GLY A C   1 
ATOM   350  O  O   . GLY A 1 44  ? 10.692  2.063   -20.354 1.00 39.34 ? 44   GLY A O   1 
ATOM   351  N  N   . THR A 1 45  ? 10.994  4.058   -19.374 1.00 38.97 ? 45   THR A N   1 
ATOM   352  C  CA  . THR A 1 45  ? 9.713   4.064   -18.659 1.00 38.90 ? 45   THR A CA  1 
ATOM   353  C  C   . THR A 1 45  ? 9.151   5.490   -18.663 1.00 39.74 ? 45   THR A C   1 
ATOM   354  O  O   . THR A 1 45  ? 9.849   6.464   -19.013 1.00 39.55 ? 45   THR A O   1 
ATOM   355  C  CB  . THR A 1 45  ? 9.825   3.646   -17.133 1.00 39.40 ? 45   THR A CB  1 
ATOM   356  O  OG1 . THR A 1 45  ? 10.701  4.547   -16.448 1.00 36.02 ? 45   THR A OG1 1 
ATOM   357  C  CG2 . THR A 1 45  ? 10.304  2.202   -16.968 1.00 40.51 ? 45   THR A CG2 1 
ATOM   358  N  N   . LYS A 1 46  ? 7.899   5.589   -18.223 1.00 40.61 ? 46   LYS A N   1 
ATOM   359  C  CA  . LYS A 1 46  ? 7.170   6.859   -18.117 1.00 42.99 ? 46   LYS A CA  1 
ATOM   360  C  C   . LYS A 1 46  ? 7.698   7.818   -17.039 1.00 42.62 ? 46   LYS A C   1 
ATOM   361  O  O   . LYS A 1 46  ? 7.035   8.815   -16.729 1.00 44.17 ? 46   LYS A O   1 
ATOM   362  C  CB  . LYS A 1 46  ? 5.699   6.570   -17.811 1.00 44.40 ? 46   LYS A CB  1 
ATOM   363  C  CG  . LYS A 1 46  ? 5.162   5.348   -18.584 1.00 47.71 ? 46   LYS A CG  1 
ATOM   364  C  CD  . LYS A 1 46  ? 3.617   5.279   -18.596 1.00 50.18 ? 46   LYS A CD  1 
ATOM   365  C  CE  . LYS A 1 46  ? 3.078   3.933   -19.119 1.00 50.48 ? 46   LYS A CE  1 
ATOM   366  N  NZ  . LYS A 1 46  ? 1.596   3.964   -19.099 1.00 50.73 ? 46   LYS A NZ  1 
ATOM   367  N  N   . PHE A 1 47  ? 8.874   7.524   -16.491 1.00 40.87 ? 47   PHE A N   1 
ATOM   368  C  CA  . PHE A 1 47  ? 9.484   8.315   -15.429 1.00 39.80 ? 47   PHE A CA  1 
ATOM   369  C  C   . PHE A 1 47  ? 10.910  8.779   -15.832 1.00 41.27 ? 47   PHE A C   1 
ATOM   370  O  O   . PHE A 1 47  ? 11.479  9.687   -15.192 1.00 41.91 ? 47   PHE A O   1 
ATOM   371  C  CB  . PHE A 1 47  ? 9.584   7.463   -14.123 1.00 36.41 ? 47   PHE A CB  1 
ATOM   372  C  CG  . PHE A 1 47  ? 8.230   7.114   -13.468 1.00 34.88 ? 47   PHE A CG  1 
ATOM   373  C  CD1 . PHE A 1 47  ? 7.370   8.102   -13.030 1.00 32.64 ? 47   PHE A CD1 1 
ATOM   374  C  CD2 . PHE A 1 47  ? 7.847   5.774   -13.274 1.00 33.62 ? 47   PHE A CD2 1 
ATOM   375  C  CE1 . PHE A 1 47  ? 6.175   7.775   -12.416 1.00 32.61 ? 47   PHE A CE1 1 
ATOM   376  C  CE2 . PHE A 1 47  ? 6.644   5.428   -12.658 1.00 31.37 ? 47   PHE A CE2 1 
ATOM   377  C  CZ  . PHE A 1 47  ? 5.800   6.422   -12.224 1.00 33.40 ? 47   PHE A CZ  1 
ATOM   378  N  N   . GLU A 1 48  ? 11.479  8.184   -16.891 1.00 42.20 ? 48   GLU A N   1 
ATOM   379  C  CA  . GLU A 1 48  ? 12.845  8.521   -17.310 1.00 43.27 ? 48   GLU A CA  1 
ATOM   380  C  C   . GLU A 1 48  ? 13.091  9.953   -17.589 1.00 43.02 ? 48   GLU A C   1 
ATOM   381  O  O   . GLU A 1 48  ? 14.238  10.414  -17.491 1.00 42.56 ? 48   GLU A O   1 
ATOM   382  C  CB  . GLU A 1 48  ? 13.301  7.753   -18.566 1.00 45.26 ? 48   GLU A CB  1 
ATOM   383  C  CG  . GLU A 1 48  ? 14.802  7.994   -18.964 1.00 46.17 ? 48   GLU A CG  1 
ATOM   384  C  CD  . GLU A 1 48  ? 15.276  7.008   -20.039 1.00 48.14 ? 48   GLU A CD  1 
ATOM   385  O  OE1 . GLU A 1 48  ? 14.763  7.018   -21.187 1.00 48.43 ? 48   GLU A OE1 1 
ATOM   386  O  OE2 . GLU A 1 48  ? 16.167  6.201   -19.732 1.00 50.19 ? 48   GLU A OE2 1 
ATOM   387  N  N   . ASN A 1 49  ? 12.029  10.653  -17.956 1.00 42.73 ? 49   ASN A N   1 
ATOM   388  C  CA  . ASN A 1 49  ? 12.173  12.059  -18.254 1.00 43.82 ? 49   ASN A CA  1 
ATOM   389  C  C   . ASN A 1 49  ? 11.819  12.974  -17.070 1.00 42.95 ? 49   ASN A C   1 
ATOM   390  O  O   . ASN A 1 49  ? 12.333  14.087  -16.954 1.00 42.30 ? 49   ASN A O   1 
ATOM   391  C  CB  . ASN A 1 49  ? 11.286  12.414  -19.449 1.00 46.17 ? 49   ASN A CB  1 
ATOM   392  C  CG  . ASN A 1 49  ? 11.244  13.929  -19.711 1.00 49.27 ? 49   ASN A CG  1 
ATOM   393  O  OD1 . ASN A 1 49  ? 10.956  14.722  -18.781 1.00 50.66 ? 49   ASN A OD1 1 
ATOM   394  N  ND2 . ASN A 1 49  ? 11.530  14.347  -20.974 1.00 49.22 ? 49   ASN A ND2 1 
ATOM   395  N  N   . LYS A 1 50  ? 10.945  12.495  -16.188 1.00 42.33 ? 50   LYS A N   1 
ATOM   396  C  CA  . LYS A 1 50  ? 10.475  13.280  -15.047 1.00 40.87 ? 50   LYS A CA  1 
ATOM   397  C  C   . LYS A 1 50  ? 11.500  13.677  -13.966 1.00 38.90 ? 50   LYS A C   1 
ATOM   398  O  O   . LYS A 1 50  ? 12.535  13.007  -13.767 1.00 38.60 ? 50   LYS A O   1 
ATOM   399  C  CB  . LYS A 1 50  ? 9.318   12.535  -14.410 1.00 42.65 ? 50   LYS A CB  1 
ATOM   400  C  CG  . LYS A 1 50  ? 8.305   12.044  -15.406 1.00 45.26 ? 50   LYS A CG  1 
ATOM   401  C  CD  . LYS A 1 50  ? 6.997   11.646  -14.680 1.00 47.64 ? 50   LYS A CD  1 
ATOM   402  C  CE  . LYS A 1 50  ? 5.768   11.689  -15.605 1.00 48.99 ? 50   LYS A CE  1 
ATOM   403  N  NZ  . LYS A 1 50  ? 4.512   11.399  -14.827 1.00 50.02 ? 50   LYS A NZ  1 
ATOM   404  N  N   . SER A 1 51  ? 11.235  14.793  -13.276 1.00 36.27 ? 51   SER A N   1 
ATOM   405  C  CA  . SER A 1 51  ? 12.137  15.219  -12.208 1.00 33.89 ? 51   SER A CA  1 
ATOM   406  C  C   . SER A 1 51  ? 11.836  14.397  -10.948 1.00 30.96 ? 51   SER A C   1 
ATOM   407  O  O   . SER A 1 51  ? 10.783  13.756  -10.812 1.00 30.43 ? 51   SER A O   1 
ATOM   408  C  CB  . SER A 1 51  ? 11.952  16.707  -11.896 1.00 34.50 ? 51   SER A CB  1 
ATOM   409  O  OG  . SER A 1 51  ? 10.804  16.847  -11.104 1.00 34.68 ? 51   SER A OG  1 
ATOM   410  N  N   . LEU A 1 52  ? 12.762  14.443  -10.002 1.00 30.18 ? 52   LEU A N   1 
ATOM   411  C  CA  . LEU A 1 52  ? 12.579  13.675  -8.785  1.00 28.38 ? 52   LEU A CA  1 
ATOM   412  C  C   . LEU A 1 52  ? 11.227  13.862  -8.158  1.00 27.70 ? 52   LEU A C   1 
ATOM   413  O  O   . LEU A 1 52  ? 10.509  12.897  -7.848  1.00 27.84 ? 52   LEU A O   1 
ATOM   414  C  CB  . LEU A 1 52  ? 13.665  14.028  -7.777  1.00 28.75 ? 52   LEU A CB  1 
ATOM   415  C  CG  . LEU A 1 52  ? 13.664  13.079  -6.571  1.00 29.66 ? 52   LEU A CG  1 
ATOM   416  C  CD1 . LEU A 1 52  ? 13.634  11.568  -6.944  1.00 28.29 ? 52   LEU A CD1 1 
ATOM   417  C  CD2 . LEU A 1 52  ? 14.905  13.453  -5.762  1.00 29.02 ? 52   LEU A CD2 1 
ATOM   418  N  N   . GLU A 1 53  ? 10.844  15.115  -7.981  1.00 29.06 ? 53   GLU A N   1 
ATOM   419  C  CA  . GLU A 1 53  ? 9.565   15.386  -7.340  1.00 29.92 ? 53   GLU A CA  1 
ATOM   420  C  C   . GLU A 1 53  ? 8.394   14.906  -8.166  1.00 30.20 ? 53   GLU A C   1 
ATOM   421  O  O   . GLU A 1 53  ? 7.403   14.483  -7.630  1.00 29.54 ? 53   GLU A O   1 
ATOM   422  C  CB  . GLU A 1 53  ? 9.433   16.870  -7.014  1.00 30.56 ? 53   GLU A CB  1 
ATOM   423  C  CG  . GLU A 1 53  ? 10.200  17.242  -5.743  1.00 34.12 ? 53   GLU A CG  1 
ATOM   424  C  CD  . GLU A 1 53  ? 10.257  18.727  -5.458  1.00 35.47 ? 53   GLU A CD  1 
ATOM   425  O  OE1 . GLU A 1 53  ? 9.336   19.487  -5.915  1.00 36.33 ? 53   GLU A OE1 1 
ATOM   426  O  OE2 . GLU A 1 53  ? 11.243  19.126  -4.757  1.00 37.30 ? 53   GLU A OE2 1 
ATOM   427  N  N   . GLU A 1 54  ? 8.498   14.935  -9.480  1.00 32.05 ? 54   GLU A N   1 
ATOM   428  C  CA  . GLU A 1 54  ? 7.353   14.455  -10.255 1.00 33.89 ? 54   GLU A CA  1 
ATOM   429  C  C   . GLU A 1 54  ? 7.289   12.966  -10.082 1.00 33.35 ? 54   GLU A C   1 
ATOM   430  O  O   . GLU A 1 54  ? 6.224   12.408  -9.968  1.00 33.08 ? 54   GLU A O   1 
ATOM   431  C  CB  . GLU A 1 54  ? 7.483   14.793  -11.747 1.00 34.96 ? 54   GLU A CB  1 
ATOM   432  C  CG  . GLU A 1 54  ? 7.559   16.261  -11.989 1.00 38.25 ? 54   GLU A CG  1 
ATOM   433  C  CD  . GLU A 1 54  ? 7.956   16.629  -13.430 1.00 40.20 ? 54   GLU A CD  1 
ATOM   434  O  OE1 . GLU A 1 54  ? 8.909   16.019  -13.988 1.00 39.54 ? 54   GLU A OE1 1 
ATOM   435  O  OE2 . GLU A 1 54  ? 7.317   17.563  -13.986 1.00 42.94 ? 54   GLU A OE2 1 
ATOM   436  N  N   . ILE A 1 55  ? 8.437   12.311  -10.067 1.00 32.84 ? 55   ILE A N   1 
ATOM   437  C  CA  . ILE A 1 55  ? 8.377   10.879  -9.892  1.00 33.05 ? 55   ILE A CA  1 
ATOM   438  C  C   . ILE A 1 55  ? 7.782   10.518  -8.534  1.00 33.41 ? 55   ILE A C   1 
ATOM   439  O  O   . ILE A 1 55  ? 6.884   9.689   -8.464  1.00 34.09 ? 55   ILE A O   1 
ATOM   440  C  CB  . ILE A 1 55  ? 9.777   10.234  -10.020 1.00 32.59 ? 55   ILE A CB  1 
ATOM   441  C  CG1 . ILE A 1 55  ? 10.277  10.368  -11.454 1.00 30.83 ? 55   ILE A CG1 1 
ATOM   442  C  CG2 . ILE A 1 55  ? 9.733   8.785   -9.559  1.00 32.33 ? 55   ILE A CG2 1 
ATOM   443  C  CD1 . ILE A 1 55  ? 11.731  10.026  -11.646 1.00 30.26 ? 55   ILE A CD1 1 
ATOM   444  N  N   . VAL A 1 56  ? 8.268   11.131  -7.455  1.00 32.87 ? 56   VAL A N   1 
ATOM   445  C  CA  . VAL A 1 56  ? 7.761   10.763  -6.128  1.00 32.83 ? 56   VAL A CA  1 
ATOM   446  C  C   . VAL A 1 56  ? 6.241   10.965  -6.056  1.00 33.15 ? 56   VAL A C   1 
ATOM   447  O  O   . VAL A 1 56  ? 5.518   10.156  -5.473  1.00 31.95 ? 56   VAL A O   1 
ATOM   448  C  CB  . VAL A 1 56  ? 8.431   11.595  -4.982  1.00 33.18 ? 56   VAL A CB  1 
ATOM   449  C  CG1 . VAL A 1 56  ? 9.975   11.447  -4.991  1.00 30.63 ? 56   VAL A CG1 1 
ATOM   450  C  CG2 . VAL A 1 56  ? 8.128   12.996  -5.220  1.00 34.24 ? 56   VAL A CG2 1 
ATOM   451  N  N   . ARG A 1 57  ? 5.747   12.017  -6.695  1.00 32.91 ? 57   ARG A N   1 
ATOM   452  C  CA  . ARG A 1 57  ? 4.317   12.263  -6.644  1.00 34.23 ? 57   ARG A CA  1 
ATOM   453  C  C   . ARG A 1 57  ? 3.459   11.496  -7.648  1.00 33.57 ? 57   ARG A C   1 
ATOM   454  O  O   . ARG A 1 57  ? 2.262   11.709  -7.661  1.00 33.91 ? 57   ARG A O   1 
ATOM   455  C  CB  . ARG A 1 57  ? 4.032   13.771  -6.765  1.00 35.51 ? 57   ARG A CB  1 
ATOM   456  C  CG  . ARG A 1 57  ? 4.653   14.579  -5.623  1.00 39.15 ? 57   ARG A CG  1 
ATOM   457  C  CD  . ARG A 1 57  ? 4.352   16.050  -5.728  1.00 41.42 ? 57   ARG A CD  1 
ATOM   458  N  NE  . ARG A 1 57  ? 2.900   16.176  -5.729  1.00 44.63 ? 57   ARG A NE  1 
ATOM   459  C  CZ  . ARG A 1 57  ? 2.272   17.163  -6.332  1.00 46.49 ? 57   ARG A CZ  1 
ATOM   460  N  NH1 . ARG A 1 57  ? 2.996   18.090  -6.942  1.00 48.48 ? 57   ARG A NH1 1 
ATOM   461  N  NH2 . ARG A 1 57  ? 0.940   17.194  -6.387  1.00 46.93 ? 57   ARG A NH2 1 
ATOM   462  N  N   . SER A 1 58  ? 4.051   10.631  -8.477  1.00 33.02 ? 58   SER A N   1 
ATOM   463  C  CA  . SER A 1 58  ? 3.258   9.841   -9.451  1.00 34.05 ? 58   SER A CA  1 
ATOM   464  C  C   . SER A 1 58  ? 3.625   8.348   -9.606  1.00 34.56 ? 58   SER A C   1 
ATOM   465  O  O   . SER A 1 58  ? 3.356   7.721   -10.655 1.00 35.44 ? 58   SER A O   1 
ATOM   466  C  CB  . SER A 1 58  ? 3.277   10.520  -10.841 1.00 32.58 ? 58   SER A CB  1 
ATOM   467  O  OG  . SER A 1 58  ? 4.589   10.701  -11.357 1.00 31.88 ? 58   SER A OG  1 
ATOM   468  N  N   . SER A 1 59  ? 4.194   7.764   -8.559  1.00 33.77 ? 59   SER A N   1 
ATOM   469  C  CA  . SER A 1 59  ? 4.597   6.370   -8.590  1.00 32.64 ? 59   SER A CA  1 
ATOM   470  C  C   . SER A 1 59  ? 4.155   5.651   -7.351  1.00 33.23 ? 59   SER A C   1 
ATOM   471  O  O   . SER A 1 59  ? 3.551   6.235   -6.430  1.00 33.34 ? 59   SER A O   1 
ATOM   472  C  CB  . SER A 1 59  ? 6.112   6.280   -8.685  1.00 33.79 ? 59   SER A CB  1 
ATOM   473  O  OG  . SER A 1 59  ? 6.771   7.120   -7.724  1.00 33.86 ? 59   SER A OG  1 
ATOM   474  N  N   . ASP A 1 60  ? 4.442   4.362   -7.335  1.00 32.71 ? 60   ASP A N   1 
ATOM   475  C  CA  . ASP A 1 60  ? 4.153   3.500   -6.210  1.00 31.98 ? 60   ASP A CA  1 
ATOM   476  C  C   . ASP A 1 60  ? 5.232   2.433   -6.269  1.00 30.25 ? 60   ASP A C   1 
ATOM   477  O  O   . ASP A 1 60  ? 6.136   2.514   -7.100  1.00 30.47 ? 60   ASP A O   1 
ATOM   478  C  CB  . ASP A 1 60  ? 2.774   2.898   -6.339  1.00 34.64 ? 60   ASP A CB  1 
ATOM   479  C  CG  . ASP A 1 60  ? 2.565   2.199   -7.673  1.00 37.82 ? 60   ASP A CG  1 
ATOM   480  O  OD1 . ASP A 1 60  ? 3.257   2.527   -8.683  1.00 40.77 ? 60   ASP A OD1 1 
ATOM   481  O  OD2 . ASP A 1 60  ? 1.669   1.342   -7.719  1.00 41.06 ? 60   ASP A OD2 1 
ATOM   482  N  N   . GLY A 1 61  ? 5.187   1.490   -5.347  1.00 29.69 ? 61   GLY A N   1 
ATOM   483  C  CA  . GLY A 1 61  ? 6.155   0.416   -5.311  1.00 28.37 ? 61   GLY A CA  1 
ATOM   484  C  C   . GLY A 1 61  ? 7.609   0.862   -5.262  1.00 28.20 ? 61   GLY A C   1 
ATOM   485  O  O   . GLY A 1 61  ? 7.961   1.923   -4.674  1.00 28.55 ? 61   GLY A O   1 
ATOM   486  N  N   . GLY A 1 62  ? 8.452   0.012   -5.863  1.00 26.52 ? 62   GLY A N   1 
ATOM   487  C  CA  . GLY A 1 62  ? 9.859   0.254   -5.909  1.00 25.38 ? 62   GLY A CA  1 
ATOM   488  C  C   . GLY A 1 62  ? 10.233  1.640   -6.403  1.00 25.89 ? 62   GLY A C   1 
ATOM   489  O  O   . GLY A 1 62  ? 11.160  2.288   -5.877  1.00 25.13 ? 62   GLY A O   1 
ATOM   490  N  N   . VAL A 1 63  ? 9.545   2.117   -7.428  1.00 25.23 ? 63   VAL A N   1 
ATOM   491  C  CA  . VAL A 1 63  ? 9.900   3.423   -7.962  1.00 25.59 ? 63   VAL A CA  1 
ATOM   492  C  C   . VAL A 1 63  ? 9.619   4.478   -6.903  1.00 25.19 ? 63   VAL A C   1 
ATOM   493  O  O   . VAL A 1 63  ? 10.478  5.340   -6.631  1.00 24.80 ? 63   VAL A O   1 
ATOM   494  C  CB  . VAL A 1 63  ? 9.127   3.759   -9.247  1.00 25.73 ? 63   VAL A CB  1 
ATOM   495  C  CG1 . VAL A 1 63  ? 9.419   5.195   -9.613  1.00 26.24 ? 63   VAL A CG1 1 
ATOM   496  C  CG2 . VAL A 1 63  ? 9.598   2.833   -10.391 1.00 27.46 ? 63   VAL A CG2 1 
ATOM   497  N  N   . PHE A 1 64  ? 8.424   4.435   -6.331  1.00 24.50 ? 64   PHE A N   1 
ATOM   498  C  CA  . PHE A 1 64  ? 8.122   5.391   -5.236  1.00 24.93 ? 64   PHE A CA  1 
ATOM   499  C  C   . PHE A 1 64  ? 9.173   5.241   -4.052  1.00 23.97 ? 64   PHE A C   1 
ATOM   500  O  O   . PHE A 1 64  ? 9.824   6.221   -3.673  1.00 23.33 ? 64   PHE A O   1 
ATOM   501  C  CB  . PHE A 1 64  ? 6.707   5.167   -4.641  1.00 24.39 ? 64   PHE A CB  1 
ATOM   502  C  CG  . PHE A 1 64  ? 6.411   6.077   -3.461  1.00 24.09 ? 64   PHE A CG  1 
ATOM   503  C  CD1 . PHE A 1 64  ? 6.166   7.438   -3.669  1.00 23.63 ? 64   PHE A CD1 1 
ATOM   504  C  CD2 . PHE A 1 64  ? 6.518   5.603   -2.143  1.00 25.26 ? 64   PHE A CD2 1 
ATOM   505  C  CE1 . PHE A 1 64  ? 6.040   8.318   -2.578  1.00 23.91 ? 64   PHE A CE1 1 
ATOM   506  C  CE2 . PHE A 1 64  ? 6.395   6.484   -1.033  1.00 23.92 ? 64   PHE A CE2 1 
ATOM   507  C  CZ  . PHE A 1 64  ? 6.157   7.816   -1.244  1.00 24.08 ? 64   PHE A CZ  1 
ATOM   508  N  N   . ASN A 1 65  ? 9.351   4.025   -3.525  1.00 22.55 ? 65   ASN A N   1 
ATOM   509  C  CA  . ASN A 1 65  ? 10.268  3.874   -2.387  1.00 23.42 ? 65   ASN A CA  1 
ATOM   510  C  C   . ASN A 1 65  ? 11.647  4.463   -2.636  1.00 23.17 ? 65   ASN A C   1 
ATOM   511  O  O   . ASN A 1 65  ? 12.164  5.209   -1.795  1.00 23.75 ? 65   ASN A O   1 
ATOM   512  C  CB  . ASN A 1 65  ? 10.400  2.432   -1.916  1.00 23.29 ? 65   ASN A CB  1 
ATOM   513  C  CG  . ASN A 1 65  ? 9.120   1.875   -1.279  1.00 23.89 ? 65   ASN A CG  1 
ATOM   514  O  OD1 . ASN A 1 65  ? 8.201   2.602   -0.877  1.00 22.40 ? 65   ASN A OD1 1 
ATOM   515  N  ND2 . ASN A 1 65  ? 9.059   0.556   -1.211  1.00 22.06 ? 65   ASN A ND2 1 
ATOM   516  N  N   . ASN A 1 66  ? 12.249  4.199   -3.794  1.00 22.38 ? 66   ASN A N   1 
ATOM   517  C  CA  . ASN A 1 66  ? 13.552  4.799   -4.053  1.00 22.59 ? 66   ASN A CA  1 
ATOM   518  C  C   . ASN A 1 66  ? 13.552  6.300   -4.336  1.00 21.86 ? 66   ASN A C   1 
ATOM   519  O  O   . ASN A 1 66  ? 14.420  7.013   -3.810  1.00 21.08 ? 66   ASN A O   1 
ATOM   520  C  CB  . ASN A 1 66  ? 14.318  4.047   -5.166  1.00 21.74 ? 66   ASN A CB  1 
ATOM   521  C  CG  . ASN A 1 66  ? 14.689  2.659   -4.734  1.00 21.30 ? 66   ASN A CG  1 
ATOM   522  O  OD1 . ASN A 1 66  ? 13.966  1.703   -4.999  1.00 21.03 ? 66   ASN A OD1 1 
ATOM   523  N  ND2 . ASN A 1 66  ? 15.796  2.548   -3.992  1.00 20.38 ? 66   ASN A ND2 1 
ATOM   524  N  N   . ALA A 1 67  ? 12.604  6.796   -5.136  1.00 20.84 ? 67   ALA A N   1 
ATOM   525  C  CA  . ALA A 1 67  ? 12.590  8.231   -5.448  1.00 20.23 ? 67   ALA A CA  1 
ATOM   526  C  C   . ALA A 1 67  ? 12.376  9.042   -4.157  1.00 21.31 ? 67   ALA A C   1 
ATOM   527  O  O   . ALA A 1 67  ? 13.140  9.991   -3.880  1.00 21.79 ? 67   ALA A O   1 
ATOM   528  C  CB  . ALA A 1 67  ? 11.480  8.587   -6.475  1.00 19.30 ? 67   ALA A CB  1 
ATOM   529  N  N   . ALA A 1 68  ? 11.310  8.680   -3.430  1.00 20.71 ? 68   ALA A N   1 
ATOM   530  C  CA  . ALA A 1 68  ? 10.950  9.345   -2.143  1.00 21.44 ? 68   ALA A CA  1 
ATOM   531  C  C   . ALA A 1 68  ? 12.149  9.303   -1.206  1.00 21.34 ? 68   ALA A C   1 
ATOM   532  O  O   . ALA A 1 68  ? 12.499  10.331  -0.614  1.00 23.15 ? 68   ALA A O   1 
ATOM   533  C  CB  . ALA A 1 68  ? 9.714   8.648   -1.472  1.00 17.97 ? 68   ALA A CB  1 
ATOM   534  N  N   . GLN A 1 69  ? 12.809  8.140   -1.090  1.00 20.91 ? 69   GLN A N   1 
ATOM   535  C  CA  . GLN A 1 69  ? 13.955  8.068   -0.178  1.00 20.46 ? 69   GLN A CA  1 
ATOM   536  C  C   . GLN A 1 69  ? 15.048  9.004   -0.619  1.00 20.60 ? 69   GLN A C   1 
ATOM   537  O  O   . GLN A 1 69  ? 15.737  9.619   0.218   1.00 19.97 ? 69   GLN A O   1 
ATOM   538  C  CB  . GLN A 1 69  ? 14.499  6.634   -0.008  1.00 20.53 ? 69   GLN A CB  1 
ATOM   539  C  CG  . GLN A 1 69  ? 13.626  5.729   0.882   1.00 19.35 ? 69   GLN A CG  1 
ATOM   540  C  CD  . GLN A 1 69  ? 13.547  6.229   2.305   1.00 22.31 ? 69   GLN A CD  1 
ATOM   541  O  OE1 . GLN A 1 69  ? 12.767  7.177   2.609   1.00 22.04 ? 69   GLN A OE1 1 
ATOM   542  N  NE2 . GLN A 1 69  ? 14.364  5.634   3.203   1.00 18.62 ? 69   GLN A NE2 1 
ATOM   543  N  N   . ILE A 1 70  ? 15.268  9.123   -1.916  1.00 21.32 ? 70   ILE A N   1 
ATOM   544  C  CA  . ILE A 1 70  ? 16.302  10.055  -2.327  1.00 20.13 ? 70   ILE A CA  1 
ATOM   545  C  C   . ILE A 1 70  ? 15.851  11.458  -1.921  1.00 20.83 ? 70   ILE A C   1 
ATOM   546  O  O   . ILE A 1 70  ? 16.637  12.258  -1.453  1.00 20.59 ? 70   ILE A O   1 
ATOM   547  C  CB  . ILE A 1 70  ? 16.499  10.110  -3.816  1.00 19.52 ? 70   ILE A CB  1 
ATOM   548  C  CG1 . ILE A 1 70  ? 17.033  8.779   -4.344  1.00 20.91 ? 70   ILE A CG1 1 
ATOM   549  C  CG2 . ILE A 1 70  ? 17.405  11.254  -4.172  1.00 14.54 ? 70   ILE A CG2 1 
ATOM   550  C  CD1 . ILE A 1 70  ? 16.654  8.622   -5.879  1.00 18.21 ? 70   ILE A CD1 1 
ATOM   551  N  N   . TRP A 1 71  ? 14.580  11.765  -2.105  1.00 20.08 ? 71   TRP A N   1 
ATOM   552  C  CA  . TRP A 1 71  ? 14.116  13.131  -1.742  1.00 20.51 ? 71   TRP A CA  1 
ATOM   553  C  C   . TRP A 1 71  ? 14.216  13.389  -0.215  1.00 18.86 ? 71   TRP A C   1 
ATOM   554  O  O   . TRP A 1 71  ? 14.732  14.413  0.197   1.00 20.51 ? 71   TRP A O   1 
ATOM   555  C  CB  . TRP A 1 71  ? 12.640  13.325  -2.136  1.00 18.76 ? 71   TRP A CB  1 
ATOM   556  C  CG  . TRP A 1 71  ? 12.177  14.770  -2.060  1.00 19.89 ? 71   TRP A CG  1 
ATOM   557  C  CD1 . TRP A 1 71  ? 12.288  15.753  -3.033  1.00 20.61 ? 71   TRP A CD1 1 
ATOM   558  C  CD2 . TRP A 1 71  ? 11.638  15.414  -0.915  1.00 18.69 ? 71   TRP A CD2 1 
ATOM   559  N  NE1 . TRP A 1 71  ? 11.852  16.964  -2.536  1.00 17.62 ? 71   TRP A NE1 1 
ATOM   560  C  CE2 . TRP A 1 71  ? 11.453  16.783  -1.242  1.00 18.83 ? 71   TRP A CE2 1 
ATOM   561  C  CE3 . TRP A 1 71  ? 11.296  14.966  0.370   1.00 18.27 ? 71   TRP A CE3 1 
ATOM   562  C  CZ2 . TRP A 1 71  ? 10.941  17.706  -0.330  1.00 19.22 ? 71   TRP A CZ2 1 
ATOM   563  C  CZ3 . TRP A 1 71  ? 10.793  15.877  1.278   1.00 19.76 ? 71   TRP A CZ3 1 
ATOM   564  C  CH2 . TRP A 1 71  ? 10.617  17.244  0.921   1.00 18.22 ? 71   TRP A CH2 1 
ATOM   565  N  N   . ASN A 1 72  ? 13.726  12.436  0.578   1.00 18.41 ? 72   ASN A N   1 
ATOM   566  C  CA  . ASN A 1 72  ? 13.703  12.537  2.039   1.00 16.52 ? 72   ASN A CA  1 
ATOM   567  C  C   . ASN A 1 72  ? 15.128  12.702  2.614   1.00 17.20 ? 72   ASN A C   1 
ATOM   568  O  O   . ASN A 1 72  ? 15.322  13.506  3.551   1.00 18.14 ? 72   ASN A O   1 
ATOM   569  C  CB  . ASN A 1 72  ? 13.099  11.284  2.701   1.00 14.70 ? 72   ASN A CB  1 
ATOM   570  C  CG  . ASN A 1 72  ? 11.631  11.017  2.286   1.00 15.47 ? 72   ASN A CG  1 
ATOM   571  O  OD1 . ASN A 1 72  ? 10.921  11.932  1.902   1.00 14.38 ? 72   ASN A OD1 1 
ATOM   572  N  ND2 . ASN A 1 72  ? 11.191  9.771   2.362   1.00 12.17 ? 72   ASN A ND2 1 
ATOM   573  N  N   . HIS A 1 73  ? 16.091  11.915  2.104   1.00 13.88 ? 73   HIS A N   1 
ATOM   574  C  CA  . HIS A 1 73  ? 17.432  12.048  2.610   1.00 15.17 ? 73   HIS A CA  1 
ATOM   575  C  C   . HIS A 1 73  ? 18.031  13.375  2.262   1.00 15.74 ? 73   HIS A C   1 
ATOM   576  O  O   . HIS A 1 73  ? 18.722  13.999  3.085   1.00 16.02 ? 73   HIS A O   1 
ATOM   577  C  CB  . HIS A 1 73  ? 18.343  10.894  2.127   1.00 13.04 ? 73   HIS A CB  1 
ATOM   578  C  CG  . HIS A 1 73  ? 18.078  9.611   2.858   1.00 14.50 ? 73   HIS A CG  1 
ATOM   579  N  ND1 . HIS A 1 73  ? 17.108  8.699   2.466   1.00 14.25 ? 73   HIS A ND1 1 
ATOM   580  C  CD2 . HIS A 1 73  ? 18.641  9.105   3.991   1.00 14.68 ? 73   HIS A CD2 1 
ATOM   581  C  CE1 . HIS A 1 73  ? 17.100  7.683   3.326   1.00 16.65 ? 73   HIS A CE1 1 
ATOM   582  N  NE2 . HIS A 1 73  ? 18.027  7.901   4.251   1.00 17.41 ? 73   HIS A NE2 1 
ATOM   583  N  N   . THR A 1 74  ? 17.795  13.836  1.048   1.00 16.56 ? 74   THR A N   1 
ATOM   584  C  CA  . THR A 1 74  ? 18.344  15.146  0.681   1.00 17.23 ? 74   THR A CA  1 
ATOM   585  C  C   . THR A 1 74  ? 17.789  16.244  1.635   1.00 17.89 ? 74   THR A C   1 
ATOM   586  O  O   . THR A 1 74  ? 18.514  17.089  2.147   1.00 19.72 ? 74   THR A O   1 
ATOM   587  C  CB  . THR A 1 74  ? 17.960  15.485  -0.766  1.00 15.58 ? 74   THR A CB  1 
ATOM   588  O  OG1 . THR A 1 74  ? 18.651  14.582  -1.636  1.00 14.09 ? 74   THR A OG1 1 
ATOM   589  C  CG2 . THR A 1 74  ? 18.357  16.945  -1.099  1.00 16.31 ? 74   THR A CG2 1 
ATOM   590  N  N   . PHE A 1 75  ? 16.484  16.181  1.872   1.00 17.50 ? 75   PHE A N   1 
ATOM   591  C  CA  . PHE A 1 75  ? 15.799  17.105  2.765   1.00 17.29 ? 75   PHE A CA  1 
ATOM   592  C  C   . PHE A 1 75  ? 16.373  16.957  4.237   1.00 18.20 ? 75   PHE A C   1 
ATOM   593  O  O   . PHE A 1 75  ? 16.534  17.945  4.979   1.00 18.60 ? 75   PHE A O   1 
ATOM   594  C  CB  . PHE A 1 75  ? 14.303  16.778  2.707   1.00 15.74 ? 75   PHE A CB  1 
ATOM   595  C  CG  . PHE A 1 75  ? 13.413  17.853  3.306   1.00 19.01 ? 75   PHE A CG  1 
ATOM   596  C  CD1 . PHE A 1 75  ? 12.994  18.933  2.537   1.00 17.70 ? 75   PHE A CD1 1 
ATOM   597  C  CD2 . PHE A 1 75  ? 13.027  17.794  4.681   1.00 19.89 ? 75   PHE A CD2 1 
ATOM   598  C  CE1 . PHE A 1 75  ? 12.204  19.968  3.113   1.00 19.34 ? 75   PHE A CE1 1 
ATOM   599  C  CE2 . PHE A 1 75  ? 12.236  18.820  5.276   1.00 19.71 ? 75   PHE A CE2 1 
ATOM   600  C  CZ  . PHE A 1 75  ? 11.824  19.913  4.483   1.00 18.75 ? 75   PHE A CZ  1 
ATOM   601  N  N   . TYR A 1 76  ? 16.704  15.723  4.619   1.00 16.72 ? 76   TYR A N   1 
ATOM   602  C  CA  . TYR A 1 76  ? 17.270  15.449  5.922   1.00 16.07 ? 76   TYR A CA  1 
ATOM   603  C  C   . TYR A 1 76  ? 18.680  16.086  6.095   1.00 17.19 ? 76   TYR A C   1 
ATOM   604  O  O   . TYR A 1 76  ? 18.956  16.718  7.113   1.00 16.25 ? 76   TYR A O   1 
ATOM   605  C  CB  . TYR A 1 76  ? 17.307  13.954  6.117   1.00 15.93 ? 76   TYR A CB  1 
ATOM   606  C  CG  . TYR A 1 76  ? 18.126  13.571  7.337   1.00 16.72 ? 76   TYR A CG  1 
ATOM   607  C  CD1 . TYR A 1 76  ? 17.679  13.912  8.645   1.00 14.86 ? 76   TYR A CD1 1 
ATOM   608  C  CD2 . TYR A 1 76  ? 19.247  12.721  7.226   1.00 16.58 ? 76   TYR A CD2 1 
ATOM   609  C  CE1 . TYR A 1 76  ? 18.304  13.402  9.769   1.00 14.97 ? 76   TYR A CE1 1 
ATOM   610  C  CE2 . TYR A 1 76  ? 19.867  12.196  8.364   1.00 14.43 ? 76   TYR A CE2 1 
ATOM   611  C  CZ  . TYR A 1 76  ? 19.391  12.545  9.624   1.00 15.11 ? 76   TYR A CZ  1 
ATOM   612  O  OH  . TYR A 1 76  ? 20.014  12.062  10.746  1.00 14.54 ? 76   TYR A OH  1 
ATOM   613  N  N   . TRP A 1 77  ? 19.552  15.957  5.086   1.00 18.00 ? 77   TRP A N   1 
ATOM   614  C  CA  . TRP A 1 77  ? 20.897  16.542  5.178   1.00 17.37 ? 77   TRP A CA  1 
ATOM   615  C  C   . TRP A 1 77  ? 20.768  18.044  5.348   1.00 16.64 ? 77   TRP A C   1 
ATOM   616  O  O   . TRP A 1 77  ? 21.504  18.668  6.066   1.00 14.43 ? 77   TRP A O   1 
ATOM   617  C  CB  . TRP A 1 77  ? 21.763  16.223  3.933   1.00 18.45 ? 77   TRP A CB  1 
ATOM   618  C  CG  . TRP A 1 77  ? 21.977  14.728  3.656   1.00 19.13 ? 77   TRP A CG  1 
ATOM   619  C  CD1 . TRP A 1 77  ? 21.775  14.087  2.471   1.00 20.20 ? 77   TRP A CD1 1 
ATOM   620  C  CD2 . TRP A 1 77  ? 22.299  13.707  4.603   1.00 19.75 ? 77   TRP A CD2 1 
ATOM   621  N  NE1 . TRP A 1 77  ? 21.947  12.713  2.611   1.00 20.38 ? 77   TRP A NE1 1 
ATOM   622  C  CE2 . TRP A 1 77  ? 22.273  12.452  3.906   1.00 18.97 ? 77   TRP A CE2 1 
ATOM   623  C  CE3 . TRP A 1 77  ? 22.600  13.717  5.975   1.00 18.81 ? 77   TRP A CE3 1 
ATOM   624  C  CZ2 . TRP A 1 77  ? 22.539  11.238  4.527   1.00 18.68 ? 77   TRP A CZ2 1 
ATOM   625  C  CZ3 . TRP A 1 77  ? 22.873  12.487  6.600   1.00 20.49 ? 77   TRP A CZ3 1 
ATOM   626  C  CH2 . TRP A 1 77  ? 22.839  11.272  5.874   1.00 18.44 ? 77   TRP A CH2 1 
ATOM   627  N  N   . ASN A 1 78  ? 19.796  18.627  4.670   1.00 16.94 ? 78   ASN A N   1 
ATOM   628  C  CA  . ASN A 1 78  ? 19.581  20.054  4.811   1.00 16.41 ? 78   ASN A CA  1 
ATOM   629  C  C   . ASN A 1 78  ? 18.947  20.453  6.127   1.00 16.08 ? 78   ASN A C   1 
ATOM   630  O  O   . ASN A 1 78  ? 19.030  21.633  6.507   1.00 18.39 ? 78   ASN A O   1 
ATOM   631  C  CB  . ASN A 1 78  ? 18.720  20.592  3.683   1.00 17.05 ? 78   ASN A CB  1 
ATOM   632  C  CG  . ASN A 1 78  ? 19.496  20.766  2.374   1.00 16.71 ? 78   ASN A CG  1 
ATOM   633  O  OD1 . ASN A 1 78  ? 19.128  20.227  1.385   1.00 22.05 ? 78   ASN A OD1 1 
ATOM   634  N  ND2 . ASN A 1 78  ? 20.504  21.531  2.390   1.00 12.73 ? 78   ASN A ND2 1 
ATOM   635  N  N   . SER A 1 79  ? 18.304  19.511  6.824   1.00 15.95 ? 79   SER A N   1 
ATOM   636  C  CA  . SER A 1 79  ? 17.671  19.849  8.103   1.00 15.00 ? 79   SER A CA  1 
ATOM   637  C  C   . SER A 1 79  ? 18.654  19.938  9.294   1.00 13.59 ? 79   SER A C   1 
ATOM   638  O  O   . SER A 1 79  ? 18.264  20.296  10.416  1.00 13.76 ? 79   SER A O   1 
ATOM   639  C  CB  . SER A 1 79  ? 16.580  18.840  8.418   1.00 13.60 ? 79   SER A CB  1 
ATOM   640  O  OG  . SER A 1 79  ? 15.509  18.868  7.463   1.00 18.50 ? 79   SER A OG  1 
ATOM   641  N  N   . LEU A 1 80  ? 19.920  19.679  8.993   1.00 15.67 ? 80   LEU A N   1 
ATOM   642  C  CA  . LEU A 1 80  ? 21.064  19.665  9.946   1.00 16.10 ? 80   LEU A CA  1 
ATOM   643  C  C   . LEU A 1 80  ? 22.134  20.658  9.484   1.00 16.91 ? 80   LEU A C   1 
ATOM   644  O  O   . LEU A 1 80  ? 22.248  20.983  8.288   1.00 16.34 ? 80   LEU A O   1 
ATOM   645  C  CB  . LEU A 1 80  ? 21.738  18.250  9.974   1.00 15.50 ? 80   LEU A CB  1 
ATOM   646  C  CG  . LEU A 1 80  ? 20.839  17.019  10.006  1.00 16.63 ? 80   LEU A CG  1 
ATOM   647  C  CD1 . LEU A 1 80  ? 21.660  15.672  9.936   1.00 15.90 ? 80   LEU A CD1 1 
ATOM   648  C  CD2 . LEU A 1 80  ? 20.057  17.091  11.378  1.00 13.19 ? 80   LEU A CD2 1 
ATOM   649  N  N   . SER A 1 81  ? 22.979  21.109  10.423  1.00 18.32 ? 81   SER A N   1 
ATOM   650  C  CA  . SER A 1 81  ? 24.042  22.028  10.049  1.00 17.45 ? 81   SER A CA  1 
ATOM   651  C  C   . SER A 1 81  ? 25.043  22.180  11.150  1.00 18.26 ? 81   SER A C   1 
ATOM   652  O  O   . SER A 1 81  ? 24.678  22.155  12.333  1.00 18.87 ? 81   SER A O   1 
ATOM   653  C  CB  . SER A 1 81  ? 23.418  23.413  9.659   1.00 18.44 ? 81   SER A CB  1 
ATOM   654  O  OG  . SER A 1 81  ? 24.353  24.469  9.771   1.00 16.56 ? 81   SER A OG  1 
ATOM   655  N  N   . PRO A 1 82  ? 26.350  22.322  10.794  1.00 18.94 ? 82   PRO A N   1 
ATOM   656  C  CA  . PRO A 1 82  ? 27.368  22.499  11.856  1.00 18.47 ? 82   PRO A CA  1 
ATOM   657  C  C   . PRO A 1 82  ? 27.076  23.835  12.562  1.00 20.58 ? 82   PRO A C   1 
ATOM   658  O  O   . PRO A 1 82  ? 27.614  24.125  13.615  1.00 20.02 ? 82   PRO A O   1 
ATOM   659  C  CB  . PRO A 1 82  ? 28.688  22.517  11.083  1.00 17.33 ? 82   PRO A CB  1 
ATOM   660  C  CG  . PRO A 1 82  ? 28.204  23.042  9.644   1.00 19.43 ? 82   PRO A CG  1 
ATOM   661  C  CD  . PRO A 1 82  ? 26.942  22.320  9.439   1.00 17.41 ? 82   PRO A CD  1 
ATOM   662  N  N   . ASN A 1 83  ? 26.182  24.654  11.982  1.00 21.58 ? 83   ASN A N   1 
ATOM   663  C  CA  . ASN A 1 83  ? 25.876  25.931  12.611  1.00 21.65 ? 83   ASN A CA  1 
ATOM   664  C  C   . ASN A 1 83  ? 24.457  26.037  13.102  1.00 20.17 ? 83   ASN A C   1 
ATOM   665  O  O   . ASN A 1 83  ? 24.017  27.097  13.444  1.00 21.92 ? 83   ASN A O   1 
ATOM   666  C  CB  . ASN A 1 83  ? 26.152  27.088  11.656  1.00 23.60 ? 83   ASN A CB  1 
ATOM   667  C  CG  . ASN A 1 83  ? 27.628  27.237  11.341  1.00 26.79 ? 83   ASN A CG  1 
ATOM   668  O  OD1 . ASN A 1 83  ? 28.107  26.832  10.288  1.00 27.62 ? 83   ASN A OD1 1 
ATOM   669  N  ND2 . ASN A 1 83  ? 28.369  27.821  12.286  1.00 28.24 ? 83   ASN A ND2 1 
ATOM   670  N  N   . GLY A 1 84  ? 23.765  24.919  13.159  1.00 19.85 ? 84   GLY A N   1 
ATOM   671  C  CA  . GLY A 1 84  ? 22.390  24.911  13.600  1.00 19.30 ? 84   GLY A CA  1 
ATOM   672  C  C   . GLY A 1 84  ? 22.306  24.647  15.110  1.00 19.40 ? 84   GLY A C   1 
ATOM   673  O  O   . GLY A 1 84  ? 23.208  25.032  15.828  1.00 18.61 ? 84   GLY A O   1 
ATOM   674  N  N   . GLY A 1 85  ? 21.213  24.035  15.558  1.00 17.50 ? 85   GLY A N   1 
ATOM   675  C  CA  . GLY A 1 85  ? 21.015  23.796  16.974  1.00 20.19 ? 85   GLY A CA  1 
ATOM   676  C  C   . GLY A 1 85  ? 20.518  25.015  17.766  1.00 20.83 ? 85   GLY A C   1 
ATOM   677  O  O   . GLY A 1 85  ? 20.344  26.132  17.224  1.00 21.08 ? 85   GLY A O   1 
ATOM   678  N  N   . GLY A 1 86  ? 20.279  24.810  19.064  1.00 20.91 ? 86   GLY A N   1 
ATOM   679  C  CA  . GLY A 1 86  ? 19.850  25.892  19.919  1.00 18.36 ? 86   GLY A CA  1 
ATOM   680  C  C   . GLY A 1 86  ? 18.424  26.319  19.597  1.00 18.27 ? 86   GLY A C   1 
ATOM   681  O  O   . GLY A 1 86  ? 17.665  25.631  18.940  1.00 17.62 ? 86   GLY A O   1 
ATOM   682  N  N   . ALA A 1 87  ? 18.081  27.470  20.121  1.00 17.86 ? 87   ALA A N   1 
ATOM   683  C  CA  . ALA A 1 87  ? 16.782  28.146  19.959  1.00 17.83 ? 87   ALA A CA  1 
ATOM   684  C  C   . ALA A 1 87  ? 16.351  28.447  18.535  1.00 17.60 ? 87   ALA A C   1 
ATOM   685  O  O   . ALA A 1 87  ? 17.171  28.899  17.733  1.00 17.63 ? 87   ALA A O   1 
ATOM   686  C  CB  . ALA A 1 87  ? 16.831  29.503  20.720  1.00 18.48 ? 87   ALA A CB  1 
ATOM   687  N  N   . PRO A 1 88  ? 15.063  28.252  18.211  1.00 17.36 ? 88   PRO A N   1 
ATOM   688  C  CA  . PRO A 1 88  ? 14.638  28.573  16.842  1.00 17.81 ? 88   PRO A CA  1 
ATOM   689  C  C   . PRO A 1 88  ? 14.707  30.106  16.641  1.00 20.77 ? 88   PRO A C   1 
ATOM   690  O  O   . PRO A 1 88  ? 14.788  30.886  17.632  1.00 20.71 ? 88   PRO A O   1 
ATOM   691  C  CB  . PRO A 1 88  ? 13.193  28.034  16.774  1.00 17.68 ? 88   PRO A CB  1 
ATOM   692  C  CG  . PRO A 1 88  ? 12.683  28.145  18.204  1.00 18.61 ? 88   PRO A CG  1 
ATOM   693  C  CD  . PRO A 1 88  ? 13.924  27.785  19.047  1.00 18.25 ? 88   PRO A CD  1 
ATOM   694  N  N   . THR A 1 89  ? 14.695  30.550  15.387  1.00 21.20 ? 89   THR A N   1 
ATOM   695  C  CA  . THR A 1 89  ? 14.745  31.983  15.118  1.00 23.69 ? 89   THR A CA  1 
ATOM   696  C  C   . THR A 1 89  ? 13.757  32.411  14.030  1.00 23.92 ? 89   THR A C   1 
ATOM   697  O  O   . THR A 1 89  ? 13.149  31.590  13.344  1.00 22.90 ? 89   THR A O   1 
ATOM   698  C  CB  . THR A 1 89  ? 16.162  32.408  14.658  1.00 24.01 ? 89   THR A CB  1 
ATOM   699  O  OG1 . THR A 1 89  ? 16.516  31.667  13.500  1.00 25.03 ? 89   THR A OG1 1 
ATOM   700  C  CG2 . THR A 1 89  ? 17.175  32.090  15.678  1.00 24.03 ? 89   THR A CG2 1 
ATOM   701  N  N   . GLY A 1 90  ? 13.530  33.717  13.940  1.00 25.33 ? 90   GLY A N   1 
ATOM   702  C  CA  . GLY A 1 90  ? 12.713  34.233  12.857  1.00 22.90 ? 90   GLY A CA  1 
ATOM   703  C  C   . GLY A 1 90  ? 11.324  33.723  12.811  1.00 22.85 ? 90   GLY A C   1 
ATOM   704  O  O   . GLY A 1 90  ? 10.777  33.367  13.853  1.00 22.92 ? 90   GLY A O   1 
ATOM   705  N  N   . ALA A 1 91  ? 10.758  33.692  11.596  1.00 21.38 ? 91   ALA A N   1 
ATOM   706  C  CA  . ALA A 1 91  ? 9.369   33.304  11.393  1.00 20.59 ? 91   ALA A CA  1 
ATOM   707  C  C   . ALA A 1 91  ? 8.973   31.953  12.020  1.00 20.84 ? 91   ALA A C   1 
ATOM   708  O  O   . ALA A 1 91  ? 7.872   31.790  12.599  1.00 19.23 ? 91   ALA A O   1 
ATOM   709  C  CB  . ALA A 1 91  ? 9.075   33.311  9.937   1.00 21.23 ? 91   ALA A CB  1 
ATOM   710  N  N   . VAL A 1 92  ? 9.839   30.956  11.864  1.00 20.02 ? 92   VAL A N   1 
ATOM   711  C  CA  . VAL A 1 92  ? 9.547   29.633  12.433  1.00 19.81 ? 92   VAL A CA  1 
ATOM   712  C  C   . VAL A 1 92  ? 9.492   29.668  13.964  1.00 17.10 ? 92   VAL A C   1 
ATOM   713  O  O   . VAL A 1 92  ? 8.658   29.030  14.532  1.00 17.27 ? 92   VAL A O   1 
ATOM   714  C  CB  . VAL A 1 92  ? 10.592  28.580  11.982  1.00 20.27 ? 92   VAL A CB  1 
ATOM   715  C  CG1 . VAL A 1 92  ? 10.167  27.202  12.498  1.00 22.83 ? 92   VAL A CG1 1 
ATOM   716  C  CG2 . VAL A 1 92  ? 10.644  28.508  10.476  1.00 23.65 ? 92   VAL A CG2 1 
ATOM   717  N  N   . ALA A 1 93  ? 10.384  30.395  14.614  1.00 18.79 ? 93   ALA A N   1 
ATOM   718  C  CA  . ALA A 1 93  ? 10.368  30.494  16.093  1.00 20.14 ? 93   ALA A CA  1 
ATOM   719  C  C   . ALA A 1 93  ? 9.008   31.033  16.510  1.00 21.98 ? 93   ALA A C   1 
ATOM   720  O  O   . ALA A 1 93  ? 8.344   30.513  17.451  1.00 22.82 ? 93   ALA A O   1 
ATOM   721  C  CB  . ALA A 1 93  ? 11.430  31.436  16.584  1.00 18.28 ? 93   ALA A CB  1 
ATOM   722  N  N   . ASP A 1 94  ? 8.567   32.068  15.805  1.00 22.40 ? 94   ASP A N   1 
ATOM   723  C  CA  . ASP A 1 94  ? 7.266   32.639  16.139  1.00 23.09 ? 94   ASP A CA  1 
ATOM   724  C  C   . ASP A 1 94  ? 6.094   31.727  15.782  1.00 21.67 ? 94   ASP A C   1 
ATOM   725  O  O   . ASP A 1 94  ? 5.128   31.649  16.584  1.00 19.66 ? 94   ASP A O   1 
ATOM   726  C  CB  . ASP A 1 94  ? 7.133   34.062  15.549  1.00 25.79 ? 94   ASP A CB  1 
ATOM   727  C  CG  . ASP A 1 94  ? 8.030   35.119  16.315  1.00 32.01 ? 94   ASP A CG  1 
ATOM   728  O  OD1 . ASP A 1 94  ? 8.101   35.114  17.599  1.00 35.62 ? 94   ASP A OD1 1 
ATOM   729  O  OD2 . ASP A 1 94  ? 8.662   35.974  15.645  1.00 34.72 ? 94   ASP A OD2 1 
ATOM   730  N  N   . ALA A 1 95  ? 6.166   30.989  14.653  1.00 21.21 ? 95   ALA A N   1 
ATOM   731  C  CA  . ALA A 1 95  ? 5.060   30.085  14.266  1.00 21.16 ? 95   ALA A CA  1 
ATOM   732  C  C   . ALA A 1 95  ? 4.950   28.875  15.224  1.00 20.99 ? 95   ALA A C   1 
ATOM   733  O  O   . ALA A 1 95  ? 3.870   28.317  15.419  1.00 19.92 ? 95   ALA A O   1 
ATOM   734  C  CB  . ALA A 1 95  ? 5.230   29.579  12.798  1.00 22.70 ? 95   ALA A CB  1 
ATOM   735  N  N   . ILE A 1 96  ? 6.076   28.501  15.826  1.00 20.19 ? 96   ILE A N   1 
ATOM   736  C  CA  . ILE A 1 96  ? 6.098   27.391  16.777  1.00 19.11 ? 96   ILE A CA  1 
ATOM   737  C  C   . ILE A 1 96  ? 5.375   27.894  18.056  1.00 18.60 ? 96   ILE A C   1 
ATOM   738  O  O   . ILE A 1 96  ? 4.524   27.198  18.658  1.00 16.13 ? 96   ILE A O   1 
ATOM   739  C  CB  . ILE A 1 96  ? 7.575   27.023  17.106  1.00 18.50 ? 96   ILE A CB  1 
ATOM   740  C  CG1 . ILE A 1 96  ? 8.170   26.111  15.985  1.00 19.99 ? 96   ILE A CG1 1 
ATOM   741  C  CG2 . ILE A 1 96  ? 7.654   26.346  18.521  1.00 19.36 ? 96   ILE A CG2 1 
ATOM   742  C  CD1 . ILE A 1 96  ? 9.752   25.950  16.069  1.00 16.96 ? 96   ILE A CD1 1 
ATOM   743  N  N   . ASN A 1 97  ? 5.759   29.093  18.489  1.00 18.50 ? 97   ASN A N   1 
ATOM   744  C  CA  . ASN A 1 97  ? 5.135   29.676  19.653  1.00 19.66 ? 97   ASN A CA  1 
ATOM   745  C  C   . ASN A 1 97  ? 3.644   29.775  19.394  1.00 20.77 ? 97   ASN A C   1 
ATOM   746  O  O   . ASN A 1 97  ? 2.834   29.476  20.286  1.00 22.04 ? 97   ASN A O   1 
ATOM   747  C  CB  . ASN A 1 97  ? 5.709   31.079  19.919  1.00 19.70 ? 97   ASN A CB  1 
ATOM   748  C  CG  . ASN A 1 97  ? 7.080   31.040  20.576  1.00 20.43 ? 97   ASN A CG  1 
ATOM   749  O  OD1 . ASN A 1 97  ? 7.807   32.042  20.560  1.00 24.06 ? 97   ASN A OD1 1 
ATOM   750  N  ND2 . ASN A 1 97  ? 7.437   29.906  21.171  1.00 17.65 ? 97   ASN A ND2 1 
ATOM   751  N  N   . ALA A 1 98  ? 3.243   30.177  18.182  1.00 20.18 ? 98   ALA A N   1 
ATOM   752  C  CA  . ALA A 1 98  ? 1.800   30.286  17.946  1.00 20.93 ? 98   ALA A CA  1 
ATOM   753  C  C   . ALA A 1 98  ? 1.033   28.961  18.057  1.00 20.60 ? 98   ALA A C   1 
ATOM   754  O  O   . ALA A 1 98  ? -0.102  28.922  18.562  1.00 21.03 ? 98   ALA A O   1 
ATOM   755  C  CB  . ALA A 1 98  ? 1.520   30.938  16.578  1.00 18.70 ? 98   ALA A CB  1 
ATOM   756  N  N   . LYS A 1 99  ? 1.638   27.867  17.610  1.00 19.44 ? 99   LYS A N   1 
ATOM   757  C  CA  . LYS A 1 99  ? 0.943   26.592  17.655  1.00 18.92 ? 99   LYS A CA  1 
ATOM   758  C  C   . LYS A 1 99  ? 1.013   25.852  19.016  1.00 19.42 ? 99   LYS A C   1 
ATOM   759  O  O   . LYS A 1 99  ? 0.024   25.300  19.508  1.00 18.98 ? 99   LYS A O   1 
ATOM   760  C  CB  . LYS A 1 99  ? 1.537   25.675  16.577  1.00 21.70 ? 99   LYS A CB  1 
ATOM   761  C  CG  . LYS A 1 99  ? 1.056   24.181  16.582  1.00 22.22 ? 99   LYS A CG  1 
ATOM   762  C  CD  . LYS A 1 99  ? -0.377  24.177  16.265  1.00 25.73 ? 99   LYS A CD  1 
ATOM   763  C  CE  . LYS A 1 99  ? -0.881  22.899  15.764  1.00 24.80 ? 99   LYS A CE  1 
ATOM   764  N  NZ  . LYS A 1 99  ? -1.108  22.059  16.874  1.00 30.95 ? 99   LYS A NZ  1 
