data_4L57
# 
_entry.id   4L57 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4L57         
RCSB  RCSB080195   
WWPDB D_1000080195 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4L57 
_pdbx_database_status.recvd_initial_deposition_date   2013-06-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pachl, P.'    1 
'Brynda, J.'   2 
'Rezacova, P.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structures of human cytosolic and mitochondrial nucleotidases: implications for structure-based design of selective inhibitors.' 
_citation.journal_abbrev            'Acta Crystallogr. D Biol. Crystallogr.' 
_citation.journal_volume            70 
_citation.page_first                461 
_citation.page_last                 470 
_citation.year                      2014 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   US 
_citation.journal_id_ISSN           1399-0047 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24531480 
_citation.pdbx_database_id_DOI      10.1107/S1399004713030502 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pachl, P.'     1 
primary 'Fabry, M.'     2 
primary 'Rosenberg, I.' 3 
primary 'Simak, O.'     4 
primary 'Rezacova, P.'  5 
primary 'Brynda, J.'    6 
# 
_cell.entry_id           4L57 
_cell.length_a           39.128 
_cell.length_b           46.493 
_cell.length_c           61.409 
_cell.angle_alpha        68.16 
_cell.angle_beta         81.47 
_cell.angle_gamma        75.28 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4L57 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;5'(3')-deoxyribonucleotidase, cytosolic type
;
22805.162 2   3.1.3.- ? 'UNP RESIDUES 1-195' ? 
2 non-polymer syn 'MAGNESIUM ION'                                24.305    2   ?       ? ?                    ? 
3 non-polymer syn 'PHOSPHATE ION'                                94.971    2   ?       ? ?                    ? 
4 non-polymer syn GLYCEROL                                       92.094    6   ?       ? ?                    ? 
5 non-polymer syn 'SODIUM ION'                                   22.990    1   ?       ? ?                    ? 
6 water       nat water                                          18.015    443 ?       ? ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Cytosolic 5',3'-pyrimidine nucleotidase, Deoxy-5'-nucleotidase 1, dNT-1
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGA
LDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEH
ILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGA
LDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEH
ILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ARG n 
1 4   SER n 
1 5   VAL n 
1 6   ARG n 
1 7   VAL n 
1 8   LEU n 
1 9   VAL n 
1 10  ASP n 
1 11  MET n 
1 12  ASP n 
1 13  GLY n 
1 14  VAL n 
1 15  LEU n 
1 16  ALA n 
1 17  ASP n 
1 18  PHE n 
1 19  GLU n 
1 20  ALA n 
1 21  GLY n 
1 22  LEU n 
1 23  LEU n 
1 24  ARG n 
1 25  GLY n 
1 26  PHE n 
1 27  ARG n 
1 28  ARG n 
1 29  ARG n 
1 30  PHE n 
1 31  PRO n 
1 32  GLU n 
1 33  GLU n 
1 34  PRO n 
1 35  HIS n 
1 36  VAL n 
1 37  PRO n 
1 38  LEU n 
1 39  GLU n 
1 40  GLN n 
1 41  ARG n 
1 42  ARG n 
1 43  GLY n 
1 44  PHE n 
1 45  LEU n 
1 46  ALA n 
1 47  ARG n 
1 48  GLU n 
1 49  GLN n 
1 50  TYR n 
1 51  ARG n 
1 52  ALA n 
1 53  LEU n 
1 54  ARG n 
1 55  PRO n 
1 56  ASP n 
1 57  LEU n 
1 58  ALA n 
1 59  ASP n 
1 60  LYS n 
1 61  VAL n 
1 62  ALA n 
1 63  SER n 
1 64  VAL n 
1 65  TYR n 
1 66  GLU n 
1 67  ALA n 
1 68  PRO n 
1 69  GLY n 
1 70  PHE n 
1 71  PHE n 
1 72  LEU n 
1 73  ASP n 
1 74  LEU n 
1 75  GLU n 
1 76  PRO n 
1 77  ILE n 
1 78  PRO n 
1 79  GLY n 
1 80  ALA n 
1 81  LEU n 
1 82  ASP n 
1 83  ALA n 
1 84  VAL n 
1 85  ARG n 
1 86  GLU n 
1 87  MET n 
1 88  ASN n 
1 89  ASP n 
1 90  LEU n 
1 91  PRO n 
1 92  ASP n 
1 93  THR n 
1 94  GLN n 
1 95  VAL n 
1 96  PHE n 
1 97  ILE n 
1 98  CYS n 
1 99  THR n 
1 100 SER n 
1 101 PRO n 
1 102 LEU n 
1 103 LEU n 
1 104 LYS n 
1 105 TYR n 
1 106 HIS n 
1 107 HIS n 
1 108 CYS n 
1 109 VAL n 
1 110 GLY n 
1 111 GLU n 
1 112 LYS n 
1 113 TYR n 
1 114 ARG n 
1 115 TRP n 
1 116 VAL n 
1 117 GLU n 
1 118 GLN n 
1 119 HIS n 
1 120 LEU n 
1 121 GLY n 
1 122 PRO n 
1 123 GLN n 
1 124 PHE n 
1 125 VAL n 
1 126 GLU n 
1 127 ARG n 
1 128 ILE n 
1 129 ILE n 
1 130 LEU n 
1 131 THR n 
1 132 ARG n 
1 133 ASP n 
1 134 LYS n 
1 135 THR n 
1 136 VAL n 
1 137 VAL n 
1 138 LEU n 
1 139 GLY n 
1 140 ASP n 
1 141 LEU n 
1 142 LEU n 
1 143 ILE n 
1 144 ASP n 
1 145 ASP n 
1 146 LYS n 
1 147 ASP n 
1 148 THR n 
1 149 VAL n 
1 150 ARG n 
1 151 GLY n 
1 152 GLN n 
1 153 GLU n 
1 154 GLU n 
1 155 THR n 
1 156 PRO n 
1 157 SER n 
1 158 TRP n 
1 159 GLU n 
1 160 HIS n 
1 161 ILE n 
1 162 LEU n 
1 163 PHE n 
1 164 THR n 
1 165 CYS n 
1 166 CYS n 
1 167 HIS n 
1 168 ASN n 
1 169 ARG n 
1 170 HIS n 
1 171 LEU n 
1 172 VAL n 
1 173 LEU n 
1 174 PRO n 
1 175 PRO n 
1 176 THR n 
1 177 ARG n 
1 178 ARG n 
1 179 ARG n 
1 180 LEU n 
1 181 LEU n 
1 182 SER n 
1 183 TRP n 
1 184 SER n 
1 185 ASP n 
1 186 ASN n 
1 187 TRP n 
1 188 ARG n 
1 189 GLU n 
1 190 ILE n 
1 191 LEU n 
1 192 ASP n 
1 193 SER n 
1 194 LYS n 
1 195 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DNT1, NT5C, UMPH2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET 22' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NT5C_HUMAN 
_struct_ref.pdbx_db_accession          Q8TCD5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGA
LDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEH
ILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKR
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4L57 A 1 ? 195 ? Q8TCD5 1 ? 195 ? 1 195 
2 1 4L57 B 1 ? 195 ? Q8TCD5 1 ? 195 ? 1 195 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?                               'Mg 2'           24.305  
NA  non-polymer         . 'SODIUM ION'    ?                               'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ?                               'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4L57 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.19 
_exptl_crystal.density_percent_sol   43.96 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.2 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '40MM KH2PO4, 5% PEG 8000, 20% GLYCEROL, pH 4.2, VAPOR DIFFUSION, temperature 291K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2010-02-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9184 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'BESSY BEAMLINE 14.2' 
_diffrn_source.pdbx_synchrotron_site       BESSY 
_diffrn_source.pdbx_synchrotron_beamline   14.2 
_diffrn_source.pdbx_wavelength             0.9184 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4L57 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             23.400 
_reflns.d_resolution_high            1.080 
_reflns.number_obs                   142636 
_reflns.number_all                   144252 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4L57 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     142636 
_refine.ls_number_reflns_all                     144252 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             22.48 
_refine.ls_d_res_high                            1.08 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1436 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1436 
_refine.ls_R_factor_R_free                       0.183 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1463 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.010 
_refine.occupancy_max                            1.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               16.1068 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                5.580 
_refine.B_iso_max                                126.510 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3163 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         49 
_refine_hist.number_atoms_solvent             443 
_refine_hist.number_atoms_total               3655 
_refine_hist.d_res_high                       1.08 
_refine_hist.d_res_low                        22.48 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    4L57 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     0.183 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            1463 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  4L57 
_struct.title                     
;High resolutin structure of human cytosolic 5'(3')-deoxyribonucleotidase
;
_struct.pdbx_descriptor           
;5'(3')-deoxyribonucleotidase, cytosolic type (E.C.3.1.3.-)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4L57 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;5'-NUCLEOTIDASE, PROTEIN CONFORMATION, SEQUENCE HOMOLOGY, HAD-LIKE, HYDROLASE, DEPHOSPHORYLATION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 5 ? 
K N N 2 ? 
L N N 3 ? 
M N N 4 ? 
N N N 6 ? 
O N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 17  ? PHE A 30  ? ASP A 17  PHE A 30  1 ? 14 
HELX_P HELX_P2  2  PRO A 37  ? ARG A 41  ? PRO A 37  ARG A 41  5 ? 5  
HELX_P HELX_P3  3  LEU A 45  ? ARG A 54  ? LEU A 45  ARG A 54  1 ? 10 
HELX_P HELX_P4  4  ASP A 56  ? GLU A 66  ? ASP A 56  GLU A 66  1 ? 11 
HELX_P HELX_P5  5  GLY A 79  ? LEU A 90  ? GLY A 79  LEU A 90  1 ? 12 
HELX_P HELX_P6  6  CYS A 108 ? GLY A 121 ? CYS A 108 GLY A 121 1 ? 14 
HELX_P HELX_P7  7  GLY A 121 ? GLU A 126 ? GLY A 121 GLU A 126 1 ? 6  
HELX_P HELX_P8  8  ASP A 133 ? VAL A 137 ? ASP A 133 VAL A 137 5 ? 5  
HELX_P HELX_P9  9  CYS A 165 ? ARG A 169 ? CYS A 165 ARG A 169 5 ? 5  
HELX_P HELX_P10 10 ASN A 186 ? SER A 193 ? ASN A 186 SER A 193 1 ? 8  
HELX_P HELX_P11 11 ASP B 17  ? PHE B 30  ? ASP B 17  PHE B 30  1 ? 14 
HELX_P HELX_P12 12 PRO B 37  ? ARG B 41  ? PRO B 37  ARG B 41  5 ? 5  
HELX_P HELX_P13 13 LEU B 45  ? ARG B 54  ? LEU B 45  ARG B 54  1 ? 10 
HELX_P HELX_P14 14 ASP B 56  ? GLU B 66  ? ASP B 56  GLU B 66  1 ? 11 
HELX_P HELX_P15 15 GLY B 79  ? LEU B 90  ? GLY B 79  LEU B 90  1 ? 12 
HELX_P HELX_P16 16 CYS B 108 ? GLY B 121 ? CYS B 108 GLY B 121 1 ? 14 
HELX_P HELX_P17 17 GLY B 121 ? GLU B 126 ? GLY B 121 GLU B 126 1 ? 6  
HELX_P HELX_P18 18 ASP B 133 ? VAL B 137 ? ASP B 133 VAL B 137 5 ? 5  
HELX_P HELX_P19 19 ASN B 186 ? SER B 193 ? ASN B 186 SER B 193 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B ASP 145 OD1 ? ? ? 1_555 K MG  . MG ? ? B ASP 145 B MG  201 1_555 ? ? ? ? ? ? ? 2.020 ? 
metalc2  metalc ? ? A ASP 145 OD1 ? ? ? 1_555 C MG  . MG ? ? A ASP 145 A MG  201 1_555 ? ? ? ? ? ? ? 2.027 ? 
metalc3  metalc ? ? A ASP 12  O   ? ? ? 1_555 C MG  . MG ? ? A ASP 12  A MG  201 1_555 ? ? ? ? ? ? ? 2.058 ? 
metalc4  metalc ? ? B ASP 12  O   ? ? ? 1_555 K MG  . MG ? ? B ASP 12  B MG  201 1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc5  metalc ? ? C MG  .   MG  ? ? ? 1_555 D PO4 . O2 ? ? A MG  201 A PO4 202 1_555 ? ? ? ? ? ? ? 2.115 ? 
metalc6  metalc ? ? A ASP 10  OD2 ? ? ? 1_555 C MG  . MG ? ? A ASP 10  A MG  201 1_555 ? ? ? ? ? ? ? 2.118 ? 
metalc7  metalc ? ? K MG  .   MG  ? ? ? 1_555 L PO4 . O2 ? ? B MG  201 B PO4 202 1_555 ? ? ? ? ? ? ? 2.120 ? 
metalc8  metalc ? ? B ASP 10  OD2 ? ? ? 1_555 K MG  . MG ? ? B ASP 10  B MG  201 1_555 ? ? ? ? ? ? ? 2.140 ? 
metalc9  metalc ? ? A LEU 90  O   ? ? ? 1_555 J NA  . NA ? ? A LEU 90  A NA  208 1_555 ? ? ? ? ? ? ? 2.578 ? 
metalc10 metalc ? ? A ASN 88  O   ? ? ? 1_555 J NA  . NA ? ? A ASN 88  A NA  208 1_555 ? ? ? ? ? ? ? 2.616 ? 
metalc11 metalc ? ? A THR 93  O   ? ? ? 1_555 J NA  . NA ? ? A THR 93  A NA  208 1_555 ? ? ? ? ? ? ? 3.009 ? 
metalc12 metalc ? ? K MG  .   MG  ? ? ? 1_555 O HOH . O  ? ? B MG  201 B HOH 315 1_555 ? ? ? ? ? ? ? 2.040 ? 
metalc13 metalc ? ? C MG  .   MG  ? ? ? 1_555 N HOH . O  ? ? A MG  201 A HOH 320 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc14 metalc ? ? K MG  .   MG  ? ? ? 1_555 O HOH . O  ? ? B MG  201 B HOH 314 1_555 ? ? ? ? ? ? ? 2.061 ? 
metalc15 metalc ? ? C MG  .   MG  ? ? ? 1_555 N HOH . O  ? ? A MG  201 A HOH 311 1_555 ? ? ? ? ? ? ? 2.084 ? 
metalc16 metalc ? ? J NA  .   NA  ? ? ? 1_555 N HOH . O  ? ? A NA  208 A HOH 423 1_555 ? ? ? ? ? ? ? 2.573 ? 
metalc17 metalc ? ? J NA  .   NA  ? ? ? 1_555 N HOH . O  ? ? A NA  208 A HOH 429 1_555 ? ? ? ? ? ? ? 2.736 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
A 4 5 ? parallel 
A 5 6 ? parallel 
B 1 2 ? parallel 
B 2 3 ? parallel 
B 3 4 ? parallel 
B 4 5 ? parallel 
B 5 6 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 128 ? LEU A 130 ? ILE A 128 LEU A 130 
A 2 THR A 93  ? THR A 99  ? THR A 93  THR A 99  
A 3 VAL A 5   ? VAL A 9   ? VAL A 5   VAL A 9   
A 4 LEU A 141 ? ASP A 144 ? LEU A 141 ASP A 144 
A 5 GLU A 159 ? PHE A 163 ? GLU A 159 PHE A 163 
A 6 ARG A 179 ? LEU A 180 ? ARG A 179 LEU A 180 
B 1 ILE B 128 ? LEU B 130 ? ILE B 128 LEU B 130 
B 2 THR B 93  ? THR B 99  ? THR B 93  THR B 99  
B 3 VAL B 5   ? VAL B 9   ? VAL B 5   VAL B 9   
B 4 LEU B 141 ? ASP B 144 ? LEU B 141 ASP B 144 
B 5 GLU B 159 ? PHE B 163 ? GLU B 159 PHE B 163 
B 6 ARG B 179 ? LEU B 180 ? ARG B 179 LEU B 180 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 129 ? O ILE A 129 N ILE A 97  ? N ILE A 97  
A 2 3 O PHE A 96  ? O PHE A 96  N VAL A 9   ? N VAL A 9   
A 3 4 N LEU A 8   ? N LEU A 8   O LEU A 141 ? O LEU A 141 
A 4 5 N LEU A 142 ? N LEU A 142 O ILE A 161 ? O ILE A 161 
A 5 6 N LEU A 162 ? N LEU A 162 O LEU A 180 ? O LEU A 180 
B 1 2 O ILE B 129 ? O ILE B 129 N ILE B 97  ? N ILE B 97  
B 2 3 O PHE B 96  ? O PHE B 96  N VAL B 9   ? N VAL B 9   
B 3 4 N LEU B 8   ? N LEU B 8   O LEU B 141 ? O LEU B 141 
B 4 5 N LEU B 142 ? N LEU B 142 O ILE B 161 ? O ILE B 161 
B 5 6 N LEU B 162 ? N LEU B 162 O LEU B 180 ? O LEU B 180 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 201'  
AC2 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE PO4 A 202' 
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 203' 
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 204' 
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL A 205' 
AC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL A 206' 
AC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 207' 
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 208'  
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG B 201'  
BC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE PO4 B 202' 
BC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL B 203' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  ASP A 10  ? ASP A 10  . ? 1_555 ? 