ATOM   765  N  N   . TRP A 1 100 ? 2.200   25.828  19.601  1.00 20.29 ? 100  TRP A N   1 
ATOM   766  C  CA  . TRP A 1 100 ? 2.427   25.058  20.822  1.00 19.90 ? 100  TRP A CA  1 
ATOM   767  C  C   . TRP A 1 100 ? 2.537   25.901  22.088  1.00 19.71 ? 100  TRP A C   1 
ATOM   768  O  O   . TRP A 1 100 ? 2.651   25.334  23.186  1.00 19.90 ? 100  TRP A O   1 
ATOM   769  C  CB  . TRP A 1 100 ? 3.734   24.231  20.672  1.00 18.87 ? 100  TRP A CB  1 
ATOM   770  C  CG  . TRP A 1 100 ? 3.622   23.031  19.738  1.00 18.99 ? 100  TRP A CG  1 
ATOM   771  C  CD1 . TRP A 1 100 ? 3.056   21.793  20.024  1.00 18.59 ? 100  TRP A CD1 1 
ATOM   772  C  CD2 . TRP A 1 100 ? 3.975   22.997  18.343  1.00 18.25 ? 100  TRP A CD2 1 
ATOM   773  N  NE1 . TRP A 1 100 ? 3.023   21.007  18.869  1.00 18.43 ? 100  TRP A NE1 1 
ATOM   774  C  CE2 . TRP A 1 100 ? 3.574   21.718  17.833  1.00 18.98 ? 100  TRP A CE2 1 
ATOM   775  C  CE3 . TRP A 1 100 ? 4.580   23.929  17.466  1.00 16.14 ? 100  TRP A CE3 1 
ATOM   776  C  CZ2 . TRP A 1 100 ? 3.749   21.351  16.462  1.00 18.88 ? 100  TRP A CZ2 1 
ATOM   777  C  CZ3 . TRP A 1 100 ? 4.749   23.566  16.088  1.00 17.66 ? 100  TRP A CZ3 1 
ATOM   778  C  CH2 . TRP A 1 100 ? 4.332   22.296  15.616  1.00 17.13 ? 100  TRP A CH2 1 
ATOM   779  N  N   . GLY A 1 101 ? 2.516   27.236  21.943  1.00 19.59 ? 101  GLY A N   1 
ATOM   780  C  CA  . GLY A 1 101 ? 2.658   28.129  23.110  1.00 19.12 ? 101  GLY A CA  1 
ATOM   781  C  C   . GLY A 1 101 ? 4.107   28.410  23.442  1.00 18.61 ? 101  GLY A C   1 
ATOM   782  O  O   . GLY A 1 101 ? 4.430   29.508  23.885  1.00 18.43 ? 101  GLY A O   1 
ATOM   783  N  N   . SER A 1 102 ? 4.996   27.423  23.235  1.00 17.58 ? 102  SER A N   1 
ATOM   784  C  CA  . SER A 1 102 ? 6.421   27.619  23.541  1.00 18.26 ? 102  SER A CA  1 
ATOM   785  C  C   . SER A 1 102 ? 7.326   26.637  22.782  1.00 18.62 ? 102  SER A C   1 
ATOM   786  O  O   . SER A 1 102 ? 6.876   25.584  22.321  1.00 18.01 ? 102  SER A O   1 
ATOM   787  C  CB  . SER A 1 102 ? 6.686   27.419  25.043  1.00 19.04 ? 102  SER A CB  1 
ATOM   788  O  OG  . SER A 1 102 ? 6.534   26.061  25.408  1.00 19.52 ? 102  SER A OG  1 
ATOM   789  N  N   . PHE A 1 103 ? 8.588   26.983  22.646  1.00 17.86 ? 103  PHE A N   1 
ATOM   790  C  CA  . PHE A 1 103 ? 9.531   26.095  21.975  1.00 19.55 ? 103  PHE A CA  1 
ATOM   791  C  C   . PHE A 1 103 ? 9.679   24.781  22.718  1.00 19.96 ? 103  PHE A C   1 
ATOM   792  O  O   . PHE A 1 103 ? 9.694   23.704  22.094  1.00 20.42 ? 103  PHE A O   1 
ATOM   793  C  CB  . PHE A 1 103 ? 10.898  26.735  21.856  1.00 18.66 ? 103  PHE A CB  1 
ATOM   794  C  CG  . PHE A 1 103 ? 11.923  25.820  21.245  1.00 19.66 ? 103  PHE A CG  1 
ATOM   795  C  CD1 . PHE A 1 103 ? 11.775  25.370  19.951  1.00 19.94 ? 103  PHE A CD1 1 
ATOM   796  C  CD2 . PHE A 1 103 ? 13.013  25.373  21.998  1.00 20.08 ? 103  PHE A CD2 1 
ATOM   797  C  CE1 . PHE A 1 103 ? 12.698  24.475  19.405  1.00 20.74 ? 103  PHE A CE1 1 
ATOM   798  C  CE2 . PHE A 1 103 ? 13.936  24.479  21.464  1.00 21.69 ? 103  PHE A CE2 1 
ATOM   799  C  CZ  . PHE A 1 103 ? 13.774  24.024  20.158  1.00 22.35 ? 103  PHE A CZ  1 
ATOM   800  N  N   . ASP A 1 104 ? 9.774   24.862  24.053  1.00 20.57 ? 104  ASP A N   1 
ATOM   801  C  CA  . ASP A 1 104 ? 9.867   23.644  24.897  1.00 19.08 ? 104  ASP A CA  1 
ATOM   802  C  C   . ASP A 1 104 ? 8.675   22.671  24.701  1.00 18.63 ? 104  ASP A C   1 
ATOM   803  O  O   . ASP A 1 104 ? 8.870   21.462  24.546  1.00 18.55 ? 104  ASP A O   1 
ATOM   804  C  CB  . ASP A 1 104 ? 9.967   24.024  26.393  1.00 19.28 ? 104  ASP A CB  1 
ATOM   805  C  CG  . ASP A 1 104 ? 11.333  24.546  26.769  1.00 17.50 ? 104  ASP A CG  1 
ATOM   806  O  OD1 . ASP A 1 104 ? 12.217  24.522  25.893  1.00 19.49 ? 104  ASP A OD1 1 
ATOM   807  O  OD2 . ASP A 1 104 ? 11.541  24.998  27.937  1.00 19.88 ? 104  ASP A OD2 1 
ATOM   808  N  N   . ALA A 1 105 ? 7.435   23.169  24.711  1.00 17.31 ? 105  ALA A N   1 
ATOM   809  C  CA  . ALA A 1 105 ? 6.307   22.242  24.512  1.00 17.73 ? 105  ALA A CA  1 
ATOM   810  C  C   . ALA A 1 105 ? 6.414   21.584  23.106  1.00 17.62 ? 105  ALA A C   1 
ATOM   811  O  O   . ALA A 1 105 ? 6.096   20.423  22.966  1.00 17.86 ? 105  ALA A O   1 
ATOM   812  C  CB  . ALA A 1 105 ? 4.983   22.955  24.618  1.00 18.09 ? 105  ALA A CB  1 
ATOM   813  N  N   . PHE A 1 106 ? 6.862   22.353  22.118  1.00 16.62 ? 106  PHE A N   1 
ATOM   814  C  CA  . PHE A 1 106 ? 6.991   21.884  20.730  1.00 18.70 ? 106  PHE A CA  1 
ATOM   815  C  C   . PHE A 1 106 ? 8.026   20.760  20.680  1.00 18.72 ? 106  PHE A C   1 
ATOM   816  O  O   . PHE A 1 106 ? 7.793   19.708  20.090  1.00 18.32 ? 106  PHE A O   1 
ATOM   817  C  CB  . PHE A 1 106 ? 7.461   23.031  19.790  1.00 18.18 ? 106  PHE A CB  1 
ATOM   818  C  CG  . PHE A 1 106 ? 8.015   22.535  18.435  1.00 19.17 ? 106  PHE A CG  1 
ATOM   819  C  CD1 . PHE A 1 106 ? 7.195   21.827  17.533  1.00 19.86 ? 106  PHE A CD1 1 
ATOM   820  C  CD2 . PHE A 1 106 ? 9.352   22.658  18.146  1.00 18.19 ? 106  PHE A CD2 1 
ATOM   821  C  CE1 . PHE A 1 106 ? 7.736   21.244  16.363  1.00 18.96 ? 106  PHE A CE1 1 
ATOM   822  C  CE2 . PHE A 1 106 ? 9.905   22.084  16.992  1.00 20.19 ? 106  PHE A CE2 1 
ATOM   823  C  CZ  . PHE A 1 106 ? 9.075   21.367  16.096  1.00 19.98 ? 106  PHE A CZ  1 
ATOM   824  N  N   . LYS A 1 107 ? 9.158   21.010  21.298  1.00 19.21 ? 107  LYS A N   1 
ATOM   825  C  CA  . LYS A 1 107 ? 10.250  20.041  21.357  1.00 20.93 ? 107  LYS A CA  1 
ATOM   826  C  C   . LYS A 1 107 ? 9.824   18.755  22.068  1.00 20.51 ? 107  LYS A C   1 
ATOM   827  O  O   . LYS A 1 107 ? 10.162  17.648  21.644  1.00 20.31 ? 107  LYS A O   1 
ATOM   828  C  CB  . LYS A 1 107 ? 11.462  20.684  22.062  1.00 23.22 ? 107  LYS A CB  1 
ATOM   829  C  CG  . LYS A 1 107 ? 12.640  19.793  22.316  1.00 24.17 ? 107  LYS A CG  1 
ATOM   830  C  CD  . LYS A 1 107 ? 13.776  20.629  22.941  1.00 26.52 ? 107  LYS A CD  1 
ATOM   831  C  CE  . LYS A 1 107 ? 15.068  19.765  23.019  1.00 28.36 ? 107  LYS A CE  1 
ATOM   832  N  NZ  . LYS A 1 107 ? 16.267  20.495  23.630  1.00 28.18 ? 107  LYS A NZ  1 
ATOM   833  N  N   . GLU A 1 108 ? 9.071   18.884  23.145  1.00 19.10 ? 108  GLU A N   1 
ATOM   834  C  CA  . GLU A 1 108 ? 8.666   17.670  23.794  1.00 19.17 ? 108  GLU A CA  1 
ATOM   835  C  C   . GLU A 1 108 ? 7.640   16.954  22.939  1.00 17.29 ? 108  GLU A C   1 
ATOM   836  O  O   . GLU A 1 108 ? 7.620   15.740  22.926  1.00 14.52 ? 108  GLU A O   1 
ATOM   837  C  CB  . GLU A 1 108 ? 8.100   17.925  25.187  1.00 23.28 ? 108  GLU A CB  1 
ATOM   838  C  CG  . GLU A 1 108 ? 6.872   18.801  25.283  1.00 32.79 ? 108  GLU A CG  1 
ATOM   839  C  CD  . GLU A 1 108 ? 6.410   18.930  26.784  1.00 38.20 ? 108  GLU A CD  1 
ATOM   840  O  OE1 . GLU A 1 108 ? 6.873   19.891  27.515  1.00 41.02 ? 108  GLU A OE1 1 
ATOM   841  O  OE2 . GLU A 1 108 ? 5.625   18.031  27.214  1.00 39.63 ? 108  GLU A OE2 1 
ATOM   842  N  N   . ALA A 1 109 ? 6.790   17.704  22.242  1.00 15.97 ? 109  ALA A N   1 
ATOM   843  C  CA  . ALA A 1 109 ? 5.761   17.078  21.346  1.00 16.59 ? 109  ALA A CA  1 
ATOM   844  C  C   . ALA A 1 109 ? 6.474   16.336  20.186  1.00 13.69 ? 109  ALA A C   1 
ATOM   845  O  O   . ALA A 1 109 ? 6.138   15.208  19.846  1.00 16.10 ? 109  ALA A O   1 
ATOM   846  C  CB  . ALA A 1 109 ? 4.802   18.166  20.741  1.00 14.77 ? 109  ALA A CB  1 
ATOM   847  N  N   . LEU A 1 110 ? 7.490   16.955  19.611  1.00 12.65 ? 110  LEU A N   1 
ATOM   848  C  CA  . LEU A 1 110 ? 8.156   16.292  18.518  1.00 12.33 ? 110  LEU A CA  1 
ATOM   849  C  C   . LEU A 1 110 ? 8.941   15.055  19.000  1.00 14.28 ? 110  LEU A C   1 
ATOM   850  O  O   . LEU A 1 110 ? 8.917   14.021  18.358  1.00 14.90 ? 110  LEU A O   1 
ATOM   851  C  CB  . LEU A 1 110 ? 9.034   17.313  17.720  1.00 11.66 ? 110  LEU A CB  1 
ATOM   852  C  CG  . LEU A 1 110 ? 9.630   16.817  16.372  1.00 10.53 ? 110  LEU A CG  1 
ATOM   853  C  CD1 . LEU A 1 110 ? 9.954   18.028  15.463  1.00 10.31 ? 110  LEU A CD1 1 
ATOM   854  C  CD2 . LEU A 1 110 ? 10.965  15.967  16.592  1.00 10.21 ? 110  LEU A CD2 1 
ATOM   855  N  N   . ASN A 1 111 ? 9.625   15.172  20.142  1.00 14.78 ? 111  ASN A N   1 
ATOM   856  C  CA  . ASN A 1 111 ? 10.421  14.061  20.702  1.00 16.20 ? 111  ASN A CA  1 
ATOM   857  C  C   . ASN A 1 111 ? 9.465   12.884  20.934  1.00 15.51 ? 111  ASN A C   1 
ATOM   858  O  O   . ASN A 1 111 ? 9.791   11.740  20.636  1.00 15.60 ? 111  ASN A O   1 
ATOM   859  C  CB  . ASN A 1 111 ? 11.104  14.504  22.052  1.00 14.19 ? 111  ASN A CB  1 
ATOM   860  C  CG  . ASN A 1 111 ? 12.434  15.260  21.851  1.00 16.51 ? 111  ASN A CG  1 
ATOM   861  O  OD1 . ASN A 1 111 ? 12.993  15.901  22.808  1.00 20.29 ? 111  ASN A OD1 1 
ATOM   862  N  ND2 . ASN A 1 111 ? 12.963  15.174  20.686  1.00 12.19 ? 111  ASN A ND2 1 
ATOM   863  N  N   . ASP A 1 112 ? 8.259   13.171  21.437  1.00 17.15 ? 112  ASP A N   1 
ATOM   864  C  CA  . ASP A 1 112 ? 7.271   12.111  21.741  1.00 17.41 ? 112  ASP A CA  1 
ATOM   865  C  C   . ASP A 1 112 ? 6.824   11.388  20.454  1.00 17.59 ? 112  ASP A C   1 
ATOM   866  O  O   . ASP A 1 112 ? 6.697   10.157  20.413  1.00 17.03 ? 112  ASP A O   1 
ATOM   867  C  CB  . ASP A 1 112 ? 6.027   12.707  22.452  1.00 21.15 ? 112  ASP A CB  1 
ATOM   868  C  CG  . ASP A 1 112 ? 4.922   11.668  22.678  1.00 24.89 ? 112  ASP A CG  1 
ATOM   869  O  OD1 . ASP A 1 112 ? 5.126   10.643  23.388  1.00 29.95 ? 112  ASP A OD1 1 
ATOM   870  O  OD2 . ASP A 1 112 ? 3.821   11.864  22.139  1.00 28.40 ? 112  ASP A OD2 1 
ATOM   871  N  N   . LYS A 1 113 ? 6.601   12.167  19.393  1.00 17.39 ? 113  LYS A N   1 
ATOM   872  C  CA  . LYS A 1 113 ? 6.191   11.588  18.134  1.00 17.92 ? 113  LYS A CA  1 
ATOM   873  C  C   . LYS A 1 113 ? 7.365   10.774  17.538  1.00 16.96 ? 113  LYS A C   1 
ATOM   874  O  O   . LYS A 1 113 ? 7.133   9.736   16.953  1.00 16.77 ? 113  LYS A O   1 
ATOM   875  C  CB  . LYS A 1 113 ? 5.841   12.713  17.120  1.00 19.42 ? 113  LYS A CB  1 
ATOM   876  C  CG  . LYS A 1 113 ? 4.515   13.474  17.463  1.00 22.38 ? 113  LYS A CG  1 
ATOM   877  C  CD  . LYS A 1 113 ? 3.334   12.611  17.163  1.00 22.55 ? 113  LYS A CD  1 
ATOM   878  C  CE  . LYS A 1 113 ? 3.108   12.496  15.668  1.00 23.77 ? 113  LYS A CE  1 
ATOM   879  N  NZ  . LYS A 1 113 ? 1.982   11.537  15.483  1.00 28.37 ? 113  LYS A NZ  1 
ATOM   880  N  N   . ALA A 1 114 ? 8.594   11.297  17.643  1.00 16.09 ? 114  ALA A N   1 
ATOM   881  C  CA  . ALA A 1 114 ? 9.767   10.632  17.042  1.00 15.93 ? 114  ALA A CA  1 
ATOM   882  C  C   . ALA A 1 114 ? 10.139  9.351   17.792  1.00 16.50 ? 114  ALA A C   1 
ATOM   883  O  O   . ALA A 1 114 ? 10.364  8.368   17.154  1.00 16.35 ? 114  ALA A O   1 
ATOM   884  C  CB  . ALA A 1 114 ? 10.988  11.595  16.982  1.00 14.28 ? 114  ALA A CB  1 
ATOM   885  N  N   . VAL A 1 115 ? 10.124  9.335   19.134  1.00 19.40 ? 115  VAL A N   1 
ATOM   886  C  CA  . VAL A 1 115 ? 10.541  8.101   19.820  1.00 19.97 ? 115  VAL A CA  1 
ATOM   887  C  C   . VAL A 1 115 ? 9.486   7.019   19.576  1.00 21.36 ? 115  VAL A C   1 
ATOM   888  O  O   . VAL A 1 115 ? 9.819   5.840   19.481  1.00 21.36 ? 115  VAL A O   1 
ATOM   889  C  CB  . VAL A 1 115 ? 10.762  8.245   21.414  1.00 21.04 ? 115  VAL A CB  1 
ATOM   890  C  CG1 . VAL A 1 115 ? 11.827  9.328   21.749  1.00 19.32 ? 115  VAL A CG1 1 
ATOM   891  C  CG2 . VAL A 1 115 ? 9.441   8.560   22.093  1.00 22.82 ? 115  VAL A CG2 1 
ATOM   892  N  N   . ASN A 1 116 ? 8.230   7.423   19.449  1.00 20.67 ? 116  ASN A N   1 
ATOM   893  C  CA  . ASN A 1 116 ? 7.181   6.436   19.210  1.00 22.46 ? 116  ASN A CA  1 
ATOM   894  C  C   . ASN A 1 116 ? 6.820   6.217   17.707  1.00 21.48 ? 116  ASN A C   1 
ATOM   895  O  O   . ASN A 1 116 ? 5.788   5.657   17.392  1.00 20.40 ? 116  ASN A O   1 
ATOM   896  C  CB  . ASN A 1 116 ? 5.899   6.850   19.980  1.00 23.82 ? 116  ASN A CB  1 
ATOM   897  C  CG  . ASN A 1 116 ? 6.104   6.788   21.501  1.00 28.27 ? 116  ASN A CG  1 
ATOM   898  O  OD1 . ASN A 1 116 ? 6.227   7.838   22.202  1.00 30.20 ? 116  ASN A OD1 1 
ATOM   899  N  ND2 . ASN A 1 116 ? 6.191   5.574   22.015  1.00 29.74 ? 116  ASN A ND2 1 
ATOM   900  N  N   . ASN A 1 117 ? 7.676   6.668   16.794  1.00 20.70 ? 117  ASN A N   1 
ATOM   901  C  CA  . ASN A 1 117 ? 7.390   6.502   15.394  1.00 19.84 ? 117  ASN A CA  1 
ATOM   902  C  C   . ASN A 1 117 ? 7.939   5.072   15.138  1.00 20.24 ? 117  ASN A C   1 
ATOM   903  O  O   . ASN A 1 117 ? 9.165   4.877   14.968  1.00 19.94 ? 117  ASN A O   1 
ATOM   904  C  CB  . ASN A 1 117 ? 8.164   7.589   14.651  1.00 18.85 ? 117  ASN A CB  1 
ATOM   905  C  CG  . ASN A 1 117 ? 7.621   7.822   13.242  1.00 16.67 ? 117  ASN A CG  1 
ATOM   906  O  OD1 . ASN A 1 117 ? 6.860   7.025   12.755  1.00 13.84 ? 117  ASN A OD1 1 
ATOM   907  N  ND2 . ASN A 1 117 ? 8.013   8.906   12.617  1.00 16.16 ? 117  ASN A ND2 1 
ATOM   908  N  N   . PHE A 1 118 ? 7.042   4.093   15.153  1.00 18.83 ? 118  PHE A N   1 
ATOM   909  C  CA  . PHE A 1 118 ? 7.370   2.694   15.034  1.00 18.55 ? 118  PHE A CA  1 
ATOM   910  C  C   . PHE A 1 118 ? 8.076   2.260   13.758  1.00 18.05 ? 118  PHE A C   1 
ATOM   911  O  O   . PHE A 1 118 ? 7.723   2.662   12.675  1.00 17.45 ? 118  PHE A O   1 
ATOM   912  C  CB  . PHE A 1 118 ? 6.116   1.838   15.245  1.00 18.52 ? 118  PHE A CB  1 
ATOM   913  C  CG  . PHE A 1 118 ? 6.434   0.412   15.610  1.00 20.03 ? 118  PHE A CG  1 
ATOM   914  C  CD1 . PHE A 1 118 ? 7.134   0.121   16.789  1.00 19.89 ? 118  PHE A CD1 1 
ATOM   915  C  CD2 . PHE A 1 118 ? 6.002   -0.658  14.790  1.00 20.52 ? 118  PHE A CD2 1 
ATOM   916  C  CE1 . PHE A 1 118 ? 7.394   -1.205  17.153  1.00 20.56 ? 118  PHE A CE1 1 
ATOM   917  C  CE2 . PHE A 1 118 ? 6.257   -1.990  15.150  1.00 21.13 ? 118  PHE A CE2 1 
ATOM   918  C  CZ  . PHE A 1 118 ? 6.955   -2.275  16.336  1.00 19.26 ? 118  PHE A CZ  1 
ATOM   919  N  N   . GLY A 1 119 ? 9.114   1.461   13.910  1.00 17.66 ? 119  GLY A N   1 
ATOM   920  C  CA  . GLY A 1 119 ? 9.877   0.966   12.746  1.00 18.07 ? 119  GLY A CA  1 
ATOM   921  C  C   . GLY A 1 119 ? 10.605  2.055   11.939  1.00 17.95 ? 119  GLY A C   1 
ATOM   922  O  O   . GLY A 1 119 ? 10.895  3.158   12.477  1.00 18.75 ? 119  GLY A O   1 
ATOM   923  N  N   . SER A 1 120 ? 10.905  1.769   10.665  1.00 16.14 ? 120  SER A N   1 
ATOM   924  C  CA  . SER A 1 120 ? 11.638  2.738   9.820   1.00 15.14 ? 120  SER A CA  1 
ATOM   925  C  C   . SER A 1 120 ? 10.641  3.861   9.542   1.00 15.65 ? 120  SER A C   1 
ATOM   926  O  O   . SER A 1 120 ? 9.535   3.602   9.033   1.00 11.82 ? 120  SER A O   1 
ATOM   927  C  CB  . SER A 1 120 ? 12.060  2.090   8.518   1.00 13.41 ? 120  SER A CB  1 
ATOM   928  O  OG  . SER A 1 120 ? 12.966  1.073   8.835   1.00 16.76 ? 120  SER A OG  1 
ATOM   929  N  N   . SER A 1 121 ? 11.053  5.086   9.852   1.00 15.17 ? 121  SER A N   1 
ATOM   930  C  CA  . SER A 1 121 ? 10.119  6.174   9.743   1.00 16.08 ? 121  SER A CA  1 
ATOM   931  C  C   . SER A 1 121 ? 10.761  7.510   9.688   1.00 14.83 ? 121  SER A C   1 
ATOM   932  O  O   . SER A 1 121 ? 11.993  7.616   9.858   1.00 18.20 ? 121  SER A O   1 
ATOM   933  C  CB  . SER A 1 121 ? 9.157   6.078   10.959  1.00 16.64 ? 121  SER A CB  1 
ATOM   934  O  OG  . SER A 1 121 ? 9.905   6.097   12.167  1.00 20.90 ? 121  SER A OG  1 
ATOM   935  N  N   . TRP A 1 122 ? 9.945   8.538   9.514   1.00 12.87 ? 122  TRP A N   1 
ATOM   936  C  CA  . TRP A 1 122 ? 10.375  9.934   9.468   1.00 12.84 ? 122  TRP A CA  1 
ATOM   937  C  C   . TRP A 1 122 ? 9.394   10.752  10.281  1.00 14.47 ? 122  TRP A C   1 
ATOM   938  O  O   . TRP A 1 122 ? 8.196   10.526  10.190  1.00 16.53 ? 122  TRP A O   1 
ATOM   939  C  CB  . TRP A 1 122 ? 10.354  10.516  8.039   1.00 10.33 ? 122  TRP A CB  1 
ATOM   940  C  CG  . TRP A 1 122 ? 11.179  9.784   7.058   1.00 11.52 ? 122  TRP A CG  1 
ATOM   941  C  CD1 . TRP A 1 122 ? 10.842  8.651   6.400   1.00 10.56 ? 122  TRP A CD1 1 
ATOM   942  C  CD2 . TRP A 1 122 ? 12.516  10.135  6.630   1.00 13.05 ? 122  TRP A CD2 1 
ATOM   943  N  NE1 . TRP A 1 122 ? 11.878  8.266   5.580   1.00 12.69 ? 122  TRP A NE1 1 
ATOM   944  C  CE2 . TRP A 1 122 ? 12.918  9.164   5.705   1.00 13.39 ? 122  TRP A CE2 1 
ATOM   945  C  CE3 . TRP A 1 122 ? 13.406  11.170  6.959   1.00 14.49 ? 122  TRP A CE3 1 
ATOM   946  C  CZ2 . TRP A 1 122 ? 14.167  9.186   5.105   1.00 13.15 ? 122  TRP A CZ2 1 
ATOM   947  C  CZ3 . TRP A 1 122 ? 14.649  11.192  6.355   1.00 15.68 ? 122  TRP A CZ3 1 
ATOM   948  C  CH2 . TRP A 1 122 ? 15.015  10.204  5.437   1.00 13.63 ? 122  TRP A CH2 1 
ATOM   949  N  N   . THR A 1 123 ? 9.887   11.716  11.046  1.00 15.49 ? 123  THR A N   1 
ATOM   950  C  CA  . THR A 1 123 ? 9.040   12.643  11.813  1.00 14.40 ? 123  THR A CA  1 
ATOM   951  C  C   . THR A 1 123 ? 9.313   14.029  11.173  1.00 14.97 ? 123  THR A C   1 
ATOM   952  O  O   . THR A 1 123 ? 10.472  14.465  11.054  1.00 17.42 ? 123  THR A O   1 
ATOM   953  C  CB  . THR A 1 123 ? 9.369   12.601  13.352  1.00 12.70 ? 123  THR A CB  1 
ATOM   954  O  OG1 . THR A 1 123 ? 8.888   11.365  13.866  1.00 11.96 ? 123  THR A OG1 1 
ATOM   955  C  CG2 . THR A 1 123 ? 8.634   13.735  14.158  1.00 11.94 ? 123  THR A CG2 1 
ATOM   956  N  N   . TRP A 1 124 ? 8.244   14.728  10.787  1.00 15.32 ? 124  TRP A N   1 
ATOM   957  C  CA  . TRP A 1 124 ? 8.344   16.001  10.085  1.00 14.52 ? 124  TRP A CA  1 
ATOM   958  C  C   . TRP A 1 124 ? 7.693   17.159  10.809  1.00 14.46 ? 124  TRP A C   1 
ATOM   959  O  O   . TRP A 1 124 ? 6.673   16.970  11.463  1.00 16.17 ? 124  TRP A O   1 
ATOM   960  C  CB  . TRP A 1 124 ? 7.599   15.911  8.732   1.00 15.27 ? 124  TRP A CB  1 
ATOM   961  C  CG  . TRP A 1 124 ? 7.964   14.667  7.862   1.00 15.01 ? 124  TRP A CG  1 
ATOM   962  C  CD1 . TRP A 1 124 ? 7.564   13.377  8.029   1.00 15.47 ? 124  TRP A CD1 1 
ATOM   963  C  CD2 . TRP A 1 124 ? 8.817   14.678  6.732   1.00 14.57 ? 124  TRP A CD2 1 
ATOM   964  N  NE1 . TRP A 1 124 ? 8.133   12.564  7.062   1.00 14.77 ? 124  TRP A NE1 1 
ATOM   965  C  CE2 . TRP A 1 124 ? 8.916   13.339  6.256   1.00 13.80 ? 124  TRP A CE2 1 
ATOM   966  C  CE3 . TRP A 1 124 ? 9.509   15.683  6.071   1.00 13.99 ? 124  TRP A CE3 1 
ATOM   967  C  CZ2 . TRP A 1 124 ? 9.695   12.987  5.146   1.00 15.23 ? 124  TRP A CZ2 1 
ATOM   968  C  CZ3 . TRP A 1 124 ? 10.276  15.341  4.970   1.00 14.60 ? 124  TRP A CZ3 1 
ATOM   969  C  CH2 . TRP A 1 124 ? 10.364  13.993  4.517   1.00 13.72 ? 124  TRP A CH2 1 
ATOM   970  N  N   . LEU A 1 125 ? 8.316   18.323  10.679  1.00 14.46 ? 125  LEU A N   1 
ATOM   971  C  CA  . LEU A 1 125 ? 7.707   19.588  11.122  1.00 17.52 ? 125  LEU A CA  1 
ATOM   972  C  C   . LEU A 1 125 ? 7.169   20.049  9.741   1.00 18.16 ? 125  LEU A C   1 
ATOM   973  O  O   . LEU A 1 125 ? 7.946   20.212  8.807   1.00 18.93 ? 125  LEU A O   1 
ATOM   974  C  CB  . LEU A 1 125 ? 8.733   20.596  11.576  1.00 13.82 ? 125  LEU A CB  1 
ATOM   975  C  CG  . LEU A 1 125 ? 8.039   21.945  11.746  1.00 14.30 ? 125  LEU A CG  1 
ATOM   976  C  CD1 . LEU A 1 125 ? 6.908   21.773  12.771  1.00 15.57 ? 125  LEU A CD1 1 
ATOM   977  C  CD2 . LEU A 1 125 ? 9.001   23.018  12.145  1.00 14.34 ? 125  LEU A CD2 1 
ATOM   978  N  N   . VAL A 1 126 ? 5.856   20.182  9.605   1.00 21.62 ? 126  VAL A N   1 
ATOM   979  C  CA  . VAL A 1 126 ? 5.230   20.615  8.353   1.00 21.25 ? 126  VAL A CA  1 
ATOM   980  C  C   . VAL A 1 126 ? 4.364   21.850  8.466   1.00 23.81 ? 126  VAL A C   1 
ATOM   981  O  O   . VAL A 1 126 ? 3.853   22.171  9.556   1.00 24.06 ? 126  VAL A O   1 
ATOM   982  C  CB  . VAL A 1 126 ? 4.315   19.548  7.742   1.00 22.10 ? 126  VAL A CB  1 
ATOM   983  C  CG1 . VAL A 1 126 ? 5.099   18.246  7.468   1.00 20.34 ? 126  VAL A CG1 1 
ATOM   984  C  CG2 . VAL A 1 126 ? 3.070   19.279  8.705   1.00 19.90 ? 126  VAL A CG2 1 
ATOM   985  N  N   . LYS A 1 127 ? 4.185   22.531  7.329   1.00 23.68 ? 127  LYS A N   1 
ATOM   986  C  CA  . LYS A 1 127 ? 3.330   23.711  7.311   1.00 25.98 ? 127  LYS A CA  1 
ATOM   987  C  C   . LYS A 1 127 ? 2.095   23.291  6.516   1.00 26.39 ? 127  LYS A C   1 
ATOM   988  O  O   . LYS A 1 127 ? 2.194   22.857  5.349   1.00 25.20 ? 127  LYS A O   1 
ATOM   989  C  CB  . LYS A 1 127 ? 4.011   24.916  6.658   1.00 26.27 ? 127  LYS A CB  1 
ATOM   990  C  CG  . LYS A 1 127 ? 3.072   26.136  6.613   1.00 28.15 ? 127  LYS A CG  1 
ATOM   991  C  CD  . LYS A 1 127 ? 3.752   27.429  6.125   1.00 28.05 ? 127  LYS A CD  1 
ATOM   992  C  CE  . LYS A 1 127 ? 3.938   27.404  4.624   1.00 31.94 ? 127  LYS A CE  1 
ATOM   993  N  NZ  . LYS A 1 127 ? 4.181   28.798  4.060   1.00 33.82 ? 127  LYS A NZ  1 
ATOM   994  N  N   . LEU A 1 128 ? 0.964   23.382  7.208   1.00 27.64 ? 128  LEU A N   1 
ATOM   995  C  CA  . LEU A 1 128 ? -0.354  23.008  6.719   1.00 30.57 ? 128  LEU A CA  1 
ATOM   996  C  C   . LEU A 1 128 ? -1.073  23.986  5.792   1.00 32.09 ? 128  LEU A C   1 
ATOM   997  O  O   . LEU A 1 128 ? -0.734  25.152  5.762   1.00 30.97 ? 128  LEU A O   1 
ATOM   998  C  CB  . LEU A 1 128 ? -1.255  22.700  7.912   1.00 30.26 ? 128  LEU A CB  1 
ATOM   999  C  CG  . LEU A 1 128 ? -1.207  21.252  8.403   1.00 31.11 ? 128  LEU A CG  1 
ATOM   1000 C  CD1 . LEU A 1 128 ? 0.242   20.887  8.644   1.00 31.10 ? 128  LEU A CD1 1 
ATOM   1001 C  CD2 . LEU A 1 128 ? -2.142  21.052  9.661   1.00 29.03 ? 128  LEU A CD2 1 
ATOM   1002 N  N   . ALA A 1 129 ? -2.084  23.491  5.047   1.00 35.48 ? 129  ALA A N   1 
ATOM   1003 C  CA  . ALA A 1 129 ? -2.820  24.370  4.118   1.00 36.86 ? 129  ALA A CA  1 
ATOM   1004 C  C   . ALA A 1 129 ? -3.251  25.636  4.844   1.00 37.40 ? 129  ALA A C   1 
ATOM   1005 O  O   . ALA A 1 129 ? -3.063  26.740  4.325   1.00 38.02 ? 129  ALA A O   1 
ATOM   1006 C  CB  . ALA A 1 129 ? -4.028  23.645  3.510   1.00 37.33 ? 129  ALA A CB  1 
ATOM   1007 N  N   . ASP A 1 130 ? -3.792  25.503  6.062   1.00 38.29 ? 130  ASP A N   1 
ATOM   1008 C  CA  . ASP A 1 130 ? -4.175  26.731  6.797   1.00 38.07 ? 130  ASP A CA  1 
ATOM   1009 C  C   . ASP A 1 130 ? -3.033  27.642  7.244   1.00 36.50 ? 130  ASP A C   1 
ATOM   1010 O  O   . ASP A 1 130 ? -3.310  28.708  7.801   1.00 36.63 ? 130  ASP A O   1 
ATOM   1011 C  CB  . ASP A 1 130 ? -5.020  26.490  8.059   1.00 42.22 ? 130  ASP A CB  1 
ATOM   1012 C  CG  . ASP A 1 130 ? -5.338  25.032  8.320   1.00 45.42 ? 130  ASP A CG  1 
ATOM   1013 O  OD1 . ASP A 1 130 ? -6.044  24.446  7.481   1.00 47.84 ? 130  ASP A OD1 1 
ATOM   1014 O  OD2 . ASP A 1 130 ? -4.913  24.484  9.374   1.00 46.74 ? 130  ASP A OD2 1 
ATOM   1015 N  N   . GLY A 1 131 ? -1.767  27.241  7.088   1.00 33.80 ? 131  GLY A N   1 
ATOM   1016 C  CA  . GLY A 1 131 ? -0.687  28.150  7.472   1.00 31.24 ? 131  GLY A CA  1 
ATOM   1017 C  C   . GLY A 1 131 ? -0.092  27.868  8.842   1.00 29.66 ? 131  GLY A C   1 
ATOM   1018 O  O   . GLY A 1 131 ? 0.923   28.470  9.261   1.00 28.42 ? 131  GLY A O   1 
ATOM   1019 N  N   . SER A 1 132 ? -0.724  26.937  9.543   1.00 29.37 ? 132  SER A N   1 
ATOM   1020 C  CA  . SER A 1 132 ? -0.233  26.577  10.875  1.00 28.49 ? 132  SER A CA  1 
ATOM   1021 C  C   . SER A 1 132 ? 0.765   25.398  10.849  1.00 28.32 ? 132  SER A C   1 
ATOM   1022 O  O   . SER A 1 132 ? 0.663   24.476  9.990   1.00 28.66 ? 132  SER A O   1 
ATOM   1023 C  CB  . SER A 1 132 ? -1.386  26.217  11.767  1.00 26.68 ? 132  SER A CB  1 
ATOM   1024 O  OG  . SER A 1 132 ? -1.879  24.942  11.451  1.00 26.81 ? 132  SER A OG  1 
ATOM   1025 N  N   . LEU A 1 133 ? 1.728   25.427  11.774  1.00 27.50 ? 133  LEU A N   1 
ATOM   1026 C  CA  . LEU A 1 133 ? 2.706   24.332  11.886  1.00 25.10 ? 133  LEU A CA  1 
ATOM   1027 C  C   . LEU A 1 133 ? 2.107   23.094  12.556  1.00 25.43 ? 133  LEU A C   1 
ATOM   1028 O  O   . LEU A 1 133 ? 1.156   23.183  13.388  1.00 24.63 ? 133  LEU A O   1 
ATOM   1029 C  CB  . LEU A 1 133 ? 3.916   24.790  12.682  1.00 23.12 ? 133  LEU A CB  1 
ATOM   1030 C  CG  . LEU A 1 133 ? 4.916   25.741  12.075  1.00 22.94 ? 133  LEU A CG  1 
ATOM   1031 C  CD1 . LEU A 1 133 ? 5.982   26.074  13.119  1.00 21.31 ? 133  LEU A CD1 1 
ATOM   1032 C  CD2 . LEU A 1 133 ? 5.590   25.126  10.787  1.00 25.13 ? 133  LEU A CD2 1 
ATOM   1033 N  N   . ASP A 1 134 ? 2.600   21.916  12.165  1.00 24.44 ? 134  ASP A N   1 
ATOM   1034 C  CA  . ASP A 1 134 ? 2.188   20.696  12.841  1.00 23.20 ? 134  ASP A CA  1 
ATOM   1035 C  C   . ASP A 1 134 ? 3.316   19.659  12.740  1.00 22.69 ? 134  ASP A C   1 
ATOM   1036 O  O   . ASP A 1 134 ? 4.265   19.880  12.011  1.00 24.09 ? 134  ASP A O   1 
ATOM   1037 C  CB  . ASP A 1 134 ? 0.914   20.158  12.256  1.00 25.01 ? 134  ASP A CB  1 
ATOM   1038 C  CG  . ASP A 1 134 ? 0.217   19.217  13.202  1.00 25.77 ? 134  ASP A CG  1 
ATOM   1039 O  OD1 . ASP A 1 134 ? 0.540   19.227  14.399  1.00 27.34 ? 134  ASP A OD1 1 
ATOM   1040 O  OD2 . ASP A 1 134 ? -0.648  18.457  12.772  1.00 29.07 ? 134  ASP A OD2 1 
ATOM   1041 N  N   . ILE A 1 135 ? 3.220   18.561  13.486  1.00 21.10 ? 135  ILE A N   1 
ATOM   1042 C  CA  . ILE A 1 135 ? 4.245   17.504  13.461  1.00 19.22 ? 135  ILE A CA  1 
ATOM   1043 C  C   . ILE A 1 135 ? 3.567   16.234  12.941  1.00 19.53 ? 135  ILE A C   1 
ATOM   1044 O  O   . ILE A 1 135 ? 2.537   15.830  13.466  1.00 20.75 ? 135  ILE A O   1 
ATOM   1045 C  CB  . ILE A 1 135 ? 4.772   17.193  14.890  1.00 17.83 ? 135  ILE A CB  1 
ATOM   1046 C  CG1 . ILE A 1 135 ? 5.430   18.452  15.506  1.00 16.31 ? 135  ILE A CG1 1 
ATOM   1047 C  CG2 . ILE A 1 135 ? 5.760   15.956  14.889  1.00 16.25 ? 135  ILE A CG2 1 
ATOM   1048 C  CD1 . ILE A 1 135 ? 5.412   18.276  17.042  1.00 18.40 ? 135  ILE A CD1 1 
ATOM   1049 N  N   . VAL A 1 136 ? 4.124   15.610  11.916  1.00 17.37 ? 136  VAL A N   1 
ATOM   1050 C  CA  . VAL A 1 136 ? 3.486   14.397  11.442  1.00 17.77 ? 136  VAL A CA  1 
ATOM   1051 C  C   . VAL A 1 136 ? 4.531   13.333  11.263  1.00 14.69 ? 136  VAL A C   1 
ATOM   1052 O  O   . VAL A 1 136 ? 5.646   13.625  10.960  1.00 14.48 ? 136  VAL A O   1 
ATOM   1053 C  CB  . VAL A 1 136 ? 2.705   14.593  10.047  1.00 18.09 ? 136  VAL A CB  1 
ATOM   1054 C  CG1 . VAL A 1 136 ? 1.580   15.643  10.173  1.00 19.34 ? 136  VAL A CG1 1 
ATOM   1055 C  CG2 . VAL A 1 136 ? 3.635   15.018  8.985   1.00 17.39 ? 136  VAL A CG2 1 
ATOM   1056 N  N   . ASN A 1 137 ? 4.141   12.090  11.489  1.00 15.92 ? 137  ASN A N   1 
ATOM   1057 C  CA  . ASN A 1 137 ? 5.024   10.943  11.307  1.00 17.15 ? 137  ASN A CA  1 
ATOM   1058 C  C   . ASN A 1 137 ? 4.665   10.246  9.982   1.00 18.45 ? 137  ASN A C   1 
ATOM   1059 O  O   . ASN A 1 137 ? 3.482   10.128  9.660   1.00 16.79 ? 137  ASN A O   1 
ATOM   1060 C  CB  . ASN A 1 137 ? 4.783   9.922   12.453  1.00 18.06 ? 137  ASN A CB  1 
ATOM   1061 C  CG  . ASN A 1 137 ? 5.464   10.352  13.784  1.00 17.06 ? 137  ASN A CG  1 
ATOM   1062 O  OD1 . ASN A 1 137 ? 6.173   11.353  13.834  1.00 18.01 ? 137  ASN A OD1 1 
ATOM   1063 N  ND2 . ASN A 1 137 ? 5.262   9.587   14.825  1.00 16.13 ? 137  ASN A ND2 1 
ATOM   1064 N  N   . THR A 1 138 ? 5.668   9.821   9.214   1.00 18.92 ? 138  THR A N   1 
ATOM   1065 C  CA  . THR A 1 138 ? 5.395   9.002   8.029   1.00 21.01 ? 138  THR A CA  1 
ATOM   1066 C  C   . THR A 1 138 ? 6.239   7.720   8.205   1.00 22.23 ? 138  THR A C   1 
ATOM   1067 O  O   . THR A 1 138 ? 7.328   7.788   8.850   1.00 20.89 ? 138  THR A O   1 
ATOM   1068 C  CB  . THR A 1 138 ? 5.853   9.659   6.733   1.00 21.61 ? 138  THR A CB  1 
ATOM   1069 O  OG1 . THR A 1 138 ? 7.255   9.927   6.828   1.00 22.04 ? 138  THR A OG1 1 
ATOM   1070 C  CG2 . THR A 1 138 ? 5.078   10.987  6.468   1.00 21.90 ? 138  THR A CG2 1 
ATOM   1071 N  N   . SER A 1 139 ? 5.735   6.586   7.672   1.00 21.64 ? 139  SER A N   1 
ATOM   1072 C  CA  . SER A 1 139 ? 6.419   5.293   7.660   1.00 23.81 ? 139  SER A CA  1 
ATOM   1073 C  C   . SER A 1 139 ? 7.174   5.019   6.382   1.00 23.18 ? 139  SER A C   1 
ATOM   1074 O  O   . SER A 1 139 ? 6.709   5.375   5.305   1.00 24.16 ? 139  SER A O   1 
ATOM   1075 C  CB  . SER A 1 139 ? 5.469   4.111   7.813   1.00 25.15 ? 139  SER A CB  1 
ATOM   1076 O  OG  . SER A 1 139 ? 4.715   4.386   8.963   1.00 32.98 ? 139  SER A OG  1 
ATOM   1077 N  N   . ASN A 1 140 ? 8.305   4.324   6.541   1.00 20.50 ? 140  ASN A N   1 
ATOM   1078 C  CA  . ASN A 1 140 ? 9.183   3.889   5.472   1.00 20.14 ? 140  ASN A CA  1 
ATOM   1079 C  C   . ASN A 1 140 ? 9.596   4.998   4.508   1.00 19.74 ? 140  ASN A C   1 
ATOM   1080 O  O   . ASN A 1 140 ? 10.394  5.844   4.888   1.00 20.42 ? 140  ASN A O   1 
ATOM   1081 C  CB  . ASN A 1 140 ? 8.493   2.716   4.762   1.00 19.40 ? 140  ASN A CB  1 
ATOM   1082 C  CG  . ASN A 1 140 ? 8.417   1.470   5.632   1.00 21.26 ? 140  ASN A CG  1 
ATOM   1083 O  OD1 . ASN A 1 140 ? 7.722   0.514   5.289   1.00 22.27 ? 140  ASN A OD1 1 
ATOM   1084 N  ND2 . ASN A 1 140 ? 9.157   1.452   6.757   1.00 18.59 ? 140  ASN A ND2 1 
ATOM   1085 N  N   . ALA A 1 141 ? 9.103   5.014   3.260   1.00 18.62 ? 141  ALA A N   1 
ATOM   1086 C  CA  . ALA A 1 141 ? 9.479   6.150   2.379   1.00 18.30 ? 141  ALA A CA  1 
ATOM   1087 C  C   . ALA A 1 141 ? 8.396   7.264   2.254   1.00 17.38 ? 141  ALA A C   1 
ATOM   1088 O  O   . ALA A 1 141 ? 8.618   8.278   1.597   1.00 17.77 ? 141  ALA A O   1 
ATOM   1089 C  CB  . ALA A 1 141 ? 9.842   5.673   0.964   1.00 19.75 ? 141  ALA A CB  1 
ATOM   1090 N  N   . ALA A 1 142 ? 7.242   7.075   2.866   1.00 17.47 ? 142  ALA A N   1 
ATOM   1091 C  CA  . ALA A 1 142 ? 6.202   8.073   2.761   1.00 17.62 ? 142  ALA A CA  1 
ATOM   1092 C  C   . ALA A 1 142 ? 6.735   9.427   3.156   1.00 19.80 ? 142  ALA A C   1 
ATOM   1093 O  O   . ALA A 1 142 ? 7.594   9.557   4.019   1.00 19.25 ? 142  ALA A O   1 
ATOM   1094 C  CB  . ALA A 1 142 ? 5.015   7.667   3.600   1.00 18.74 ? 142  ALA A CB  1 
ATOM   1095 N  N   . THR A 1 143 ? 6.238   10.466  2.500   1.00 21.74 ? 143  THR A N   1 
ATOM   1096 C  CA  . THR A 1 143 ? 6.713   11.806  2.727   1.00 22.90 ? 143  THR A CA  1 
ATOM   1097 C  C   . THR A 1 143 ? 5.574   12.811  2.522   1.00 24.58 ? 143  THR A C   1 
ATOM   1098 O  O   . THR A 1 143 ? 4.655   12.548  1.758   1.00 26.17 ? 143  THR A O   1 
ATOM   1099 C  CB  . THR A 1 143 ? 7.826   12.065  1.731   1.00 22.92 ? 143  THR A CB  1 
ATOM   1100 O  OG1 . THR A 1 143 ? 8.146   13.452  1.672   1.00 20.45 ? 143  THR A OG1 1 
ATOM   1101 C  CG2 . THR A 1 143 ? 7.415   11.588  0.355   1.00 22.79 ? 143  THR A CG2 1 
ATOM   1102 N  N   . PRO A 1 144 ? 5.617   13.954  3.216   1.00 25.30 ? 144  PRO A N   1 
ATOM   1103 C  CA  . PRO A 1 144 ? 4.538   14.945  3.032   1.00 25.55 ? 144  PRO A CA  1 
ATOM   1104 C  C   . PRO A 1 144 ? 4.646   15.602  1.646   1.00 26.65 ? 144  PRO A C   1 
ATOM   1105 O  O   . PRO A 1 144 ? 3.801   16.378  1.249   1.00 27.30 ? 144  PRO A O   1 
ATOM   1106 C  CB  . PRO A 1 144 ? 4.781   15.980  4.152   1.00 25.74 ? 144  PRO A CB  1 
ATOM   1107 C  CG  . PRO A 1 144 ? 5.722   15.216  5.163   1.00 26.54 ? 144  PRO A CG  1 
ATOM   1108 C  CD  . PRO A 1 144 ? 6.566   14.329  4.295   1.00 23.71 ? 144  PRO A CD  1 
ATOM   1109 N  N   . LEU A 1 145 ? 5.729   15.338  0.933   1.00 25.76 ? 145  LEU A N   1 
ATOM   1110 C  CA  . LEU A 1 145 ? 5.863   15.907  -0.384  1.00 26.60 ? 145  LEU A CA  1 
ATOM   1111 C  C   . LEU A 1 145 ? 4.672   15.501  -1.254  1.00 27.98 ? 145  LEU A C   1 
ATOM   1112 O  O   . LEU A 1 145 ? 4.333   16.206  -2.203  1.00 28.92 ? 145  LEU A O   1 
ATOM   1113 C  CB  . LEU A 1 145 ? 7.136   15.419  -1.046  1.00 24.59 ? 145  LEU A CB  1 
ATOM   1114 C  CG  . LEU A 1 145 ? 7.334   15.862  -2.502  1.00 23.80 ? 145  LEU A CG  1 
ATOM   1115 C  CD1 . LEU A 1 145 ? 7.649   17.369  -2.513  1.00 23.45 ? 145  LEU A CD1 1 
ATOM   1116 C  CD2 . LEU A 1 145 ? 8.508   15.076  -3.136  1.00 22.97 ? 145  LEU A CD2 1 
ATOM   1117 N  N   . THR A 1 146 ? 4.059   14.356  -0.965  1.00 28.62 ? 146  THR A N   1 
ATOM   1118 C  CA  . THR A 1 146 ? 2.923   13.960  -1.745  1.00 29.44 ? 146  THR A CA  1 
ATOM   1119 C  C   . THR A 1 146 ? 1.580   14.515  -1.263  1.00 31.20 ? 146  THR A C   1 
ATOM   1120 O  O   . THR A 1 146 ? 0.579   14.290  -1.926  1.00 30.98 ? 146  THR A O   1 
ATOM   1121 C  CB  . THR A 1 146 ? 2.820   12.451  -1.860  1.00 29.22 ? 146  THR A CB  1 
ATOM   1122 O  OG1 . THR A 1 146 ? 2.736   11.882  -0.561  1.00 26.96 ? 146  THR A OG1 1 
ATOM   1123 C  CG2 . THR A 1 146 ? 4.045   11.879  -2.659  1.00 28.61 ? 146  THR A CG2 1 
ATOM   1124 N  N   . ASP A 1 147 ? 1.548   15.229  -0.123  1.00 31.70 ? 147  ASP A N   1 
ATOM   1125 C  CA  . ASP A 1 147 ? 0.306   15.837  0.356   1.00 32.47 ? 147  ASP A CA  1 
ATOM   1126 C  C   . ASP A 1 147 ? 0.136   17.291  -0.075  1.00 32.18 ? 147  ASP A C   1 
ATOM   1127 O  O   . ASP A 1 147 ? 0.781   18.191  0.448   1.00 29.62 ? 147  ASP A O   1 
ATOM   1128 C  CB  . ASP A 1 147 ? 0.199   15.802  1.869   1.00 34.31 ? 147  ASP A CB  1 
ATOM   1129 C  CG  . ASP A 1 147 ? 0.041   14.413  2.396   1.00 35.95 ? 147  ASP A CG  1 
ATOM   1130 O  OD1 . ASP A 1 147 ? -0.496  13.562  1.667   1.00 38.22 ? 147  ASP A OD1 1 
ATOM   1131 O  OD2 . ASP A 1 147 ? 0.466   14.163  3.548   1.00 36.76 ? 147  ASP A OD2 1 
ATOM   1132 N  N   . ASP A 1 148 ? -0.767  17.510  -1.031  1.00 33.47 ? 148  ASP A N   1 
ATOM   1133 C  CA  . ASP A 1 148 ? -1.098  18.868  -1.529  1.00 33.90 ? 148  ASP A CA  1 
ATOM   1134 C  C   . ASP A 1 148 ? -1.347  19.845  -0.392  1.00 31.40 ? 148  ASP A C   1 
ATOM   1135 O  O   . ASP A 1 148 ? -2.029  19.527  0.577   1.00 30.94 ? 148  ASP A O   1 
ATOM   1136 C  CB  . ASP A 1 148 ? -2.395  18.829  -2.394  1.00 38.17 ? 148  ASP A CB  1 
ATOM   1137 C  CG  . ASP A 1 148 ? -2.260  17.931  -3.626  1.00 42.01 ? 148  ASP A CG  1 
ATOM   1138 O  OD1 . ASP A 1 148 ? -1.402  18.264  -4.485  1.00 43.54 ? 148  ASP A OD1 1 
ATOM   1139 O  OD2 . ASP A 1 148 ? -2.992  16.888  -3.719  1.00 44.54 ? 148  ASP A OD2 1 
ATOM   1140 N  N   . GLY A 1 149 ? -0.791  21.031  -0.491  1.00 29.83 ? 149  GLY A N   1 
ATOM   1141 C  CA  . GLY A 1 149 ? -1.038  22.008  0.545   1.00 28.85 ? 149  GLY A CA  1 
ATOM   1142 C  C   . GLY A 1 149 ? -0.303  21.798  1.851   1.00 28.92 ? 149  GLY A C   1 
ATOM   1143 O  O   . GLY A 1 149 ? -0.576  22.512  2.822   1.00 28.64 ? 149  GLY A O   1 
ATOM   1144 N  N   . VAL A 1 150 ? 0.612   20.822  1.904   1.00 27.39 ? 150  VAL A N   1 
ATOM   1145 C  CA  . VAL A 1 150 ? 1.372   20.602  3.140   1.00 25.73 ? 150  VAL A CA  1 
ATOM   1146 C  C   . VAL A 1 150 ? 2.813   20.881  2.827   1.00 26.43 ? 150  VAL A C   1 
ATOM   1147 O  O   . VAL A 1 150 ? 3.366   20.261  1.902   1.00 26.88 ? 150  VAL A O   1 
ATOM   1148 C  CB  . VAL A 1 150 ? 1.273   19.173  3.614   1.00 25.88 ? 150  VAL A CB  1 
ATOM   1149 C  CG1 . VAL A 1 150 ? 2.174   18.954  4.855   1.00 24.08 ? 150  VAL A CG1 1 
ATOM   1150 C  CG2 . VAL A 1 150 ? -0.231  18.844  3.888   1.00 25.58 ? 150  VAL A CG2 1 
ATOM   1151 N  N   . THR A 1 151 ? 3.449   21.802  3.562   1.00 24.41 ? 151  THR A N   1 
ATOM   1152 C  CA  . THR A 1 151 ? 4.850   22.119  3.243   1.00 22.79 ? 151  THR A CA  1 
ATOM   1153 C  C   . THR A 1 151 ? 5.907   21.579  4.236   1.00 23.80 ? 151  THR A C   1 
ATOM   1154 O  O   . THR A 1 151 ? 5.990   22.045  5.375   1.00 22.91 ? 151  THR A O   1 
ATOM   1155 C  CB  . THR A 1 151 ? 5.090   23.674  3.104   1.00 22.13 ? 151  THR A CB  1 
ATOM   1156 O  OG1 . THR A 1 151 ? 4.299   24.172  2.037   1.00 21.10 ? 151  THR A OG1 1 
ATOM   1157 C  CG2 . THR A 1 151 ? 6.563   23.983  2.730   1.00 20.80 ? 151  THR A CG2 1 
ATOM   1158 N  N   . PRO A 1 152 ? 6.744   20.629  3.782   1.00 22.71 ? 152  PRO A N   1 
ATOM   1159 C  CA  . PRO A 1 152 ? 7.746   20.115  4.711   1.00 23.47 ? 152  PRO A CA  1 
ATOM   1160 C  C   . PRO A 1 152 ? 8.694   21.206  5.107   1.00 21.36 ? 152  PRO A C   1 
ATOM   1161 O  O   . PRO A 1 152 ? 9.182   21.968  4.260   1.00 21.56 ? 152  PRO A O   1 
ATOM   1162 C  CB  . PRO A 1 152 ? 8.437   18.982  3.935   1.00 24.31 ? 152  PRO A CB  1 
ATOM   1163 C  CG  . PRO A 1 152 ? 7.754   18.957  2.551   1.00 26.27 ? 152  PRO A CG  1 
ATOM   1164 C  CD  . PRO A 1 152 ? 6.478   19.685  2.686   1.00 24.33 ? 152  PRO A CD  1 
ATOM   1165 N  N   . ILE A 1 153 ? 8.959   21.318  6.396   1.00 19.13 ? 153  ILE A N   1 
ATOM   1166 C  CA  . ILE A 1 153 ? 9.896   22.339  6.784   1.00 18.28 ? 153  ILE A CA  1 
ATOM   1167 C  C   . ILE A 1 153 ? 11.193  21.768  7.404   1.00 17.93 ? 153  ILE A C   1 
ATOM   1168 O  O   . ILE A 1 153 ? 12.253  22.363  7.256   1.00 18.15 ? 153  ILE A O   1 
ATOM   1169 C  CB  . ILE A 1 153 ? 9.169   23.468  7.663   1.00 21.42 ? 153  ILE A CB  1 
ATOM   1170 C  CG1 . ILE A 1 153 ? 9.834   23.581  8.972   1.00 20.24 ? 153  ILE A CG1 1 
ATOM   1171 C  CG2 . ILE A 1 153 ? 7.614   23.335  7.690   1.00 20.37 ? 153  ILE A CG2 1 
ATOM   1172 C  CD1 . ILE A 1 153 ? 10.500  24.798  9.018   1.00 25.89 ? 153  ILE A CD1 1 
ATOM   1173 N  N   . LEU A 1 154 ? 11.104  20.638  8.107   1.00 16.72 ? 154  LEU A N   1 
ATOM   1174 C  CA  . LEU A 1 154 ? 12.291  19.946  8.679   1.00 16.47 ? 154  LEU A CA  1 
ATOM   1175 C  C   . LEU A 1 154 ? 11.933  18.467  8.844   1.00 16.69 ? 154  LEU A C   1 
ATOM   1176 O  O   . LEU A 1 154 ? 10.739  18.124  8.995   1.00 15.66 ? 154  LEU A O   1 
ATOM   1177 C  CB  . LEU A 1 154 ? 12.608  20.450  10.076  1.00 17.75 ? 154  LEU A CB  1 
ATOM   1178 C  CG  . LEU A 1 154 ? 13.708  21.418  10.487  1.00 18.49 ? 154  LEU A CG  1 
ATOM   1179 C  CD1 . LEU A 1 154 ? 14.260  22.136  9.361   1.00 18.47 ? 154  LEU A CD1 1 
ATOM   1180 C  CD2 . LEU A 1 154 ? 13.206  22.221  11.706  1.00 17.09 ? 154  LEU A CD2 1 
ATOM   1181 N  N   . THR A 1 155 ? 12.942  17.592  8.836   1.00 16.25 ? 155  THR A N   1 
ATOM   1182 C  CA  . THR A 1 155 ? 12.694  16.200  9.035   1.00 15.63 ? 155  THR A CA  1 
ATOM   1183 C  C   . THR A 1 155 ? 13.809  15.547  9.870   1.00 16.91 ? 155  THR A C   1 
ATOM   1184 O  O   . THR A 1 155 ? 14.982  15.987  9.842   1.00 15.56 ? 155  THR A O   1 
ATOM   1185 C  CB  . THR A 1 155 ? 12.576  15.428  7.696   1.00 14.40 ? 155  THR A CB  1 
ATOM   1186 O  OG1 . THR A 1 155 ? 11.846  14.220  7.955   1.00 17.01 ? 155  THR A OG1 1 
ATOM   1187 C  CG2 . THR A 1 155 ? 13.965  14.991  7.134   1.00 12.63 ? 155  THR A CG2 1 
ATOM   1188 N  N   . VAL A 1 156 ? 13.429  14.518  10.635  1.00 16.78 ? 156  VAL A N   1 
ATOM   1189 C  CA  . VAL A 1 156 ? 14.430  13.753  11.332  1.00 17.43 ? 156  VAL A CA  1 
ATOM   1190 C  C   . VAL A 1 156 ? 14.250  12.296  10.863  1.00 15.34 ? 156  VAL A C   1 
ATOM   1191 O  O   . VAL A 1 156 ? 13.148  11.685  10.932  1.00 15.87 ? 156  VAL A O   1 
ATOM   1192 C  CB  . VAL A 1 156 ? 14.351  13.873  12.914  1.00 19.23 ? 156  VAL A CB  1 
ATOM   1193 C  CG1 . VAL A 1 156 ? 13.048  13.278  13.462  1.00 22.34 ? 156  VAL A CG1 1 
ATOM   1194 C  CG2 . VAL A 1 156 ? 15.537  13.063  13.547  1.00 18.81 ? 156  VAL A CG2 1 
ATOM   1195 N  N   . ASP A 1 157 ? 15.319  11.752  10.364  1.00 14.83 ? 157  ASP A N   1 
ATOM   1196 C  CA  . ASP A 1 157 ? 15.277  10.357  9.886   1.00 15.80 ? 157  ASP A CA  1 
ATOM   1197 C  C   . ASP A 1 157 ? 15.310  9.451   11.136  1.00 16.06 ? 157  ASP A C   1 
ATOM   1198 O  O   . ASP A 1 157 ? 16.246  9.579   11.974  1.00 14.38 ? 157  ASP A O   1 
ATOM   1199 C  CB  . ASP A 1 157 ? 16.538  10.113  9.016   1.00 15.45 ? 157  ASP A CB  1 
ATOM   1200 C  CG  . ASP A 1 157 ? 16.531  8.759   8.230   1.00 13.79 ? 157  ASP A CG  1 
ATOM   1201 O  OD1 . ASP A 1 157 ? 15.559  7.948   8.302   1.00 12.76 ? 157  ASP A OD1 1 
ATOM   1202 O  OD2 . ASP A 1 157 ? 17.527  8.541   7.507   1.00 14.06 ? 157  ASP A OD2 1 
ATOM   1203 N  N   . LEU A 1 158 ? 14.348  8.540   11.252  1.00 15.01 ? 158  LEU A N   1 
ATOM   1204 C  CA  . LEU A 1 158 ? 14.296  7.605   12.352  1.00 14.60 ? 158  LEU A CA  1 
ATOM   1205 C  C   . LEU A 1 158 ? 14.541  6.131   11.930  1.00 14.74 ? 158  LEU A C   1 
ATOM   1206 O  O   . LEU A 1 158 ? 14.396  5.179   12.725  1.00 13.05 ? 158  LEU A O   1 
ATOM   1207 C  CB  . LEU A 1 158 ? 12.987  7.723   13.097  1.00 17.92 ? 158  LEU A CB  1 
ATOM   1208 C  CG  . LEU A 1 158 ? 12.699  8.777   14.149  1.00 20.49 ? 158  LEU A CG  1 
ATOM   1209 C  CD1 . LEU A 1 158 ? 13.950  9.241   14.862  1.00 21.35 ? 158  LEU A CD1 1 
ATOM   1210 C  CD2 . LEU A 1 158 ? 11.890  9.854   13.549  1.00 24.29 ? 158  LEU A CD2 1 
ATOM   1211 N  N   . TRP A 1 159 ? 14.881  5.921   10.660  1.00 14.19 ? 159  TRP A N   1 
ATOM   1212 C  CA  . TRP A 1 159 ? 15.329  4.583   10.253  1.00 14.09 ? 159  TRP A CA  1 
ATOM   1213 C  C   . TRP A 1 159 ? 16.556  4.320   11.197  1.00 14.11 ? 159  TRP A C   1 
ATOM   1214 O  O   . TRP A 1 159 ? 17.347  5.274   11.516  1.00 12.44 ? 159  TRP A O   1 
ATOM   1215 C  CB  . TRP A 1 159 ? 15.839  4.613   8.807   1.00 14.02 ? 159  TRP A CB  1 
ATOM   1216 C  CG  . TRP A 1 159 ? 14.711  4.488   7.819   1.00 15.37 ? 159  TRP A CG  1 
ATOM   1217 C  CD1 . TRP A 1 159 ? 13.706  5.397   7.605   1.00 16.29 ? 159  TRP A CD1 1 
ATOM   1218 C  CD2 . TRP A 1 159 ? 14.563  3.487   6.797   1.00 15.91 ? 159  TRP A CD2 1 
ATOM   1219 N  NE1 . TRP A 1 159 ? 12.959  5.035   6.489   1.00 14.82 ? 159  TRP A NE1 1 
ATOM   1220 C  CE2 . TRP A 1 159 ? 13.462  3.871   5.984   1.00 15.29 ? 159  TRP A CE2 1 
ATOM   1221 C  CE3 . TRP A 1 159 ? 15.257  2.326   6.478   1.00 14.33 ? 159  TRP A CE3 1 
ATOM   1222 C  CZ2 . TRP A 1 159 ? 13.061  3.131   4.890   1.00 15.88 ? 159  TRP A CZ2 1 
ATOM   1223 C  CZ3 . TRP A 1 159 ? 14.858  1.577   5.381   1.00 15.96 ? 159  TRP A CZ3 1 
ATOM   1224 C  CH2 . TRP A 1 159 ? 13.762  1.991   4.599   1.00 15.59 ? 159  TRP A CH2 1 
ATOM   1225 N  N   . GLU A 1 160 ? 16.721  3.078   11.664  1.00 15.41 ? 160  GLU A N   1 
ATOM   1226 C  CA  . GLU A 1 160 ? 17.835  2.793   12.591  1.00 14.53 ? 160  GLU A CA  1 
ATOM   1227 C  C   . GLU A 1 160 ? 19.261  3.060   12.014  1.00 15.39 ? 160  GLU A C   1 
ATOM   1228 O  O   . GLU A 1 160 ? 20.166  3.327   12.800  1.00 15.88 ? 160  GLU A O   1 
ATOM   1229 C  CB  . GLU A 1 160 ? 17.731  1.360   13.108  1.00 16.22 ? 160  GLU A CB  1 
ATOM   1230 C  CG  . GLU A 1 160 ? 16.408  1.090   13.847  1.00 16.19 ? 160  GLU A CG  1 
ATOM   1231 C  CD  . GLU A 1 160 ? 16.345  -0.352  14.335  1.00 16.60 ? 160  GLU A CD  1 
ATOM   1232 O  OE1 . GLU A 1 160 ? 16.563  -1.265  13.499  1.00 14.94 ? 160  GLU A OE1 1 
ATOM   1233 O  OE2 . GLU A 1 160 ? 16.071  -0.558  15.538  1.00 14.63 ? 160  GLU A OE2 1 
ATOM   1234 N  N   . HIS A 1 161 ? 19.472  2.997   10.679  1.00 15.18 ? 161  HIS A N   1 
ATOM   1235 C  CA  . HIS A 1 161 ? 20.804  3.320   10.153  1.00 15.34 ? 161  HIS A CA  1 
ATOM   1236 C  C   . HIS A 1 161 ? 21.147  4.748   10.415  1.00 14.86 ? 161  HIS A C   1 
ATOM   1237 O  O   . HIS A 1 161 ? 22.307  5.096   10.415  1.00 14.18 ? 161  HIS A O   1 
ATOM   1238 C  CB  . HIS A 1 161 ? 20.968  3.064   8.635   1.00 17.06 ? 161  HIS A CB  1 
ATOM   1239 C  CG  . HIS A 1 161 ? 20.013  3.837   7.765   1.00 18.26 ? 161  HIS A CG  1 
ATOM   1240 N  ND1 . HIS A 1 161 ? 19.075  3.212   6.973   1.00 19.93 ? 161  HIS A ND1 1 
ATOM   1241 C  CD2 . HIS A 1 161 ? 19.851  5.176   7.560   1.00 18.55 ? 161  HIS A CD2 1 
ATOM   1242 C  CE1 . HIS A 1 161 ? 18.366  4.121   6.321   1.00 17.09 ? 161  HIS A CE1 1 
ATOM   1243 N  NE2 . HIS A 1 161 ? 18.817  5.317   6.662   1.00 18.29 ? 161  HIS A NE2 1 
ATOM   1244 N  N   . ALA A 1 162 ? 20.151  5.592   10.681  1.00 13.66 ? 162  ALA A N   1 
ATOM   1245 C  CA  . ALA A 1 162 ? 20.494  7.000   10.941  1.00 12.46 ? 162  ALA A CA  1 
ATOM   1246 C  C   . ALA A 1 162 ? 21.259  7.251   12.286  1.00 12.86 ? 162  ALA A C   1 
ATOM   1247 O  O   . ALA A 1 162 ? 22.016  8.244   12.429  1.00 11.87 ? 162  ALA A O   1 
ATOM   1248 C  CB  . ALA A 1 162 ? 19.257  7.829   10.905  1.00 11.88 ? 162  ALA A CB  1 
ATOM   1249 N  N   . TYR A 1 163 ? 21.097  6.352   13.250  1.00 12.05 ? 163  TYR A N   1 
ATOM   1250 C  CA  . TYR A 1 163 ? 21.717  6.572   14.534  1.00 13.02 ? 163  TYR A CA  1 
ATOM   1251 C  C   . TYR A 1 163 ? 22.329  5.357   15.168  1.00 13.62 ? 163  TYR A C   1 
ATOM   1252 O  O   . TYR A 1 163 ? 23.033  5.465   16.178  1.00 13.63 ? 163  TYR A O   1 
ATOM   1253 C  CB  . TYR A 1 163 ? 20.655  7.151   15.469  1.00 10.52 ? 163  TYR A CB  1 
ATOM   1254 C  CG  . TYR A 1 163 ? 19.417  6.231   15.595  1.00 12.38 ? 163  TYR A CG  1 
ATOM   1255 C  CD1 . TYR A 1 163 ? 19.422  5.125   16.450  1.00 11.01 ? 163  TYR A CD1 1 
ATOM   1256 C  CD2 . TYR A 1 163 ? 18.229  6.480   14.860  1.00 12.57 ? 163  TYR A CD2 1 
ATOM   1257 C  CE1 . TYR A 1 163 ? 18.274  4.282   16.612  1.00 14.34 ? 163  TYR A CE1 1 
ATOM   1258 C  CE2 . TYR A 1 163 ? 17.087  5.647   15.020  1.00 11.75 ? 163  TYR A CE2 1 
ATOM   1259 C  CZ  . TYR A 1 163 ? 17.092  4.571   15.883  1.00 14.24 ? 163  TYR A CZ  1 
ATOM   1260 O  OH  . TYR A 1 163 ? 15.929  3.807   16.135  1.00 14.21 ? 163  TYR A OH  1 
ATOM   1261 N  N   . TYR A 1 164 ? 22.050  4.179   14.620  1.00 12.44 ? 164  TYR A N   1 
ATOM   1262 C  CA  . TYR A 1 164 ? 22.580  2.978   15.318  1.00 13.87 ? 164  TYR A CA  1 
ATOM   1263 C  C   . TYR A 1 164 ? 24.086  2.979   15.627  1.00 14.55 ? 164  TYR A C   1 
ATOM   1264 O  O   . TYR A 1 164 ? 24.500  2.507   16.687  1.00 17.06 ? 164  TYR A O   1 
ATOM   1265 C  CB  . TYR A 1 164 ? 22.236  1.679   14.533  1.00 11.33 ? 164  TYR A CB  1 
ATOM   1266 C  CG  . TYR A 1 164 ? 21.770  0.557   15.478  1.00 13.60 ? 164  TYR A CG  1 
ATOM   1267 C  CD1 . TYR A 1 164 ? 20.553  0.664   16.173  1.00 11.45 ? 164  TYR A CD1 1 
ATOM   1268 C  CD2 . TYR A 1 164 ? 22.617  -0.534  15.797  1.00 13.04 ? 164  TYR A CD2 1 
ATOM   1269 C  CE1 . TYR A 1 164 ? 20.192  -0.252  17.158  1.00 10.82 ? 164  TYR A CE1 1 
ATOM   1270 C  CE2 . TYR A 1 164 ? 22.263  -1.437  16.777  1.00 12.15 ? 164  TYR A CE2 1 
ATOM   1271 C  CZ  . TYR A 1 164 ? 21.042  -1.274  17.442  1.00 12.22 ? 164  TYR A CZ  1 
ATOM   1272 O  OH  . TYR A 1 164 ? 20.678  -2.203  18.387  1.00 12.35 ? 164  TYR A OH  1 
ATOM   1273 N  N   . ILE A 1 165 ? 24.908  3.452   14.685  1.00 15.46 ? 165  ILE A N   1 
ATOM   1274 C  CA  . ILE A 1 165 ? 26.356  3.445   14.892  1.00 15.52 ? 165  ILE A CA  1 
ATOM   1275 C  C   . ILE A 1 165 ? 26.756  4.296   16.086  1.00 15.82 ? 165  ILE A C   1 
ATOM   1276 O  O   . ILE A 1 165 ? 27.646  3.900   16.839  1.00 17.53 ? 165  ILE A O   1 
ATOM   1277 C  CB  . ILE A 1 165 ? 27.129  4.003   13.602  1.00 15.70 ? 165  ILE A CB  1 
ATOM   1278 C  CG1 . ILE A 1 165 ? 26.937  3.039   12.452  1.00 12.50 ? 165  ILE A CG1 1 
ATOM   1279 C  CG2 . ILE A 1 165 ? 28.659  4.217   13.885  1.00 14.68 ? 165  ILE A CG2 1 
ATOM   1280 C  CD1 . ILE A 1 165 ? 27.240  3.568   11.146  1.00 12.67 ? 165  ILE A CD1 1 
ATOM   1281 N  N   . ASP A 1 166 ? 26.081  5.446   16.248  1.00 15.98 ? 166  ASP A N   1 
ATOM   1282 C  CA  . ASP A 1 166 ? 26.371  6.417   17.279  1.00 16.79 ? 166  ASP A CA  1 
ATOM   1283 C  C   . ASP A 1 166 ? 25.588  6.250   18.552  1.00 17.55 ? 166  ASP A C   1 
ATOM   1284 O  O   . ASP A 1 166 ? 26.104  6.564   19.585  1.00 18.05 ? 166  ASP A O   1 
ATOM   1285 C  CB  . ASP A 1 166 ? 26.140  7.835   16.770  1.00 17.06 ? 166  ASP A CB  1 
ATOM   1286 C  CG  . ASP A 1 166 ? 26.949  8.138   15.507  1.00 18.58 ? 166  ASP A CG  1 
ATOM   1287 O  OD1 . ASP A 1 166 ? 28.099  7.602   15.417  1.00 18.69 ? 166  ASP A OD1 1 
ATOM   1288 O  OD2 . ASP A 1 166 ? 26.485  8.906   14.612  1.00 18.21 ? 166  ASP A OD2 1 
ATOM   1289 N  N   . TYR A 1 167 ? 24.378  5.705   18.491  1.00 17.04 ? 167  TYR A N   1 
ATOM   1290 C  CA  . TYR A 1 167 ? 23.567  5.626   19.680  1.00 16.60 ? 167  TYR A CA  1 
ATOM   1291 C  C   . TYR A 1 167 ? 22.883  4.284   19.912  1.00 15.62 ? 167  TYR A C   1 
ATOM   1292 O  O   . TYR A 1 167 ? 22.091  4.164   20.839  1.00 14.51 ? 167  TYR A O   1 
ATOM   1293 C  CB  . TYR A 1 167 ? 22.495  6.712   19.566  1.00 17.62 ? 167  TYR A CB  1 
ATOM   1294 C  CG  . TYR A 1 167 ? 23.082  8.109   19.441  1.00 17.94 ? 167  TYR A CG  1 
ATOM   1295 C  CD1 . TYR A 1 167 ? 23.700  8.727   20.547  1.00 16.87 ? 167  TYR A CD1 1 
ATOM   1296 C  CD2 . TYR A 1 167 ? 23.032  8.813   18.220  1.00 17.28 ? 167  TYR A CD2 1 
ATOM   1297 C  CE1 . TYR A 1 167 ? 24.218  9.979   20.450  1.00 15.77 ? 167  TYR A CE1 1 
ATOM   1298 C  CE2 . TYR A 1 167 ? 23.593  10.108  18.113  1.00 15.78 ? 167  TYR A CE2 1 
ATOM   1299 C  CZ  . TYR A 1 167 ? 24.171  10.671  19.248  1.00 17.03 ? 167  TYR A CZ  1 
ATOM   1300 O  OH  . TYR A 1 167 ? 24.722  11.944  19.172  1.00 15.76 ? 167  TYR A OH  1 
ATOM   1301 N  N   . ARG A 1 168 ? 23.145  3.328   19.043  1.00 13.74 ? 168  ARG A N   1 
ATOM   1302 C  CA  . ARG A 1 168 ? 22.530  2.025   19.121  1.00 15.40 ? 168  ARG A CA  1 
ATOM   1303 C  C   . ARG A 1 168 ? 20.985  2.155   19.246  1.00 16.42 ? 168  ARG A C   1 
ATOM   1304 O  O   . ARG A 1 168 ? 20.328  2.868   18.423  1.00 15.91 ? 168  ARG A O   1 
ATOM   1305 C  CB  . ARG A 1 168 ? 23.168  1.219   20.308  1.00 14.87 ? 168  ARG A CB  1 
ATOM   1306 C  CG  . ARG A 1 168 ? 24.716  0.936   20.110  1.00 14.46 ? 168  ARG A CG  1 
ATOM   1307 C  CD  . ARG A 1 168 ? 24.951  -0.206  19.109  1.00 14.54 ? 168  ARG A CD  1 
ATOM   1308 N  NE  . ARG A 1 168 ? 26.353  -0.660  19.046  1.00 15.08 ? 168  ARG A NE  1 
ATOM   1309 C  CZ  . ARG A 1 168 ? 27.313  -0.055  18.344  1.00 17.22 ? 168  ARG A CZ  1 
ATOM   1310 N  NH1 . ARG A 1 168 ? 27.015  1.048   17.635  1.00 16.58 ? 168  ARG A NH1 1 
ATOM   1311 N  NH2 . ARG A 1 168 ? 28.564  -0.552  18.303  1.00 13.75 ? 168  ARG A NH2 1 
ATOM   1312 N  N   . ASN A 1 169 ? 20.420  1.544   20.285  1.00 14.76 ? 169  ASN A N   1 
ATOM   1313 C  CA  . ASN A 1 169 ? 18.958  1.542   20.472  1.00 17.67 ? 169  ASN A CA  1 
ATOM   1314 C  C   . ASN A 1 169 ? 18.365  2.793   21.111  1.00 18.76 ? 169  ASN A C   1 
ATOM   1315 O  O   . ASN A 1 169 ? 17.114  2.919   21.152  1.00 17.64 ? 169  ASN A O   1 
ATOM   1316 C  CB  . ASN A 1 169 ? 18.534  0.370   21.365  1.00 17.09 ? 169  ASN A CB  1 
ATOM   1317 C  CG  . ASN A 1 169 ? 19.127  0.486   22.769  1.00 16.63 ? 169  ASN A CG  1 
ATOM   1318 O  OD1 . ASN A 1 169 ? 20.323  0.518   22.941  1.00 16.90 ? 169  ASN A OD1 1 
ATOM   1319 N  ND2 . ASN A 1 169 ? 18.293  0.549   23.744  1.00 17.65 ? 169  ASN A ND2 1 
ATOM   1320 N  N   . VAL A 1 170 ? 19.214  3.738   21.540  1.00 17.72 ? 170  VAL A N   1 
ATOM   1321 C  CA  . VAL A 1 170 ? 18.681  4.882   22.274  1.00 17.58 ? 170  VAL A CA  1 
ATOM   1322 C  C   . VAL A 1 170 ? 18.300  6.127   21.433  1.00 18.74 ? 170  VAL A C   1 
ATOM   1323 O  O   . VAL A 1 170 ? 19.089  7.091   21.248  1.00 16.11 ? 170  VAL A O   1 
ATOM   1324 C  CB  . VAL A 1 170 ? 19.646  5.175   23.425  1.00 17.16 ? 170  VAL A CB  1 
ATOM   1325 C  CG1 . VAL A 1 170 ? 20.879  5.730   22.835  1.00 21.53 ? 170  VAL A CG1 1 
ATOM   1326 C  CG2 . VAL A 1 170 ? 19.061  6.159   24.445  1.00 16.02 ? 170  VAL A CG2 1 
ATOM   1327 N  N   . ARG A 1 171 ? 17.074  6.079   20.887  1.00 17.49 ? 171  ARG A N   1 
ATOM   1328 C  CA  . ARG A 1 171 ? 16.582  7.200   20.099  1.00 18.29 ? 171  ARG A CA  1 
ATOM   1329 C  C   . ARG A 1 171 ? 16.596  8.516   20.879  1.00 16.41 ? 171  ARG A C   1 
ATOM   1330 O  O   . ARG A 1 171 ? 16.816  9.531   20.294  1.00 17.41 ? 171  ARG A O   1 
ATOM   1331 C  CB  . ARG A 1 171 ? 15.161  6.994   19.628  1.00 18.41 ? 171  ARG A CB  1 
ATOM   1332 C  CG  . ARG A 1 171 ? 15.065  6.220   18.384  1.00 17.06 ? 171  ARG A CG  1 
ATOM   1333 C  CD  . ARG A 1 171 ? 13.617  6.243   17.868  1.00 17.29 ? 171  ARG A CD  1 
ATOM   1334 N  NE  . ARG A 1 171 ? 13.515  5.339   16.732  1.00 18.30 ? 171  ARG A NE  1 
ATOM   1335 C  CZ  . ARG A 1 171 ? 12.366  5.004   16.159  1.00 19.70 ? 171  ARG A CZ  1 
ATOM   1336 N  NH1 . ARG A 1 171 ? 11.227  5.493   16.619  1.00 18.65 ? 171  ARG A NH1 1 
ATOM   1337 N  NH2 . ARG A 1 171 ? 12.357  4.242   15.084  1.00 18.86 ? 171  ARG A NH2 1 
ATOM   1338 N  N   . PRO A 1 172 ? 16.337  8.493   22.198  1.00 16.76 ? 172  PRO A N   1 
ATOM   1339 C  CA  . PRO A 1 172 ? 16.369  9.805   22.890  1.00 16.52 ? 172  PRO A CA  1 
ATOM   1340 C  C   . PRO A 1 172 ? 17.725  10.501  22.761  1.00 16.32 ? 172  PRO A C   1 
ATOM   1341 O  O   . PRO A 1 172 ? 17.790  11.717  22.614  1.00 19.60 ? 172  PRO A O   1 
ATOM   1342 C  CB  . PRO A 1 172 ? 16.010  9.459   24.363  1.00 14.92 ? 172  PRO A CB  1 
ATOM   1343 C  CG  . PRO A 1 172 ? 15.063  8.239   24.186  1.00 17.89 ? 172  PRO A CG  1 
ATOM   1344 C  CD  . PRO A 1 172 ? 15.781  7.431   23.072  1.00 15.00 ? 172  PRO A CD  1 
ATOM   1345 N  N   . ASP A 1 173 ? 18.818  9.742   22.795  1.00 16.36 ? 173  ASP A N   1 
ATOM   1346 C  CA  . ASP A 1 173 ? 20.131  10.400  22.677  1.00 16.00 ? 173  ASP A CA  1 
ATOM   1347 C  C   . ASP A 1 173 ? 20.361  10.933  21.286  1.00 14.85 ? 173  ASP A C   1 
ATOM   1348 O  O   . ASP A 1 173 ? 21.018  11.981  21.094  1.00 12.12 ? 173  ASP A O   1 
ATOM   1349 C  CB  . ASP A 1 173 ? 21.267  9.427   22.992  1.00 17.86 ? 173  ASP A CB  1 
ATOM   1350 C  CG  . ASP A 1 173 ? 21.301  8.985   24.478  1.00 19.63 ? 173  ASP A CG  1 
ATOM   1351 O  OD1 . ASP A 1 173 ? 20.670  9.623   25.344  1.00 14.79 ? 173  ASP A OD1 1 
ATOM   1352 O  OD2 . ASP A 1 173 ? 21.962  7.958   24.730  1.00 21.03 ? 173  ASP A OD2 1 
ATOM   1353 N  N   . TYR A 1 174 ? 19.913  10.151  20.299  1.00 12.53 ? 174  TYR A N   1 
ATOM   1354 C  CA  . TYR A 1 174 ? 20.051  10.592  18.915  1.00 12.74 ? 174  TYR A CA  1 
ATOM   1355 C  C   . TYR A 1 174 ? 19.231  11.905  18.822  1.00 12.78 ? 174  TYR A C   1 
ATOM   1356 O  O   . TYR A 1 174 ? 19.683  12.915  18.255  1.00 13.40 ? 174  TYR A O   1 
ATOM   1357 C  CB  . TYR A 1 174 ? 19.464  9.519   17.976  1.00 13.68 ? 174  TYR A CB  1 
ATOM   1358 C  CG  . TYR A 1 174 ? 19.114  10.025  16.585  1.00 11.91 ? 174  TYR A CG  1 
ATOM   1359 C  CD1 . TYR A 1 174 ? 20.101  10.560  15.761  1.00 8.89  ? 174  TYR A CD1 1 
ATOM   1360 C  CD2 . TYR A 1 174 ? 17.800  9.860   16.060  1.00 11.92 ? 174  TYR A CD2 1 
ATOM   1361 C  CE1 . TYR A 1 174 ? 19.814  10.901  14.425  1.00 13.28 ? 174  TYR A CE1 1 
ATOM   1362 C  CE2 . TYR A 1 174 ? 17.486  10.234  14.705  1.00 9.55  ? 174  TYR A CE2 1 
ATOM   1363 C  CZ  . TYR A 1 174 ? 18.506  10.743  13.897  1.00 12.16 ? 174  TYR A CZ  1 
ATOM   1364 O  OH  . TYR A 1 174 ? 18.298  11.113  12.575  1.00 13.33 ? 174  TYR A OH  1 
ATOM   1365 N  N   . LEU A 1 175 ? 18.031  11.897  19.381  1.00 13.01 ? 175  LEU A N   1 
ATOM   1366 C  CA  . LEU A 1 175 ? 17.207  13.107  19.319  1.00 14.86 ? 175  LEU A CA  1 
ATOM   1367 C  C   . LEU A 1 175 ? 17.914  14.288  19.965  1.00 16.18 ? 175  LEU A C   1 
ATOM   1368 O  O   . LEU A 1 175 ? 17.737  15.449  19.550  1.00 15.51 ? 175  LEU A O   1 
ATOM   1369 C  CB  . LEU A 1 175 ? 15.834  12.867  19.981  1.00 14.00 ? 175  LEU A CB  1 
ATOM   1370 C  CG  . LEU A 1 175 ? 14.890  12.037  19.109  1.00 17.00 ? 175  LEU A CG  1 
ATOM   1371 C  CD1 . LEU A 1 175 ? 13.593  11.758  19.906  1.00 16.62 ? 175  LEU A CD1 1 
ATOM   1372 C  CD2 . LEU A 1 175 ? 14.538  12.772  17.838  1.00 16.05 ? 175  LEU A CD2 1 
ATOM   1373 N  N   . LYS A 1 176 ? 18.686  14.033  21.033  1.00 17.35 ? 176  LYS A N   1 
ATOM   1374 C  CA  . LYS A 1 176 ? 19.449  15.150  21.629  1.00 17.58 ? 176  LYS A CA  1 
ATOM   1375 C  C   . LYS A 1 176 ? 20.450  15.617  20.603  1.00 16.49 ? 176  LYS A C   1 
ATOM   1376 O  O   . LYS A 1 176 ? 20.734  16.828  20.504  1.00 16.94 ? 176  LYS A O   1 
ATOM   1377 C  CB  . LYS A 1 176 ? 20.254  14.730  22.888  1.00 19.85 ? 176  LYS A CB  1 
ATOM   1378 C  CG  . LYS A 1 176 ? 19.383  14.531  24.095  1.00 24.42 ? 176  LYS A CG  1 
ATOM   1379 C  CD  . LYS A 1 176 ? 20.155  13.876  25.287  1.00 29.95 ? 176  LYS A CD  1 
ATOM   1380 C  CE  . LYS A 1 176 ? 19.201  13.547  26.485  1.00 32.80 ? 176  LYS A CE  1 
ATOM   1381 N  NZ  . LYS A 1 176 ? 19.905  13.416  27.874  1.00 37.60 ? 176  LYS A NZ  1 
ATOM   1382 N  N   . GLY A 1 177 ? 21.041  14.689  19.864  1.00 14.15 ? 177  GLY A N   1 
ATOM   1383 C  CA  . GLY A 1 177 ? 21.966  15.177  18.876  1.00 15.23 ? 177  GLY A CA  1 
ATOM   1384 C  C   . GLY A 1 177 ? 21.265  16.065  17.811  1.00 15.39 ? 177  GLY A C   1 
ATOM   1385 O  O   . GLY A 1 177 ? 21.777  17.100  17.375  1.00 13.84 ? 177  GLY A O   1 
ATOM   1386 N  N   . PHE A 1 178 ? 20.095  15.631  17.367  1.00 15.14 ? 178  PHE A N   1 
ATOM   1387 C  CA  . PHE A 1 178 ? 19.360  16.388  16.352  1.00 17.86 ? 178  PHE A CA  1 
ATOM   1388 C  C   . PHE A 1 178 ? 19.111  17.829  16.825  1.00 18.19 ? 178  PHE A C   1 
ATOM   1389 O  O   . PHE A 1 178 ? 19.336  18.796  16.061  1.00 20.20 ? 178  PHE A O   1 
ATOM   1390 C  CB  . PHE A 1 178 ? 18.014  15.727  16.057  1.00 17.65 ? 178  PHE A CB  1 
ATOM   1391 C  CG  . PHE A 1 178 ? 17.090  16.586  15.242  1.00 18.86 ? 178  PHE A CG  1 
ATOM   1392 C  CD1 . PHE A 1 178 ? 17.281  16.709  13.848  1.00 19.71 ? 178  PHE A CD1 1 
ATOM   1393 C  CD2 . PHE A 1 178 ? 16.046  17.288  15.870  1.00 17.16 ? 178  PHE A CD2 1 
ATOM   1394 C  CE1 . PHE A 1 178 ? 16.448  17.528  13.058  1.00 19.41 ? 178  PHE A CE1 1 
ATOM   1395 C  CE2 . PHE A 1 178 ? 15.176  18.144  15.089  1.00 20.10 ? 178  PHE A CE2 1 
ATOM   1396 C  CZ  . PHE A 1 178 ? 15.395  18.251  13.696  1.00 19.38 ? 178  PHE A CZ  1 
ATOM   1397 N  N   . TRP A 1 179 ? 18.706  17.992  18.083  1.00 18.27 ? 179  TRP A N   1 
ATOM   1398 C  CA  . TRP A 1 179 ? 18.420  19.345  18.552  1.00 18.86 ? 179  TRP A CA  1 
ATOM   1399 C  C   . TRP A 1 179 ? 19.655  20.219  18.587  1.00 19.92 ? 179  TRP A C   1 
ATOM   1400 O  O   . TRP A 1 179 ? 19.505  21.447  18.568  1.00 18.13 ? 179  TRP A O   1 
ATOM   1401 C  CB  . TRP A 1 179 ? 17.747  19.337  19.915  1.00 18.20 ? 179  TRP A CB  1 
ATOM   1402 C  CG  . TRP A 1 179 ? 16.400  18.790  19.785  1.00 19.58 ? 179  TRP A CG  1 
ATOM   1403 C  CD1 . TRP A 1 179 ? 15.932  17.604  20.307  1.00 18.74 ? 179  TRP A CD1 1 
ATOM   1404 C  CD2 . TRP A 1 179 ? 15.310  19.383  19.085  1.00 17.10 ? 179  TRP A CD2 1 
ATOM   1405 N  NE1 . TRP A 1 179 ? 14.610  17.439  19.961  1.00 19.35 ? 179  TRP A NE1 1 
ATOM   1406 C  CE2 . TRP A 1 179 ? 14.216  18.521  19.212  1.00 18.63 ? 179  TRP A CE2 1 
ATOM   1407 C  CE3 . TRP A 1 179 ? 15.152  20.579  18.361  1.00 19.89 ? 179  TRP A CE3 1 
ATOM   1408 C  CZ2 . TRP A 1 179 ? 12.958  18.803  18.636  1.00 19.46 ? 179  TRP A CZ2 1 
ATOM   1409 C  CZ3 . TRP A 1 179 ? 13.856  20.873  17.781  1.00 16.95 ? 179  TRP A CZ3 1 
ATOM   1410 C  CH2 . TRP A 1 179 ? 12.807  19.976  17.933  1.00 17.54 ? 179  TRP A CH2 1 
ATOM   1411 N  N   . SER A 1 180 ? 20.852  19.609  18.646  1.00 17.13 ? 180  SER A N   1 
ATOM   1412 C  CA  . SER A 1 180 ? 22.091  20.402  18.634  1.00 18.51 ? 180  SER A CA  1 
ATOM   1413 C  C   . SER A 1 180 ? 22.472  20.759  17.209  1.00 17.24 ? 180  SER A C   1 
ATOM   1414 O  O   . SER A 1 180 ? 23.373  21.530  16.982  1.00 15.80 ? 180  SER A O   1 
ATOM   1415 C  CB  . SER A 1 180 ? 23.289  19.605  19.184  1.00 18.71 ? 180  SER A CB  1 
ATOM   1416 O  OG  . SER A 1 180 ? 23.060  19.295  20.537  1.00 21.38 ? 180  SER A OG  1 
ATOM   1417 N  N   . LEU A 1 181 ? 21.818  20.114  16.270  1.00 16.98 ? 181  LEU A N   1 
ATOM   1418 C  CA  . LEU A 1 181 ? 22.099  20.299  14.882  1.00 17.37 ? 181  LEU A CA  1 
ATOM   1419 C  C   . LEU A 1 181 ? 21.021  20.977  14.019  1.00 17.58 ? 181  LEU A C   1 
ATOM   1420 O  O   . LEU A 1 181 ? 21.344  21.424  12.922  1.00 17.77 ? 181  LEU A O   1 
ATOM   1421 C  CB  . LEU A 1 181 ? 22.435  18.933  14.245  1.00 15.82 ? 181  LEU A CB  1 
ATOM   1422 C  CG  . LEU A 1 181 ? 23.703  18.129  14.746  1.00 15.19 ? 181  LEU A CG  1 
ATOM   1423 C  CD1 . LEU A 1 181 ? 23.696  16.757  14.012  1.00 11.20 ? 181  LEU A CD1 1 
ATOM   1424 C  CD2 . LEU A 1 181 ? 25.062  18.848  14.454  1.00 14.77 ? 181  LEU A CD2 1 
ATOM   1425 N  N   . VAL A 1 182 ? 19.784  21.033  14.491  1.00 17.91 ? 182  VAL A N   1 
ATOM   1426 C  CA  . VAL A 1 182 ? 18.638  21.549  13.695  1.00 19.87 ? 182  VAL A CA  1 
ATOM   1427 C  C   . VAL A 1 182 ? 18.987  22.796  12.933  1.00 19.34 ? 182  VAL A C   1 
ATOM   1428 O  O   . VAL A 1 182 ? 19.508  23.736  13.535  1.00 17.64 ? 182  VAL A O   1 
ATOM   1429 C  CB  . VAL A 1 182 ? 17.463  21.975  14.536  1.00 22.10 ? 182  VAL A CB  1 
ATOM   1430 C  CG1 . VAL A 1 182 ? 16.140  21.853  13.729  1.00 19.81 ? 182  VAL A CG1 1 
ATOM   1431 C  CG2 . VAL A 1 182 ? 17.477  21.251  15.807  1.00 25.18 ? 182  VAL A CG2 1 
ATOM   1432 N  N   . ASN A 1 183 ? 18.645  22.798  11.636  1.00 19.17 ? 183  ASN A N   1 
ATOM   1433 C  CA  . ASN A 1 183 ? 18.961  23.903  10.737  1.00 18.80 ? 183  ASN A CA  1 
ATOM   1434 C  C   . ASN A 1 183 ? 17.747  24.850  10.623  1.00 20.13 ? 183  ASN A C   1 
ATOM   1435 O  O   . ASN A 1 183 ? 16.841  24.655  9.759   1.00 17.99 ? 183  ASN A O   1 
ATOM   1436 C  CB  . ASN A 1 183 ? 19.353  23.365  9.343   1.00 18.20 ? 183  ASN A CB  1 
ATOM   1437 C  CG  . ASN A 1 183 ? 19.905  24.484  8.446   1.00 19.53 ? 183  ASN A CG  1 
ATOM   1438 O  OD1 . ASN A 1 183 ? 19.887  25.653  8.858   1.00 18.86 ? 183  ASN A OD1 1 
ATOM   1439 N  ND2 . ASN A 1 183 ? 20.394  24.144  7.250   1.00 18.67 ? 183  ASN A ND2 1 
ATOM   1440 N  N   . TRP A 1 184 ? 17.722  25.849  11.517  1.00 19.71 ? 184  TRP A N   1 
ATOM   1441 C  CA  . TRP A 1 184 ? 16.644  26.827  11.535  1.00 21.47 ? 184  TRP A CA  1 
ATOM   1442 C  C   . TRP A 1 184 ? 16.649  27.707  10.278  1.00 22.35 ? 184  TRP A C   1 
ATOM   1443 O  O   . TRP A 1 184 ? 15.599  28.152  9.898   1.00 21.88 ? 184  TRP A O   1 
ATOM   1444 C  CB  . TRP A 1 184 ? 16.705  27.700  12.822  1.00 20.03 ? 184  TRP A CB  1 
ATOM   1445 C  CG  . TRP A 1 184 ? 16.525  26.878  14.061  1.00 16.78 ? 184  TRP A CG  1 
ATOM   1446 C  CD1 . TRP A 1 184 ? 17.426  26.740  15.111  1.00 17.79 ? 184  TRP A CD1 1 
ATOM   1447 C  CD2 . TRP A 1 184 ? 15.403  26.058  14.387  1.00 16.20 ? 184  TRP A CD2 1 
ATOM   1448 N  NE1 . TRP A 1 184 ? 16.898  25.880  16.054  1.00 15.18 ? 184  TRP A NE1 1 
ATOM   1449 C  CE2 . TRP A 1 184 ? 15.668  25.453  15.641  1.00 15.20 ? 184  TRP A CE2 1 
ATOM   1450 C  CE3 . TRP A 1 184 ? 14.193  25.771  13.749  1.00 13.22 ? 184  TRP A CE3 1 
ATOM   1451 C  CZ2 . TRP A 1 184 ? 14.749  24.583  16.268  1.00 15.54 ? 184  TRP A CZ2 1 
ATOM   1452 C  CZ3 . TRP A 1 184 ? 13.304  24.907  14.374  1.00 16.86 ? 184  TRP A CZ3 1 
ATOM   1453 C  CH2 . TRP A 1 184 ? 13.588  24.327  15.621  1.00 13.21 ? 184  TRP A CH2 1 
ATOM   1454 N  N   . GLU A 1 185 ? 17.812  27.941  9.643   1.00 23.39 ? 185  GLU A N   1 
ATOM   1455 C  CA  . GLU A 1 185 ? 17.836  28.710  8.400   1.00 26.40 ? 185  GLU A CA  1 
ATOM   1456 C  C   . GLU A 1 185 ? 17.080  27.910  7.333   1.00 25.95 ? 185  GLU A C   1 
ATOM   1457 O  O   . GLU A 1 185 ? 16.200  28.467  6.666   1.00 23.75 ? 185  GLU A O   1 
ATOM   1458 C  CB  . GLU A 1 185 ? 19.244  28.988  7.851   1.00 31.15 ? 185  GLU A CB  1 
ATOM   1459 C  CG  . GLU A 1 185 ? 20.314  29.487  8.784   1.00 38.89 ? 185  GLU A CG  1 
ATOM   1460 C  CD  . GLU A 1 185 ? 19.924  30.655  9.671   1.00 43.09 ? 185  GLU A CD  1 
ATOM   1461 O  OE1 . GLU A 1 185 ? 20.395  30.641  10.844  1.00 46.40 ? 185  GLU A OE1 1 
ATOM   1462 O  OE2 . GLU A 1 185 ? 19.168  31.582  9.217   1.00 47.67 ? 185  GLU A OE2 1 
ATOM   1463 N  N   . PHE A 1 186 ? 17.402  26.609  7.183   1.00 24.35 ? 186  PHE A N   1 
ATOM   1464 C  CA  . PHE A 1 186 ? 16.693  25.753  6.211   1.00 23.14 ? 186  PHE A CA  1 
ATOM   1465 C  C   . PHE A 1 186 ? 15.199  25.802  6.531   1.00 22.76 ? 186  PHE A C   1 
ATOM   1466 O  O   . PHE A 1 186 ? 14.323  25.961  5.641   1.00 21.69 ? 186  PHE A O   1 
ATOM   1467 C  CB  . PHE A 1 186 ? 17.162  24.265  6.279   1.00 22.55 ? 186  PHE A CB  1 
ATOM   1468 C  CG  . PHE A 1 186 ? 16.555  23.370  5.190   1.00 22.51 ? 186  PHE A CG  1 
ATOM   1469 C  CD1 . PHE A 1 186 ? 16.606  23.760  3.832   1.00 22.97 ? 186  PHE A CD1 1 
ATOM   1470 C  CD2 . PHE A 1 186 ? 15.940  22.153  5.504   1.00 20.87 ? 186  PHE A CD2 1 
ATOM   1471 C  CE1 . PHE A 1 186 ? 16.038  22.919  2.798   1.00 22.13 ? 186  PHE A CE1 1 
ATOM   1472 C  CE2 . PHE A 1 186 ? 15.380  21.341  4.514   1.00 22.27 ? 186  PHE A CE2 1 
ATOM   1473 C  CZ  . PHE A 1 186 ? 15.429  21.720  3.154   1.00 23.24 ? 186  PHE A CZ  1 
ATOM   1474 N  N   . ALA A 1 187 ? 14.874  25.659  7.811   1.00 21.48 ? 187  ALA A N   1 
ATOM   1475 C  CA  . ALA A 1 187 ? 13.452  25.692  8.172   1.00 20.93 ? 187  ALA A CA  1 
ATOM   1476 C  C   . ALA A 1 187 ? 12.716  27.047  7.790   1.00 20.05 ? 187  ALA A C   1 
ATOM   1477 O  O   . ALA A 1 187 ? 11.582  27.046  7.332   1.00 19.24 ? 187  ALA A O   1 
ATOM   1478 C  CB  . ALA A 1 187 ? 13.302  25.385  9.694   1.00 18.07 ? 187  ALA A CB  1 
ATOM   1479 N  N   . ASN A 1 188 ? 13.370  28.164  8.036   1.00 19.21 ? 188  ASN A N   1 
ATOM   1480 C  CA  . ASN A 1 188 ? 12.819  29.480  7.746   1.00 19.73 ? 188  ASN A CA  1 
ATOM   1481 C  C   . ASN A 1 188 ? 12.702  29.648  6.221   1.00 21.65 ? 188  ASN A C   1 
ATOM   1482 O  O   . ASN A 1 188 ? 11.672  30.168  5.750   1.00 21.07 ? 188  ASN A O   1 
ATOM   1483 C  CB  . ASN A 1 188 ? 13.712  30.521  8.362   1.00 17.83 ? 188  ASN A CB  1 
ATOM   1484 C  CG  . ASN A 1 188 ? 13.327  30.833  9.823   1.00 21.29 ? 188  ASN A CG  1 
ATOM   1485 O  OD1 . ASN A 1 188 ? 14.199  30.960  10.703  1.00 20.52 ? 188  ASN A OD1 1 
ATOM   1486 N  ND2 . ASN A 1 188 ? 12.021  30.963  10.078  1.00 18.36 ? 188  ASN A ND2 1 
ATOM   1487 N  N   . ALA A 1 189 ? 13.719  29.196  5.450   1.00 21.29 ? 189  ALA A N   1 
ATOM   1488 C  CA  . ALA A 1 189 ? 13.644  29.223  3.975   1.00 21.58 ? 189  ALA A CA  1 
ATOM   1489 C  C   . ALA A 1 189 ? 12.406  28.421  3.470   1.00 22.79 ? 189  ALA A C   1 
ATOM   1490 O  O   . ALA A 1 189 ? 11.637  28.897  2.602   1.00 21.89 ? 189  ALA A O   1 
ATOM   1491 C  CB  . ALA A 1 189 ? 14.924  28.654  3.385   1.00 20.82 ? 189  ALA A CB  1 
ATOM   1492 N  N   . ASN A 1 190 ? 12.156  27.238  4.031   1.00 21.65 ? 190  ASN A N   1 
ATOM   1493 C  CA  . ASN A 1 190 ? 11.000  26.441  3.631   1.00 22.15 ? 190  ASN A CA  1 
ATOM   1494 C  C   . ASN A 1 190 ? 9.675   27.070  4.040   1.00 22.93 ? 190  ASN A C   1 
ATOM   1495 O  O   . ASN A 1 190 ? 8.677   27.001  3.282   1.00 22.82 ? 190  ASN A O   1 
ATOM   1496 C  CB  . ASN A 1 190 ? 11.064  25.007  4.237   1.00 22.66 ? 190  ASN A CB  1 
ATOM   1497 C  CG  . ASN A 1 190 ? 12.309  24.253  3.795   1.00 25.26 ? 190  ASN A CG  1 
ATOM   1498 O  OD1 . ASN A 1 190 ? 12.835  23.333  4.505   1.00 27.38 ? 190  ASN A OD1 1 
ATOM   1499 N  ND2 . ASN A 1 190 ? 12.827  24.657  2.645   1.00 24.25 ? 190  ASN A ND2 1 
ATOM   1500 N  N   . PHE A 1 191 ? 9.657   27.660  5.244   1.00 21.86 ? 191  PHE A N   1 
ATOM   1501 C  CA  . PHE A 1 191 ? 8.443   28.277  5.787   1.00 22.63 ? 191  PHE A CA  1 
ATOM   1502 C  C   . PHE A 1 191 ? 8.003   29.522  5.008   1.00 23.23 ? 191  PHE A C   1 
ATOM   1503 O  O   . PHE A 1 191 ? 6.832   29.695  4.722   1.00 23.68 ? 191  PHE A O   1 
ATOM   1504 C  CB  . PHE A 1 191 ? 8.666   28.665  7.253   1.00 22.56 ? 191  PHE A CB  1 
ATOM   1505 C  CG  . PHE A 1 191 ? 7.390   29.020  7.987   1.00 22.87 ? 191  PHE A CG  1 
ATOM   1506 C  CD1 . PHE A 1 191 ? 6.487   28.025  8.379   1.00 25.32 ? 191  PHE A CD1 1 
ATOM   1507 C  CD2 . PHE A 1 191 ? 7.104   30.348  8.273   1.00 24.24 ? 191  PHE A CD2 1 
ATOM   1508 C  CE1 . PHE A 1 191 ? 5.277   28.368  9.083   1.00 25.01 ? 191  PHE A CE1 1 
ATOM   1509 C  CE2 . PHE A 1 191 ? 5.938   30.724  8.942   1.00 25.72 ? 191  PHE A CE2 1 
ATOM   1510 C  CZ  . PHE A 1 191 ? 5.013   29.733  9.362   1.00 25.98 ? 191  PHE A CZ  1 
ATOM   1511 N  N   . ALA A 1 192 ? 8.966   30.371  4.705   1.00 25.36 ? 192  ALA A N   1 
ATOM   1512 C  CA  . ALA A 1 192 ? 8.768   31.606  3.973   1.00 28.69 ? 192  ALA A CA  1 
ATOM   1513 C  C   . ALA A 1 192 ? 8.805   31.306  2.480   1.00 30.81 ? 192  ALA A C   1 
ATOM   1514 O  O   . ALA A 1 192 ? 8.530   32.217  1.695   1.00 32.81 ? 192  ALA A O   1 
ATOM   1515 C  CB  . ALA A 1 192 ? 9.908   32.648  4.346   1.00 27.44 ? 192  ALA A CB  1 
ATOM   1516 O  OXT . ALA A 1 192 ? 9.102   30.184  2.070   1.00 30.00 ? 192  ALA A OXT 1 
ATOM   1517 N  N   . ALA B 1 1   ? 2.724   -10.910 34.410  1.00 30.51 ? 1    ALA B N   1 
ATOM   1518 C  CA  . ALA B 1 1   ? 3.577   -10.086 33.550  1.00 30.98 ? 1    ALA B CA  1 
ATOM   1519 C  C   . ALA B 1 1   ? 4.468   -11.003 32.720  1.00 32.10 ? 1    ALA B C   1 
ATOM   1520 O  O   . ALA B 1 1   ? 4.883   -12.115 33.132  1.00 32.52 ? 1    ALA B O   1 
ATOM   1521 C  CB  . ALA B 1 1   ? 4.485   -9.113  34.381  1.00 29.27 ? 1    ALA B CB  1 
ATOM   1522 N  N   . PHE B 1 2   ? 4.799   -10.518 31.548  1.00 31.73 ? 2    PHE B N   1 
ATOM   1523 C  CA  . PHE B 1 2   ? 5.634   -11.270 30.665  1.00 30.03 ? 2    PHE B CA  1 
ATOM   1524 C  C   . PHE B 1 2   ? 7.060   -11.095 31.027  1.00 30.89 ? 2    PHE B C   1 
ATOM   1525 O  O   . PHE B 1 2   ? 7.439   -10.099 31.652  1.00 29.75 ? 2    PHE B O   1 
ATOM   1526 C  CB  . PHE B 1 2   ? 5.329   -10.785 29.281  1.00 29.48 ? 2    PHE B CB  1 
ATOM   1527 C  CG  . PHE B 1 2   ? 4.000   -11.221 28.826  1.00 29.95 ? 2    PHE B CG  1 
ATOM   1528 C  CD1 . PHE B 1 2   ? 3.757   -12.596 28.625  1.00 29.10 ? 2    PHE B CD1 1 
ATOM   1529 C  CD2 . PHE B 1 2   ? 2.967   -10.315 28.680  1.00 28.11 ? 2    PHE B CD2 1 
ATOM   1530 C  CE1 . PHE B 1 2   ? 2.506   -13.046 28.290  1.00 29.03 ? 2    PHE B CE1 1 
ATOM   1531 C  CE2 . PHE B 1 2   ? 1.706   -10.755 28.341  1.00 29.88 ? 2    PHE B CE2 1 
ATOM   1532 C  CZ  . PHE B 1 2   ? 1.471   -12.130 28.143  1.00 29.94 ? 2    PHE B CZ  1 
ATOM   1533 N  N   . GLU B 1 3   ? 7.869   -12.065 30.634  1.00 30.99 ? 3    GLU B N   1 
ATOM   1534 C  CA  . GLU B 1 3   ? 9.295   -12.010 30.910  1.00 31.68 ? 3    GLU B CA  1 
ATOM   1535 C  C   . GLU B 1 3   ? 10.159  -12.191 29.648  1.00 30.80 ? 3    GLU B C   1 
ATOM   1536 O  O   . GLU B 1 3   ? 9.707   -12.738 28.647  1.00 29.54 ? 3    GLU B O   1 
ATOM   1537 C  CB  . GLU B 1 3   ? 9.664   -13.098 31.865  1.00 34.63 ? 3    GLU B CB  1 
ATOM   1538 C  CG  . GLU B 1 3   ? 8.935   -13.056 33.166  1.00 40.63 ? 3    GLU B CG  1 
ATOM   1539 C  CD  . GLU B 1 3   ? 9.727   -13.842 34.180  1.00 44.32 ? 3    GLU B CD  1 
ATOM   1540 O  OE1 . GLU B 1 3   ? 9.750   -15.104 34.051  1.00 46.44 ? 3    GLU B OE1 1 
ATOM   1541 O  OE2 . GLU B 1 3   ? 10.363  -13.181 35.058  1.00 46.07 ? 3    GLU B OE2 1 
ATOM   1542 N  N   . LEU B 1 4   ? 11.403  -11.731 29.719  1.00 29.34 ? 4    LEU B N   1 
ATOM   1543 C  CA  . LEU B 1 4   ? 12.300  -11.870 28.600  1.00 26.48 ? 4    LEU B CA  1 
ATOM   1544 C  C   . LEU B 1 4   ? 12.815  -13.307 28.643  1.00 25.71 ? 4    LEU B C   1 
ATOM   1545 O  O   . LEU B 1 4   ? 13.451  -13.707 29.606  1.00 22.75 ? 4    LEU B O   1 
ATOM   1546 C  CB  . LEU B 1 4   ? 13.442  -10.853 28.699  1.00 26.08 ? 4    LEU B CB  1 
ATOM   1547 C  CG  . LEU B 1 4   ? 14.562  -11.013 27.654  1.00 27.46 ? 4    LEU B CG  1 
ATOM   1548 C  CD1 . LEU B 1 4   ? 14.037  -10.766 26.205  1.00 24.65 ? 4    LEU B CD1 1 
ATOM   1549 C  CD2 . LEU B 1 4   ? 15.697  -10.073 28.020  1.00 24.38 ? 4    LEU B CD2 1 
ATOM   1550 N  N   . PRO B 1 5   ? 12.526  -14.111 27.598  1.00 24.76 ? 5    PRO B N   1 
ATOM   1551 C  CA  . PRO B 1 5   ? 13.002  -15.516 27.578  1.00 24.52 ? 5    PRO B CA  1 
ATOM   1552 C  C   . PRO B 1 5   ? 14.510  -15.515 27.505  1.00 23.92 ? 5    PRO B C   1 
ATOM   1553 O  O   . PRO B 1 5   ? 15.102  -14.561 26.931  1.00 23.08 ? 5    PRO B O   1 
ATOM   1554 C  CB  . PRO B 1 5   ? 12.402  -16.090 26.275  1.00 25.45 ? 5    PRO B CB  1 
ATOM   1555 C  CG  . PRO B 1 5   ? 11.243  -15.132 25.946  1.00 27.54 ? 5    PRO B CG  1 
ATOM   1556 C  CD  . PRO B 1 5   ? 11.809  -13.766 26.352  1.00 25.41 ? 5    PRO B CD  1 
ATOM   1557 N  N   . SER B 1 6   ? 15.144  -16.552 28.036  1.00 22.48 ? 6    SER B N   1 
ATOM   1558 C  CA  . SER B 1 6   ? 16.609  -16.625 27.983  1.00 22.77 ? 6    SER B CA  1 
ATOM   1559 C  C   . SER B 1 6   ? 16.989  -16.919 26.533  1.00 23.45 ? 6    SER B C   1 
ATOM   1560 O  O   . SER B 1 6   ? 16.176  -17.431 25.766  1.00 23.56 ? 6    SER B O   1 
ATOM   1561 C  CB  . SER B 1 6   ? 17.187  -17.777 28.795  1.00 22.01 ? 6    SER B CB  1 
ATOM   1562 O  OG  . SER B 1 6   ? 16.985  -17.635 30.166  1.00 25.08 ? 6    SER B OG  1 
ATOM   1563 N  N   . LEU B 1 7   ? 18.228  -16.627 26.179  1.00 21.41 ? 7    LEU B N   1 
ATOM   1564 C  CA  . LEU B 1 7   ? 18.688  -16.912 24.820  1.00 21.82 ? 7    LEU B CA  1 
ATOM   1565 C  C   . LEU B 1 7   ? 18.953  -18.424 24.848  1.00 20.64 ? 7    LEU B C   1 
ATOM   1566 O  O   . LEU B 1 7   ? 19.451  -18.939 25.844  1.00 20.52 ? 7    LEU B O   1 
ATOM   1567 C  CB  . LEU B 1 7   ? 19.961  -16.070 24.581  1.00 21.64 ? 7    LEU B CB  1 
ATOM   1568 C  CG  . LEU B 1 7   ? 20.187  -15.203 23.329  1.00 24.74 ? 7    LEU B CG  1 
ATOM   1569 C  CD1 . LEU B 1 7   ? 18.952  -14.645 22.777  1.00 25.22 ? 7    LEU B CD1 1 
ATOM   1570 C  CD2 . LEU B 1 7   ? 21.214  -14.118 23.634  1.00 21.39 ? 7    LEU B CD2 1 
ATOM   1571 N  N   . PRO B 1 8   ? 18.607  -19.173 23.772  1.00 22.00 ? 8    PRO B N   1 
ATOM   1572 C  CA  . PRO B 1 8   ? 18.852  -20.654 23.775  1.00 20.61 ? 8    PRO B CA  1 
ATOM   1573 C  C   . PRO B 1 8   ? 20.342  -21.091 23.693  1.00 20.71 ? 8    PRO B C   1 
ATOM   1574 O  O   . PRO B 1 8   ? 20.669  -22.272 23.640  1.00 20.95 ? 8    PRO B O   1 
ATOM   1575 C  CB  . PRO B 1 8   ? 18.097  -21.144 22.543  1.00 21.31 ? 8    PRO B CB  1 
ATOM   1576 C  CG  . PRO B 1 8   ? 17.115  -20.027 22.194  1.00 23.76 ? 8    PRO B CG  1 
ATOM   1577 C  CD  . PRO B 1 8   ? 17.887  -18.739 22.562  1.00 19.94 ? 8    PRO B CD  1 
ATOM   1578 N  N   . TYR B 1 9   ? 21.242  -20.127 23.644  1.00 19.35 ? 9    TYR B N   1 
ATOM   1579 C  CA  . TYR B 1 9   ? 22.649  -20.430 23.519  1.00 18.70 ? 9    TYR B CA  1 
ATOM   1580 C  C   . TYR B 1 9   ? 23.456  -19.263 24.086  1.00 18.09 ? 9    TYR B C   1 
ATOM   1581 O  O   . TYR B 1 9   ? 22.921  -18.151 24.233  1.00 19.21 ? 9    TYR B O   1 
ATOM   1582 C  CB  . TYR B 1 9   ? 22.987  -20.654 22.029  1.00 17.13 ? 9    TYR B CB  1 
ATOM   1583 C  CG  . TYR B 1 9   ? 22.126  -19.783 21.119  1.00 18.51 ? 9    TYR B CG  1 
ATOM   1584 C  CD1 . TYR B 1 9   ? 22.321  -18.415 21.042  1.00 14.96 ? 9    TYR B CD1 1 
ATOM   1585 C  CD2 . TYR B 1 9   ? 21.057  -20.344 20.393  1.00 18.62 ? 9    TYR B CD2 1 
ATOM   1586 C  CE1 . TYR B 1 9   ? 21.467  -17.616 20.279  1.00 17.21 ? 9    TYR B CE1 1 
ATOM   1587 C  CE2 . TYR B 1 9   ? 20.187  -19.562 19.611  1.00 16.83 ? 9    TYR B CE2 1 
ATOM   1588 C  CZ  . TYR B 1 9   ? 20.402  -18.186 19.561  1.00 16.71 ? 9    TYR B CZ  1 
ATOM   1589 O  OH  . TYR B 1 9   ? 19.561  -17.390 18.838  1.00 14.27 ? 9    TYR B OH  1 
ATOM   1590 N  N   . ALA B 1 10  ? 24.704  -19.547 24.458  1.00 19.37 ? 10   ALA B N   1 
ATOM   1591 C  CA  . ALA B 1 10  ? 25.668  -18.561 24.989  1.00 18.64 ? 10   ALA B CA  1 
ATOM   1592 C  C   . ALA B 1 10  ? 25.739  -17.303 24.083  1.00 20.81 ? 10   ALA B C   1 
ATOM   1593 O  O   . ALA B 1 10  ? 25.606  -17.415 22.827  1.00 19.47 ? 10   ALA B O   1 