2  AC1 6  ASP A 12  ? ASP A 12  . ? 1_555 ? 
3  AC1 6  ASP A 145 ? ASP A 145 . ? 1_555 ? 
4  AC1 6  PO4 D .   ? PO4 A 202 . ? 1_555 ? 
5  AC1 6  HOH N .   ? HOH A 311 . ? 1_555 ? 
6  AC1 6  HOH N .   ? HOH A 320 . ? 1_555 ? 
7  AC2 13 ASP A 10  ? ASP A 10  . ? 1_555 ? 
8  AC2 13 MET A 11  ? MET A 11  . ? 1_555 ? 
9  AC2 13 ASP A 12  ? ASP A 12  . ? 1_555 ? 
10 AC2 13 THR A 99  ? THR A 99  . ? 1_555 ? 
11 AC2 13 SER A 100 ? SER A 100 . ? 1_555 ? 
12 AC2 13 LYS A 112 ? LYS A 112 . ? 1_555 ? 
13 AC2 13 LYS A 134 ? LYS A 134 . ? 1_555 ? 
14 AC2 13 MG  C .   ? MG  A 201 . ? 1_555 ? 
15 AC2 13 GOL F .   ? GOL A 204 . ? 1_555 ? 
16 AC2 13 HOH N .   ? HOH A 301 . ? 1_555 ? 
17 AC2 13 HOH N .   ? HOH A 311 . ? 1_555 ? 
18 AC2 13 HOH N .   ? HOH A 320 . ? 1_555 ? 
19 AC2 13 HOH N .   ? HOH A 535 . ? 1_555 ? 
20 AC3 8  ASN A 186 ? ASN A 186 . ? 1_555 ? 
21 AC3 8  ARG A 188 ? ARG A 188 . ? 1_555 ? 
22 AC3 8  GLU A 189 ? GLU A 189 . ? 1_555 ? 
23 AC3 8  HOH N .   ? HOH A 335 . ? 1_555 ? 
24 AC3 8  HOH N .   ? HOH A 391 . ? 1_555 ? 
25 AC3 8  HOH N .   ? HOH A 524 . ? 1_555 ? 
26 AC3 8  HOH O .   ? HOH B 336 . ? 1_565 ? 
27 AC3 8  HOH O .   ? HOH B 353 . ? 1_565 ? 
28 AC4 9  PHE A 18  ? PHE A 18  . ? 1_555 ? 
29 AC4 9  GLU A 19  ? GLU A 19  . ? 1_555 ? 
30 AC4 9  PHE A 44  ? PHE A 44  . ? 1_555 ? 
31 AC4 9  PO4 D .   ? PO4 A 202 . ? 1_555 ? 
32 AC4 9  GOL I .   ? GOL A 207 . ? 1_555 ? 
33 AC4 9  HOH N .   ? HOH A 320 . ? 1_555 ? 
34 AC4 9  HOH N .   ? HOH A 326 . ? 1_555 ? 
35 AC4 9  HOH N .   ? HOH A 500 . ? 1_555 ? 
36 AC4 9  HOH N .   ? HOH A 510 . ? 1_555 ? 
37 AC5 6  PHE A 44  ? PHE A 44  . ? 1_555 ? 
38 AC5 6  SER A 100 ? SER A 100 . ? 1_555 ? 
39 AC5 6  ARG A 132 ? ARG A 132 . ? 1_555 ? 
40 AC5 6  HOH N .   ? HOH A 301 . ? 1_555 ? 
41 AC5 6  HOH N .   ? HOH A 389 . ? 1_555 ? 
42 AC5 6  HOH N .   ? HOH A 546 . ? 1_555 ? 
43 AC6 7  ARG A 51  ? ARG A 51  . ? 1_555 ? 
44 AC6 7  ASP A 59  ? ASP A 59  . ? 1_555 ? 
45 AC6 7  GLU A 117 ? GLU A 117 . ? 1_455 ? 
46 AC6 7  GLN A 118 ? GLN A 118 . ? 1_455 ? 
47 AC6 7  HOH N .   ? HOH A 318 . ? 1_555 ? 
48 AC6 7  HOH N .   ? HOH A 332 . ? 1_555 ? 
49 AC6 7  HOH N .   ? HOH A 520 . ? 1_555 ? 
50 AC7 9  PHE A 18  ? PHE A 18  . ? 1_555 ? 
51 AC7 9  PHE A 44  ? PHE A 44  . ? 1_555 ? 
52 AC7 9  LEU A 45  ? LEU A 45  . ? 1_555 ? 
53 AC7 9  ALA A 46  ? ALA A 46  . ? 1_555 ? 
54 AC7 9  ARG A 47  ? ARG A 47  . ? 1_555 ? 
55 AC7 9  TYR A 65  ? TYR A 65  . ? 1_555 ? 
56 AC7 9  GOL F .   ? GOL A 204 . ? 1_555 ? 
57 AC7 9  HOH N .   ? HOH A 410 . ? 1_555 ? 
58 AC7 9  HOH N .   ? HOH A 511 . ? 1_555 ? 
59 AC8 5  ASN A 88  ? ASN A 88  . ? 1_555 ? 
60 AC8 5  LEU A 90  ? LEU A 90  . ? 1_555 ? 
61 AC8 5  THR A 93  ? THR A 93  . ? 1_555 ? 
62 AC8 5  HOH N .   ? HOH A 423 . ? 1_555 ? 
63 AC8 5  HOH N .   ? HOH A 429 . ? 1_555 ? 
64 AC9 6  ASP B 10  ? ASP B 10  . ? 1_555 ? 
65 AC9 6  ASP B 12  ? ASP B 12  . ? 1_555 ? 
66 AC9 6  ASP B 145 ? ASP B 145 . ? 1_555 ? 
67 AC9 6  PO4 L .   ? PO4 B 202 . ? 1_555 ? 
68 AC9 6  HOH O .   ? HOH B 314 . ? 1_555 ? 
69 AC9 6  HOH O .   ? HOH B 315 . ? 1_555 ? 
70 BC1 13 ASP B 10  ? ASP B 10  . ? 1_555 ? 
71 BC1 13 MET B 11  ? MET B 11  . ? 1_555 ? 
72 BC1 13 ASP B 12  ? ASP B 12  . ? 1_555 ? 
73 BC1 13 THR B 99  ? THR B 99  . ? 1_555 ? 
74 BC1 13 SER B 100 ? SER B 100 . ? 1_555 ? 
75 BC1 13 LYS B 112 ? LYS B 112 . ? 1_555 ? 
76 BC1 13 LYS B 134 ? LYS B 134 . ? 1_555 ? 
77 BC1 13 MG  K .   ? MG  B 201 . ? 1_555 ? 
78 BC1 13 GOL M .   ? GOL B 203 . ? 1_555 ? 
79 BC1 13 HOH O .   ? HOH B 301 . ? 1_555 ? 
80 BC1 13 HOH O .   ? HOH B 314 . ? 1_555 ? 
81 BC1 13 HOH O .   ? HOH B 315 . ? 1_555 ? 
82 BC1 13 HOH O .   ? HOH B 371 . ? 1_555 ? 
83 BC2 10 ASP B 12  ? ASP B 12  . ? 1_555 ? 
84 BC2 10 PHE B 18  ? PHE B 18  . ? 1_555 ? 
85 BC2 10 PHE B 44  ? PHE B 44  . ? 1_555 ? 
86 BC2 10 LEU B 45  ? LEU B 45  . ? 1_555 ? 
87 BC2 10 PHE B 71  ? PHE B 71  . ? 1_555 ? 
88 BC2 10 LEU B 102 ? LEU B 102 . ? 1_555 ? 
89 BC2 10 PO4 L .   ? PO4 B 202 . ? 1_555 ? 
90 BC2 10 HOH O .   ? HOH B 371 . ? 1_555 ? 
91 BC2 10 HOH O .   ? HOH B 384 . ? 1_555 ? 
92 BC2 10 HOH O .   ? HOH B 479 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4L57 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4L57 
_atom_sites.fract_transf_matrix[1][1]   0.025557 
_atom_sites.fract_transf_matrix[1][2]   -0.006714 
_atom_sites.fract_transf_matrix[1][3]   -0.001586 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022239 
_atom_sites.fract_transf_matrix[2][3]   -0.008297 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017575 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 4   ? 15.402  19.177  2.664   1.00 27.99  ? 4   SER A N   1 
ATOM   2    C  CA  . SER A 1 4   ? 15.025  17.753  2.789   1.00 21.34  ? 4   SER A CA  1 
ATOM   3    C  C   . SER A 1 4   ? 13.586  17.383  2.458   1.00 17.25  ? 4   SER A C   1 
ATOM   4    O  O   . SER A 1 4   ? 12.685  18.073  2.956   1.00 22.18  ? 4   SER A O   1 
ATOM   5    C  CB  . SER A 1 4   ? 15.257  17.266  4.223   1.00 32.72  ? 4   SER A CB  1 
ATOM   6    O  OG  . SER A 1 4   ? 15.517  15.865  4.156   1.00 42.23  ? 4   SER A OG  1 
ATOM   7    N  N   . VAL A 1 5   ? 13.421  16.339  1.667   1.00 11.31  ? 5   VAL A N   1 
ATOM   8    C  CA  . VAL A 1 5   ? 12.089  15.897  1.278   1.00 10.60  ? 5   VAL A CA  1 
ATOM   9    C  C   . VAL A 1 5   ? 11.761  14.601  2.013   1.00 9.52   ? 5   VAL A C   1 
ATOM   10   O  O   . VAL A 1 5   ? 12.532  13.662  1.909   1.00 10.57  ? 5   VAL A O   1 
ATOM   11   C  CB  . VAL A 1 5   ? 11.963  15.692  -0.225  1.00 12.09  ? 5   VAL A CB  1 
ATOM   12   C  CG1 . VAL A 1 5   ? 10.602  15.189  -0.611  1.00 12.64  ? 5   VAL A CG1 1 
ATOM   13   C  CG2 . VAL A 1 5   ? 12.244  17.077  -0.869  1.00 15.23  ? 5   VAL A CG2 1 
ATOM   14   N  N   . ARG A 1 6   ? 10.654  14.594  2.727   1.00 9.01   ? 6   ARG A N   1 
ATOM   15   C  CA  . ARG A 1 6   ? 10.223  13.410  3.489   1.00 8.43   ? 6   ARG A CA  1 
ATOM   16   C  C   . ARG A 1 6   ? 9.070   12.757  2.727   1.00 7.20   ? 6   ARG A C   1 
ATOM   17   O  O   . ARG A 1 6   ? 8.037   13.362  2.474   1.00 8.28   ? 6   ARG A O   1 
ATOM   18   C  CB  . ARG A 1 6   ? 9.842   13.748  4.905   1.00 9.70   ? 6   ARG A CB  1 
ATOM   19   C  CG  . ARG A 1 6   ? 9.496   12.490  5.727   1.00 10.99  ? 6   ARG A CG  1 
ATOM   20   C  CD  . ARG A 1 6   ? 9.133   12.736  7.173   1.00 13.09  ? 6   ARG A CD  1 
ATOM   21   N  NE  . ARG A 1 6   ? 10.140  13.590  7.779   1.00 13.29  ? 6   ARG A NE  1 
ATOM   22   C  CZ  . ARG A 1 6   ? 10.024  14.695  8.435   1.00 12.16  ? 6   ARG A CZ  1 
ATOM   23   N  NH1 . ARG A 1 6   ? 8.834   15.235  8.690   1.00 15.54  ? 6   ARG A NH1 1 
ATOM   24   N  NH2 . ARG A 1 6   ? 11.139  15.312  8.873   1.00 14.63  ? 6   ARG A NH2 1 
ATOM   25   N  N   . VAL A 1 7   ? 9.289   11.507  2.385   1.00 7.77   ? 7   VAL A N   1 
ATOM   26   C  CA  . VAL A 1 7   ? 8.340   10.693  1.622   1.00 7.18   ? 7   VAL A CA  1 
ATOM   27   C  C   . VAL A 1 7   ? 7.797   9.588   2.537   1.00 6.87   ? 7   VAL A C   1 
ATOM   28   O  O   . VAL A 1 7   ? 8.560   8.778   3.049   1.00 7.94   ? 7   VAL A O   1 
ATOM   29   C  CB  . VAL A 1 7   ? 8.965   10.060  0.374   1.00 7.14   ? 7   VAL A CB  1 
ATOM   30   C  CG1 . VAL A 1 7   ? 7.890   9.375   -0.476  1.00 8.60   ? 7   VAL A CG1 1 
ATOM   31   C  CG2 . VAL A 1 7   ? 9.702   11.120  -0.449  1.00 8.58   ? 7   VAL A CG2 1 
ATOM   32   N  N   . LEU A 1 8   ? 6.506   9.571   2.674   1.00 6.86   ? 8   LEU A N   1 
ATOM   33   C  CA  . LEU A 1 8   ? 5.771   8.511   3.371   1.00 6.51   ? 8   LEU A CA  1 
ATOM   34   C  C   . LEU A 1 8   ? 5.316   7.523   2.303   1.00 6.61   ? 8   LEU A C   1 
ATOM   35   O  O   . LEU A 1 8   ? 4.600   7.923   1.361   1.00 7.59   ? 8   LEU A O   1 
ATOM   36   C  CB  . LEU A 1 8   ? 4.554   9.102   4.123   1.00 6.84   ? 8   LEU A CB  1 
ATOM   37   C  CG  . LEU A 1 8   ? 4.865   10.269  5.096   1.00 7.85   ? 8   LEU A CG  1 
ATOM   38   C  CD1 . LEU A 1 8   ? 3.568   10.717  5.774   1.00 9.86   ? 8   LEU A CD1 1 
ATOM   39   C  CD2 . LEU A 1 8   ? 5.966   9.947   6.085   1.00 8.69   ? 8   LEU A CD2 1 
ATOM   40   N  N   . VAL A 1 9   ? 5.740   6.300   2.408   1.00 6.34   ? 9   VAL A N   1 
ATOM   41   C  CA  . VAL A 1 9   ? 5.493   5.254   1.441   1.00 6.81   ? 9   VAL A CA  1 
ATOM   42   C  C   . VAL A 1 9   ? 4.555   4.244   2.093   1.00 6.96   ? 9   VAL A C   1 
ATOM   43   O  O   . VAL A 1 9   ? 4.873   3.644   3.110   1.00 7.23   ? 9   VAL A O   1 
ATOM   44   C  CB  . VAL A 1 9   ? 6.799   4.614   0.975   1.00 8.02   ? 9   VAL A CB  1 
ATOM   45   C  CG1 . VAL A 1 9   ? 6.502   3.563   -0.100  1.00 9.19   ? 9   VAL A CG1 1 
ATOM   46   C  CG2 . VAL A 1 9   ? 7.746   5.666   0.384   1.00 8.73   ? 9   VAL A CG2 1 
ATOM   47   N  N   . ASP A 1 10  ? 3.381   4.081   1.501   1.00 7.40   ? 10  ASP A N   1 
ATOM   48   C  CA  . ASP A 1 10  ? 2.422   3.104   1.963   1.00 7.19   ? 10  ASP A CA  1 
ATOM   49   C  C   . ASP A 1 10  ? 2.954   1.680   1.766   1.00 6.67   ? 10  ASP A C   1 
ATOM   50   O  O   . ASP A 1 10  ? 3.871   1.426   0.955   1.00 7.85   ? 10  ASP A O   1 
ATOM   51   C  CB  . ASP A 1 10  ? 1.155   3.351   1.149   1.00 7.69   ? 10  ASP A CB  1 
ATOM   52   C  CG  . ASP A 1 10  ? 0.003   2.487   1.464   1.00 7.81   ? 10  ASP A CG  1 
ATOM   53   O  OD1 . ASP A 1 10  ? -0.162  2.210   2.713   1.00 8.40   ? 10  ASP A OD1 1 
ATOM   54   O  OD2 . ASP A 1 10  ? -0.774  2.081   0.563   1.00 7.90   ? 10  ASP A OD2 1 
ATOM   55   N  N   . MET A 1 11  ? 2.382   0.727   2.485   1.00 7.47   ? 11  MET A N   1 
ATOM   56   C  CA  . MET A 1 11  ? 2.792   -0.674  2.422   1.00 7.04   ? 11  MET A CA  1 
ATOM   57   C  C   . MET A 1 11  ? 1.862   -1.478  1.546   1.00 6.83   ? 11  MET A C   1 
ATOM   58   O  O   . MET A 1 11  ? 2.246   -1.854  0.402   1.00 7.49   ? 11  MET A O   1 
ATOM   59   C  CB  . MET A 1 11  ? 2.954   -1.236  3.814   1.00 8.11   ? 11  MET A CB  1 
ATOM   60   C  CG  . MET A 1 11  ? 3.665   -2.544  3.890   1.00 8.94   ? 11  MET A CG  1 
ATOM   61   S  SD  . MET A 1 11  ? 4.161   -2.919  5.593   1.00 9.45   ? 11  MET A SD  1 
ATOM   62   C  CE  . MET A 1 11  ? 4.884   -4.530  5.260   1.00 9.18   ? 11  MET A CE  1 
ATOM   63   N  N   . ASP A 1 12  ? 0.644   -1.805  1.972   1.00 6.91   ? 12  ASP A N   1 
ATOM   64   C  CA  . ASP A 1 12  ? -0.239  -2.587  1.121   1.00 7.04   ? 12  ASP A CA  1 
ATOM   65   C  C   . ASP A 1 12  ? -0.603  -1.816  -0.121  1.00 6.70   ? 12  ASP A C   1 
ATOM   66   O  O   . ASP A 1 12  ? -1.097  -0.684  -0.060  1.00 7.70   ? 12  ASP A O   1 
ATOM   67   C  CB  . ASP A 1 12  ? -1.509  -2.970  1.883   1.00 7.53   ? 12  ASP A CB  1 
ATOM   68   C  CG  . ASP A 1 12  ? -1.174  -3.865  3.055   1.00 8.45   ? 12  ASP A CG  1 
ATOM   69   O  OD1 . ASP A 1 12  ? -0.540  -4.906  2.840   1.00 9.17   ? 12  ASP A OD1 1 
ATOM   70   O  OD2 . ASP A 1 12  ? -1.653  -3.509  4.189   1.00 10.02  ? 12  ASP A OD2 1 
ATOM   71   N  N   . GLY A 1 13  ? -0.409  -2.443  -1.296  1.00 7.00   ? 13  GLY A N   1 
ATOM   72   C  CA  . GLY A 1 13  ? -0.699  -1.868  -2.582  1.00 7.65   ? 13  GLY A CA  1 
ATOM   73   C  C   . GLY A 1 13  ? 0.389   -1.027  -3.192  1.00 8.59   ? 13  GLY A C   1 
ATOM   74   O  O   . GLY A 1 13  ? 0.212   -0.581  -4.322  1.00 10.08  ? 13  GLY A O   1 
ATOM   75   N  N   . VAL A 1 14  ? 1.451   -0.784  -2.408  1.00 6.96   ? 14  VAL A N   1 
ATOM   76   C  CA  . VAL A 1 14  ? 2.563   0.063   -2.899  1.00 6.97   ? 14  VAL A CA  1 
ATOM   77   C  C   . VAL A 1 14  ? 3.861   -0.690  -2.771  1.00 6.80   ? 14  VAL A C   1 
ATOM   78   O  O   . VAL A 1 14  ? 4.682   -0.701  -3.736  1.00 7.67   ? 14  VAL A O   1 
ATOM   79   C  CB  . VAL A 1 14  ? 2.548   1.409   -2.157  1.00 7.10   ? 14  VAL A CB  1 
ATOM   80   C  CG1 . VAL A 1 14  ? 3.749   2.253   -2.550  1.00 8.35   ? 14  VAL A CG1 1 
ATOM   81   C  CG2 . VAL A 1 14  ? 1.260   2.141   -2.438  1.00 7.64   ? 14  VAL A CG2 1 
ATOM   82   N  N   . LEU A 1 15  ? 4.123   -1.320  -1.617  1.00 6.57   ? 15  LEU A N   1 
ATOM   83   C  CA  . LEU A 1 15  ? 5.277   -2.192  -1.434  1.00 6.66   ? 15  LEU A CA  1 
ATOM   84   C  C   . LEU A 1 15  ? 4.905   -3.677  -1.485  1.00 7.02   ? 15  LEU A C   1 
ATOM   85   O  O   . LEU A 1 15  ? 5.693   -4.458  -2.010  1.00 7.56   ? 15  LEU A O   1 
ATOM   86   C  CB  . LEU A 1 15  ? 5.980   -1.923  -0.088  1.00 7.50   ? 15  LEU A CB  1 
ATOM   87   C  CG  . LEU A 1 15  ? 6.545   -0.519  0.047   1.00 8.89   ? 15  LEU A CG  1 
ATOM   88   C  CD1 . LEU A 1 15  ? 7.243   -0.364  1.400   1.00 10.89  ? 15  LEU A CD1 1 
ATOM   89   C  CD2 . LEU A 1 15  ? 7.439   -0.076  -1.108  1.00 11.14  ? 15  LEU A CD2 1 
ATOM   90   N  N   . ALA A 1 16  ? 3.783   -4.053  -0.869  1.00 7.13   ? 16  ALA A N   1 
ATOM   91   C  CA  . ALA A 1 16  ? 3.326   -5.425  -0.677  1.00 8.04   ? 16  ALA A CA  1 
ATOM   92   C  C   . ALA A 1 16  ? 2.032   -5.629  -1.426  1.00 7.62   ? 16  ALA A C   1 
ATOM   93   O  O   . ALA A 1 16  ? 1.111   -4.802  -1.328  1.00 8.24   ? 16  ALA A O   1 
ATOM   94   C  CB  . ALA A 1 16  ? 3.180   -5.768  0.800   1.00 8.58   ? 16  ALA A CB  1 
ATOM   95   N  N   . ASP A 1 17  ? 1.939   -6.726  -2.188  1.00 8.39   ? 17  ASP A N   1 
ATOM   96   C  CA  . ASP A 1 17  ? 0.776   -6.954  -3.063  1.00 8.03   ? 17  ASP A CA  1 
ATOM   97   C  C   . ASP A 1 17  ? -0.330  -7.684  -2.312  1.00 7.19   ? 17  ASP A C   1 
ATOM   98   O  O   . ASP A 1 17  ? -0.525  -8.897  -2.402  1.00 8.23   ? 17  ASP A O   1 
ATOM   99   C  CB  . ASP A 1 17  ? 1.166   -7.700  -4.331  1.00 8.80   ? 17  ASP A CB  1 
ATOM   100  C  CG  . ASP A 1 17  ? 0.109   -7.572  -5.399  1.00 9.95   ? 17  ASP A CG  1 
ATOM   101  O  OD1 . ASP A 1 17  ? -1.059  -7.288  -5.071  1.00 9.61   ? 17  ASP A OD1 1 
ATOM   102  O  OD2 . ASP A 1 17  ? 0.454   -7.814  -6.590  1.00 14.22  ? 17  ASP A OD2 1 
ATOM   103  N  N   . PHE A 1 18  ? -1.067  -6.901  -1.542  1.00 7.30   ? 18  PHE A N   1 
ATOM   104  C  CA  . PHE A 1 18  ? -2.209  -7.378  -0.779  1.00 7.53   ? 18  PHE A CA  1 
ATOM   105  C  C   . PHE A 1 18  ? -3.260  -7.978  -1.663  1.00 7.59   ? 18  PHE A C   1 
ATOM   106  O  O   . PHE A 1 18  ? -3.798  -9.053  -1.357  1.00 7.85   ? 18  PHE A O   1 
ATOM   107  C  CB  . PHE A 1 18  ? -2.734  -6.184  0.057   1.00 8.26   ? 18  PHE A CB  1 
ATOM   108  C  CG  . PHE A 1 18  ? -3.949  -6.486  0.918   1.00 8.38   ? 18  PHE A CG  1 
ATOM   109  C  CD1 . PHE A 1 18  ? -5.203  -6.458  0.381   1.00 9.95   ? 18  PHE A CD1 1 
ATOM   110  C  CD2 . PHE A 1 18  ? -3.845  -6.775  2.265   1.00 9.61   ? 18  PHE A CD2 1 
ATOM   111  C  CE1 . PHE A 1 18  ? -6.326  -6.756  1.112   1.00 11.51  ? 18  PHE A CE1 1 
ATOM   112  C  CE2 . PHE A 1 18  ? -4.983  -7.056  3.048   1.00 11.46  ? 18  PHE A CE2 1 
ATOM   113  C  CZ  . PHE A 1 18  ? -6.195  -7.047  2.438   1.00 11.75  ? 18  PHE A CZ  1 
ATOM   114  N  N   . GLU A 1 19  ? -3.664  -7.283  -2.701  1.00 7.32   ? 19  GLU A N   1 
ATOM   115  C  CA  . GLU A 1 19  ? -4.771  -7.737  -3.518  1.00 8.25   ? 19  GLU A CA  1 
ATOM   116  C  C   . GLU A 1 19  ? -4.449  -9.073  -4.169  1.00 7.73   ? 19  GLU A C   1 
ATOM   117  O  O   . GLU A 1 19  ? -5.328  -9.957  -4.232  1.00 8.14   ? 19  GLU A O   1 
ATOM   118  C  CB  . GLU A 1 19  ? -5.116  -6.692  -4.584  1.00 10.02  ? 19  GLU A CB  1 
ATOM   119  C  CG  . GLU A 1 19  ? -5.720  -5.420  -4.011  1.00 11.14  ? 19  GLU A CG  1 
ATOM   120  C  CD  . GLU A 1 19  ? -7.186  -5.541  -3.661  1.00 13.03  ? 19  GLU A CD  1 
ATOM   121  O  OE1 . GLU A 1 19  ? -7.901  -6.458  -4.085  1.00 11.98  ? 19  GLU A OE1 1 
ATOM   122  O  OE2 . GLU A 1 19  ? -7.646  -4.620  -2.924  1.00 21.07  ? 19  GLU A OE2 1 
ATOM   123  N  N   . ALA A 1 20  ? -3.239  -9.250  -4.705  1.00 8.36   ? 20  ALA A N   1 
ATOM   124  C  CA  . ALA A 1 20  ? -2.898  -10.513 -5.326  1.00 8.81   ? 20  ALA A CA  1 
ATOM   125  C  C   . ALA A 1 20  ? -2.856  -11.613 -4.272  1.00 7.86   ? 20  ALA A C   1 
ATOM   126  O  O   . ALA A 1 20  ? -3.280  -12.746 -4.509  1.00 8.61   ? 20  ALA A O   1 
ATOM   127  C  CB  . ALA A 1 20  ? -1.569  -10.461 -6.062  1.00 10.56  ? 20  ALA A CB  1 
ATOM   128  N  N   . GLY A 1 21  ? -2.383  -11.296 -3.094  1.00 8.39   ? 21  GLY A N   1 
ATOM   129  C  CA  . GLY A 1 21  ? -2.322  -12.272 -2.022  1.00 8.89   ? 21  GLY A CA  1 
ATOM   130  C  C   . GLY A 1 21  ? -3.718  -12.669 -1.585  1.00 7.59   ? 21  GLY A C   1 
ATOM   131  O  O   . GLY A 1 21  ? -3.983  -13.868 -1.319  1.00 8.58   ? 21  GLY A O   1 
ATOM   132  N  N   . LEU A 1 22  ? -4.607  -11.734 -1.482  1.00 7.79   ? 22  LEU A N   1 
ATOM   133  C  CA  A LEU A 1 22  ? -5.970  -12.028 -1.084  0.54 6.97   ? 22  LEU A CA  1 
ATOM   134  C  CA  B LEU A 1 22  ? -6.007  -11.974 -1.126  0.46 7.14   ? 22  LEU A CA  1 
ATOM   135  C  C   . LEU A 1 22  ? -6.623  -12.965 -2.089  1.00 6.93   ? 22  LEU A C   1 
ATOM   136  O  O   . LEU A 1 22  ? -7.272  -13.948 -1.722  1.00 8.31   ? 22  LEU A O   1 
ATOM   137  C  CB  A LEU A 1 22  ? -6.705  -10.678 -0.913  0.54 5.58   ? 22  LEU A CB  1 
ATOM   138  C  CB  B LEU A 1 22  ? -6.853  -10.701 -1.228  0.46 13.36  ? 22  LEU A CB  1 
ATOM   139  C  CG  A LEU A 1 22  ? -8.159  -10.824 -0.423  0.54 7.05   ? 22  LEU A CG  1 
ATOM   140  C  CG  B LEU A 1 22  ? -8.340  -10.798 -0.875  0.46 9.14   ? 22  LEU A CG  1 
ATOM   141  C  CD1 A LEU A 1 22  ? -8.184  -11.583 0.912   0.54 10.91  ? 22  LEU A CD1 1 
ATOM   142  C  CD1 B LEU A 1 22  ? -8.752  -9.524  -0.147  0.46 17.06  ? 22  LEU A CD1 1 
ATOM   143  C  CD2 A LEU A 1 22  ? -8.850  -9.474  -0.394  0.54 6.19   ? 22  LEU A CD2 1 
ATOM   144  C  CD2 B LEU A 1 22  ? -9.226  -11.012 -2.099  0.46 10.37  ? 22  LEU A CD2 1 
ATOM   145  N  N   . LEU A 1 23  ? -6.524  -12.658 -3.393  1.00 7.58   ? 23  LEU A N   1 
ATOM   146  C  CA  . LEU A 1 23  ? -7.169  -13.468 -4.395  1.00 8.19   ? 23  LEU A CA  1 
ATOM   147  C  C   . LEU A 1 23  ? -6.548  -14.832 -4.408  1.00 7.98   ? 23  LEU A C   1 
ATOM   148  O  O   . LEU A 1 23  ? -7.251  -15.842 -4.494  1.00 9.05   ? 23  LEU A O   1 
ATOM   149  C  CB  . LEU A 1 23  ? -7.111  -12.773 -5.760  1.00 9.23   ? 23  LEU A CB  1 
ATOM   150  C  CG  . LEU A 1 23  ? -7.806  -13.596 -6.889  1.00 10.18  ? 23  LEU A CG  1 
ATOM   151  C  CD1 . LEU A 1 23  ? -9.262  -13.877 -6.537  1.00 11.59  ? 23  LEU A CD1 1 
ATOM   152  C  CD2 . LEU A 1 23  ? -7.669  -12.865 -8.209  1.00 13.15  ? 23  LEU A CD2 1 
ATOM   153  N  N   . ARG A 1 24  ? -5.235  -14.957 -4.365  1.00 8.43   ? 24  ARG A N   1 
ATOM   154  C  CA  A ARG A 1 24  ? -4.663  -16.311 -4.401  0.50 8.70   ? 24  ARG A CA  1 
ATOM   155  C  CA  B ARG A 1 24  ? -4.582  -16.257 -4.314  0.50 9.31   ? 24  ARG A CA  1 
ATOM   156  C  C   . ARG A 1 24  ? -5.084  -17.100 -3.175  1.00 8.69   ? 24  ARG A C   1 
ATOM   157  O  O   . ARG A 1 24  ? -5.390  -18.285 -3.315  1.00 9.35   ? 24  ARG A O   1 
ATOM   158  C  CB  A ARG A 1 24  ? -3.145  -16.173 -4.579  0.50 14.36  ? 24  ARG A CB  1 
ATOM   159  C  CB  B ARG A 1 24  ? -3.040  -16.050 -4.200  0.50 9.68   ? 24  ARG A CB  1 
ATOM   160  C  CG  A ARG A 1 24  ? -2.292  -17.390 -4.264  0.50 12.15  ? 24  ARG A CG  1 
ATOM   161  C  CG  B ARG A 1 24  ? -2.532  -15.815 -5.632  0.50 14.83  ? 24  ARG A CG  1 
ATOM   162  C  CD  A ARG A 1 24  ? -0.809  -17.114 -4.491  0.50 15.80  ? 24  ARG A CD  1 
ATOM   163  C  CD  B ARG A 1 24  ? -1.022  -16.000 -5.709  0.50 23.71  ? 24  ARG A CD  1 
ATOM   164  N  NE  A ARG A 1 24  ? -0.247  -16.095 -3.635  0.50 30.46  ? 24  ARG A NE  1 
ATOM   165  N  NE  B ARG A 1 24  ? -0.402  -14.784 -5.209  0.50 39.92  ? 24  ARG A NE  1 
ATOM   166  C  CZ  A ARG A 1 24  ? 0.003   -14.819 -3.901  0.50 40.55  ? 24  ARG A CZ  1 
ATOM   167  C  CZ  B ARG A 1 24  ? 0.054   -14.581 -3.983  0.50 40.05  ? 24  ARG A CZ  1 
ATOM   168  N  NH1 A ARG A 1 24  ? -0.271  -14.286 -5.089  0.50 53.74  ? 24  ARG A NH1 1 
ATOM   169  N  NH1 B ARG A 1 24  ? 0.008   -15.495 -3.015  0.50 52.35  ? 24  ARG A NH1 1 
ATOM   170  N  NH2 A ARG A 1 24  ? 0.539   -14.038 -2.955  0.50 15.10  ? 24  ARG A NH2 1 
ATOM   171  N  NH2 B ARG A 1 24  ? 0.576   -13.391 -3.731  0.50 37.24  ? 24  ARG A NH2 1 
ATOM   172  N  N   . GLY A 1 25  ? -5.142  -16.493 -2.000  1.00 8.65   ? 25  GLY A N   1 
ATOM   173  C  CA  . GLY A 1 25  ? -5.561  -17.219 -0.811  1.00 7.97   ? 25  GLY A CA  1 
ATOM   174  C  C   . GLY A 1 25  ? -7.025  -17.599 -0.880  1.00 7.89   ? 25  GLY A C   1 
ATOM   175  O  O   . GLY A 1 25  ? -7.384  -18.717 -0.449  1.00 9.84   ? 25  GLY A O   1 
ATOM   176  N  N   . PHE A 1 26  ? -7.841  -16.745 -1.428  1.00 7.85   ? 26  PHE A N   1 
ATOM   177  C  CA  . PHE A 1 26  ? -9.270  -17.030 -1.583  1.00 7.92   ? 26  PHE A CA  1 
ATOM   178  C  C   . PHE A 1 26  ? -9.489  -18.163 -2.540  1.00 8.09   ? 26  PHE A C   1 
ATOM   179  O  O   . PHE A 1 26  ? -10.283 -19.086 -2.279  1.00 8.84   ? 26  PHE A O   1 
ATOM   180  C  CB  . PHE A 1 26  ? -10.013 -15.751 -2.009  1.00 7.95   ? 26  PHE A CB  1 
ATOM   181  C  CG  . PHE A 1 26  ? -11.510 -15.952 -2.092  1.00 8.53   ? 26  PHE A CG  1 
ATOM   182  C  CD1 . PHE A 1 26  ? -12.134 -16.389 -3.252  1.00 9.23   ? 26  PHE A CD1 1 
ATOM   183  C  CD2 . PHE A 1 26  ? -12.294 -15.700 -0.957  1.00 9.80   ? 26  PHE A CD2 1 
ATOM   184  C  CE1 . PHE A 1 26  ? -13.506 -16.591 -3.275  1.00 10.60  ? 26  PHE A CE1 1 
ATOM   185  C  CE2 . PHE A 1 26  ? -13.653 -15.869 -0.999  1.00 11.37  ? 26  PHE A CE2 1 
ATOM   186  C  CZ  . PHE A 1 26  ? -14.246 -16.309 -2.156  1.00 11.48  ? 26  PHE A CZ  1 
ATOM   187  N  N   . ARG A 1 27  ? -8.804  -18.168 -3.691  1.00 7.96   ? 27  ARG A N   1 
ATOM   188  C  CA  A ARG A 1 27  ? -9.083  -19.272 -4.604  0.41 9.63   ? 27  ARG A CA  1 
ATOM   189  C  CA  B ARG A 1 27  ? -8.913  -19.227 -4.684  0.59 9.04   ? 27  ARG A CA  1 
ATOM   190  C  C   . ARG A 1 27  ? -8.427  -20.568 -4.103  1.00 10.10  ? 27  ARG A C   1 
ATOM   191  O  O   . ARG A 1 27  ? -8.960  -21.634 -4.470  1.00 11.31  ? 27  ARG A O   1 
ATOM   192  C  CB  A ARG A 1 27  ? -8.633  -18.864 -5.985  0.41 8.63   ? 27  ARG A CB  1 
ATOM   193  C  CB  B ARG A 1 27  ? -8.113  -18.910 -5.939  0.59 8.55   ? 27  ARG A CB  1 
ATOM   194  C  CG  A ARG A 1 27  ? -9.273  -17.643 -6.589  0.41 11.11  ? 27  ARG A CG  1 
ATOM   195  C  CG  B ARG A 1 27  ? -8.596  -17.753 -6.772  0.59 9.44   ? 27  ARG A CG  1 
ATOM   196  C  CD  A ARG A 1 27  ? -8.786  -17.473 -8.021  0.41 11.03  ? 27  ARG A CD  1 
ATOM   197  C  CD  B ARG A 1 27  ? -9.936  -17.902 -7.408  0.59 14.15  ? 27  ARG A CD  1 
ATOM   198  N  NE  A ARG A 1 27  ? -9.439  -18.431 -8.928  0.41 17.22  ? 27  ARG A NE  1 
ATOM   199  N  NE  B ARG A 1 27  ? -9.953  -18.974 -8.376  0.59 15.65  ? 27  ARG A NE  1 
ATOM   200  C  CZ  A ARG A 1 27  ? -9.276  -18.381 -10.251 0.41 23.39  ? 27  ARG A CZ  1 
ATOM   201  C  CZ  B ARG A 1 27  ? -10.650 -20.106 -8.370  0.59 14.61  ? 27  ARG A CZ  1 
ATOM   202  N  NH1 A ARG A 1 27  ? -8.501  -17.445 -10.779 0.41 31.86  ? 27  ARG A NH1 1 
ATOM   203  N  NH1 B ARG A 1 27  ? -10.467 -20.921 -9.397  0.59 26.72  ? 27  ARG A NH1 1 
ATOM   204  N  NH2 A ARG A 1 27  ? -9.865  -19.248 -11.069 0.41 33.83  ? 27  ARG A NH2 1 
ATOM   205  N  NH2 B ARG A 1 27  ? -11.474 -20.427 -7.430  0.59 13.08  ? 27  ARG A NH2 1 
ATOM   206  N  N   . ARG A 1 28  ? -7.395  -20.526 -3.265  1.00 8.79   ? 28  ARG A N   1 
ATOM   207  C  CA  . ARG A 1 28  ? -6.842  -21.744 -2.656  1.00 9.48   ? 28  ARG A CA  1 
ATOM   208  C  C   . ARG A 1 28  ? -7.846  -22.306 -1.664  1.00 9.61   ? 28  ARG A C   1 
ATOM   209  O  O   . ARG A 1 28  ? -8.165  -23.546 -1.684  1.00 9.87   ? 28  ARG A O   1 
ATOM   210  C  CB  . ARG A 1 28  ? -5.512  -21.425 -2.015  1.00 9.94   ? 28  ARG A CB  1 
ATOM   211  C  CG  . ARG A 1 28  ? -4.905  -22.641 -1.350  1.00 11.82  ? 28  ARG A CG  1 
ATOM   212  C  CD  . ARG A 1 28  ? -3.599  -22.419 -0.680  1.00 14.21  ? 28  ARG A CD  1 
ATOM   213  N  NE  . ARG A 1 28  ? -3.460  -21.498 0.395   1.00 27.91  ? 28  ARG A NE  1 
ATOM   214  C  CZ  . ARG A 1 28  ? -4.021  -21.488 1.589   1.00 49.44  ? 28  ARG A CZ  1 
ATOM   215  N  NH1 . ARG A 1 28  ? -4.906  -22.385 2.002   1.00 24.68  ? 28  ARG A NH1 1 
ATOM   216  N  NH2 . ARG A 1 28  ? -3.678  -20.479 2.409   1.00 60.57  ? 28  ARG A NH2 1 
ATOM   217  N  N   . ARG A 1 29  ? -8.354  -21.512 -0.750  1.00 9.70   ? 29  ARG A N   1 
ATOM   218  C  CA  A ARG A 1 29  ? -9.131  -21.958 0.395   0.41 9.03   ? 29  ARG A CA  1 
ATOM   219  C  CA  B ARG A 1 29  ? -9.125  -21.981 0.374   0.59 9.27   ? 29  ARG A CA  1 
ATOM   220  C  C   . ARG A 1 29  ? -10.605 -22.155 0.038   1.00 9.26   ? 29  ARG A C   1 
ATOM   221  O  O   . ARG A 1 29  ? -11.281 -23.014 0.618   1.00 10.45  ? 29  ARG A O   1 
ATOM   222  C  CB  A ARG A 1 29  ? -9.053  -20.977 1.556   0.41 10.01  ? 29  ARG A CB  1 
ATOM   223  C  CB  B ARG A 1 29  ? -8.964  -20.995 1.520   0.59 11.00  ? 29  ARG A CB  1 
ATOM   224  C  CG  A ARG A 1 29  ? -9.387  -21.462 2.952   0.41 20.47  ? 29  ARG A CG  1 
ATOM   225  C  CG  B ARG A 1 29  ? -9.839  -21.257 2.721   0.59 12.83  ? 29  ARG A CG  1 
ATOM   226  C  CD  A ARG A 1 29  ? -9.017  -20.405 3.999   0.41 13.75  ? 29  ARG A CD  1 
ATOM   227  C  CD  B ARG A 1 29  ? -9.475  -22.632 3.325   0.59 28.58  ? 29  ARG A CD  1 
ATOM   228  N  NE  A ARG A 1 29  ? -9.921  -20.512 5.151   0.41 18.51  ? 29  ARG A NE  1 
ATOM   229  N  NE  B ARG A 1 29  ? -10.349 -22.666 4.486   0.59 25.72  ? 29  ARG A NE  1 
ATOM   230  C  CZ  A ARG A 1 29  ? -9.728  -19.774 6.237   0.41 17.85  ? 29  ARG A CZ  1 
ATOM   231  C  CZ  B ARG A 1 29  ? -11.602 -23.147 4.499   0.59 22.25  ? 29  ARG A CZ  1 
ATOM   232  N  NH1 A ARG A 1 29  ? -8.691  -18.924 6.237   0.41 21.42  ? 29  ARG A NH1 1 
ATOM   233  N  NH1 B ARG A 1 29  ? -12.171 -23.686 3.404   0.59 12.69  ? 29  ARG A NH1 1 
ATOM   234  N  NH2 A ARG A 1 29  ? -10.569 -19.922 7.233   0.41 20.18  ? 29  ARG A NH2 1 
ATOM   235  N  NH2 B ARG A 1 29  ? -12.191 -23.038 5.690   0.59 25.72  ? 29  ARG A NH2 1 
ATOM   236  N  N   . PHE A 1 30  ? -11.123 -21.371 -0.913  1.00 9.45   ? 30  PHE A N   1 
ATOM   237  C  CA  . PHE A 1 30  ? -12.520 -21.366 -1.320  1.00 10.00  ? 30  PHE A CA  1 
ATOM   238  C  C   . PHE A 1 30  ? -12.616 -21.622 -2.811  1.00 10.29  ? 30  PHE A C   1 
ATOM   239  O  O   . PHE A 1 30  ? -13.141 -20.806 -3.538  1.00 10.65  ? 30  PHE A O   1 
ATOM   240  C  CB  . PHE A 1 30  ? -13.183 -20.034 -0.903  1.00 10.63  ? 30  PHE A CB  1 
ATOM   241  C  CG  . PHE A 1 30  ? -13.101 -19.823 0.572   1.00 9.91   ? 30  PHE A CG  1 
ATOM   242  C  CD1 . PHE A 1 30  ? -13.874 -20.533 1.479   1.00 10.80  ? 30  PHE A CD1 1 
ATOM   243  C  CD2 . PHE A 1 30  ? -12.220 -18.881 1.117   1.00 10.10  ? 30  PHE A CD2 1 
ATOM   244  C  CE1 . PHE A 1 30  ? -13.811 -20.340 2.828   1.00 11.84  ? 30  PHE A CE1 1 
ATOM   245  C  CE2 . PHE A 1 30  ? -12.148 -18.700 2.464   1.00 10.68  ? 30  PHE A CE2 1 
ATOM   246  C  CZ  . PHE A 1 30  ? -12.914 -19.416 3.344   1.00 10.80  ? 30  PHE A CZ  1 
ATOM   247  N  N   . PRO A 1 31  ? -12.094 -22.741 -3.328  1.00 10.99  ? 31  PRO A N   1 
ATOM   248  C  CA  . PRO A 1 31  ? -11.979 -22.927 -4.775  1.00 11.72  ? 31  PRO A CA  1 
ATOM   249  C  C   . PRO A 1 31  ? -13.313 -23.011 -5.504  1.00 12.28  ? 31  PRO A C   1 
ATOM   250  O  O   . PRO A 1 31  ? -13.357 -22.678 -6.692  1.00 13.75  ? 31  PRO A O   1 
ATOM   251  C  CB  . PRO A 1 31  ? -11.267 -24.263 -4.911  1.00 12.45  ? 31  PRO A CB  1 
ATOM   252  C  CG  . PRO A 1 31  ? -11.509 -24.958 -3.638  1.00 12.53  ? 31  PRO A CG  1 
ATOM   253  C  CD  . PRO A 1 31  ? -11.491 -23.857 -2.602  1.00 12.64  ? 31  PRO A CD  1 
ATOM   254  N  N   . GLU A 1 32  ? -14.375 -23.432 -4.819  1.00 12.78  ? 32  GLU A N   1 
ATOM   255  C  CA  . GLU A 1 32  ? -15.679 -23.581 -5.436  1.00 15.61  ? 32  GLU A CA  1 
ATOM   256  C  C   . GLU A 1 32  ? -16.444 -22.274 -5.556  1.00 15.28  ? 32  GLU A C   1 
ATOM   257  O  O   . GLU A 1 32  ? -17.385 -22.156 -6.313  1.00 19.74  ? 32  GLU A O   1 
ATOM   258  C  CB  . GLU A 1 32  ? -16.514 -24.592 -4.633  1.00 15.76  ? 32  GLU A CB  1 
ATOM   259  C  CG  . GLU A 1 32  ? -15.916 -25.985 -4.636  1.00 21.81  ? 32  GLU A CG  1 
ATOM   260  C  CD  . GLU A 1 32  ? -16.824 -27.052 -4.067  1.00 27.58  ? 32  GLU A CD  1 
ATOM   261  O  OE1 . GLU A 1 32  ? -18.058 -26.849 -4.181  1.00 25.15  ? 32  GLU A OE1 1 
ATOM   262  O  OE2 . GLU A 1 32  ? -16.192 -28.005 -3.592  1.00 41.83  ? 32  GLU A OE2 1 
ATOM   263  N  N   . GLU A 1 33  ? -16.050 -21.256 -4.782  1.00 12.40  ? 33  GLU A N   1 
ATOM   264  C  CA  A GLU A 1 33  ? -16.793 -20.021 -4.678  0.43 11.63  ? 33  GLU A CA  1 
ATOM   265  C  CA  B GLU A 1 33  ? -16.855 -20.056 -4.757  0.57 12.33  ? 33  GLU A CA  1 
ATOM   266  C  C   . GLU A 1 33  ? -16.513 -19.038 -5.818  1.00 13.03  ? 33  GLU A C   1 
ATOM   267  O  O   . GLU A 1 33  ? -15.393 -18.950 -6.335  1.00 12.73  ? 33  GLU A O   1 
ATOM   268  C  CB  A GLU A 1 33  ? -16.439 -19.340 -3.363  0.43 7.90   ? 33  GLU A CB  1 
ATOM   269  C  CB  B GLU A 1 33  ? -16.682 -19.379 -3.390  0.57 13.45  ? 33  GLU A CB  1 
ATOM   270  C  CG  A GLU A 1 33  ? -17.144 -19.729 -2.097  0.43 11.37  ? 33  GLU A CG  1 
ATOM   271  C  CG  B GLU A 1 33  ? -16.788 -20.472 -2.321  0.57 13.08  ? 33  GLU A CG  1 
ATOM   272  C  CD  A GLU A 1 33  ? -16.792 -21.016 -1.396  0.43 10.24  ? 33  GLU A CD  1 
ATOM   273  C  CD  B GLU A 1 33  ? -18.245 -20.832 -2.088  0.57 17.45  ? 33  GLU A CD  1 
ATOM   274  O  OE1 A GLU A 1 33  ? -15.790 -21.650 -1.752  0.43 11.89  ? 33  GLU A OE1 1 
ATOM   275  O  OE1 B GLU A 1 33  ? -19.056 -20.390 -2.919  0.57 18.00  ? 33  GLU A OE1 1 
ATOM   276  O  OE2 A GLU A 1 33  ? -17.539 -21.352 -0.445  0.43 14.16  ? 33  GLU A OE2 1 
ATOM   277  O  OE2 B GLU A 1 33  ? -18.568 -21.502 -1.114  0.57 22.75  ? 33  GLU A OE2 1 
ATOM   278  N  N   . PRO A 1 34  ? -17.528 -18.247 -6.143  1.00 12.91  ? 34  PRO A N   1 
ATOM   279  C  CA  . PRO A 1 34  ? -17.255 -17.102 -7.055  1.00 14.09  ? 34  PRO A CA  1 
ATOM   280  C  C   . PRO A 1 34  ? -16.175 -16.169 -6.472  1.00 11.43  ? 34  PRO A C   1 
ATOM   281  O  O   . PRO A 1 34  ? -16.062 -16.042 -5.274  1.00 11.12  ? 34  PRO A O   1 
ATOM   282  C  CB  . PRO A 1 34  ? -18.601 -16.358 -7.085  1.00 18.08  ? 34  PRO A CB  1 
ATOM   283  C  CG  . PRO A 1 34  ? -19.642 -17.232 -6.515  1.00 16.50  ? 34  PRO A CG  1 
ATOM   284  C  CD  . PRO A 1 34  ? -18.916 -18.214 -5.637  1.00 15.16  ? 34  PRO A CD  1 
ATOM   285  N  N   . HIS A 1 35  ? -15.416 -15.537 -7.338  1.00 11.98  ? 35  HIS A N   1 
ATOM   286  C  CA  . HIS A 1 35  ? -14.376 -14.586 -6.863  1.00 10.96  ? 35  HIS A CA  1 
ATOM   287  C  C   . HIS A 1 35  ? -14.429 -13.334 -7.689  1.00 10.57  ? 35  HIS A C   1 
ATOM   288  O  O   . HIS A 1 35  ? -15.122 -13.267 -8.688  1.00 11.78  ? 35  HIS A O   1 
ATOM   289  C  CB  . HIS A 1 35  ? -12.992 -15.224 -6.949  1.00 11.55  ? 35  HIS A CB  1 
ATOM   290  C  CG  . HIS A 1 35  ? -12.464 -15.407 -8.334  1.00 13.00  ? 35  HIS A CG  1 
ATOM   291  N  ND1 . HIS A 1 35  ? -12.756 -16.492 -9.130  1.00 14.68  ? 35  HIS A ND1 1 
ATOM   292  C  CD2 . HIS A 1 35  ? -11.660 -14.601 -9.090  1.00 15.66  ? 35  HIS A CD2 1 
ATOM   293  C  CE1 . HIS A 1 35  ? -12.138 -16.360 -10.302 1.00 17.94  ? 35  HIS A CE1 1 
ATOM   294  N  NE2 . HIS A 1 35  ? -11.471 -15.211 -10.302 1.00 17.89  ? 35  HIS A NE2 1 
ATOM   295  N  N   . VAL A 1 36  ? -13.640 -12.330 -7.278  1.00 9.03   ? 36  VAL A N   1 
ATOM   296  C  CA  . VAL A 1 36  ? -13.521 -11.068 -7.988  1.00 9.59   ? 36  VAL A CA  1 
ATOM   297  C  C   . VAL A 1 36  ? -12.178 -11.011 -8.710  1.00 9.53   ? 36  VAL A C   1 
ATOM   298  O  O   . VAL A 1 36  ? -11.140 -10.895 -8.080  1.00 9.84   ? 36  VAL A O   1 
ATOM   299  C  CB  . VAL A 1 36  ? -13.664 -9.867  -7.067  1.00 9.36   ? 36  VAL A CB  1 
ATOM   300  C  CG1 . VAL A 1 36  ? -13.550 -8.564  -7.851  1.00 11.27  ? 36  VAL A CG1 1 
ATOM   301  C  CG2 . VAL A 1 36  ? -14.990 -9.907  -6.309  1.00 11.06  ? 36  VAL A CG2 1 
ATOM   302  N  N   . PRO A 1 37  ? -12.139 -11.148 -10.038 1.00 10.48  ? 37  PRO A N   1 
ATOM   303  C  CA  . PRO A 1 37  ? -10.875 -11.003 -10.743 1.00 10.83  ? 37  PRO A CA  1 
ATOM   304  C  C   . PRO A 1 37  ? -10.238 -9.662  -10.417 1.00 9.87   ? 37  PRO A C   1 
ATOM   305  O  O   . PRO A 1 37  ? -10.925 -8.663  -10.218 1.00 9.52   ? 37  PRO A O   1 
ATOM   306  C  CB  . PRO A 1 37  ? -11.258 -11.110 -12.202 1.00 14.06  ? 37  PRO A CB  1 
ATOM   307  C  CG  . PRO A 1 37  ? -12.498 -11.932 -12.211 1.00 15.40  ? 37  PRO A CG  1 
ATOM   308  C  CD  . PRO A 1 37  ? -13.236 -11.463 -10.965 1.00 12.72  ? 37  PRO A CD  1 
ATOM   309  N  N   . LEU A 1 38  ? -8.887  -9.598  -10.437 1.00 10.82  ? 38  LEU A N   1 
ATOM   310  C  CA  . LEU A 1 38  ? -8.240  -8.377  -9.934  1.00 9.57   ? 38  LEU A CA  1 
ATOM   311  C  C   . LEU A 1 38  ? -8.675  -7.132  -10.675 1.00 8.78   ? 38  LEU A C   1 
ATOM   312  O  O   . LEU A 1 38  ? -8.966  -6.095  -10.059 1.00 9.47   ? 38  LEU A O   1 
ATOM   313  C  CB  . LEU A 1 38  ? -6.726  -8.494  -9.999  1.00 11.74  ? 38  LEU A CB  1 
ATOM   314  C  CG  . LEU A 1 38  ? -6.079  -9.493  -9.057  1.00 14.07  ? 38  LEU A CG  1 
ATOM   315  C  CD1 . LEU A 1 38  ? -4.556  -9.496  -9.316  1.00 23.66  ? 38  LEU A CD1 1 
ATOM   316  C  CD2 . LEU A 1 38  ? -6.423  -9.178  -7.635  1.00 17.00  ? 38  LEU A CD2 1 
ATOM   317  N  N   . GLU A 1 39  ? -8.783  -7.205  -12.006 1.00 8.87   ? 39  GLU A N   1 
ATOM   318  C  CA  A GLU A 1 39  ? -9.138  -6.026  -12.773 0.61 10.24  ? 39  GLU A CA  1 
ATOM   319  C  CA  B GLU A 1 39  ? -9.125  -5.953  -12.700 0.39 8.60   ? 39  GLU A CA  1 
ATOM   320  C  C   . GLU A 1 39  ? -10.620 -5.650  -12.659 1.00 9.18   ? 39  GLU A C   1 
ATOM   321  O  O   . GLU A 1 39  ? -10.990 -4.573  -13.144 1.00 10.26  ? 39  GLU A O   1 
ATOM   322  C  CB  A GLU A 1 39  ? -8.787  -6.241  -14.263 0.61 16.90  ? 39  GLU A CB  1 
ATOM   323  C  CB  B GLU A 1 39  ? -8.541  -5.952  -14.133 0.39 5.68   ? 39  GLU A CB  1 
ATOM   324  C  CG  A GLU A 1 39  ? -7.289  -6.240  -14.514 0.61 12.04  ? 39  GLU A CG  1 
ATOM   325  C  CG  B GLU A 1 39  ? -7.021  -5.775  -14.105 0.39 10.49  ? 39  GLU A CG  1 
ATOM   326  C  CD  A GLU A 1 39  ? -6.532  -7.451  -14.057 0.61 16.78  ? 39  GLU A CD  1 
ATOM   327  C  CD  B GLU A 1 39  ? -6.609  -4.549  -13.307 0.39 14.48  ? 39  GLU A CD  1 
ATOM   328  O  OE1 A GLU A 1 39  ? -6.973  -8.611  -14.270 0.61 25.84  ? 39  GLU A OE1 1 
ATOM   329  O  OE1 B GLU A 1 39  ? -7.232  -3.470  -13.450 0.39 14.77  ? 39  GLU A OE1 1 
ATOM   330  O  OE2 A GLU A 1 39  ? -5.444  -7.352  -13.431 0.61 25.06  ? 39  GLU A OE2 1 
ATOM   331  O  OE2 B GLU A 1 39  ? -5.646  -4.657  -12.530 0.39 16.61  ? 39  GLU A OE2 1 
ATOM   332  N  N   A GLN A 1 40  ? -11.378 -6.562  -12.049 0.45 8.08   ? 40  GLN A N   1 
ATOM   333  N  N   B GLN A 1 40  ? -11.511 -6.448  -12.061 0.55 8.55   ? 40  GLN A N   1 
ATOM   334  C  CA  A GLN A 1 40  ? -12.773 -6.290  -11.725 0.45 7.47   ? 40  GLN A CA  1 
ATOM   335  C  CA  B GLN A 1 40  ? -12.861 -6.010  -11.735 0.55 9.11   ? 40  GLN A CA  1 
ATOM   336  C  C   A GLN A 1 40  ? -12.914 -5.594  -10.369 0.45 7.74   ? 40  GLN A C   1 
ATOM   337  C  C   B GLN A 1 40  ? -12.952 -5.375  -10.348 0.55 8.30   ? 40  GLN A C   1 
ATOM   338  O  O   A GLN A 1 40  ? -14.042 -5.208  -10.001 0.45 7.54   ? 40  GLN A O   1 
ATOM   339  O  O   B GLN A 1 40  ? -14.026 -4.880  -9.954  0.55 8.76   ? 40  GLN A O   1 
ATOM   340  C  CB  A GLN A 1 40  ? -13.555 -7.608  -11.770 0.45 9.24   ? 40  GLN A CB  1 
ATOM   341  C  CB  B GLN A 1 40  ? -13.807 -7.207  -11.792 0.55 10.12  ? 40  GLN A CB  1 
ATOM   342  C  CG  A GLN A 1 40  ? -15.051 -7.501  -11.512 0.45 11.78  ? 40  GLN A CG  1 
ATOM   343  C  CG  B GLN A 1 40  ? -14.014 -7.694  -13.219 0.55 11.40  ? 40  GLN A CG  1 
ATOM   344  C  CD  A GLN A 1 40  ? -15.762 -8.849  -11.538 0.45 19.56  ? 40  GLN A CD  1 
ATOM   345  C  CD  B GLN A 1 40  ? -14.873 -6.689  -13.957 0.55 16.07  ? 40  GLN A CD  1 
ATOM   346  O  OE1 A GLN A 1 40  ? -16.517 -9.273  -10.641 0.45 18.83  ? 40  GLN A OE1 1 
ATOM   347  O  OE1 B GLN A 1 40  ? -16.012 -6.399  -13.602 0.55 19.51  ? 40  GLN A OE1 1 
ATOM   348  N  NE2 A GLN A 1 40  ? -15.504 -9.573  -12.610 0.45 16.05  ? 40  GLN A NE2 1 
ATOM   349  N  NE2 B GLN A 1 40  ? -14.270 -6.122  -14.965 0.55 12.91  ? 40  GLN A NE2 1 
ATOM   350  N  N   . ARG A 1 41  ? -11.855 -5.408  -9.586  1.00 8.27   ? 41  ARG A N   1 
ATOM   351  C  CA  . ARG A 1 41  ? -11.927 -4.789  -8.291  1.00 8.47   ? 41  ARG A CA  1 
ATOM   352  C  C   . ARG A 1 41  ? -12.249 -3.291  -8.396  1.00 8.01   ? 41  ARG A C   1 
ATOM   353  O  O   . ARG A 1 41  ? -11.700 -2.602  -9.247  1.00 8.55   ? 41  ARG A O   1 
ATOM   354  C  CB  . ARG A 1 41  ? -10.592 -4.935  -7.533  1.00 7.81   ? 41  ARG A CB  1 
ATOM   355  C  CG  . ARG A 1 41  ? -10.416 -6.322  -6.895  1.00 8.29   ? 41  ARG A CG  1 
ATOM   356  C  CD  . ARG A 1 41  ? -11.191 -6.533  -5.569  1.00 8.15   ? 41  ARG A CD  1 
ATOM   357  N  NE  . ARG A 1 41  ? -10.595 -5.659  -4.551  1.00 7.45   ? 41  ARG A NE  1 
ATOM   358  C  CZ  . ARG A 1 41  ? -11.036 -4.535  -4.083  1.00 7.18   ? 41  ARG A CZ  1 
ATOM   359  N  NH1 . ARG A 1 41  ? -12.247 -4.057  -4.376  1.00 7.85   ? 41  ARG A NH1 1 
ATOM   360  N  NH2 . ARG A 1 41  ? -10.274 -3.837  -3.258  1.00 7.82   ? 41  ARG A NH2 1 
ATOM   361  N  N   . ARG A 1 42  ? -13.174 -2.826  -7.545  1.00 7.89   ? 42  ARG A N   1 
ATOM   362  C  CA  . ARG A 1 42  ? -13.552 -1.430  -7.445  1.00 8.52   ? 42  ARG A CA  1 
ATOM   363  C  C   . ARG A 1 42  ? -13.750 -1.128  -5.988  1.00 8.47   ? 42  ARG A C   1 
ATOM   364  O  O   . ARG A 1 42  ? -14.420 -1.893  -5.281  1.00 8.79   ? 42  ARG A O   1 
ATOM   365  C  CB  . ARG A 1 42  ? -14.827 -1.130  -8.213  1.00 9.46   ? 42  ARG A CB  1 
ATOM   366  C  CG  . ARG A 1 42  ? -14.848 -1.403  -9.704  1.00 9.58   ? 42  ARG A CG  1 
ATOM   367  C  CD  . ARG A 1 42  ? -13.962 -0.456  -10.490 1.00 10.08  ? 42  ARG A CD  1 
ATOM   368  N  NE  . ARG A 1 42  ? -14.076 -0.732  -11.949 1.00 11.31  ? 42  ARG A NE  1 
ATOM   369  C  CZ  . ARG A 1 42  ? -13.422 -1.681  -12.588 1.00 11.47  ? 42  ARG A CZ  1 
ATOM   370  N  NH1 . ARG A 1 42  ? -12.528 -2.460  -11.988 1.00 10.51  ? 42  ARG A NH1 1 
ATOM   371  N  NH2 . ARG A 1 42  ? -13.662 -1.839  -13.882 1.00 14.51  ? 42  ARG A NH2 1 
ATOM   372  N  N   . GLY A 1 43  ? -13.167 -0.008  -5.531  1.00 9.50   ? 43  GLY A N   1 
ATOM   373  C  CA  . GLY A 1 43  ? -13.331 0.403   -4.136  1.00 9.78   ? 43  GLY A CA  1 
ATOM   374  C  C   . GLY A 1 43  ? -12.310 -0.214  -3.253  1.00 8.87   ? 43  GLY A C   1 
ATOM   375  O  O   . GLY A 1 43  ? -11.847 -1.342  -3.417  1.00 8.85   ? 43  GLY A O   1 
ATOM   376  N  N   . PHE A 1 44  ? -11.890 0.540   -2.243  1.00 8.36   ? 44  PHE A N   1 
ATOM   377  C  CA  . PHE A 1 44  ? -10.814 0.148   -1.380  1.00 9.29   ? 44  PHE A CA  1 
ATOM   378  C  C   . PHE A 1 44  ? -11.102 -1.131  -0.579  1.00 9.72   ? 44  PHE A C   1 
ATOM   379  O  O   . PHE A 1 44  ? -10.194 -1.879  -0.322  1.00 13.20  ? 44  PHE A O   1 
ATOM   380  C  CB  . PHE A 1 44  ? -10.500 1.328   -0.417  1.00 8.90   ? 44  PHE A CB  1 
ATOM   381  C  CG  . PHE A 1 44  ? -9.230  1.131   0.371   1.00 9.07   ? 44  PHE A CG  1 
ATOM   382  C  CD1 . PHE A 1 44  ? -7.994  1.106   -0.211  1.00 9.92   ? 44  PHE A CD1 1 