ATOM   1594 C  CB  . ALA B 1 10  ? 27.075  -19.225 25.063  1.00 20.22 ? 10   ALA B CB  1 
ATOM   1595 N  N   . ILE B 1 11  ? 26.004  -16.126 24.686  1.00 20.98 ? 11   ILE B N   1 
ATOM   1596 C  CA  . ILE B 1 11  ? 26.059  -14.891 23.912  1.00 20.48 ? 11   ILE B CA  1 
ATOM   1597 C  C   . ILE B 1 11  ? 27.080  -14.845 22.785  1.00 18.53 ? 11   ILE B C   1 
ATOM   1598 O  O   . ILE B 1 11  ? 26.946  -14.014 21.879  1.00 17.14 ? 11   ILE B O   1 
ATOM   1599 C  CB  . ILE B 1 11  ? 26.215  -13.583 24.801  1.00 22.66 ? 11   ILE B CB  1 
ATOM   1600 C  CG1 . ILE B 1 11  ? 27.392  -13.715 25.745  1.00 23.68 ? 11   ILE B CG1 1 
ATOM   1601 C  CG2 . ILE B 1 11  ? 24.976  -13.362 25.590  1.00 24.35 ? 11   ILE B CG2 1 
ATOM   1602 C  CD1 . ILE B 1 11  ? 28.693  -14.012 25.028  1.00 26.27 ? 11   ILE B CD1 1 
ATOM   1603 N  N   . ASP B 1 12  ? 28.073  -15.717 22.816  1.00 18.24 ? 12   ASP B N   1 
ATOM   1604 C  CA  . ASP B 1 12  ? 29.057  -15.745 21.740  1.00 19.88 ? 12   ASP B CA  1 
ATOM   1605 C  C   . ASP B 1 12  ? 28.898  -16.967 20.837  1.00 19.91 ? 12   ASP B C   1 
ATOM   1606 O  O   . ASP B 1 12  ? 29.659  -17.175 19.889  1.00 18.88 ? 12   ASP B O   1 
ATOM   1607 C  CB  . ASP B 1 12  ? 30.508  -15.710 22.296  1.00 22.89 ? 12   ASP B CB  1 
ATOM   1608 C  CG  . ASP B 1 12  ? 30.803  -16.873 23.207  1.00 25.19 ? 12   ASP B CG  1 
ATOM   1609 O  OD1 . ASP B 1 12  ? 29.848  -17.436 23.770  1.00 27.26 ? 12   ASP B OD1 1 
ATOM   1610 O  OD2 . ASP B 1 12  ? 31.973  -17.228 23.369  1.00 28.15 ? 12   ASP B OD2 1 
ATOM   1611 N  N   . ALA B 1 13  ? 27.891  -17.779 21.109  1.00 20.82 ? 13   ALA B N   1 
ATOM   1612 C  CA  . ALA B 1 13  ? 27.698  -19.012 20.324  1.00 21.04 ? 13   ALA B CA  1 
ATOM   1613 C  C   . ALA B 1 13  ? 27.405  -18.781 18.836  1.00 20.59 ? 13   ALA B C   1 
ATOM   1614 O  O   . ALA B 1 13  ? 27.541  -19.696 18.043  1.00 22.62 ? 13   ALA B O   1 
ATOM   1615 C  CB  . ALA B 1 13  ? 26.562  -19.849 20.954  1.00 20.35 ? 13   ALA B CB  1 
ATOM   1616 N  N   . LEU B 1 14  ? 26.994  -17.581 18.435  1.00 20.43 ? 14   LEU B N   1 
ATOM   1617 C  CA  . LEU B 1 14  ? 26.667  -17.377 17.018  1.00 20.23 ? 14   LEU B CA  1 
ATOM   1618 C  C   . LEU B 1 14  ? 27.809  -16.754 16.250  1.00 20.06 ? 14   LEU B C   1 
ATOM   1619 O  O   . LEU B 1 14  ? 27.680  -16.554 15.036  1.00 17.58 ? 14   LEU B O   1 
ATOM   1620 C  CB  . LEU B 1 14  ? 25.405  -16.516 16.891  1.00 19.51 ? 14   LEU B CB  1 
ATOM   1621 C  CG  . LEU B 1 14  ? 24.148  -17.079 17.540  1.00 20.32 ? 14   LEU B CG  1 
ATOM   1622 C  CD1 . LEU B 1 14  ? 22.940  -16.290 17.099  1.00 19.95 ? 14   LEU B CD1 1 
ATOM   1623 C  CD2 . LEU B 1 14  ? 24.004  -18.594 17.163  1.00 21.67 ? 14   LEU B CD2 1 
ATOM   1624 N  N   . GLU B 1 15  ? 28.945  -16.495 16.940  1.00 20.00 ? 15   GLU B N   1 
ATOM   1625 C  CA  . GLU B 1 15  ? 30.128  -15.888 16.287  1.00 21.16 ? 15   GLU B CA  1 
ATOM   1626 C  C   . GLU B 1 15  ? 30.647  -16.911 15.272  1.00 20.28 ? 15   GLU B C   1 
ATOM   1627 O  O   . GLU B 1 15  ? 30.581  -18.100 15.501  1.00 21.34 ? 15   GLU B O   1 
ATOM   1628 C  CB  . GLU B 1 15  ? 31.305  -15.663 17.273  1.00 23.77 ? 15   GLU B CB  1 
ATOM   1629 C  CG  . GLU B 1 15  ? 31.050  -14.789 18.501  1.00 29.06 ? 15   GLU B CG  1 
ATOM   1630 C  CD  . GLU B 1 15  ? 31.283  -13.319 18.241  1.00 32.93 ? 15   GLU B CD  1 
ATOM   1631 O  OE1 . GLU B 1 15  ? 31.100  -12.513 19.191  1.00 34.23 ? 15   GLU B OE1 1 
ATOM   1632 O  OE2 . GLU B 1 15  ? 31.641  -12.962 17.064  1.00 35.52 ? 15   GLU B OE2 1 
ATOM   1633 N  N   . PRO B 1 16  ? 31.212  -16.466 14.161  1.00 19.36 ? 16   PRO B N   1 
ATOM   1634 C  CA  . PRO B 1 16  ? 31.399  -15.085 13.767  1.00 20.65 ? 16   PRO B CA  1 
ATOM   1635 C  C   . PRO B 1 16  ? 30.262  -14.642 12.830  1.00 21.79 ? 16   PRO B C   1 
ATOM   1636 O  O   . PRO B 1 16  ? 30.438  -13.663 12.074  1.00 23.33 ? 16   PRO B O   1 
ATOM   1637 C  CB  . PRO B 1 16  ? 32.751  -15.132 13.069  1.00 19.42 ? 16   PRO B CB  1 
ATOM   1638 C  CG  . PRO B 1 16  ? 32.599  -16.404 12.273  1.00 20.02 ? 16   PRO B CG  1 
ATOM   1639 C  CD  . PRO B 1 16  ? 32.109  -17.345 13.388  1.00 19.05 ? 16   PRO B CD  1 
ATOM   1640 N  N   . HIS B 1 17  ? 29.098  -15.312 12.889  1.00 19.98 ? 17   HIS B N   1 
ATOM   1641 C  CA  . HIS B 1 17  ? 27.981  -14.904 11.987  1.00 19.35 ? 17   HIS B CA  1 
ATOM   1642 C  C   . HIS B 1 17  ? 27.140  -13.777 12.569  1.00 18.16 ? 17   HIS B C   1 
ATOM   1643 O  O   . HIS B 1 17  ? 26.718  -12.893 11.859  1.00 18.72 ? 17   HIS B O   1 
ATOM   1644 C  CB  . HIS B 1 17  ? 27.156  -16.149 11.628  1.00 17.56 ? 17   HIS B CB  1 
ATOM   1645 C  CG  . HIS B 1 17  ? 28.024  -17.237 11.088  1.00 16.89 ? 17   HIS B CG  1 
ATOM   1646 N  ND1 . HIS B 1 17  ? 28.702  -17.112 9.891   1.00 16.94 ? 17   HIS B ND1 1 
ATOM   1647 C  CD2 . HIS B 1 17  ? 28.413  -18.428 11.619  1.00 17.85 ? 17   HIS B CD2 1 
ATOM   1648 C  CE1 . HIS B 1 17  ? 29.461  -18.183 9.695   1.00 15.62 ? 17   HIS B CE1 1 
ATOM   1649 N  NE2 . HIS B 1 17  ? 29.305  -18.997 10.731  1.00 17.40 ? 17   HIS B NE2 1 
ATOM   1650 N  N   . ILE B 1 18  ? 26.901  -13.830 13.869  1.00 16.34 ? 18   ILE B N   1 
ATOM   1651 C  CA  . ILE B 1 18  ? 26.195  -12.786 14.566  1.00 17.71 ? 18   ILE B CA  1 
ATOM   1652 C  C   . ILE B 1 18  ? 26.987  -12.589 15.842  1.00 19.09 ? 18   ILE B C   1 
ATOM   1653 O  O   . ILE B 1 18  ? 27.129  -13.530 16.640  1.00 19.37 ? 18   ILE B O   1 
ATOM   1654 C  CB  . ILE B 1 18  ? 24.743  -13.161 14.900  1.00 18.58 ? 18   ILE B CB  1 
ATOM   1655 C  CG1 . ILE B 1 18  ? 23.968  -13.395 13.577  1.00 15.60 ? 18   ILE B CG1 1 
ATOM   1656 C  CG2 . ILE B 1 18  ? 24.133  -12.044 15.776  1.00 16.69 ? 18   ILE B CG2 1 
ATOM   1657 C  CD1 . ILE B 1 18  ? 22.467  -13.749 13.810  1.00 17.18 ? 18   ILE B CD1 1 
ATOM   1658 N  N   . SER B 1 19  ? 27.506  -11.364 16.037  1.00 19.88 ? 19   SER B N   1 
ATOM   1659 C  CA  . SER B 1 19  ? 28.341  -11.016 17.215  1.00 18.03 ? 19   SER B CA  1 
ATOM   1660 C  C   . SER B 1 19  ? 27.742  -11.050 18.613  1.00 17.32 ? 19   SER B C   1 
ATOM   1661 O  O   . SER B 1 19  ? 26.561  -10.837 18.827  1.00 15.59 ? 19   SER B O   1 
ATOM   1662 C  CB  . SER B 1 19  ? 28.950  -9.610  16.970  1.00 16.48 ? 19   SER B CB  1 
ATOM   1663 O  OG  . SER B 1 19  ? 28.022  -8.552  17.253  1.00 15.72 ? 19   SER B OG  1 
ATOM   1664 N  N   . LYS B 1 20  ? 28.612  -11.216 19.606  1.00 18.01 ? 20   LYS B N   1 
ATOM   1665 C  CA  . LYS B 1 20  ? 28.208  -11.153 21.000  1.00 16.26 ? 20   LYS B CA  1 
ATOM   1666 C  C   . LYS B 1 20  ? 27.584  -9.779  21.202  1.00 14.87 ? 20   LYS B C   1 
ATOM   1667 O  O   . LYS B 1 20  ? 26.576  -9.622  21.867  1.00 13.26 ? 20   LYS B O   1 
ATOM   1668 C  CB  . LYS B 1 20  ? 29.476  -11.285 21.926  1.00 20.12 ? 20   LYS B CB  1 
ATOM   1669 C  CG  . LYS B 1 20  ? 29.330  -10.732 23.337  1.00 21.20 ? 20   LYS B CG  1 
ATOM   1670 C  CD  . LYS B 1 20  ? 30.599  -11.010 24.141  1.00 24.68 ? 20   LYS B CD  1 
ATOM   1671 C  CE  . LYS B 1 20  ? 30.384  -10.597 25.632  1.00 27.22 ? 20   LYS B CE  1 
ATOM   1672 N  NZ  . LYS B 1 20  ? 31.707  -10.478 26.424  1.00 31.41 ? 20   LYS B NZ  1 
ATOM   1673 N  N   . GLU B 1 21  ? 28.159  -8.742  20.617  1.00 16.15 ? 21   GLU B N   1 
ATOM   1674 C  CA  . GLU B 1 21  ? 27.564  -7.404  20.833  1.00 15.66 ? 21   GLU B CA  1 
ATOM   1675 C  C   . GLU B 1 21  ? 26.149  -7.314  20.236  1.00 14.52 ? 21   GLU B C   1 
ATOM   1676 O  O   . GLU B 1 21  ? 25.223  -6.778  20.854  1.00 15.55 ? 21   GLU B O   1 
ATOM   1677 C  CB  . GLU B 1 21  ? 28.423  -6.307  20.193  1.00 15.61 ? 21   GLU B CB  1 
ATOM   1678 C  CG  . GLU B 1 21  ? 27.956  -4.872  20.581  1.00 14.23 ? 21   GLU B CG  1 
ATOM   1679 C  CD  . GLU B 1 21  ? 28.778  -3.747  19.916  1.00 15.57 ? 21   GLU B CD  1 
ATOM   1680 O  OE1 . GLU B 1 21  ? 29.773  -4.037  19.206  1.00 16.80 ? 21   GLU B OE1 1 
ATOM   1681 O  OE2 . GLU B 1 21  ? 28.393  -2.567  20.070  1.00 14.98 ? 21   GLU B OE2 1 
ATOM   1682 N  N   . THR B 1 22  ? 25.977  -7.843  19.033  1.00 15.94 ? 22   THR B N   1 
ATOM   1683 C  CA  . THR B 1 22  ? 24.637  -7.726  18.428  1.00 17.00 ? 22   THR B CA  1 
ATOM   1684 C  C   . THR B 1 22  ? 23.609  -8.415  19.350  1.00 15.50 ? 22   THR B C   1 
ATOM   1685 O  O   . THR B 1 22  ? 22.516  -7.882  19.639  1.00 17.62 ? 22   THR B O   1 
ATOM   1686 C  CB  . THR B 1 22  ? 24.595  -8.377  16.999  1.00 16.51 ? 22   THR B CB  1 
ATOM   1687 O  OG1 . THR B 1 22  ? 25.271  -7.546  16.055  1.00 16.27 ? 22   THR B OG1 1 
ATOM   1688 C  CG2 . THR B 1 22  ? 23.083  -8.554  16.525  1.00 17.76 ? 22   THR B CG2 1 
ATOM   1689 N  N   . LEU B 1 23  ? 23.948  -9.613  19.822  1.00 17.56 ? 23   LEU B N   1 
ATOM   1690 C  CA  . LEU B 1 23  ? 23.035  -10.349 20.714  1.00 17.79 ? 23   LEU B CA  1 
ATOM   1691 C  C   . LEU B 1 23  ? 22.791  -9.555  21.994  1.00 18.91 ? 23   LEU B C   1 
ATOM   1692 O  O   . LEU B 1 23  ? 21.649  -9.505  22.548  1.00 16.95 ? 23   LEU B O   1 
ATOM   1693 C  CB  . LEU B 1 23  ? 23.608  -11.747 21.036  1.00 18.48 ? 23   LEU B CB  1 
ATOM   1694 C  CG  . LEU B 1 23  ? 23.702  -12.741 19.835  1.00 19.85 ? 23   LEU B CG  1 
ATOM   1695 C  CD1 . LEU B 1 23  ? 23.943  -14.173 20.335  1.00 19.63 ? 23   LEU B CD1 1 
ATOM   1696 C  CD2 . LEU B 1 23  ? 22.389  -12.702 19.049  1.00 20.80 ? 23   LEU B CD2 1 
ATOM   1697 N  N   . GLU B 1 24  ? 23.842  -8.915  22.503  1.00 18.82 ? 24   GLU B N   1 
ATOM   1698 C  CA  . GLU B 1 24  ? 23.609  -8.106  23.732  1.00 21.47 ? 24   GLU B CA  1 
ATOM   1699 C  C   . GLU B 1 24  ? 22.601  -6.974  23.523  1.00 18.13 ? 24   GLU B C   1 
ATOM   1700 O  O   . GLU B 1 24  ? 21.728  -6.731  24.349  1.00 20.19 ? 24   GLU B O   1 
ATOM   1701 C  CB  . GLU B 1 24  ? 24.924  -7.532  24.264  1.00 23.93 ? 24   GLU B CB  1 
ATOM   1702 C  CG  . GLU B 1 24  ? 25.804  -8.578  24.885  1.00 31.50 ? 24   GLU B CG  1 
ATOM   1703 C  CD  . GLU B 1 24  ? 27.178  -8.075  25.220  1.00 34.08 ? 24   GLU B CD  1 
ATOM   1704 O  OE1 . GLU B 1 24  ? 27.849  -8.742  26.057  1.00 37.35 ? 24   GLU B OE1 1 
ATOM   1705 O  OE2 . GLU B 1 24  ? 27.592  -7.041  24.643  1.00 37.94 ? 24   GLU B OE2 1 
ATOM   1706 N  N   . PHE B 1 25  ? 22.684  -6.269  22.409  1.00 19.14 ? 25   PHE B N   1 
ATOM   1707 C  CA  . PHE B 1 25  ? 21.720  -5.179  22.246  1.00 16.48 ? 25   PHE B CA  1 
ATOM   1708 C  C   . PHE B 1 25  ? 20.372  -5.730  21.765  1.00 15.68 ? 25   PHE B C   1 
ATOM   1709 O  O   . PHE B 1 25  ? 19.295  -5.320  22.208  1.00 15.71 ? 25   PHE B O   1 
ATOM   1710 C  CB  . PHE B 1 25  ? 22.259  -4.192  21.207  1.00 15.95 ? 25   PHE B CB  1 
ATOM   1711 C  CG  . PHE B 1 25  ? 23.278  -3.230  21.758  1.00 15.06 ? 25   PHE B CG  1 
ATOM   1712 C  CD1 . PHE B 1 25  ? 22.865  -2.076  22.468  1.00 13.63 ? 25   PHE B CD1 1 
ATOM   1713 C  CD2 . PHE B 1 25  ? 24.641  -3.483  21.596  1.00 13.74 ? 25   PHE B CD2 1 
ATOM   1714 C  CE1 . PHE B 1 25  ? 23.815  -1.172  23.014  1.00 11.84 ? 25   PHE B CE1 1 
ATOM   1715 C  CE2 . PHE B 1 25  ? 25.627  -2.571  22.154  1.00 15.10 ? 25   PHE B CE2 1 
ATOM   1716 C  CZ  . PHE B 1 25  ? 25.193  -1.424  22.858  1.00 12.58 ? 25   PHE B CZ  1 
ATOM   1717 N  N   . HIS B 1 26  ? 20.450  -6.674  20.829  1.00 16.38 ? 26   HIS B N   1 
ATOM   1718 C  CA  . HIS B 1 26  ? 19.221  -7.157  20.202  1.00 15.33 ? 26   HIS B CA  1 
ATOM   1719 C  C   . HIS B 1 26  ? 18.335  -7.908  21.167  1.00 16.62 ? 26   HIS B C   1 
ATOM   1720 O  O   . HIS B 1 26  ? 17.133  -7.618  21.234  1.00 15.47 ? 26   HIS B O   1 
ATOM   1721 C  CB  . HIS B 1 26  ? 19.573  -8.001  19.002  1.00 14.87 ? 26   HIS B CB  1 
ATOM   1722 C  CG  . HIS B 1 26  ? 18.434  -8.228  18.053  1.00 15.34 ? 26   HIS B CG  1 
ATOM   1723 N  ND1 . HIS B 1 26  ? 18.620  -8.836  16.823  1.00 14.02 ? 26   HIS B ND1 1 
ATOM   1724 C  CD2 . HIS B 1 26  ? 17.122  -7.903  18.125  1.00 13.26 ? 26   HIS B CD2 1 
ATOM   1725 C  CE1 . HIS B 1 26  ? 17.468  -8.875  16.179  1.00 16.08 ? 26   HIS B CE1 1 
ATOM   1726 N  NE2 . HIS B 1 26  ? 16.543  -8.309  16.940  1.00 13.99 ? 26   HIS B NE2 1 
ATOM   1727 N  N   . HIS B 1 27  ? 18.920  -8.857  21.911  1.00 16.85 ? 27   HIS B N   1 
ATOM   1728 C  CA  . HIS B 1 27  ? 18.129  -9.613  22.897  1.00 18.88 ? 27   HIS B CA  1 
ATOM   1729 C  C   . HIS B 1 27  ? 17.979  -8.750  24.176  1.00 20.08 ? 27   HIS B C   1 
ATOM   1730 O  O   . HIS B 1 27  ? 16.855  -8.474  24.739  1.00 18.91 ? 27   HIS B O   1 
ATOM   1731 C  CB  . HIS B 1 27  ? 18.874  -10.909 23.251  1.00 17.20 ? 27   HIS B CB  1 
ATOM   1732 C  CG  . HIS B 1 27  ? 18.332  -11.601 24.454  1.00 19.43 ? 27   HIS B CG  1 
ATOM   1733 N  ND1 . HIS B 1 27  ? 17.181  -12.351 24.422  1.00 20.31 ? 27   HIS B ND1 1 
ATOM   1734 C  CD2 . HIS B 1 27  ? 18.794  -11.679 25.717  1.00 17.39 ? 27   HIS B CD2 1 
ATOM   1735 C  CE1 . HIS B 1 27  ? 16.952  -12.857 25.615  1.00 18.66 ? 27   HIS B CE1 1 
ATOM   1736 N  NE2 . HIS B 1 27  ? 17.916  -12.464 26.415  1.00 21.22 ? 27   HIS B NE2 1 
ATOM   1737 N  N   . GLY B 1 28  ? 19.155  -8.309  24.620  1.00 20.38 ? 28   GLY B N   1 
ATOM   1738 C  CA  . GLY B 1 28  ? 19.230  -7.574  25.862  1.00 20.97 ? 28   GLY B CA  1 
ATOM   1739 C  C   . GLY B 1 28  ? 18.512  -6.275  25.985  1.00 19.06 ? 28   GLY B C   1 
ATOM   1740 O  O   . GLY B 1 28  ? 18.078  -5.937  27.073  1.00 21.31 ? 28   GLY B O   1 
ATOM   1741 N  N   . LYS B 1 29  ? 18.427  -5.512  24.907  1.00 19.87 ? 29   LYS B N   1 
ATOM   1742 C  CA  . LYS B 1 29  ? 17.768  -4.205  24.965  1.00 19.10 ? 29   LYS B CA  1 
ATOM   1743 C  C   . LYS B 1 29  ? 16.492  -4.193  24.099  1.00 18.84 ? 29   LYS B C   1 
ATOM   1744 O  O   . LYS B 1 29  ? 15.389  -3.896  24.559  1.00 19.12 ? 29   LYS B O   1 
ATOM   1745 C  CB  . LYS B 1 29  ? 18.730  -3.145  24.410  1.00 21.31 ? 29   LYS B CB  1 
ATOM   1746 C  CG  . LYS B 1 29  ? 19.371  -2.234  25.424  1.00 27.70 ? 29   LYS B CG  1 
ATOM   1747 C  CD  . LYS B 1 29  ? 20.265  -2.962  26.358  1.00 30.99 ? 29   LYS B CD  1 
ATOM   1748 C  CE  . LYS B 1 29  ? 20.957  -1.971  27.366  1.00 34.67 ? 29   LYS B CE  1 
ATOM   1749 N  NZ  . LYS B 1 29  ? 22.327  -1.607  26.870  1.00 34.56 ? 29   LYS B NZ  1 
ATOM   1750 N  N   . HIS B 1 30  ? 16.662  -4.487  22.812  1.00 16.65 ? 30   HIS B N   1 
ATOM   1751 C  CA  . HIS B 1 30  ? 15.523  -4.442  21.929  1.00 16.88 ? 30   HIS B CA  1 
ATOM   1752 C  C   . HIS B 1 30  ? 14.425  -5.405  22.377  1.00 17.32 ? 30   HIS B C   1 
ATOM   1753 O  O   . HIS B 1 30  ? 13.330  -4.944  22.642  1.00 17.60 ? 30   HIS B O   1 
ATOM   1754 C  CB  . HIS B 1 30  ? 15.929  -4.734  20.471  1.00 14.82 ? 30   HIS B CB  1 
ATOM   1755 C  CG  . HIS B 1 30  ? 16.698  -3.632  19.820  1.00 13.20 ? 30   HIS B CG  1 
ATOM   1756 N  ND1 . HIS B 1 30  ? 16.110  -2.468  19.364  1.00 13.68 ? 30   HIS B ND1 1 
ATOM   1757 C  CD2 . HIS B 1 30  ? 18.017  -3.493  19.588  1.00 13.32 ? 30   HIS B CD2 1 
ATOM   1758 C  CE1 . HIS B 1 30  ? 17.032  -1.658  18.881  1.00 11.23 ? 30   HIS B CE1 1 
ATOM   1759 N  NE2 . HIS B 1 30  ? 18.201  -2.255  19.009  1.00 12.41 ? 30   HIS B NE2 1 
ATOM   1760 N  N   . HIS B 1 31  ? 14.708  -6.714  22.455  1.00 17.02 ? 31   HIS B N   1 
ATOM   1761 C  CA  . HIS B 1 31  ? 13.683  -7.696  22.857  1.00 18.03 ? 31   HIS B CA  1 
ATOM   1762 C  C   . HIS B 1 31  ? 13.065  -7.296  24.208  1.00 19.92 ? 31   HIS B C   1 
ATOM   1763 O  O   . HIS B 1 31  ? 11.831  -7.184  24.350  1.00 18.72 ? 31   HIS B O   1 
ATOM   1764 C  CB  . HIS B 1 31  ? 14.301  -9.116  22.958  1.00 16.67 ? 31   HIS B CB  1 
ATOM   1765 C  CG  . HIS B 1 31  ? 13.286  -10.237 22.847  1.00 17.53 ? 31   HIS B CG  1 
ATOM   1766 N  ND1 . HIS B 1 31  ? 13.651  -11.543 22.600  1.00 16.86 ? 31   HIS B ND1 1 
ATOM   1767 C  CD2 . HIS B 1 31  ? 11.932  -10.245 22.994  1.00 13.70 ? 31   HIS B CD2 1 
ATOM   1768 C  CE1 . HIS B 1 31  ? 12.567  -12.312 22.588  1.00 17.34 ? 31   HIS B CE1 1 
ATOM   1769 N  NE2 . HIS B 1 31  ? 11.509  -11.552 22.830  1.00 17.18 ? 31   HIS B NE2 1 
ATOM   1770 N  N   . ASN B 1 32  ? 13.959  -7.034  25.163  1.00 20.77 ? 32   ASN B N   1 
ATOM   1771 C  CA  . ASN B 1 32  ? 13.603  -6.623  26.519  1.00 22.22 ? 32   ASN B CA  1 
ATOM   1772 C  C   . ASN B 1 32  ? 12.658  -5.435  26.511  1.00 21.63 ? 32   ASN B C   1 
ATOM   1773 O  O   . ASN B 1 32  ? 11.673  -5.397  27.206  1.00 21.84 ? 32   ASN B O   1 
ATOM   1774 C  CB  . ASN B 1 32  ? 14.871  -6.243  27.314  1.00 23.89 ? 32   ASN B CB  1 
ATOM   1775 C  CG  . ASN B 1 32  ? 14.592  -6.093  28.816  1.00 26.73 ? 32   ASN B CG  1 
ATOM   1776 O  OD1 . ASN B 1 32  ? 14.032  -7.020  29.460  1.00 28.12 ? 32   ASN B OD1 1 
ATOM   1777 N  ND2 . ASN B 1 32  ? 14.937  -4.929  29.368  1.00 25.53 ? 32   ASN B ND2 1 
ATOM   1778 N  N   . THR B 1 33  ? 12.978  -4.427  25.720  1.00 22.50 ? 33   THR B N   1 
ATOM   1779 C  CA  . THR B 1 33  ? 12.137  -3.280  25.677  1.00 19.96 ? 33   THR B CA  1 
ATOM   1780 C  C   . THR B 1 33  ? 10.691  -3.600  25.315  1.00 21.57 ? 33   THR B C   1 
ATOM   1781 O  O   . THR B 1 33  ? 9.748   -3.007  25.899  1.00 20.99 ? 33   THR B O   1 
ATOM   1782 C  CB  . THR B 1 33  ? 12.741  -2.219  24.741  1.00 21.19 ? 33   THR B CB  1 
ATOM   1783 O  OG1 . THR B 1 33  ? 13.877  -1.640  25.395  1.00 19.69 ? 33   THR B OG1 1 
ATOM   1784 C  CG2 . THR B 1 33  ? 11.713  -1.099  24.439  1.00 20.41 ? 33   THR B CG2 1 
ATOM   1785 N  N   . TYR B 1 34  ? 10.493  -4.517  24.357  1.00 20.11 ? 34   TYR B N   1 
ATOM   1786 C  CA  . TYR B 1 34  ? 9.145   -4.870  23.976  1.00 19.73 ? 34   TYR B CA  1 
ATOM   1787 C  C   . TYR B 1 34  ? 8.445   -5.489  25.167  1.00 19.62 ? 34   TYR B C   1 
ATOM   1788 O  O   . TYR B 1 34  ? 7.243   -5.243  25.391  1.00 18.96 ? 34   TYR B O   1 
ATOM   1789 C  CB  . TYR B 1 34  ? 9.125   -5.849  22.792  1.00 17.56 ? 34   TYR B CB  1 
ATOM   1790 C  CG  . TYR B 1 34  ? 9.619   -5.217  21.477  1.00 17.44 ? 34   TYR B CG  1 
ATOM   1791 C  CD1 . TYR B 1 34  ? 9.006   -4.057  20.945  1.00 15.80 ? 34   TYR B CD1 1 
ATOM   1792 C  CD2 . TYR B 1 34  ? 10.721  -5.769  20.791  1.00 16.78 ? 34   TYR B CD2 1 
ATOM   1793 C  CE1 . TYR B 1 34  ? 9.478   -3.469  19.790  1.00 16.80 ? 34   TYR B CE1 1 
ATOM   1794 C  CE2 . TYR B 1 34  ? 11.217  -5.186  19.625  1.00 16.68 ? 34   TYR B CE2 1 
ATOM   1795 C  CZ  . TYR B 1 34  ? 10.606  -4.046  19.127  1.00 18.53 ? 34   TYR B CZ  1 
ATOM   1796 O  OH  . TYR B 1 34  ? 11.138  -3.443  17.984  1.00 20.35 ? 34   TYR B OH  1 
ATOM   1797 N  N   . VAL B 1 35  ? 9.185   -6.289  25.923  1.00 19.65 ? 35   VAL B N   1 
ATOM   1798 C  CA  . VAL B 1 35  ? 8.580   -6.956  27.086  1.00 20.16 ? 35   VAL B CA  1 
ATOM   1799 C  C   . VAL B 1 35  ? 8.178   -5.889  28.139  1.00 22.40 ? 35   VAL B C   1 
ATOM   1800 O  O   . VAL B 1 35  ? 7.050   -5.910  28.617  1.00 21.53 ? 35   VAL B O   1 
ATOM   1801 C  CB  . VAL B 1 35  ? 9.546   -7.981  27.713  1.00 19.12 ? 35   VAL B CB  1 
ATOM   1802 C  CG1 . VAL B 1 35  ? 8.897   -8.574  29.003  1.00 19.45 ? 35   VAL B CG1 1 
ATOM   1803 C  CG2 . VAL B 1 35  ? 9.918   -9.092  26.692  1.00 15.19 ? 35   VAL B CG2 1 
ATOM   1804 N  N   . VAL B 1 36  ? 9.075   -4.956  28.505  1.00 24.81 ? 36   VAL B N   1 
ATOM   1805 C  CA  . VAL B 1 36  ? 8.662   -3.973  29.497  1.00 26.10 ? 36   VAL B CA  1 
ATOM   1806 C  C   . VAL B 1 36  ? 7.554   -3.082  28.938  1.00 27.50 ? 36   VAL B C   1 
ATOM   1807 O  O   . VAL B 1 36  ? 6.588   -2.773  29.624  1.00 26.90 ? 36   VAL B O   1 
ATOM   1808 C  CB  . VAL B 1 36  ? 9.810   -3.101  29.999  1.00 26.76 ? 36   VAL B CB  1 
ATOM   1809 C  CG1 . VAL B 1 36  ? 11.047  -3.923  30.258  1.00 26.76 ? 36   VAL B CG1 1 
ATOM   1810 C  CG2 . VAL B 1 36  ? 10.070  -2.054  29.067  1.00 31.09 ? 36   VAL B CG2 1 
ATOM   1811 N  N   . LYS B 1 37  ? 7.623   -2.690  27.673  1.00 28.53 ? 37   LYS B N   1 
ATOM   1812 C  CA  . LYS B 1 37  ? 6.535   -1.841  27.214  1.00 29.88 ? 37   LYS B CA  1 
ATOM   1813 C  C   . LYS B 1 37  ? 5.205   -2.561  27.278  1.00 30.25 ? 37   LYS B C   1 
ATOM   1814 O  O   . LYS B 1 37  ? 4.197   -1.981  27.692  1.00 29.97 ? 37   LYS B O   1 
ATOM   1815 C  CB  . LYS B 1 37  ? 6.748   -1.364  25.776  1.00 32.21 ? 37   LYS B CB  1 
ATOM   1816 C  CG  . LYS B 1 37  ? 7.511   -0.069  25.657  1.00 34.89 ? 37   LYS B CG  1 
ATOM   1817 C  CD  . LYS B 1 37  ? 7.313   0.483   24.235  1.00 39.59 ? 37   LYS B CD  1 
ATOM   1818 C  CE  . LYS B 1 37  ? 7.926   1.883   24.024  1.00 42.16 ? 37   LYS B CE  1 
ATOM   1819 N  NZ  . LYS B 1 37  ? 9.432   1.847   23.952  1.00 43.16 ? 37   LYS B NZ  1 
ATOM   1820 N  N   . LEU B 1 38  ? 5.144   -3.812  26.831  1.00 29.64 ? 38   LEU B N   1 
ATOM   1821 C  CA  . LEU B 1 38  ? 3.813   -4.481  26.882  1.00 29.49 ? 38   LEU B CA  1 
ATOM   1822 C  C   . LEU B 1 38  ? 3.279   -4.614  28.298  1.00 30.01 ? 38   LEU B C   1 
ATOM   1823 O  O   . LEU B 1 38  ? 2.101   -4.403  28.530  1.00 29.90 ? 38   LEU B O   1 
ATOM   1824 C  CB  . LEU B 1 38  ? 3.846   -5.881  26.279  1.00 28.50 ? 38   LEU B CB  1 
ATOM   1825 C  CG  . LEU B 1 38  ? 2.534   -6.665  26.303  1.00 26.42 ? 38   LEU B CG  1 
ATOM   1826 C  CD1 . LEU B 1 38  ? 1.525   -6.036  25.334  1.00 26.56 ? 38   LEU B CD1 1 
ATOM   1827 C  CD2 . LEU B 1 38  ? 2.856   -8.140  25.927  1.00 26.73 ? 38   LEU B CD2 1 
ATOM   1828 N  N   . ASN B 1 39  ? 4.153   -5.016  29.214  1.00 29.72 ? 39   ASN B N   1 
ATOM   1829 C  CA  . ASN B 1 39  ? 3.795   -5.185  30.611  1.00 31.61 ? 39   ASN B CA  1 
ATOM   1830 C  C   . ASN B 1 39  ? 3.163   -3.863  31.120  1.00 32.93 ? 39   ASN B C   1 
ATOM   1831 O  O   . ASN B 1 39  ? 2.180   -3.870  31.885  1.00 33.59 ? 39   ASN B O   1 
ATOM   1832 C  CB  . ASN B 1 39  ? 5.060   -5.572  31.426  1.00 29.21 ? 39   ASN B CB  1 
ATOM   1833 C  CG  . ASN B 1 39  ? 5.381   -7.077  31.348  1.00 28.36 ? 39   ASN B CG  1 
ATOM   1834 O  OD1 . ASN B 1 39  ? 6.508   -7.505  31.602  1.00 29.30 ? 39   ASN B OD1 1 
ATOM   1835 N  ND2 . ASN B 1 39  ? 4.403   -7.862  31.000  1.00 25.81 ? 39   ASN B ND2 1 
ATOM   1836 N  N   . GLY B 1 40  ? 3.693   -2.742  30.640  1.00 34.61 ? 40   GLY B N   1 
ATOM   1837 C  CA  . GLY B 1 40  ? 3.175   -1.443  31.034  1.00 36.29 ? 40   GLY B CA  1 
ATOM   1838 C  C   . GLY B 1 40  ? 1.847   -1.112  30.375  1.00 37.30 ? 40   GLY B C   1 
ATOM   1839 O  O   . GLY B 1 40  ? 1.026   -0.368  30.926  1.00 37.23 ? 40   GLY B O   1 
ATOM   1840 N  N   . LEU B 1 41  ? 1.601   -1.687  29.207  1.00 36.99 ? 41   LEU B N   1 
ATOM   1841 C  CA  . LEU B 1 41  ? 0.367   -1.397  28.498  1.00 37.76 ? 41   LEU B CA  1 
ATOM   1842 C  C   . LEU B 1 41  ? -0.884  -2.193  28.851  1.00 38.83 ? 41   LEU B C   1 
ATOM   1843 O  O   . LEU B 1 41  ? -2.003  -1.676  28.753  1.00 37.90 ? 41   LEU B O   1 
ATOM   1844 C  CB  . LEU B 1 41  ? 0.591   -1.553  26.987  1.00 36.56 ? 41   LEU B CB  1 
ATOM   1845 C  CG  . LEU B 1 41  ? 1.272   -0.419  26.218  1.00 35.46 ? 41   LEU B CG  1 
ATOM   1846 C  CD1 . LEU B 1 41  ? 1.373   -0.789  24.764  1.00 34.43 ? 41   LEU B CD1 1 
ATOM   1847 C  CD2 . LEU B 1 41  ? 0.466   0.834   26.350  1.00 34.81 ? 41   LEU B CD2 1 
ATOM   1848 N  N   . ILE B 1 42  ? -0.706  -3.439  29.256  1.00 41.35 ? 42   ILE B N   1 
ATOM   1849 C  CA  . ILE B 1 42  ? -1.870  -4.257  29.468  1.00 43.97 ? 42   ILE B CA  1 
ATOM   1850 C  C   . ILE B 1 42  ? -2.719  -4.056  30.687  1.00 44.80 ? 42   ILE B C   1 
ATOM   1851 O  O   . ILE B 1 42  ? -3.949  -4.176  30.605  1.00 43.87 ? 42   ILE B O   1 
ATOM   1852 C  CB  . ILE B 1 42  ? -1.544  -5.760  29.262  1.00 44.62 ? 42   ILE B CB  1 
ATOM   1853 C  CG1 . ILE B 1 42  ? -0.473  -6.269  30.192  1.00 45.57 ? 42   ILE B CG1 1 
ATOM   1854 C  CG2 . ILE B 1 42  ? -0.959  -5.943  27.864  1.00 44.75 ? 42   ILE B CG2 1 
ATOM   1855 C  CD1 . ILE B 1 42  ? 0.029   -7.616  29.654  1.00 46.04 ? 42   ILE B CD1 1 
ATOM   1856 N  N   . PRO B 1 43  ? -2.099  -3.714  31.816  1.00 45.86 ? 43   PRO B N   1 
ATOM   1857 C  CA  . PRO B 1 43  ? -2.946  -3.516  32.998  1.00 47.24 ? 43   PRO B CA  1 
ATOM   1858 C  C   . PRO B 1 43  ? -4.184  -2.627  32.714  1.00 48.30 ? 43   PRO B C   1 
ATOM   1859 O  O   . PRO B 1 43  ? -4.099  -1.623  31.993  1.00 48.87 ? 43   PRO B O   1 
ATOM   1860 C  CB  . PRO B 1 43  ? -1.983  -2.921  34.032  1.00 46.62 ? 43   PRO B CB  1 
ATOM   1861 C  CG  . PRO B 1 43  ? -0.654  -2.669  33.261  1.00 46.71 ? 43   PRO B CG  1 
ATOM   1862 C  CD  . PRO B 1 43  ? -0.664  -3.612  32.127  1.00 46.00 ? 43   PRO B CD  1 
ATOM   1863 N  N   . GLY B 1 44  ? -5.340  -3.064  33.223  1.00 49.25 ? 44   GLY B N   1 
ATOM   1864 C  CA  . GLY B 1 44  ? -6.562  -2.311  33.071  1.00 50.02 ? 44   GLY B CA  1 
ATOM   1865 C  C   . GLY B 1 44  ? -7.228  -2.422  31.728  1.00 51.47 ? 44   GLY B C   1 
ATOM   1866 O  O   . GLY B 1 44  ? -7.969  -1.500  31.337  1.00 51.50 ? 44   GLY B O   1 
ATOM   1867 N  N   . THR B 1 45  ? -6.948  -3.510  31.000  1.00 51.64 ? 45   THR B N   1 
ATOM   1868 C  CA  . THR B 1 45  ? -7.588  -3.750  29.690  1.00 52.35 ? 45   THR B CA  1 
ATOM   1869 C  C   . THR B 1 45  ? -7.972  -5.214  29.675  1.00 52.06 ? 45   THR B C   1 
ATOM   1870 O  O   . THR B 1 45  ? -7.567  -5.971  30.556  1.00 52.06 ? 45   THR B O   1 
ATOM   1871 C  CB  . THR B 1 45  ? -6.645  -3.536  28.450  1.00 52.16 ? 45   THR B CB  1 
ATOM   1872 O  OG1 . THR B 1 45  ? -5.450  -4.326  28.627  1.00 52.85 ? 45   THR B OG1 1 
ATOM   1873 C  CG2 . THR B 1 45  ? -6.324  -2.068  28.246  1.00 52.35 ? 45   THR B CG2 1 
ATOM   1874 N  N   . LYS B 1 46  ? -8.717  -5.623  28.653  1.00 52.68 ? 46   LYS B N   1 
ATOM   1875 C  CA  . LYS B 1 46  ? -9.129  -7.010  28.592  1.00 53.27 ? 46   LYS B CA  1 
ATOM   1876 C  C   . LYS B 1 46  ? -7.990  -7.864  28.045  1.00 52.63 ? 46   LYS B C   1 
ATOM   1877 O  O   . LYS B 1 46  ? -8.248  -8.861  27.389  1.00 52.76 ? 46   LYS B O   1 
ATOM   1878 C  CB  . LYS B 1 46  ? -10.414 -7.159  27.759  1.00 54.57 ? 46   LYS B CB  1 
ATOM   1879 C  CG  . LYS B 1 46  ? -11.282 -8.455  28.053  1.00 56.66 ? 46   LYS B CG  1 
ATOM   1880 C  CD  . LYS B 1 46  ? -11.955 -8.400  29.439  1.00 56.83 ? 46   LYS B CD  1 
ATOM   1881 C  CE  . LYS B 1 46  ? -12.825 -9.633  29.752  1.00 57.27 ? 46   LYS B CE  1 
ATOM   1882 N  NZ  . LYS B 1 46  ? -12.070 -10.803 30.285  1.00 57.75 ? 46   LYS B NZ  1 
ATOM   1883 N  N   . PHE B 1 47  ? -6.738  -7.467  28.348  1.00 51.25 ? 47   PHE B N   1 
ATOM   1884 C  CA  . PHE B 1 47  ? -5.542  -8.203  27.936  1.00 50.08 ? 47   PHE B CA  1 
ATOM   1885 C  C   . PHE B 1 47  ? -4.692  -8.715  29.086  1.00 51.41 ? 47   PHE B C   1 
ATOM   1886 O  O   . PHE B 1 47  ? -3.920  -9.661  28.886  1.00 52.18 ? 47   PHE B O   1 
ATOM   1887 C  CB  . PHE B 1 47  ? -4.589  -7.359  27.060  1.00 47.77 ? 47   PHE B CB  1 
ATOM   1888 C  CG  . PHE B 1 47  ? -5.135  -7.000  25.699  1.00 44.42 ? 47   PHE B CG  1 
ATOM   1889 C  CD1 . PHE B 1 47  ? -5.538  -7.990  24.807  1.00 42.91 ? 47   PHE B CD1 1 
ATOM   1890 C  CD2 . PHE B 1 47  ? -5.263  -5.646  25.320  1.00 42.97 ? 47   PHE B CD2 1 
ATOM   1891 C  CE1 . PHE B 1 47  ? -6.069  -7.642  23.559  1.00 41.13 ? 47   PHE B CE1 1 
ATOM   1892 C  CE2 . PHE B 1 47  ? -5.783  -5.284  24.088  1.00 40.93 ? 47   PHE B CE2 1 
ATOM   1893 C  CZ  . PHE B 1 47  ? -6.196  -6.282  23.195  1.00 41.20 ? 47   PHE B CZ  1 
ATOM   1894 N  N   . GLU B 1 48  ? -4.789  -8.112  30.276  1.00 52.37 ? 48   GLU B N   1 
ATOM   1895 C  CA  . GLU B 1 48  ? -3.925  -8.533  31.422  1.00 52.49 ? 48   GLU B CA  1 
ATOM   1896 C  C   . GLU B 1 48  ? -3.864  -9.993  31.831  1.00 51.25 ? 48   GLU B C   1 
ATOM   1897 O  O   . GLU B 1 48  ? -2.878  -10.439 32.426  1.00 51.31 ? 48   GLU B O   1 
ATOM   1898 C  CB  . GLU B 1 48  ? -4.241  -7.749  32.721  1.00 55.27 ? 48   GLU B CB  1 
ATOM   1899 C  CG  . GLU B 1 48  ? -3.384  -8.285  33.936  1.00 57.16 ? 48   GLU B CG  1 
ATOM   1900 C  CD  . GLU B 1 48  ? -3.547  -7.500  35.232  1.00 58.84 ? 48   GLU B CD  1 
ATOM   1901 O  OE1 . GLU B 1 48  ? -4.695  -7.357  35.740  1.00 59.34 ? 48   GLU B OE1 1 
ATOM   1902 O  OE2 . GLU B 1 48  ? -2.504  -7.037  35.736  1.00 59.49 ? 48   GLU B OE2 1 
ATOM   1903 N  N   . ASN B 1 49  ? -4.942  -10.706 31.549  1.00 50.45 ? 49   ASN B N   1 
ATOM   1904 C  CA  . ASN B 1 49  ? -5.075  -12.111 31.898  1.00 50.09 ? 49   ASN B CA  1 
ATOM   1905 C  C   . ASN B 1 49  ? -4.733  -13.092 30.748  1.00 48.75 ? 49   ASN B C   1 
ATOM   1906 O  O   . ASN B 1 49  ? -4.410  -14.268 30.981  1.00 48.18 ? 49   ASN B O   1 
ATOM   1907 C  CB  . ASN B 1 49  ? -6.514  -12.324 32.356  1.00 52.37 ? 49   ASN B CB  1 
ATOM   1908 C  CG  . ASN B 1 49  ? -6.668  -13.532 33.237  1.00 55.30 ? 49   ASN B CG  1 
ATOM   1909 O  OD1 . ASN B 1 49  ? -5.802  -14.415 33.229  1.00 57.91 ? 49   ASN B OD1 1 
ATOM   1910 N  ND2 . ASN B 1 49  ? -7.787  -13.604 34.000  1.00 56.43 ? 49   ASN B ND2 1 
ATOM   1911 N  N   . LYS B 1 50  ? -4.776  -12.580 29.518  1.00 46.54 ? 50   LYS B N   1 
ATOM   1912 C  CA  . LYS B 1 50  ? -4.528  -13.359 28.312  1.00 44.79 ? 50   LYS B CA  1 
ATOM   1913 C  C   . LYS B 1 50  ? -3.085  -13.703 27.931  1.00 42.96 ? 50   LYS B C   1 
ATOM   1914 O  O   . LYS B 1 50  ? -2.139  -13.019 28.324  1.00 43.12 ? 50   LYS B O   1 
ATOM   1915 C  CB  . LYS B 1 50  ? -5.237  -12.644 27.161  1.00 45.29 ? 50   LYS B CB  1 
ATOM   1916 C  CG  . LYS B 1 50  ? -6.730  -12.484 27.467  1.00 46.98 ? 50   LYS B CG  1 
ATOM   1917 C  CD  . LYS B 1 50  ? -7.503  -11.624 26.436  1.00 48.30 ? 50   LYS B CD  1 
ATOM   1918 C  CE  . LYS B 1 50  ? -9.030  -11.447 26.820  1.00 49.57 ? 50   LYS B CE  1 
ATOM   1919 N  NZ  . LYS B 1 50  ? -9.739  -10.409 25.950  1.00 49.45 ? 50   LYS B NZ  1 
ATOM   1920 N  N   . SER B 1 51  ? -2.949  -14.796 27.168  1.00 41.10 ? 51   SER B N   1 
ATOM   1921 C  CA  . SER B 1 51  ? -1.675  -15.323 26.629  1.00 38.93 ? 51   SER B CA  1 
ATOM   1922 C  C   . SER B 1 51  ? -0.954  -14.362 25.695  1.00 35.83 ? 51   SER B C   1 
ATOM   1923 O  O   . SER B 1 51  ? -1.604  -13.614 24.973  1.00 35.61 ? 51   SER B O   1 
ATOM   1924 C  CB  . SER B 1 51  ? -1.945  -16.544 25.747  1.00 40.19 ? 51   SER B CB  1 
ATOM   1925 O  OG  . SER B 1 51  ? -1.055  -17.565 26.066  1.00 46.75 ? 51   SER B OG  1 
ATOM   1926 N  N   . LEU B 1 52  ? 0.374   -14.422 25.642  1.00 33.94 ? 52   LEU B N   1 
ATOM   1927 C  CA  . LEU B 1 52  ? 1.063   -13.586 24.648  1.00 31.48 ? 52   LEU B CA  1 
ATOM   1928 C  C   . LEU B 1 52  ? 0.431   -13.822 23.264  1.00 31.43 ? 52   LEU B C   1 
ATOM   1929 O  O   . LEU B 1 52  ? 0.074   -12.861 22.543  1.00 29.68 ? 52   LEU B O   1 
ATOM   1930 C  CB  . LEU B 1 52  ? 2.543   -13.938 24.548  1.00 30.41 ? 52   LEU B CB  1 
ATOM   1931 C  CG  . LEU B 1 52  ? 3.243   -13.104 23.441  1.00 29.17 ? 52   LEU B CG  1 
ATOM   1932 C  CD1 . LEU B 1 52  ? 3.031   -11.624 23.634  1.00 26.89 ? 52   LEU B CD1 1 
ATOM   1933 C  CD2 . LEU B 1 52  ? 4.705   -13.450 23.408  1.00 28.42 ? 52   LEU B CD2 1 
ATOM   1934 N  N   . GLU B 1 53  ? 0.274   -15.095 22.878  1.00 31.87 ? 53   GLU B N   1 
ATOM   1935 C  CA  . GLU B 1 53  ? -0.308  -15.381 21.550  1.00 33.02 ? 53   GLU B CA  1 
ATOM   1936 C  C   . GLU B 1 53  ? -1.727  -14.902 21.485  1.00 32.76 ? 53   GLU B C   1 
ATOM   1937 O  O   . GLU B 1 53  ? -2.186  -14.401 20.460  1.00 34.03 ? 53   GLU B O   1 
ATOM   1938 C  CB  . GLU B 1 53  ? -0.231  -16.866 21.195  1.00 34.01 ? 53   GLU B CB  1 
ATOM   1939 C  CG  . GLU B 1 53  ? 1.194   -17.370 21.205  1.00 36.69 ? 53   GLU B CG  1 
ATOM   1940 C  CD  . GLU B 1 53  ? 1.396   -18.732 20.523  1.00 39.65 ? 53   GLU B CD  1 
ATOM   1941 O  OE1 . GLU B 1 53  ? 2.565   -19.220 20.559  1.00 40.30 ? 53   GLU B OE1 1 
ATOM   1942 O  OE2 . GLU B 1 53  ? 0.407   -19.310 19.956  1.00 39.81 ? 53   GLU B OE2 1 
ATOM   1943 N  N   . GLU B 1 54  ? -2.450  -15.007 22.582  1.00 34.23 ? 54   GLU B N   1 
ATOM   1944 C  CA  . GLU B 1 54  ? -3.831  -14.507 22.541  1.00 34.68 ? 54   GLU B CA  1 
ATOM   1945 C  C   . GLU B 1 54  ? -3.863  -13.013 22.269  1.00 34.44 ? 54   GLU B C   1 
ATOM   1946 O  O   . GLU B 1 54  ? -4.670  -12.545 21.490  1.00 36.05 ? 54   GLU B O   1 
ATOM   1947 C  CB  . GLU B 1 54  ? -4.561  -14.770 23.855  1.00 36.27 ? 54   GLU B CB  1 
ATOM   1948 C  CG  . GLU B 1 54  ? -4.942  -16.197 24.010  1.00 39.23 ? 54   GLU B CG  1 
ATOM   1949 C  CD  . GLU B 1 54  ? -5.623  -16.446 25.343  1.00 40.14 ? 54   GLU B CD  1 
ATOM   1950 O  OE1 . GLU B 1 54  ? -5.120  -16.013 26.409  1.00 39.71 ? 54   GLU B OE1 1 
ATOM   1951 O  OE2 . GLU B 1 54  ? -6.676  -17.101 25.294  1.00 42.19 ? 54   GLU B OE2 1 
ATOM   1952 N  N   . ILE B 1 55  ? -2.987  -12.266 22.910  1.00 33.51 ? 55   ILE B N   1 
ATOM   1953 C  CA  . ILE B 1 55  ? -2.953  -10.830 22.695  1.00 33.75 ? 55   ILE B CA  1 
ATOM   1954 C  C   . ILE B 1 55  ? -2.568  -10.489 21.265  1.00 33.46 ? 55   ILE B C   1 
ATOM   1955 O  O   . ILE B 1 55  ? -3.231  -9.674  20.590  1.00 33.20 ? 55   ILE B O   1 
ATOM   1956 C  CB  . ILE B 1 55  ? -1.946  -10.193 23.687  1.00 33.99 ? 55   ILE B CB  1 
ATOM   1957 C  CG1 . ILE B 1 55  ? -2.401  -10.530 25.109  1.00 33.08 ? 55   ILE B CG1 1 
ATOM   1958 C  CG2 . ILE B 1 55  ? -1.791  -8.681  23.447  1.00 33.62 ? 55   ILE B CG2 1 
ATOM   1959 C  CD1 . ILE B 1 55  ? -1.479  -10.099 26.214  1.00 33.69 ? 55   ILE B CD1 1 
ATOM   1960 N  N   . VAL B 1 56  ? -1.502  -11.125 20.774  1.00 32.48 ? 56   VAL B N   1 
ATOM   1961 C  CA  . VAL B 1 56  ? -1.086  -10.762 19.438  1.00 32.83 ? 56   VAL B CA  1 
ATOM   1962 C  C   . VAL B 1 56  ? -2.246  -11.006 18.478  1.00 31.87 ? 56   VAL B C   1 
ATOM   1963 O  O   . VAL B 1 56  ? -2.460  -10.234 17.544  1.00 29.98 ? 56   VAL B O   1 
ATOM   1964 C  CB  . VAL B 1 56  ? 0.199   -11.529 18.969  1.00 32.87 ? 56   VAL B CB  1 
ATOM   1965 C  CG1 . VAL B 1 56  ? 1.369   -11.328 19.946  1.00 33.16 ? 56   VAL B CG1 1 
ATOM   1966 C  CG2 . VAL B 1 56  ? -0.093  -12.945 18.933  1.00 35.96 ? 56   VAL B CG2 1 
ATOM   1967 N  N   . ARG B 1 57  ? -3.020  -12.059 18.722  1.00 32.01 ? 57   ARG B N   1 
ATOM   1968 C  CA  . ARG B 1 57  ? -4.130  -12.325 17.806  1.00 33.46 ? 57   ARG B CA  1 
ATOM   1969 C  C   . ARG B 1 57  ? -5.406  -11.505 17.989  1.00 34.18 ? 57   ARG B C   1 
ATOM   1970 O  O   . ARG B 1 57  ? -6.358  -11.710 17.232  1.00 34.85 ? 57   ARG B O   1 
ATOM   1971 C  CB  . ARG B 1 57  ? -4.501  -13.811 17.791  1.00 33.51 ? 57   ARG B CB  1 
ATOM   1972 C  CG  . ARG B 1 57  ? -3.748  -14.580 16.757  1.00 36.31 ? 57   ARG B CG  1 
ATOM   1973 C  CD  . ARG B 1 57  ? -4.190  -16.022 16.686  1.00 39.65 ? 57   ARG B CD  1 
ATOM   1974 N  NE  . ARG B 1 57  ? -3.619  -16.785 17.782  1.00 42.72 ? 57   ARG B NE  1 
ATOM   1975 C  CZ  . ARG B 1 57  ? -2.992  -17.954 17.614  1.00 45.56 ? 57   ARG B CZ  1 
ATOM   1976 N  NH1 . ARG B 1 57  ? -2.873  -18.455 16.378  1.00 45.41 ? 57   ARG B NH1 1 
ATOM   1977 N  NH2 . ARG B 1 57  ? -2.494  -18.639 18.667  1.00 44.01 ? 57   ARG B NH2 1 
ATOM   1978 N  N   . SER B 1 58  ? -5.446  -10.598 18.968  1.00 33.47 ? 58   SER B N   1 
ATOM   1979 C  CA  . SER B 1 58  ? -6.646  -9.766  19.163  1.00 33.66 ? 58   SER B CA  1 
ATOM   1980 C  C   . SER B 1 58  ? -6.423  -8.271  19.483  1.00 33.60 ? 58   SER B C   1 
ATOM   1981 O  O   . SER B 1 58  ? -7.318  -7.603  19.991  1.00 35.06 ? 58   SER B O   1 
ATOM   1982 C  CB  . SER B 1 58  ? -7.538  -10.380 20.257  1.00 33.00 ? 58   SER B CB  1 
ATOM   1983 O  OG  . SER B 1 58  ? -6.796  -10.696 21.413  1.00 32.40 ? 58   SER B OG  1 
ATOM   1984 N  N   . SER B 1 59  ? -5.245  -7.748  19.171  1.00 32.60 ? 59   SER B N   1 
ATOM   1985 C  CA  . SER B 1 59  ? -4.948  -6.367  19.473  1.00 30.52 ? 59   SER B CA  1 
ATOM   1986 C  C   . SER B 1 59  ? -4.513  -5.631  18.225  1.00 30.28 ? 59   SER B C   1 
ATOM   1987 O  O   . SER B 1 59  ? -4.360  -6.232  17.131  1.00 28.93 ? 59   SER B O   1 
ATOM   1988 C  CB  . SER B 1 59  ? -3.810  -6.352  20.460  1.00 31.18 ? 59   SER B CB  1 
ATOM   1989 O  OG  . SER B 1 59  ? -2.742  -7.131  19.932  1.00 32.73 ? 59   SER B OG  1 
ATOM   1990 N  N   . ASP B 1 60  ? -4.314  -4.326  18.392  1.00 27.94 ? 60   ASP B N   1 
ATOM   1991 C  CA  . ASP B 1 60  ? -3.804  -3.473  17.320  1.00 28.82 ? 60   ASP B CA  1 
ATOM   1992 C  C   . ASP B 1 60  ? -2.994  -2.378  18.005  1.00 26.60 ? 60   ASP B C   1 
ATOM   1993 O  O   . ASP B 1 60  ? -2.750  -2.446  19.191  1.00 25.39 ? 60   ASP B O   1 
ATOM   1994 C  CB  . ASP B 1 60  ? -4.906  -2.812  16.528  1.00 30.51 ? 60   ASP B CB  1 
ATOM   1995 C  CG  . ASP B 1 60  ? -5.922  -2.132  17.420  1.00 33.32 ? 60   ASP B CG  1 
ATOM   1996 O  OD1 . ASP B 1 60  ? -5.621  -1.666  18.549  1.00 33.77 ? 60   ASP B OD1 1 
ATOM   1997 O  OD2 . ASP B 1 60  ? -7.057  -2.075  16.961  1.00 36.89 ? 60   ASP B OD2 1 
ATOM   1998 N  N   . GLY B 1 61  ? -2.602  -1.378  17.246  1.00 26.47 ? 61   GLY B N   1 
ATOM   1999 C  CA  . GLY B 1 61  ? -1.826  -0.283  17.804  1.00 27.66 ? 61   GLY B CA  1 
ATOM   2000 C  C   . GLY B 1 61  ? -0.657  -0.750  18.625  1.00 27.52 ? 61   GLY B C   1 
ATOM   2001 O  O   . GLY B 1 61  ? -0.006  -1.774  18.319  1.00 28.08 ? 61   GLY B O   1 
ATOM   2002 N  N   . GLY B 1 62  ? -0.398  0.008   19.686  1.00 27.39 ? 62   GLY B N   1 
ATOM   2003 C  CA  . GLY B 1 62  ? 0.721   -0.269  20.552  1.00 25.43 ? 62   GLY B CA  1 
ATOM   2004 C  C   . GLY B 1 62  ? 0.824   -1.623  21.220  1.00 26.21 ? 62   GLY B C   1 
ATOM   2005 O  O   . GLY B 1 62  ? 1.906   -2.194  21.347  1.00 27.56 ? 62   GLY B O   1 
ATOM   2006 N  N   . VAL B 1 63  ? -0.286  -2.126  21.720  1.00 25.26 ? 63   VAL B N   1 
ATOM   2007 C  CA  . VAL B 1 63  ? -0.251  -3.396  22.394  1.00 23.94 ? 63   VAL B CA  1 
ATOM   2008 C  C   . VAL B 1 63  ? 0.171   -4.426  21.348  1.00 23.21 ? 63   VAL B C   1 
ATOM   2009 O  O   . VAL B 1 63  ? 0.980   -5.316  21.635  1.00 22.86 ? 63   VAL B O   1 
ATOM   2010 C  CB  . VAL B 1 63  ? -1.659  -3.757  22.946  1.00 23.99 ? 63   VAL B CB  1 
ATOM   2011 C  CG1 . VAL B 1 63  ? -1.611  -5.164  23.511  1.00 23.55 ? 63   VAL B CG1 1 
ATOM   2012 C  CG2 . VAL B 1 63  ? -2.141  -2.701  24.034  1.00 23.21 ? 63   VAL B CG2 1 
ATOM   2013 N  N   . PHE B 1 64  ? -0.400  -4.341  20.141  1.00 23.47 ? 64   PHE B N   1 
ATOM   2014 C  CA  . PHE B 1 64  ? -0.003  -5.307  19.072  1.00 22.92 ? 64   PHE B CA  1 
ATOM   2015 C  C   . PHE B 1 64  ? 1.520   -5.189  18.761  1.00 20.97 ? 64   PHE B C   1 
ATOM   2016 O  O   . PHE B 1 64  ? 2.238   -6.198  18.804  1.00 21.45 ? 64   PHE B O   1 
ATOM   2017 C  CB  . PHE B 1 64  ? -0.738  -5.081  17.729  1.00 22.38 ? 64   PHE B CB  1 
ATOM   2018 C  CG  . PHE B 1 64  ? -0.312  -6.089  16.654  1.00 21.79 ? 64   PHE B CG  1 
ATOM   2019 C  CD1 . PHE B 1 64  ? -0.876  -7.370  16.621  1.00 20.62 ? 64   PHE B CD1 1 
ATOM   2020 C  CD2 . PHE B 1 64  ? 0.720   -5.782  15.749  1.00 21.95 ? 64   PHE B CD2 1 
ATOM   2021 C  CE1 . PHE B 1 64  ? -0.431  -8.339  15.697  1.00 19.80 ? 64   PHE B CE1 1 
ATOM   2022 C  CE2 . PHE B 1 64  ? 1.187   -6.757  14.805  1.00 19.85 ? 64   PHE B CE2 1 
ATOM   2023 C  CZ  . PHE B 1 64  ? 0.599   -8.026  14.784  1.00 19.20 ? 64   PHE B CZ  1 
ATOM   2024 N  N   . ASN B 1 65  ? 1.976   -3.974  18.441  1.00 20.24 ? 65   ASN B N   1 
ATOM   2025 C  CA  . ASN B 1 65  ? 3.373   -3.792  18.088  1.00 20.33 ? 65   ASN B CA  1 
ATOM   2026 C  C   . ASN B 1 65  ? 4.278   -4.416  19.093  1.00 20.08 ? 65   ASN B C   1 
ATOM   2027 O  O   . ASN B 1 65  ? 5.162   -5.158  18.704  1.00 19.17 ? 65   ASN B O   1 
ATOM   2028 C  CB  . ASN B 1 65  ? 3.723   -2.332  17.858  1.00 20.10 ? 65   ASN B CB  1 
ATOM   2029 C  CG  . ASN B 1 65  ? 3.094   -1.807  16.592  1.00 22.43 ? 65   ASN B CG  1 
ATOM   2030 O  OD1 . ASN B 1 65  ? 2.661   -2.566  15.735  1.00 21.22 ? 65   ASN B OD1 1 
ATOM   2031 N  ND2 . ASN B 1 65  ? 3.039   -0.524  16.467  1.00 22.24 ? 65   ASN B ND2 1 
ATOM   2032 N  N   . ASN B 1 66  ? 4.040   -4.175  20.388  1.00 19.79 ? 66   ASN B N   1 
ATOM   2033 C  CA  . ASN B 1 66  ? 4.864   -4.803  21.397  1.00 20.62 ? 66   ASN B CA  1 
ATOM   2034 C  C   . ASN B 1 66  ? 4.679   -6.292  21.584  1.00 19.66 ? 66   ASN B C   1 
ATOM   2035 O  O   . ASN B 1 66  ? 5.679   -7.023  21.641  1.00 20.47 ? 66   ASN B O   1 
ATOM   2036 C  CB  . ASN B 1 66  ? 4.743   -4.074  22.766  1.00 19.72 ? 66   ASN B CB  1 
ATOM   2037 C  CG  . ASN B 1 66  ? 5.301   -2.663  22.689  1.00 20.25 ? 66   ASN B CG  1 
ATOM   2038 O  OD1 . ASN B 1 66  ? 4.535   -1.689  22.549  1.00 22.15 ? 66   ASN B OD1 1 
ATOM   2039 N  ND2 . ASN B 1 66  ? 6.646   -2.539  22.691  1.00 19.89 ? 66   ASN B ND2 1 
ATOM   2040 N  N   . ALA B 1 67  ? 3.446   -6.765  21.750  1.00 19.18 ? 67   ALA B N   1 
ATOM   2041 C  CA  . ALA B 1 67  ? 3.241   -8.217  21.947  1.00 19.76 ? 67   ALA B CA  1 
ATOM   2042 C  C   . ALA B 1 67  ? 3.788   -9.029  20.747  1.00 19.07 ? 67   ALA B C   1 
ATOM   2043 O  O   . ALA B 1 67  ? 4.424   -10.052 20.948  1.00 19.79 ? 67   ALA B O   1 
ATOM   2044 C  CB  . ALA B 1 67  ? 1.718   -8.558  22.156  1.00 20.98 ? 67   ALA B CB  1 
ATOM   2045 N  N   . ALA B 1 68  ? 3.525   -8.554  19.534  1.00 18.65 ? 68   ALA B N   1 
ATOM   2046 C  CA  . ALA B 1 68  ? 3.995   -9.245  18.318  1.00 19.44 ? 68   ALA B CA  1 
ATOM   2047 C  C   . ALA B 1 68  ? 5.543   -9.237  18.245  1.00 20.47 ? 68   ALA B C   1 
ATOM   2048 O  O   . ALA B 1 68  ? 6.151   -10.256 17.931  1.00 20.35 ? 68   ALA B O   1 
ATOM   2049 C  CB  . ALA B 1 68  ? 3.384   -8.608  17.056  1.00 16.02 ? 68   ALA B CB  1 
ATOM   2050 N  N   . GLN B 1 69  ? 6.179   -8.109  18.561  1.00 20.38 ? 69   GLN B N   1 
ATOM   2051 C  CA  . GLN B 1 69  ? 7.635   -8.122  18.534  1.00 20.55 ? 69   GLN B CA  1 
ATOM   2052 C  C   . GLN B 1 69  ? 8.187   -9.101  19.549  1.00 20.50 ? 69   GLN B C   1 
ATOM   2053 O  O   . GLN B 1 69  ? 9.246   -9.741  19.320  1.00 20.42 ? 69   GLN B O   1 
ATOM   2054 C  CB  . GLN B 1 69  ? 8.191   -6.710  18.767  1.00 20.00 ? 69   GLN B CB  1 
ATOM   2055 C  CG  . GLN B 1 69  ? 8.017   -5.830  17.530  1.00 17.35 ? 69   GLN B CG  1 
ATOM   2056 C  CD  . GLN B 1 69  ? 8.847   -6.358  16.325  1.00 20.02 ? 69   GLN B CD  1 
ATOM   2057 O  OE1 . GLN B 1 69  ? 8.422   -7.304  15.619  1.00 17.86 ? 69   GLN B OE1 1 
ATOM   2058 N  NE2 . GLN B 1 69  ? 10.059  -5.763  16.108  1.00 15.14 ? 69   GLN B NE2 1 
ATOM   2059 N  N   . ILE B 1 70  ? 7.512   -9.251  20.681  1.00 21.00 ? 70   ILE B N   1 
ATOM   2060 C  CA  . ILE B 1 70  ? 8.061   -10.168 21.685  1.00 21.26 ? 70   ILE B CA  1 
ATOM   2061 C  C   . ILE B 1 70  ? 7.992   -11.559 21.073  1.00 20.75 ? 70   ILE B C   1 
ATOM   2062 O  O   . ILE B 1 70  ? 8.938   -12.323 21.109  1.00 20.85 ? 70   ILE B O   1 
ATOM   2063 C  CB  . ILE B 1 70  ? 7.247   -10.228 22.981  1.00 21.88 ? 70   ILE B CB  1 
ATOM   2064 C  CG1 . ILE B 1 70  ? 7.274   -8.890  23.727  1.00 24.84 ? 70   ILE B CG1 1 
ATOM   2065 C  CG2 . ILE B 1 70  ? 7.829   -11.294 23.888  1.00 20.75 ? 70   ILE B CG2 1 
ATOM   2066 C  CD1 . ILE B 1 70  ? 6.172   -8.814  24.771  1.00 23.33 ? 70   ILE B CD1 1 
ATOM   2067 N  N   . TRP B 1 71  ? 6.858   -11.867 20.471  1.00 20.38 ? 71   TRP B N   1 
ATOM   2068 C  CA  . TRP B 1 71  ? 6.698   -13.197 19.881  1.00 19.64 ? 71   TRP B CA  1 
ATOM   2069 C  C   . TRP B 1 71  ? 7.705   -13.441 18.751  1.00 18.16 ? 71   TRP B C   1 
ATOM   2070 O  O   . TRP B 1 71  ? 8.436   -14.464 18.764  1.00 17.58 ? 71   TRP B O   1 
ATOM   2071 C  CB  . TRP B 1 71  ? 5.264   -13.390 19.364  1.00 18.09 ? 71   TRP B CB  1 
ATOM   2072 C  CG  . TRP B 1 71  ? 4.988   -14.854 19.032  1.00 20.42 ? 71   TRP B CG  1 
ATOM   2073 C  CD1 . TRP B 1 71  ? 4.587   -15.860 19.890  1.00 20.14 ? 71   TRP B CD1 1 
ATOM   2074 C  CD2 . TRP B 1 71  ? 5.198   -15.483 17.761  1.00 20.13 ? 71   TRP B CD2 1 
ATOM   2075 N  NE1 . TRP B 1 71  ? 4.539   -17.080 19.220  1.00 18.27 ? 71   TRP B NE1 1 
ATOM   2076 C  CE2 . TRP B 1 71  ? 4.901   -16.878 17.917  1.00 21.20 ? 71   TRP B CE2 1 
ATOM   2077 C  CE3 . TRP B 1 71  ? 5.616   -15.010 16.506  1.00 19.49 ? 71   TRP B CE3 1 
ATOM   2078 C  CZ2 . TRP B 1 71  ? 5.006   -17.798 16.848  1.00 20.57 ? 71   TRP B CZ2 1 
ATOM   2079 C  CZ3 . TRP B 1 71  ? 5.727   -15.918 15.450  1.00 20.50 ? 71   TRP B CZ3 1 
ATOM   2080 C  CH2 . TRP B 1 71  ? 5.416   -17.301 15.630  1.00 21.04 ? 71   TRP B CH2 1 
ATOM   2081 N  N   . ASN B 1 72  ? 7.797   -12.467 17.838  1.00 18.01 ? 72   ASN B N   1 
ATOM   2082 C  CA  . ASN B 1 72  ? 8.684   -12.595 16.664  1.00 16.20 ? 72   ASN B CA  1 
ATOM   2083 C  C   . ASN B 1 72  ? 10.138  -12.795 17.028  1.00 15.74 ? 72   ASN B C   1 
ATOM   2084 O  O   . ASN B 1 72  ? 10.822  -13.599 16.382  1.00 15.60 ? 72   ASN B O   1 
ATOM   2085 C  CB  . ASN B 1 72  ? 8.606   -11.349 15.768  1.00 15.60 ? 72   ASN B CB  1 
ATOM   2086 C  CG  . ASN B 1 72  ? 7.197   -11.081 15.233  1.00 14.80 ? 72   ASN B CG  1 
ATOM   2087 O  OD1 . ASN B 1 72  ? 6.388   -11.984 15.113  1.00 16.37 ? 72   ASN B OD1 1 
ATOM   2088 N  ND2 . ASN B 1 72  ? 6.919   -9.843  14.926  1.00 13.72 ? 72   ASN B ND2 1 
ATOM   2089 N  N   . HIS B 1 73  ? 10.621  -12.051 18.049  1.00 12.18 ? 73   HIS B N   1 
ATOM   2090 C  CA  . HIS B 1 73  ? 12.012  -12.157 18.431  1.00 13.59 ? 73   HIS B CA  1 
ATOM   2091 C  C   . HIS B 1 73  ? 12.242  -13.473 19.089  1.00 14.09 ? 73   HIS B C   1 
ATOM   2092 O  O   . HIS B 1 73  ? 13.281  -14.067 18.899  1.00 15.95 ? 73   HIS B O   1 
ATOM   2093 C  CB  . HIS B 1 73  ? 12.451  -11.003 19.393  1.00 13.23 ? 73   HIS B CB  1 
ATOM   2094 C  CG  . HIS B 1 73  ? 12.709  -9.708  18.670  1.00 12.08 ? 73   HIS B CG  1 
ATOM   2095 N  ND1 . HIS B 1 73  ? 11.714  -8.802  18.385  1.00 15.14 ? 73   HIS B ND1 1 
ATOM   2096 C  CD2 . HIS B 1 73  ? 13.830  -9.236  18.060  1.00 14.52 ? 73   HIS B CD2 1 
ATOM   2097 C  CE1 . HIS B 1 73  ? 12.205  -7.830  17.622  1.00 15.09 ? 73   HIS B CE1 1 
ATOM   2098 N  NE2 . HIS B 1 73  ? 13.490  -8.076  17.413  1.00 15.99 ? 73   HIS B NE2 1 
ATOM   2099 N  N   . THR B 1 74  ? 11.287  -13.943 19.880  1.00 16.22 ? 74   THR B N   1 
ATOM   2100 C  CA  . THR B 1 74  ? 11.505  -15.221 20.547  1.00 17.63 ? 74   THR B CA  1 
ATOM   2101 C  C   . THR B 1 74  ? 11.591  -16.355 19.464  1.00 17.71 ? 74   THR B C   1 
ATOM   2102 O  O   . THR B 1 74  ? 12.423  -17.275 19.533  1.00 18.26 ? 74   THR B O   1 
ATOM   2103 C  CB  . THR B 1 74  ? 10.361  -15.533 21.510  1.00 17.78 ? 74   THR B CB  1 
ATOM   2104 O  OG1 . THR B 1 74  ? 10.284  -14.506 22.505  1.00 19.11 ? 74   THR B OG1 1 
ATOM   2105 C  CG2 . THR B 1 74  ? 10.612  -16.946 22.190  1.00 17.03 ? 74   THR B CG2 1 
ATOM   2106 N  N   . PHE B 1 75  ? 10.728  -16.262 18.467  1.00 18.22 ? 75   PHE B N   1 
ATOM   2107 C  CA  . PHE B 1 75  ? 10.744  -17.226 17.375  1.00 18.22 ? 75   PHE B CA  1 
ATOM   2108 C  C   . PHE B 1 75  ? 12.080  -17.114 16.557  1.00 18.49 ? 75   PHE B C   1 
ATOM   2109 O  O   . PHE B 1 75  ? 12.593  -18.088 16.019  1.00 18.90 ? 75   PHE B O   1 
ATOM   2110 C  CB  . PHE B 1 75  ? 9.579   -16.907 16.483  1.00 18.83 ? 75   PHE B CB  1 
ATOM   2111 C  CG  . PHE B 1 75  ? 9.173   -18.054 15.598  1.00 19.72 ? 75   PHE B CG  1 
ATOM   2112 C  CD1 . PHE B 1 75  ? 8.460   -19.141 16.119  1.00 21.41 ? 75   PHE B CD1 1 
ATOM   2113 C  CD2 . PHE B 1 75  ? 9.473   -18.021 14.230  1.00 22.38 ? 75   PHE B CD2 1 
ATOM   2114 C  CE1 . PHE B 1 75  ? 8.024   -20.231 15.228  1.00 23.60 ? 75   PHE B CE1 1 
ATOM   2115 C  CE2 . PHE B 1 75  ? 9.049   -19.062 13.368  1.00 21.25 ? 75   PHE B CE2 1 
ATOM   2116 C  CZ  . PHE B 1 75  ? 8.324   -20.158 13.876  1.00 19.43 ? 75   PHE B CZ  1 
ATOM   2117 N  N   . TYR B 1 76  ? 12.552  -15.877 16.396  1.00 18.91 ? 76   TYR B N   1 
ATOM   2118 C  CA  . TYR B 1 76  ? 13.810  -15.606 15.709  1.00 18.33 ? 76   TYR B CA  1 
ATOM   2119 C  C   . TYR B 1 76  ? 15.029  -16.252 16.398  1.00 16.93 ? 76   TYR B C   1 
ATOM   2120 O  O   . TYR B 1 76  ? 15.832  -16.947 15.742  1.00 15.20 ? 76   TYR B O   1 
ATOM   2121 C  CB  . TYR B 1 76  ? 13.997  -14.123 15.583  1.00 17.76 ? 76   TYR B CB  1 
ATOM   2122 C  CG  . TYR B 1 76  ? 15.372  -13.713 15.062  1.00 19.38 ? 76   TYR B CG  1 
ATOM   2123 C  CD1 . TYR B 1 76  ? 15.747  -13.924 13.713  1.00 17.99 ? 76   TYR B CD1 1 
ATOM   2124 C  CD2 . TYR B 1 76  ? 16.241  -12.994 15.891  1.00 18.74 ? 76   TYR B CD2 1 
ATOM   2125 C  CE1 . TYR B 1 76  ? 16.944  -13.396 13.219  1.00 18.47 ? 76   TYR B CE1 1 
ATOM   2126 C  CE2 . TYR B 1 76  ? 17.425  -12.475 15.420  1.00 16.31 ? 76   TYR B CE2 1 
ATOM   2127 C  CZ  . TYR B 1 76  ? 17.780  -12.665 14.081  1.00 18.41 ? 76   TYR B CZ  1 
ATOM   2128 O  OH  . TYR B 1 76  ? 18.957  -12.094 13.645  1.00 15.95 ? 76   TYR B OH  1 
ATOM   2129 N  N   . TRP B 1 77  ? 15.162  -16.061 17.717  1.00 17.70 ? 77   TRP B N   1 
ATOM   2130 C  CA  . TRP B 1 77  ? 16.304  -16.651 18.451  1.00 17.58 ? 77   TRP B CA  1 
ATOM   2131 C  C   . TRP B 1 77  ? 16.313  -18.186 18.255  1.00 16.10 ? 77   TRP B C   1 
ATOM   2132 O  O   . TRP B 1 77  ? 17.355  -18.853 18.143  1.00 14.37 ? 77   TRP B O   1 
ATOM   2133 C  CB  . TRP B 1 77  ? 16.227  -16.337 19.982  1.00 17.30 ? 77   TRP B CB  1 
ATOM   2134 C  CG  . TRP B 1 77  ? 16.233  -14.878 20.314  1.00 16.17 ? 77   TRP B CG  1 
ATOM   2135 C  CD1 . TRP B 1 77  ? 15.307  -14.213 21.084  1.00 15.39 ? 77   TRP B CD1 1 
ATOM   2136 C  CD2 . TRP B 1 77  ? 17.119  -13.886 19.795  1.00 15.39 ? 77   TRP B CD2 1 
ATOM   2137 N  NE1 . TRP B 1 77  ? 15.571  -12.855 21.076  1.00 16.65 ? 77   TRP B NE1 1 
ATOM   2138 C  CE2 . TRP B 1 77  ? 16.673  -12.628 20.285  1.00 16.15 ? 77   TRP B CE2 1 
ATOM   2139 C  CE3 . TRP B 1 77  ? 18.248  -13.930 18.940  1.00 17.81 ? 77   TRP B CE3 1 
ATOM   2140 C  CZ2 . TRP B 1 77  ? 17.305  -11.414 19.952  1.00 15.64 ? 77   TRP B CZ2 1 
ATOM   2141 C  CZ3 . TRP B 1 77  ? 18.886  -12.707 18.597  1.00 17.16 ? 77   TRP B CZ3 1 
ATOM   2142 C  CH2 . TRP B 1 77  ? 18.400  -11.467 19.106  1.00 15.92 ? 77   TRP B CH2 1 
ATOM   2143 N  N   . ASN B 1 78  ? 15.125  -18.744 18.219  1.00 17.06 ? 78   ASN B N   1 
ATOM   2144 C  CA  . ASN B 1 78  ? 15.007  -20.203 18.036  1.00 18.17 ? 78   ASN B CA  1 
ATOM   2145 C  C   . ASN B 1 78  ? 15.303  -20.639 16.596  1.00 17.97 ? 78   ASN B C   1 
ATOM   2146 O  O   . ASN B 1 78  ? 15.589  -21.827 16.357  1.00 19.61 ? 78   ASN B O   1 
ATOM   2147 C  CB  . ASN B 1 78  ? 13.566  -20.662 18.402  1.00 18.98 ? 78   ASN B CB  1 
ATOM   2148 C  CG  . ASN B 1 78  ? 13.334  -20.750 19.902  1.00 19.21 ? 78   ASN B CG  1 
ATOM   2149 O  OD1 . ASN B 1 78  ? 12.290  -20.318 20.405  1.00 20.52 ? 78   ASN B OD1 1 
ATOM   2150 N  ND2 . ASN B 1 78  ? 14.249  -21.341 20.590  1.00 15.43 ? 78   ASN B ND2 1 
ATOM   2151 N  N   . SER B 1 79  ? 15.192  -19.712 15.642  1.00 17.18 ? 79   SER B N   1 
ATOM   2152 C  CA  . SER B 1 79  ? 15.446  -20.010 14.213  1.00 16.62 ? 79   SER B CA  1 
ATOM   2153 C  C   . SER B 1 79  ? 16.915  -20.102 13.848  1.00 17.68 ? 79   SER B C   1 
ATOM   2154 O  O   . SER B 1 79  ? 17.280  -20.417 12.687  1.00 18.33 ? 79   SER B O   1 
ATOM   2155 C  CB  . SER B 1 79  ? 14.815  -18.953 13.339  1.00 15.73 ? 79   SER B CB  1 
ATOM   2156 O  OG  . SER B 1 79  ? 13.391  -19.091 13.383  1.00 15.80 ? 79   SER B OG  1 
ATOM   2157 N  N   . LEU B 1 80  ? 17.764  -19.846 14.849  1.00 17.14 ? 80   LEU B N   1 
ATOM   2158 C  CA  . LEU B 1 80  ? 19.247  -19.830 14.740  1.00 14.18 ? 80   LEU B CA  1 
ATOM   2159 C  C   . LEU B 1 80  ? 19.765  -20.791 15.776  1.00 14.21 ? 80   LEU B C   1 
ATOM   2160 O  O   . LEU B 1 80  ? 19.065  -21.057 16.747  1.00 13.87 ? 80   LEU B O   1 
ATOM   2161 C  CB  . LEU B 1 80  ? 19.802  -18.461 15.127  1.00 12.71 ? 80   LEU B CB  1 
ATOM   2162 C  CG  . LEU B 1 80  ? 19.092  -17.260 14.549  1.00 13.99 ? 80   LEU B CG  1 
ATOM   2163 C  CD1 . LEU B 1 80  ? 19.665  -15.968 15.164  1.00 10.99 ? 80   LEU B CD1 1 
ATOM   2164 C  CD2 . LEU B 1 80  ? 19.333  -17.248 12.977  1.00 12.29 ? 80   LEU B CD2 1 
ATOM   2165 N  N   . SER B 1 81  ? 20.989  -21.305 15.581  1.00 15.28 ? 81   SER B N   1 
ATOM   2166 C  CA  . SER B 1 81  ? 21.601  -22.210 16.538  1.00 15.64 ? 81   SER B CA  1 
ATOM   2167 C  C   . SER B 1 81  ? 23.081  -22.345 16.253  1.00 17.04 ? 81   SER B C   1 
ATOM   2168 O  O   . SER B 1 81  ? 23.492  -22.267 15.090  1.00 16.74 ? 81   SER B O   1 
ATOM   2169 C  CB  . SER B 1 81  ? 20.942  -23.617 16.412  1.00 18.82 ? 81   SER B CB  1 
ATOM   2170 O  OG  . SER B 1 81  ? 21.740  -24.596 17.046  1.00 19.42 ? 81   SER B OG  1 
ATOM   2171 N  N   . PRO B 1 82  ? 23.920  -22.524 17.309  1.00 17.16 ? 82   PRO B N   1 
ATOM   2172 C  CA  . PRO B 1 82  ? 25.373  -22.693 17.103  1.00 17.78 ? 82   PRO B CA  1 
ATOM   2173 C  C   . PRO B 1 82  ? 25.577  -24.002 16.307  1.00 19.38 ? 82   PRO B C   1 
ATOM   2174 O  O   . PRO B 1 82  ? 26.678  -24.287 15.844  1.00 20.12 ? 82   PRO B O   1 
ATOM   2175 C  CB  . PRO B 1 82  ? 25.928  -22.818 18.522  1.00 17.25 ? 82   PRO B CB  1 
ATOM   2176 C  CG  . PRO B 1 82  ? 24.646  -23.180 19.380  1.00 17.01 ? 82   PRO B CG  1 
ATOM   2177 C  CD  . PRO B 1 82  ? 23.601  -22.345 18.735  1.00 14.52 ? 82   PRO B CD  1 
ATOM   2178 N  N   . ASN B 1 83  ? 24.532  -24.835 16.215  1.00 20.18 ? 83   ASN B N   1 
ATOM   2179 C  CA  . ASN B 1 83  ? 24.653  -26.070 15.459  1.00 22.36 ? 83   ASN B CA  1 
ATOM   2180 C  C   . ASN B 1 83  ? 23.772  -26.161 14.199  1.00 22.40 ? 83   ASN B C   1 
ATOM   2181 O  O   . ASN B 1 83  ? 23.624  -27.228 13.618  1.00 24.03 ? 83   ASN B O   1 
ATOM   2182 C  CB  . ASN B 1 83  ? 24.377  -27.265 16.391  1.00 24.71 ? 83   ASN B CB  1 
ATOM   2183 C  CG  . ASN B 1 83  ? 25.409  -27.345 17.557  1.00 28.20 ? 83   ASN B CG  1 
ATOM   2184 O  OD1 . ASN B 1 83  ? 26.608  -27.567 17.326  1.00 27.97 ? 83   ASN B OD1 1 
ATOM   2185 N  ND2 . ASN B 1 83  ? 24.941  -27.138 18.795  1.00 26.65 ? 83   ASN B ND2 1 
ATOM   2186 N  N   . GLY B 1 84  ? 23.192  -25.046 13.773  1.00 21.51 ? 84   GLY B N   1 
ATOM   2187 C  CA  . GLY B 1 84  ? 22.367  -25.050 12.589  1.00 20.51 ? 84   GLY B CA  1 
ATOM   2188 C  C   . GLY B 1 84  ? 23.248  -24.789 11.370  1.00 19.82 ? 84   GLY B C   1 
ATOM   2189 O  O   . GLY B 1 84  ? 24.435  -25.127 11.394  1.00 19.64 ? 84   GLY B O   1 
ATOM   2190 N  N   . GLY B 1 85  ? 22.673  -24.163 10.354  1.00 18.91 ? 85   GLY B N   1 
ATOM   2191 C  CA  . GLY B 1 85  ? 23.355  -23.880 9.103   1.00 19.07 ? 85   GLY B CA  1 
ATOM   2192 C  C   . GLY B 1 85  ? 23.410  -25.068 8.151   1.00 21.84 ? 85   GLY B C   1 
ATOM   2193 O  O   . GLY B 1 85  ? 22.989  -26.203 8.472   1.00 23.77 ? 85   GLY B O   1 
ATOM   2194 N  N   . GLY B 1 86  ? 23.903  -24.851 6.941   1.00 21.82 ? 86   GLY B N   1 
ATOM   2195 C  CA  . GLY B 1 86  ? 24.027  -25.982 6.060   1.00 21.67 ? 86   GLY B CA  1 
ATOM   2196 C  C   . GLY B 1 86  ? 22.739  -26.474 5.442   1.00 21.80 ? 86   GLY B C   1 
ATOM   2197 O  O   . GLY B 1 86  ? 21.694  -25.789 5.451   1.00 22.14 ? 86   GLY B O   1 
ATOM   2198 N  N   . ALA B 1 87  ? 22.823  -27.685 4.904   1.00 19.79 ? 87   ALA B N   1 
ATOM   2199 C  CA  . ALA B 1 87  ? 21.681  -28.307 4.230   1.00 19.72 ? 87   ALA B CA  1 
ATOM   2200 C  C   . ALA B 1 87  ? 20.473  -28.552 5.109   1.00 18.68 ? 87   ALA B C   1 
ATOM   2201 O  O   . ALA B 1 87  ? 20.616  -28.865 6.263   1.00 19.41 ? 87   ALA B O   1 
ATOM   2202 C  CB  . ALA B 1 87  ? 22.098  -29.700 3.598   1.00 20.21 ? 87   ALA B CB  1 
ATOM   2203 N  N   . PRO B 1 88  ? 19.279  -28.406 4.563   1.00 17.99 ? 88   PRO B N   1 
ATOM   2204 C  CA  . PRO B 1 88  ? 18.099  -28.688 5.388   1.00 19.08 ? 88   PRO B CA  1 
ATOM   2205 C  C   . PRO B 1 88  ? 18.078  -30.247 5.533   1.00 20.84 ? 88   PRO B C   1 
ATOM   2206 O  O   . PRO B 1 88  ? 18.782  -30.980 4.794   1.00 20.47 ? 88   PRO B O   1 
ATOM   2207 C  CB  . PRO B 1 88  ? 16.924  -28.146 4.541   1.00 19.24 ? 88   PRO B CB  1 
ATOM   2208 C  CG  . PRO B 1 88  ? 17.436  -28.206 3.111   1.00 18.78 ? 88   PRO B CG  1 
ATOM   2209 C  CD  . PRO B 1 88  ? 18.928  -27.895 3.207   1.00 18.50 ? 88   PRO B CD  1 
ATOM   2210 N  N   . THR B 1 89  ? 17.305  -30.759 6.472   1.00 21.17 ? 89   THR B N   1 
ATOM   2211 C  CA  . THR B 1 89  ? 17.244  -32.185 6.694   1.00 24.37 ? 89   THR B CA  1 
ATOM   2212 C  C   . THR B 1 89  ? 15.776  -32.539 7.021   1.00 25.36 ? 89   THR B C   1 
ATOM   2213 O  O   . THR B 1 89  ? 14.989  -31.656 7.361   1.00 26.27 ? 89   THR B O   1 
ATOM   2214 C  CB  . THR B 1 89  ? 18.006  -32.538 7.952   1.00 25.02 ? 89   THR B CB  1 
ATOM   2215 O  OG1 . THR B 1 89  ? 17.312  -31.903 9.033   1.00 26.65 ? 89   THR B OG1 1 
ATOM   2216 C  CG2 . THR B 1 89  ? 19.464  -32.036 7.915   1.00 21.90 ? 89   THR B CG2 1 
ATOM   2217 N  N   . GLY B 1 90  ? 15.417  -33.812 6.870   1.00 25.10 ? 90   GLY B N   1 
ATOM   2218 C  CA  . GLY B 1 90  ? 14.102  -34.259 7.266   1.00 24.19 ? 90   GLY B CA  1 
ATOM   2219 C  C   . GLY B 1 90  ? 12.905  -33.811 6.508   1.00 23.76 ? 90   GLY B C   1 
ATOM   2220 O  O   . GLY B 1 90  ? 12.978  -33.567 5.309   1.00 23.25 ? 90   GLY B O   1 
ATOM   2221 N  N   . ALA B 1 91  ? 11.764  -33.753 7.197   1.00 23.36 ? 91   ALA B N   1 
ATOM   2222 C  CA  . ALA B 1 91  ? 10.535  -33.340 6.536   1.00 22.56 ? 91   ALA B CA  1 
ATOM   2223 C  C   . ALA B 1 91  ? 10.631  -31.968 5.808   1.00 23.36 ? 91   ALA B C   1 
ATOM   2224 O  O   . ALA B 1 91  ? 10.074  -31.781 4.696   1.00 22.62 ? 91   ALA B O   1 
ATOM   2225 C  CB  . ALA B 1 91  ? 9.377   -33.324 7.589   1.00 23.21 ? 91   ALA B CB  1 
ATOM   2226 N  N   . VAL B 1 92  ? 11.305  -30.979 6.425   1.00 21.52 ? 92   VAL B N   1 
ATOM   2227 C  CA  . VAL B 1 92  ? 11.415  -29.659 5.801   1.00 19.43 ? 92   VAL B CA  1 
ATOM   2228 C  C   . VAL B 1 92  ? 12.246  -29.709 4.520   1.00 17.96 ? 92   VAL B C   1 
ATOM   2229 O  O   . VAL B 1 92  ? 11.885  -29.106 3.530   1.00 20.07 ? 92   VAL B O   1 
ATOM   2230 C  CB  . VAL B 1 92  ? 12.039  -28.587 6.845   1.00 20.72 ? 92   VAL B CB  1 
ATOM   2231 C  CG1 . VAL B 1 92  ? 12.223  -27.247 6.154   1.00 19.64 ? 92   VAL B CG1 1 
ATOM   2232 C  CG2 . VAL B 1 92  ? 11.118  -28.460 8.127   1.00 19.79 ? 92   VAL B CG2 1 
ATOM   2233 N  N   . ALA B 1 93  ? 13.339  -30.420 4.524   1.00 18.98 ? 93   ALA B N   1 
ATOM   2234 C  CA  . ALA B 1 93  ? 14.130  -30.494 3.295   1.00 22.27 ? 93   ALA B CA  1 
ATOM   2235 C  C   . ALA B 1 93  ? 13.248  -31.020 2.127   1.00 23.13 ? 93   ALA B C   1 
ATOM   2236 O  O   . ALA B 1 93  ? 13.261  -30.467 0.994   1.00 23.43 ? 93   ALA B O   1 
ATOM   2237 C  CB  . ALA B 1 93  ? 15.386  -31.381 3.478   1.00 20.13 ? 93   ALA B CB  1 
ATOM   2238 N  N   . ASP B 1 94  ? 12.416  -32.009 2.436   1.00 25.17 ? 94   ASP B N   1 
ATOM   2239 C  CA  . ASP B 1 94  ? 11.570  -32.612 1.435   1.00 26.23 ? 94   ASP B CA  1 
ATOM   2240 C  C   . ASP B 1 94  ? 10.542  -31.667 0.927   1.00 25.31 ? 94   ASP B C   1 
ATOM   2241 O  O   . ASP B 1 94  ? 10.376  -31.604 -0.276  1.00 24.57 ? 94   ASP B O   1 
ATOM   2242 C  CB  . ASP B 1 94  ? 10.861  -33.855 1.971   1.00 30.75 ? 94   ASP B CB  1 
ATOM   2243 C  CG  . ASP B 1 94  ? 11.776  -35.047 2.055   1.00 37.39 ? 94   ASP B CG  1 
ATOM   2244 O  OD1 . ASP B 1 94  ? 12.862  -35.024 1.370   1.00 40.63 ? 94   ASP B OD1 1 
ATOM   2245 O  OD2 . ASP B 1 94  ? 11.407  -36.023 2.794   1.00 41.42 ? 94   ASP B OD2 1 
ATOM   2246 N  N   . ALA B 1 95  ? 9.855   -30.932 1.832   1.00 23.75 ? 95   ALA B N   1 
ATOM   2247 C  CA  . ALA B 1 95  ? 8.792   -29.998 1.432   1.00 22.29 ? 95   ALA B CA  1 
ATOM   2248 C  C   . ALA B 1 95  ? 9.445   -28.899 0.665   1.00 21.82 ? 95   ALA B C   1 
ATOM   2249 O  O   . ALA B 1 95  ? 8.826   -28.315 -0.233  1.00 23.06 ? 95   ALA B O   1 
ATOM   2250 C  CB  . ALA B 1 95  ? 8.010   -29.401 2.688   1.00 22.43 ? 95   ALA B CB  1 
ATOM   2251 N  N   . ILE B 1 96  ? 10.710  -28.606 1.003   1.00 21.58 ? 96   ILE B N   1 
ATOM   2252 C  CA  . ILE B 1 96  ? 11.413  -27.549 0.254   1.00 19.69 ? 96   ILE B CA  1 
ATOM   2253 C  C   . ILE B 1 96  ? 11.561  -28.016 -1.224  1.00 19.21 ? 96   ILE B C   1 
ATOM   2254 O  O   . ILE B 1 96  ? 11.241  -27.294 -2.180  1.00 19.24 ? 96   ILE B O   1 
ATOM   2255 C  CB  . ILE B 1 96  ? 12.795  -27.249 0.894   1.00 18.85 ? 96   ILE B CB  1 
ATOM   2256 C  CG1 . ILE B 1 96  ? 12.625  -26.332 2.146   1.00 18.98 ? 96   ILE B CG1 1 
ATOM   2257 C  CG2 . ILE B 1 96  ? 13.698  -26.586 -0.154  1.00 18.03 ? 96   ILE B CG2 1 
ATOM   2258 C  CD1 . ILE B 1 96  ? 13.902  -26.149 3.024   1.00 18.97 ? 96   ILE B CD1 1 
ATOM   2259 N  N   . ASN B 1 97  ? 12.040  -29.236 -1.390  1.00 18.80 ? 97   ASN B N   1 
ATOM   2260 C  CA  . ASN B 1 97  ? 12.193  -29.808 -2.713  1.00 19.23 ? 97   ASN B CA  1 
ATOM   2261 C  C   . ASN B 1 97  ? 10.865  -29.912 -3.471  1.00 19.48 ? 97   ASN B C   1 
ATOM   2262 O  O   . ASN B 1 97  ? 10.796  -29.638 -4.676  1.00 17.46 ? 97   ASN B O   1 
ATOM   2263 C  CB  . ASN B 1 97  ? 12.802  -31.177 -2.572  1.00 18.89 ? 97   ASN B CB  1 
ATOM   2264 C  CG  . ASN B 1 97  ? 14.306  -31.112 -2.274  1.00 18.54 ? 97   ASN B CG  1 
ATOM   2265 O  OD1 . ASN B 1 97  ? 14.918  -32.098 -1.872  1.00 20.71 ? 97   ASN B OD1 1 
ATOM   2266 N  ND2 . ASN B 1 97  ? 14.890  -29.961 -2.488  1.00 16.92 ? 97   ASN B ND2 1 
ATOM   2267 N  N   . ALA B 1 98  ? 9.796   -30.251 -2.733  1.00 19.72 ? 98   ALA B N   1 
ATOM   2268 C  CA  . ALA B 1 98  ? 8.494   -30.403 -3.361  1.00 19.91 ? 98   ALA B CA  1 
ATOM   2269 C  C   . ALA B 1 98  ? 8.017   -29.102 -3.956  1.00 20.95 ? 98   ALA B C   1 
ATOM   2270 O  O   . ALA B 1 98  ? 7.434   -29.070 -5.053  1.00 21.99 ? 98   ALA B O   1 
ATOM   2271 C  CB  . ALA B 1 98  ? 7.475   -30.903 -2.304  1.00 18.96 ? 98   ALA B CB  1 
ATOM   2272 N  N   . LYS B 1 99  ? 8.253   -28.004 -3.227  1.00 20.99 ? 99   LYS B N   1 
ATOM   2273 C  CA  . LYS B 1 99  ? 7.800   -26.707 -3.655  1.00 21.03 ? 99   LYS B CA  1 
ATOM   2274 C  C   . LYS B 1 99  ? 8.729   -25.925 -4.604  1.00 21.54 ? 99   LYS B C   1 
ATOM   2275 O  O   . LYS B 1 99  ? 8.249   -25.361 -5.608  1.00 22.50 ? 99   LYS B O   1 
ATOM   2276 C  CB  . LYS B 1 99  ? 7.498   -25.877 -2.409  1.00 24.04 ? 99   LYS B CB  1 
ATOM   2277 C  CG  . LYS B 1 99  ? 7.514   -24.370 -2.623  1.00 24.21 ? 99   LYS B CG  1 
ATOM   2278 C  CD  . LYS B 1 99  ? 6.178   -23.816 -2.867  1.00 23.11 ? 99   LYS B CD  1 
ATOM   2279 C  CE  . LYS B 1 99  ? 6.321   -22.525 -3.638  1.00 24.39 ? 99   LYS B CE  1 
ATOM   2280 N  NZ  . LYS B 1 99  ? 5.083   -21.783 -3.846  1.00 25.24 ? 99   LYS B NZ  1 
ATOM   2281 N  N   . TRP B 1 100 ? 10.032  -25.935 -4.359  1.00 21.09 ? 100  TRP B N   1 
ATOM   2282 C  CA  . TRP B 1 100 ? 10.946  -25.123 -5.197  1.00 19.93 ? 100  TRP B CA  1 
ATOM   2283 C  C   . TRP B 1 100 ? 11.827  -25.966 -6.133  1.00 20.73 ? 100  TRP B C   1 
ATOM   2284 O  O   . TRP B 1 100 ? 12.647  -25.401 -6.910  1.00 19.99 ? 100  TRP B O   1 
ATOM   2285 C  CB  . TRP B 1 100 ? 11.882  -24.273 -4.307  1.00 20.30 ? 100  TRP B CB  1 
ATOM   2286 C  CG  . TRP B 1 100 ? 11.220  -23.066 -3.644  1.00 19.75 ? 100  TRP B CG  1 
ATOM   2287 C  CD1 . TRP B 1 100 ? 10.877  -21.887 -4.238  1.00 20.05 ? 100  TRP B CD1 1 
ATOM   2288 C  CD2 . TRP B 1 100 ? 10.687  -23.009 -2.312  1.00 19.44 ? 100  TRP B CD2 1 
ATOM   2289 N  NE1 . TRP B 1 100 ? 10.143  -21.115 -3.368  1.00 19.20 ? 100  TRP B NE1 1 
ATOM   2290 C  CE2 . TRP B 1 100 ? 10.015  -21.777 -2.182  1.00 20.90 ? 100  TRP B CE2 1 
ATOM   2291 C  CE3 . TRP B 1 100 ? 10.709  -23.884 -1.231  1.00 22.12 ? 100  TRP B CE3 1 
ATOM   2292 C  CZ2 . TRP B 1 100 ? 9.365   -21.393 -1.007  1.00 20.39 ? 100  TRP B CZ2 1 
ATOM   2293 C  CZ3 . TRP B 1 100 ? 10.055  -23.505 -0.047  1.00 23.66 ? 100  TRP B CZ3 1 
ATOM   2294 C  CH2 . TRP B 1 100 ? 9.400   -22.276 0.050   1.00 21.39 ? 100  TRP B CH2 1 
ATOM   2295 N  N   . GLY B 1 101 ? 11.690  -27.296 -6.045  1.00 20.25 ? 101  GLY B N   1 
ATOM   2296 C  CA  . GLY B 1 101 ? 12.485  -28.181 -6.904  1.00 19.34 ? 101  GLY B CA  1 
ATOM   2297 C  C   . GLY B 1 101 ? 13.815  -28.476 -6.269  1.00 20.30 ? 101  GLY B C   1 
ATOM   2298 O  O   . GLY B 1 101 ? 14.337  -29.604 -6.405  1.00 19.75 ? 101  GLY B O   1 
ATOM   2299 N  N   . SER B 1 102 ? 14.386  -27.478 -5.565  1.00 18.67 ? 102  SER B N   1 
ATOM   2300 C  CA  . SER B 1 102 ? 15.695  -27.679 -4.933  1.00 18.65 ? 102  SER B CA  1 
ATOM   2301 C  C   . SER B 1 102 ? 15.963  -26.720 -3.754  1.00 19.27 ? 102  SER B C   1 
ATOM   2302 O  O   . SER B 1 102 ? 15.329  -25.676 -3.630  1.00 17.09 ? 102  SER B O   1 
ATOM   2303 C  CB  . SER B 1 102 ? 16.833  -27.491 -5.968  1.00 18.80 ? 102  SER B CB  1 
ATOM   2304 O  OG  . SER B 1 102 ? 16.912  -26.141 -6.411  1.00 18.69 ? 102  SER B OG  1 
ATOM   2305 N  N   . PHE B 1 103 ? 16.889  -27.093 -2.891  1.00 17.74 ? 103  PHE B N   1 
ATOM   2306 C  CA  . PHE B 1 103 ? 17.234  -26.212 -1.792  1.00 19.31 ? 103  PHE B CA  1 
ATOM   2307 C  C   . PHE B 1 103 ? 17.778  -24.911 -2.370  1.00 19.40 ? 103  PHE B C   1 
ATOM   2308 O  O   . PHE B 1 103 ? 17.339  -23.821 -1.973  1.00 19.28 ? 103  PHE B O   1 
ATOM   2309 C  CB  . PHE B 1 103 ? 18.265  -26.887 -0.878  1.00 19.33 ? 103  PHE B CB  1 
ATOM   2310 C  CG  . PHE B 1 103 ? 18.707  -26.029 0.252   1.00 21.63 ? 103  PHE B CG  1 
ATOM   2311 C  CD1 . PHE B 1 103 ? 17.758  -25.420 1.093   1.00 23.44 ? 103  PHE B CD1 1 
ATOM   2312 C  CD2 . PHE B 1 103 ? 20.046  -25.726 0.422   1.00 21.69 ? 103  PHE B CD2 1 
ATOM   2313 C  CE1 . PHE B 1 103 ? 18.156  -24.506 2.069   1.00 23.83 ? 103  PHE B CE1 1 
ATOM   2314 C  CE2 . PHE B 1 103 ? 20.451  -24.825 1.384   1.00 23.03 ? 103  PHE B CE2 1 
ATOM   2315 C  CZ  . PHE B 1 103 ? 19.486  -24.199 2.217   1.00 23.72 ? 103  PHE B CZ  1 
ATOM   2316 N  N   . ASP B 1 104 ? 18.680  -25.003 -3.358  1.00 19.31 ? 104  ASP B N   1 
ATOM   2317 C  CA  . ASP B 1 104 ? 19.259  -23.788 -3.967  1.00 20.44 ? 104  ASP B CA  1 
ATOM   2318 C  C   . ASP B 1 104 ? 18.220  -22.822 -4.509  1.00 19.73 ? 104  ASP B C   1 
ATOM   2319 O  O   . ASP B 1 104 ? 18.321  -21.628 -4.256  1.00 19.05 ? 104  ASP B O   1 
ATOM   2320 C  CB  . ASP B 1 104 ? 20.237  -24.137 -5.096  1.00 20.07 ? 104  ASP B CB  1 
ATOM   2321 C  CG  . ASP B 1 104 ? 21.554  -24.702 -4.556  1.00 20.45 ? 104  ASP B CG  1 
ATOM   2322 O  OD1 . ASP B 1 104 ? 21.727  -24.716 -3.319  1.00 21.83 ? 104  ASP B OD1 1 
ATOM   2323 O  OD2 . ASP B 1 104 ? 22.400  -25.155 -5.358  1.00 20.94 ? 104  ASP B OD2 1 
ATOM   2324 N  N   . ALA B 1 105 ? 17.229  -23.322 -5.260  1.00 17.55 ? 105  ALA B N   1 
ATOM   2325 C  CA  . ALA B 1 105 ? 16.180  -22.430 -5.754  1.00 17.56 ? 105  ALA B CA  1 
ATOM   2326 C  C   . ALA B 1 105 ? 15.425  -21.777 -4.567  1.00 16.95 ? 105  ALA B C   1 
ATOM   2327 O  O   . ALA B 1 105 ? 15.077  -20.631 -4.617  1.00 16.85 ? 105  ALA B O   1 
ATOM   2328 C  CB  . ALA B 1 105 ? 15.156  -23.209 -6.668  1.00 18.89 ? 105  ALA B CB  1 
ATOM   2329 N  N   . PHE B 1 106 ? 15.177  -22.514 -3.508  1.00 17.45 ? 106  PHE B N   1 
ATOM   2330 C  CA  . PHE B 1 106 ? 14.444  -21.964 -2.344  1.00 17.60 ? 106  PHE B CA  1 
ATOM   2331 C  C   . PHE B 1 106 ? 15.284  -20.856 -1.682  1.00 18.17 ? 106  PHE B C   1 
ATOM   2332 O  O   . PHE B 1 106 ? 14.767  -19.790 -1.345  1.00 17.46 ? 106  PHE B O   1 
ATOM   2333 C  CB  . PHE B 1 106 ? 14.170  -23.092 -1.335  1.00 17.03 ? 106  PHE B CB  1 
ATOM   2334 C  CG  . PHE B 1 106 ? 13.978  -22.626 0.100   1.00 18.25 ? 106  PHE B CG  1 
ATOM   2335 C  CD1 . PHE B 1 106 ? 12.891  -21.821 0.465   1.00 19.45 ? 106  PHE B CD1 1 
ATOM   2336 C  CD2 . PHE B 1 106 ? 14.899  -22.959 1.064   1.00 18.75 ? 106  PHE B CD2 1 
ATOM   2337 C  CE1 . PHE B 1 106 ? 12.736  -21.326 1.787   1.00 17.44 ? 106  PHE B CE1 1 
ATOM   2338 C  CE2 . PHE B 1 106 ? 14.750  -22.480 2.401   1.00 20.81 ? 106  PHE B CE2 1 
ATOM   2339 C  CZ  . PHE B 1 106 ? 13.659  -21.658 2.738   1.00 19.16 ? 106  PHE B CZ  1 
ATOM   2340 N  N   . LYS B 1 107 ? 16.570  -21.134 -1.499  1.00 18.24 ? 107  LYS B N   1 
ATOM   2341 C  CA  . LYS B 1 107 ? 17.489  -20.171 -0.881  1.00 19.35 ? 107  LYS B CA  1 
ATOM   2342 C  C   . LYS B 1 107 ? 17.536  -18.871 -1.707  1.00 19.25 ? 107  LYS B C   1 
ATOM   2343 O  O   . LYS B 1 107 ? 17.514  -17.755 -1.172  1.00 18.29 ? 107  LYS B O   1 
ATOM   2344 C  CB  . LYS B 1 107 ? 18.906  -20.793 -0.785  1.00 19.83 ? 107  LYS B CB  1 
ATOM   2345 C  CG  . LYS B 1 107 ? 19.966  -19.911 -0.177  1.00 22.66 ? 107  LYS B CG  1 
ATOM   2346 C  CD  . LYS B 1 107 ? 21.300  -20.672 -0.014  1.00 25.60 ? 107  LYS B CD  1 
ATOM   2347 C  CE  . LYS B 1 107 ? 22.283  -19.807 0.780   1.00 26.81 ? 107  LYS B CE  1 
ATOM   2348 N  NZ  . LYS B 1 107 ? 23.517  -20.552 1.122   1.00 28.62 ? 107  LYS B NZ  1 
ATOM   2349 N  N   . GLU B 1 108 ? 17.622  -19.013 -3.018  1.00 17.55 ? 108  GLU B N   1 
ATOM   2350 C  CA  . GLU B 1 108 ? 17.645  -17.826 -3.858  1.00 19.68 ? 108  GLU B CA  1 
ATOM   2351 C  C   . GLU B 1 108 ? 16.358  -17.078 -3.690  1.00 18.50 ? 108  GLU B C   1 
ATOM   2352 O  O   . GLU B 1 108 ? 16.364  -15.873 -3.619  1.00 18.28 ? 108  GLU B O   1 
ATOM   2353 C  CB  . GLU B 1 108 ? 17.790  -18.183 -5.325  1.00 21.95 ? 108  GLU B CB  1 
ATOM   2354 C  CG  . GLU B 1 108 ? 17.860  -16.935 -6.253  1.00 28.30 ? 108  GLU B CG  1 
ATOM   2355 C  CD  . GLU B 1 108 ? 18.171  -17.345 -7.675  1.00 31.89 ? 108  GLU B CD  1 
ATOM   2356 O  OE1 . GLU B 1 108 ? 17.277  -17.959 -8.307  1.00 34.62 ? 108  GLU B OE1 1 
ATOM   2357 O  OE2 . GLU B 1 108 ? 19.308  -17.091 -8.149  1.00 34.48 ? 108  GLU B OE2 1 
ATOM   2358 N  N   . ALA B 1 109 ? 15.239  -17.801 -3.692  1.00 18.24 ? 109  ALA B N   1 
ATOM   2359 C  CA  . ALA B 1 109 ? 13.941  -17.176 -3.503  1.00 19.94 ? 109  ALA B CA  1 
ATOM   2360 C  C   . ALA B 1 109 ? 13.845  -16.435 -2.140  1.00 19.26 ? 109  ALA B C   1 
ATOM   2361 O  O   . ALA B 1 109 ? 13.394  -15.282 -2.080  1.00 20.40 ? 109  ALA B O   1 
ATOM   2362 C  CB  . ALA B 1 109 ? 12.777  -18.276 -3.599  1.00 19.56 ? 109  ALA B CB  1 
ATOM   2363 N  N   . LEU B 1 110 ? 14.265  -17.079 -1.060  1.00 16.86 ? 110  LEU B N   1 
ATOM   2364 C  CA  . LEU B 1 110 ? 14.158  -16.423 0.216   1.00 17.00 ? 110  LEU B CA  1 
ATOM   2365 C  C   . LEU B 1 110 ? 15.060  -15.184 0.287   1.00 17.69 ? 110  LEU B C   1 
ATOM   2366 O  O   . LEU B 1 110 ? 14.664  -14.135 0.824   1.00 16.18 ? 110  LEU B O   1 
ATOM   2367 C  CB  . LEU B 1 110 ? 14.467  -17.390 1.389   1.00 16.54 ? 110  LEU B CB  1 
ATOM   2368 C  CG  . LEU B 1 110 ? 14.064  -16.865 2.821   1.00 15.57 ? 110  LEU B CG  1 
ATOM   2369 C  CD1 . LEU B 1 110 ? 13.711  -18.059 3.704   1.00 13.03 ? 110  LEU B CD1 1 
ATOM   2370 C  CD2 . LEU B 1 110 ? 15.207  -16.025 3.479   1.00 14.22 ? 110  LEU B CD2 1 
ATOM   2371 N  N   . ASN B 1 111 ? 16.252  -15.303 -0.291  1.00 18.20 ? 111  ASN B N   1 
ATOM   2372 C  CA  . ASN B 1 111 ? 17.206  -14.209 -0.252  1.00 18.96 ? 111  ASN B CA  1 
ATOM   2373 C  C   . ASN B 1 111 ? 16.602  -13.089 -1.004  1.00 18.70 ? 111  ASN B C   1 
ATOM   2374 O  O   . ASN B 1 111 ? 16.669  -11.943 -0.565  1.00 17.65 ? 111  ASN B O   1 
ATOM   2375 C  CB  . ASN B 1 111 ? 18.575  -14.592 -0.874  1.00 16.66 ? 111  ASN B CB  1 
ATOM   2376 C  CG  . ASN B 1 111 ? 19.483  -15.291 0.136   1.00 18.87 ? 111  ASN B CG  1 
ATOM   2377 O  OD1 . ASN B 1 111 ? 19.249  -15.214 1.343   1.00 16.73 ? 111  ASN B OD1 1 
ATOM   2378 N  ND2 . ASN B 1 111 ? 20.548  -15.965 -0.358  1.00 18.46 ? 111  ASN B ND2 1 
ATOM   2379 N  N   . ASP B 1 112 ? 15.960  -13.427 -2.122  1.00 19.82 ? 112  ASP B N   1 
ATOM   2380 C  CA  . ASP B 1 112 ? 15.378  -12.374 -2.926  1.00 20.45 ? 112  ASP B CA  1 
ATOM   2381 C  C   . ASP B 1 112 ? 14.292  -11.644 -2.147  1.00 19.74 ? 112  ASP B C   1 
ATOM   2382 O  O   . ASP B 1 112 ? 14.225  -10.391 -2.148  1.00 20.19 ? 112  ASP B O   1 
ATOM   2383 C  CB  . ASP B 1 112 ? 14.785  -12.914 -4.213  1.00 25.26 ? 112  ASP B CB  1 
ATOM   2384 C  CG  . ASP B 1 112 ? 14.074  -11.829 -5.001  1.00 28.84 ? 112  ASP B CG  1 
ATOM   2385 O  OD1 . ASP B 1 112 ? 14.724  -10.830 -5.381  1.00 33.12 ? 112  ASP B OD1 1 
ATOM   2386 O  OD2 . ASP B 1 112 ? 12.869  -11.950 -5.225  1.00 33.10 ? 112  ASP B OD2 1 
ATOM   2387 N  N   . LYS B 1 113 ? 13.433  -12.421 -1.491  1.00 17.89 ? 113  LYS B N   1 
ATOM   2388 C  CA  . LYS B 1 113 ? 12.393  -11.817 -0.691  1.00 18.55 ? 113  LYS B CA  1 
ATOM   2389 C  C   . LYS B 1 113 ? 12.971  -10.947 0.447   1.00 18.45 ? 113  LYS B C   1 
ATOM   2390 O  O   . LYS B 1 113 ? 12.474  -9.838  0.738   1.00 18.08 ? 113  LYS B O   1 
ATOM   2391 C  CB  . LYS B 1 113 ? 11.512  -12.914 -0.069  1.00 20.14 ? 113  LYS B CB  1 
ATOM   2392 C  CG  . LYS B 1 113 ? 10.559  -13.614 -1.075  1.00 23.59 ? 113  LYS B CG  1 
ATOM   2393 C  CD  . LYS B 1 113 ? 9.506   -12.709 -1.564  1.00 22.88 ? 113  LYS B CD  1 
ATOM   2394 C  CE  . LYS B 1 113 ? 8.308   -12.687 -0.608  1.00 26.91 ? 113  LYS B CE  1 
ATOM   2395 N  NZ  . LYS B 1 113 ? 7.293   -11.721 -1.126  1.00 26.66 ? 113  LYS B NZ  1 
ATOM   2396 N  N   . ALA B 1 114 ? 13.991  -11.466 1.116   1.00 17.54 ? 114  ALA B N   1 
ATOM   2397 C  CA  . ALA B 1 114 ? 14.528  -10.757 2.274   1.00 18.67 ? 114  ALA B CA  1 
ATOM   2398 C  C   . ALA B 1 114 ? 15.295  -9.511  1.890   1.00 19.09 ? 114  ALA B C   1 
ATOM   2399 O  O   . ALA B 1 114 ? 15.033  -8.468  2.471   1.00 20.18 ? 114  ALA B O   1 
ATOM   2400 C  CB  . ALA B 1 114 ? 15.383  -11.707 3.151   1.00 15.26 ? 114  ALA B CB  1 
ATOM   2401 N  N   . VAL B 1 115 ? 16.158  -9.567  0.877   1.00 18.69 ? 115  VAL B N   1 
ATOM   2402 C  CA  . VAL B 1 115 ? 16.921  -8.365  0.506   1.00 20.15 ? 115  VAL B CA  1 
ATOM   2403 C  C   . VAL B 1 115 ? 15.974  -7.239  0.087   1.00 21.65 ? 115  VAL B C   1 
ATOM   2404 O  O   . VAL B 1 115 ? 16.214  -6.060  0.360   1.00 22.14 ? 115  VAL B O   1 
ATOM   2405 C  CB  . VAL B 1 115 ? 17.950  -8.616  -0.672  1.00 21.09 ? 115  VAL B CB  1 
ATOM   2406 C  CG1 . VAL B 1 115 ? 18.682  -7.294  -1.056  1.00 22.70 ? 115  VAL B CG1 1 
ATOM   2407 C  CG2 . VAL B 1 115 ? 18.992  -9.584  -0.244  1.00 21.63 ? 115  VAL B CG2 1 
ATOM   2408 N  N   . ASN B 1 116 ? 14.888  -7.581  -0.568  1.00 21.47 ? 116  ASN B N   1 
ATOM   2409 C  CA  . ASN B 1 116 ? 13.956  -6.551  -0.983  1.00 23.14 ? 116  ASN B CA  1 
ATOM   2410 C  C   . ASN B 1 116 ? 12.747  -6.306  -0.037  1.00 22.36 ? 116  ASN B C   1 
ATOM   2411 O  O   . ASN B 1 116 ? 11.763  -5.686  -0.429  1.00 23.84 ? 116  ASN B O   1 
ATOM   2412 C  CB  . ASN B 1 116 ? 13.457  -6.861  -2.408  1.00 24.83 ? 116  ASN B CB  1 
ATOM   2413 C  CG  . ASN B 1 116 ? 14.611  -6.926  -3.413  1.00 27.71 ? 116  ASN B CG  1 
ATOM   2414 O  OD1 . ASN B 1 116 ? 14.993  -8.005  -3.881  1.00 29.23 ? 116  ASN B OD1 1 
ATOM   2415 N  ND2 . ASN B 1 116 ? 15.199  -5.770  -3.710  1.00 30.02 ? 116  ASN B ND2 1 
ATOM   2416 N  N   . ASN B 1 117 ? 12.821  -6.778  1.192   1.00 21.43 ? 117  ASN B N   1 
ATOM   2417 C  CA  . ASN B 1 117 ? 11.750  -6.567  2.149   1.00 21.16 ? 117  ASN B CA  1 
ATOM   2418 C  C   . ASN B 1 117 ? 12.037  -5.127  2.676   1.00 21.60 ? 117  ASN B C   1 
ATOM   2419 O  O   . ASN B 1 117 ? 12.956  -4.920  3.490   1.00 20.66 ? 117  ASN B O   1 
ATOM   2420 C  CB  . ASN B 1 117 ? 11.866  -7.630  3.235   1.00 18.28 ? 117  ASN B CB  1 
ATOM   2421 C  CG  . ASN B 1 117 ? 10.575  -7.779  4.010   1.00 17.58 ? 117  ASN B CG  1 
ATOM   2422 O  OD1 . ASN B 1 117 ? 9.693   -6.977  3.833   1.00 17.07 ? 117  ASN B OD1 1 
ATOM   2423 N  ND2 . ASN B 1 117 ? 10.458  -8.808  4.842   1.00 16.92 ? 117  ASN B ND2 1 