ATOM   383  C  CD2 . PHE A 1 44  ? -9.350  1.001   1.761   1.00 10.25  ? 44  PHE A CD2 1 
ATOM   384  C  CE1 . PHE A 1 44  ? -6.833  0.959   0.508   1.00 11.28  ? 44  PHE A CE1 1 
ATOM   385  C  CE2 . PHE A 1 44  ? -8.165  0.862   2.480   1.00 11.82  ? 44  PHE A CE2 1 
ATOM   386  C  CZ  . PHE A 1 44  ? -6.904  0.844   1.883   1.00 12.39  ? 44  PHE A CZ  1 
ATOM   387  N  N   . LEU A 1 45  ? -12.325 -1.336  -0.155  1.00 9.98   ? 45  LEU A N   1 
ATOM   388  C  CA  . LEU A 1 45  ? -12.659 -2.432  0.724   1.00 11.92  ? 45  LEU A CA  1 
ATOM   389  C  C   . LEU A 1 45  ? -13.041 -3.665  -0.104  1.00 10.14  ? 45  LEU A C   1 
ATOM   390  O  O   . LEU A 1 45  ? -14.192 -3.827  -0.586  1.00 9.49   ? 45  LEU A O   1 
ATOM   391  C  CB  . LEU A 1 45  ? -13.849 -2.071  1.654   1.00 15.88  ? 45  LEU A CB  1 
ATOM   392  C  CG  . LEU A 1 45  ? -13.675 -0.726  2.417   1.00 17.31  ? 45  LEU A CG  1 
ATOM   393  C  CD1 . LEU A 1 45  ? -14.914 -0.327  3.196   1.00 22.73  ? 45  LEU A CD1 1 
ATOM   394  C  CD2 . LEU A 1 45  ? -12.468 -0.912  3.324   1.00 22.47  ? 45  LEU A CD2 1 
ATOM   395  N  N   . ALA A 1 46  ? -12.103 -4.587  -0.279  1.00 10.47  ? 46  ALA A N   1 
ATOM   396  C  CA  . ALA A 1 46  ? -12.404 -5.831  -0.983  1.00 9.47   ? 46  ALA A CA  1 
ATOM   397  C  C   . ALA A 1 46  ? -13.542 -6.599  -0.348  1.00 8.58   ? 46  ALA A C   1 
ATOM   398  O  O   . ALA A 1 46  ? -14.368 -7.215  -1.035  1.00 9.39   ? 46  ALA A O   1 
ATOM   399  C  CB  . ALA A 1 46  ? -11.158 -6.676  -1.026  1.00 11.17  ? 46  ALA A CB  1 
ATOM   400  N  N   . ARG A 1 47  ? -13.602 -6.622  0.976   1.00 8.80   ? 47  ARG A N   1 
ATOM   401  C  CA  A ARG A 1 47  ? -14.624 -7.410  1.643   0.45 8.20   ? 47  ARG A CA  1 
ATOM   402  C  CA  B ARG A 1 47  ? -14.621 -7.395  1.656   0.55 8.11   ? 47  ARG A CA  1 
ATOM   403  C  C   . ARG A 1 47  ? -16.027 -6.990  1.238   1.00 8.36   ? 47  ARG A C   1 
ATOM   404  O  O   . ARG A 1 47  ? -16.902 -7.828  1.091   1.00 9.15   ? 47  ARG A O   1 
ATOM   405  C  CB  A ARG A 1 47  ? -14.419 -7.261  3.141   0.45 11.04  ? 47  ARG A CB  1 
ATOM   406  C  CB  B ARG A 1 47  ? -14.569 -7.253  3.181   0.55 8.64   ? 47  ARG A CB  1 
ATOM   407  C  CG  A ARG A 1 47  ? -15.386 -7.956  4.059   0.45 10.89  ? 47  ARG A CG  1 
ATOM   408  C  CG  B ARG A 1 47  ? -15.441 -8.239  3.917   0.55 10.20  ? 47  ARG A CG  1 
ATOM   409  C  CD  A ARG A 1 47  ? -15.018 -7.775  5.518   0.45 15.27  ? 47  ARG A CD  1 
ATOM   410  C  CD  B ARG A 1 47  ? -15.399 -8.054  5.425   0.55 11.59  ? 47  ARG A CD  1 
ATOM   411  N  NE  A ARG A 1 47  ? -15.515 -8.852  6.359   0.45 22.12  ? 47  ARG A NE  1 
ATOM   412  N  NE  B ARG A 1 47  ? -16.012 -6.796  5.831   0.55 15.26  ? 47  ARG A NE  1 
ATOM   413  C  CZ  A ARG A 1 47  ? -15.161 -8.986  7.644   0.45 24.56  ? 47  ARG A CZ  1 
ATOM   414  C  CZ  B ARG A 1 47  ? -16.147 -6.407  7.092   0.55 16.82  ? 47  ARG A CZ  1 
ATOM   415  N  NH1 A ARG A 1 47  ? -15.654 -9.988  8.349   0.45 26.54  ? 47  ARG A NH1 1 
ATOM   416  N  NH1 B ARG A 1 47  ? -16.714 -5.253  7.394   0.55 22.02  ? 47  ARG A NH1 1 
ATOM   417  N  NH2 A ARG A 1 47  ? -14.312 -8.090  8.156   0.45 36.10  ? 47  ARG A NH2 1 
ATOM   418  N  NH2 B ARG A 1 47  ? -15.682 -7.219  8.023   0.55 22.35  ? 47  ARG A NH2 1 
ATOM   419  N  N   . GLU A 1 48  ? -16.225 -5.679  1.029   1.00 8.57   ? 48  GLU A N   1 
ATOM   420  C  CA  . GLU A 1 48  ? -17.542 -5.225  0.633   1.00 8.75   ? 48  GLU A CA  1 
ATOM   421  C  C   . GLU A 1 48  ? -17.891 -5.559  -0.807  1.00 8.75   ? 48  GLU A C   1 
ATOM   422  O  O   . GLU A 1 48  ? -19.089 -5.768  -1.099  1.00 9.43   ? 48  GLU A O   1 
ATOM   423  C  CB  . GLU A 1 48  ? -17.684 -3.730  0.941   1.00 9.99   ? 48  GLU A CB  1 
ATOM   424  C  CG  . GLU A 1 48  ? -17.502 -3.418  2.426   1.00 10.73  ? 48  GLU A CG  1 
ATOM   425  C  CD  . GLU A 1 48  ? -18.275 -4.297  3.381   1.00 12.90  ? 48  GLU A CD  1 
ATOM   426  O  OE1 . GLU A 1 48  ? -17.652 -4.810  4.341   1.00 16.91  ? 48  GLU A OE1 1 
ATOM   427  O  OE2 . GLU A 1 48  ? -19.490 -4.499  3.155   1.00 15.29  ? 48  GLU A OE2 1 
ATOM   428  N  N   . GLN A 1 49  ? -16.926 -5.655  -1.710  1.00 8.02   ? 49  GLN A N   1 
ATOM   429  C  CA  . GLN A 1 49  ? -17.202 -6.099  -3.064  1.00 8.46   ? 49  GLN A CA  1 
ATOM   430  C  C   . GLN A 1 49  ? -17.537 -7.595  -3.041  1.00 8.43   ? 49  GLN A C   1 
ATOM   431  O  O   . GLN A 1 49  ? -18.429 -8.035  -3.774  1.00 9.57   ? 49  GLN A O   1 
ATOM   432  C  CB  . GLN A 1 49  ? -16.028 -5.783  -3.982  1.00 8.81   ? 49  GLN A CB  1 
ATOM   433  C  CG  . GLN A 1 49  ? -16.409 -6.061  -5.442  1.00 9.66   ? 49  GLN A CG  1 
ATOM   434  C  CD  . GLN A 1 49  ? -15.410 -5.557  -6.424  1.00 8.89   ? 49  GLN A CD  1 
ATOM   435  O  OE1 . GLN A 1 49  ? -14.331 -5.063  -6.040  1.00 9.11   ? 49  GLN A OE1 1 
ATOM   436  N  NE2 . GLN A 1 49  ? -15.724 -5.681  -7.720  1.00 10.76  ? 49  GLN A NE2 1 
ATOM   437  N  N   . TYR A 1 50  ? -16.857 -8.384  -2.245  1.00 8.06   ? 50  TYR A N   1 
ATOM   438  C  CA  . TYR A 1 50  ? -17.188 -9.810  -2.095  1.00 8.17   ? 50  TYR A CA  1 
ATOM   439  C  C   . TYR A 1 50  ? -18.579 -9.953  -1.486  1.00 8.23   ? 50  TYR A C   1 
ATOM   440  O  O   . TYR A 1 50  ? -19.362 -10.816 -1.960  1.00 9.27   ? 50  TYR A O   1 
ATOM   441  C  CB  . TYR A 1 50  ? -16.119 -10.564 -1.302  1.00 8.36   ? 50  TYR A CB  1 
ATOM   442  C  CG  . TYR A 1 50  ? -14.973 -11.006 -2.182  1.00 7.93   ? 50  TYR A CG  1 
ATOM   443  C  CD1 . TYR A 1 50  ? -13.970 -10.132 -2.558  1.00 8.04   ? 50  TYR A CD1 1 
ATOM   444  C  CD2 . TYR A 1 50  ? -14.904 -12.316 -2.661  1.00 9.25   ? 50  TYR A CD2 1 
ATOM   445  C  CE1 . TYR A 1 50  ? -12.943 -10.524 -3.388  1.00 8.44   ? 50  TYR A CE1 1 
ATOM   446  C  CE2 . TYR A 1 50  ? -13.866 -12.750 -3.460  1.00 9.50   ? 50  TYR A CE2 1 
ATOM   447  C  CZ  . TYR A 1 50  ? -12.874 -11.821 -3.842  1.00 8.79   ? 50  TYR A CZ  1 
ATOM   448  O  OH  . TYR A 1 50  ? -11.905 -12.286 -4.697  1.00 9.25   ? 50  TYR A OH  1 
ATOM   449  N  N   . ARG A 1 51  ? -18.944 -9.134  -0.508  1.00 8.20   ? 51  ARG A N   1 
ATOM   450  C  CA  . ARG A 1 51  ? -20.284 -9.207  0.080   1.00 8.23   ? 51  ARG A CA  1 
ATOM   451  C  C   . ARG A 1 51  ? -21.352 -8.967  -0.980  1.00 8.59   ? 51  ARG A C   1 
ATOM   452  O  O   . ARG A 1 51  ? -22.389 -9.635  -0.991  1.00 9.04   ? 51  ARG A O   1 
ATOM   453  C  CB  . ARG A 1 51  ? -20.455 -8.185  1.214   1.00 8.90   ? 51  ARG A CB  1 
ATOM   454  C  CG  . ARG A 1 51  ? -21.660 -8.440  2.066   1.00 9.83   ? 51  ARG A CG  1 
ATOM   455  C  CD  . ARG A 1 51  ? -21.916 -7.320  3.057   1.00 10.78  ? 51  ARG A CD  1 
ATOM   456  N  NE  . ARG A 1 51  ? -20.797 -6.892  3.850   1.00 10.86  ? 51  ARG A NE  1 
ATOM   457  C  CZ  . ARG A 1 51  ? -20.352 -7.459  4.957   1.00 11.72  ? 51  ARG A CZ  1 
ATOM   458  N  NH1 . ARG A 1 51  ? -20.946 -8.541  5.452   1.00 12.09  ? 51  ARG A NH1 1 
ATOM   459  N  NH2 . ARG A 1 51  ? -19.318 -6.895  5.557   1.00 13.25  ? 51  ARG A NH2 1 
ATOM   460  N  N   . ALA A 1 52  ? -21.083 -7.996  -1.867  1.00 9.31   ? 52  ALA A N   1 
ATOM   461  C  CA  . ALA A 1 52  ? -22.005 -7.651  -2.928  1.00 10.50  ? 52  ALA A CA  1 
ATOM   462  C  C   . ALA A 1 52  ? -22.161 -8.810  -3.912  1.00 10.64  ? 52  ALA A C   1 
ATOM   463  O  O   . ALA A 1 52  ? -23.220 -9.042  -4.476  1.00 13.58  ? 52  ALA A O   1 
ATOM   464  C  CB  . ALA A 1 52  ? -21.523 -6.384  -3.655  1.00 12.50  ? 52  ALA A CB  1 
ATOM   465  N  N   . LEU A 1 53  ? -21.053 -9.529  -4.158  1.00 10.43  ? 53  LEU A N   1 
ATOM   466  C  CA  . LEU A 1 53  ? -21.056 -10.685 -5.036  1.00 11.27  ? 53  LEU A CA  1 
ATOM   467  C  C   . LEU A 1 53  ? -21.957 -11.763 -4.466  1.00 11.86  ? 53  LEU A C   1 
ATOM   468  O  O   . LEU A 1 53  ? -22.810 -12.324 -5.191  1.00 13.75  ? 53  LEU A O   1 
ATOM   469  C  CB  . LEU A 1 53  ? -19.618 -11.116 -5.305  1.00 11.24  ? 53  LEU A CB  1 
ATOM   470  C  CG  . LEU A 1 53  ? -19.407 -12.314 -6.247  1.00 13.84  ? 53  LEU A CG  1 
ATOM   471  C  CD1 . LEU A 1 53  ? -19.991 -12.033 -7.614  1.00 17.43  ? 53  LEU A CD1 1 
ATOM   472  C  CD2 . LEU A 1 53  ? -17.909 -12.672 -6.320  1.00 14.82  ? 53  LEU A CD2 1 
ATOM   473  N  N   . ARG A 1 54  ? -21.798 -12.088 -3.165  1.00 10.99  ? 54  ARG A N   1 
ATOM   474  C  CA  . ARG A 1 54  ? -22.686 -13.027 -2.510  1.00 10.83  ? 54  ARG A CA  1 
ATOM   475  C  C   . ARG A 1 54  ? -22.488 -12.835 -0.996  1.00 10.70  ? 54  ARG A C   1 
ATOM   476  O  O   . ARG A 1 54  ? -21.338 -12.840 -0.542  1.00 10.02  ? 54  ARG A O   1 
ATOM   477  C  CB  . ARG A 1 54  ? -22.456 -14.474 -2.948  1.00 12.40  ? 54  ARG A CB  1 
ATOM   478  C  CG  . ARG A 1 54  ? -23.766 -15.326 -2.869  1.00 16.45  ? 54  ARG A CG  1 
ATOM   479  C  CD  . ARG A 1 54  ? -23.464 -16.734 -3.417  1.00 17.99  ? 54  ARG A CD  1 
ATOM   480  N  NE  . ARG A 1 54  ? -22.504 -17.436 -2.577  1.00 16.11  ? 54  ARG A NE  1 
ATOM   481  C  CZ  . ARG A 1 54  ? -21.866 -18.523 -2.922  1.00 14.94  ? 54  ARG A CZ  1 
ATOM   482  N  NH1 . ARG A 1 54  ? -21.015 -19.103 -2.088  1.00 19.22  ? 54  ARG A NH1 1 
ATOM   483  N  NH2 . ARG A 1 54  ? -22.077 -19.064 -4.125  1.00 19.86  ? 54  ARG A NH2 1 
ATOM   484  N  N   . PRO A 1 55  ? -23.572 -12.664 -0.212  1.00 10.68  ? 55  PRO A N   1 
ATOM   485  C  CA  . PRO A 1 55  ? -23.355 -12.310 1.210   1.00 10.70  ? 55  PRO A CA  1 
ATOM   486  C  C   . PRO A 1 55  ? -22.409 -13.173 2.009   1.00 9.78   ? 55  PRO A C   1 
ATOM   487  O  O   . PRO A 1 55  ? -21.689 -12.633 2.863   1.00 11.02  ? 55  PRO A O   1 
ATOM   488  C  CB  . PRO A 1 55  ? -24.777 -12.360 1.818   1.00 11.79  ? 55  PRO A CB  1 
ATOM   489  C  CG  . PRO A 1 55  ? -25.619 -11.912 0.661   1.00 13.16  ? 55  PRO A CG  1 
ATOM   490  C  CD  . PRO A 1 55  ? -24.992 -12.585 -0.549  1.00 12.87  ? 55  PRO A CD  1 
ATOM   491  N  N   . ASP A 1 56  ? -22.387 -14.470 1.800   1.00 10.95  ? 56  ASP A N   1 
ATOM   492  C  CA  . ASP A 1 56  ? -21.517 -15.361 2.603   1.00 10.37  ? 56  ASP A CA  1 
ATOM   493  C  C   . ASP A 1 56  ? -20.036 -15.165 2.288   1.00 11.06  ? 56  ASP A C   1 
ATOM   494  O  O   . ASP A 1 56  ? -19.173 -15.605 3.041   1.00 11.85  ? 56  ASP A O   1 
ATOM   495  C  CB  . ASP A 1 56  ? -21.924 -16.852 2.363   1.00 14.55  ? 56  ASP A CB  1 
ATOM   496  C  CG  . ASP A 1 56  ? -21.701 -17.224 0.903   1.00 15.49  ? 56  ASP A CG  1 
ATOM   497  O  OD1 . ASP A 1 56  ? -22.307 -16.657 -0.028  1.00 19.30  ? 56  ASP A OD1 1 
ATOM   498  O  OD2 . ASP A 1 56  ? -20.823 -18.104 0.658   1.00 18.35  ? 56  ASP A OD2 1 
ATOM   499  N  N   . LEU A 1 57  ? -19.730 -14.518 1.179   1.00 9.56   ? 57  LEU A N   1 
ATOM   500  C  CA  . LEU A 1 57  ? -18.321 -14.352 0.795   1.00 9.14   ? 57  LEU A CA  1 
ATOM   501  C  C   . LEU A 1 57  ? -17.622 -13.313 1.645   1.00 8.49   ? 57  LEU A C   1 
ATOM   502  O  O   . LEU A 1 57  ? -16.365 -13.319 1.663   1.00 10.10  ? 57  LEU A O   1 
ATOM   503  C  CB  . LEU A 1 57  ? -18.175 -14.021 -0.696  1.00 9.64   ? 57  LEU A CB  1 
ATOM   504  C  CG  . LEU A 1 57  ? -18.862 -15.025 -1.635  1.00 10.70  ? 57  LEU A CG  1 
ATOM   505  C  CD1 . LEU A 1 57  ? -18.756 -14.574 -3.086  1.00 14.15  ? 57  LEU A CD1 1 
ATOM   506  C  CD2 . LEU A 1 57  ? -18.380 -16.445 -1.430  1.00 12.71  ? 57  LEU A CD2 1 
ATOM   507  N  N   . ALA A 1 58  ? -18.333 -12.425 2.309   1.00 9.92   ? 58  ALA A N   1 
ATOM   508  C  CA  . ALA A 1 58  ? -17.639 -11.416 3.123   1.00 9.69   ? 58  ALA A CA  1 
ATOM   509  C  C   . ALA A 1 58  ? -16.798 -12.052 4.224   1.00 10.18  ? 58  ALA A C   1 
ATOM   510  O  O   . ALA A 1 58  ? -15.579 -11.754 4.384   1.00 10.51  ? 58  ALA A O   1 
ATOM   511  C  CB  . ALA A 1 58  ? -18.645 -10.447 3.716   1.00 10.07  ? 58  ALA A CB  1 
ATOM   512  N  N   . ASP A 1 59  ? -17.378 -12.971 4.972   1.00 9.85   ? 59  ASP A N   1 
ATOM   513  C  CA  . ASP A 1 59  ? -16.633 -13.574 6.071   1.00 10.49  ? 59  ASP A CA  1 
ATOM   514  C  C   . ASP A 1 59  ? -15.541 -14.477 5.521   1.00 8.93   ? 59  ASP A C   1 
ATOM   515  O  O   . ASP A 1 59  ? -14.485 -14.635 6.145   1.00 9.68   ? 59  ASP A O   1 
ATOM   516  C  CB  . ASP A 1 59  ? -17.557 -14.350 7.006   1.00 14.43  ? 59  ASP A CB  1 
ATOM   517  C  CG  . ASP A 1 59  ? -18.459 -13.468 7.847   1.00 17.80  ? 59  ASP A CG  1 
ATOM   518  O  OD1 . ASP A 1 59  ? -18.251 -12.242 7.884   1.00 20.65  ? 59  ASP A OD1 1 
ATOM   519  O  OD2 . ASP A 1 59  ? -19.344 -14.093 8.463   1.00 26.88  ? 59  ASP A OD2 1 
ATOM   520  N  N   . LYS A 1 60  ? -15.812 -15.125 4.373   1.00 8.97   ? 60  LYS A N   1 
ATOM   521  C  CA  . LYS A 1 60  ? -14.784 -15.996 3.778   1.00 9.16   ? 60  LYS A CA  1 
ATOM   522  C  C   . LYS A 1 60  ? -13.552 -15.208 3.362   1.00 8.77   ? 60  LYS A C   1 
ATOM   523  O  O   . LYS A 1 60  ? -12.418 -15.596 3.663   1.00 8.82   ? 60  LYS A O   1 
ATOM   524  C  CB  . LYS A 1 60  ? -15.416 -16.789 2.613   1.00 9.65   ? 60  LYS A CB  1 
ATOM   525  C  CG  . LYS A 1 60  ? -16.487 -17.782 3.091   1.00 10.84  ? 60  LYS A CG  1 
ATOM   526  C  CD  . LYS A 1 60  ? -17.155 -18.530 1.948   1.00 12.51  ? 60  LYS A CD  1 
ATOM   527  C  CE  . LYS A 1 60  ? -18.168 -19.563 2.495   1.00 16.90  ? 60  LYS A CE  1 
ATOM   528  N  NZ  . LYS A 1 60  ? -19.110 -20.061 1.494   1.00 20.69  ? 60  LYS A NZ  1 
ATOM   529  N  N   . VAL A 1 61  ? -13.767 -14.109 2.636   1.00 8.60   ? 61  VAL A N   1 
ATOM   530  C  CA  . VAL A 1 61  ? -12.596 -13.362 2.181   1.00 9.59   ? 61  VAL A CA  1 
ATOM   531  C  C   . VAL A 1 61  ? -11.902 -12.751 3.405   1.00 8.94   ? 61  VAL A C   1 
ATOM   532  O  O   . VAL A 1 61  ? -10.649 -12.725 3.452   1.00 9.26   ? 61  VAL A O   1 
ATOM   533  C  CB  . VAL A 1 61  ? -12.996 -12.376 1.052   1.00 10.71  ? 61  VAL A CB  1 
ATOM   534  C  CG1 . VAL A 1 61  ? -13.651 -11.145 1.594   1.00 11.44  ? 61  VAL A CG1 1 
ATOM   535  C  CG2 . VAL A 1 61  ? -11.747 -11.990 0.241   1.00 12.84  ? 61  VAL A CG2 1 
ATOM   536  N  N   . ALA A 1 62  ? -12.602 -12.303 4.416   1.00 9.57   ? 62  ALA A N   1 
ATOM   537  C  CA  . ALA A 1 62  ? -11.975 -11.773 5.647   1.00 10.67  ? 62  ALA A CA  1 
ATOM   538  C  C   . ALA A 1 62  ? -11.089 -12.831 6.280   1.00 10.38  ? 62  ALA A C   1 
ATOM   539  O  O   . ALA A 1 62  ? -10.006 -12.547 6.803   1.00 10.61  ? 62  ALA A O   1 
ATOM   540  C  CB  . ALA A 1 62  ? -13.012 -11.275 6.660   1.00 12.53  ? 62  ALA A CB  1 
ATOM   541  N  N   . SER A 1 63  ? -11.521 -14.103 6.272   1.00 9.42   ? 63  SER A N   1 
ATOM   542  C  CA  . SER A 1 63  ? -10.763 -15.150 6.890   1.00 10.27  ? 63  SER A CA  1 
ATOM   543  C  C   . SER A 1 63  ? -9.435  -15.327 6.229   1.00 9.85   ? 63  SER A C   1 
ATOM   544  O  O   . SER A 1 63  ? -8.470  -15.777 6.857   1.00 11.27  ? 63  SER A O   1 
ATOM   545  C  CB  . SER A 1 63  ? -11.519 -16.490 6.949   1.00 11.17  ? 63  SER A CB  1 
ATOM   546  O  OG  . SER A 1 63  ? -11.553 -17.156 5.726   1.00 13.28  ? 63  SER A OG  1 
ATOM   547  N  N   . VAL A 1 64  ? -9.317  -14.997 4.928   1.00 8.22   ? 64  VAL A N   1 
ATOM   548  C  CA  . VAL A 1 64  ? -8.022  -15.075 4.252   1.00 8.24   ? 64  VAL A CA  1 
ATOM   549  C  C   . VAL A 1 64  ? -7.040  -14.027 4.765   1.00 8.08   ? 64  VAL A C   1 
ATOM   550  O  O   . VAL A 1 64  ? -5.918  -14.355 5.157   1.00 8.47   ? 64  VAL A O   1 
ATOM   551  C  CB  . VAL A 1 64  ? -8.208  -14.935 2.726   1.00 8.66   ? 64  VAL A CB  1 
ATOM   552  C  CG1 . VAL A 1 64  ? -6.876  -14.900 2.003   1.00 8.91   ? 64  VAL A CG1 1 
ATOM   553  C  CG2 . VAL A 1 64  ? -9.097  -16.073 2.194   1.00 9.39   ? 64  VAL A CG2 1 
ATOM   554  N  N   . TYR A 1 65  ? -7.433  -12.738 4.786   1.00 8.46   ? 65  TYR A N   1 
ATOM   555  C  CA  . TYR A 1 65  ? -6.474  -11.699 5.194   1.00 8.66   ? 65  TYR A CA  1 
ATOM   556  C  C   . TYR A 1 65  ? -6.334  -11.600 6.699   1.00 9.52   ? 65  TYR A C   1 
ATOM   557  O  O   . TYR A 1 65  ? -5.372  -10.920 7.115   1.00 11.03  ? 65  TYR A O   1 
ATOM   558  C  CB  . TYR A 1 65  ? -6.806  -10.353 4.520   1.00 10.33  ? 65  TYR A CB  1 
ATOM   559  C  CG  . TYR A 1 65  ? -8.119  -9.705  4.790   1.00 11.24  ? 65  TYR A CG  1 
ATOM   560  C  CD1 . TYR A 1 65  ? -8.428  -9.180  6.029   1.00 14.38  ? 65  TYR A CD1 1 
ATOM   561  C  CD2 . TYR A 1 65  ? -9.084  -9.601  3.777   1.00 15.39  ? 65  TYR A CD2 1 
ATOM   562  C  CE1 . TYR A 1 65  ? -9.638  -8.575  6.308   1.00 17.13  ? 65  TYR A CE1 1 
ATOM   563  C  CE2 . TYR A 1 65  ? -10.297 -8.988  4.063   1.00 19.63  ? 65  TYR A CE2 1 
ATOM   564  C  CZ  . TYR A 1 65  ? -10.556 -8.493  5.318   1.00 18.92  ? 65  TYR A CZ  1 
ATOM   565  O  OH  . TYR A 1 65  ? -11.758 -7.870  5.613   1.00 26.90  ? 65  TYR A OH  1 
ATOM   566  N  N   . GLU A 1 66  ? -7.178  -12.244 7.480   1.00 9.66   ? 66  GLU A N   1 
ATOM   567  C  CA  . GLU A 1 66  ? -7.029  -12.292 8.921   1.00 10.70  ? 66  GLU A CA  1 
ATOM   568  C  C   . GLU A 1 66  ? -6.239  -13.520 9.395   1.00 11.02  ? 66  GLU A C   1 
ATOM   569  O  O   . GLU A 1 66  ? -5.946  -13.713 10.561  1.00 13.14  ? 66  GLU A O   1 
ATOM   570  C  CB  . GLU A 1 66  ? -8.417  -12.250 9.600   1.00 13.08  ? 66  GLU A CB  1 
ATOM   571  C  CG  . GLU A 1 66  ? -9.040  -10.855 9.376   1.00 16.31  ? 66  GLU A CG  1 
ATOM   572  C  CD  . GLU A 1 66  ? -10.398 -10.518 9.852   1.00 20.13  ? 66  GLU A CD  1 
ATOM   573  O  OE1 . GLU A 1 66  ? -11.093 -11.469 10.285  1.00 30.50  ? 66  GLU A OE1 1 
ATOM   574  O  OE2 . GLU A 1 66  ? -10.851 -9.345  9.786   1.00 30.28  ? 66  GLU A OE2 1 
ATOM   575  N  N   . ALA A 1 67  ? -5.824  -14.417 8.493   1.00 10.14  ? 67  ALA A N   1 
ATOM   576  C  CA  . ALA A 1 67  ? -5.165  -15.644 8.861   1.00 10.85  ? 67  ALA A CA  1 
ATOM   577  C  C   . ALA A 1 67  ? -3.688  -15.435 9.203   1.00 9.69   ? 67  ALA A C   1 
ATOM   578  O  O   . ALA A 1 67  ? -3.001  -14.611 8.581   1.00 10.43  ? 67  ALA A O   1 
ATOM   579  C  CB  . ALA A 1 67  ? -5.215  -16.673 7.752   1.00 12.70  ? 67  ALA A CB  1 
ATOM   580  N  N   . PRO A 1 68  ? -3.144  -16.217 10.141  1.00 11.11  ? 68  PRO A N   1 
ATOM   581  C  CA  . PRO A 1 68  ? -1.687  -16.175 10.340  1.00 11.30  ? 68  PRO A CA  1 
ATOM   582  C  C   . PRO A 1 68  ? -0.952  -16.428 9.037   1.00 10.03  ? 68  PRO A C   1 
ATOM   583  O  O   . PRO A 1 68  ? -1.330  -17.285 8.247   1.00 11.02  ? 68  PRO A O   1 
ATOM   584  C  CB  . PRO A 1 68  ? -1.460  -17.350 11.310  1.00 14.66  ? 68  PRO A CB  1 
ATOM   585  C  CG  . PRO A 1 68  ? -2.737  -17.597 11.997  1.00 15.51  ? 68  PRO A CG  1 
ATOM   586  C  CD  . PRO A 1 68  ? -3.829  -17.186 11.051  1.00 12.45  ? 68  PRO A CD  1 
ATOM   587  N  N   . GLY A 1 69  ? 0.093   -15.659 8.845   1.00 10.34  ? 69  GLY A N   1 
ATOM   588  C  CA  . GLY A 1 69  ? 0.927   -15.808 7.651   1.00 10.47  ? 69  GLY A CA  1 
ATOM   589  C  C   . GLY A 1 69  ? 0.534   -14.956 6.466   1.00 8.95   ? 69  GLY A C   1 
ATOM   590  O  O   . GLY A 1 69  ? 1.347   -14.755 5.576   1.00 10.26  ? 69  GLY A O   1 
ATOM   591  N  N   . PHE A 1 70  ? -0.690  -14.460 6.430   1.00 8.93   ? 70  PHE A N   1 
ATOM   592  C  CA  . PHE A 1 70  ? -1.149  -13.755 5.247   1.00 8.92   ? 70  PHE A CA  1 
ATOM   593  C  C   . PHE A 1 70  ? -0.228  -12.549 4.934   1.00 8.23   ? 70  PHE A C   1 
ATOM   594  O  O   . PHE A 1 70  ? 0.221   -12.411 3.791   1.00 8.26   ? 70  PHE A O   1 
ATOM   595  C  CB  . PHE A 1 70  ? -2.585  -13.248 5.437   1.00 9.49   ? 70  PHE A CB  1 
ATOM   596  C  CG  . PHE A 1 70  ? -3.074  -12.454 4.250   1.00 8.61   ? 70  PHE A CG  1 
ATOM   597  C  CD1 . PHE A 1 70  ? -3.497  -13.086 3.087   1.00 9.64   ? 70  PHE A CD1 1 
ATOM   598  C  CD2 . PHE A 1 70  ? -3.050  -11.060 4.272   1.00 9.18   ? 70  PHE A CD2 1 
ATOM   599  C  CE1 . PHE A 1 70  ? -3.877  -12.358 1.994   1.00 9.79   ? 70  PHE A CE1 1 