ATOM   2424 N  N   . PHE B 1 118 ? 11.267  -4.147  2.210   1.00 19.79 ? 118  PHE B N   1 
ATOM   2425 C  CA  . PHE B 1 118 ? 11.547  -2.752  2.514   1.00 19.07 ? 118  PHE B CA  1 
ATOM   2426 C  C   . PHE B 1 118 ? 11.289  -2.293  3.967   1.00 18.98 ? 118  PHE B C   1 
ATOM   2427 O  O   . PHE B 1 118 ? 10.264  -2.595  4.581   1.00 17.35 ? 118  PHE B O   1 
ATOM   2428 C  CB  . PHE B 1 118 ? 10.807  -1.865  1.537   1.00 19.53 ? 118  PHE B CB  1 
ATOM   2429 C  CG  . PHE B 1 118 ? 11.321  -0.459  1.464   1.00 21.45 ? 118  PHE B CG  1 
ATOM   2430 C  CD1 . PHE B 1 118 ? 12.583  -0.181  0.948   1.00 21.02 ? 118  PHE B CD1 1 
ATOM   2431 C  CD2 . PHE B 1 118 ? 10.497  0.618   1.796   1.00 23.08 ? 118  PHE B CD2 1 
ATOM   2432 C  CE1 . PHE B 1 118 ? 13.011  1.138   0.763   1.00 22.02 ? 118  PHE B CE1 1 
ATOM   2433 C  CE2 . PHE B 1 118 ? 10.925  1.948   1.605   1.00 21.73 ? 118  PHE B CE2 1 
ATOM   2434 C  CZ  . PHE B 1 118 ? 12.173  2.210   1.097   1.00 21.47 ? 118  PHE B CZ  1 
ATOM   2435 N  N   . GLY B 1 119 ? 12.255  -1.549  4.499   1.00 17.87 ? 119  GLY B N   1 
ATOM   2436 C  CA  . GLY B 1 119 ? 12.149  -1.051  5.866   1.00 17.41 ? 119  GLY B CA  1 
ATOM   2437 C  C   . GLY B 1 119 ? 12.295  -2.163  6.909   1.00 17.91 ? 119  GLY B C   1 
ATOM   2438 O  O   . GLY B 1 119 ? 12.852  -3.268  6.642   1.00 16.49 ? 119  GLY B O   1 
ATOM   2439 N  N   . SER B 1 120 ? 11.768  -1.878  8.102   1.00 17.93 ? 120  SER B N   1 
ATOM   2440 C  CA  . SER B 1 120 ? 11.832  -2.797  9.210   1.00 15.17 ? 120  SER B CA  1 
ATOM   2441 C  C   . SER B 1 120 ? 10.811  -3.915  8.824   1.00 15.54 ? 120  SER B C   1 
ATOM   2442 O  O   . SER B 1 120 ? 9.644   -3.629  8.577   1.00 13.28 ? 120  SER B O   1 
ATOM   2443 C  CB  . SER B 1 120 ? 11.408  -2.043  10.478  1.00 15.42 ? 120  SER B CB  1 
ATOM   2444 O  OG  . SER B 1 120 ? 12.265  -0.958  10.766  1.00 15.15 ? 120  SER B OG  1 
ATOM   2445 N  N   . SER B 1 121 ? 11.261  -5.163  8.853   1.00 15.85 ? 121  SER B N   1 
ATOM   2446 C  CA  . SER B 1 121 ? 10.455  -6.282  8.420   1.00 16.67 ? 121  SER B CA  1 
ATOM   2447 C  C   . SER B 1 121 ? 11.054  -7.594  8.815   1.00 16.62 ? 121  SER B C   1 
ATOM   2448 O  O   . SER B 1 121 ? 12.187  -7.637  9.295   1.00 16.75 ? 121  SER B O   1 
ATOM   2449 C  CB  . SER B 1 121 ? 10.331  -6.230  6.865   1.00 17.37 ? 121  SER B CB  1 
ATOM   2450 O  OG  . SER B 1 121 ? 11.636  -6.161  6.333   1.00 17.79 ? 121  SER B OG  1 
ATOM   2451 N  N   . TRP B 1 122 ? 10.310  -8.663  8.519   1.00 15.49 ? 122  TRP B N   1 
ATOM   2452 C  CA  . TRP B 1 122 ? 10.671  -10.052 8.807   1.00 15.03 ? 122  TRP B CA  1 
ATOM   2453 C  C   . TRP B 1 122 ? 10.358  -10.864 7.583   1.00 16.59 ? 122  TRP B C   1 
ATOM   2454 O  O   . TRP B 1 122 ? 9.317   -10.620 6.934   1.00 18.22 ? 122  TRP B O   1 
ATOM   2455 C  CB  . TRP B 1 122 ? 9.806   -10.664 9.897   1.00 13.20 ? 122  TRP B CB  1 
ATOM   2456 C  CG  . TRP B 1 122 ? 9.771   -9.938  11.193  1.00 14.47 ? 122  TRP B CG  1 
ATOM   2457 C  CD1 . TRP B 1 122 ? 9.083   -8.795  11.485  1.00 13.75 ? 122  TRP B CD1 1 
ATOM   2458 C  CD2 . TRP B 1 122 ? 10.573  -10.246 12.346  1.00 14.17 ? 122  TRP B CD2 1 
ATOM   2459 N  NE1 . TRP B 1 122 ? 9.427   -8.368  12.771  1.00 12.27 ? 122  TRP B NE1 1 
ATOM   2460 C  CE2 . TRP B 1 122 ? 10.337  -9.244  13.307  1.00 14.54 ? 122  TRP B CE2 1 
ATOM   2461 C  CE3 . TRP B 1 122 ? 11.479  -11.279 12.648  1.00 14.80 ? 122  TRP B CE3 1 
ATOM   2462 C  CZ2 . TRP B 1 122 ? 10.973  -9.230  14.558  1.00 12.43 ? 122  TRP B CZ2 1 
ATOM   2463 C  CZ3 . TRP B 1 122 ? 12.119  -11.265 13.907  1.00 17.25 ? 122  TRP B CZ3 1 
ATOM   2464 C  CH2 . TRP B 1 122 ? 11.847  -10.231 14.838  1.00 15.18 ? 122  TRP B CH2 1 
ATOM   2465 N  N   . THR B 1 123 ? 11.224  -11.808 7.258   1.00 16.01 ? 123  THR B N   1 
ATOM   2466 C  CA  . THR B 1 123 ? 10.956  -12.700 6.129   1.00 16.55 ? 123  THR B CA  1 
ATOM   2467 C  C   . THR B 1 123 ? 10.780  -14.057 6.786   1.00 16.92 ? 123  THR B C   1 
ATOM   2468 O  O   . THR B 1 123 ? 11.661  -14.477 7.568   1.00 17.38 ? 123  THR B O   1 
ATOM   2469 C  CB  . THR B 1 123 ? 12.095  -12.745 5.011   1.00 14.36 ? 123  THR B CB  1 
ATOM   2470 O  OG1 . THR B 1 123 ? 12.019  -11.525 4.289   1.00 12.67 ? 123  THR B OG1 1 
ATOM   2471 C  CG2 . THR B 1 123 ? 11.865  -13.932 4.001   1.00 12.95 ? 123  THR B CG2 1 
ATOM   2472 N  N   . TRP B 1 124 ? 9.651   -14.707 6.450   1.00 14.66 ? 124  TRP B N   1 
ATOM   2473 C  CA  . TRP B 1 124 ? 9.263   -16.001 7.007   1.00 14.01 ? 124  TRP B CA  1 
ATOM   2474 C  C   . TRP B 1 124 ? 9.227   -17.229 6.073   1.00 15.08 ? 124  TRP B C   1 
ATOM   2475 O  O   . TRP B 1 124 ? 8.855   -17.117 4.923   1.00 14.93 ? 124  TRP B O   1 
ATOM   2476 C  CB  . TRP B 1 124 ? 7.816   -15.906 7.636   1.00 14.57 ? 124  TRP B CB  1 
ATOM   2477 C  CG  . TRP B 1 124 ? 7.582   -14.679 8.570   1.00 15.43 ? 124  TRP B CG  1 
ATOM   2478 C  CD1 . TRP B 1 124 ? 7.359   -13.408 8.203   1.00 13.72 ? 124  TRP B CD1 1 
ATOM   2479 C  CD2 . TRP B 1 124 ? 7.593   -14.687 9.999   1.00 15.00 ? 124  TRP B CD2 1 
ATOM   2480 N  NE1 . TRP B 1 124 ? 7.229   -12.597 9.301   1.00 14.89 ? 124  TRP B NE1 1 
ATOM   2481 C  CE2 . TRP B 1 124 ? 7.366   -13.356 10.425  1.00 15.08 ? 124  TRP B CE2 1 
ATOM   2482 C  CE3 . TRP B 1 124 ? 7.770   -15.686 10.957  1.00 14.47 ? 124  TRP B CE3 1 
ATOM   2483 C  CZ2 . TRP B 1 124 ? 7.312   -12.993 11.780  1.00 15.17 ? 124  TRP B CZ2 1 
ATOM   2484 C  CZ3 . TRP B 1 124 ? 7.722   -15.335 12.304  1.00 14.20 ? 124  TRP B CZ3 1 
ATOM   2485 C  CH2 . TRP B 1 124 ? 7.493   -13.991 12.704  1.00 15.09 ? 124  TRP B CH2 1 
ATOM   2486 N  N   . LEU B 1 125 ? 9.588   -18.394 6.614   1.00 16.66 ? 125  LEU B N   1 
ATOM   2487 C  CA  . LEU B 1 125 ? 9.329   -19.667 5.903   1.00 17.66 ? 125  LEU B CA  1 
ATOM   2488 C  C   . LEU B 1 125 ? 7.997   -20.102 6.605   1.00 18.71 ? 125  LEU B C   1 
ATOM   2489 O  O   . LEU B 1 125 ? 7.939   -20.141 7.849   1.00 19.24 ? 125  LEU B O   1 
ATOM   2490 C  CB  . LEU B 1 125 ? 10.386  -20.698 6.206   1.00 13.93 ? 125  LEU B CB  1 
ATOM   2491 C  CG  . LEU B 1 125 ? 10.062  -22.084 5.609   1.00 13.15 ? 125  LEU B CG  1 
ATOM   2492 C  CD1 . LEU B 1 125 ? 9.885   -21.963 4.084   1.00 9.85  ? 125  LEU B CD1 1 
ATOM   2493 C  CD2 . LEU B 1 125 ? 11.166  -23.014 5.946   1.00 10.33 ? 125  LEU B CD2 1 
ATOM   2494 N  N   . VAL B 1 126 ? 6.910   -20.331 5.864   1.00 20.44 ? 126  VAL B N   1 
ATOM   2495 C  CA  . VAL B 1 126 ? 5.696   -20.783 6.556   1.00 19.87 ? 126  VAL B CA  1 
ATOM   2496 C  C   . VAL B 1 126 ? 5.098   -22.022 5.939   1.00 20.84 ? 126  VAL B C   1 
ATOM   2497 O  O   . VAL B 1 126 ? 5.507   -22.427 4.833   1.00 21.39 ? 126  VAL B O   1 
ATOM   2498 C  CB  . VAL B 1 126 ? 4.605   -19.724 6.611   1.00 20.75 ? 126  VAL B CB  1 
ATOM   2499 C  CG1 . VAL B 1 126 ? 5.132   -18.505 7.321   1.00 18.82 ? 126  VAL B CG1 1 
ATOM   2500 C  CG2 . VAL B 1 126 ? 4.137   -19.345 5.221   1.00 20.19 ? 126  VAL B CG2 1 
ATOM   2501 N  N   . LYS B 1 127 ? 4.210   -22.679 6.688   1.00 20.72 ? 127  LYS B N   1 
ATOM   2502 C  CA  . LYS B 1 127 ? 3.542   -23.860 6.178   1.00 22.61 ? 127  LYS B CA  1 
ATOM   2503 C  C   . LYS B 1 127 ? 2.080   -23.458 5.983   1.00 23.06 ? 127  LYS B C   1 
ATOM   2504 O  O   . LYS B 1 127 ? 1.388   -23.039 6.937   1.00 22.23 ? 127  LYS B O   1 
ATOM   2505 C  CB  . LYS B 1 127 ? 3.641   -25.073 7.141   1.00 24.83 ? 127  LYS B CB  1 
ATOM   2506 C  CG  . LYS B 1 127 ? 2.990   -26.378 6.598   1.00 25.89 ? 127  LYS B CG  1 
ATOM   2507 C  CD  . LYS B 1 127 ? 2.963   -27.559 7.542   1.00 29.19 ? 127  LYS B CD  1 
ATOM   2508 C  CE  . LYS B 1 127 ? 2.146   -27.276 8.812   1.00 32.25 ? 127  LYS B CE  1 
ATOM   2509 N  NZ  . LYS B 1 127 ? 0.594   -27.308 8.742   1.00 36.60 ? 127  LYS B NZ  1 
ATOM   2510 N  N   . LEU B 1 128 ? 1.618   -23.600 4.747   1.00 22.77 ? 128  LEU B N   1 
ATOM   2511 C  CA  . LEU B 1 128 ? 0.229   -23.248 4.419   1.00 25.82 ? 128  LEU B CA  1 
ATOM   2512 C  C   . LEU B 1 128 ? -0.787  -24.353 4.713   1.00 26.00 ? 128  LEU B C   1 
ATOM   2513 O  O   . LEU B 1 128 ? -0.433  -25.483 4.981   1.00 23.62 ? 128  LEU B O   1 
ATOM   2514 C  CB  . LEU B 1 128 ? 0.131   -22.866 2.940   1.00 28.02 ? 128  LEU B CB  1 
ATOM   2515 C  CG  . LEU B 1 128 ? 0.554   -21.440 2.526   1.00 29.68 ? 128  LEU B CG  1 
ATOM   2516 C  CD1 . LEU B 1 128 ? 1.597   -20.851 3.413   1.00 32.63 ? 128  LEU B CD1 1 
ATOM   2517 C  CD2 . LEU B 1 128 ? 0.982   -21.516 1.072   1.00 31.23 ? 128  LEU B CD2 1 
ATOM   2518 N  N   . ALA B 1 129 ? -2.061  -24.003 4.630   1.00 29.23 ? 129  ALA B N   1 
ATOM   2519 C  CA  . ALA B 1 129 ? -3.144  -24.970 4.884   1.00 30.53 ? 129  ALA B CA  1 
ATOM   2520 C  C   . ALA B 1 129 ? -2.962  -26.283 4.136   1.00 30.98 ? 129  ALA B C   1 
ATOM   2521 O  O   . ALA B 1 129 ? -3.257  -27.337 4.677   1.00 31.97 ? 129  ALA B O   1 
ATOM   2522 C  CB  . ALA B 1 129 ? -4.530  -24.322 4.536   1.00 30.85 ? 129  ALA B CB  1 
ATOM   2523 N  N   . ASP B 1 130 ? -2.452  -26.241 2.907   1.00 32.14 ? 130  ASP B N   1 
ATOM   2524 C  CA  . ASP B 1 130 ? -2.255  -27.492 2.154   1.00 32.07 ? 130  ASP B CA  1 
ATOM   2525 C  C   . ASP B 1 130 ? -1.062  -28.284 2.591   1.00 31.15 ? 130  ASP B C   1 
ATOM   2526 O  O   . ASP B 1 130 ? -0.823  -29.359 2.049   1.00 30.89 ? 130  ASP B O   1 
ATOM   2527 C  CB  . ASP B 1 130 ? -2.055  -27.229 0.668   1.00 35.93 ? 130  ASP B CB  1 
ATOM   2528 C  CG  . ASP B 1 130 ? -0.881  -26.289 0.399   1.00 37.66 ? 130  ASP B CG  1 
ATOM   2529 O  OD1 . ASP B 1 130 ? -0.326  -25.714 1.346   1.00 39.33 ? 130  ASP B OD1 1 
ATOM   2530 O  OD2 . ASP B 1 130 ? -0.523  -26.117 -0.771  1.00 41.19 ? 130  ASP B OD2 1 
ATOM   2531 N  N   . GLY B 1 131 ? -0.266  -27.763 3.517   1.00 28.82 ? 131  GLY B N   1 
ATOM   2532 C  CA  . GLY B 1 131 ? 0.857   -28.553 3.939   1.00 27.89 ? 131  GLY B CA  1 
ATOM   2533 C  C   . GLY B 1 131 ? 2.107   -28.226 3.147   1.00 27.85 ? 131  GLY B C   1 
ATOM   2534 O  O   . GLY B 1 131 ? 3.183   -28.764 3.423   1.00 26.83 ? 131  GLY B O   1 
ATOM   2535 N  N   . SER B 1 132 ? 1.970   -27.309 2.208   1.00 26.83 ? 132  SER B N   1 
ATOM   2536 C  CA  . SER B 1 132 ? 3.108   -26.922 1.398   1.00 25.94 ? 132  SER B CA  1 
ATOM   2537 C  C   . SER B 1 132 ? 3.817   -25.728 2.063   1.00 26.52 ? 132  SER B C   1 
ATOM   2538 O  O   . SER B 1 132 ? 3.215   -24.985 2.861   1.00 26.17 ? 132  SER B O   1 
ATOM   2539 C  CB  . SER B 1 132 ? 2.659   -26.497 0.010   1.00 26.87 ? 132  SER B CB  1 
ATOM   2540 O  OG  . SER B 1 132 ? 1.926   -25.293 0.081   1.00 25.00 ? 132  SER B OG  1 
ATOM   2541 N  N   . LEU B 1 133 ? 5.097   -25.560 1.739   1.00 24.69 ? 133  LEU B N   1 
ATOM   2542 C  CA  . LEU B 1 133 ? 5.855   -24.441 2.276   1.00 24.26 ? 133  LEU B CA  1 
ATOM   2543 C  C   . LEU B 1 133 ? 5.750   -23.197 1.403   1.00 24.33 ? 133  LEU B C   1 
ATOM   2544 O  O   . LEU B 1 133 ? 5.490   -23.271 0.173   1.00 23.62 ? 133  LEU B O   1 
ATOM   2545 C  CB  . LEU B 1 133 ? 7.328   -24.821 2.375   1.00 22.36 ? 133  LEU B CB  1 
ATOM   2546 C  CG  . LEU B 1 133 ? 7.748   -25.862 3.398   1.00 22.44 ? 133  LEU B CG  1 
ATOM   2547 C  CD1 . LEU B 1 133 ? 9.225   -26.253 3.132   1.00 20.12 ? 133  LEU B CD1 1 
ATOM   2548 C  CD2 . LEU B 1 133 ? 7.527   -25.319 4.830   1.00 22.23 ? 133  LEU B CD2 1 
ATOM   2549 N  N   . ASP B 1 134 ? 5.961   -22.033 2.019   1.00 23.82 ? 134  ASP B N   1 
ATOM   2550 C  CA  . ASP B 1 134 ? 6.009   -20.826 1.240   1.00 23.63 ? 134  ASP B CA  1 
ATOM   2551 C  C   . ASP B 1 134 ? 6.865   -19.787 1.963   1.00 23.26 ? 134  ASP B C   1 
ATOM   2552 O  O   . ASP B 1 134 ? 7.240   -19.961 3.121   1.00 23.33 ? 134  ASP B O   1 
ATOM   2553 C  CB  . ASP B 1 134 ? 4.600   -20.283 1.018   1.00 26.55 ? 134  ASP B CB  1 
ATOM   2554 C  CG  . ASP B 1 134 ? 4.513   -19.333 -0.169  1.00 27.96 ? 134  ASP B CG  1 
ATOM   2555 O  OD1 . ASP B 1 134 ? 5.507   -19.189 -0.908  1.00 26.90 ? 134  ASP B OD1 1 
ATOM   2556 O  OD2 . ASP B 1 134 ? 3.441   -18.734 -0.364  1.00 32.93 ? 134  ASP B OD2 1 
ATOM   2557 N  N   . ILE B 1 135 ? 7.141   -18.688 1.275   1.00 22.76 ? 135  ILE B N   1 
ATOM   2558 C  CA  . ILE B 1 135 ? 7.923   -17.619 1.882   1.00 22.08 ? 135  ILE B CA  1 
ATOM   2559 C  C   . ILE B 1 135 ? 7.069   -16.373 1.876   1.00 22.07 ? 135  ILE B C   1 
ATOM   2560 O  O   . ILE B 1 135 ? 6.527   -15.989 0.846   1.00 22.15 ? 135  ILE B O   1 
ATOM   2561 C  CB  . ILE B 1 135 ? 9.212   -17.277 1.054   1.00 22.01 ? 135  ILE B CB  1 
ATOM   2562 C  CG1 . ILE B 1 135 ? 10.154  -18.488 1.035   1.00 20.42 ? 135  ILE B CG1 1 
ATOM   2563 C  CG2 . ILE B 1 135 ? 9.940   -16.022 1.670   1.00 21.19 ? 135  ILE B CG2 1 
ATOM   2564 C  CD1 . ILE B 1 135 ? 11.128  -18.473 -0.115  1.00 22.38 ? 135  ILE B CD1 1 
ATOM   2565 N  N   . VAL B 1 136 ? 6.967   -15.720 3.021   1.00 19.94 ? 136  VAL B N   1 
ATOM   2566 C  CA  . VAL B 1 136 ? 6.197   -14.482 3.052   1.00 19.65 ? 136  VAL B CA  1 
ATOM   2567 C  C   . VAL B 1 136 ? 6.931   -13.372 3.837   1.00 18.84 ? 136  VAL B C   1 
ATOM   2568 O  O   . VAL B 1 136 ? 7.649   -13.646 4.790   1.00 17.24 ? 136  VAL B O   1 
ATOM   2569 C  CB  . VAL B 1 136 ? 4.793   -14.704 3.692   1.00 20.47 ? 136  VAL B CB  1 
ATOM   2570 C  CG1 . VAL B 1 136 ? 3.959   -15.678 2.774   1.00 21.41 ? 136  VAL B CG1 1 
ATOM   2571 C  CG2 . VAL B 1 136 ? 4.918   -15.261 5.098   1.00 17.14 ? 136  VAL B CG2 1 
ATOM   2572 N  N   . ASN B 1 137 ? 6.713   -12.140 3.431   1.00 17.09 ? 137  ASN B N   1 
ATOM   2573 C  CA  . ASN B 1 137 ? 7.326   -10.987 4.078   1.00 18.26 ? 137  ASN B CA  1 
ATOM   2574 C  C   . ASN B 1 137 ? 6.259   -10.268 4.863   1.00 19.29 ? 137  ASN B C   1 
ATOM   2575 O  O   . ASN B 1 137 ? 5.131   -10.219 4.434   1.00 17.40 ? 137  ASN B O   1 
ATOM   2576 C  CB  . ASN B 1 137 ? 7.905   -9.947  3.050   1.00 18.63 ? 137  ASN B CB  1 
ATOM   2577 C  CG  . ASN B 1 137 ? 9.203   -10.428 2.340   1.00 16.83 ? 137  ASN B CG  1 
ATOM   2578 O  OD1 . ASN B 1 137 ? 9.821   -11.480 2.681   1.00 17.82 ? 137  ASN B OD1 1 
ATOM   2579 N  ND2 . ASN B 1 137 ? 9.624   -9.651  1.379   1.00 17.09 ? 137  ASN B ND2 1 
ATOM   2580 N  N   . THR B 1 138 ? 6.632   -9.741  6.036   1.00 19.40 ? 138  THR B N   1 
ATOM   2581 C  CA  . THR B 1 138 ? 5.740   -8.913  6.850   1.00 18.85 ? 138  THR B CA  1 
ATOM   2582 C  C   . THR B 1 138 ? 6.542   -7.657  7.164   1.00 20.25 ? 138  THR B C   1 
ATOM   2583 O  O   . THR B 1 138 ? 7.799   -7.695  7.201   1.00 19.94 ? 138  THR B O   1 
ATOM   2584 C  CB  . THR B 1 138 ? 5.291   -9.566  8.173   1.00 19.47 ? 138  THR B CB  1 
ATOM   2585 O  OG1 . THR B 1 138 ? 6.424   -9.895  9.007   1.00 18.48 ? 138  THR B OG1 1 
ATOM   2586 C  CG2 . THR B 1 138 ? 4.427   -10.860 7.862   1.00 19.03 ? 138  THR B CG2 1 
ATOM   2587 N  N   . SER B 1 139 ? 5.812   -6.565  7.358   1.00 18.88 ? 139  SER B N   1 
ATOM   2588 C  CA  . SER B 1 139 ? 6.362   -5.260  7.659   1.00 20.07 ? 139  SER B CA  1 
ATOM   2589 C  C   . SER B 1 139 ? 6.197   -4.949  9.165   1.00 20.46 ? 139  SER B C   1 
ATOM   2590 O  O   . SER B 1 139 ? 5.155   -5.273  9.770   1.00 21.38 ? 139  SER B O   1 
ATOM   2591 C  CB  . SER B 1 139 ? 5.635   -4.226  6.775   1.00 20.07 ? 139  SER B CB  1 
ATOM   2592 O  OG  . SER B 1 139 ? 5.806   -2.934  7.291   1.00 20.62 ? 139  SER B OG  1 
ATOM   2593 N  N   . ASN B 1 140 ? 7.238   -4.383  9.770   1.00 18.82 ? 140  ASN B N   1 
ATOM   2594 C  CA  . ASN B 1 140 ? 7.257   -4.023  11.194  1.00 19.70 ? 140  ASN B CA  1 
ATOM   2595 C  C   . ASN B 1 140 ? 7.017   -5.119  12.210  1.00 19.46 ? 140  ASN B C   1 
ATOM   2596 O  O   . ASN B 1 140 ? 7.927   -5.918  12.441  1.00 20.10 ? 140  ASN B O   1 
ATOM   2597 C  CB  . ASN B 1 140 ? 6.313   -2.852  11.444  1.00 18.66 ? 140  ASN B CB  1 
ATOM   2598 C  CG  . ASN B 1 140 ? 6.759   -1.583  10.705  1.00 18.95 ? 140  ASN B CG  1 
ATOM   2599 O  OD1 . ASN B 1 140 ? 6.008   -0.642  10.604  1.00 22.34 ? 140  ASN B OD1 1 
ATOM   2600 N  ND2 . ASN B 1 140 ? 7.990   -1.564  10.201  1.00 18.24 ? 140  ASN B ND2 1 
ATOM   2601 N  N   . ALA B 1 141 ? 5.832   -5.165  12.854  1.00 19.25 ? 141  ALA B N   1 
ATOM   2602 C  CA  . ALA B 1 141 ? 5.569   -6.206  13.826  1.00 18.90 ? 141  ALA B CA  1 
ATOM   2603 C  C   . ALA B 1 141 ? 4.637   -7.273  13.312  1.00 18.74 ? 141  ALA B C   1 
ATOM   2604 O  O   . ALA B 1 141 ? 4.437   -8.243  13.981  1.00 18.11 ? 141  ALA B O   1 
ATOM   2605 C  CB  . ALA B 1 141 ? 5.000   -5.635  15.106  1.00 21.41 ? 141  ALA B CB  1 
ATOM   2606 N  N   . ALA B 1 142 ? 4.075   -7.080  12.125  1.00 18.55 ? 142  ALA B N   1 
ATOM   2607 C  CA  . ALA B 1 142 ? 3.137   -8.060  11.575  1.00 19.77 ? 142  ALA B CA  1 
ATOM   2608 C  C   . ALA B 1 142 ? 3.796   -9.444  11.563  1.00 19.69 ? 142  ALA B C   1 
ATOM   2609 O  O   . ALA B 1 142 ? 5.037   -9.602  11.380  1.00 19.39 ? 142  ALA B O   1 
ATOM   2610 C  CB  . ALA B 1 142 ? 2.680   -7.635  10.139  1.00 18.49 ? 142  ALA B CB  1 
ATOM   2611 N  N   . THR B 1 143 ? 2.965   -10.452 11.741  1.00 20.25 ? 143  THR B N   1 
ATOM   2612 C  CA  . THR B 1 143 ? 3.483   -11.801 11.836  1.00 21.73 ? 143  THR B CA  1 
ATOM   2613 C  C   . THR B 1 143 ? 2.476   -12.847 11.331  1.00 23.09 ? 143  THR B C   1 
ATOM   2614 O  O   . THR B 1 143 ? 1.264   -12.693 11.547  1.00 21.68 ? 143  THR B O   1 
ATOM   2615 C  CB  . THR B 1 143 ? 3.759   -12.118 13.280  1.00 19.76 ? 143  THR B CB  1 
ATOM   2616 O  OG1 . THR B 1 143 ? 3.961   -13.529 13.443  1.00 20.51 ? 143  THR B OG1 1 
ATOM   2617 C  CG2 . THR B 1 143 ? 2.538   -11.691 14.158  1.00 18.50 ? 143  THR B CG2 1 
ATOM   2618 N  N   . PRO B 1 144 ? 2.964   -13.930 10.692  1.00 24.38 ? 144  PRO B N   1 
ATOM   2619 C  CA  . PRO B 1 144 ? 2.012   -14.946 10.222  1.00 26.32 ? 144  PRO B CA  1 
ATOM   2620 C  C   . PRO B 1 144 ? 1.246   -15.594 11.381  1.00 27.02 ? 144  PRO B C   1 
ATOM   2621 O  O   . PRO B 1 144 ? 0.285   -16.314 11.161  1.00 28.43 ? 144  PRO B O   1 
ATOM   2622 C  CB  . PRO B 1 144 ? 2.884   -15.951 9.429   1.00 24.01 ? 144  PRO B CB  1 
ATOM   2623 C  CG  . PRO B 1 144 ? 4.185   -15.852 10.070  1.00 26.61 ? 144  PRO B CG  1 
ATOM   2624 C  CD  . PRO B 1 144 ? 4.353   -14.354 10.458  1.00 25.19 ? 144  PRO B CD  1 
ATOM   2625 N  N   . LEU B 1 145 ? 1.643   -15.345 12.612  1.00 27.75 ? 145  LEU B N   1 
ATOM   2626 C  CA  . LEU B 1 145 ? 0.915   -15.911 13.743  1.00 28.97 ? 145  LEU B CA  1 
ATOM   2627 C  C   . LEU B 1 145 ? -0.579  -15.510 13.697  1.00 29.42 ? 145  LEU B C   1 
ATOM   2628 O  O   . LEU B 1 145 ? -1.447  -16.216 14.208  1.00 29.02 ? 145  LEU B O   1 
ATOM   2629 C  CB  . LEU B 1 145 ? 1.474   -15.368 15.037  1.00 29.07 ? 145  LEU B CB  1 
ATOM   2630 C  CG  . LEU B 1 145 ? 1.601   -16.107 16.368  1.00 32.08 ? 145  LEU B CG  1 
ATOM   2631 C  CD1 . LEU B 1 145 ? 1.479   -15.052 17.512  1.00 30.51 ? 145  LEU B CD1 1 
ATOM   2632 C  CD2 . LEU B 1 145 ? 0.622   -17.248 16.481  1.00 29.83 ? 145  LEU B CD2 1 
ATOM   2633 N  N   . THR B 1 146 ? -0.874  -14.362 13.128  1.00 29.73 ? 146  THR B N   1 
ATOM   2634 C  CA  . THR B 1 146 ? -2.239  -13.952 13.092  1.00 32.43 ? 146  THR B CA  1 
ATOM   2635 C  C   . THR B 1 146 ? -3.001  -14.467 11.905  1.00 34.63 ? 146  THR B C   1 
ATOM   2636 O  O   . THR B 1 146 ? -4.150  -14.078 11.726  1.00 35.53 ? 146  THR B O   1 
ATOM   2637 C  CB  . THR B 1 146 ? -2.380  -12.422 13.152  1.00 31.35 ? 146  THR B CB  1 
ATOM   2638 O  OG1 . THR B 1 146 ? -1.657  -11.814 12.078  1.00 30.89 ? 146  THR B OG1 1 
ATOM   2639 C  CG2 . THR B 1 146 ? -1.885  -11.903 14.524  1.00 33.02 ? 146  THR B CG2 1 
ATOM   2640 N  N   . ASP B 1 147 ? -2.365  -15.315 11.083  1.00 37.12 ? 147  ASP B N   1 
ATOM   2641 C  CA  . ASP B 1 147 ? -3.023  -15.916 9.916   1.00 39.40 ? 147  ASP B CA  1 
ATOM   2642 C  C   . ASP B 1 147 ? -3.537  -17.310 10.202  1.00 39.40 ? 147  ASP B C   1 
ATOM   2643 O  O   . ASP B 1 147 ? -2.753  -18.263 10.318  1.00 38.24 ? 147  ASP B O   1 
ATOM   2644 C  CB  . ASP B 1 147 ? -2.078  -16.014 8.742   1.00 42.85 ? 147  ASP B CB  1 
ATOM   2645 C  CG  . ASP B 1 147 ? -2.043  -14.761 7.957   1.00 46.60 ? 147  ASP B CG  1 
ATOM   2646 O  OD1 . ASP B 1 147 ? -3.149  -14.309 7.615   1.00 49.70 ? 147  ASP B OD1 1 
ATOM   2647 O  OD2 . ASP B 1 147 ? -0.940  -14.212 7.690   1.00 49.52 ? 147  ASP B OD2 1 
ATOM   2648 N  N   . ASP B 1 148 ? -4.851  -17.432 10.301  1.00 38.92 ? 148  ASP B N   1 
ATOM   2649 C  CA  . ASP B 1 148 ? -5.457  -18.730 10.574  1.00 40.20 ? 148  ASP B CA  1 
ATOM   2650 C  C   . ASP B 1 148 ? -4.971  -19.744 9.518   1.00 38.47 ? 148  ASP B C   1 
ATOM   2651 O  O   . ASP B 1 148 ? -4.908  -19.461 8.333   1.00 38.35 ? 148  ASP B O   1 
ATOM   2652 C  CB  . ASP B 1 148 ? -7.016  -18.640 10.529  1.00 42.71 ? 148  ASP B CB  1 
ATOM   2653 C  CG  . ASP B 1 148 ? -7.590  -17.586 11.499  1.00 45.89 ? 148  ASP B CG  1 
ATOM   2654 O  OD1 . ASP B 1 148 ? -7.206  -17.595 12.690  1.00 46.99 ? 148  ASP B OD1 1 
ATOM   2655 O  OD2 . ASP B 1 148 ? -8.437  -16.749 11.073  1.00 47.36 ? 148  ASP B OD2 1 
ATOM   2656 N  N   . GLY B 1 149 ? -4.607  -20.928 9.947   1.00 37.97 ? 149  GLY B N   1 
ATOM   2657 C  CA  . GLY B 1 149 ? -4.153  -21.883 8.957   1.00 39.15 ? 149  GLY B CA  1 
ATOM   2658 C  C   . GLY B 1 149 ? -2.828  -21.607 8.266   1.00 39.02 ? 149  GLY B C   1 
ATOM   2659 O  O   . GLY B 1 149 ? -2.564  -22.146 7.197   1.00 41.23 ? 149  GLY B O   1 
ATOM   2660 N  N   . VAL B 1 150 ? -1.998  -20.745 8.832   1.00 37.35 ? 150  VAL B N   1 
ATOM   2661 C  CA  . VAL B 1 150 ? -0.666  -20.522 8.254   1.00 34.86 ? 150  VAL B CA  1 
ATOM   2662 C  C   . VAL B 1 150 ? 0.290   -20.740 9.430   1.00 33.46 ? 150  VAL B C   1 
ATOM   2663 O  O   . VAL B 1 150 ? 0.251   -19.961 10.379  1.00 35.17 ? 150  VAL B O   1 
ATOM   2664 C  CB  . VAL B 1 150 ? -0.502  -19.107 7.732   1.00 34.69 ? 150  VAL B CB  1 
ATOM   2665 C  CG1 . VAL B 1 150 ? 0.960   -18.858 7.366   1.00 35.35 ? 150  VAL B CG1 1 
ATOM   2666 C  CG2 . VAL B 1 150 ? -1.393  -18.907 6.542   1.00 35.12 ? 150  VAL B CG2 1 
ATOM   2667 N  N   . THR B 1 151 ? 1.105   -21.799 9.384   1.00 30.62 ? 151  THR B N   1 
ATOM   2668 C  CA  . THR B 1 151 ? 2.053   -22.129 10.447  1.00 27.75 ? 151  THR B CA  1 
ATOM   2669 C  C   . THR B 1 151 ? 3.487   -21.587 10.224  1.00 27.03 ? 151  THR B C   1 
ATOM   2670 O  O   . THR B 1 151 ? 4.178   -21.984 9.277   1.00 26.36 ? 151  THR B O   1 
ATOM   2671 C  CB  . THR B 1 151 ? 2.167   -23.674 10.661  1.00 27.67 ? 151  THR B CB  1 
ATOM   2672 O  OG1 . THR B 1 151 ? 0.904   -24.206 11.050  1.00 28.35 ? 151  THR B OG1 1 
ATOM   2673 C  CG2 . THR B 1 151 ? 3.168   -24.003 11.771  1.00 26.49 ? 151  THR B CG2 1 
ATOM   2674 N  N   . PRO B 1 152 ? 3.966   -20.723 11.141  1.00 25.02 ? 152  PRO B N   1 
ATOM   2675 C  CA  . PRO B 1 152 ? 5.307   -20.148 11.027  1.00 23.36 ? 152  PRO B CA  1 
ATOM   2676 C  C   . PRO B 1 152 ? 6.299   -21.243 11.236  1.00 22.67 ? 152  PRO B C   1 
ATOM   2677 O  O   . PRO B 1 152 ? 6.146   -22.061 12.145  1.00 22.49 ? 152  PRO B O   1 
ATOM   2678 C  CB  . PRO B 1 152 ? 5.372   -19.147 12.188  1.00 24.23 ? 152  PRO B CB  1 
ATOM   2679 C  CG  . PRO B 1 152 ? 3.882   -18.865 12.523  1.00 25.21 ? 152  PRO B CG  1 
ATOM   2680 C  CD  . PRO B 1 152 ? 3.318   -20.274 12.387  1.00 25.21 ? 152  PRO B CD  1 
ATOM   2681 N  N   . ILE B 1 153 ? 7.309   -21.325 10.395  1.00 20.85 ? 153  ILE B N   1 
ATOM   2682 C  CA  . ILE B 1 153 ? 8.280   -22.365 10.681  1.00 21.31 ? 153  ILE B CA  1 
ATOM   2683 C  C   . ILE B 1 153 ? 9.720   -21.811 10.960  1.00 18.03 ? 153  ILE B C   1 
ATOM   2684 O  O   . ILE B 1 153 ? 10.461  -22.413 11.712  1.00 18.02 ? 153  ILE B O   1 
ATOM   2685 C  CB  . ILE B 1 153 ? 8.261   -23.506 9.608   1.00 23.19 ? 153  ILE B CB  1 
ATOM   2686 C  CG1 . ILE B 1 153 ? 9.325   -23.318 8.619   1.00 25.01 ? 153  ILE B CG1 1 
ATOM   2687 C  CG2 . ILE B 1 153 ? 6.843   -23.773 9.012   1.00 23.86 ? 153  ILE B CG2 1 
ATOM   2688 C  CD1 . ILE B 1 153 ? 10.476  -24.177 9.005   1.00 26.99 ? 153  ILE B CD1 1 
ATOM   2689 N  N   . LEU B 1 154 ? 10.090  -20.692 10.347  1.00 16.84 ? 154  LEU B N   1 
ATOM   2690 C  CA  . LEU B 1 154 ? 11.396  -20.083 10.606  1.00 15.80 ? 154  LEU B CA  1 
ATOM   2691 C  C   . LEU B 1 154 ? 11.225  -18.603 10.265  1.00 17.81 ? 154  LEU B C   1 
ATOM   2692 O  O   . LEU B 1 154 ? 10.325  -18.230 9.462   1.00 17.73 ? 154  LEU B O   1 
ATOM   2693 C  CB  . LEU B 1 154 ? 12.415  -20.714 9.716   1.00 16.05 ? 154  LEU B CB  1 
ATOM   2694 C  CG  . LEU B 1 154 ? 13.709  -21.433 10.057  1.00 18.58 ? 154  LEU B CG  1 
ATOM   2695 C  CD1 . LEU B 1 154 ? 13.776  -22.073 11.335  1.00 15.38 ? 154  LEU B CD1 1 
ATOM   2696 C  CD2 . LEU B 1 154 ? 14.071  -22.295 8.838   1.00 16.03 ? 154  LEU B CD2 1 
ATOM   2697 N  N   . THR B 1 155 ? 12.008  -17.732 10.918  1.00 16.78 ? 155  THR B N   1 
ATOM   2698 C  CA  . THR B 1 155 ? 11.942  -16.330 10.579  1.00 15.68 ? 155  THR B CA  1 
ATOM   2699 C  C   . THR B 1 155 ? 13.306  -15.694 10.552  1.00 16.39 ? 155  THR B C   1 
ATOM   2700 O  O   . THR B 1 155 ? 14.253  -16.172 11.243  1.00 15.71 ? 155  THR B O   1 
ATOM   2701 C  CB  . THR B 1 155 ? 11.075  -15.510 11.550  1.00 14.70 ? 155  THR B CB  1 
ATOM   2702 O  OG1 . THR B 1 155 ? 10.699  -14.302 10.869  1.00 16.32 ? 155  THR B OG1 1 
ATOM   2703 C  CG2 . THR B 1 155 ? 11.857  -15.072 12.825  1.00 12.72 ? 155  THR B CG2 1 
ATOM   2704 N  N   . VAL B 1 156 ? 13.430  -14.630 9.754   1.00 17.13 ? 156  VAL B N   1 
ATOM   2705 C  CA  . VAL B 1 156 ? 14.700  -13.882 9.785   1.00 17.78 ? 156  VAL B CA  1 
ATOM   2706 C  C   . VAL B 1 156 ? 14.377  -12.407 9.968   1.00 16.26 ? 156  VAL B C   1 
ATOM   2707 O  O   . VAL B 1 156 ? 13.625  -11.792 9.220   1.00 16.71 ? 156  VAL B O   1 
ATOM   2708 C  CB  . VAL B 1 156 ? 15.638  -14.167 8.554   1.00 18.71 ? 156  VAL B CB  1 
ATOM   2709 C  CG1 . VAL B 1 156 ? 14.891  -13.994 7.282   1.00 21.58 ? 156  VAL B CG1 1 
ATOM   2710 C  CG2 . VAL B 1 156 ? 16.906  -13.214 8.589   1.00 20.99 ? 156  VAL B CG2 1 
ATOM   2711 N  N   . ASP B 1 157 ? 14.937  -11.862 11.016  1.00 16.91 ? 157  ASP B N   1 
ATOM   2712 C  CA  . ASP B 1 157 ? 14.689  -10.482 11.378  1.00 16.66 ? 157  ASP B CA  1 
ATOM   2713 C  C   . ASP B 1 157 ? 15.421  -9.602  10.418  1.00 17.00 ? 157  ASP B C   1 
ATOM   2714 O  O   . ASP B 1 157 ? 16.633  -9.753  10.247  1.00 15.85 ? 157  ASP B O   1 
ATOM   2715 C  CB  . ASP B 1 157 ? 15.219  -10.239 12.797  1.00 19.33 ? 157  ASP B CB  1 
ATOM   2716 C  CG  . ASP B 1 157 ? 14.725  -8.887  13.423  1.00 18.51 ? 157  ASP B CG  1 
ATOM   2717 O  OD1 . ASP B 1 157 ? 13.992  -8.081  12.772  1.00 16.72 ? 157  ASP B OD1 1 
ATOM   2718 O  OD2 . ASP B 1 157 ? 15.077  -8.699  14.594  1.00 19.75 ? 157  ASP B OD2 1 
ATOM   2719 N  N   . LEU B 1 158 ? 14.698  -8.683  9.769   1.00 16.70 ? 158  LEU B N   1 
ATOM   2720 C  CA  . LEU B 1 158 ? 15.359  -7.782  8.855   1.00 17.01 ? 158  LEU B CA  1 
ATOM   2721 C  C   . LEU B 1 158 ? 15.380  -6.304  9.362   1.00 15.81 ? 158  LEU B C   1 
ATOM   2722 O  O   . LEU B 1 158 ? 15.759  -5.392  8.628   1.00 16.20 ? 158  LEU B O   1 
ATOM   2723 C  CB  . LEU B 1 158 ? 14.739  -7.867  7.466   1.00 18.89 ? 158  LEU B CB  1 
ATOM   2724 C  CG  . LEU B 1 158 ? 15.185  -8.854  6.397   1.00 21.53 ? 158  LEU B CG  1 
ATOM   2725 C  CD1 . LEU B 1 158 ? 16.520  -9.427  6.724   1.00 21.94 ? 158  LEU B CD1 1 
ATOM   2726 C  CD2 . LEU B 1 158 ? 14.132  -9.872  6.140   1.00 24.55 ? 158  LEU B CD2 1 
ATOM   2727 N  N   . TRP B 1 159 ? 14.951  -6.055  10.599  1.00 14.56 ? 159  TRP B N   1 
ATOM   2728 C  CA  . TRP B 1 159 ? 15.091  -4.700  11.119  1.00 13.41 ? 159  TRP B CA  1 
ATOM   2729 C  C   . TRP B 1 159 ? 16.623  -4.459  11.095  1.00 13.50 ? 159  TRP B C   1 
ATOM   2730 O  O   . TRP B 1 159 ? 17.406  -5.411  11.319  1.00 11.41 ? 159  TRP B O   1 
ATOM   2731 C  CB  . TRP B 1 159 ? 14.594  -4.654  12.552  1.00 14.46 ? 159  TRP B CB  1 
ATOM   2732 C  CG  . TRP B 1 159 ? 13.119  -4.542  12.682  1.00 12.99 ? 159  TRP B CG  1 
ATOM   2733 C  CD1 . TRP B 1 159 ? 12.177  -5.436  12.230  1.00 14.70 ? 159  TRP B CD1 1 
ATOM   2734 C  CD2 . TRP B 1 159 ? 12.411  -3.545  13.437  1.00 14.03 ? 159  TRP B CD2 1 
ATOM   2735 N  NE1 . TRP B 1 159 ? 10.917  -5.057  12.687  1.00 15.14 ? 159  TRP B NE1 1 
ATOM   2736 C  CE2 . TRP B 1 159 ? 11.043  -3.907  13.434  1.00 14.52 ? 159  TRP B CE2 1 
ATOM   2737 C  CE3 . TRP B 1 159 ? 12.809  -2.392  14.133  1.00 13.42 ? 159  TRP B CE3 1 
ATOM   2738 C  CZ2 . TRP B 1 159 ? 10.081  -3.167  14.090  1.00 13.57 ? 159  TRP B CZ2 1 
ATOM   2739 C  CZ3 . TRP B 1 159 ? 11.849  -1.642  14.776  1.00 14.36 ? 159  TRP B CZ3 1 
ATOM   2740 C  CH2 . TRP B 1 159 ? 10.470  -2.052  14.745  1.00 13.66 ? 159  TRP B CH2 1 
ATOM   2741 N  N   . GLU B 1 160 ? 17.050  -3.229  10.811  1.00 13.22 ? 160  GLU B N   1 
ATOM   2742 C  CA  . GLU B 1 160 ? 18.471  -2.931  10.753  1.00 12.72 ? 160  GLU B CA  1 
ATOM   2743 C  C   . GLU B 1 160 ? 19.242  -3.224  12.028  1.00 13.45 ? 160  GLU B C   1 
ATOM   2744 O  O   . GLU B 1 160 ? 20.419  -3.559  11.932  1.00 13.04 ? 160  GLU B O   1 
ATOM   2745 C  CB  . GLU B 1 160 ? 18.710  -1.469  10.347  1.00 14.39 ? 160  GLU B CB  1 
ATOM   2746 C  CG  . GLU B 1 160 ? 18.189  -1.185  8.958   1.00 13.45 ? 160  GLU B CG  1 
ATOM   2747 C  CD  . GLU B 1 160 ? 18.354  0.271   8.490   1.00 14.40 ? 160  GLU B CD  1 
ATOM   2748 O  OE1 . GLU B 1 160 ? 18.006  1.230   9.221   1.00 15.45 ? 160  GLU B OE1 1 
ATOM   2749 O  OE2 . GLU B 1 160 ? 18.791  0.418   7.339   1.00 14.25 ? 160  GLU B OE2 1 
ATOM   2750 N  N   . HIS B 1 161 ? 18.625  -3.091  13.201  1.00 12.22 ? 161  HIS B N   1 
ATOM   2751 C  CA  . HIS B 1 161 ? 19.310  -3.411  14.441  1.00 14.87 ? 161  HIS B CA  1 
ATOM   2752 C  C   . HIS B 1 161 ? 19.755  -4.862  14.512  1.00 15.76 ? 161  HIS B C   1 
ATOM   2753 O  O   . HIS B 1 161 ? 20.687  -5.196  15.236  1.00 16.16 ? 161  HIS B O   1 
ATOM   2754 C  CB  . HIS B 1 161 ? 18.449  -3.064  15.695  1.00 13.41 ? 161  HIS B CB  1 
ATOM   2755 C  CG  . HIS B 1 161 ? 17.182  -3.867  15.828  1.00 16.03 ? 161  HIS B CG  1 
ATOM   2756 N  ND1 . HIS B 1 161 ? 15.939  -3.264  15.946  1.00 17.31 ? 161  HIS B ND1 1 
ATOM   2757 C  CD2 . HIS B 1 161 ? 16.963  -5.208  15.942  1.00 14.01 ? 161  HIS B CD2 1 
ATOM   2758 C  CE1 . HIS B 1 161 ? 15.009  -4.196  16.114  1.00 14.50 ? 161  HIS B CE1 1 
ATOM   2759 N  NE2 . HIS B 1 161 ? 15.601  -5.380  16.119  1.00 15.45 ? 161  HIS B NE2 1 
ATOM   2760 N  N   . ALA B 1 162 ? 19.110  -5.734  13.745  1.00 15.39 ? 162  ALA B N   1 
ATOM   2761 C  CA  . ALA B 1 162 ? 19.498  -7.146  13.756  1.00 14.35 ? 162  ALA B CA  1 
ATOM   2762 C  C   . ALA B 1 162 ? 20.908  -7.407  13.143  1.00 14.51 ? 162  ALA B C   1 
ATOM   2763 O  O   . ALA B 1 162 ? 21.574  -8.407  13.491  1.00 13.78 ? 162  ALA B O   1 
ATOM   2764 C  CB  . ALA B 1 162 ? 18.437  -7.999  12.997  1.00 14.22 ? 162  ALA B CB  1 
ATOM   2765 N  N   . TYR B 1 163 ? 21.350  -6.511  12.256  1.00 13.62 ? 163  TYR B N   1 
ATOM   2766 C  CA  . TYR B 1 163 ? 22.598  -6.758  11.572  1.00 13.14 ? 163  TYR B CA  1 
ATOM   2767 C  C   . TYR B 1 163 ? 23.515  -5.547  11.417  1.00 13.05 ? 163  TYR B C   1 
ATOM   2768 O  O   . TYR B 1 163 ? 24.632  -5.678  10.986  1.00 13.09 ? 163  TYR B O   1 
ATOM   2769 C  CB  . TYR B 1 163 ? 22.267  -7.336  10.172  1.00 13.95 ? 163  TYR B CB  1 
ATOM   2770 C  CG  . TYR B 1 163 ? 21.422  -6.410  9.247   1.00 14.66 ? 163  TYR B CG  1 
ATOM   2771 C  CD1 . TYR B 1 163 ? 21.979  -5.281  8.622   1.00 12.68 ? 163  TYR B CD1 1 
ATOM   2772 C  CD2 . TYR B 1 163 ? 20.039  -6.653  9.056   1.00 14.20 ? 163  TYR B CD2 1 
ATOM   2773 C  CE1 . TYR B 1 163 ? 21.187  -4.427  7.820   1.00 14.54 ? 163  TYR B CE1 1 
ATOM   2774 C  CE2 . TYR B 1 163 ? 19.263  -5.814  8.287   1.00 14.86 ? 163  TYR B CE2 1 
ATOM   2775 C  CZ  . TYR B 1 163 ? 19.825  -4.708  7.643   1.00 16.74 ? 163  TYR B CZ  1 
ATOM   2776 O  OH  . TYR B 1 163 ? 19.041  -3.984  6.725   1.00 16.01 ? 163  TYR B OH  1 
ATOM   2777 N  N   . TYR B 1 164 ? 23.054  -4.362  11.746  1.00 13.10 ? 164  TYR B N   1 
ATOM   2778 C  CA  . TYR B 1 164 ? 23.885  -3.169  11.504  1.00 15.15 ? 164  TYR B CA  1 
ATOM   2779 C  C   . TYR B 1 164 ? 25.273  -3.122  12.165  1.00 15.94 ? 164  TYR B C   1 
ATOM   2780 O  O   . TYR B 1 164 ? 26.217  -2.653  11.566  1.00 16.85 ? 164  TYR B O   1 
ATOM   2781 C  CB  . TYR B 1 164 ? 23.120  -1.892  11.858  1.00 13.17 ? 164  TYR B CB  1 
ATOM   2782 C  CG  . TYR B 1 164 ? 23.341  -0.798  10.861  1.00 12.62 ? 164  TYR B CG  1 
ATOM   2783 C  CD1 . TYR B 1 164 ? 22.786  -0.872  9.563   1.00 12.05 ? 164  TYR B CD1 1 
ATOM   2784 C  CD2 . TYR B 1 164 ? 24.213  0.264   11.144  1.00 13.91 ? 164  TYR B CD2 1 
ATOM   2785 C  CE1 . TYR B 1 164 ? 23.145  0.080   8.574   1.00 10.24 ? 164  TYR B CE1 1 
ATOM   2786 C  CE2 . TYR B 1 164 ? 24.531  1.221   10.163  1.00 11.11 ? 164  TYR B CE2 1 
ATOM   2787 C  CZ  . TYR B 1 164 ? 23.990  1.097   8.898   1.00 13.29 ? 164  TYR B CZ  1 
ATOM   2788 O  OH  . TYR B 1 164 ? 24.285  2.065   7.963   1.00 13.32 ? 164  TYR B OH  1 
ATOM   2789 N  N   . ILE B 1 165 ? 25.364  -3.601  13.397  1.00 16.68 ? 165  ILE B N   1 
ATOM   2790 C  CA  . ILE B 1 165 ? 26.644  -3.651  14.079  1.00 16.86 ? 165  ILE B CA  1 
ATOM   2791 C  C   . ILE B 1 165 ? 27.662  -4.497  13.379  1.00 16.43 ? 165  ILE B C   1 
ATOM   2792 O  O   . ILE B 1 165 ? 28.807  -4.118  13.290  1.00 17.86 ? 165  ILE B O   1 
ATOM   2793 C  CB  . ILE B 1 165 ? 26.478  -4.200  15.526  1.00 17.23 ? 165  ILE B CB  1 
ATOM   2794 C  CG1 . ILE B 1 165 ? 25.500  -3.259  16.249  1.00 16.41 ? 165  ILE B CG1 1 
ATOM   2795 C  CG2 . ILE B 1 165 ? 27.848  -4.275  16.232  1.00 15.43 ? 165  ILE B CG2 1 
ATOM   2796 C  CD1 . ILE B 1 165 ? 25.022  -3.770  17.537  1.00 14.58 ? 165  ILE B CD1 1 
ATOM   2797 N  N   . ASP B 1 166 ? 27.238  -5.644  12.887  1.00 17.07 ? 166  ASP B N   1 
ATOM   2798 C  CA  . ASP B 1 166 ? 28.132  -6.605  12.221  1.00 18.70 ? 166  ASP B CA  1 
ATOM   2799 C  C   . ASP B 1 166 ? 28.291  -6.404  10.734  1.00 19.45 ? 166  ASP B C   1 
ATOM   2800 O  O   . ASP B 1 166 ? 29.331  -6.702  10.183  1.00 19.95 ? 166  ASP B O   1 
ATOM   2801 C  CB  . ASP B 1 166 ? 27.622  -8.046  12.443  1.00 17.64 ? 166  ASP B CB  1 
ATOM   2802 C  CG  . ASP B 1 166 ? 27.481  -8.373  13.904  1.00 20.04 ? 166  ASP B CG  1 
ATOM   2803 O  OD1 . ASP B 1 166 ? 28.352  -7.795  14.681  1.00 19.33 ? 166  ASP B OD1 1 
ATOM   2804 O  OD2 . ASP B 1 166 ? 26.505  -9.161  14.300  1.00 16.88 ? 166  ASP B OD2 1 
ATOM   2805 N  N   . TYR B 1 167 ? 27.269  -5.854  10.090  1.00 18.54 ? 167  TYR B N   1 
ATOM   2806 C  CA  . TYR B 1 167 ? 27.285  -5.769  8.656   1.00 18.33 ? 167  TYR B CA  1 
ATOM   2807 C  C   . TYR B 1 167 ? 26.902  -4.404  8.045   1.00 17.34 ? 167  TYR B C   1 
ATOM   2808 O  O   . TYR B 1 167 ? 26.883  -4.294  6.845   1.00 16.92 ? 167  TYR B O   1 
ATOM   2809 C  CB  . TYR B 1 167 ? 26.307  -6.843  8.125   1.00 20.29 ? 167  TYR B CB  1 
ATOM   2810 C  CG  . TYR B 1 167 ? 26.668  -8.257  8.506   1.00 19.42 ? 167  TYR B CG  1 
ATOM   2811 C  CD1 . TYR B 1 167 ? 27.756  -8.903  7.896   1.00 20.64 ? 167  TYR B CD1 1 
ATOM   2812 C  CD2 . TYR B 1 167 ? 25.932  -8.956  9.482   1.00 21.63 ? 167  TYR B CD2 1 
ATOM   2813 C  CE1 . TYR B 1 167 ? 28.118  -10.205 8.254   1.00 19.35 ? 167  TYR B CE1 1 
ATOM   2814 C  CE2 . TYR B 1 167 ? 26.293  -10.285 9.851   1.00 20.59 ? 167  TYR B CE2 1 
ATOM   2815 C  CZ  . TYR B 1 167 ? 27.391  -10.870 9.220   1.00 20.57 ? 167  TYR B CZ  1 
ATOM   2816 O  OH  . TYR B 1 167 ? 27.803  -12.097 9.563   1.00 22.55 ? 167  TYR B OH  1 
ATOM   2817 N  N   . ARG B 1 168 ? 26.574  -3.426  8.881   1.00 16.19 ? 168  ARG B N   1 
ATOM   2818 C  CA  . ARG B 1 168 ? 26.164  -2.120  8.444   1.00 16.85 ? 168  ARG B CA  1 
ATOM   2819 C  C   . ARG B 1 168 ? 25.055  -2.293  7.424   1.00 16.56 ? 168  ARG B C   1 
ATOM   2820 O  O   . ARG B 1 168 ? 24.116  -3.041  7.673   1.00 16.55 ? 168  ARG B O   1 
ATOM   2821 C  CB  . ARG B 1 168 ? 27.374  -1.365  7.860   1.00 16.00 ? 168  ARG B CB  1 
ATOM   2822 C  CG  . ARG B 1 168 ? 28.407  -0.968  8.959   1.00 16.74 ? 168  ARG B CG  1 
ATOM   2823 C  CD  . ARG B 1 168 ? 27.967  0.149   9.935   1.00 14.91 ? 168  ARG B CD  1 
ATOM   2824 N  NE  . ARG B 1 168 ? 29.088  0.506   10.840  1.00 17.06 ? 168  ARG B NE  1 
ATOM   2825 C  CZ  . ARG B 1 168 ? 29.374  -0.112  11.999  1.00 19.25 ? 168  ARG B CZ  1 
ATOM   2826 N  NH1 . ARG B 1 168 ? 28.608  -1.137  12.500  1.00 15.43 ? 168  ARG B NH1 1 
ATOM   2827 N  NH2 . ARG B 1 168 ? 30.490  0.207   12.627  1.00 17.13 ? 168  ARG B NH2 1 
ATOM   2828 N  N   . ASN B 1 169 ? 25.206  -1.646  6.279   1.00 15.33 ? 169  ASN B N   1 
ATOM   2829 C  CA  . ASN B 1 169 ? 24.209  -1.695  5.215   1.00 19.42 ? 169  ASN B CA  1 
ATOM   2830 C  C   . ASN B 1 169 ? 24.137  -2.939  4.361   1.00 19.82 ? 169  ASN B C   1 
ATOM   2831 O  O   . ASN B 1 169 ? 23.211  -3.065  3.588   1.00 20.36 ? 169  ASN B O   1 
ATOM   2832 C  CB  . ASN B 1 169 ? 24.362  -0.502  4.249   1.00 19.61 ? 169  ASN B CB  1 
ATOM   2833 C  CG  . ASN B 1 169 ? 25.641  -0.569  3.443   1.00 21.46 ? 169  ASN B CG  1 
ATOM   2834 O  OD1 . ASN B 1 169 ? 26.715  -0.571  3.996   1.00 21.56 ? 169  ASN B OD1 1 
ATOM   2835 N  ND2 . ASN B 1 169 ? 25.521  -0.606  2.139   1.00 19.62 ? 169  ASN B ND2 1 
ATOM   2836 N  N   . VAL B 1 170 ? 25.042  -3.894  4.548   1.00 20.33 ? 170  VAL B N   1 
ATOM   2837 C  CA  . VAL B 1 170 ? 25.039  -5.080  3.673   1.00 20.29 ? 170  VAL B CA  1 
ATOM   2838 C  C   . VAL B 1 170 ? 24.173  -6.304  4.090   1.00 20.80 ? 170  VAL B C   1 