ATOM   600  C  CE2 . PHE A 1 70  ? -3.423  -10.353 3.154   1.00 9.26   ? 70  PHE A CE2 1 
ATOM   601  C  CZ  . PHE A 1 70  ? -3.831  -10.980 1.993   1.00 9.47   ? 70  PHE A CZ  1 
ATOM   602  N  N   . PHE A 1 71  ? -0.030  -11.678 5.892   1.00 8.07   ? 71  PHE A N   1 
ATOM   603  C  CA  . PHE A 1 71  ? 0.820   -10.505 5.646   1.00 8.01   ? 71  PHE A CA  1 
ATOM   604  C  C   . PHE A 1 71  ? 2.269   -10.928 5.449   1.00 8.09   ? 71  PHE A C   1 
ATOM   605  O  O   . PHE A 1 71  ? 2.961   -10.365 4.595   1.00 9.30   ? 71  PHE A O   1 
ATOM   606  C  CB  . PHE A 1 71  ? 0.681   -9.485  6.778   1.00 8.32   ? 71  PHE A CB  1 
ATOM   607  C  CG  . PHE A 1 71  ? -0.577  -8.670  6.634   1.00 8.10   ? 71  PHE A CG  1 
ATOM   608  C  CD1 . PHE A 1 71  ? -0.572  -7.577  5.788   1.00 9.49   ? 71  PHE A CD1 1 
ATOM   609  C  CD2 . PHE A 1 71  ? -1.743  -8.992  7.309   1.00 9.77   ? 71  PHE A CD2 1 
ATOM   610  C  CE1 . PHE A 1 71  ? -1.734  -6.833  5.638   1.00 10.20  ? 71  PHE A CE1 1 
ATOM   611  C  CE2 . PHE A 1 71  ? -2.900  -8.274  7.160   1.00 10.55  ? 71  PHE A CE2 1 
ATOM   612  C  CZ  . PHE A 1 71  ? -2.867  -7.212  6.306   1.00 10.70  ? 71  PHE A CZ  1 
ATOM   613  N  N   . LEU A 1 72  ? 2.779   -11.878 6.237   1.00 8.81   ? 72  LEU A N   1 
ATOM   614  C  CA  . LEU A 1 72  ? 4.142   -12.341 6.119   1.00 9.40   ? 72  LEU A CA  1 
ATOM   615  C  C   . LEU A 1 72  ? 4.488   -12.812 4.709   1.00 9.25   ? 72  LEU A C   1 
ATOM   616  O  O   . LEU A 1 72  ? 5.599   -12.573 4.237   1.00 10.76  ? 72  LEU A O   1 
ATOM   617  C  CB  . LEU A 1 72  ? 4.338   -13.474 7.123   1.00 11.55  ? 72  LEU A CB  1 
ATOM   618  C  CG  . LEU A 1 72  ? 5.803   -13.922 7.252   1.00 13.78  ? 72  LEU A CG  1 
ATOM   619  C  CD1 . LEU A 1 72  ? 6.651   -12.828 7.885   1.00 18.20  ? 72  LEU A CD1 1 
ATOM   620  C  CD2 . LEU A 1 72  ? 5.840   -15.224 8.060   1.00 20.89  ? 72  LEU A CD2 1 
ATOM   621  N  N   . ASP A 1 73  ? 3.523   -13.467 4.048   1.00 9.00   ? 73  ASP A N   1 
ATOM   622  C  CA  . ASP A 1 73  ? 3.785   -14.146 2.795   1.00 9.86   ? 73  ASP A CA  1 
ATOM   623  C  C   . ASP A 1 73  ? 3.483   -13.283 1.578   1.00 10.50  ? 73  ASP A C   1 
ATOM   624  O  O   . ASP A 1 73  ? 3.685   -13.761 0.452   1.00 10.95  ? 73  ASP A O   1 
ATOM   625  C  CB  . ASP A 1 73  ? 2.989   -15.452 2.726   1.00 11.39  ? 73  ASP A CB  1 
ATOM   626  C  CG  . ASP A 1 73  ? 3.399   -16.470 3.764   1.00 13.26  ? 73  ASP A CG  1 
ATOM   627  O  OD1 . ASP A 1 73  ? 4.449   -16.361 4.411   1.00 17.67  ? 73  ASP A OD1 1 
ATOM   628  O  OD2 . ASP A 1 73  ? 2.596   -17.411 3.962   1.00 18.67  ? 73  ASP A OD2 1 
ATOM   629  N  N   . LEU A 1 74  ? 3.043   -12.035 1.694   1.00 8.47   ? 74  LEU A N   1 
ATOM   630  C  CA  . LEU A 1 74  ? 2.716   -11.257 0.508   1.00 8.21   ? 74  LEU A CA  1 
ATOM   631  C  C   . LEU A 1 74  ? 3.972   -11.064 -0.347  1.00 8.20   ? 74  LEU A C   1 
ATOM   632  O  O   . LEU A 1 74  ? 5.102   -10.903 0.158   1.00 8.98   ? 74  LEU A O   1 
ATOM   633  C  CB  . LEU A 1 74  ? 2.197   -9.891  0.879   1.00 7.34   ? 74  LEU A CB  1 
ATOM   634  C  CG  . LEU A 1 74  ? 0.843   -9.890  1.624   1.00 7.88   ? 74  LEU A CG  1 
ATOM   635  C  CD1 . LEU A 1 74  ? 0.405   -8.472  1.926   1.00 9.52   ? 74  LEU A CD1 1 
ATOM   636  C  CD2 . LEU A 1 74  ? -0.232  -10.594 0.813   1.00 9.16   ? 74  LEU A CD2 1 
ATOM   637  N  N   . GLU A 1 75  ? 3.802   -11.027 -1.651  1.00 8.92   ? 75  GLU A N   1 
ATOM   638  C  CA  . GLU A 1 75  ? 4.850   -10.757 -2.600  1.00 9.00   ? 75  GLU A CA  1 
ATOM   639  C  C   . GLU A 1 75  ? 5.063   -9.247  -2.726  1.00 8.31   ? 75  GLU A C   1 
ATOM   640  O  O   . GLU A 1 75  ? 4.136   -8.468  -2.639  1.00 9.68   ? 75  GLU A O   1 
ATOM   641  C  CB  . GLU A 1 75  ? 4.475   -11.354 -3.953  1.00 12.85  ? 75  GLU A CB  1 
ATOM   642  C  CG  . GLU A 1 75  ? 4.400   -12.888 -3.871  1.00 22.04  ? 75  GLU A CG  1 
ATOM   643  C  CD  . GLU A 1 75  ? 4.417   -13.513 -5.246  1.00 25.71  ? 75  GLU A CD  1 
ATOM   644  O  OE1 . GLU A 1 75  ? 5.476   -14.103 -5.572  1.00 62.06  ? 75  GLU A OE1 1 
ATOM   645  O  OE2 . GLU A 1 75  ? 3.379   -13.376 -5.909  1.00 40.75  ? 75  GLU A OE2 1 
ATOM   646  N  N   . PRO A 1 76  ? 6.288   -8.828  -3.018  1.00 8.24   ? 76  PRO A N   1 
ATOM   647  C  CA  . PRO A 1 76  ? 6.509   -7.376  -3.291  1.00 8.58   ? 76  PRO A CA  1 
ATOM   648  C  C   . PRO A 1 76  ? 5.848   -6.939  -4.568  1.00 8.88   ? 76  PRO A C   1 
ATOM   649  O  O   . PRO A 1 76  ? 5.713   -7.693  -5.517  1.00 12.13  ? 76  PRO A O   1 
ATOM   650  C  CB  . PRO A 1 76  ? 8.020   -7.284  -3.474  1.00 11.39  ? 76  PRO A CB  1 
ATOM   651  C  CG  . PRO A 1 76  ? 8.579   -8.512  -2.849  1.00 14.61  ? 76  PRO A CG  1 
ATOM   652  C  CD  . PRO A 1 76  ? 7.539   -9.584  -3.028  1.00 9.65   ? 76  PRO A CD  1 
ATOM   653  N  N   . ILE A 1 77  ? 5.433   -5.704  -4.614  1.00 9.73   ? 77  ILE A N   1 
ATOM   654  C  CA  . ILE A 1 77  ? 4.989   -5.023  -5.832  1.00 9.81   ? 77  ILE A CA  1 
ATOM   655  C  C   . ILE A 1 77  ? 6.174   -4.889  -6.769  1.00 9.61   ? 77  ILE A C   1 
ATOM   656  O  O   . ILE A 1 77  ? 7.294   -4.532  -6.339  1.00 9.25   ? 77  ILE A O   1 
ATOM   657  C  CB  . ILE A 1 77  ? 4.319   -3.691  -5.446  1.00 9.95   ? 77  ILE A CB  1 
ATOM   658  C  CG1 . ILE A 1 77  ? 2.977   -3.848  -4.673  1.00 13.24  ? 77  ILE A CG1 1 
ATOM   659  C  CG2 . ILE A 1 77  ? 4.149   -2.747  -6.621  1.00 10.06  ? 77  ILE A CG2 1 
ATOM   660  C  CD1 . ILE A 1 77  ? 1.754   -4.190  -5.420  1.00 15.41  ? 77  ILE A CD1 1 
ATOM   661  N  N   . PRO A 1 78  ? 6.046   -5.114  -8.068  1.00 10.37  ? 78  PRO A N   1 
ATOM   662  C  CA  . PRO A 1 78  ? 7.204   -4.984  -8.974  1.00 12.66  ? 78  PRO A CA  1 
ATOM   663  C  C   . PRO A 1 78  ? 7.868   -3.608  -8.904  1.00 9.64   ? 78  PRO A C   1 
ATOM   664  O  O   . PRO A 1 78  ? 7.201   -2.599  -8.947  1.00 11.47  ? 78  PRO A O   1 
ATOM   665  C  CB  . PRO A 1 78  ? 6.617   -5.149  -10.387 1.00 16.69  ? 78  PRO A CB  1 
ATOM   666  C  CG  . PRO A 1 78  ? 5.290   -5.753  -10.183 1.00 20.96  ? 78  PRO A CG  1 
ATOM   667  C  CD  . PRO A 1 78  ? 4.814   -5.482  -8.787  1.00 15.02  ? 78  PRO A CD  1 
ATOM   668  N  N   . GLY A 1 79  ? 9.191   -3.637  -8.753  1.00 10.71  ? 79  GLY A N   1 
ATOM   669  C  CA  . GLY A 1 79  ? 9.954   -2.404  -8.765  1.00 10.47  ? 79  GLY A CA  1 
ATOM   670  C  C   . GLY A 1 79  ? 9.948   -1.681  -7.434  1.00 10.02  ? 79  GLY A C   1 
ATOM   671  O  O   . GLY A 1 79  ? 10.701  -0.723  -7.273  1.00 10.23  ? 79  GLY A O   1 
ATOM   672  N  N   . ALA A 1 80  ? 9.084   -2.098  -6.474  1.00 8.01   ? 80  ALA A N   1 
ATOM   673  C  CA  . ALA A 1 80  ? 8.905   -1.316  -5.252  1.00 8.20   ? 80  ALA A CA  1 
ATOM   674  C  C   . ALA A 1 80  ? 10.117  -1.286  -4.364  1.00 8.05   ? 80  ALA A C   1 
ATOM   675  O  O   . ALA A 1 80  ? 10.510  -0.283  -3.832  1.00 9.00   ? 80  ALA A O   1 
ATOM   676  C  CB  . ALA A 1 80  ? 7.733   -1.856  -4.483  1.00 8.27   ? 80  ALA A CB  1 
ATOM   677  N  N   . LEU A 1 81  ? 10.700  -2.467  -4.132  1.00 8.89   ? 81  LEU A N   1 
ATOM   678  C  CA  . LEU A 1 81  ? 11.801  -2.544  -3.181  1.00 10.60  ? 81  LEU A CA  1 
ATOM   679  C  C   . LEU A 1 81  ? 13.002  -1.827  -3.747  1.00 9.54   ? 81  LEU A C   1 
ATOM   680  O  O   . LEU A 1 81  ? 13.710  -1.134  -2.993  1.00 10.65  ? 81  LEU A O   1 
ATOM   681  C  CB  . LEU A 1 81  ? 12.125  -3.995  -2.867  1.00 11.59  ? 81  LEU A CB  1 
ATOM   682  C  CG  . LEU A 1 81  ? 10.955  -4.790  -2.278  1.00 13.73  ? 81  LEU A CG  1 
ATOM   683  C  CD1 . LEU A 1 81  ? 11.401  -6.216  -1.987  1.00 19.57  ? 81  LEU A CD1 1 
ATOM   684  C  CD2 . LEU A 1 81  ? 10.384  -4.131  -1.052  1.00 18.42  ? 81  LEU A CD2 1 
ATOM   685  N  N   . ASP A 1 82  ? 13.303  -1.961  -5.016  1.00 10.22  ? 82  ASP A N   1 
ATOM   686  C  CA  . ASP A 1 82  ? 14.410  -1.189  -5.605  1.00 11.58  ? 82  ASP A CA  1 
ATOM   687  C  C   . ASP A 1 82  ? 14.130  0.295   -5.521  1.00 10.30  ? 82  ASP A C   1 
ATOM   688  O  O   . ASP A 1 82  ? 15.055  1.063   -5.231  1.00 11.18  ? 82  ASP A O   1 
ATOM   689  C  CB  . ASP A 1 82  ? 14.625  -1.638  -7.035  1.00 15.00  ? 82  ASP A CB  1 
ATOM   690  C  CG  . ASP A 1 82  ? 15.314  -3.012  -7.136  1.00 22.95  ? 82  ASP A CG  1 
ATOM   691  O  OD1 . ASP A 1 82  ? 15.910  -3.516  -6.163  1.00 30.74  ? 82  ASP A OD1 1 
ATOM   692  O  OD2 . ASP A 1 82  ? 15.240  -3.579  -8.253  1.00 41.99  ? 82  ASP A OD2 1 
ATOM   693  N  N   . ALA A 1 83  ? 12.907  0.695   -5.792  1.00 10.13  ? 83  ALA A N   1 
ATOM   694  C  CA  . ALA A 1 83  ? 12.650  2.110   -5.758  1.00 10.23  ? 83  ALA A CA  1 
ATOM   695  C  C   . ALA A 1 83  ? 12.827  2.703   -4.356  1.00 9.39   ? 83  ALA A C   1 
ATOM   696  O  O   . ALA A 1 83  ? 13.377  3.782   -4.174  1.00 9.57   ? 83  ALA A O   1 
ATOM   697  C  CB  . ALA A 1 83  ? 11.260  2.425   -6.237  1.00 11.98  ? 83  ALA A CB  1 
ATOM   698  N  N   . VAL A 1 84  ? 12.313  1.988   -3.330  1.00 9.04   ? 84  VAL A N   1 
ATOM   699  C  CA  . VAL A 1 84  ? 12.446  2.545   -2.007  1.00 10.62  ? 84  VAL A CA  1 
ATOM   700  C  C   . VAL A 1 84  ? 13.910  2.548   -1.530  1.00 9.91   ? 84  VAL A C   1 
ATOM   701  O  O   . VAL A 1 84  ? 14.286  3.478   -0.829  1.00 10.97  ? 84  VAL A O   1 
ATOM   702  C  CB  . VAL A 1 84  ? 11.518  1.888   -0.955  1.00 14.54  ? 84  VAL A CB  1 
ATOM   703  C  CG1 . VAL A 1 84  ? 10.069  2.226   -1.332  1.00 37.76  ? 84  VAL A CG1 1 
ATOM   704  C  CG2 . VAL A 1 84  ? 11.742  0.442   -0.700  1.00 16.92  ? 84  VAL A CG2 1 
ATOM   705  N  N   . ARG A 1 85  ? 14.695  1.541   -1.917  1.00 9.79   ? 85  ARG A N   1 
ATOM   706  C  CA  A ARG A 1 85  ? 16.113  1.556   -1.632  0.69 11.25  ? 85  ARG A CA  1 
ATOM   707  C  CA  B ARG A 1 85  ? 16.078  1.667   -1.430  0.31 9.60   ? 85  ARG A CA  1 
ATOM   708  C  C   . ARG A 1 85  ? 16.811  2.747   -2.251  1.00 10.92  ? 85  ARG A C   1 
ATOM   709  O  O   . ARG A 1 85  ? 17.625  3.430   -1.653  1.00 12.61  ? 85  ARG A O   1 
ATOM   710  C  CB  A ARG A 1 85  ? 16.845  0.311   -2.225  0.69 11.02  ? 85  ARG A CB  1 
ATOM   711  C  CB  B ARG A 1 85  ? 16.791  0.333   -1.460  0.31 14.16  ? 85  ARG A CB  1 
ATOM   712  C  CG  A ARG A 1 85  ? 16.515  -0.957  -1.440  0.69 16.09  ? 85  ARG A CG  1 
ATOM   713  C  CG  B ARG A 1 85  ? 16.544  -0.781  -0.485  0.31 25.02  ? 85  ARG A CG  1 
ATOM   714  C  CD  A ARG A 1 85  ? 17.243  -2.156  -2.063  0.69 17.44  ? 85  ARG A CD  1 
ATOM   715  C  CD  B ARG A 1 85  ? 17.300  -2.041  -0.940  0.31 26.10  ? 85  ARG A CD  1 
ATOM   716  N  NE  A ARG A 1 85  ? 18.648  -2.022  -2.040  0.69 14.99  ? 85  ARG A NE  1 
ATOM   717  N  NE  B ARG A 1 85  ? 16.453  -2.905  -1.741  0.31 26.56  ? 85  ARG A NE  1 
ATOM   718  C  CZ  A ARG A 1 85  ? 19.835  -2.235  -2.546  0.69 16.05  ? 85  ARG A CZ  1 
ATOM   719  C  CZ  B ARG A 1 85  ? 16.329  -3.099  -3.036  0.31 22.25  ? 85  ARG A CZ  1 
ATOM   720  N  NH1 A ARG A 1 85  ? 20.929  -1.734  -1.978  0.69 17.57  ? 85  ARG A NH1 1 
ATOM   721  N  NH1 B ARG A 1 85  ? 15.442  -3.988  -3.481  0.31 22.44  ? 85  ARG A NH1 1 
ATOM   722  N  NH2 A ARG A 1 85  ? 19.959  -2.958  -3.632  0.69 17.94  ? 85  ARG A NH2 1 
ATOM   723  N  NH2 B ARG A 1 85  ? 17.045  -2.445  -3.949  0.31 33.62  ? 85  ARG A NH2 1 
ATOM   724  N  N   . GLU A 1 86  ? 16.515  2.903   -3.548  1.00 10.19  ? 86  GLU A N   1 
ATOM   725  C  CA  . GLU A 1 86  ? 17.090  4.061   -4.307  1.00 10.21  ? 86  GLU A CA  1 
ATOM   726  C  C   . GLU A 1 86  ? 16.672  5.367   -3.652  1.00 10.53  ? 86  GLU A C   1 
ATOM   727  O  O   . GLU A 1 86  ? 17.472  6.311   -3.482  1.00 12.81  ? 86  GLU A O   1 
ATOM   728  C  CB  . GLU A 1 86  ? 16.646  4.016   -5.767  1.00 11.26  ? 86  GLU A CB  1 
ATOM   729  C  CG  . GLU A 1 86  ? 17.200  2.858   -6.568  1.00 13.03  ? 86  GLU A CG  1 
ATOM   730  C  CD  . GLU A 1 86  ? 16.466  2.519   -7.843  1.00 15.17  ? 86  GLU A CD  1 
ATOM   731  O  OE1 . GLU A 1 86  ? 15.624  3.293   -8.305  1.00 16.25  ? 86  GLU A OE1 1 
ATOM   732  O  OE2 . GLU A 1 86  ? 16.767  1.392   -8.393  1.00 19.65  ? 86  GLU A OE2 1 
ATOM   733  N  N   . MET A 1 87  ? 15.417  5.517   -3.288  1.00 9.75   ? 87  MET A N   1 
ATOM   734  C  CA  . MET A 1 87  ? 14.867  6.737   -2.733  1.00 9.27   ? 87  MET A CA  1 
ATOM   735  C  C   . MET A 1 87  ? 15.526  7.076   -1.425  1.00 9.25   ? 87  MET A C   1 
ATOM   736  O  O   . MET A 1 87  ? 15.944  8.209   -1.169  1.00 10.65  ? 87  MET A O   1 
ATOM   737  C  CB  . MET A 1 87  ? 13.360  6.534   -2.579  1.00 8.89   ? 87  MET A CB  1 
ATOM   738  C  CG  . MET A 1 87  ? 12.625  7.743   -2.130  1.00 9.40   ? 87  MET A CG  1 
ATOM   739  S  SD  . MET A 1 87  ? 10.890  7.512   -1.746  1.00 10.05  ? 87  MET A SD  1 
ATOM   740  C  CE  . MET A 1 87  ? 10.233  7.003   -3.316  1.00 11.62  ? 87  MET A CE  1 
ATOM   741  N  N   . ASN A 1 88  ? 15.681  6.056   -0.584  1.00 11.51  ? 88  ASN A N   1 
ATOM   742  C  CA  . ASN A 1 88  ? 16.322  6.204   0.697   1.00 13.07  ? 88  ASN A CA  1 
ATOM   743  C  C   . ASN A 1 88  ? 17.758  6.667   0.579   1.00 14.39  ? 88  ASN A C   1 
ATOM   744  O  O   . ASN A 1 88  ? 18.247  7.317   1.501   1.00 17.03  ? 88  ASN A O   1 
ATOM   745  C  CB  . ASN A 1 88  ? 16.253  4.858   1.444   1.00 19.09  ? 88  ASN A CB  1 
ATOM   746  C  CG  . ASN A 1 88  ? 16.779  4.896   2.871   1.00 26.66  ? 88  ASN A CG  1 
ATOM   747  O  OD1 . ASN A 1 88  ? 16.310  5.677   3.685   1.00 32.07  ? 88  ASN A OD1 1 
ATOM   748  N  ND2 . ASN A 1 88  ? 17.722  3.994   3.175   1.00 34.14  ? 88  ASN A ND2 1 
ATOM   749  N  N   . ASP A 1 89  ? 18.452  6.301   -0.475  1.00 14.99  ? 89  ASP A N   1 
ATOM   750  C  CA  . ASP A 1 89  ? 19.833  6.633   -0.691  1.00 17.90  ? 89  ASP A CA  1 
ATOM   751  C  C   . ASP A 1 89  ? 20.001  7.988   -1.364  1.00 17.62  ? 89  ASP A C   1 
ATOM   752  O  O   . ASP A 1 89  ? 21.161  8.423   -1.470  1.00 22.58  ? 89  ASP A O   1 
ATOM   753  C  CB  . ASP A 1 89  ? 20.562  5.527   -1.472  1.00 23.94  ? 89  ASP A CB  1 
ATOM   754  C  CG  . ASP A 1 89  ? 21.021  4.388   -0.574  1.00 27.88  ? 89  ASP A CG  1 
ATOM   755  O  OD1 . ASP A 1 89  ? 20.672  4.390   0.623   1.00 39.92  ? 89  ASP A OD1 1 
ATOM   756  O  OD2 . ASP A 1 89  ? 21.729  3.445   -0.991  1.00 63.51  ? 89  ASP A OD2 1 
ATOM   757  N  N   . LEU A 1 90  ? 18.958  8.669   -1.798  1.00 13.32  ? 90  LEU A N   1 
ATOM   758  C  CA  . LEU A 1 90  ? 19.103  10.018  -2.391  1.00 13.69  ? 90  LEU A CA  1 
ATOM   759  C  C   . LEU A 1 90  ? 19.518  11.049  -1.368  1.00 13.68  ? 90  LEU A C   1 
ATOM   760  O  O   . LEU A 1 90  ? 19.026  11.053  -0.224  1.00 14.75  ? 90  LEU A O   1 
ATOM   761  C  CB  . LEU A 1 90  ? 17.787  10.522  -3.030  1.00 12.19  ? 90  LEU A CB  1 
ATOM   762  C  CG  . LEU A 1 90  ? 17.311  9.733   -4.240  1.00 14.56  ? 90  LEU A CG  1 
ATOM   763  C  CD1 . LEU A 1 90  ? 15.919  10.159  -4.652  1.00 14.44  ? 90  LEU A CD1 1 
ATOM   764  C  CD2 . LEU A 1 90  ? 18.255  9.870   -5.436  1.00 18.75  ? 90  LEU A CD2 1 
ATOM   765  N  N   . PRO A 1 91  ? 20.368  11.998  -1.767  1.00 15.92  ? 91  PRO A N   1 
ATOM   766  C  CA  . PRO A 1 91  ? 20.664  13.085  -0.835  1.00 16.96  ? 91  PRO A CA  1 
ATOM   767  C  C   . PRO A 1 91  ? 19.406  13.836  -0.471  1.00 14.65  ? 91  PRO A C   1 
ATOM   768  O  O   . PRO A 1 91  ? 18.449  13.970  -1.227  1.00 13.73  ? 91  PRO A O   1 
ATOM   769  C  CB  . PRO A 1 91  ? 21.599  13.988  -1.637  1.00 21.28  ? 91  PRO A CB  1 
ATOM   770  C  CG  . PRO A 1 91  ? 22.140  13.183  -2.773  1.00 22.71  ? 91  PRO A CG  1 
ATOM   771  C  CD  . PRO A 1 91  ? 21.128  12.065  -2.997  1.00 17.76  ? 91  PRO A CD  1 
ATOM   772  N  N   . ASP A 1 92  ? 19.400  14.358  0.753   1.00 13.57  ? 92  ASP A N   1 
ATOM   773  C  CA  . ASP A 1 92  ? 18.317  15.237  1.207   1.00 13.53  ? 92  ASP A CA  1 
ATOM   774  C  C   . ASP A 1 92  ? 16.916  14.669  1.001   1.00 11.59  ? 92  ASP A C   1 
ATOM   775  O  O   . ASP A 1 92  ? 15.956  15.341  0.619   1.00 12.83  ? 92  ASP A O   1 
ATOM   776  C  CB  . ASP A 1 92  ? 18.472  16.621  0.543   1.00 17.56  ? 92  ASP A CB  1 
ATOM   777  C  CG  . ASP A 1 92  ? 19.826  17.264  0.735   1.00 20.08  ? 92  ASP A CG  1 
ATOM   778  O  OD1 . ASP A 1 92  ? 20.355  17.201  1.857   1.00 26.90  ? 92  ASP A OD1 1 
ATOM   779  O  OD2 . ASP A 1 92  ? 20.350  17.807  -0.260  1.00 32.11  ? 92  ASP A OD2 1 
ATOM   780  N  N   . THR A 1 93  ? 16.800  13.391  1.333   1.00 12.03  ? 93  THR A N   1 
ATOM   781  C  CA  . THR A 1 93  ? 15.560  12.612  1.229   1.00 10.28  ? 93  THR A CA  1 
ATOM   782  C  C   . THR A 1 93  ? 15.468  11.696  2.419   1.00 11.82  ? 93  THR A C   1 
ATOM   783  O  O   . THR A 1 93  ? 16.448  11.083  2.820   1.00 16.23  ? 93  THR A O   1 
ATOM   784  C  CB  . THR A 1 93  ? 15.601  11.796  -0.079  1.00 10.82  ? 93  THR A CB  1 
ATOM   785  O  OG1 . THR A 1 93  ? 15.931  12.648  -1.191  1.00 11.55  ? 93  THR A OG1 1 
ATOM   786  C  CG2 . THR A 1 93  ? 14.266  11.175  -0.369  1.00 10.79  ? 93  THR A CG2 1 
ATOM   787  N  N   . GLN A 1 94  ? 14.265  11.625  2.980   1.00 11.98  ? 94  GLN A N   1 
ATOM   788  C  CA  A GLN A 1 94  ? 13.862  10.901  4.195   0.40 8.64   ? 94  GLN A CA  1 
ATOM   789  C  CA  B GLN A 1 94  ? 14.073  10.607  4.035   0.60 12.88  ? 94  GLN A CA  1 
ATOM   790  C  C   . GLN A 1 94  ? 12.737  9.925   3.761   1.00 9.79   ? 94  GLN A C   1 
ATOM   791  O  O   . GLN A 1 94  ? 11.800  10.471  3.245   1.00 12.09  ? 94  GLN A O   1 
ATOM   792  C  CB  A GLN A 1 94  ? 13.457  11.837  5.350   0.40 6.92   ? 94  GLN A CB  1 
ATOM   793  C  CB  B GLN A 1 94  ? 14.035  11.214  5.417   0.60 20.96  ? 94  GLN A CB  1 
ATOM   794  C  CG  A GLN A 1 94  ? 14.540  12.770  5.873   0.40 9.08   ? 94  GLN A CG  1 
ATOM   795  C  CG  B GLN A 1 94  ? 15.248  12.007  5.875   0.60 16.44  ? 94  GLN A CG  1 
ATOM   796  C  CD  A GLN A 1 94  ? 14.064  13.839  6.832   0.40 13.88  ? 94  GLN A CD  1 
ATOM   797  C  CD  B GLN A 1 94  ? 16.390  11.093  6.279   0.60 21.53  ? 94  GLN A CD  1 
ATOM   798  O  OE1 A GLN A 1 94  ? 12.876  13.874  7.202   0.40 24.76  ? 94  GLN A OE1 1 
ATOM   799  O  OE1 B GLN A 1 94  ? 16.268  9.876   6.289   0.60 25.44  ? 94  GLN A OE1 1 
ATOM   800  N  NE2 A GLN A 1 94  ? 14.929  14.681  7.383   0.40 24.37  ? 94  GLN A NE2 1 
ATOM   801  N  NE2 B GLN A 1 94  ? 17.523  11.706  6.602   0.60 32.62  ? 94  GLN A NE2 1 
ATOM   802  N  N   . VAL A 1 95  ? 12.752  8.652   4.046   1.00 10.12  ? 95  VAL A N   1 
ATOM   803  C  CA  . VAL A 1 95  ? 11.661  7.732   3.751   1.00 9.02   ? 95  VAL A CA  1 
ATOM   804  C  C   . VAL A 1 95  ? 11.150  7.110   5.052   1.00 7.76   ? 95  VAL A C   1 
ATOM   805  O  O   . VAL A 1 95  ? 11.944  6.633   5.862   1.00 9.20   ? 95  VAL A O   1 
ATOM   806  C  CB  . VAL A 1 95  ? 12.151  6.633   2.817   1.00 11.65  ? 95  VAL A CB  1 
ATOM   807  C  CG1 . VAL A 1 95  ? 11.105  5.585   2.488   1.00 15.18  ? 95  VAL A CG1 1 
ATOM   808  C  CG2 . VAL A 1 95  ? 12.678  7.244   1.514   1.00 15.89  ? 95  VAL A CG2 1 
ATOM   809  N  N   . PHE A 1 96  ? 9.843   7.094   5.203   1.00 7.05   ? 96  PHE A N   1 
ATOM   810  C  CA  . PHE A 1 96  ? 9.180   6.284   6.220   1.00 7.06   ? 96  PHE A CA  1 
ATOM   811  C  C   . PHE A 1 96  ? 8.155   5.398   5.522   1.00 6.79   ? 96  PHE A C   1 
ATOM   812  O  O   . PHE A 1 96  ? 7.536   5.772   4.515   1.00 9.60   ? 96  PHE A O   1 
ATOM   813  C  CB  . PHE A 1 96  ? 8.458   7.104   7.284   1.00 8.08   ? 96  PHE A CB  1 
ATOM   814  C  CG  . PHE A 1 96  ? 9.364   7.845   8.207   1.00 8.49   ? 96  PHE A CG  1 
ATOM   815  C  CD1 . PHE A 1 96  ? 9.833   9.116   7.896   1.00 11.69  ? 96  PHE A CD1 1 