ATOM   2839 O  O   . VAL B 1 170 ? 24.693  -7.248  4.703   1.00 20.17 ? 170  VAL B O   1 
ATOM   2840 C  CB  . VAL B 1 170 ? 26.526  -5.576  3.447   1.00 20.47 ? 170  VAL B CB  1 
ATOM   2841 C  CG1 . VAL B 1 170 ? 26.576  -6.415  2.118   1.00 19.92 ? 170  VAL B CG1 1 
ATOM   2842 C  CG2 . VAL B 1 170 ? 27.466  -4.399  3.362   1.00 20.18 ? 170  VAL B CG2 1 
ATOM   2843 N  N   . ARG B 1 171 ? 22.878  -6.300  3.735   1.00 21.34 ? 171  ARG B N   1 
ATOM   2844 C  CA  . ARG B 1 171 ? 21.949  -7.408  4.056   1.00 21.63 ? 171  ARG B CA  1 
ATOM   2845 C  C   . ARG B 1 171 ? 22.394  -8.708  3.434   1.00 20.55 ? 171  ARG B C   1 
ATOM   2846 O  O   . ARG B 1 171 ? 22.137  -9.763  3.985   1.00 21.22 ? 171  ARG B O   1 
ATOM   2847 C  CB  . ARG B 1 171 ? 20.539  -7.188  3.500   1.00 22.43 ? 171  ARG B CB  1 
ATOM   2848 C  CG  . ARG B 1 171 ? 19.683  -6.315  4.334   1.00 22.36 ? 171  ARG B CG  1 
ATOM   2849 C  CD  . ARG B 1 171 ? 18.230  -6.470  4.014   1.00 19.95 ? 171  ARG B CD  1 
ATOM   2850 N  NE  . ARG B 1 171 ? 17.524  -5.442  4.762   1.00 20.32 ? 171  ARG B NE  1 
ATOM   2851 C  CZ  . ARG B 1 171 ? 16.256  -5.142  4.594   1.00 21.68 ? 171  ARG B CZ  1 
ATOM   2852 N  NH1 . ARG B 1 171 ? 15.521  -5.786  3.703   1.00 20.11 ? 171  ARG B NH1 1 
ATOM   2853 N  NH2 . ARG B 1 171 ? 15.712  -4.208  5.360   1.00 22.82 ? 171  ARG B NH2 1 
ATOM   2854 N  N   . PRO B 1 172 ? 22.993  -8.647  2.221   1.00 20.27 ? 172  PRO B N   1 
ATOM   2855 C  CA  . PRO B 1 172 ? 23.387  -9.962  1.692   1.00 19.62 ? 172  PRO B CA  1 
ATOM   2856 C  C   . PRO B 1 172 ? 24.381  -10.683 2.624   1.00 19.06 ? 172  PRO B C   1 
ATOM   2857 O  O   . PRO B 1 172 ? 24.335  -11.920 2.779   1.00 18.36 ? 172  PRO B O   1 
ATOM   2858 C  CB  . PRO B 1 172 ? 23.961  -9.619  0.305   1.00 20.14 ? 172  PRO B CB  1 
ATOM   2859 C  CG  . PRO B 1 172 ? 23.116  -8.395  -0.126  1.00 20.96 ? 172  PRO B CG  1 
ATOM   2860 C  CD  . PRO B 1 172 ? 23.016  -7.596  1.162   1.00 18.09 ? 172  PRO B CD  1 
ATOM   2861 N  N   . ASP B 1 173 ? 25.291  -9.919  3.228   1.00 17.96 ? 173  ASP B N   1 
ATOM   2862 C  CA  . ASP B 1 173 ? 26.272  -10.565 4.119   1.00 16.69 ? 173  ASP B CA  1 
ATOM   2863 C  C   . ASP B 1 173 ? 25.589  -11.110 5.359   1.00 16.19 ? 173  ASP B C   1 
ATOM   2864 O  O   . ASP B 1 173 ? 25.906  -12.218 5.828   1.00 13.82 ? 173  ASP B O   1 
ATOM   2865 C  CB  . ASP B 1 173 ? 27.395  -9.629  4.514   1.00 18.69 ? 173  ASP B CB  1 
ATOM   2866 C  CG  . ASP B 1 173 ? 28.292  -9.239  3.308   1.00 20.78 ? 173  ASP B CG  1 
ATOM   2867 O  OD1 . ASP B 1 173 ? 28.324  -9.948  2.302   1.00 19.14 ? 173  ASP B OD1 1 
ATOM   2868 O  OD2 . ASP B 1 173 ? 28.957  -8.209  3.387   1.00 24.11 ? 173  ASP B OD2 1 
ATOM   2869 N  N   . TYR B 1 174 ? 24.659  -10.330 5.894   1.00 15.47 ? 174  TYR B N   1 
ATOM   2870 C  CA  . TYR B 1 174 ? 23.868  -10.791 7.014   1.00 15.20 ? 174  TYR B CA  1 
ATOM   2871 C  C   . TYR B 1 174 ? 23.135  -12.109 6.624   1.00 16.58 ? 174  TYR B C   1 
ATOM   2872 O  O   . TYR B 1 174 ? 23.084  -13.070 7.404   1.00 17.42 ? 174  TYR B O   1 
ATOM   2873 C  CB  . TYR B 1 174 ? 22.872  -9.689  7.383   1.00 15.95 ? 174  TYR B CB  1 
ATOM   2874 C  CG  . TYR B 1 174 ? 21.752  -10.124 8.319   1.00 14.05 ? 174  TYR B CG  1 
ATOM   2875 C  CD1 . TYR B 1 174 ? 22.037  -10.656 9.583   1.00 12.92 ? 174  TYR B CD1 1 
ATOM   2876 C  CD2 . TYR B 1 174 ? 20.410  -9.941  7.950   1.00 13.73 ? 174  TYR B CD2 1 
ATOM   2877 C  CE1 . TYR B 1 174 ? 20.988  -11.001 10.489  1.00 13.57 ? 174  TYR B CE1 1 
ATOM   2878 C  CE2 . TYR B 1 174 ? 19.326  -10.285 8.854   1.00 12.83 ? 174  TYR B CE2 1 
ATOM   2879 C  CZ  . TYR B 1 174 ? 19.638  -10.818 10.115  1.00 14.61 ? 174  TYR B CZ  1 
ATOM   2880 O  OH  . TYR B 1 174 ? 18.649  -11.249 10.967  1.00 13.85 ? 174  TYR B OH  1 
ATOM   2881 N  N   . LEU B 1 175 ? 22.545  -12.156 5.445   1.00 17.29 ? 175  LEU B N   1 
ATOM   2882 C  CA  . LEU B 1 175 ? 21.817  -13.349 5.016   1.00 18.41 ? 175  LEU B CA  1 
ATOM   2883 C  C   . LEU B 1 175 ? 22.792  -14.512 4.919   1.00 18.90 ? 175  LEU B C   1 
ATOM   2884 O  O   . LEU B 1 175 ? 22.465  -15.651 5.226   1.00 18.85 ? 175  LEU B O   1 
ATOM   2885 C  CB  . LEU B 1 175 ? 21.095  -13.068 3.669   1.00 20.03 ? 175  LEU B CB  1 
ATOM   2886 C  CG  . LEU B 1 175 ? 19.820  -12.191 3.872   1.00 22.60 ? 175  LEU B CG  1 
ATOM   2887 C  CD1 . LEU B 1 175 ? 19.239  -11.727 2.546   1.00 23.46 ? 175  LEU B CD1 1 
ATOM   2888 C  CD2 . LEU B 1 175 ? 18.736  -13.001 4.594   1.00 23.88 ? 175  LEU B CD2 1 
ATOM   2889 N  N   . LYS B 1 176 ? 24.027  -14.237 4.489   1.00 19.91 ? 176  LYS B N   1 
ATOM   2890 C  CA  . LYS B 1 176 ? 24.986  -15.365 4.441   1.00 21.13 ? 176  LYS B CA  1 
ATOM   2891 C  C   . LYS B 1 176 ? 25.151  -15.876 5.890   1.00 20.65 ? 176  LYS B C   1 
ATOM   2892 O  O   . LYS B 1 176 ? 25.272  -17.074 6.133   1.00 20.06 ? 176  LYS B O   1 
ATOM   2893 C  CB  . LYS B 1 176 ? 26.389  -14.941 3.901   1.00 21.91 ? 176  LYS B CB  1 
ATOM   2894 C  CG  . LYS B 1 176 ? 26.471  -14.707 2.370   1.00 25.35 ? 176  LYS B CG  1 
ATOM   2895 C  CD  . LYS B 1 176 ? 27.830  -14.036 1.995   1.00 28.05 ? 176  LYS B CD  1 
ATOM   2896 C  CE  . LYS B 1 176 ? 27.703  -13.231 0.712   1.00 29.38 ? 176  LYS B CE  1 
ATOM   2897 N  NZ  . LYS B 1 176 ? 27.218  -14.231 -0.272  1.00 33.84 ? 176  LYS B NZ  1 
ATOM   2898 N  N   . GLY B 1 177 ? 25.175  -14.957 6.852   1.00 18.72 ? 177  GLY B N   1 
ATOM   2899 C  CA  . GLY B 1 177 ? 25.300  -15.413 8.209   1.00 18.42 ? 177  GLY B CA  1 
ATOM   2900 C  C   . GLY B 1 177 ? 24.073  -16.235 8.639   1.00 17.19 ? 177  GLY B C   1 
ATOM   2901 O  O   . GLY B 1 177 ? 24.183  -17.241 9.306   1.00 14.67 ? 177  GLY B O   1 
ATOM   2902 N  N   . PHE B 1 178 ? 22.887  -15.797 8.264   1.00 16.49 ? 178  PHE B N   1 
ATOM   2903 C  CA  . PHE B 1 178 ? 21.701  -16.535 8.664   1.00 18.18 ? 178  PHE B CA  1 
ATOM   2904 C  C   . PHE B 1 178 ? 21.801  -17.988 8.151   1.00 18.59 ? 178  PHE B C   1 
ATOM   2905 O  O   . PHE B 1 178 ? 21.538  -18.977 8.879   1.00 18.44 ? 178  PHE B O   1 
ATOM   2906 C  CB  . PHE B 1 178 ? 20.435  -15.838 8.088   1.00 17.04 ? 178  PHE B CB  1 
ATOM   2907 C  CG  . PHE B 1 178 ? 19.185  -16.659 8.206   1.00 18.58 ? 178  PHE B CG  1 
ATOM   2908 C  CD1 . PHE B 1 178 ? 18.511  -16.746 9.418   1.00 17.13 ? 178  PHE B CD1 1 
ATOM   2909 C  CD2 . PHE B 1 178 ? 18.708  -17.384 7.104   1.00 18.24 ? 178  PHE B CD2 1 
ATOM   2910 C  CE1 . PHE B 1 178 ? 17.367  -17.557 9.555   1.00 18.20 ? 178  PHE B CE1 1 
ATOM   2911 C  CE2 . PHE B 1 178 ? 17.583  -18.190 7.225   1.00 18.48 ? 178  PHE B CE2 1 
ATOM   2912 C  CZ  . PHE B 1 178 ? 16.918  -18.275 8.450   1.00 18.12 ? 178  PHE B CZ  1 
ATOM   2913 N  N   . TRP B 1 179 ? 22.225  -18.131 6.902   1.00 19.05 ? 179  TRP B N   1 
ATOM   2914 C  CA  . TRP B 1 179 ? 22.267  -19.490 6.381   1.00 18.44 ? 179  TRP B CA  1 
ATOM   2915 C  C   . TRP B 1 179 ? 23.271  -20.355 7.087   1.00 19.02 ? 179  TRP B C   1 
ATOM   2916 O  O   . TRP B 1 179 ? 23.178  -21.575 7.008   1.00 15.07 ? 179  TRP B O   1 
ATOM   2917 C  CB  . TRP B 1 179 ? 22.513  -19.507 4.886   1.00 17.65 ? 179  TRP B CB  1 
ATOM   2918 C  CG  . TRP B 1 179 ? 21.378  -18.934 4.128   1.00 18.23 ? 179  TRP B CG  1 
ATOM   2919 C  CD1 . TRP B 1 179 ? 21.385  -17.756 3.409   1.00 19.28 ? 179  TRP B CD1 1 
ATOM   2920 C  CD2 . TRP B 1 179 ? 20.062  -19.492 3.974   1.00 17.05 ? 179  TRP B CD2 1 
ATOM   2921 N  NE1 . TRP B 1 179 ? 20.158  -17.560 2.822   1.00 18.21 ? 179  TRP B NE1 1 
ATOM   2922 C  CE2 . TRP B 1 179 ? 19.328  -18.607 3.163   1.00 18.34 ? 179  TRP B CE2 1 
ATOM   2923 C  CE3 . TRP B 1 179 ? 19.433  -20.664 4.453   1.00 19.11 ? 179  TRP B CE3 1 
ATOM   2924 C  CZ2 . TRP B 1 179 ? 17.961  -18.844 2.808   1.00 18.36 ? 179  TRP B CZ2 1 
ATOM   2925 C  CZ3 . TRP B 1 179 ? 18.082  -20.914 4.115   1.00 18.21 ? 179  TRP B CZ3 1 
ATOM   2926 C  CH2 . TRP B 1 179 ? 17.358  -19.990 3.290   1.00 17.64 ? 179  TRP B CH2 1 
ATOM   2927 N  N   . SER B 1 180 ? 24.213  -19.720 7.794   1.00 17.75 ? 180  SER B N   1 
ATOM   2928 C  CA  . SER B 1 180 ? 25.224  -20.497 8.497   1.00 18.38 ? 180  SER B CA  1 
ATOM   2929 C  C   . SER B 1 180 ? 24.697  -20.855 9.848   1.00 17.33 ? 180  SER B C   1 
ATOM   2930 O  O   . SER B 1 180 ? 25.263  -21.662 10.532  1.00 16.04 ? 180  SER B O   1 
ATOM   2931 C  CB  . SER B 1 180 ? 26.536  -19.699 8.644   1.00 20.65 ? 180  SER B CB  1 
ATOM   2932 O  OG  . SER B 1 180 ? 27.137  -19.578 7.350   1.00 21.83 ? 180  SER B OG  1 
ATOM   2933 N  N   . LEU B 1 181 ? 23.597  -20.229 10.225  1.00 16.35 ? 181  LEU B N   1 
ATOM   2934 C  CA  . LEU B 1 181 ? 23.018  -20.453 11.531  1.00 17.70 ? 181  LEU B CA  1 
ATOM   2935 C  C   . LEU B 1 181 ? 21.619  -21.097 11.540  1.00 18.85 ? 181  LEU B C   1 
ATOM   2936 O  O   . LEU B 1 181 ? 21.154  -21.517 12.612  1.00 19.07 ? 181  LEU B O   1 
ATOM   2937 C  CB  . LEU B 1 181 ? 22.907  -19.106 12.274  1.00 16.80 ? 181  LEU B CB  1 
ATOM   2938 C  CG  . LEU B 1 181 ? 24.206  -18.291 12.572  1.00 16.81 ? 181  LEU B CG  1 
ATOM   2939 C  CD1 . LEU B 1 181 ? 23.812  -16.930 13.079  1.00 14.12 ? 181  LEU B CD1 1 
ATOM   2940 C  CD2 . LEU B 1 181 ? 25.080  -19.008 13.606  1.00 15.68 ? 181  LEU B CD2 1 
ATOM   2941 N  N   . VAL B 1 182 ? 20.948  -21.140 10.380  1.00 19.76 ? 182  VAL B N   1 
ATOM   2942 C  CA  . VAL B 1 182 ? 19.547  -21.625 10.335  1.00 20.41 ? 182  VAL B CA  1 
ATOM   2943 C  C   . VAL B 1 182 ? 19.359  -22.926 11.129  1.00 20.27 ? 182  VAL B C   1 
ATOM   2944 O  O   . VAL B 1 182 ? 20.133  -23.885 10.957  1.00 20.64 ? 182  VAL B O   1 
ATOM   2945 C  CB  . VAL B 1 182 ? 19.071  -21.811 8.894   1.00 21.21 ? 182  VAL B CB  1 
ATOM   2946 C  CG1 . VAL B 1 182 ? 19.834  -22.977 8.193   1.00 19.92 ? 182  VAL B CG1 1 
ATOM   2947 C  CG2 . VAL B 1 182 ? 17.608  -22.063 8.909   1.00 21.63 ? 182  VAL B CG2 1 
ATOM   2948 N  N   . ASN B 1 183 ? 18.338  -22.945 11.994  1.00 20.01 ? 183  ASN B N   1 
ATOM   2949 C  CA  . ASN B 1 183 ? 18.051  -24.091 12.865  1.00 19.26 ? 183  ASN B CA  1 
ATOM   2950 C  C   . ASN B 1 183 ? 16.998  -25.023 12.225  1.00 20.24 ? 183  ASN B C   1 
ATOM   2951 O  O   . ASN B 1 183 ? 15.757  -24.882 12.397  1.00 19.70 ? 183  ASN B O   1 
ATOM   2952 C  CB  . ASN B 1 183 ? 17.616  -23.579 14.264  1.00 17.53 ? 183  ASN B CB  1 
ATOM   2953 C  CG  . ASN B 1 183 ? 17.418  -24.707 15.302  1.00 19.20 ? 183  ASN B CG  1 
ATOM   2954 O  OD1 . ASN B 1 183 ? 17.521  -25.885 14.969  1.00 18.07 ? 183  ASN B OD1 1 
ATOM   2955 N  ND2 . ASN B 1 183 ? 17.137  -24.322 16.592  1.00 18.72 ? 183  ASN B ND2 1 
ATOM   2956 N  N   . TRP B 1 184 ? 17.500  -25.975 11.455  1.00 20.52 ? 184  TRP B N   1 
ATOM   2957 C  CA  . TRP B 1 184 ? 16.606  -26.937 10.813  1.00 21.54 ? 184  TRP B CA  1 
ATOM   2958 C  C   . TRP B 1 184 ? 15.845  -27.794 11.804  1.00 22.00 ? 184  TRP B C   1 
ATOM   2959 O  O   . TRP B 1 184 ? 14.763  -28.212 11.482  1.00 20.98 ? 184  TRP B O   1 
ATOM   2960 C  CB  . TRP B 1 184 ? 17.398  -27.803 9.839   1.00 20.61 ? 184  TRP B CB  1 
ATOM   2961 C  CG  . TRP B 1 184 ? 17.999  -26.932 8.726   1.00 18.51 ? 184  TRP B CG  1 
ATOM   2962 C  CD1 . TRP B 1 184 ? 19.314  -26.832 8.398   1.00 18.93 ? 184  TRP B CD1 1 
ATOM   2963 C  CD2 . TRP B 1 184 ? 17.297  -26.116 7.790   1.00 17.74 ? 184  TRP B CD2 1 
ATOM   2964 N  NE1 . TRP B 1 184 ? 19.473  -26.012 7.301   1.00 16.97 ? 184  TRP B NE1 1 
ATOM   2965 C  CE2 . TRP B 1 184 ? 18.259  -25.557 6.906   1.00 17.88 ? 184  TRP B CE2 1 
ATOM   2966 C  CE3 . TRP B 1 184 ? 15.956  -25.793 7.600   1.00 15.12 ? 184  TRP B CE3 1 
ATOM   2967 C  CZ2 . TRP B 1 184 ? 17.907  -24.695 5.845   1.00 17.21 ? 184  TRP B CZ2 1 
ATOM   2968 C  CZ3 . TRP B 1 184 ? 15.617  -24.957 6.566   1.00 15.11 ? 184  TRP B CZ3 1 
ATOM   2969 C  CH2 . TRP B 1 184 ? 16.580  -24.417 5.698   1.00 16.73 ? 184  TRP B CH2 1 
ATOM   2970 N  N   . GLU B 1 185 ? 16.408  -28.061 12.995  1.00 22.08 ? 185  GLU B N   1 
ATOM   2971 C  CA  . GLU B 1 185 ? 15.653  -28.840 14.005  1.00 23.63 ? 185  GLU B CA  1 
ATOM   2972 C  C   . GLU B 1 185 ? 14.379  -28.064 14.460  1.00 23.13 ? 185  GLU B C   1 
ATOM   2973 O  O   . GLU B 1 185 ? 13.317  -28.647 14.587  1.00 21.30 ? 185  GLU B O   1 
ATOM   2974 C  CB  . GLU B 1 185 ? 16.518  -29.158 15.240  1.00 26.86 ? 185  GLU B CB  1 
ATOM   2975 C  CG  . GLU B 1 185 ? 17.819  -29.965 14.981  1.00 32.11 ? 185  GLU B CG  1 
ATOM   2976 C  CD  . GLU B 1 185 ? 17.581  -31.375 14.324  1.00 36.41 ? 185  GLU B CD  1 
ATOM   2977 O  OE1 . GLU B 1 185 ? 16.880  -32.245 14.957  1.00 36.02 ? 185  GLU B OE1 1 
ATOM   2978 O  OE2 . GLU B 1 185 ? 18.111  -31.609 13.182  1.00 38.44 ? 185  GLU B OE2 1 
ATOM   2979 N  N   . PHE B 1 186 ? 14.499  -26.754 14.719  1.00 21.70 ? 186  PHE B N   1 
ATOM   2980 C  CA  . PHE B 1 186 ? 13.359  -25.960 15.131  1.00 20.65 ? 186  PHE B CA  1 
ATOM   2981 C  C   . PHE B 1 186 ? 12.346  -25.919 13.944  1.00 20.03 ? 186  PHE B C   1 
ATOM   2982 O  O   . PHE B 1 186 ? 11.116  -25.943 14.102  1.00 18.81 ? 186  PHE B O   1 
ATOM   2983 C  CB  . PHE B 1 186 ? 13.836  -24.517 15.468  1.00 19.67 ? 186  PHE B CB  1 
ATOM   2984 C  CG  . PHE B 1 186 ? 12.740  -23.609 15.974  1.00 19.95 ? 186  PHE B CG  1 
ATOM   2985 C  CD1 . PHE B 1 186 ? 11.960  -23.965 17.074  1.00 20.62 ? 186  PHE B CD1 1 
ATOM   2986 C  CD2 . PHE B 1 186 ? 12.462  -22.394 15.319  1.00 19.28 ? 186  PHE B CD2 1 
ATOM   2987 C  CE1 . PHE B 1 186 ? 10.905  -23.099 17.517  1.00 19.93 ? 186  PHE B CE1 1 
ATOM   2988 C  CE2 . PHE B 1 186 ? 11.454  -21.569 15.739  1.00 19.18 ? 186  PHE B CE2 1 
ATOM   2989 C  CZ  . PHE B 1 186 ? 10.673  -21.913 16.835  1.00 20.03 ? 186  PHE B CZ  1 
ATOM   2990 N  N   . ALA B 1 187 ? 12.900  -25.857 12.743  1.00 19.63 ? 187  ALA B N   1 
ATOM   2991 C  CA  . ALA B 1 187 ? 12.037  -25.811 11.569  1.00 20.27 ? 187  ALA B CA  1 
ATOM   2992 C  C   . ALA B 1 187 ? 11.160  -27.109 11.430  1.00 20.99 ? 187  ALA B C   1 
ATOM   2993 O  O   . ALA B 1 187 ? 9.956   -27.022 11.128  1.00 20.17 ? 187  ALA B O   1 
ATOM   2994 C  CB  . ALA B 1 187 ? 12.896  -25.571 10.296  1.00 18.48 ? 187  ALA B CB  1 
ATOM   2995 N  N   . ASN B 1 188 ? 11.789  -28.260 11.631  1.00 20.25 ? 188  ASN B N   1 
ATOM   2996 C  CA  . ASN B 1 188 ? 11.158  -29.549 11.505  1.00 20.64 ? 188  ASN B CA  1 
ATOM   2997 C  C   . ASN B 1 188 ? 10.219  -29.701 12.693  1.00 22.11 ? 188  ASN B C   1 
ATOM   2998 O  O   . ASN B 1 188 ? 9.062   -30.165 12.524  1.00 20.48 ? 188  ASN B O   1 
ATOM   2999 C  CB  . ASN B 1 188 ? 12.213  -30.636 11.484  1.00 20.41 ? 188  ASN B CB  1 
ATOM   3000 C  CG  . ASN B 1 188 ? 12.721  -30.949 10.052  1.00 25.02 ? 188  ASN B CG  1 
ATOM   3001 O  OD1 . ASN B 1 188 ? 11.931  -31.159 9.115   1.00 25.39 ? 188  ASN B OD1 1 
ATOM   3002 N  ND2 . ASN B 1 188 ? 14.049  -30.983 9.889   1.00 23.80 ? 188  ASN B ND2 1 
ATOM   3003 N  N   . ALA B 1 189 ? 10.696  -29.321 13.896  1.00 21.21 ? 189  ALA B N   1 
ATOM   3004 C  CA  . ALA B 1 189 ? 9.792   -29.360 15.062  1.00 22.48 ? 189  ALA B CA  1 
ATOM   3005 C  C   . ALA B 1 189 ? 8.509   -28.591 14.710  1.00 21.60 ? 189  ALA B C   1 
ATOM   3006 O  O   . ALA B 1 189 ? 7.411   -29.073 14.979  1.00 20.56 ? 189  ALA B O   1 
ATOM   3007 C  CB  . ALA B 1 189 ? 10.438  -28.738 16.309  1.00 20.66 ? 189  ALA B CB  1 
ATOM   3008 N  N   . ASN B 1 190 ? 8.624   -27.411 14.101  1.00 20.40 ? 190  ASN B N   1 
ATOM   3009 C  CA  . ASN B 1 190 ? 7.426   -26.606 13.774  1.00 21.47 ? 190  ASN B CA  1 
ATOM   3010 C  C   . ASN B 1 190 ? 6.634   -27.155 12.627  1.00 21.41 ? 190  ASN B C   1 
ATOM   3011 O  O   . ASN B 1 190 ? 5.413   -26.898 12.529  1.00 22.77 ? 190  ASN B O   1 
ATOM   3012 C  CB  . ASN B 1 190 ? 7.753   -25.138 13.371  1.00 20.63 ? 190  ASN B CB  1 
ATOM   3013 C  CG  . ASN B 1 190 ? 8.389   -24.337 14.499  1.00 21.19 ? 190  ASN B CG  1 
ATOM   3014 O  OD1 . ASN B 1 190 ? 9.203   -23.454 14.251  1.00 25.11 ? 190  ASN B OD1 1 
ATOM   3015 N  ND2 . ASN B 1 190 ? 8.046   -24.657 15.722  1.00 17.53 ? 190  ASN B ND2 1 
ATOM   3016 N  N   . PHE B 1 191 ? 7.316   -27.817 11.693  1.00 21.45 ? 191  PHE B N   1 
ATOM   3017 C  CA  . PHE B 1 191 ? 6.602   -28.360 10.515  1.00 22.95 ? 191  PHE B CA  1 
ATOM   3018 C  C   . PHE B 1 191 ? 5.779   -29.597 10.881  1.00 23.57 ? 191  PHE B C   1 
ATOM   3019 O  O   . PHE B 1 191 ? 4.712   -29.784 10.337  1.00 24.32 ? 191  PHE B O   1 
ATOM   3020 C  CB  . PHE B 1 191 ? 7.584   -28.731 9.399   1.00 22.22 ? 191  PHE B CB  1 
ATOM   3021 C  CG  . PHE B 1 191 ? 6.930   -29.144 8.091   1.00 22.94 ? 191  PHE B CG  1 
ATOM   3022 C  CD1 . PHE B 1 191 ? 6.633   -28.208 7.110   1.00 23.96 ? 191  PHE B CD1 1 
ATOM   3023 C  CD2 . PHE B 1 191 ? 6.685   -30.503 7.806   1.00 24.37 ? 191  PHE B CD2 1 
ATOM   3024 C  CE1 . PHE B 1 191 ? 6.105   -28.632 5.837   1.00 23.14 ? 191  PHE B CE1 1 
ATOM   3025 C  CE2 . PHE B 1 191 ? 6.148   -30.929 6.530   1.00 23.72 ? 191  PHE B CE2 1 
ATOM   3026 C  CZ  . PHE B 1 191 ? 5.873   -29.988 5.564   1.00 22.74 ? 191  PHE B CZ  1 
ATOM   3027 N  N   . ALA B 1 192 ? 6.282   -30.405 11.817  1.00 26.11 ? 192  ALA B N   1 
ATOM   3028 C  CA  . ALA B 1 192 ? 5.632   -31.646 12.254  1.00 27.68 ? 192  ALA B CA  1 
ATOM   3029 C  C   . ALA B 1 192 ? 4.584   -31.499 13.369  1.00 30.57 ? 192  ALA B C   1 
ATOM   3030 O  O   . ALA B 1 192 ? 3.629   -32.309 13.398  1.00 30.82 ? 192  ALA B O   1 
ATOM   3031 C  CB  . ALA B 1 192 ? 6.712   -32.680 12.684  1.00 28.53 ? 192  ALA B CB  1 
ATOM   3032 O  OXT . ALA B 1 192 ? 4.716   -30.596 14.230  1.00 32.79 ? 192  ALA B OXT 1 
HETATM 3033 FE FE  . FE  C 2 .   ? 18.176  7.250   6.149   1.00 17.01 ? 5000 FE  A FE  1 
HETATM 3034 FE FE  . FE  D 2 .   ? 14.788  -7.391  16.044  1.00 16.75 ? 5001 FE  B FE  1 
HETATM 3035 O  O   . HOH E 3 .   ? 16.151  6.381   5.929   1.00 17.71 ? 5101 HOH A O   1 
HETATM 3036 O  O   . HOH E 3 .   ? 24.413  5.525   12.500  1.00 17.87 ? 5102 HOH A O   1 
HETATM 3037 O  O   . HOH E 3 .   ? 22.196  10.100  10.178  1.00 17.20 ? 5103 HOH A O   1 
HETATM 3038 O  O   . HOH E 3 .   ? 21.989  0.952   25.364  1.00 26.12 ? 5104 HOH A O   1 
HETATM 3039 O  O   . HOH E 3 .   ? 27.716  21.034  -0.713  1.00 19.79 ? 5105 HOH A O   1 
HETATM 3040 O  O   . HOH E 3 .   ? 20.232  14.554  -9.566  1.00 28.70 ? 5106 HOH A O   1 
HETATM 3041 O  O   . HOH E 3 .   ? 10.469  1.344   16.522  1.00 18.15 ? 5107 HOH A O   1 
HETATM 3042 O  O   . HOH E 3 .   ? 4.868   6.389   10.886  1.00 26.08 ? 5108 HOH A O   1 
HETATM 3043 O  O   . HOH E 3 .   ? 1.529   10.948  8.033   1.00 39.50 ? 5109 HOH A O   1 
HETATM 3044 O  O   . HOH E 3 .   ? 21.666  23.263  3.956   1.00 23.18 ? 5110 HOH A O   1 
HETATM 3045 O  O   . HOH E 3 .   ? 4.040   10.077  0.876   1.00 25.64 ? 5111 HOH A O   1 
HETATM 3046 O  O   . HOH E 3 .   ? 17.959  18.344  23.607  1.00 30.73 ? 5112 HOH A O   1 
HETATM 3047 O  O   . HOH E 3 .   ? 14.974  16.430  -10.307 1.00 46.23 ? 5113 HOH A O   1 
HETATM 3048 O  O   . HOH E 3 .   ? 31.358  15.664  2.599   1.00 48.11 ? 5114 HOH A O   1 
HETATM 3049 O  O   . HOH E 3 .   ? 15.674  16.145  23.559  1.00 17.35 ? 5115 HOH A O   1 
HETATM 3050 O  O   . HOH E 3 .   ? 15.378  1.076   10.053  1.00 12.45 ? 5116 HOH A O   1 
HETATM 3051 O  O   . HOH E 3 .   ? -1.337  23.121  13.017  1.00 30.68 ? 5117 HOH A O   1 
HETATM 3052 O  O   . HOH E 3 .   ? 1.870   27.560  13.696  1.00 18.27 ? 5118 HOH A O   1 
HETATM 3053 O  O   . HOH E 3 .   ? 16.304  1.568   17.351  1.00 15.93 ? 5119 HOH A O   1 
HETATM 3054 O  O   . HOH E 3 .   ? 17.343  22.990  19.232  1.00 15.48 ? 5120 HOH A O   1 
HETATM 3055 O  O   . HOH E 3 .   ? 10.837  35.182  16.295  1.00 35.06 ? 5121 HOH A O   1 
HETATM 3056 O  O   . HOH E 3 .   ? 22.860  22.388  6.177   1.00 19.78 ? 5122 HOH A O   1 
HETATM 3057 O  O   . HOH E 3 .   ? 23.640  9.390   14.649  1.00 13.83 ? 5123 HOH A O   1 
HETATM 3058 O  O   . HOH E 3 .   ? 25.216  22.477  15.478  1.00 33.86 ? 5124 HOH A O   1 
HETATM 3059 O  O   . HOH E 3 .   ? 5.111   2.018   -1.756  1.00 37.67 ? 5125 HOH A O   1 
HETATM 3060 O  O   . HOH E 3 .   ? 21.452  0.518   1.699   1.00 45.44 ? 5126 HOH A O   1 
HETATM 3061 O  O   . HOH E 3 .   ? 6.555   34.381  19.272  1.00 36.11 ? 5127 HOH A O   1 
HETATM 3062 O  O   . HOH E 3 .   ? 20.005  27.640  12.732  1.00 26.94 ? 5128 HOH A O   1 
HETATM 3063 O  O   . HOH E 3 .   ? 31.072  28.593  10.823  1.00 44.07 ? 5129 HOH A O   1 
HETATM 3064 O  O   . HOH E 3 .   ? 7.468   2.162   9.871   1.00 19.27 ? 5130 HOH A O   1 
HETATM 3065 O  O   . HOH E 3 .   ? 19.668  2.253   0.976   1.00 26.06 ? 5131 HOH A O   1 
HETATM 3066 O  O   . HOH E 3 .   ? 20.317  18.721  22.528  1.00 20.44 ? 5132 HOH A O   1 
HETATM 3067 O  O   . HOH E 3 .   ? -3.077  21.225  5.068   1.00 38.78 ? 5133 HOH A O   1 
HETATM 3068 O  O   . HOH E 3 .   ? 14.632  16.996  -0.976  1.00 22.74 ? 5134 HOH A O   1 
HETATM 3069 O  O   . HOH E 3 .   ? 7.356   3.340   1.996   1.00 17.01 ? 5135 HOH A O   1 
HETATM 3070 O  O   . HOH E 3 .   ? 31.301  16.517  -3.624  1.00 38.95 ? 5136 HOH A O   1 
HETATM 3071 O  O   . HOH E 3 .   ? 9.365   3.123   18.309  1.00 30.86 ? 5137 HOH A O   1 
HETATM 3072 O  O   . HOH E 3 .   ? 16.193  0.794   2.299   1.00 19.26 ? 5138 HOH A O   1 
HETATM 3073 O  O   . HOH E 3 .   ? 30.089  14.707  11.227  1.00 18.78 ? 5139 HOH A O   1 
HETATM 3074 O  O   . HOH E 3 .   ? 17.244  22.717  21.935  1.00 20.69 ? 5140 HOH A O   1 
HETATM 3075 O  O   . HOH E 3 .   ? 29.746  15.143  -0.143  1.00 24.78 ? 5141 HOH A O   1 
HETATM 3076 O  O   . HOH E 3 .   ? 3.150   9.824   19.955  1.00 38.30 ? 5142 HOH A O   1 
HETATM 3077 O  O   . HOH E 3 .   ? 21.578  23.120  20.887  1.00 36.42 ? 5143 HOH A O   1 
HETATM 3078 O  O   . HOH E 3 .   ? 28.179  3.477   19.826  1.00 28.79 ? 5144 HOH A O   1 
HETATM 3079 O  O   . HOH E 3 .   ? 24.245  19.374  -1.887  1.00 26.40 ? 5145 HOH A O   1 
HETATM 3080 O  O   . HOH E 3 .   ? 9.382   22.018  1.522   1.00 23.92 ? 5146 HOH A O   1 
HETATM 3081 O  O   . HOH E 3 .   ? 29.334  3.026   -2.159  1.00 44.99 ? 5147 HOH A O   1 
HETATM 3082 O  O   . HOH E 3 .   ? 30.307  10.720  17.669  1.00 35.84 ? 5148 HOH A O   1 
HETATM 3083 O  O   . HOH E 3 .   ? 14.088  -1.491  -4.070  1.00 43.94 ? 5149 HOH A O   1 
HETATM 3084 O  O   . HOH E 3 .   ? 28.752  19.991  15.011  1.00 35.81 ? 5150 HOH A O   1 
HETATM 3085 O  O   . HOH E 3 .   ? 15.239  26.235  1.323   1.00 31.72 ? 5151 HOH A O   1 
HETATM 3086 O  O   . HOH E 3 .   ? 16.526  31.252  5.989   1.00 28.81 ? 5152 HOH A O   1 
HETATM 3087 O  O   . HOH E 3 .   ? -2.931  15.425  -1.544  1.00 35.68 ? 5153 HOH A O   1 
HETATM 3088 O  O   . HOH E 3 .   ? 11.142  20.206  25.851  1.00 35.67 ? 5154 HOH A O   1 
HETATM 3089 O  O   . HOH E 3 .   ? -0.005  11.139  0.530   1.00 45.79 ? 5155 HOH A O   1 
HETATM 3090 O  O   . HOH E 3 .   ? 12.148  34.865  9.556   1.00 24.57 ? 5156 HOH A O   1 
HETATM 3091 O  O   . HOH E 3 .   ? 15.673  13.600  23.636  1.00 25.40 ? 5157 HOH A O   1 
HETATM 3092 O  O   . HOH E 3 .   ? 26.398  2.808   -2.026  1.00 34.36 ? 5158 HOH A O   1 
HETATM 3093 O  O   . HOH E 3 .   ? 13.598  25.655  29.291  1.00 24.64 ? 5159 HOH A O   1 
HETATM 3094 O  O   . HOH E 3 .   ? 5.832   33.330  12.085  1.00 31.17 ? 5160 HOH A O   1 
HETATM 3095 O  O   . HOH E 3 .   ? 3.058   6.930   6.683   1.00 26.62 ? 5161 HOH A O   1 
HETATM 3096 O  O   . HOH E 3 .   ? 13.370  1.410   15.920  1.00 33.35 ? 5162 HOH A O   1 
HETATM 3097 O  O   . HOH E 3 .   ? 15.561  1.324   19.885  1.00 22.60 ? 5163 HOH A O   1 
HETATM 3098 O  O   . HOH E 3 .   ? 9.568   29.080  19.535  1.00 16.11 ? 5164 HOH A O   1 
HETATM 3099 O  O   . HOH E 3 .   ? -2.825  25.842  9.218   1.00 65.10 ? 5165 HOH A O   1 
HETATM 3100 O  O   . HOH E 3 .   ? 1.847   24.628  2.864   1.00 30.02 ? 5166 HOH A O   1 
HETATM 3101 O  O   . HOH E 3 .   ? 30.489  6.500   16.390  1.00 26.83 ? 5167 HOH A O   1 
HETATM 3102 O  O   . HOH E 3 .   ? 13.100  27.162  25.716  1.00 20.93 ? 5168 HOH A O   1 
HETATM 3103 O  O   . HOH E 3 .   ? 6.541   -0.943  0.723   1.00 42.32 ? 5169 HOH A O   1 
HETATM 3104 O  O   . HOH E 3 .   ? 20.963  -4.919  18.076  1.00 13.78 ? 5170 HOH A O   1 
HETATM 3105 O  O   . HOH E 3 .   ? 25.705  24.270  4.028   1.00 19.56 ? 5171 HOH A O   1 
HETATM 3106 O  O   . HOH E 3 .   ? 33.803  10.136  15.202  1.00 40.81 ? 5172 HOH A O   1 
HETATM 3107 O  O   . HOH E 3 .   ? 25.231  21.483  -0.580  1.00 20.49 ? 5173 HOH A O   1 
HETATM 3108 O  O   . HOH E 3 .   ? 15.898  16.838  -3.745  1.00 25.46 ? 5174 HOH A O   1 
HETATM 3109 O  O   . HOH E 3 .   ? 21.895  2.357   -11.505 1.00 32.01 ? 5175 HOH A O   1 
HETATM 3110 O  O   . HOH E 3 .   ? 15.844  18.929  0.143   1.00 37.31 ? 5176 HOH A O   1 
HETATM 3111 O  O   . HOH E 3 .   ? 11.642  22.571  0.267   1.00 55.32 ? 5177 HOH A O   1 
HETATM 3112 O  O   . HOH E 3 .   ? 17.704  15.018  -4.239  1.00 23.91 ? 5178 HOH A O   1 
HETATM 3113 O  O   . HOH E 3 .   ? 33.275  8.309   12.920  1.00 20.09 ? 5179 HOH A O   1 
HETATM 3114 O  O   . HOH E 3 .   ? 19.818  21.971  22.283  1.00 50.79 ? 5180 HOH A O   1 
HETATM 3115 O  O   . HOH E 3 .   ? 10.620  -1.366  -2.822  1.00 32.58 ? 5181 HOH A O   1 
HETATM 3116 O  O   . HOH E 3 .   ? 26.689  24.995  16.460  1.00 41.80 ? 5182 HOH A O   1 
HETATM 3117 O  O   . HOH E 3 .   ? 30.627  5.447   1.945   1.00 39.57 ? 5183 HOH A O   1 
HETATM 3118 O  O   . HOH E 3 .   ? 17.623  0.424   -0.353  1.00 18.26 ? 5184 HOH A O   1 
HETATM 3119 O  O   . HOH E 3 .   ? 18.695  1.405   3.775   1.00 33.81 ? 5185 HOH A O   1 
HETATM 3120 O  O   . HOH E 3 .   ? 1.202   11.650  12.350  1.00 25.17 ? 5186 HOH A O   1 
HETATM 3121 O  O   . HOH E 3 .   ? 23.112  5.339   -10.528 1.00 44.51 ? 5187 HOH A O   1 
HETATM 3122 O  O   . HOH E 3 .   ? 35.130  6.421   9.276   1.00 40.58 ? 5188 HOH A O   1 
HETATM 3123 O  O   . HOH E 3 .   ? 28.865  7.575   -5.255  1.00 52.52 ? 5189 HOH A O   1 
HETATM 3124 O  O   . HOH E 3 .   ? 9.701   20.911  -2.633  1.00 32.17 ? 5190 HOH A O   1 
HETATM 3125 O  O   . HOH E 3 .   ? 19.644  29.961  18.029  1.00 28.06 ? 5191 HOH A O   1 
HETATM 3126 O  O   . HOH E 3 .   ? 8.580   13.846  24.846  1.00 39.36 ? 5192 HOH A O   1 
HETATM 3127 O  O   . HOH E 3 .   ? 3.433   25.965  25.843  1.00 26.92 ? 5193 HOH A O   1 
HETATM 3128 O  O   . HOH E 3 .   ? 3.735   5.868   22.929  1.00 42.13 ? 5194 HOH A O   1 
HETATM 3129 O  O   . HOH E 3 .   ? 24.840  22.929  18.748  1.00 26.75 ? 5195 HOH A O   1 
HETATM 3130 O  O   . HOH E 3 .   ? 8.928   25.532  0.914   1.00 34.82 ? 5196 HOH A O   1 
HETATM 3131 O  O   . HOH E 3 .   ? 22.136  6.213   27.261  1.00 38.83 ? 5197 HOH A O   1 
HETATM 3132 O  O   . HOH E 3 .   ? -2.696  25.528  18.922  1.00 51.16 ? 5198 HOH A O   1 
HETATM 3133 O  O   . HOH E 3 .   ? 29.078  13.137  -2.599  1.00 50.81 ? 5199 HOH A O   1 
HETATM 3134 O  O   . HOH E 3 .   ? 21.163  27.652  15.097  1.00 25.83 ? 5200 HOH A O   1 
HETATM 3135 O  O   . HOH E 3 .   ? 13.417  12.230  24.344  1.00 39.29 ? 5201 HOH A O   1 
HETATM 3136 O  O   . HOH E 3 .   ? 32.596  5.915   14.597  1.00 25.07 ? 5202 HOH A O   1 
HETATM 3137 O  O   . HOH E 3 .   ? 1.471   22.989  23.750  1.00 29.29 ? 5203 HOH A O   1 
HETATM 3138 O  O   . HOH E 3 .   ? 3.547   14.646  20.388  1.00 34.98 ? 5204 HOH A O   1 
HETATM 3139 O  O   . HOH E 3 .   ? 16.725  -0.808  -10.117 1.00 38.00 ? 5205 HOH A O   1 
HETATM 3140 O  O   . HOH E 3 .   ? 30.388  13.508  1.661   1.00 51.72 ? 5206 HOH A O   1 
HETATM 3141 O  O   . HOH E 3 .   ? 24.961  23.794  6.774   1.00 21.84 ? 5207 HOH A O   1 
HETATM 3142 O  O   . HOH E 3 .   ? 1.753   10.172  -16.561 1.00 57.84 ? 5208 HOH A O   1 
HETATM 3143 O  O   . HOH E 3 .   ? -5.630  19.365  -2.526  1.00 55.42 ? 5209 HOH A O   1 
HETATM 3144 O  O   . HOH E 3 .   ? 21.127  19.823  -1.351  1.00 35.07 ? 5210 HOH A O   1 
HETATM 3145 O  O   . HOH E 3 .   ? 25.814  10.268  -7.892  1.00 34.51 ? 5211 HOH A O   1 
HETATM 3146 O  O   . HOH E 3 .   ? 18.940  30.315  12.446  1.00 40.42 ? 5212 HOH A O   1 
HETATM 3147 O  O   . HOH E 3 .   ? 11.546  15.245  25.649  1.00 40.87 ? 5213 HOH A O   1 
HETATM 3148 O  O   . HOH E 3 .   ? 6.631   0.944   2.486   1.00 37.29 ? 5214 HOH A O   1 
HETATM 3149 O  O   . HOH E 3 .   ? 28.091  16.420  -6.101  1.00 37.69 ? 5215 HOH A O   1 
HETATM 3150 O  O   . HOH E 3 .   ? 33.181  0.875   10.088  1.00 27.92 ? 5216 HOH A O   1 
HETATM 3151 O  O   . HOH E 3 .   ? 13.472  2.523   19.446  1.00 49.18 ? 5217 HOH A O   1 
HETATM 3152 O  O   . HOH E 3 .   ? 1.461   15.435  5.569   1.00 41.85 ? 5218 HOH A O   1 
HETATM 3153 O  O   . HOH E 3 .   ? 19.054  30.523  4.019   1.00 46.84 ? 5219 HOH A O   1 
HETATM 3154 O  O   . HOH E 3 .   ? 35.132  10.553  3.646   1.00 43.98 ? 5220 HOH A O   1 
HETATM 3155 O  O   . HOH E 3 .   ? 9.697   38.495  16.290  1.00 43.13 ? 5221 HOH A O   1 
HETATM 3156 O  O   . HOH E 3 .   ? 28.233  10.007  19.344  1.00 43.63 ? 5222 HOH A O   1 
HETATM 3157 O  O   . HOH E 3 .   ? 32.572  1.920   14.483  1.00 36.15 ? 5223 HOH A O   1 
HETATM 3158 O  O   . HOH E 3 .   ? 14.357  17.668  -5.708  1.00 34.44 ? 5224 HOH A O   1 
HETATM 3159 O  O   . HOH E 3 .   ? 11.900  17.889  25.893  1.00 50.93 ? 5225 HOH A O   1 
HETATM 3160 O  O   . HOH E 3 .   ? 18.993  -2.145  -0.264  1.00 31.23 ? 5226 HOH A O   1 
HETATM 3161 O  O   . HOH E 3 .   ? 11.953  3.906   20.267  1.00 52.41 ? 5227 HOH A O   1 
HETATM 3162 O  O   . HOH E 3 .   ? 21.539  2.908   27.881  1.00 51.23 ? 5228 HOH A O   1 
HETATM 3163 O  O   . HOH E 3 .   ? 2.040   19.791  -2.902  1.00 44.90 ? 5229 HOH A O   1 
HETATM 3164 O  O   . HOH E 3 .   ? 14.635  16.987  26.004  1.00 49.61 ? 5230 HOH A O   1 
HETATM 3165 O  O   . HOH E 3 .   ? 32.156  8.755   17.084  1.00 50.02 ? 5231 HOH A O   1 
HETATM 3166 O  O   . HOH E 3 .   ? 18.881  1.482   26.950  1.00 28.94 ? 5232 HOH A O   1 
HETATM 3167 O  O   . HOH E 3 .   ? 28.207  13.095  -4.760  1.00 42.61 ? 5233 HOH A O   1 
HETATM 3168 O  O   . HOH E 3 .   ? 4.743   4.352   1.534   1.00 38.03 ? 5234 HOH A O   1 
HETATM 3169 O  O   . HOH E 3 .   ? 29.706  1.781   16.913  1.00 43.59 ? 5235 HOH A O   1 
HETATM 3170 O  O   . HOH E 3 .   ? 14.554  4.563   21.887  1.00 38.29 ? 5236 HOH A O   1 
HETATM 3171 O  O   . HOH E 3 .   ? 13.863  2.902   13.080  1.00 29.74 ? 5237 HOH A O   1 
HETATM 3172 O  O   . HOH E 3 .   ? 35.517  7.559   11.288  1.00 31.30 ? 5238 HOH A O   1 
HETATM 3173 O  O   . HOH E 3 .   ? 33.118  12.895  18.223  1.00 41.44 ? 5239 HOH A O   1 
HETATM 3174 O  O   . HOH E 3 .   ? 4.222   4.023   3.950   1.00 29.27 ? 5240 HOH A O   1 
HETATM 3175 O  O   . HOH E 3 .   ? 34.516  20.394  9.757   1.00 48.32 ? 5241 HOH A O   1 
HETATM 3176 O  O   . HOH E 3 .   ? 25.907  15.736  -7.240  1.00 34.76 ? 5242 HOH A O   1 
HETATM 3177 O  O   . HOH E 3 .   ? 1.683   18.412  18.286  1.00 27.97 ? 5243 HOH A O   1 
HETATM 3178 O  O   . HOH E 3 .   ? 4.088   19.452  24.248  1.00 28.39 ? 5244 HOH A O   1 
HETATM 3179 O  O   . HOH E 3 .   ? 7.934   0.924   -9.521  1.00 45.93 ? 5245 HOH A O   1 
HETATM 3180 O  O   . HOH E 3 .   ? 3.388   33.016  13.274  1.00 53.87 ? 5246 HOH A O   1 
HETATM 3181 O  O   . HOH E 3 .   ? 23.436  13.143  22.620  1.00 41.81 ? 5247 HOH A O   1 
HETATM 3182 O  O   . HOH E 3 .   ? 14.467  20.951  -0.488  1.00 41.41 ? 5248 HOH A O   1 
HETATM 3183 O  O   . HOH E 3 .   ? 21.906  17.949  24.823  1.00 40.57 ? 5249 HOH A O   1 
HETATM 3184 O  O   . HOH E 3 .   ? 17.846  -2.268  -13.181 1.00 56.58 ? 5250 HOH A O   1 
HETATM 3185 O  O   . HOH E 3 .   ? 21.975  17.434  0.552   1.00 35.57 ? 5251 HOH A O   1 
HETATM 3186 O  O   . HOH E 3 .   ? -2.993  16.706  2.165   1.00 43.26 ? 5252 HOH A O   1 
HETATM 3187 O  O   . HOH E 3 .   ? 2.113   31.407  11.887  1.00 37.80 ? 5253 HOH A O   1 
HETATM 3188 O  O   . HOH E 3 .   ? 11.672  5.979   -21.539 1.00 47.04 ? 5254 HOH A O   1 
HETATM 3189 O  O   . HOH E 3 .   ? 5.212   23.113  -0.282  1.00 44.60 ? 5255 HOH A O   1 
HETATM 3190 O  O   . HOH E 3 .   ? 24.636  14.645  21.232  1.00 24.93 ? 5256 HOH A O   1 
HETATM 3191 O  O   . HOH E 3 .   ? 21.675  15.777  -6.730  1.00 67.52 ? 5257 HOH A O   1 
HETATM 3192 O  O   . HOH E 3 .   ? 23.590  6.345   23.222  1.00 39.26 ? 5258 HOH A O   1 
HETATM 3193 O  O   . HOH E 3 .   ? 17.938  17.350  26.036  1.00 53.33 ? 5259 HOH A O   1 
HETATM 3194 O  O   . HOH E 3 .   ? 29.782  10.518  1.616   1.00 30.86 ? 5260 HOH A O   1 
HETATM 3195 O  O   . HOH E 3 .   ? 2.356   4.874   5.528   1.00 50.08 ? 5261 HOH A O   1 
HETATM 3196 O  O   . HOH E 3 .   ? 27.592  21.812  16.567  1.00 48.36 ? 5262 HOH A O   1 
HETATM 3197 O  O   . HOH E 3 .   ? 10.217  20.720  28.474  1.00 54.56 ? 5263 HOH A O   1 
HETATM 3198 O  O   . HOH E 3 .   ? 10.950  27.360  -1.459  1.00 51.17 ? 5264 HOH A O   1 
HETATM 3199 O  O   . HOH E 3 .   ? -0.702  12.020  13.853  1.00 55.47 ? 5265 HOH A O   1 
HETATM 3200 O  O   . HOH E 3 .   ? 11.318  33.525  0.371   1.00 36.66 ? 5266 HOH A O   1 
HETATM 3201 O  O   . HOH E 3 .   ? 6.469   27.904  1.714   1.00 32.31 ? 5267 HOH A O   1 
HETATM 3202 O  O   . HOH F 3 .   ? 7.807   -33.066 3.803   1.00 46.10 ? 5101 HOH B O   1 
HETATM 3203 O  O   . HOH F 3 .   ? 12.922  -6.507  14.984  1.00 18.59 ? 5102 HOH B O   1 
HETATM 3204 O  O   . HOH F 3 .   ? 14.842  -1.274  3.185   1.00 17.81 ? 5103 HOH B O   1 
HETATM 3205 O  O   . HOH F 3 .   ? 24.324  4.810   8.333   1.00 18.83 ? 5104 HOH B O   1 
HETATM 3206 O  O   . HOH F 3 .   ? 14.909  -1.194  11.275  1.00 12.83 ? 5105 HOH B O   1 
HETATM 3207 O  O   . HOH F 3 .   ? 12.584  -2.405  21.242  1.00 18.22 ? 5106 HOH B O   1 
HETATM 3208 O  O   . HOH F 3 .   ? 6.049   -27.472 0.000   1.00 17.06 ? 5107 HOH B O   1 
HETATM 3209 O  O   . HOH F 3 .   ? 24.263  -9.554  12.623  1.00 17.84 ? 5108 HOH B O   1 
HETATM 3210 O  O   . HOH F 3 .   ? 8.346   -2.182  6.548   1.00 15.60 ? 5109 HOH B O   1 
HETATM 3211 O  O   . HOH F 3 .   ? 21.860  -23.077 5.031   1.00 15.72 ? 5110 HOH B O   1 
HETATM 3212 O  O   . HOH F 3 .   ? 26.120  -18.737 4.210   1.00 18.46 ? 5111 HOH B O   1 
HETATM 3213 O  O   . HOH F 3 .   ? 28.870  -14.922 8.153   1.00 32.49 ? 5112 HOH B O   1 
HETATM 3214 O  O   . HOH F 3 .   ? 12.537  -16.063 31.305  1.00 38.61 ? 5113 HOH B O   1 
HETATM 3215 O  O   . HOH F 3 .   ? 27.281  -14.931 19.209  1.00 20.54 ? 5114 HOH B O   1 
HETATM 3216 O  O   . HOH F 3 .   ? 10.968  -0.842  18.071  1.00 22.91 ? 5115 HOH B O   1 
HETATM 3217 O  O   . HOH F 3 .   ? 26.162  -22.471 12.905  1.00 37.69 ? 5116 HOH B O   1 
HETATM 3218 O  O   . HOH F 3 .   ? 3.539   -3.528  12.988  1.00 17.41 ? 5117 HOH B O   1 
HETATM 3219 O  O   . HOH F 3 .   ? 30.264  -11.057 12.734  1.00 51.77 ? 5118 HOH B O   1 
HETATM 3220 O  O   . HOH F 3 .   ? -6.806  -10.438 30.006  1.00 57.17 ? 5119 HOH B O   1 
HETATM 3221 O  O   . HOH F 3 .   ? 23.685  -5.692  14.665  1.00 16.54 ? 5120 HOH B O   1 
HETATM 3222 O  O   . HOH F 3 .   ? 7.222   -6.227  4.001   1.00 38.54 ? 5121 HOH B O   1 
HETATM 3223 O  O   . HOH F 3 .   ? 19.305  -24.389 22.388  1.00 19.43 ? 5122 HOH B O   1 
HETATM 3224 O  O   . HOH F 3 .   ? -2.235  0.201   31.092  1.00 28.26 ? 5123 HOH B O   1 
HETATM 3225 O  O   . HOH F 3 .   ? 9.703   -0.019  8.943   1.00 16.69 ? 5124 HOH B O   1 
HETATM 3226 O  O   . HOH F 3 .   ? 2.180   -30.186 14.585  1.00 33.62 ? 5125 HOH B O   1 
HETATM 3227 O  O   . HOH F 3 .   ? 24.797  -25.901 -5.070  1.00 25.95 ? 5126 HOH B O   1 
HETATM 3228 O  O   . HOH F 3 .   ? -0.820  -18.893 12.547  1.00 25.35 ? 5127 HOH B O   1 
HETATM 3229 O  O   . HOH F 3 .   ? 18.232  -21.135 27.424  1.00 25.15 ? 5128 HOH B O   1 
HETATM 3230 O  O   . HOH F 3 .   ? -2.209  2.521   20.283  1.00 31.73 ? 5129 HOH B O   1 
HETATM 3231 O  O   . HOH F 3 .   ? 28.403  -20.239 15.419  1.00 38.04 ? 5130 HOH B O   1 
HETATM 3232 O  O   . HOH F 3 .   ? 30.897  -6.802  15.450  1.00 26.97 ? 5131 HOH B O   1 
HETATM 3233 O  O   . HOH F 3 .   ? 9.658   -30.445 -7.142  1.00 44.83 ? 5132 HOH B O   1 
HETATM 3234 O  O   . HOH F 3 .   ? 22.229  -27.237 -2.610  1.00 17.23 ? 5133 HOH B O   1 
HETATM 3235 O  O   . HOH F 3 .   ? 14.964  -16.172 23.848  1.00 40.92 ? 5134 HOH B O   1 
HETATM 3236 O  O   . HOH F 3 .   ? 3.237   -23.153 -1.335  1.00 38.02 ? 5135 HOH B O   1 
HETATM 3237 O  O   . HOH F 3 .   ? 4.763   -22.462 14.522  1.00 33.34 ? 5136 HOH B O   1 
HETATM 3238 O  O   . HOH F 3 .   ? 20.972  -1.589  3.601   1.00 22.62 ? 5137 HOH B O   1 
HETATM 3239 O  O   . HOH F 3 .   ? 9.378   -19.706 19.578  1.00 31.53 ? 5138 HOH B O   1 
HETATM 3240 O  O   . HOH F 3 .   ? 15.728  -2.519  8.106   1.00 43.03 ? 5139 HOH B O   1 
HETATM 3241 O  O   . HOH F 3 .   ? 1.302   -8.226  31.558  1.00 27.36 ? 5140 HOH B O   1 
HETATM 3242 O  O   . HOH F 3 .   ? -2.938  -0.385  26.819  1.00 40.06 ? 5141 HOH B O   1 
HETATM 3243 O  O   . HOH F 3 .   ? 13.180  -34.553 -1.307  1.00 24.45 ? 5142 HOH B O   1 
HETATM 3244 O  O   . HOH F 3 .   ? 7.657   -17.086 19.788  1.00 16.60 ? 5143 HOH B O   1 
HETATM 3245 O  O   . HOH F 3 .   ? 23.374  -13.762 0.553   1.00 38.25 ? 5144 HOH B O   1 
HETATM 3246 O  O   . HOH F 3 .   ? 20.514  -10.302 15.361  1.00 13.25 ? 5145 HOH B O   1 
HETATM 3247 O  O   . HOH F 3 .   ? 2.487   0.757   12.861  1.00 31.23 ? 5146 HOH B O   1 
HETATM 3248 O  O   . HOH F 3 .   ? 18.531  -14.068 -4.423  1.00 28.38 ? 5147 HOH B O   1 
HETATM 3249 O  O   . HOH F 3 .   ? 30.748  -8.592  19.749  1.00 20.89 ? 5148 HOH B O   1 
HETATM 3250 O  O   . HOH F 3 .   ? 9.117   -15.422 27.915  1.00 41.18 ? 5149 HOH B O   1 
HETATM 3251 O  O   . HOH F 3 .   ? 19.978  -1.677  6.078   1.00 16.00 ? 5150 HOH B O   1 
HETATM 3252 O  O   . HOH F 3 .   ? 22.398  -27.753 10.811  1.00 20.81 ? 5151 HOH B O   1 
HETATM 3253 O  O   . HOH F 3 .   ? 16.020  -2.898  27.635  1.00 27.98 ? 5152 HOH B O   1 
HETATM 3254 O  O   . HOH F 3 .   ? 4.074   0.746   18.960  1.00 41.54 ? 5153 HOH B O   1 
HETATM 3255 O  O   . HOH F 3 .   ? 23.296  -23.006 2.829   1.00 30.55 ? 5154 HOH B O   1 
HETATM 3256 O  O   . HOH F 3 .   ? 26.279  -23.340 6.212   1.00 33.69 ? 5155 HOH B O   1 
HETATM 3257 O  O   . HOH F 3 .   ? 14.675  -19.389 25.997  1.00 28.32 ? 5156 HOH B O   1 
HETATM 3258 O  O   . HOH F 3 .   ? 0.092   -9.775  11.540  1.00 24.50 ? 5157 HOH B O   1 
HETATM 3259 O  O   . HOH F 3 .   ? 20.084  -15.390 28.053  1.00 23.83 ? 5158 HOH B O   1 
HETATM 3260 O  O   . HOH F 3 .   ? 14.951  -25.974 -8.490  1.00 28.57 ? 5159 HOH B O   1 
HETATM 3261 O  O   . HOH F 3 .   ? 18.130  -22.431 19.131  1.00 22.18 ? 5160 HOH B O   1 
HETATM 3262 O  O   . HOH F 3 .   ? 15.742  -29.209 0.078   1.00 25.47 ? 5161 HOH B O   1 
HETATM 3263 O  O   . HOH F 3 .   ? 14.370  -19.427 -7.105  1.00 30.20 ? 5162 HOH B O   1 
HETATM 3264 O  O   . HOH F 3 .   ? 1.073   -17.398 24.296  1.00 28.26 ? 5163 HOH B O   1 
HETATM 3265 O  O   . HOH F 3 .   ? 14.832  -0.669  21.723  1.00 27.21 ? 5164 HOH B O   1 
HETATM 3266 O  O   . HOH F 3 .   ? 4.896   -11.582 0.917   1.00 36.18 ? 5165 HOH B O   1 
HETATM 3267 O  O   . HOH F 3 .   ? 24.773  -18.491 1.785   1.00 25.14 ? 5166 HOH B O   1 
HETATM 3268 O  O   . HOH F 3 .   ? 23.012  -15.746 26.996  1.00 65.95 ? 5167 HOH B O   1 
HETATM 3269 O  O   . HOH F 3 .   ? 20.388  -33.205 4.362   1.00 28.27 ? 5168 HOH B O   1 
HETATM 3270 O  O   . HOH F 3 .   ? -2.796  -21.450 4.089   1.00 35.25 ? 5169 HOH B O   1 
HETATM 3271 O  O   . HOH F 3 .   ? 16.069  -23.400 20.081  1.00 18.87 ? 5170 HOH B O   1 
HETATM 3272 O  O   . HOH F 3 .   ? 8.803   -26.148 17.828  1.00 33.51 ? 5171 HOH B O   1 
HETATM 3273 O  O   . HOH F 3 .   ? 4.138   -23.426 18.357  1.00 55.15 ? 5172 HOH B O   1 
HETATM 3274 O  O   . HOH F 3 .   ? 16.719  -1.520  5.628   1.00 23.22 ? 5173 HOH B O   1 
HETATM 3275 O  O   . HOH F 3 .   ? -5.240  0.504   34.089  1.00 26.06 ? 5174 HOH B O   1 
HETATM 3276 O  O   . HOH F 3 .   ? 23.196  -16.362 0.673   1.00 24.34 ? 5175 HOH B O   1 
HETATM 3277 O  O   . HOH F 3 .   ? 4.162   -25.415 14.676  1.00 30.71 ? 5176 HOH B O   1 
HETATM 3278 O  O   . HOH F 3 .   ? 11.942  -14.837 -4.200  1.00 40.91 ? 5177 HOH B O   1 
HETATM 3279 O  O   . HOH F 3 .   ? 10.674  -0.665  20.881  1.00 25.25 ? 5178 HOH B O   1 
HETATM 3280 O  O   . HOH F 3 .   ? 5.314   1.502   21.990  1.00 48.30 ? 5179 HOH B O   1 
HETATM 3281 O  O   . HOH F 3 .   ? 25.697  -21.699 3.966   1.00 45.84 ? 5180 HOH B O   1 
HETATM 3282 O  O   . HOH F 3 .   ? 14.755  -16.560 31.695  1.00 39.24 ? 5181 HOH B O   1 
HETATM 3283 O  O   . HOH F 3 .   ? 22.637  -29.867 7.535   1.00 34.77 ? 5182 HOH B O   1 
HETATM 3284 O  O   . HOH F 3 .   ? 22.196  -5.691  27.343  1.00 30.04 ? 5183 HOH B O   1 
HETATM 3285 O  O   . HOH F 3 .   ? 13.248  -31.672 15.117  1.00 36.29 ? 5184 HOH B O   1 
HETATM 3286 O  O   . HOH F 3 .   ? 12.160  -34.652 10.074  1.00 30.64 ? 5185 HOH B O   1 
HETATM 3287 O  O   . HOH F 3 .   ? 31.351  -11.156 15.001  1.00 45.17 ? 5186 HOH B O   1 
HETATM 3288 O  O   . HOH F 3 .   ? 12.633  -19.678 23.824  1.00 28.88 ? 5187 HOH B O   1 
HETATM 3289 O  O   . HOH F 3 .   ? 20.683  -24.023 19.690  1.00 20.85 ? 5188 HOH B O   1 
HETATM 3290 O  O   . HOH F 3 .   ? 12.043  -10.519 32.016  1.00 38.13 ? 5189 HOH B O   1 
HETATM 3291 O  O   . HOH F 3 .   ? 2.269   -16.564 27.262  1.00 24.46 ? 5190 HOH B O   1 
HETATM 3292 O  O   . HOH F 3 .   ? 22.035  -28.422 -0.063  1.00 29.85 ? 5191 HOH B O   1 
HETATM 3293 O  O   . HOH F 3 .   ? 30.229  -1.841  14.926  1.00 21.47 ? 5192 HOH B O   1 
HETATM 3294 O  O   . HOH F 3 .   ? 6.069   -22.524 16.723  1.00 42.99 ? 5193 HOH B O   1 
HETATM 3295 O  O   . HOH F 3 .   ? -4.364  -9.065  15.782  1.00 30.97 ? 5194 HOH B O   1 
HETATM 3296 O  O   . HOH F 3 .   ? 29.206  -1.091  3.040   1.00 33.52 ? 5195 HOH B O   1 
HETATM 3297 O  O   . HOH F 3 .   ? 2.464   -21.325 18.571  1.00 45.89 ? 5196 HOH B O   1 
HETATM 3298 O  O   . HOH F 3 .   ? 10.490  -17.153 30.272  1.00 43.72 ? 5197 HOH B O   1 
HETATM 3299 O  O   . HOH F 3 .   ? 24.613  -29.534 11.479  1.00 58.00 ? 5198 HOH B O   1 
HETATM 3300 O  O   . HOH F 3 .   ? 19.794  -27.695 12.065  1.00 21.79 ? 5199 HOH B O   1 
HETATM 3301 O  O   . HOH F 3 .   ? 10.223  -9.816  -3.554  1.00 37.69 ? 5200 HOH B O   1 
HETATM 3302 O  O   . HOH F 3 .   ? -3.260  -23.716 1.392   1.00 43.53 ? 5201 HOH B O   1 
HETATM 3303 O  O   . HOH F 3 .   ? -4.767  -12.210 34.735  1.00 38.83 ? 5202 HOH B O   1 
HETATM 3304 O  O   . HOH F 3 .   ? -6.616  -14.911 9.950   1.00 37.95 ? 5203 HOH B O   1 
HETATM 3305 O  O   . HOH F 3 .   ? 26.839  -24.529 -3.718  1.00 35.43 ? 5204 HOH B O   1 
HETATM 3306 O  O   . HOH F 3 .   ? 3.308   -1.269  11.655  1.00 40.85 ? 5205 HOH B O   1 
HETATM 3307 O  O   . HOH F 3 .   ? 31.352  -6.157  18.070  1.00 28.01 ? 5206 HOH B O   1 
HETATM 3308 O  O   . HOH F 3 .   ? 8.143   -15.039 24.112  1.00 21.71 ? 5207 HOH B O   1 
HETATM 3309 O  O   . HOH F 3 .   ? 16.710  -34.424 10.766  1.00 49.17 ? 5208 HOH B O   1 
HETATM 3310 O  O   . HOH F 3 .   ? 20.806  -15.098 -3.781  1.00 32.32 ? 5209 HOH B O   1 
HETATM 3311 O  O   . HOH F 3 .   ? 4.906   -30.355 1.994   1.00 50.18 ? 5210 HOH B O   1 
HETATM 3312 O  O   . HOH F 3 .   ? 13.645  -1.530  18.359  1.00 41.49 ? 5211 HOH B O   1 
HETATM 3313 O  O   . HOH F 3 .   ? -4.713  -26.227 8.716   1.00 54.19 ? 5212 HOH B O   1 
HETATM 3314 O  O   . HOH F 3 .   ? 3.961   0.583   28.405  1.00 28.22 ? 5213 HOH B O   1 
HETATM 3315 O  O   . HOH F 3 .   ? 32.723  -10.333 18.705  1.00 52.86 ? 5214 HOH B O   1 
HETATM 3316 O  O   . HOH F 3 .   ? 31.142  -2.107  17.807  1.00 39.87 ? 5215 HOH B O   1 
HETATM 3317 O  O   . HOH F 3 .   ? 6.907   -14.697 29.871  1.00 30.29 ? 5216 HOH B O   1 
HETATM 3318 O  O   . HOH F 3 .   ? 7.252   2.173   20.739  1.00 42.53 ? 5217 HOH B O   1 
HETATM 3319 O  O   . HOH F 3 .   ? 13.994  -19.189 28.937  1.00 24.56 ? 5218 HOH B O   1 
HETATM 3320 O  O   . HOH F 3 .   ? 25.439  -29.483 5.078   1.00 44.63 ? 5219 HOH B O   1 
HETATM 3321 O  O   . HOH F 3 .   ? 26.764  -3.996  25.608  1.00 49.77 ? 5220 HOH B O   1 
HETATM 3322 O  O   . HOH F 3 .   ? 3.004   -6.972  6.598   1.00 20.62 ? 5221 HOH B O   1 
HETATM 3323 O  O   . HOH F 3 .   ? 24.115  -22.152 -0.933  1.00 44.53 ? 5222 HOH B O   1 
HETATM 3324 O  O   . HOH F 3 .   ? 0.649   -20.343 14.139  1.00 55.97 ? 5223 HOH B O   1 
HETATM 3325 O  O   . HOH F 3 .   ? 28.536  -22.212 13.714  1.00 45.12 ? 5224 HOH B O   1 
HETATM 3326 O  O   . HOH F 3 .   ? 16.293  -21.769 25.708  1.00 31.88 ? 5225 HOH B O   1 
HETATM 3327 O  O   . HOH F 3 .   ? 15.193  -3.273  1.024   1.00 31.12 ? 5226 HOH B O   1 
HETATM 3328 O  O   . HOH F 3 .   ? 4.518   -17.510 23.344  1.00 26.77 ? 5227 HOH B O   1 
HETATM 3329 O  O   . HOH F 3 .   ? -2.960  -0.650  21.641  1.00 36.90 ? 5228 HOH B O   1 
HETATM 3330 O  O   . HOH F 3 .   ? 21.172  -20.772 -6.965  1.00 36.70 ? 5229 HOH B O   1 
HETATM 3331 O  O   . HOH F 3 .   ? 22.065  -29.970 9.780   1.00 41.52 ? 5230 HOH B O   1 
HETATM 3332 O  O   . HOH F 3 .   ? 11.049  -19.093 28.588  1.00 34.64 ? 5231 HOH B O   1 
HETATM 3333 O  O   . HOH F 3 .   ? 21.761  -13.747 27.062  1.00 45.30 ? 5232 HOH B O   1 
HETATM 3334 O  O   . HOH F 3 .   ? 26.444  -16.345 27.518  1.00 28.05 ? 5233 HOH B O   1 
HETATM 3335 O  O   . HOH F 3 .   ? 19.130  -30.388 11.595  1.00 42.27 ? 5234 HOH B O   1 
HETATM 3336 O  O   . HOH F 3 .   ? 22.529  -32.769 6.105   1.00 32.40 ? 5235 HOH B O   1 
HETATM 3337 O  O   . HOH F 3 .   ? 21.032  -20.348 -4.088  1.00 38.44 ? 5236 HOH B O   1 
HETATM 3338 O  O   . HOH F 3 .   ? 6.924   -16.824 22.732  1.00 34.82 ? 5237 HOH B O   1 
HETATM 3339 O  O   . HOH F 3 .   ? 18.434  -13.402 29.501  1.00 47.47 ? 5238 HOH B O   1 
HETATM 3340 O  O   . HOH F 3 .   ? 24.363  -29.702 0.266   1.00 41.09 ? 5239 HOH B O   1 
HETATM 3341 O  O   . HOH F 3 .   ? 15.083  -23.748 24.297  1.00 21.41 ? 5240 HOH B O   1 
HETATM 3342 O  O   . HOH F 3 .   ? 31.463  -7.589  22.497  1.00 28.14 ? 5241 HOH B O   1 
HETATM 3343 O  O   . HOH F 3 .   ? 20.337  -27.058 14.938  1.00 45.45 ? 5242 HOH B O   1 
HETATM 3344 O  O   . HOH F 3 .   ? 28.580  -1.881  0.225   1.00 24.28 ? 5243 HOH B O   1 
HETATM 3345 O  O   . HOH F 3 .   ? 7.512   -14.229 26.438  1.00 31.60 ? 5244 HOH B O   1 
HETATM 3346 O  O   . HOH F 3 .   ? 33.008  -8.888  15.286  1.00 63.34 ? 5245 HOH B O   1 
HETATM 3347 O  O   . HOH F 3 .   ? -0.438  -10.458 30.692  1.00 52.53 ? 5246 HOH B O   1 
HETATM 3348 O  O   . HOH F 3 .   ? 0.963   -15.041 6.316   1.00 50.49 ? 5247 HOH B O   1 
HETATM 3349 O  O   . HOH F 3 .   ? 11.118  -32.574 14.712  1.00 45.79 ? 5248 HOH B O   1 
HETATM 3350 O  O   . HOH F 3 .   ? 13.193  -22.693 22.965  1.00 28.10 ? 5249 HOH B O   1 
HETATM 3351 O  O   . HOH F 3 .   ? 0.335   0.396   14.227  1.00 56.11 ? 5250 HOH B O   1 
HETATM 3352 O  O   . HOH F 3 .   ? -1.662  1.391   23.384  1.00 56.88 ? 5251 HOH B O   1 
HETATM 3353 O  O   . HOH F 3 .   ? 27.041  -17.714 0.070   1.00 48.61 ? 5252 HOH B O   1 
HETATM 3354 O  O   . HOH F 3 .   ? 18.812  -25.359 -8.321  1.00 19.84 ? 5253 HOH B O   1 
HETATM 3355 O  O   . HOH F 3 .   ? 28.463  -22.310 4.411   1.00 57.75 ? 5254 HOH B O   1 
HETATM 3356 O  O   . HOH F 3 .   ? -7.470  1.616   34.049  1.00 43.42 ? 5255 HOH B O   1 
HETATM 3357 O  O   . HOH F 3 .   ? 25.782  -28.829 8.770   1.00 60.70 ? 5256 HOH B O   1 
HETATM 3358 O  O   . HOH F 3 .   ? 30.555  -20.424 22.420  1.00 55.30 ? 5257 HOH B O   1 
HETATM 3359 O  O   . HOH F 3 .   ? 31.167  -4.229  8.431   1.00 46.26 ? 5258 HOH B O   1 
HETATM 3360 O  O   . HOH F 3 .   ? 29.918  -21.748 19.007  1.00 42.38 ? 5259 HOH B O   1 
HETATM 3361 O  O   . HOH F 3 .   ? 13.292  -29.329 -9.833  1.00 49.93 ? 5260 HOH B O   1 
HETATM 3362 O  O   . HOH F 3 .   ? 0.866   -16.585 29.277  1.00 56.84 ? 5261 HOH B O   1 
HETATM 3363 O  O   . HOH F 3 .   ? 20.198  -26.929 17.690  1.00 24.26 ? 5262 HOH B O   1 
HETATM 3364 O  O   . HOH F 3 .   ? 20.719  -5.080  29.268  1.00 34.40 ? 5263 HOH B O   1 
HETATM 3365 O  O   . HOH F 3 .   ? 32.656  -18.572 20.174  1.00 51.31 ? 5264 HOH B O   1 
HETATM 3366 O  O   . HOH F 3 .   ? 15.628  -31.744 12.183  1.00 55.59 ? 5265 HOH B O   1 
HETATM 3367 O  O   . HOH F 3 .   ? -0.359  -24.069 -2.906  1.00 49.38 ? 5266 HOH B O   1 
HETATM 3368 O  O   . HOH F 3 .   ? -4.777  -9.772  12.224  1.00 49.82 ? 5267 HOH B O   1 
HETATM 3369 O  O   . HOH F 3 .   ? 12.046  -23.157 -8.312  1.00 26.59 ? 5268 HOH B O   1 
HETATM 3370 O  O   . HOH F 3 .   ? 31.210  -3.602  10.789  1.00 32.63 ? 5269 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   PHE 2   2   2   PHE PHE A . n 
A 1 3   GLU 3   3   3   GLU GLU A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   TYR 9   9   9   TYR TYR A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  HIS 17  17  17  HIS HIS A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  GLU 21  21  21  GLU GLU A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  HIS 27  27  27  HIS HIS A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  HIS 30  30  30  HIS HIS A . n 
A 1 31  HIS 31  31  31  HIS HIS A . n 
A 1 32  ASN 32  32  32  ASN ASN A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  GLY 44  44  44  GLY GLY A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  ASN 49  49  49  ASN ASN A . n 
A 1 50  LYS 50  50  50  LYS LYS A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  ARG 57  57  57  ARG ARG A . n 
A 1 58  SER 58  58  58  SER SER A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  PHE 64  64  64  PHE PHE A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  ILE 70  70  70  ILE ILE A . n 
A 1 71  TRP 71  71  71  TRP TRP A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  HIS 73  73  73  HIS HIS A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  TRP 77  77  77  TRP TRP A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  PRO 82  82  82  PRO PRO A . n 
A 1 83  ASN 83  83  83  ASN ASN A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  THR 89  89  89  THR THR A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 ASP 104 104 104 ASP ASP A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 PHE 106 106 106 PHE PHE A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 GLU 108 108 108 GLU GLU A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 LYS 113 113 113 LYS LYS A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 ASN 116 116 116 ASN ASN A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 PHE 118 118 118 PHE PHE A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 SER 120 120 120 SER SER A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 TRP 122 122 122 TRP TRP A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 TRP 124 124 124 TRP TRP A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 ASN 140 140 140 ASN ASN A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 THR 146 146 146 THR THR A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 ASP 148 148 148 ASP ASP A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 THR 151 151 151 THR THR A . n 
A 1 152 PRO 152 152 152 PRO PRO A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 LEU 154 154 154 LEU LEU A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 VAL 156 156 156 VAL VAL A . n 
A 1 157 ASP 157 157 157 ASP ASP A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 TRP 159 159 159 TRP TRP A . n 
A 1 160 GLU 160 160 160 GLU GLU A . n 
A 1 161 HIS 161 161 161 HIS HIS A . n 
A 1 162 ALA 162 162 162 ALA ALA A . n 
A 1 163 TYR 163 163 163 TYR TYR A . n 
A 1 164 TYR 164 164 164 TYR TYR A . n 
A 1 165 ILE 165 165 165 ILE ILE A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 TYR 167 167 167 TYR TYR A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 ASN 169 169 169 ASN ASN A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 ARG 171 171 171 ARG ARG A . n 
A 1 172 PRO 172 172 172 PRO PRO A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 TYR 174 174 174 TYR TYR A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 PHE 178 178 178 PHE PHE A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 TRP 184 184 184 TRP TRP A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 ASN 188 188 188 ASN ASN A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 ASN 190 190 190 ASN ASN A . n 
A 1 191 PHE 191 191 191 PHE PHE A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
B 1 1   ALA 1   1   1   ALA ALA B . n 
B 1 2   PHE 2   2   2   PHE PHE B . n 
B 1 3   GLU 3   3   3   GLU GLU B . n 
B 1 4   LEU 4   4   4   LEU LEU B . n 
B 1 5   PRO 5   5   5   PRO PRO B . n 
B 1 6   SER 6   6   6   SER SER B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   PRO 8   8   8   PRO PRO B . n 
B 1 9   TYR 9   9   9   TYR TYR B . n 
B 1 10  ALA 10  10  10  ALA ALA B . n 
B 1 11  ILE 11  11  11  ILE ILE B . n 
B 1 12  ASP 12  12  12  ASP ASP B . n 
B 1 13  ALA 13  13  13  ALA ALA B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  GLU 15  15  15  GLU GLU B . n 
B 1 16  PRO 16  16  16  PRO PRO B . n 
B 1 17  HIS 17  17  17  HIS HIS B . n 
B 1 18  ILE 18  18  18  ILE ILE B . n 
B 1 19  SER 19  19  19  SER SER B . n 
B 1 20  LYS 20  20  20  LYS LYS B . n 
B 1 21  GLU 21  21  21  GLU GLU B . n 
B 1 22  THR 22  22  22  THR THR B . n 
B 1 23  LEU 23  23  23  LEU LEU B . n 
B 1 24  GLU 24  24  24  GLU GLU B . n 
B 1 25  PHE 25  25  25  PHE PHE B . n 
B 1 26  HIS 26  26  26  HIS HIS B . n 
B 1 27  HIS 27  27  27  HIS HIS B . n 
B 1 28  GLY 28  28  28  GLY GLY B . n 
B 1 29  LYS 29  29  29  LYS LYS B . n 
B 1 30  HIS 30  30  30  HIS HIS B . n 
B 1 31  HIS 31  31  31  HIS HIS B . n 
B 1 32  ASN 32  32  32  ASN ASN B . n 
B 1 33  THR 33  33  33  THR THR B . n 
B 1 34  TYR 34  34  34  TYR TYR B . n 
B 1 35  VAL 35  35  35  VAL VAL B . n 
B 1 36  VAL 36  36  36  VAL VAL B . n 
B 1 37  LYS 37  37  37  LYS LYS B . n 
B 1 38  LEU 38  38  38  LEU LEU B . n 
B 1 39  ASN 39  39  39  ASN ASN B . n 
B 1 40  GLY 40  40  40  GLY GLY B . n 
B 1 41  LEU 41  41  41  LEU LEU B . n 
B 1 42  ILE 42  42  42  ILE ILE B . n 
B 1 43  PRO 43  43  43  PRO PRO B . n 
B 1 44  GLY 44  44  44  GLY GLY B . n 
B 1 45  THR 45  45  45  THR THR B . n 
B 1 46  LYS 46  46  46  LYS LYS B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  GLU 48  48  48  GLU GLU B . n 
B 1 49  ASN 49  49  49  ASN ASN B . n 
B 1 50  LYS 50  50  50  LYS LYS B . n 
B 1 51  SER 51  51  51  SER SER B . n 
B 1 52  LEU 52  52  52  LEU LEU B . n 
B 1 53  GLU 53  53  53  GLU GLU B . n 
B 1 54  GLU 54  54  54  GLU GLU B . n 
B 1 55  ILE 55  55  55  ILE ILE B . n 
B 1 56  VAL 56  56  56  VAL VAL B . n 
B 1 57  ARG 57  57  57  ARG ARG B . n 
B 1 58  SER 58  58  58  SER SER B . n 
B 1 59  SER 59  59  59  SER SER B . n 
B 1 60  ASP 60  60  60  ASP ASP B . n 
B 1 61  GLY 61  61  61  GLY GLY B . n 
B 1 62  GLY 62  62  62  GLY GLY B . n 
B 1 63  VAL 63  63  63  VAL VAL B . n 
B 1 64  PHE 64  64  64  PHE PHE B . n 
B 1 65  ASN 65  65  65  ASN ASN B . n 
B 1 66  ASN 66  66  66  ASN ASN B . n 
B 1 67  ALA 67  67  67  ALA ALA B . n 
B 1 68  ALA 68  68  68  ALA ALA B . n 
B 1 69  GLN 69  69  69  GLN GLN B . n 
B 1 70  ILE 70  70  70  ILE ILE B . n 
B 1 71  TRP 71  71  71  TRP TRP B . n 
B 1 72  ASN 72  72  72  ASN ASN B . n 
B 1 73  HIS 73  73  73  HIS HIS B . n 
B 1 74  THR 74  74  74  THR THR B . n 
B 1 75  PHE 75  75  75  PHE PHE B . n 
B 1 76  TYR 76  76  76  TYR TYR B . n 
B 1 77  TRP 77  77  77  TRP TRP B . n 
B 1 78  ASN 78  78  78  ASN ASN B . n 
B 1 79  SER 79  79  79  SER SER B . n 
B 1 80  LEU 80  80  80  LEU LEU B . n 
B 1 81  SER 81  81  81  SER SER B . n 
B 1 82  PRO 82  82  82  PRO PRO B . n 
B 1 83  ASN 83  83  83  ASN ASN B . n 
B 1 84  GLY 84  84  84  GLY GLY B . n 
B 1 85  GLY 85  85  85  GLY GLY B . n 
B 1 86  GLY 86  86  86  GLY GLY B . n 
B 1 87  ALA 87  87  87  ALA ALA B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  THR 89  89  89  THR THR B . n 
B 1 90  GLY 90  90  90  GLY GLY B . n 
B 1 91  ALA 91  91  91  ALA ALA B . n 
B 1 92  VAL 92  92  92  VAL VAL B . n 
B 1 93  ALA 93  93  93  ALA ALA B . n 
B 1 94  ASP 94  94  94  ASP ASP B . n 
B 1 95  ALA 95  95  95  ALA ALA B . n 
B 1 96  ILE 96  96  96  ILE ILE B . n 
B 1 97  ASN 97  97  97  ASN ASN B . n 
B 1 98  ALA 98  98  98  ALA ALA B . n 
B 1 99  LYS 99  99  99  LYS LYS B . n 
B 1 100 TRP 100 100 100 TRP TRP B . n 
B 1 101 GLY 101 101 101 GLY GLY B . n 
B 1 102 SER 102 102 102 SER SER B . n 
B 1 103 PHE 103 103 103 PHE PHE B . n 
B 1 104 ASP 104 104 104 ASP ASP B . n 
B 1 105 ALA 105 105 105 ALA ALA B . n 
B 1 106 PHE 106 106 106 PHE PHE B . n 
B 1 107 LYS 107 107 107 LYS LYS B . n 
B 1 108 GLU 108 108 108 GLU GLU B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 LEU 110 110 110 LEU LEU B . n 
B 1 111 ASN 111 111 111 ASN ASN B . n 
B 1 112 ASP 112 112 112 ASP ASP B . n 
B 1 113 LYS 113 113 113 LYS LYS B . n 
B 1 114 ALA 114 114 114 ALA ALA B . n 
B 1 115 VAL 115 115 115 VAL VAL B . n 
B 1 116 ASN 116 116 116 ASN ASN B . n 
B 1 117 ASN 117 117 117 ASN ASN B . n 
B 1 118 PHE 118 118 118 PHE PHE B . n 
B 1 119 GLY 119 119 119 GLY GLY B . n 
B 1 120 SER 120 120 120 SER SER B . n 
B 1 121 SER 121 121 121 SER SER B . n 
B 1 122 TRP 122 122 122 TRP TRP B . n 
B 1 123 THR 123 123 123 THR THR B . n 
B 1 124 TRP 124 124 124 TRP TRP B . n 
B 1 125 LEU 125 125 125 LEU LEU B . n 
B 1 126 VAL 126 126 126 VAL VAL B . n 
B 1 127 LYS 127 127 127 LYS LYS B . n 
B 1 128 LEU 128 128 128 LEU LEU B . n 
B 1 129 ALA 129 129 129 ALA ALA B . n 
B 1 130 ASP 130 130 130 ASP ASP B . n 
B 1 131 GLY 131 131 131 GLY GLY B . n 
B 1 132 SER 132 132 132 SER SER B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 ILE 135 135 135 ILE ILE B . n 
B 1 136 VAL 136 136 136 VAL VAL B . n 
B 1 137 ASN 137 137 137 ASN ASN B . n 
B 1 138 THR 138 138 138 THR THR B . n 
B 1 139 SER 139 139 139 SER SER B . n 
B 1 140 ASN 140 140 140 ASN ASN B . n 
B 1 141 ALA 141 141 141 ALA ALA B . n 
B 1 142 ALA 142 142 142 ALA ALA B . n 
B 1 143 THR 143 143 143 THR THR B . n 
B 1 144 PRO 144 144 144 PRO PRO B . n 
B 1 145 LEU 145 145 145 LEU LEU B . n 
B 1 146 THR 146 146 146 THR THR B . n 
B 1 147 ASP 147 147 147 ASP ASP B . n 
B 1 148 ASP 148 148 148 ASP ASP B . n 
B 1 149 GLY 149 149 149 GLY GLY B . n 
B 1 150 VAL 150 150 150 VAL VAL B . n 
B 1 151 THR 151 151 151 THR THR B . n 
B 1 152 PRO 152 152 152 PRO PRO B . n 
B 1 153 ILE 153 153 153 ILE ILE B . n 
B 1 154 LEU 154 154 154 LEU LEU B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 VAL 156 156 156 VAL VAL B . n 
B 1 157 ASP 157 157 157 ASP ASP B . n 
B 1 158 LEU 158 158 158 LEU LEU B . n 
B 1 159 TRP 159 159 159 TRP TRP B . n 
B 1 160 GLU 160 160 160 GLU GLU B . n 
B 1 161 HIS 161 161 161 HIS HIS B . n 
B 1 162 ALA 162 162 162 ALA ALA B . n 
B 1 163 TYR 163 163 163 TYR TYR B . n 
B 1 164 TYR 164 164 164 TYR TYR B . n 
B 1 165 ILE 165 165 165 ILE ILE B . n 
B 1 166 ASP 166 166 166 ASP ASP B . n 
B 1 167 TYR 167 167 167 TYR TYR B . n 
B 1 168 ARG 168 168 168 ARG ARG B . n 
B 1 169 ASN 169 169 169 ASN ASN B . n 
B 1 170 VAL 170 170 170 VAL VAL B . n 
B 1 171 ARG 171 171 171 ARG ARG B . n 
B 1 172 PRO 172 172 172 PRO PRO B . n 
B 1 173 ASP 173 173 173 ASP ASP B . n 
B 1 174 TYR 174 174 174 TYR TYR B . n 
B 1 175 LEU 175 175 175 LEU LEU B . n 
B 1 176 LYS 176 176 176 LYS LYS B . n 
B 1 177 GLY 177 177 177 GLY GLY B . n 
B 1 178 PHE 178 178 178 PHE PHE B . n 
B 1 179 TRP 179 179 179 TRP TRP B . n 
B 1 180 SER 180 180 180 SER SER B . n 
B 1 181 LEU 181 181 181 LEU LEU B . n 
B 1 182 VAL 182 182 182 VAL VAL B . n 
B 1 183 ASN 183 183 183 ASN ASN B . n 
B 1 184 TRP 184 184 184 TRP TRP B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 PHE 186 186 186 PHE PHE B . n 
B 1 187 ALA 187 187 187 ALA ALA B . n 
B 1 188 ASN 188 188 188 ASN ASN B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 ASN 190 190 190 ASN ASN B . n 
B 1 191 PHE 191 191 191 PHE PHE B . n 
B 1 192 ALA 192 192 192 ALA ALA B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1910  ? 
1 MORE         -9    ? 
1 'SSA (A^2)'  16080 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? B ASP 157 ? B ASP 157 ? 1_555 FE ? D FE . ? B FE 5001 ? 1_555 NE2 ? B HIS 73  ? B HIS 73   ? 1_555 111.7 ? 
2  OD2 ? B ASP 157 ? B ASP 157 ? 1_555 FE ? D FE . ? B FE 5001 ? 1_555 NE2 ? B HIS 161 ? B HIS 161  ? 1_555 125.8 ? 
3  NE2 ? B HIS 73  ? B HIS 73  ? 1_555 FE ? D FE . ? B FE 5001 ? 1_555 NE2 ? B HIS 161 ? B HIS 161  ? 1_555 122.3 ? 
4  OD2 ? B ASP 157 ? B ASP 157 ? 1_555 FE ? D FE . ? B FE 5001 ? 1_555 NE2 ? B HIS 26  ? B HIS 26   ? 1_555 84.5  ? 
5  NE2 ? B HIS 73  ? B HIS 73  ? 1_555 FE ? D FE . ? B FE 5001 ? 1_555 NE2 ? B HIS 26  ? B HIS 26   ? 1_555 95.6  ? 
6  NE2 ? B HIS 161 ? B HIS 161 ? 1_555 FE ? D FE . ? B FE 5001 ? 1_555 NE2 ? B HIS 26  ? B HIS 26   ? 1_555 94.3  ? 
7  OD2 ? B ASP 157 ? B ASP 157 ? 1_555 FE ? D FE . ? B FE 5001 ? 1_555 O   ? F HOH .   ? B HOH 5102 ? 1_555 92.0  ? 
8  NE2 ? B HIS 73  ? B HIS 73  ? 1_555 FE ? D FE . ? B FE 5001 ? 1_555 O   ? F HOH .   ? B HOH 5102 ? 1_555 85.5  ? 
9  NE2 ? B HIS 161 ? B HIS 161 ? 1_555 FE ? D FE . ? B FE 5001 ? 1_555 O   ? F HOH .   ? B HOH 5102 ? 1_555 87.9  ? 
10 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 FE ? D FE . ? B FE 5001 ? 1_555 O   ? F HOH .   ? B HOH 5102 ? 1_555 176.5 ? 
11 OD2 ? A ASP 157 ? A ASP 157 ? 1_555 FE ? C FE . ? A FE 5000 ? 1_555 NE2 ? A HIS 73  ? A HIS 73   ? 1_555 114.3 ? 
12 OD2 ? A ASP 157 ? A ASP 157 ? 1_555 FE ? C FE . ? A FE 5000 ? 1_555 NE2 ? A HIS 161 ? A HIS 161  ? 1_555 122.1 ? 
13 NE2 ? A HIS 73  ? A HIS 73  ? 1_555 FE ? C FE . ? A FE 5000 ? 1_555 NE2 ? A HIS 161 ? A HIS 161  ? 1_555 123.4 ? 
14 OD2 ? A ASP 157 ? A ASP 157 ? 1_555 FE ? C FE . ? A FE 5000 ? 1_555 NE2 ? A HIS 26  ? A HIS 26   ? 1_555 84.5  ? 
15 NE2 ? A HIS 73  ? A HIS 73  ? 1_555 FE ? C FE . ? A FE 5000 ? 1_555 NE2 ? A HIS 26  ? A HIS 26   ? 1_555 96.9  ? 
16 NE2 ? A HIS 161 ? A HIS 161 ? 1_555 FE ? C FE . ? A FE 5000 ? 1_555 NE2 ? A HIS 26  ? A HIS 26   ? 1_555 92.5  ? 
17 OD2 ? A ASP 157 ? A ASP 157 ? 1_555 FE ? C FE . ? A FE 5000 ? 1_555 O   ? E HOH .   ? A HOH 5101 ? 1_555 91.4  ? 
18 NE2 ? A HIS 73  ? A HIS 73  ? 1_555 FE ? C FE . ? A FE 5000 ? 1_555 O   ? E HOH .   ? A HOH 5101 ? 1_555 88.0  ? 
19 NE2 ? A HIS 161 ? A HIS 161 ? 1_555 FE ? C FE . ? A FE 5000 ? 1_555 O   ? E HOH .   ? A HOH 5101 ? 1_555 86.7  ? 
20 NE2 ? A HIS 26  ? A HIS 26  ? 1_555 FE ? C FE . ? A FE 5000 ? 1_555 O   ? E HOH .   ? A HOH 5101 ? 1_555 174.5 ? 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2014-02-26 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHASES   phasing          .   ? 1 
CNS      refinement       1.1 ? 2 
HKL-2000 'data reduction' .   ? 3 
HKL-2000 'data scaling'   .   ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    185 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    5212 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              154 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              154 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              154 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                130.37 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            15.07 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 29  ? ? -109.68 -61.69  
2 1 LYS A 46  ? ? -68.38  11.71   
3 1 ASN A 140 ? ? 51.43   -108.82 
4 1 ARG A 168 ? ? 50.86   -125.00 
5 1 LYS B 46  ? ? -80.52  32.71   
6 1 ASN B 140 ? ? 58.02   -106.16 
7 1 ARG B 168 ? ? 51.35   -129.10 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE (III) ION' FE  
3 water          HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 FE  1   5000 5000 FE  FE  A . 
D 2 FE  1   5001 5001 FE  FE  B . 
E 3 HOH 1   5101 2001 HOH HOH A . 
E 3 HOH 2   5102 2003 HOH HOH A . 
E 3 HOH 3   5103 2004 HOH HOH A . 
E 3 HOH 4   5104 2007 HOH HOH A . 
E 3 HOH 5   5105 2009 HOH HOH A . 
E 3 HOH 6   5106 2010 HOH HOH A . 
E 3 HOH 7   5107 2011 HOH HOH A . 
E 3 HOH 8   5108 2012 HOH HOH A . 
E 3 HOH 9   5109 2013 HOH HOH A . 
E 3 HOH 10  5110 2014 HOH HOH A . 
E 3 HOH 11  5111 2015 HOH HOH A . 
E 3 HOH 12  5112 2016 HOH HOH A . 
E 3 HOH 13  5113 2017 HOH HOH A . 
E 3 HOH 14  5114 2018 HOH HOH A . 
E 3 HOH 15  5115 2020 HOH HOH A . 
E 3 HOH 16  5116 2023 HOH HOH A . 
E 3 HOH 17  5117 2024 HOH HOH A . 
E 3 HOH 18  5118 2025 HOH HOH A . 
E 3 HOH 19  5119 2026 HOH HOH A . 
E 3 HOH 20  5120 2027 HOH HOH A . 
E 3 HOH 21  5121 2032 HOH HOH A . 
E 3 HOH 22  5122 2033 HOH HOH A . 
E 3 HOH 23  5123 2040 HOH HOH A . 
E 3 HOH 24  5124 2042 HOH HOH A . 
E 3 HOH 25  5125 2043 HOH HOH A . 
E 3 HOH 26  5126 2045 HOH HOH A . 
E 3 HOH 27  5127 2046 HOH HOH A . 
E 3 HOH 28  5128 2053 HOH HOH A . 
E 3 HOH 29  5129 2054 HOH HOH A . 
E 3 HOH 30  5130 2055 HOH HOH A . 
E 3 HOH 31  5131 2059 HOH HOH A . 
E 3 HOH 32  5132 2060 HOH HOH A . 
E 3 HOH 33  5133 2061 HOH HOH A . 
E 3 HOH 34  5134 2066 HOH HOH A . 
E 3 HOH 35  5135 2067 HOH HOH A . 
E 3 HOH 36  5136 2073 HOH HOH A . 
E 3 HOH 37  5137 2074 HOH HOH A . 
E 3 HOH 38  5138 2075 HOH HOH A . 
E 3 HOH 39  5139 2077 HOH HOH A . 
E 3 HOH 40  5140 2079 HOH HOH A . 
E 3 HOH 41  5141 2081 HOH HOH A . 
E 3 HOH 42  5142 2083 HOH HOH A . 
E 3 HOH 43  5143 2084 HOH HOH A . 
E 3 HOH 44  5144 2088 HOH HOH A . 
E 3 HOH 45  5145 2089 HOH HOH A . 
E 3 HOH 46  5146 2090 HOH HOH A . 
E 3 HOH 47  5147 2091 HOH HOH A . 
E 3 HOH 48  5148 2093 HOH HOH A . 
E 3 HOH 49  5149 2098 HOH HOH A . 
E 3 HOH 50  5150 2101 HOH HOH A . 
E 3 HOH 51  5151 2102 HOH HOH A . 
E 3 HOH 52  5152 2104 HOH HOH A . 
E 3 HOH 53  5153 2105 HOH HOH A . 
E 3 HOH 54  5154 2106 HOH HOH A . 
E 3 HOH 55  5155 2107 HOH HOH A . 
E 3 HOH 56  5156 2108 HOH HOH A . 
E 3 HOH 57  5157 2109 HOH HOH A . 
E 3 HOH 58  5158 2111 HOH HOH A . 
E 3 HOH 59  5159 2112 HOH HOH A . 
E 3 HOH 60  5160 2113 HOH HOH A . 
E 3 HOH 61  5161 2115 HOH HOH A . 
E 3 HOH 62  5162 2116 HOH HOH A . 
E 3 HOH 63  5163 2118 HOH HOH A . 
E 3 HOH 64  5164 2119 HOH HOH A . 
E 3 HOH 65  5165 2120 HOH HOH A . 
E 3 HOH 66  5166 2122 HOH HOH A . 
E 3 HOH 67  5167 2123 HOH HOH A . 
E 3 HOH 68  5168 2125 HOH HOH A . 
E 3 HOH 69  5169 2130 HOH HOH A . 
E 3 HOH 70  5170 2133 HOH HOH A . 
E 3 HOH 71  5171 2134 HOH HOH A . 
E 3 HOH 72  5172 2135 HOH HOH A . 
E 3 HOH 73  5173 2137 HOH HOH A . 
E 3 HOH 74  5174 2138 HOH HOH A . 
E 3 HOH 75  5175 2139 HOH HOH A . 
E 3 HOH 76  5176 2142 HOH HOH A . 
E 3 HOH 77  5177 2146 HOH HOH A . 
E 3 HOH 78  5178 2148 HOH HOH A . 
E 3 HOH 79  5179 2151 HOH HOH A . 
E 3 HOH 80  5180 2152 HOH HOH A . 
E 3 HOH 81  5181 2153 HOH HOH A . 
E 3 HOH 82  5182 2158 HOH HOH A . 
E 3 HOH 83  5183 2161 HOH HOH A . 
E 3 HOH 84  5184 2165 HOH HOH A . 
E 3 HOH 85  5185 2166 HOH HOH A . 
E 3 HOH 86  5186 2167 HOH HOH A . 
E 3 HOH 87  5187 2168 HOH HOH A . 
E 3 HOH 88  5188 2170 HOH HOH A . 
E 3 HOH 89  5189 2171 HOH HOH A . 
E 3 HOH 90  5190 2172 HOH HOH A . 
E 3 HOH 91  5191 2175 HOH HOH A . 
E 3 HOH 92  5192 2176 HOH HOH A . 
E 3 HOH 93  5193 2178 HOH HOH A . 
E 3 HOH 94  5194 2179 HOH HOH A . 
E 3 HOH 95  5195 2180 HOH HOH A . 
E 3 HOH 96  5196 2181 HOH HOH A . 
E 3 HOH 97  5197 2182 HOH HOH A . 
E 3 HOH 98  5198 2183 HOH HOH A . 
E 3 HOH 99  5199 2186 HOH HOH A . 
E 3 HOH 100 5200 2187 HOH HOH A . 
E 3 HOH 101 5201 2188 HOH HOH A . 
E 3 HOH 102 5202 2191 HOH HOH A . 
E 3 HOH 103 5203 2193 HOH HOH A . 
E 3 HOH 104 5204 2197 HOH HOH A . 
E 3 HOH 105 5205 2199 HOH HOH A . 
E 3 HOH 106 5206 2201 HOH HOH A . 
E 3 HOH 107 5207 2203 HOH HOH A . 
E 3 HOH 108 5208 2204 HOH HOH A . 
E 3 HOH 109 5209 2205 HOH HOH A . 
E 3 HOH 110 5210 2206 HOH HOH A . 
E 3 HOH 111 5211 2209 HOH HOH A . 
E 3 HOH 112 5212 2211 HOH HOH A . 
E 3 HOH 113 5213 2213 HOH HOH A . 
E 3 HOH 114 5214 2214 HOH HOH A . 
E 3 HOH 115 5215 2215 HOH HOH A . 
E 3 HOH 116 5216 2217 HOH HOH A . 
E 3 HOH 117 5217 2220 HOH HOH A . 
E 3 HOH 118 5218 2221 HOH HOH A . 
E 3 HOH 119 5219 2222 HOH HOH A . 
E 3 HOH 120 5220 2224 HOH HOH A . 
E 3 HOH 121 5221 2228 HOH HOH A . 
E 3 HOH 122 5222 2231 HOH HOH A . 
E 3 HOH 123 5223 2236 HOH HOH A . 
E 3 HOH 124 5224 2237 HOH HOH A . 
E 3 HOH 125 5225 2239 HOH HOH A . 
E 3 HOH 126 5226 2240 HOH HOH A . 
E 3 HOH 127 5227 2242 HOH HOH A . 
E 3 HOH 128 5228 2243 HOH HOH A . 
E 3 HOH 129 5229 2245 HOH HOH A . 
E 3 HOH 130 5230 2246 HOH HOH A . 
E 3 HOH 131 5231 2249 HOH HOH A . 
E 3 HOH 132 5232 2253 HOH HOH A . 
E 3 HOH 133 5233 2257 HOH HOH A . 
E 3 HOH 134 5234 2260 HOH HOH A . 
E 3 HOH 135 5235 2265 HOH HOH A . 
E 3 HOH 136 5236 2267 HOH HOH A . 
E 3 HOH 137 5237 2268 HOH HOH A . 
E 3 HOH 138 5238 2273 HOH HOH A . 
E 3 HOH 139 5239 2274 HOH HOH A . 
E 3 HOH 140 5240 2278 HOH HOH A . 
E 3 HOH 141 5241 2280 HOH HOH A . 
E 3 HOH 142 5242 2284 HOH HOH A . 
E 3 HOH 143 5243 2285 HOH HOH A . 
E 3 HOH 144 5244 2287 HOH HOH A . 
E 3 HOH 145 5245 2290 HOH HOH A . 
E 3 HOH 146 5246 2291 HOH HOH A . 
E 3 HOH 147 5247 2294 HOH HOH A . 
E 3 HOH 148 5248 2298 HOH HOH A . 
E 3 HOH 149 5249 2302 HOH HOH A . 
E 3 HOH 150 5250 2303 HOH HOH A . 
E 3 HOH 151 5251 2305 HOH HOH A . 
E 3 HOH 152 5252 2306 HOH HOH A . 
E 3 HOH 153 5253 2310 HOH HOH A . 
E 3 HOH 154 5254 2311 HOH HOH A . 
E 3 HOH 155 5255 2313 HOH HOH A . 
E 3 HOH 156 5256 2314 HOH HOH A . 
E 3 HOH 157 5257 2318 HOH HOH A . 
E 3 HOH 158 5258 2320 HOH HOH A . 
E 3 HOH 159 5259 2324 HOH HOH A . 
E 3 HOH 160 5260 2325 HOH HOH A . 
E 3 HOH 161 5261 2326 HOH HOH A . 
E 3 HOH 162 5262 2328 HOH HOH A . 
E 3 HOH 163 5263 2329 HOH HOH A . 
E 3 HOH 164 5264 2334 HOH HOH A . 
E 3 HOH 165 5265 2336 HOH HOH A . 
E 3 HOH 166 5266 2337 HOH HOH A . 
E 3 HOH 167 5267 2293 HOH HOH A . 
F 3 HOH 1   5101 2315 HOH HOH B . 
F 3 HOH 2   5102 2002 HOH HOH B . 
F 3 HOH 3   5103 2005 HOH HOH B . 
F 3 HOH 4   5104 2006 HOH HOH B . 
F 3 HOH 5   5105 2008 HOH HOH B . 
F 3 HOH 6   5106 2019 HOH HOH B . 
F 3 HOH 7   5107 5107 HOH HOH B . 
F 3 HOH 8   5108 2022 HOH HOH B . 
F 3 HOH 9   5109 2028 HOH HOH B . 
F 3 HOH 10  5110 2029 HOH HOH B . 
F 3 HOH 11  5111 2030 HOH HOH B . 
F 3 HOH 12  5112 2031 HOH HOH B . 
F 3 HOH 13  5113 2034 HOH HOH B . 
F 3 HOH 14  5114 2035 HOH HOH B . 
F 3 HOH 15  5115 2036 HOH HOH B . 
F 3 HOH 16  5116 2037 HOH HOH B . 
F 3 HOH 17  5117 2038 HOH HOH B . 
F 3 HOH 18  5118 2039 HOH HOH B . 
F 3 HOH 19  5119 2041 HOH HOH B . 
F 3 HOH 20  5120 2044 HOH HOH B . 
F 3 HOH 21  5121 2047 HOH HOH B . 
F 3 HOH 22  5122 2048 HOH HOH B . 
F 3 HOH 23  5123 2049 HOH HOH B . 
F 3 HOH 24  5124 2050 HOH HOH B . 
F 3 HOH 25  5125 2051 HOH HOH B . 
F 3 HOH 26  5126 2052 HOH HOH B . 
F 3 HOH 27  5127 2056 HOH HOH B . 
F 3 HOH 28  5128 2057 HOH HOH B . 
F 3 HOH 29  5129 2058 HOH HOH B . 
F 3 HOH 30  5130 2062 HOH HOH B . 
F 3 HOH 31  5131 2063 HOH HOH B . 
F 3 HOH 32  5132 2064 HOH HOH B . 
F 3 HOH 33  5133 2065 HOH HOH B . 
F 3 HOH 34  5134 2068 HOH HOH B . 
F 3 HOH 35  5135 2069 HOH HOH B . 
F 3 HOH 36  5136 2070 HOH HOH B . 
F 3 HOH 37  5137 2071 HOH HOH B . 
F 3 HOH 38  5138 2072 HOH HOH B . 
F 3 HOH 39  5139 2076 HOH HOH B . 
F 3 HOH 40  5140 2078 HOH HOH B . 
F 3 HOH 41  5141 2080 HOH HOH B . 
F 3 HOH 42  5142 2082 HOH HOH B . 
F 3 HOH 43  5143 2085 HOH HOH B . 
F 3 HOH 44  5144 2086 HOH HOH B . 
F 3 HOH 45  5145 2087 HOH HOH B . 
F 3 HOH 46  5146 2092 HOH HOH B . 
F 3 HOH 47  5147 2094 HOH HOH B . 
F 3 HOH 48  5148 2095 HOH HOH B . 
F 3 HOH 49  5149 2096 HOH HOH B . 
F 3 HOH 50  5150 2097 HOH HOH B . 
F 3 HOH 51  5151 2099 HOH HOH B . 
F 3 HOH 52  5152 2100 HOH HOH B . 
F 3 HOH 53  5153 2103 HOH HOH B . 
F 3 HOH 54  5154 2110 HOH HOH B . 
F 3 HOH 55  5155 2114 HOH HOH B . 
F 3 HOH 56  5156 2117 HOH HOH B . 
F 3 HOH 57  5157 2121 HOH HOH B . 
F 3 HOH 58  5158 2124 HOH HOH B . 
F 3 HOH 59  5159 2126 HOH HOH B . 
F 3 HOH 60  5160 2127 HOH HOH B . 
F 3 HOH 61  5161 2128 HOH HOH B . 
F 3 HOH 62  5162 2129 HOH HOH B . 
F 3 HOH 63  5163 2131 HOH HOH B . 
F 3 HOH 64  5164 2132 HOH HOH B . 
F 3 HOH 65  5165 2136 HOH HOH B . 
F 3 HOH 66  5166 2140 HOH HOH B . 
F 3 HOH 67  5167 2141 HOH HOH B . 
F 3 HOH 68  5168 2143 HOH HOH B . 
F 3 HOH 69  5169 2144 HOH HOH B . 
F 3 HOH 70  5170 2145 HOH HOH B . 
F 3 HOH 71  5171 2147 HOH HOH B . 
F 3 HOH 72  5172 2149 HOH HOH B . 
F 3 HOH 73  5173 2150 HOH HOH B . 
F 3 HOH 74  5174 2154 HOH HOH B . 
F 3 HOH 75  5175 2155 HOH HOH B . 
F 3 HOH 76  5176 2156 HOH HOH B . 
F 3 HOH 77  5177 2157 HOH HOH B . 
F 3 HOH 78  5178 2159 HOH HOH B . 
F 3 HOH 79  5179 2160 HOH HOH B . 
F 3 HOH 80  5180 2162 HOH HOH B . 
F 3 HOH 81  5181 2163 HOH HOH B . 
F 3 HOH 82  5182 2164 HOH HOH B . 
F 3 HOH 83  5183 2169 HOH HOH B . 
F 3 HOH 84  5184 2173 HOH HOH B . 
F 3 HOH 85  5185 2174 HOH HOH B . 
F 3 HOH 86  5186 2177 HOH HOH B . 
F 3 HOH 87  5187 2184 HOH HOH B . 
F 3 HOH 88  5188 2185 HOH HOH B . 
F 3 HOH 89  5189 2189 HOH HOH B . 
F 3 HOH 90  5190 2190 HOH HOH B . 
F 3 HOH 91  5191 2192 HOH HOH B . 
F 3 HOH 92  5192 2194 HOH HOH B . 
F 3 HOH 93  5193 2195 HOH HOH B . 
F 3 HOH 94  5194 2196 HOH HOH B . 
F 3 HOH 95  5195 2198 HOH HOH B . 
F 3 HOH 96  5196 2200 HOH HOH B . 
F 3 HOH 97  5197 2202 HOH HOH B . 
F 3 HOH 98  5198 2207 HOH HOH B . 
F 3 HOH 99  5199 2208 HOH HOH B . 
F 3 HOH 100 5200 2210 HOH HOH B . 
F 3 HOH 101 5201 2212 HOH HOH B . 
F 3 HOH 102 5202 2216 HOH HOH B . 
F 3 HOH 103 5203 2218 HOH HOH B . 
F 3 HOH 104 5204 2219 HOH HOH B . 
F 3 HOH 105 5205 2223 HOH HOH B . 
F 3 HOH 106 5206 2225 HOH HOH B . 
F 3 HOH 107 5207 2226 HOH HOH B . 
F 3 HOH 108 5208 2227 HOH HOH B . 
F 3 HOH 109 5209 2229 HOH HOH B . 
F 3 HOH 110 5210 2230 HOH HOH B . 
F 3 HOH 111 5211 2232 HOH HOH B . 
F 3 HOH 112 5212 2233 HOH HOH B . 
F 3 HOH 113 5213 2234 HOH HOH B . 
F 3 HOH 114 5214 2235 HOH HOH B . 
F 3 HOH 115 5215 2238 HOH HOH B . 
F 3 HOH 116 5216 2241 HOH HOH B . 
F 3 HOH 117 5217 2244 HOH HOH B . 
F 3 HOH 118 5218 2247 HOH HOH B . 
F 3 HOH 119 5219 2248 HOH HOH B . 
F 3 HOH 120 5220 2250 HOH HOH B . 
F 3 HOH 121 5221 2251 HOH HOH B . 
F 3 HOH 122 5222 2252 HOH HOH B . 
F 3 HOH 123 5223 2254 HOH HOH B . 
F 3 HOH 124 5224 2255 HOH HOH B . 
F 3 HOH 125 5225 2256 HOH HOH B . 
F 3 HOH 126 5226 2258 HOH HOH B . 
F 3 HOH 127 5227 2259 HOH HOH B . 
F 3 HOH 128 5228 2261 HOH HOH B . 
F 3 HOH 129 5229 2262 HOH HOH B . 
F 3 HOH 130 5230 2263 HOH HOH B . 
F 3 HOH 131 5231 2264 HOH HOH B . 
F 3 HOH 132 5232 2266 HOH HOH B . 
F 3 HOH 133 5233 2269 HOH HOH B . 
F 3 HOH 134 5234 2270 HOH HOH B . 
F 3 HOH 135 5235 2271 HOH HOH B . 
F 3 HOH 136 5236 2272 HOH HOH B . 
F 3 HOH 137 5237 2275 HOH HOH B . 
F 3 HOH 138 5238 2276 HOH HOH B . 
F 3 HOH 139 5239 2277 HOH HOH B . 
F 3 HOH 140 5240 2279 HOH HOH B . 
F 3 HOH 141 5241 2281 HOH HOH B . 
F 3 HOH 142 5242 2282 HOH HOH B . 
F 3 HOH 143 5243 2283 HOH HOH B . 
F 3 HOH 144 5244 2286 HOH HOH B . 
F 3 HOH 145 5245 2288 HOH HOH B . 
F 3 HOH 146 5246 2289 HOH HOH B . 
F 3 HOH 147 5247 2292 HOH HOH B . 
F 3 HOH 148 5248 2295 HOH HOH B . 
F 3 HOH 149 5249 2296 HOH HOH B . 
F 3 HOH 150 5250 2297 HOH HOH B . 
F 3 HOH 151 5251 2299 HOH HOH B . 
F 3 HOH 152 5252 2300 HOH HOH B . 
F 3 HOH 153 5253 2301 HOH HOH B . 
F 3 HOH 154 5254 2304 HOH HOH B . 
F 3 HOH 155 5255 2307 HOH HOH B . 
F 3 HOH 156 5256 2308 HOH HOH B . 
F 3 HOH 157 5257 2309 HOH HOH B . 
F 3 HOH 158 5258 2312 HOH HOH B . 
F 3 HOH 159 5259 2316 HOH HOH B . 
F 3 HOH 160 5260 2317 HOH HOH B . 
F 3 HOH 161 5261 2319 HOH HOH B . 
F 3 HOH 162 5262 2321 HOH HOH B . 
F 3 HOH 163 5263 2323 HOH HOH B . 
F 3 HOH 164 5264 2327 HOH HOH B . 
F 3 HOH 165 5265 2330 HOH HOH B . 
F 3 HOH 166 5266 2331 HOH HOH B . 
F 3 HOH 167 5267 2332 HOH HOH B . 
F 3 HOH 168 5268 2333 HOH HOH B . 
F 3 HOH 169 5269 2335 HOH HOH B . 
#