ATOM   816  C  CD2 . PHE A 1 96  ? 9.786   7.295   9.401   1.00 9.41   ? 96  PHE A CD2 1 
ATOM   817  C  CE1 . PHE A 1 96  ? 10.654  9.800   8.769   1.00 13.49  ? 96  PHE A CE1 1 
ATOM   818  C  CE2 . PHE A 1 96  ? 10.592  7.954   10.290  1.00 10.34  ? 96  PHE A CE2 1 
ATOM   819  C  CZ  . PHE A 1 96  ? 11.047  9.209   9.959   1.00 12.92  ? 96  PHE A CZ  1 
ATOM   820  N  N   . ILE A 1 97  ? 7.971   4.199   6.053   1.00 6.90   ? 97  ILE A N   1 
ATOM   821  C  CA  . ILE A 1 97  ? 6.920   3.285   5.581   1.00 6.95   ? 97  ILE A CA  1 
ATOM   822  C  C   . ILE A 1 97  ? 5.726   3.494   6.486   1.00 6.60   ? 97  ILE A C   1 
ATOM   823  O  O   . ILE A 1 97  ? 5.799   3.145   7.681   1.00 9.16   ? 97  ILE A O   1 
ATOM   824  C  CB  . ILE A 1 97  ? 7.405   1.830   5.627   1.00 7.09   ? 97  ILE A CB  1 
ATOM   825  C  CG1 . ILE A 1 97  ? 8.612   1.631   4.678   1.00 8.11   ? 97  ILE A CG1 1 
ATOM   826  C  CG2 . ILE A 1 97  ? 6.249   0.909   5.295   1.00 8.85   ? 97  ILE A CG2 1 
ATOM   827  C  CD1 . ILE A 1 97  ? 9.271   0.285   4.827   1.00 10.95  ? 97  ILE A CD1 1 
ATOM   828  N  N   . CYS A 1 98  ? 4.650   4.077   5.982   1.00 7.37   ? 98  CYS A N   1 
ATOM   829  C  CA  . CYS A 1 98  ? 3.511   4.538   6.787   1.00 7.69   ? 98  CYS A CA  1 
ATOM   830  C  C   . CYS A 1 98  ? 2.290   3.675   6.438   1.00 7.77   ? 98  CYS A C   1 
ATOM   831  O  O   . CYS A 1 98  ? 1.783   3.762   5.302   1.00 8.16   ? 98  CYS A O   1 
ATOM   832  C  CB  . CYS A 1 98  ? 3.271   6.011   6.558   1.00 9.47   ? 98  CYS A CB  1 
ATOM   833  S  SG  . CYS A 1 98  ? 1.971   6.703   7.619   1.00 10.03  ? 98  CYS A SG  1 
ATOM   834  N  N   . THR A 1 99  ? 1.932   2.811   7.367   1.00 7.85   ? 99  THR A N   1 
ATOM   835  C  CA  . THR A 1 99  ? 0.982   1.679   7.100   1.00 7.24   ? 99  THR A CA  1 
ATOM   836  C  C   . THR A 1 99  ? -0.008  1.596   8.218   1.00 7.38   ? 99  THR A C   1 
ATOM   837  O  O   . THR A 1 99  ? 0.310   1.835   9.384   1.00 7.99   ? 99  THR A O   1 
ATOM   838  C  CB  . THR A 1 99  ? 1.807   0.397   6.892   1.00 8.14   ? 99  THR A CB  1 
ATOM   839  O  OG1 . THR A 1 99  ? 0.953   -0.713  6.645   1.00 8.87   ? 99  THR A OG1 1 
ATOM   840  C  CG2 . THR A 1 99  ? 2.733   0.044   8.023   1.00 11.00  ? 99  THR A CG2 1 
ATOM   841  N  N   . SER A 1 100 ? -1.248  1.251   7.857   1.00 7.78   ? 100 SER A N   1 
ATOM   842  C  CA  . SER A 1 100 ? -2.282  1.042   8.826   1.00 8.59   ? 100 SER A CA  1 
ATOM   843  C  C   . SER A 1 100 ? -2.486  -0.447  9.133   1.00 9.33   ? 100 SER A C   1 
ATOM   844  O  O   . SER A 1 100 ? -2.657  -1.216  8.168   1.00 13.22  ? 100 SER A O   1 
ATOM   845  C  CB  . SER A 1 100 ? -3.630  1.592   8.294   1.00 9.38   ? 100 SER A CB  1 
ATOM   846  O  OG  . SER A 1 100 ? -3.525  3.018   8.143   1.00 9.67   ? 100 SER A OG  1 
ATOM   847  N  N   . PRO A 1 101 ? -2.575  -0.813  10.392  1.00 8.43   ? 101 PRO A N   1 
ATOM   848  C  CA  . PRO A 1 101 ? -2.974  -2.217  10.693  1.00 9.41   ? 101 PRO A CA  1 
ATOM   849  C  C   . PRO A 1 101 ? -4.444  -2.398  10.452  1.00 9.65   ? 101 PRO A C   1 
ATOM   850  O  O   . PRO A 1 101 ? -5.194  -1.461  10.594  1.00 11.24  ? 101 PRO A O   1 
ATOM   851  C  CB  . PRO A 1 101 ? -2.610  -2.328  12.167  1.00 13.32  ? 101 PRO A CB  1 
ATOM   852  C  CG  . PRO A 1 101 ? -2.633  -0.972  12.702  1.00 16.55  ? 101 PRO A CG  1 
ATOM   853  C  CD  . PRO A 1 101 ? -2.393  0.010   11.605  1.00 9.88   ? 101 PRO A CD  1 
ATOM   854  N  N   . LEU A 1 102 ? -4.840  -3.646  10.160  1.00 9.37   ? 102 LEU A N   1 
ATOM   855  C  CA  . LEU A 1 102 ? -6.232  -3.984  10.249  1.00 9.93   ? 102 LEU A CA  1 
ATOM   856  C  C   . LEU A 1 102 ? -6.793  -3.773  11.633  1.00 10.04  ? 102 LEU A C   1 
ATOM   857  O  O   . LEU A 1 102 ? -6.119  -3.741  12.639  1.00 11.16  ? 102 LEU A O   1 
ATOM   858  C  CB  . LEU A 1 102 ? -6.423  -5.474  9.926   1.00 11.85  ? 102 LEU A CB  1 
ATOM   859  C  CG  . LEU A 1 102 ? -5.960  -5.978  8.572   1.00 12.12  ? 102 LEU A CG  1 
ATOM   860  C  CD1 . LEU A 1 102 ? -6.121  -7.498  8.522   1.00 18.43  ? 102 LEU A CD1 1 
ATOM   861  C  CD2 . LEU A 1 102 ? -6.679  -5.322  7.429   1.00 21.11  ? 102 LEU A CD2 1 
ATOM   862  N  N   . LEU A 1 103 ? -8.127  -3.576  11.691  1.00 10.82  ? 103 LEU A N   1 
ATOM   863  C  CA  . LEU A 1 103 ? -8.809  -3.603  12.966  1.00 11.40  ? 103 LEU A CA  1 
ATOM   864  C  C   . LEU A 1 103 ? -8.605  -4.909  13.715  1.00 11.69  ? 103 LEU A C   1 
ATOM   865  O  O   . LEU A 1 103 ? -8.401  -4.915  14.929  1.00 13.60  ? 103 LEU A O   1 
ATOM   866  C  CB  . LEU A 1 103 ? -10.285 -3.255  12.764  1.00 14.41  ? 103 LEU A CB  1 
ATOM   867  C  CG  . LEU A 1 103 ? -10.608 -1.797  12.390  1.00 15.47  ? 103 LEU A CG  1 
ATOM   868  C  CD1 . LEU A 1 103 ? -12.129 -1.600  12.405  1.00 25.02  ? 103 LEU A CD1 1 
ATOM   869  C  CD2 . LEU A 1 103 ? -9.955  -0.779  13.341  1.00 17.72  ? 103 LEU A CD2 1 
ATOM   870  N  N   . LYS A 1 104 ? -8.651  -6.003  12.994  1.00 12.36  ? 104 LYS A N   1 
ATOM   871  C  CA  . LYS A 1 104 ? -8.239  -7.274  13.557  1.00 12.05  ? 104 LYS A CA  1 
ATOM   872  C  C   . LYS A 1 104 ? -6.725  -7.379  13.417  1.00 12.55  ? 104 LYS A C   1 
ATOM   873  O  O   . LYS A 1 104 ? -6.185  -7.889  12.413  1.00 14.12  ? 104 LYS A O   1 
ATOM   874  C  CB  . LYS A 1 104 ? -8.950  -8.423  12.839  1.00 17.59  ? 104 LYS A CB  1 
ATOM   875  C  CG  . LYS A 1 104 ? -10.450 -8.467  12.876  1.00 25.46  ? 104 LYS A CG  1 
ATOM   876  C  CD  . LYS A 1 104 ? -10.984 -9.452  13.879  1.00 36.93  ? 104 LYS A CD  1 
ATOM   877  C  CE  . LYS A 1 104 ? -12.486 -9.586  13.807  1.00 40.21  ? 104 LYS A CE  1 
ATOM   878  N  NZ  . LYS A 1 104 ? -13.143 -9.454  15.147  1.00 50.06  ? 104 LYS A NZ  1 
ATOM   879  N  N   . TYR A 1 105 ? -6.016  -6.804  14.372  1.00 12.88  ? 105 TYR A N   1 
ATOM   880  C  CA  . TYR A 1 105 ? -4.569  -6.504  14.296  1.00 12.86  ? 105 TYR A CA  1 
ATOM   881  C  C   . TYR A 1 105 ? -3.691  -7.734  14.538  1.00 12.01  ? 105 TYR A C   1 
ATOM   882  O  O   . TYR A 1 105 ? -2.483  -7.639  14.279  1.00 12.50  ? 105 TYR A O   1 
ATOM   883  C  CB  . TYR A 1 105 ? -4.244  -5.314  15.267  1.00 14.11  ? 105 TYR A CB  1 
ATOM   884  C  CG  . TYR A 1 105 ? -4.448  -5.727  16.689  1.00 12.42  ? 105 TYR A CG  1 
ATOM   885  C  CD1 . TYR A 1 105 ? -3.516  -6.443  17.457  1.00 13.30  ? 105 TYR A CD1 1 
ATOM   886  C  CD2 . TYR A 1 105 ? -5.644  -5.460  17.311  1.00 12.78  ? 105 TYR A CD2 1 
ATOM   887  C  CE1 . TYR A 1 105 ? -3.708  -6.884  18.710  1.00 17.17  ? 105 TYR A CE1 1 
ATOM   888  C  CE2 . TYR A 1 105 ? -5.852  -5.854  18.611  1.00 13.17  ? 105 TYR A CE2 1 
ATOM   889  C  CZ  . TYR A 1 105 ? -4.926  -6.572  19.305  1.00 12.75  ? 105 TYR A CZ  1 
ATOM   890  O  OH  . TYR A 1 105 ? -5.086  -7.008  20.589  1.00 16.35  ? 105 TYR A OH  1 
ATOM   891  N  N   . HIS A 1 106 ? -4.237  -8.766  15.196  1.00 11.17  ? 106 HIS A N   1 
ATOM   892  C  CA  . HIS A 1 106 ? -3.404  -9.793  15.809  1.00 12.49  ? 106 HIS A CA  1 
ATOM   893  C  C   . HIS A 1 106 ? -2.314  -10.411 14.935  1.00 12.89  ? 106 HIS A C   1 
ATOM   894  O  O   . HIS A 1 106 ? -1.205  -10.506 15.412  1.00 20.57  ? 106 HIS A O   1 
ATOM   895  C  CB  . HIS A 1 106 ? -4.322  -10.905 16.346  1.00 18.30  ? 106 HIS A CB  1 
ATOM   896  C  CG  . HIS A 1 106 ? -3.748  -12.023 17.098  1.00 32.30  ? 106 HIS A CG  1 
ATOM   897  N  ND1 . HIS A 1 106 ? -2.457  -12.165 17.560  1.00 42.01  ? 106 HIS A ND1 1 
ATOM   898  C  CD2 . HIS A 1 106 ? -4.403  -13.146 17.505  1.00 38.70  ? 106 HIS A CD2 1 
ATOM   899  C  CE1 . HIS A 1 106 ? -2.326  -13.312 18.200  1.00 42.32  ? 106 HIS A CE1 1 
ATOM   900  N  NE2 . HIS A 1 106 ? -3.495  -13.922 18.183  1.00 39.75  ? 106 HIS A NE2 1 
ATOM   901  N  N   . HIS A 1 107 ? -2.629  -10.774 13.689  1.00 12.74  ? 107 HIS A N   1 
ATOM   902  C  CA  . HIS A 1 107 ? -1.625  -11.391 12.799  1.00 15.73  ? 107 HIS A CA  1 
ATOM   903  C  C   . HIS A 1 107 ? -1.167  -10.425 11.732  1.00 13.11  ? 107 HIS A C   1 
ATOM   904  O  O   . HIS A 1 107 ? -0.598  -10.833 10.711  1.00 14.08  ? 107 HIS A O   1 
ATOM   905  C  CB  . HIS A 1 107 ? -2.219  -12.590 12.081  1.00 15.07  ? 107 HIS A CB  1 
ATOM   906  C  CG  . HIS A 1 107 ? -2.683  -13.618 13.055  1.00 15.54  ? 107 HIS A CG  1 
ATOM   907  N  ND1 . HIS A 1 107 ? -1.770  -14.216 13.913  1.00 19.79  ? 107 HIS A ND1 1 
ATOM   908  C  CD2 . HIS A 1 107 ? -3.894  -14.156 13.319  1.00 21.35  ? 107 HIS A CD2 1 
ATOM   909  C  CE1 . HIS A 1 107 ? -2.389  -15.097 14.673  1.00 27.38  ? 107 HIS A CE1 1 
ATOM   910  N  NE2 . HIS A 1 107 ? -3.665  -15.061 14.331  1.00 25.89  ? 107 HIS A NE2 1 
ATOM   911  N  N   . CYS A 1 108 ? -1.394  -9.167  11.935  1.00 9.68   ? 108 CYS A N   1 
ATOM   912  C  CA  . CYS A 1 108 ? -1.017  -8.126  10.987  1.00 9.57   ? 108 CYS A CA  1 
ATOM   913  C  C   . CYS A 1 108 ? 0.198   -7.351  11.483  1.00 9.71   ? 108 CYS A C   1 
ATOM   914  O  O   . CYS A 1 108 ? 1.164   -7.190  10.731  1.00 10.26  ? 108 CYS A O   1 
ATOM   915  C  CB  . CYS A 1 108 ? -2.256  -7.227  10.804  1.00 11.17  ? 108 CYS A CB  1 
ATOM   916  S  SG  . CYS A 1 108 ? -1.955  -5.736  9.836   1.00 11.71  ? 108 CYS A SG  1 
ATOM   917  N  N   . VAL A 1 109 ? 0.216   -6.858  12.724  1.00 9.82   ? 109 VAL A N   1 
ATOM   918  C  CA  . VAL A 1 109 ? 1.218   -5.892  13.168  1.00 9.99   ? 109 VAL A CA  1 
ATOM   919  C  C   . VAL A 1 109 ? 2.603   -6.509  13.177  1.00 9.10   ? 109 VAL A C   1 
ATOM   920  O  O   . VAL A 1 109 ? 3.535   -5.975  12.556  1.00 9.42   ? 109 VAL A O   1 
ATOM   921  C  CB  . VAL A 1 109 ? 0.769   -5.344  14.529  1.00 14.19  ? 109 VAL A CB  1 
ATOM   922  C  CG1 . VAL A 1 109 ? 1.899   -4.753  15.306  1.00 17.65  ? 109 VAL A CG1 1 
ATOM   923  C  CG2 . VAL A 1 109 ? -0.426  -4.392  14.236  1.00 17.92  ? 109 VAL A CG2 1 
ATOM   924  N  N   . GLY A 1 110 ? 2.799   -7.621  13.844  1.00 9.15   ? 110 GLY A N   1 
ATOM   925  C  CA  . GLY A 1 110 ? 4.101   -8.229  13.847  1.00 9.69   ? 110 GLY A CA  1 
ATOM   926  C  C   . GLY A 1 110 ? 4.551   -8.730  12.490  1.00 8.70   ? 110 GLY A C   1 
ATOM   927  O  O   . GLY A 1 110 ? 5.741   -8.686  12.153  1.00 8.85   ? 110 GLY A O   1 
ATOM   928  N  N   . GLU A 1 111 ? 3.614   -9.259  11.714  1.00 8.29   ? 111 GLU A N   1 
ATOM   929  C  CA  . GLU A 1 111 ? 3.987   -9.788  10.406  1.00 8.32   ? 111 GLU A CA  1 
ATOM   930  C  C   . GLU A 1 111 ? 4.450   -8.656  9.469   1.00 8.27   ? 111 GLU A C   1 
ATOM   931  O  O   . GLU A 1 111 ? 5.308   -8.885  8.624   1.00 8.23   ? 111 GLU A O   1 
ATOM   932  C  CB  . GLU A 1 111 ? 2.842   -10.572 9.780   1.00 8.76   ? 111 GLU A CB  1 
ATOM   933  C  CG  . GLU A 1 111 ? 2.579   -11.883 10.485  1.00 8.87   ? 111 GLU A CG  1 
ATOM   934  C  CD  . GLU A 1 111 ? 1.565   -12.775 9.839   1.00 10.08  ? 111 GLU A CD  1 
ATOM   935  O  OE1 . GLU A 1 111 ? 1.237   -12.590 8.645   1.00 10.33  ? 111 GLU A OE1 1 
ATOM   936  O  OE2 . GLU A 1 111 ? 1.057   -13.729 10.497  1.00 11.85  ? 111 GLU A OE2 1 
ATOM   937  N  N   . LYS A 1 112 ? 3.890   -7.468  9.586   1.00 7.28   ? 112 LYS A N   1 
ATOM   938  C  CA  . LYS A 1 112 ? 4.333   -6.326  8.764   1.00 7.61   ? 112 LYS A CA  1 
ATOM   939  C  C   . LYS A 1 112 ? 5.790   -5.993  9.086   1.00 7.35   ? 112 LYS A C   1 
ATOM   940  O  O   . LYS A 1 112 ? 6.563   -5.705  8.213   1.00 7.46   ? 112 LYS A O   1 
ATOM   941  C  CB  . LYS A 1 112 ? 3.395   -5.124  8.939   1.00 8.25   ? 112 LYS A CB  1 
ATOM   942  C  CG  . LYS A 1 112 ? 2.093   -5.229  8.170   1.00 8.26   ? 112 LYS A CG  1 
ATOM   943  C  CD  . LYS A 1 112 ? 1.210   -4.047  8.420   1.00 9.25   ? 112 LYS A CD  1 
ATOM   944  C  CE  . LYS A 1 112 ? 0.038   -3.858  7.500   1.00 9.67   ? 112 LYS A CE  1 
ATOM   945  N  NZ  . LYS A 1 112 ? 0.457   -3.487  6.152   1.00 9.35   ? 112 LYS A NZ  1 
ATOM   946  N  N   . TYR A 1 113 ? 6.132   -5.981  10.374  1.00 7.72   ? 113 TYR A N   1 
ATOM   947  C  CA  . TYR A 1 113 ? 7.496   -5.664  10.806  1.00 7.51   ? 113 TYR A CA  1 
ATOM   948  C  C   . TYR A 1 113 ? 8.441   -6.704  10.250  1.00 8.18   ? 113 TYR A C   1 
ATOM   949  O  O   . TYR A 1 113 ? 9.481   -6.405  9.683   1.00 8.53   ? 113 TYR A O   1 
ATOM   950  C  CB  . TYR A 1 113 ? 7.619   -5.541  12.338  1.00 7.81   ? 113 TYR A CB  1 
ATOM   951  C  CG  . TYR A 1 113 ? 7.257   -4.177  12.836  1.00 8.27   ? 113 TYR A CG  1 
ATOM   952  C  CD1 . TYR A 1 113 ? 5.970   -3.685  12.752  1.00 9.55   ? 113 TYR A CD1 1 
ATOM   953  C  CD2 . TYR A 1 113 ? 8.216   -3.319  13.329  1.00 9.18   ? 113 TYR A CD2 1 
ATOM   954  C  CE1 . TYR A 1 113 ? 5.614   -2.426  13.168  1.00 10.67  ? 113 TYR A CE1 1 
ATOM   955  C  CE2 . TYR A 1 113 ? 7.874   -2.031  13.728  1.00 9.33   ? 113 TYR A CE2 1 
ATOM   956  C  CZ  . TYR A 1 113 ? 6.583   -1.586  13.654  1.00 10.09  ? 113 TYR A CZ  1 
ATOM   957  O  OH  . TYR A 1 113 ? 6.214   -0.327  14.060  1.00 11.76  ? 113 TYR A OH  1 
ATOM   958  N  N   . ARG A 1 114 ? 8.084   -7.987  10.335  1.00 8.11   ? 114 ARG A N   1 
ATOM   959  C  CA  . ARG A 1 114 ? 8.910   -9.084  9.816   1.00 8.09   ? 114 ARG A CA  1 
ATOM   960  C  C   . ARG A 1 114 ? 9.017   -9.007  8.294   1.00 7.69   ? 114 ARG A C   1 
ATOM   961  O  O   . ARG A 1 114 ? 10.103  -9.272  7.738   1.00 7.92   ? 114 ARG A O   1 
ATOM   962  C  CB  . ARG A 1 114 ? 8.354   -10.436 10.259  1.00 9.57   ? 114 ARG A CB  1 
ATOM   963  C  CG  . ARG A 1 114 ? 9.229   -11.598 9.834   1.00 13.61  ? 114 ARG A CG  1 
ATOM   964  C  CD  . ARG A 1 114 ? 10.665  -11.590 10.298  1.00 18.49  ? 114 ARG A CD  1 
ATOM   965  N  NE  . ARG A 1 114 ? 11.286  -12.881 10.044  1.00 22.01  ? 114 ARG A NE  1 
ATOM   966  C  CZ  . ARG A 1 114 ? 12.565  -13.146 10.234  1.00 20.96  ? 114 ARG A CZ  1 
ATOM   967  N  NH1 . ARG A 1 114 ? 13.045  -14.340 9.992   1.00 26.73  ? 114 ARG A NH1 1 
ATOM   968  N  NH2 . ARG A 1 114 ? 13.307  -12.132 10.679  1.00 29.80  ? 114 ARG A NH2 1 
ATOM   969  N  N   . TRP A 1 115 ? 7.964   -8.651  7.593   1.00 7.34   ? 115 TRP A N   1 
ATOM   970  C  CA  . TRP A 1 115 ? 8.006   -8.532  6.155   1.00 7.46   ? 115 TRP A CA  1 
ATOM   971  C  C   . TRP A 1 115 ? 9.012   -7.481  5.742   1.00 7.21   ? 115 TRP A C   1 
ATOM   972  O  O   . TRP A 1 115 ? 9.814   -7.701  4.829   1.00 7.80   ? 115 TRP A O   1 
ATOM   973  C  CB  . TRP A 1 115 ? 6.621   -8.178  5.609   1.00 7.56   ? 115 TRP A CB  1 
ATOM   974  C  CG  . TRP A 1 115 ? 6.480   -8.242  4.117   1.00 8.03   ? 115 TRP A CG  1 
ATOM   975  C  CD1 . TRP A 1 115 ? 5.970   -9.310  3.426   1.00 7.91   ? 115 TRP A CD1 1 
ATOM   976  C  CD2 . TRP A 1 115 ? 6.827   -7.254  3.130   1.00 7.81   ? 115 TRP A CD2 1 
ATOM   977  N  NE1 . TRP A 1 115 ? 5.978   -9.045  2.073   1.00 8.30   ? 115 TRP A NE1 1 
ATOM   978  C  CE2 . TRP A 1 115 ? 6.500   -7.792  1.881   1.00 8.20   ? 115 TRP A CE2 1 
ATOM   979  C  CE3 . TRP A 1 115 ? 7.386   -5.972  3.157   1.00 7.59   ? 115 TRP A CE3 1 
ATOM   980  C  CZ2 . TRP A 1 115 ? 6.694   -7.120  0.673   1.00 9.17   ? 115 TRP A CZ2 1 
ATOM   981  C  CZ3 . TRP A 1 115 ? 7.572   -5.305  1.958   1.00 8.94   ? 115 TRP A CZ3 1 
ATOM   982  C  CH2 . TRP A 1 115 ? 7.231   -5.855  0.735   1.00 9.09   ? 115 TRP A CH2 1 
ATOM   983  N  N   . VAL A 1 116 ? 8.980   -6.320  6.414   1.00 7.39   ? 116 VAL A N   1 
ATOM   984  C  CA  . VAL A 1 116 ? 9.990   -5.293  6.115   1.00 7.08   ? 116 VAL A CA  1 
ATOM   985  C  C   . VAL A 1 116 ? 11.390  -5.779  6.424   1.00 7.48   ? 116 VAL A C   1 
ATOM   986  O  O   . VAL A 1 116 ? 12.330  -5.578  5.656   1.00 8.11   ? 116 VAL A O   1 
ATOM   987  C  CB  . VAL A 1 116 ? 9.611   -3.976  6.842   1.00 7.09   ? 116 VAL A CB  1 
ATOM   988  C  CG1 . VAL A 1 116 ? 10.724  -2.959  6.711   1.00 8.03   ? 116 VAL A CG1 1 
ATOM   989  C  CG2 . VAL A 1 116 ? 8.315   -3.407  6.299   1.00 8.49   ? 116 VAL A CG2 1 
ATOM   990  N  N   . GLU A 1 117 ? 11.553  -6.415  7.599   1.00 7.76   ? 117 GLU A N   1 
ATOM   991  C  CA  . GLU A 1 117 ? 12.882  -6.906  7.953   1.00 9.06   ? 117 GLU A CA  1 
ATOM   992  C  C   . GLU A 1 117 ? 13.438  -7.830  6.888   1.00 8.76   ? 117 GLU A C   1 
ATOM   993  O  O   . GLU A 1 117 ? 14.594  -7.741  6.465   1.00 10.38  ? 117 GLU A O   1 
ATOM   994  C  CB  . GLU A 1 117 ? 12.863  -7.657  9.294   1.00 9.85   ? 117 GLU A CB  1 
ATOM   995  C  CG  . GLU A 1 117 ? 14.271  -7.869  9.845   1.00 12.79  ? 117 GLU A CG  1 
ATOM   996  C  CD  . GLU A 1 117 ? 14.464  -8.760  11.039  1.00 17.88  ? 117 GLU A CD  1 
ATOM   997  O  OE1 . GLU A 1 117 ? 13.451  -9.227  11.574  1.00 20.46  ? 117 GLU A OE1 1 
ATOM   998  O  OE2 . GLU A 1 117 ? 15.667  -9.002  11.336  1.00 23.93  ? 117 GLU A OE2 1 
ATOM   999  N  N   . GLN A 1 118 ? 12.613  -8.778  6.436   1.00 8.50   ? 118 GLN A N   1 
ATOM   1000 C  CA  . GLN A 1 118 ? 13.072  -9.742  5.462   1.00 9.37   ? 118 GLN A CA  1 
ATOM   1001 C  C   . GLN A 1 118 ? 13.308  -9.143  4.086   1.00 8.59   ? 118 GLN A C   1 
ATOM   1002 O  O   . GLN A 1 118 ? 14.281  -9.471  3.400   1.00 9.69   ? 118 GLN A O   1 
ATOM   1003 C  CB  . GLN A 1 118 ? 12.051  -10.900 5.353   1.00 10.67  ? 118 GLN A CB  1 
ATOM   1004 C  CG  . GLN A 1 118 ? 12.034  -11.708 6.620   1.00 13.12  ? 118 GLN A CG  1 
ATOM   1005 C  CD  . GLN A 1 118 ? 11.328  -13.024 6.509   1.00 15.60  ? 118 GLN A CD  1 
ATOM   1006 O  OE1 . GLN A 1 118 ? 10.153  -13.081 6.163   1.00 18.99  ? 118 GLN A OE1 1 
ATOM   1007 N  NE2 . GLN A 1 118 ? 12.014  -14.111 6.807   1.00 24.85  ? 118 GLN A NE2 1 
ATOM   1008 N  N   . HIS A 1 119 ? 12.404  -8.275  3.626   1.00 8.01   ? 119 HIS A N   1 
ATOM   1009 C  CA  . HIS A 1 119 ? 12.517  -7.786  2.264   1.00 8.02   ? 119 HIS A CA  1 
ATOM   1010 C  C   . HIS A 1 119 ? 13.434  -6.580  2.101   1.00 8.67   ? 119 HIS A C   1 
ATOM   1011 O  O   . HIS A 1 119 ? 13.995  -6.417  1.028   1.00 9.27   ? 119 HIS A O   1 
ATOM   1012 C  CB  . HIS A 1 119 ? 11.131  -7.495  1.658   1.00 8.53   ? 119 HIS A CB  1 
ATOM   1013 C  CG  . HIS A 1 119 ? 10.324  -8.730  1.464   1.00 8.47   ? 119 HIS A CG  1 
ATOM   1014 N  ND1 . HIS A 1 119 ? 10.309  -9.524  0.360   1.00 11.34  ? 119 HIS A ND1 1 
ATOM   1015 C  CD2 . HIS A 1 119 ? 9.494   -9.325  2.388   1.00 9.59   ? 119 HIS A CD2 1 
ATOM   1016 C  CE1 . HIS A 1 119 ? 9.486   -10.549 0.569   1.00 11.40  ? 119 HIS A CE1 1 
ATOM   1017 N  NE2 . HIS A 1 119 ? 9.000   -10.451 1.762   1.00 13.98  ? 119 HIS A NE2 1 
ATOM   1018 N  N   . LEU A 1 120 ? 13.520  -5.719  3.122   1.00 8.75   ? 120 LEU A N   1 
ATOM   1019 C  CA  . LEU A 1 120 ? 14.279  -4.485  3.079   1.00 9.02   ? 120 LEU A CA  1 
ATOM   1020 C  C   . LEU A 1 120 ? 15.356  -4.382  4.156   1.00 8.65   ? 120 LEU A C   1 
ATOM   1021 O  O   . LEU A 1 120 ? 16.233  -3.511  3.996   1.00 10.76  ? 120 LEU A O   1 
ATOM   1022 C  CB  . LEU A 1 120 ? 13.333  -3.277  3.230   1.00 9.26   ? 120 LEU A CB  1 
ATOM   1023 C  CG  . LEU A 1 120 ? 12.479  -3.013  1.983   1.00 9.67   ? 120 LEU A CG  1 
ATOM   1024 C  CD1 . LEU A 1 120 ? 11.340  -2.071  2.299   1.00 11.32  ? 120 LEU A CD1 1 
ATOM   1025 C  CD2 . LEU A 1 120 ? 13.341  -2.411  0.875   1.00 11.22  ? 120 LEU A CD2 1 
ATOM   1026 N  N   . GLY A 1 121 ? 15.328  -5.185  5.209   1.00 9.39   ? 121 GLY A N   1 
ATOM   1027 C  CA  . GLY A 1 121 ? 16.376  -5.186  6.190   1.00 10.39  ? 121 GLY A CA  1 
ATOM   1028 C  C   . GLY A 1 121 ? 16.093  -4.338  7.397   1.00 10.89  ? 121 GLY A C   1 
ATOM   1029 O  O   . GLY A 1 121 ? 15.126  -3.563  7.464   1.00 9.94   ? 121 GLY A O   1 
ATOM   1030 N  N   . PRO A 1 122 ? 16.916  -4.493  8.429   1.00 14.63  ? 122 PRO A N   1 
ATOM   1031 C  CA  . PRO A 1 122 ? 16.697  -3.817  9.698   1.00 15.34  ? 122 PRO A CA  1 
ATOM   1032 C  C   . PRO A 1 122 ? 16.646  -2.293  9.656   1.00 16.26  ? 122 PRO A C   1 
ATOM   1033 O  O   . PRO A 1 122 ? 15.957  -1.673  10.443  1.00 18.37  ? 122 PRO A O   1 
ATOM   1034 C  CB  . PRO A 1 122 ? 17.889  -4.264  10.561  1.00 21.05  ? 122 PRO A CB  1 
ATOM   1035 C  CG  . PRO A 1 122 ? 18.898  -4.812  9.612   1.00 24.64  ? 122 PRO A CG  1 
ATOM   1036 C  CD  . PRO A 1 122 ? 18.119  -5.377  8.435   1.00 17.17  ? 122 PRO A CD  1 
ATOM   1037 N  N   . GLN A 1 123 ? 17.359  -1.667  8.739   1.00 17.12  ? 123 GLN A N   1 
ATOM   1038 C  CA  . GLN A 1 123 ? 17.358  -0.212  8.663   1.00 20.38  ? 123 GLN A CA  1 
ATOM   1039 C  C   . GLN A 1 123 ? 15.993  0.305   8.262   1.00 16.43  ? 123 GLN A C   1 
ATOM   1040 O  O   . GLN A 1 123 ? 15.582  1.381   8.670   1.00 21.58  ? 123 GLN A O   1 
ATOM   1041 C  CB  . GLN A 1 123 ? 18.490  0.216   7.737   1.00 25.04  ? 123 GLN A CB  1 
ATOM   1042 C  CG  . GLN A 1 123 ? 18.604  -0.298  6.331   1.00 38.31  ? 123 GLN A CG  1 
ATOM   1043 C  CD  . GLN A 1 123 ? 18.558  -1.768  5.993   1.00 44.23  ? 123 GLN A CD  1 
ATOM   1044 O  OE1 . GLN A 1 123 ? 18.906  -2.747  6.661   1.00 32.01  ? 123 GLN A OE1 1 
ATOM   1045 N  NE2 . GLN A 1 123 ? 18.085  -2.054  4.766   1.00 52.73  ? 123 GLN A NE2 1 
ATOM   1046 N  N   . PHE A 1 124 ? 15.275  -0.465  7.464   1.00 12.29  ? 124 PHE A N   1 
ATOM   1047 C  CA  . PHE A 1 124 ? 13.935  -0.027  7.102   1.00 11.38  ? 124 PHE A CA  1 
ATOM   1048 C  C   . PHE A 1 124 ? 12.921  -0.349  8.201   1.00 9.38   ? 124 PHE A C   1 
ATOM   1049 O  O   . PHE A 1 124 ? 11.939  0.352   8.311   1.00 9.58   ? 124 PHE A O   1 
ATOM   1050 C  CB  . PHE A 1 124 ? 13.519  -0.621  5.761   1.00 11.65  ? 124 PHE A CB  1 
ATOM   1051 C  CG  . PHE A 1 124 ? 14.049  0.137   4.567   1.00 12.36  ? 124 PHE A CG  1 
ATOM   1052 C  CD1 . PHE A 1 124 ? 13.319  1.204   4.070   1.00 17.29  ? 124 PHE A CD1 1 
ATOM   1053 C  CD2 . PHE A 1 124 ? 15.249  -0.215  3.955   1.00 15.12  ? 124 PHE A CD2 1 
ATOM   1054 C  CE1 . PHE A 1 124 ? 13.788  1.916   2.988   1.00 23.20  ? 124 PHE A CE1 1 
ATOM   1055 C  CE2 . PHE A 1 124 ? 15.704  0.488   2.868   1.00 19.24  ? 124 PHE A CE2 1 
ATOM   1056 C  CZ  . PHE A 1 124 ? 14.964  1.538   2.380   1.00 22.92  ? 124 PHE A CZ  1 
ATOM   1057 N  N   . VAL A 1 125 ? 13.143  -1.375  9.025   1.00 9.91   ? 125 VAL A N   1 
ATOM   1058 C  CA  . VAL A 1 125 ? 12.229  -1.617  10.152  1.00 8.92   ? 125 VAL A CA  1 
ATOM   1059 C  C   . VAL A 1 125 ? 12.142  -0.388  11.039  1.00 8.50   ? 125 VAL A C   1 
ATOM   1060 O  O   . VAL A 1 125 ? 11.054  -0.049  11.509  1.00 9.06   ? 125 VAL A O   1 
ATOM   1061 C  CB  . VAL A 1 125 ? 12.629  -2.879  10.918  1.00 9.79   ? 125 VAL A CB  1 
ATOM   1062 C  CG1 . VAL A 1 125 ? 11.678  -3.060  12.100  1.00 13.71  ? 125 VAL A CG1 1 
ATOM   1063 C  CG2 . VAL A 1 125 ? 12.568  -4.094  10.005  1.00 11.33  ? 125 VAL A CG2 1 
ATOM   1064 N  N   . GLU A 1 126 ? 13.262  0.295   11.244  1.00 9.10   ? 126 GLU A N   1 
ATOM   1065 C  CA  . GLU A 1 126 ? 13.289  1.504   12.054  1.00 10.26  ? 126 GLU A CA  1 
ATOM   1066 C  C   . GLU A 1 126 ? 12.524  2.662   11.439  1.00 9.09   ? 126 GLU A C   1 
ATOM   1067 O  O   . GLU A 1 126 ? 12.288  3.650   12.110  1.00 10.26  ? 126 GLU A O   1 
ATOM   1068 C  CB  . GLU A 1 126 ? 14.749  1.942   12.322  1.00 13.65  ? 126 GLU A CB  1 
ATOM   1069 C  CG  . GLU A 1 126 ? 15.403  0.883   13.257  1.00 18.49  ? 126 GLU A CG  1 
ATOM   1070 C  CD  . GLU A 1 126 ? 16.860  1.201   13.465  1.00 24.48  ? 126 GLU A CD  1 
ATOM   1071 O  OE1 . GLU A 1 126 ? 17.160  2.391   13.743  1.00 32.02  ? 126 GLU A OE1 1 
ATOM   1072 O  OE2 . GLU A 1 126 ? 17.699  0.277   13.394  1.00 25.23  ? 126 GLU A OE2 1 
ATOM   1073 N  N   . ARG A 1 127 ? 12.118  2.570   10.185  1.00 7.87   ? 127 ARG A N   1 
ATOM   1074 C  CA  A ARG A 1 127 ? 11.384  3.627   9.509   0.52 8.93   ? 127 ARG A CA  1 
ATOM   1075 C  CA  B ARG A 1 127 ? 11.410  3.536   9.378   0.48 6.38   ? 127 ARG A CA  1 
ATOM   1076 C  C   . ARG A 1 127 ? 9.920   3.301   9.324   1.00 7.05   ? 127 ARG A C   1 
ATOM   1077 O  O   . ARG A 1 127 ? 9.207   4.027   8.633   1.00 7.75   ? 127 ARG A O   1 
ATOM   1078 C  CB  A ARG A 1 127 ? 12.074  3.946   8.167   0.52 7.58   ? 127 ARG A CB  1 
ATOM   1079 C  CB  B ARG A 1 127 ? 11.975  3.580   7.928   0.48 8.63   ? 127 ARG A CB  1 
ATOM   1080 C  CG  A ARG A 1 127 ? 13.484  4.462   8.314   0.52 10.20  ? 127 ARG A CG  1 
ATOM   1081 C  CG  B ARG A 1 127 ? 13.487  3.680   7.875   0.48 12.22  ? 127 ARG A CG  1 
ATOM   1082 C  CD  A ARG A 1 127 ? 14.264  4.545   7.009   0.52 14.10  ? 127 ARG A CD  1 
ATOM   1083 C  CD  B ARG A 1 127 ? 14.052  4.824   8.696   0.48 17.00  ? 127 ARG A CD  1 
ATOM   1084 N  NE  A ARG A 1 127 ? 15.413  5.399   7.332   0.52 30.97  ? 127 ARG A NE  1 
ATOM   1085 N  NE  B ARG A 1 127 ? 13.561  6.080   8.192   0.48 18.38  ? 127 ARG A NE  1 
ATOM   1086 C  CZ  A ARG A 1 127 ? 15.452  6.719   7.393   0.52 33.85  ? 127 ARG A CZ  1 
ATOM   1087 C  CZ  B ARG A 1 127 ? 13.708  7.294   8.712   0.48 22.63  ? 127 ARG A CZ  1 
ATOM   1088 N  NH1 A ARG A 1 127 ? 14.370  7.451   7.114   0.52 31.22  ? 127 ARG A NH1 1 
ATOM   1089 N  NH1 B ARG A 1 127 ? 14.390  7.466   9.840   0.48 25.05  ? 127 ARG A NH1 1 
ATOM   1090 N  NH2 A ARG A 1 127 ? 16.597  7.317   7.710   0.52 36.24  ? 127 ARG A NH2 1 
ATOM   1091 N  NH2 B ARG A 1 127 ? 13.117  8.266   8.007   0.48 21.47  ? 127 ARG A NH2 1 
ATOM   1092 N  N   . ILE A 1 128 ? 9.443   2.255   10.020  1.00 7.35   ? 128 ILE A N   1 
ATOM   1093 C  CA  . ILE A 1 128 ? 8.003   1.978   9.987   1.00 7.36   ? 128 ILE A CA  1 
ATOM   1094 C  C   . ILE A 1 128 ? 7.255   2.911   10.940  1.00 6.60   ? 128 ILE A C   1 
ATOM   1095 O  O   . ILE A 1 128 ? 7.673   3.110   12.085  1.00 7.42   ? 128 ILE A O   1 
ATOM   1096 C  CB  . ILE A 1 128 ? 7.709   0.499   10.372  1.00 7.41   ? 128 ILE A CB  1 
ATOM   1097 C  CG1 . ILE A 1 128 ? 8.380   -0.462  9.382   1.00 7.72   ? 128 ILE A CG1 1 
ATOM   1098 C  CG2 . ILE A 1 128 ? 6.221   0.244   10.535  1.00 8.18   ? 128 ILE A CG2 1 
ATOM   1099 C  CD1 . ILE A 1 128 ? 8.289   -1.909  9.832   1.00 9.45   ? 128 ILE A CD1 1 
ATOM   1100 N  N   . ILE A 1 129 ? 6.125   3.424   10.469  1.00 7.20   ? 129 ILE A N   1 
ATOM   1101 C  CA  . ILE A 1 129 ? 5.135   4.120   11.287  1.00 6.97   ? 129 ILE A CA  1 
ATOM   1102 C  C   . ILE A 1 129 ? 3.839   3.381   11.081  1.00 7.30   ? 129 ILE A C   1 
ATOM   1103 O  O   . ILE A 1 129 ? 3.285   3.362   9.984   1.00 8.77   ? 129 ILE A O   1 
ATOM   1104 C  CB  . ILE A 1 129 ? 5.017   5.630   10.924  1.00 7.89   ? 129 ILE A CB  1 
ATOM   1105 C  CG1 . ILE A 1 129 ? 6.337   6.348   11.043  1.00 8.80   ? 129 ILE A CG1 1 
ATOM   1106 C  CG2 . ILE A 1 129 ? 3.970   6.263   11.797  1.00 9.80   ? 129 ILE A CG2 1 
ATOM   1107 C  CD1 . ILE A 1 129 ? 6.340   7.777   10.560  1.00 12.17  ? 129 ILE A CD1 1 
ATOM   1108 N  N   . LEU A 1 130 ? 3.317   2.776   12.137  1.00 7.60   ? 130 LEU A N   1 
ATOM   1109 C  CA  . LEU A 1 130 ? 2.022   2.128   12.120  1.00 7.64   ? 130 LEU A CA  1 
ATOM   1110 C  C   . LEU A 1 130 ? 0.994   3.066   12.695  1.00 8.40   ? 130 LEU A C   1 
ATOM   1111 O  O   . LEU A 1 130 ? 1.155   3.528   13.839  1.00 9.25   ? 130 LEU A O   1 
ATOM   1112 C  CB  . LEU A 1 130 ? 2.097   0.876   12.981  1.00 14.07  ? 130 LEU A CB  1 
ATOM   1113 C  CG  . LEU A 1 130 ? 2.113   -0.469  12.443  1.00 27.29  ? 130 LEU A CG  1 
ATOM   1114 C  CD1 . LEU A 1 130 ? 1.802   -1.448  13.623  1.00 16.29  ? 130 LEU A CD1 1 
ATOM   1115 C  CD2 . LEU A 1 130 ? 1.125   -0.842  11.359  1.00 33.78  ? 130 LEU A CD2 1 
ATOM   1116 N  N   . THR A 1 131 ? -0.047  3.366   11.932  1.00 7.39   ? 131 THR A N   1 
ATOM   1117 C  CA  . THR A 1 131 ? -1.077  4.330   12.374  1.00 8.30   ? 131 THR A CA  1 
ATOM   1118 C  C   . THR A 1 131 ? -2.330  4.132   11.589  1.00 8.48   ? 131 THR A C   1 
ATOM   1119 O  O   . THR A 1 131 ? -2.265  3.798   10.383  1.00 8.97   ? 131 THR A O   1 
ATOM   1120 C  CB  . THR A 1 131 ? -0.519  5.781   12.164  1.00 7.87   ? 131 THR A CB  1 
ATOM   1121 O  OG1 . THR A 1 131 ? -1.534  6.673   12.680  1.00 9.14   ? 131 THR A OG1 1 
ATOM   1122 C  CG2 . THR A 1 131 ? -0.192  6.071   10.736  1.00 9.44   ? 131 THR A CG2 1 
ATOM   1123 N  N   . ARG A 1 132 ? -3.480  4.336   12.235  1.00 8.18   ? 132 ARG A N   1 
ATOM   1124 C  CA  . ARG A 1 132 ? -4.760  4.381   11.532  1.00 9.28   ? 132 ARG A CA  1 
ATOM   1125 C  C   . ARG A 1 132 ? -5.120  5.760   11.012  1.00 8.98   ? 132 ARG A C   1 
ATOM   1126 O  O   . ARG A 1 132 ? -6.146  5.970   10.377  1.00 11.14  ? 132 ARG A O   1 
ATOM   1127 C  CB  . ARG A 1 132 ? -5.867  3.890   12.447  1.00 12.93  ? 132 ARG A CB  1 
ATOM   1128 C  CG  . ARG A 1 132 ? -5.840  2.549   13.067  1.00 16.32  ? 132 ARG A CG  1 
ATOM   1129 C  CD  . ARG A 1 132 ? -6.447  1.444   12.341  1.00 18.20  ? 132 ARG A CD  1 
ATOM   1130 N  NE  . ARG A 1 132 ? -7.766  1.654   11.774  1.00 15.38  ? 132 ARG A NE  1 
ATOM   1131 C  CZ  . ARG A 1 132 ? -8.275  0.975   10.737  1.00 13.91  ? 132 ARG A CZ  1 
ATOM   1132 N  NH1 . ARG A 1 132 ? -9.507  1.344   10.365  1.00 17.50  ? 132 ARG A NH1 1 
ATOM   1133 N  NH2 . ARG A 1 132 ? -7.591  0.010   10.148  1.00 15.63  ? 132 ARG A NH2 1 
ATOM   1134 N  N   . ASP A 1 133 ? -4.289  6.739   11.312  1.00 8.54   ? 133 ASP A N   1 
ATOM   1135 C  CA  . ASP A 1 133 ? -4.461  8.126   10.878  1.00 8.50   ? 133 ASP A CA  1 
ATOM   1136 C  C   . ASP A 1 133 ? -3.121  8.612   10.318  1.00 8.04   ? 133 ASP A C   1 
ATOM   1137 O  O   . ASP A 1 133 ? -2.187  8.948   11.059  1.00 8.68   ? 133 ASP A O   1 
ATOM   1138 C  CB  . ASP A 1 133 ? -4.958  9.034   12.016  1.00 10.25  ? 133 ASP A CB  1 
ATOM   1139 C  CG  . ASP A 1 133 ? -5.381  10.406  11.548  1.00 9.18   ? 133 ASP A CG  1 
ATOM   1140 O  OD1 . ASP A 1 133 ? -4.867  10.830  10.482  1.00 9.58   ? 133 ASP A OD1 1 
ATOM   1141 O  OD2 . ASP A 1 133 ? -6.218  11.043  12.248  1.00 10.43  ? 133 ASP A OD2 1 
ATOM   1142 N  N   . LYS A 1 134 ? -3.020  8.650   8.996   1.00 7.59   ? 134 LYS A N   1 
ATOM   1143 C  CA  . LYS A 1 134 ? -1.778  9.101   8.345   1.00 7.86   ? 134 LYS A CA  1 
ATOM   1144 C  C   . LYS A 1 134 ? -1.721  10.611  8.274   1.00 7.46   ? 134 LYS A C   1 
ATOM   1145 O  O   . LYS A 1 134 ? -0.661  11.187  7.991   1.00 7.68   ? 134 LYS A O   1 
ATOM   1146 C  CB  . LYS A 1 134 ? -1.638  8.440   6.968   1.00 7.06   ? 134 LYS A CB  1 
ATOM   1147 C  CG  . LYS A 1 134 ? -1.736  6.918   7.020   1.00 8.05   ? 134 LYS A CG  1 
ATOM   1148 C  CD  . LYS A 1 134 ? -1.329  6.224   5.746   1.00 8.22   ? 134 LYS A CD  1 
ATOM   1149 C  CE  . LYS A 1 134 ? -1.540  4.719   5.862   1.00 7.88   ? 134 LYS A CE  1 
ATOM   1150 N  NZ  . LYS A 1 134 ? -1.045  3.950   4.679   1.00 7.70   ? 134 LYS A NZ  1 
ATOM   1151 N  N   . THR A 1 135 ? -2.864  11.297  8.485   1.00 7.42   ? 135 THR A N   1 
ATOM   1152 C  CA  . THR A 1 135 ? -2.876  12.761  8.374   1.00 8.19   ? 135 THR A CA  1 
ATOM   1153 C  C   . THR A 1 135 ? -2.131  13.431  9.507   1.00 8.09   ? 135 THR A C   1 
ATOM   1154 O  O   . THR A 1 135 ? -1.785  14.622  9.392   1.00 9.05   ? 135 THR A O   1 
ATOM   1155 C  CB  . THR A 1 135 ? -4.296  13.336  8.272   1.00 8.43   ? 135 THR A CB  1 
ATOM   1156 O  OG1 . THR A 1 135 ? -4.961  13.353  9.562   1.00 9.56   ? 135 THR A OG1 1 
ATOM   1157 C  CG2 . THR A 1 135 ? -5.114  12.604  7.204   1.00 9.94   ? 135 THR A CG2 1 
ATOM   1158 N  N   . VAL A 1 136 ? -1.890  12.741  10.622  1.00 7.83   ? 136 VAL A N   1 
ATOM   1159 C  CA  . VAL A 1 136 ? -1.116  13.281  11.729  1.00 8.32   ? 136 VAL A CA  1 
ATOM   1160 C  C   . VAL A 1 136 ? 0.372   12.953  11.596  1.00 8.58   ? 136 VAL A C   1 
ATOM   1161 O  O   . VAL A 1 136 ? 1.109   13.257  12.527  1.00 10.77  ? 136 VAL A O   1 
ATOM   1162 C  CB  . VAL A 1 136 ? -1.666  12.875  13.098  1.00 9.28   ? 136 VAL A CB  1 
ATOM   1163 C  CG1 . VAL A 1 136 ? -3.112  13.283  13.256  1.00 10.25  ? 136 VAL A CG1 1 
ATOM   1164 C  CG2 . VAL A 1 136 ? -1.462  11.376  13.372  1.00 10.57  ? 136 VAL A CG2 1 
ATOM   1165 N  N   . VAL A 1 137 ? 0.829   12.455  10.487  1.00 8.00   ? 137 VAL A N   1 
ATOM   1166 C  CA  . VAL A 1 137 ? 2.244   12.192  10.191  1.00 8.45   ? 137 VAL A CA  1 
ATOM   1167 C  C   . VAL A 1 137 ? 2.720   13.272  9.219   1.00 8.93   ? 137 VAL A C   1 
ATOM   1168 O  O   . VAL A 1 137 ? 2.097   13.541  8.179   1.00 8.94   ? 137 VAL A O   1 
ATOM   1169 C  CB  . VAL A 1 137 ? 2.460   10.791  9.633   1.00 8.66   ? 137 VAL A CB  1 
ATOM   1170 C  CG1 . VAL A 1 137 ? 3.969   10.587  9.444   1.00 9.93   ? 137 VAL A CG1 1 
ATOM   1171 C  CG2 . VAL A 1 137 ? 1.858   9.731   10.541  1.00 10.64  ? 137 VAL A CG2 1 
ATOM   1172 N  N   . LEU A 1 138 ? 3.799   13.936  9.624   1.00 8.47   ? 138 LEU A N   1 
ATOM   1173 C  CA  A LEU A 1 138 ? 4.370   15.043  8.866   0.73 9.54   ? 138 LEU A CA  1 
ATOM   1174 C  CA  B LEU A 1 138 ? 4.455   14.989  8.918   0.27 11.07  ? 138 LEU A CA  1 
ATOM   1175 C  C   . LEU A 1 138 ? 5.256   14.537  7.729   1.00 10.08  ? 138 LEU A C   1 
ATOM   1176 O  O   . LEU A 1 138 ? 6.185   13.779  7.940   1.00 14.40  ? 138 LEU A O   1 
ATOM   1177 C  CB  A LEU A 1 138 ? 5.151   15.960  9.831   0.73 9.68   ? 138 LEU A CB  1 
ATOM   1178 C  CB  B LEU A 1 138 ? 5.524   15.657  9.833   0.27 11.79  ? 138 LEU A CB  1 
ATOM   1179 C  CG  A LEU A 1 138 ? 5.893   17.168  9.289   0.73 16.00  ? 138 LEU A CG  1 
ATOM   1180 C  CG  B LEU A 1 138 ? 4.866   16.785  10.612  0.27 13.09  ? 138 LEU A CG  1 
ATOM   1181 C  CD1 A LEU A 1 138 ? 4.999   18.125  8.528   0.73 17.81  ? 138 LEU A CD1 1 
ATOM   1182 C  CD1 B LEU A 1 138 ? 5.637   17.229  11.844  0.27 13.00  ? 138 LEU A CD1 1 
ATOM   1183 C  CD2 A LEU A 1 138 ? 6.635   17.899  10.413  0.73 21.56  ? 138 LEU A CD2 1 
ATOM   1184 C  CD2 B LEU A 1 138 ? 4.644   17.974  9.678   0.27 24.29  ? 138 LEU A CD2 1 
ATOM   1185 N  N   . GLY A 1 139 ? 4.983   15.030  6.535   1.00 10.75  ? 139 GLY A N   1 
ATOM   1186 C  CA  . GLY A 1 139 ? 5.827   14.730  5.404   1.00 11.07  ? 139 GLY A CA  1 
ATOM   1187 C  C   . GLY A 1 139 ? 5.456   15.578  4.203   1.00 8.06   ? 139 GLY A C   1 
ATOM   1188 O  O   . GLY A 1 139 ? 4.453   16.281  4.250   1.00 9.43   ? 139 GLY A O   1 
ATOM   1189 N  N   . ASP A 1 140 ? 6.253   15.500  3.148   1.00 8.02   ? 140 ASP A N   1 
ATOM   1190 C  CA  . ASP A 1 140 ? 5.967   16.213  1.938   1.00 7.60   ? 140 ASP A CA  1 
ATOM   1191 C  C   . ASP A 1 140 ? 5.080   15.443  0.959   1.00 7.24   ? 140 ASP A C   1 
ATOM   1192 O  O   . ASP A 1 140 ? 4.318   16.093  0.216   1.00 8.00   ? 140 ASP A O   1 
ATOM   1193 C  CB  . ASP A 1 140 ? 7.270   16.581  1.217   1.00 8.83   ? 140 ASP A CB  1 
ATOM   1194 C  CG  . ASP A 1 140 ? 8.160   17.432  2.087   1.00 10.25  ? 140 ASP A CG  1 
ATOM   1195 O  OD1 . ASP A 1 140 ? 7.824   18.616  2.171   1.00 23.73  ? 140 ASP A OD1 1 
ATOM   1196 O  OD2 . ASP A 1 140 ? 9.156   16.976  2.630   1.00 12.14  ? 140 ASP A OD2 1 
ATOM   1197 N  N   . LEU A 1 141 ? 5.181   14.142  0.961   1.00 7.11   ? 141 LEU A N   1 
ATOM   1198 C  CA  . LEU A 1 141 ? 4.485   13.291  0.006   1.00 7.08   ? 141 LEU A CA  1 
ATOM   1199 C  C   . LEU A 1 141 ? 4.025   12.044  0.730   1.00 6.74   ? 141 LEU A C   1 
ATOM   1200 O  O   . LEU A 1 141 ? 4.736   11.542  1.608   1.00 7.49   ? 141 LEU A O   1 
ATOM   1201 C  CB  . LEU A 1 141 ? 5.465   12.871  -1.084  1.00 7.06   ? 141 LEU A CB  1 
ATOM   1202 C  CG  . LEU A 1 141 ? 5.882   13.967  -2.058  1.00 7.42   ? 141 LEU A CG  1 
ATOM   1203 C  CD1 . LEU A 1 141 ? 7.153   13.604  -2.789  1.00 10.36  ? 141 LEU A CD1 1 
ATOM   1204 C  CD2 . LEU A 1 141 ? 4.774   14.262  -3.059  1.00 8.93   ? 141 LEU A CD2 1 
ATOM   1205 N  N   . LEU A 1 142 ? 2.865   11.540  0.325   1.00 7.08   ? 142 LEU A N   1 
ATOM   1206 C  CA  . LEU A 1 142 ? 2.335   10.241  0.754   1.00 6.54   ? 142 LEU A CA  1 
ATOM   1207 C  C   . LEU A 1 142 ? 1.960   9.474   -0.529  1.00 6.33   ? 142 LEU A C   1 
ATOM   1208 O  O   . LEU A 1 142 ? 1.043   9.880   -1.205  1.00 7.54   ? 142 LEU A O   1 
ATOM   1209 C  CB  . LEU A 1 142 ? 1.153   10.378  1.693   1.00 7.20   ? 142 LEU A CB  1 
ATOM   1210 C  CG  . LEU A 1 142 ? 0.411   9.050   1.994   1.00 8.03   ? 142 LEU A CG  1 
ATOM   1211 C  CD1 . LEU A 1 142 ? 1.254   8.061   2.723   1.00 8.35   ? 142 LEU A CD1 1 
ATOM   1212 C  CD2 . LEU A 1 142 ? -0.853  9.332   2.802   1.00 10.15  ? 142 LEU A CD2 1 
ATOM   1213 N  N   . ILE A 1 143 ? 2.703   8.391   -0.786  1.00 6.38   ? 143 ILE A N   1 
ATOM   1214 C  CA  . ILE A 1 143 ? 2.431   7.556   -1.960  1.00 6.56   ? 143 ILE A CA  1 
ATOM   1215 C  C   . ILE A 1 143 ? 1.572   6.388   -1.448  1.00 6.51   ? 143 ILE A C   1 
ATOM   1216 O  O   . ILE A 1 143 ? 2.061   5.563   -0.667  1.00 7.04   ? 143 ILE A O   1 
ATOM   1217 C  CB  . ILE A 1 143 ? 3.740   7.100   -2.583  1.00 6.40   ? 143 ILE A CB  1 
ATOM   1218 C  CG1 . ILE A 1 143 ? 4.604   8.294   -3.062  1.00 8.36   ? 143 ILE A CG1 1 
ATOM   1219 C  CG2 . ILE A 1 143 ? 3.481   6.157   -3.733  1.00 7.82   ? 143 ILE A CG2 1 
ATOM   1220 C  CD1 . ILE A 1 143 ? 5.990   7.923   -3.500  1.00 8.52   ? 143 ILE A CD1 1 
ATOM   1221 N  N   . ASP A 1 144 ? 0.295   6.334   -1.857  1.00 6.73   ? 144 ASP A N   1 
ATOM   1222 C  CA  . ASP A 1 144 ? -0.680  5.454   -1.200  1.00 6.62   ? 144 ASP A CA  1 
ATOM   1223 C  C   . ASP A 1 144 ? -1.737  5.103   -2.217  1.00 6.56   ? 144 ASP A C   1 
ATOM   1224 O  O   . ASP A 1 144 ? -2.204  5.972   -2.967  1.00 7.22   ? 144 ASP A O   1 
ATOM   1225 C  CB  . ASP A 1 144 ? -1.211  6.131   0.071   1.00 7.14   ? 144 ASP A CB  1 
ATOM   1226 C  CG  . ASP A 1 144 ? -2.004  5.290   0.999   1.00 7.11   ? 144 ASP A CG  1 
ATOM   1227 O  OD1 . ASP A 1 144 ? -2.901  4.577   0.533   1.00 7.92   ? 144 ASP A OD1 1 
ATOM   1228 O  OD2 . ASP A 1 144 ? -1.720  5.339   2.241   1.00 9.15   ? 144 ASP A OD2 1 
ATOM   1229 N  N   . ASP A 1 145 ? -2.178  3.835   -2.277  1.00 6.62   ? 145 ASP A N   1 
ATOM   1230 C  CA  . ASP A 1 145 ? -3.185  3.390   -3.205  1.00 6.77   ? 145 ASP A CA  1 
ATOM   1231 C  C   . ASP A 1 145 ? -4.621  3.701   -2.772  1.00 6.58   ? 145 ASP A C   1 
ATOM   1232 O  O   . ASP A 1 145 ? -5.538  3.536   -3.574  1.00 7.42   ? 145 ASP A O   1 
ATOM   1233 C  CB  . ASP A 1 145 ? -3.083  1.895   -3.461  1.00 7.35   ? 145 ASP A CB  1 
ATOM   1234 C  CG  . ASP A 1 145 ? -3.321  1.021   -2.262  1.00 7.51   ? 145 ASP A CG  1 
ATOM   1235 O  OD1 . ASP A 1 145 ? -2.780  1.366   -1.185  1.00 7.25   ? 145 ASP A OD1 1 
ATOM   1236 O  OD2 . ASP A 1 145 ? -3.997  -0.008  -2.403  1.00 10.18  ? 145 ASP A OD2 1 
ATOM   1237 N  N   . LYS A 1 146 ? -4.822  4.080   -1.520  1.00 6.40   ? 146 LYS A N   1 
ATOM   1238 C  CA  . LYS A 1 146 ? -6.157  4.418   -1.049  1.00 6.52   ? 146 LYS A CA  1 
ATOM   1239 C  C   . LYS A 1 146 ? -6.634  5.706   -1.744  1.00 7.48   ? 146 LYS A C   1 
ATOM   1240 O  O   . LYS A 1 146 ? -5.868  6.650   -1.855  1.00 7.96   ? 146 LYS A O   1 
ATOM   1241 C  CB  . LYS A 1 146 ? -6.191  4.535   0.470   1.00 7.62   ? 146 LYS A CB  1 
ATOM   1242 C  CG  . LYS A 1 146 ? -7.608  4.569   1.048   1.00 8.47   ? 146 LYS A CG  1 
ATOM   1243 C  CD  . LYS A 1 146 ? -7.595  4.587   2.568   1.00 9.41   ? 146 LYS A CD  1 
ATOM   1244 C  CE  . LYS A 1 146 ? -8.973  4.560   3.163   1.00 10.91  ? 146 LYS A CE  1 
ATOM   1245 N  NZ  . LYS A 1 146 ? -9.712  5.819   2.958   1.00 11.52  ? 146 LYS A NZ  1 
ATOM   1246 N  N   . ASP A 1 147 ? -7.887  5.718   -2.227  1.00 7.85   ? 147 ASP A N   1 
ATOM   1247 C  CA  . ASP A 1 147 ? -8.297  6.818   -3.067  1.00 9.03   ? 147 ASP A CA  1 
ATOM   1248 C  C   . ASP A 1 147 ? -8.467  8.124   -2.310  1.00 9.33   ? 147 ASP A C   1 
ATOM   1249 O  O   . ASP A 1 147 ? -8.248  9.173   -2.907  1.00 13.77  ? 147 ASP A O   1 
ATOM   1250 C  CB  . ASP A 1 147 ? -9.575  6.498   -3.829  1.00 13.14  ? 147 ASP A CB  1 
ATOM   1251 C  CG  . ASP A 1 147 ? -10.620 5.847   -3.023  1.00 12.80  ? 147 ASP A CG  1 
ATOM   1252 O  OD1 . ASP A 1 147 ? -10.478 4.671   -2.594  1.00 13.93  ? 147 ASP A OD1 1 
ATOM   1253 O  OD2 . ASP A 1 147 ? -11.644 6.587   -2.814  1.00 20.06  ? 147 ASP A OD2 1 
ATOM   1254 N  N   . THR A 1 148 ? -8.788  8.023   -1.034  1.00 8.90   ? 148 THR A N   1 
ATOM   1255 C  CA  . THR A 1 148 ? -8.830  9.165   -0.151  1.00 11.37  ? 148 THR A CA  1 
ATOM   1256 C  C   . THR A 1 148 ? -8.075  8.795   1.111   1.00 9.72   ? 148 THR A C   1 
ATOM   1257 O  O   . THR A 1 148 ? -8.211  7.669   1.548   1.00 15.81  ? 148 THR A O   1 
ATOM   1258 C  CB  . THR A 1 148 ? -10.260 9.583   0.255   1.00 13.88  ? 148 THR A CB  1 
ATOM   1259 O  OG1 . THR A 1 148 ? -10.911 8.460   0.884   1.00 23.21  ? 148 THR A OG1 1 
ATOM   1260 C  CG2 . THR A 1 148 ? -11.080 9.989   -0.973  1.00 21.46  ? 148 THR A CG2 1 
ATOM   1261 N  N   . VAL A 1 149 ? -7.267  9.668   1.651   1.00 10.16  ? 149 VAL A N   1 
ATOM   1262 C  CA  . VAL A 1 149 ? -6.553  9.439   2.897   1.00 9.25   ? 149 VAL A CA  1 
ATOM   1263 C  C   . VAL A 1 149 ? -6.949  10.538  3.884   1.00 11.03  ? 149 VAL A C   1 
ATOM   1264 O  O   . VAL A 1 149 ? -6.586  11.691  3.704   1.00 13.30  ? 149 VAL A O   1 
ATOM   1265 C  CB  . VAL A 1 149 ? -5.048  9.376   2.706   1.00 9.65   ? 149 VAL A CB  1 
ATOM   1266 C  CG1 . VAL A 1 149 ? -4.342  9.086   4.025   1.00 9.89   ? 149 VAL A CG1 1 
ATOM   1267 C  CG2 . VAL A 1 149 ? -4.659  8.324   1.696   1.00 10.16  ? 149 VAL A CG2 1 
ATOM   1268 N  N   . ARG A 1 150 ? -7.743  10.158  4.865   1.00 11.30  ? 150 ARG A N   1 
ATOM   1269 C  CA  . ARG A 1 150 ? -8.425  11.078  5.740   1.00 14.29  ? 150 ARG A CA  1 
ATOM   1270 C  C   . ARG A 1 150 ? -8.115  10.823  7.200   1.00 10.25  ? 150 ARG A C   1 
ATOM   1271 O  O   . ARG A 1 150 ? -7.666  9.748   7.564   1.00 10.89  ? 150 ARG A O   1 
ATOM   1272 C  CB  . ARG A 1 150 ? -9.967  10.936  5.499   1.00 20.79  ? 150 ARG A CB  1 
ATOM   1273 C  CG  . ARG A 1 150 ? -10.398 11.505  4.158   1.00 24.50  ? 150 ARG A CG  1 
ATOM   1274 C  CD  . ARG A 1 150 ? -11.903 11.403  3.973   0.01 20.00  ? 150 ARG A CD  1 
ATOM   1275 N  NE  . ARG A 1 150 ? -12.621 12.432  4.721   0.01 20.00  ? 150 ARG A NE  1 
ATOM   1276 C  CZ  . ARG A 1 150 ? -13.932 12.623  4.663   0.01 20.00  ? 150 ARG A CZ  1 
ATOM   1277 N  NH1 . ARG A 1 150 ? -14.685 11.852  3.890   0.01 20.00  ? 150 ARG A NH1 1 
ATOM   1278 N  NH2 . ARG A 1 150 ? -14.498 13.585  5.380   0.01 20.00  ? 150 ARG A NH2 1 
ATOM   1279 N  N   . GLY A 1 151 ? -8.373  11.827  8.023   1.00 11.24  ? 151 GLY A N   1 
ATOM   1280 C  CA  . GLY A 1 151 ? -8.072  11.721  9.461   1.00 11.34  ? 151 GLY A CA  1 
ATOM   1281 C  C   . GLY A 1 151 ? -8.288  13.071  10.105  1.00 10.81  ? 151 GLY A C   1 
ATOM   1282 O  O   . GLY A 1 151 ? -9.032  13.917  9.614   1.00 13.85  ? 151 GLY A O   1 
ATOM   1283 N  N   . GLN A 1 152 ? -7.650  13.251  11.245  1.00 11.90  ? 152 GLN A N   1 
ATOM   1284 C  CA  . GLN A 1 152 ? -7.955  14.417  12.042  1.00 13.05  ? 152 GLN A CA  1 
ATOM   1285 C  C   . GLN A 1 152 ? -7.407  15.704  11.469  1.00 16.88  ? 152 GLN A C   1 
ATOM   1286 O  O   . GLN A 1 152 ? -7.974  16.737  11.866  1.00 25.15  ? 152 GLN A O   1 
ATOM   1287 C  CB  . GLN A 1 152 ? -7.393  14.295  13.448  1.00 15.67  ? 152 GLN A CB  1 
ATOM   1288 C  CG  . GLN A 1 152 ? -8.168  13.204  14.157  1.00 18.03  ? 152 GLN A CG  1 
ATOM   1289 C  CD  . GLN A 1 152 ? -7.707  13.102  15.600  1.00 24.12  ? 152 GLN A CD  1 
ATOM   1290 O  OE1 . GLN A 1 152 ? -6.743  13.761  15.997  1.00 28.31  ? 152 GLN A OE1 1 
ATOM   1291 N  NE2 . GLN A 1 152 ? -8.599  12.314  16.162  1.00 33.94  ? 152 GLN A NE2 1 
ATOM   1292 N  N   . GLU A 1 153 ? -6.391  15.687  10.637  1.00 14.22  ? 153 GLU A N   1 
ATOM   1293 C  CA  . GLU A 1 153 ? -5.935  16.954  9.997   1.00 17.52  ? 153 GLU A CA  1 
ATOM   1294 C  C   . GLU A 1 153 ? -6.695  17.161  8.694   1.00 17.14  ? 153 GLU A C   1 
ATOM   1295 O  O   . GLU A 1 153 ? -6.532  16.329  7.814   1.00 17.84  ? 153 GLU A O   1 
ATOM   1296 C  CB  . GLU A 1 153 ? -4.463  16.899  9.728   1.00 16.42  ? 153 GLU A CB  1 
ATOM   1297 C  CG  . GLU A 1 153 ? -3.637  16.928  10.997  1.00 19.33  ? 153 GLU A CG  1 
ATOM   1298 C  CD  . GLU A 1 153 ? -3.647  18.318  11.630  1.00 19.17  ? 153 GLU A CD  1 
ATOM   1299 O  OE1 . GLU A 1 153 ? -3.528  19.322  10.914  1.00 20.46  ? 153 GLU A OE1 1 
ATOM   1300 O  OE2 . GLU A 1 153 ? -3.706  18.370  12.856  1.00 22.88  ? 153 GLU A OE2 1 
ATOM   1301 N  N   . GLU A 1 154 ? -7.510  18.240  8.642   1.00 20.06  ? 154 GLU A N   1 
ATOM   1302 C  CA  . GLU A 1 154 ? -8.276  18.508  7.433   1.00 25.79  ? 154 GLU A CA  1 
ATOM   1303 C  C   . GLU A 1 154 ? -7.381  18.804  6.235   1.00 22.87  ? 154 GLU A C   1 
ATOM   1304 O  O   . GLU A 1 154 ? -7.762  18.547  5.093   1.00 23.66  ? 154 GLU A O   1 
ATOM   1305 C  CB  . GLU A 1 154 ? -9.238  19.671  7.683   1.00 33.49  ? 154 GLU A CB  1 
ATOM   1306 C  CG  . GLU A 1 154 ? -10.063 20.174  6.520   1.00 50.97  ? 154 GLU A CG  1 
ATOM   1307 C  CD  . GLU A 1 154 ? -10.920 21.385  6.859   1.00 73.16  ? 154 GLU A CD  1 
ATOM   1308 O  OE1 . GLU A 1 154 ? -11.456 22.022  5.916   1.00 89.12  ? 154 GLU A OE1 1 
ATOM   1309 O  OE2 . GLU A 1 154 ? -11.072 21.717  8.062   1.00 91.40  ? 154 GLU A OE2 1 
ATOM   1310 N  N   . THR A 1 155 ? -6.200  19.375  6.533   1.00 17.82  ? 155 THR A N   1 
ATOM   1311 C  CA  . THR A 1 155 ? -5.227  19.753  5.521   1.00 15.37  ? 155 THR A CA  1 
ATOM   1312 C  C   . THR A 1 155 ? -3.900  19.094  5.875   1.00 13.02  ? 155 THR A C   1 
ATOM   1313 O  O   . THR A 1 155 ? -3.081  19.690  6.564   1.00 14.62  ? 155 THR A O   1 
ATOM   1314 C  CB  . THR A 1 155 ? -5.060  21.284  5.418   1.00 15.49  ? 155 THR A CB  1 
ATOM   1315 O  OG1 . THR A 1 155 ? -6.354  21.860  5.183   1.00 19.87  ? 155 THR A OG1 1 
ATOM   1316 C  CG2 . THR A 1 155 ? -4.140  21.738  4.310   1.00 18.88  ? 155 THR A CG2 1 
ATOM   1317 N  N   . PRO A 1 156 ? -3.709  17.883  5.431   1.00 12.63  ? 156 PRO A N   1 
ATOM   1318 C  CA  . PRO A 1 156 ? -2.447  17.208  5.750   1.00 12.45  ? 156 PRO A CA  1 
ATOM   1319 C  C   . PRO A 1 156 ? -1.255  17.955  5.223   1.00 11.36  ? 156 PRO A C   1 
ATOM   1320 O  O   . PRO A 1 156 ? -1.334  18.664  4.221   1.00 11.33  ? 156 PRO A O   1 
ATOM   1321 C  CB  . PRO A 1 156 ? -2.617  15.854  5.026   1.00 15.68  ? 156 PRO A CB  1 
ATOM   1322 C  CG  . PRO A 1 156 ? -4.095  15.650  4.976   1.00 14.86  ? 156 PRO A CG  1 
ATOM   1323 C  CD  . PRO A 1 156 ? -4.663  17.023  4.692   1.00 13.76  ? 156 PRO A CD  1 
ATOM   1324 N  N   . SER A 1 157 ? -0.118  17.766  5.887   1.00 9.88   ? 157 SER A N   1 
ATOM   1325 C  CA  . SER A 1 157 ? 1.149   18.365  5.398   1.00 9.94   ? 157 SER A CA  1 
ATOM   1326 C  C   . SER A 1 157 ? 1.550   17.846  4.026   1.00 9.15   ? 157 SER A C   1 
ATOM   1327 O  O   . SER A 1 157 ? 2.109   18.566  3.196   1.00 9.78   ? 157 SER A O   1 
ATOM   1328 C  CB  . SER A 1 157 ? 2.219   18.099  6.455   1.00 10.94  ? 157 SER A CB  1 
ATOM   1329 O  OG  . SER A 1 157 ? 2.429   16.710  6.619   1.00 13.58  ? 157 SER A OG  1 
ATOM   1330 N  N   . TRP A 1 158 ? 1.294   16.555  3.798   1.00 8.68   ? 158 TRP A N   1 
ATOM   1331 C  CA  . TRP A 1 158 ? 1.767   15.894  2.587   1.00 8.42   ? 158 TRP A CA  1 
ATOM   1332 C  C   . TRP A 1 158 ? 0.775   16.061  1.436   1.00 8.10   ? 158 TRP A C   1 
ATOM   1333 O  O   . TRP A 1 158 ? -0.417  16.283  1.630   1.00 8.78   ? 158 TRP A O   1 
ATOM   1334 C  CB  . TRP A 1 158 ? 1.995   14.398  2.863   1.00 8.49   ? 158 TRP A CB  1 
ATOM   1335 C  CG  . TRP A 1 158 ? 1.028   13.704  3.779   1.00 7.87   ? 158 TRP A CG  1 
ATOM   1336 C  CD1 . TRP A 1 158 ? 1.314   13.373  5.079   1.00 8.10   ? 158 TRP A CD1 1 
ATOM   1337 C  CD2 . TRP A 1 158 ? -0.339  13.282  3.542   1.00 7.81   ? 158 TRP A CD2 1 
ATOM   1338 N  NE1 . TRP A 1 158 ? 0.232   12.759  5.640   1.00 8.14   ? 158 TRP A NE1 1 
ATOM   1339 C  CE2 . TRP A 1 158 ? -0.774  12.693  4.731   1.00 7.82   ? 158 TRP A CE2 1 
ATOM   1340 C  CE3 . TRP A 1 158 ? -1.200  13.344  2.447   1.00 8.51   ? 158 TRP A CE3 1 
ATOM   1341 C  CZ2 . TRP A 1 158 ? -2.055  12.142  4.873   1.00 8.28   ? 158 TRP A CZ2 1 
ATOM   1342 C  CZ3 . TRP A 1 158 ? -2.475  12.819  2.587   1.00 8.41   ? 158 TRP A CZ3 1 
ATOM   1343 C  CH2 . TRP A 1 158 ? -2.912  12.247  3.776   1.00 7.95   ? 158 TRP A CH2 1 
ATOM   1344 N  N   . GLU A 1 159 ? 1.304   15.939  0.240   1.00 7.53   ? 159 GLU A N   1 
ATOM   1345 C  CA  . GLU A 1 159 ? 0.564   15.778  -0.989  1.00 8.15   ? 159 GLU A CA  1 
ATOM   1346 C  C   . GLU A 1 159 ? 0.333   14.291  -1.206  1.00 7.14   ? 159 GLU A C   1 
ATOM   1347 O  O   . GLU A 1 159 ? 1.311   13.538  -1.240  1.00 7.72   ? 159 GLU A O   1 
ATOM   1348 C  CB  . GLU A 1 159 ? 1.310   16.390  -2.183  1.00 8.32   ? 159 GLU A CB  1 
ATOM   1349 C  CG  . GLU A 1 159 ? 0.518   16.264  -3.494  1.00 8.81   ? 159 GLU A CG  1 
ATOM   1350 C  CD  . GLU A 1 159 ? 1.265   16.721  -4.704  1.00 10.58  ? 159 GLU A CD  1 
ATOM   1351 O  OE1 . GLU A 1 159 ? 2.385   17.280  -4.590  1.00 10.27  ? 159 GLU A OE1 1 
ATOM   1352 O  OE2 . GLU A 1 159 ? 0.762   16.493  -5.805  1.00 14.17  ? 159 GLU A OE2 1 
ATOM   1353 N  N   . HIS A 1 160 ? -0.896  13.848  -1.341  1.00 7.75   ? 160 HIS A N   1 
ATOM   1354 C  CA  . HIS A 1 160 ? -1.208  12.453  -1.658  1.00 7.43   ? 160 HIS A CA  1 
ATOM   1355 C  C   . HIS A 1 160 ? -0.957  12.202  -3.142  1.00 6.77   ? 160 HIS A C   1 
ATOM   1356 O  O   . HIS A 1 160 ? -1.580  12.849  -3.973  1.00 8.43   ? 160 HIS A O   1 
ATOM   1357 C  CB  . HIS A 1 160 ? -2.675  12.175  -1.331  1.00 7.82   ? 160 HIS A CB  1 
ATOM   1358 C  CG  . HIS A 1 160 ? -3.100  10.795  -1.692  1.00 7.69   ? 160 HIS A CG  1 
ATOM   1359 N  ND1 . HIS A 1 160 ? -4.417  10.548  -2.008  1.00 9.90   ? 160 HIS A ND1 1 
ATOM   1360 C  CD2 . HIS A 1 160 ? -2.425  9.617   -1.750  1.00 8.41   ? 160 HIS A CD2 1 
ATOM   1361 C  CE1 . HIS A 1 160 ? -4.530  9.269   -2.263  1.00 9.40   ? 160 HIS A CE1 1 
ATOM   1362 N  NE2 . HIS A 1 160 ? -3.370  8.657   -2.136  1.00 8.25   ? 160 HIS A NE2 1 
ATOM   1363 N  N   . ILE A 1 161 ? -0.080  11.280  -3.408  1.00 6.91   ? 161 ILE A N   1 
ATOM   1364 C  CA  . ILE A 1 161 ? 0.179   10.750  -4.726  1.00 7.09   ? 161 ILE A CA  1 
ATOM   1365 C  C   . ILE A 1 161 ? -0.508  9.375   -4.813  1.00 6.84   ? 161 ILE A C   1 
ATOM   1366 O  O   . ILE A 1 161 ? -0.096  8.436   -4.136  1.00 7.48   ? 161 ILE A O   1 
ATOM   1367 C  CB  . ILE A 1 161 ? 1.688   10.585  -4.992  1.00 7.07   ? 161 ILE A CB  1 
ATOM   1368 C  CG1 . ILE A 1 161 ? 2.467   11.883  -4.681  1.00 8.02   ? 161 ILE A CG1 1 
ATOM   1369 C  CG2 . ILE A 1 161 ? 1.946   10.071  -6.379  1.00 8.87   ? 161 ILE A CG2 1 
ATOM   1370 C  CD1 . ILE A 1 161 ? 2.054   13.051  -5.558  1.00 9.44   ? 161 ILE A CD1 1 
ATOM   1371 N  N   . LEU A 1 162 ? -1.583  9.321   -5.579  1.00 7.08   ? 162 LEU A N   1 
ATOM   1372 C  CA  . LEU A 1 162 ? -2.309  8.045   -5.742  1.00 7.30   ? 162 LEU A CA  1 
ATOM   1373 C  C   . LEU A 1 162 ? -1.419  7.074   -6.458  1.00 7.59   ? 162 LEU A C   1 
ATOM   1374 O  O   . LEU A 1 162 ? -0.956  7.348   -7.589  1.00 9.66   ? 162 LEU A O   1 
ATOM   1375 C  CB  . LEU A 1 162 ? -3.577  8.250   -6.528  1.00 8.14   ? 162 LEU A CB  1 
ATOM   1376 C  CG  . LEU A 1 162 ? -4.457  7.027   -6.650  1.00 7.95   ? 162 LEU A CG  1 
ATOM   1377 C  CD1 . LEU A 1 162 ? -4.987  6.594   -5.267  1.00 8.20   ? 162 LEU A CD1 1 
ATOM   1378 C  CD2 . LEU A 1 162 ? -5.610  7.313   -7.595  1.00 9.52   ? 162 LEU A CD2 1 
ATOM   1379 N  N   . PHE A 1 163 ? -1.149  5.912   -5.864  1.00 7.32   ? 163 PHE A N   1 
ATOM   1380 C  CA  . PHE A 1 163 ? -0.410  4.843   -6.504  1.00 7.08   ? 163 PHE A CA  1 
ATOM   1381 C  C   . PHE A 1 163 ? -1.398  3.898   -7.159  1.00 6.75   ? 163 PHE A C   1 
ATOM   1382 O  O   . PHE A 1 163 ? -2.295  3.401   -6.484  1.00 8.15   ? 163 PHE A O   1 
ATOM   1383 C  CB  . PHE A 1 163 ? 0.428   4.085   -5.467  1.00 7.74   ? 163 PHE A CB  1 
ATOM   1384 C  CG  . PHE A 1 163 ? 1.430   3.127   -6.125  1.00 7.25   ? 163 PHE A CG  1 
ATOM   1385 C  CD1 . PHE A 1 163 ? 2.691   3.589   -6.502  1.00 8.82   ? 163 PHE A CD1 1 
ATOM   1386 C  CD2 . PHE A 1 163 ? 1.092   1.820   -6.377  1.00 7.92   ? 163 PHE A CD2 1 
ATOM   1387 C  CE1 . PHE A 1 163 ? 3.577   2.720   -7.114  1.00 9.02   ? 163 PHE A CE1 1 
ATOM   1388 C  CE2 . PHE A 1 163 ? 1.996   0.981   -6.999  1.00 9.05   ? 163 PHE A CE2 1 
ATOM   1389 C  CZ  . PHE A 1 163 ? 3.224   1.405   -7.385  1.00 8.83   ? 163 PHE A CZ  1 
ATOM   1390 N  N   . THR A 1 164 ? -1.259  3.690   -8.466  1.00 8.52   ? 164 THR A N   1 
ATOM   1391 C  CA  . THR A 1 164 ? -2.258  2.905   -9.193  1.00 8.63   ? 164 THR A CA  1 
ATOM   1392 C  C   . THR A 1 164 ? -2.277  1.447   -8.732  1.00 8.14   ? 164 THR A C   1 
ATOM   1393 O  O   . THR A 1 164 ? -1.254  0.805   -8.560  1.00 9.82   ? 164 THR A O   1 
ATOM   1394 C  CB  . THR A 1 164 ? -1.975  2.961   -10.699 1.00 10.07  ? 164 THR A CB  1 
ATOM   1395 O  OG1 . THR A 1 164 ? -2.086  4.316   -11.142 1.00 10.67  ? 164 THR A OG1 1 
ATOM   1396 C  CG2 . THR A 1 164 ? -2.980  2.137   -11.519 1.00 12.42  ? 164 THR A CG2 1 
ATOM   1397 N  N   . CYS A 1 165 ? -3.494  0.966   -8.546  1.00 8.74   ? 165 CYS A N   1 
ATOM   1398 C  CA  A CYS A 1 165 ? -3.761  -0.392  -8.065  0.72 8.45   ? 165 CYS A CA  1 
ATOM   1399 C  CA  B CYS A 1 165 ? -3.773  -0.381  -8.137  0.28 9.79   ? 165 CYS A CA  1 
ATOM   1400 C  C   . CYS A 1 165 ? -5.067  -0.820  -8.733  1.00 9.04   ? 165 CYS A C   1 
ATOM   1401 O  O   . CYS A 1 165 ? -5.866  0.072   -9.058  1.00 10.71  ? 165 CYS A O   1 
ATOM   1402 C  CB  A CYS A 1 165 ? -3.833  -0.436  -6.535  0.72 10.48  ? 165 CYS A CB  1 
ATOM   1403 C  CB  B CYS A 1 165 ? -3.936  -0.444  -6.603  0.28 14.99  ? 165 CYS A CB  1 
ATOM   1404 S  SG  A CYS A 1 165 ? -3.889  -2.057  -5.735  0.72 11.09  ? 165 CYS A SG  1 
ATOM   1405 S  SG  B CYS A 1 165 ? -2.245  -0.626  -6.021  0.28 17.20  ? 165 CYS A SG  1 
ATOM   1406 N  N   . CYS A 1 166 ? -5.334  -2.095  -8.844  1.00 9.66   ? 166 CYS A N   1 
ATOM   1407 C  CA  . CYS A 1 166 ? -6.550  -2.598  -9.506  1.00 11.05  ? 166 CYS A CA  1 
ATOM   1408 C  C   . CYS A 1 166 ? -7.808  -1.882  -9.066  1.00 9.29   ? 166 CYS A C   1 
ATOM   1409 O  O   . CYS A 1 166 ? -8.603  -1.536  -9.911  1.00 11.12  ? 166 CYS A O   1 
ATOM   1410 C  CB  . CYS A 1 166 ? -6.695  -4.124  -9.353  1.00 12.10  ? 166 CYS A CB  1 
ATOM   1411 S  SG  . CYS A 1 166 ? -6.752  -4.753  -7.638  1.00 15.84  ? 166 CYS A SG  1 
ATOM   1412 N  N   . HIS A 1 167 ? -7.982  -1.640  -7.747  1.00 8.79   ? 167 HIS A N   1 
ATOM   1413 C  CA  . HIS A 1 167 ? -9.247  -1.122  -7.234  1.00 8.09   ? 167 HIS A CA  1 
ATOM   1414 C  C   . HIS A 1 167 ? -9.451  0.371   -7.504  1.00 7.32   ? 167 HIS A C   1 
ATOM   1415 O  O   . HIS A 1 167 ? -10.590 0.883   -7.429  1.00 8.74   ? 167 HIS A O   1 
ATOM   1416 C  CB  . HIS A 1 167 ? -9.374  -1.386  -5.709  1.00 9.55   ? 167 HIS A CB  1 
ATOM   1417 C  CG  . HIS A 1 167 ? -8.305  -0.724  -4.908  1.00 8.68   ? 167 HIS A CG  1 
ATOM   1418 N  ND1 . HIS A 1 167 ? -8.352  0.614   -4.605  1.00 8.95   ? 167 HIS A ND1 1 
ATOM   1419 C  CD2 . HIS A 1 167 ? -7.143  -1.225  -4.400  1.00 11.07  ? 167 HIS A CD2 1 
ATOM   1420 C  CE1 . HIS A 1 167 ? -7.248  0.899   -3.914  1.00 9.57   ? 167 HIS A CE1 1 
ATOM   1421 N  NE2 . HIS A 1 167 ? -6.491  -0.186  -3.765  1.00 10.07  ? 167 HIS A NE2 1 
ATOM   1422 N  N   . ASN A 1 168 ? -8.368  1.102   -7.806  1.00 7.72   ? 168 ASN A N   1 
ATOM   1423 C  CA  . ASN A 1 168 ? -8.435  2.548   -8.056  1.00 7.42   ? 168 ASN A CA  1 
ATOM   1424 C  C   . ASN A 1 168 ? -8.206  2.880   -9.532  1.00 8.25   ? 168 ASN A C   1 
ATOM   1425 O  O   . ASN A 1 168 ? -8.295  4.064   -9.883  1.00 9.14   ? 168 ASN A O   1 
ATOM   1426 C  CB  . ASN A 1 168 ? -7.496  3.337   -7.134  1.00 7.46   ? 168 ASN A CB  1 
ATOM   1427 C  CG  . ASN A 1 168 ? -6.019  3.168   -7.439  1.00 7.18   ? 168 ASN A CG  1 
ATOM   1428 O  OD1 . ASN A 1 168 ? -5.618  3.104   -8.623  1.00 7.77   ? 168 ASN A OD1 1 
ATOM   1429 N  ND2 . ASN A 1 168 ? -5.204  3.115   -6.403  1.00 7.33   ? 168 ASN A ND2 1 
ATOM   1430 N  N   . ARG A 1 169 ? -7.930  1.889   -10.390 1.00 9.04   ? 169 ARG A N   1 
ATOM   1431 C  CA  . ARG A 1 169 ? -7.520  2.173   -11.782 1.00 10.26  ? 169 ARG A CA  1 
ATOM   1432 C  C   . ARG A 1 169 ? -8.578  2.964   -12.526 1.00 9.94   ? 169 ARG A C   1 
ATOM   1433 O  O   . ARG A 1 169 ? -8.286  3.786   -13.379 1.00 11.31  ? 169 ARG A O   1 
ATOM   1434 C  CB  . ARG A 1 169 ? -7.247  0.859   -12.507 1.00 11.20  ? 169 ARG A CB  1 
ATOM   1435 C  CG  . ARG A 1 169 ? -6.550  1.034   -13.860 1.00 14.83  ? 169 ARG A CG  1 
ATOM   1436 C  CD  . ARG A 1 169 ? -6.153  -0.270  -14.545 1.00 16.59  ? 169 ARG A CD  1 
ATOM   1437 N  NE  . ARG A 1 169 ? -5.525  -1.239  -13.676 1.00 18.93  ? 169 ARG A NE  1 
ATOM   1438 C  CZ  . ARG A 1 169 ? -4.261  -1.285  -13.329 1.00 16.60  ? 169 ARG A CZ  1 
ATOM   1439 N  NH1 . ARG A 1 169 ? -3.431  -0.349  -13.783 1.00 25.74  ? 169 ARG A NH1 1 
ATOM   1440 N  NH2 . ARG A 1 169 ? -3.866  -2.269  -12.508 1.00 26.98  ? 169 ARG A NH2 1 
ATOM   1441 N  N   . HIS A 1 170 ? -9.868  2.698   -12.221 1.00 10.37  ? 170 HIS A N   1 
ATOM   1442 C  CA  . HIS A 1 170 ? -10.978 3.303   -12.901 1.00 10.56  ? 170 HIS A CA  1 
ATOM   1443 C  C   . HIS A 1 170 ? -11.095 4.793   -12.644 1.00 9.92   ? 170 HIS A C   1 
ATOM   1444 O  O   . HIS A 1 170 ? -11.741 5.509   -13.451 1.00 11.23  ? 170 HIS A O   1 
ATOM   1445 C  CB  . HIS A 1 170 ? -12.309 2.618   -12.484 1.00 11.63  ? 170 HIS A CB  1 
ATOM   1446 C  CG  . HIS A 1 170 ? -12.658 2.889   -11.023 1.00 10.95  ? 170 HIS A CG  1 
ATOM   1447 N  ND1 . HIS A 1 170 ? -13.669 3.759   -10.634 1.00 13.51  ? 170 HIS A ND1 1 
ATOM   1448 C  CD2 . HIS A 1 170 ? -12.153 2.401   -9.888  1.00 10.61  ? 170 HIS A CD2 1 
ATOM   1449 C  CE1 . HIS A 1 170 ? -13.733 3.811   -9.316  1.00 13.47  ? 170 HIS A CE1 1 
ATOM   1450 N  NE2 . HIS A 1 170 ? -12.822 2.972   -8.832  1.00 11.48  ? 170 HIS A NE2 1 
ATOM   1451 N  N   . LEU A 1 171 ? -10.541 5.277   -11.552 1.00 9.81   ? 171 LEU A N   1 
ATOM   1452 C  CA  . LEU A 1 171 ? -10.646 6.697   -11.228 1.00 8.85   ? 171 LEU A CA  1 
ATOM   1453 C  C   . LEU A 1 171 ? -9.836  7.536   -12.209 1.00 9.06   ? 171 LEU A C   1 
ATOM   1454 O  O   . LEU A 1 171 ? -8.769  7.116   -12.659 1.00 9.97   ? 171 LEU A O   1 
ATOM   1455 C  CB  . LEU A 1 171 ? -10.167 6.923   -9.832  1.00 9.93   ? 171 LEU A CB  1 
ATOM   1456 C  CG  . LEU A 1 171 ? -10.931 6.270   -8.677  1.00 9.90   ? 171 LEU A CG  1 
ATOM   1457 C  CD1 . LEU A 1 171 ? -10.215 6.461   -7.361  1.00 11.44  ? 171 LEU A CD1 1 
ATOM   1458 C  CD2 . LEU A 1 171 ? -12.359 6.832   -8.560  1.00 13.23  ? 171 LEU A CD2 1 
ATOM   1459 N  N   . VAL A 1 172 ? -10.324 8.742   -12.479 1.00 9.43   ? 172 VAL A N   1 
ATOM   1460 C  CA  . VAL A 1 172 ? -9.626  9.735   -13.257 1.00 10.15  ? 172 VAL A CA  1 
ATOM   1461 C  C   . VAL A 1 172 ? -9.376  10.957  -12.395 1.00 10.52  ? 172 VAL A C   1 
ATOM   1462 O  O   . VAL A 1 172 ? -10.305 11.575  -11.876 1.00 14.23  ? 172 VAL A O   1 
ATOM   1463 C  CB  . VAL A 1 172 ? -10.405 10.119  -14.535 1.00 10.23  ? 172 VAL A CB  1 
ATOM   1464 C  CG1 . VAL A 1 172 ? -9.705  11.228  -15.299 1.00 14.63  ? 172 VAL A CG1 1 
ATOM   1465 C  CG2 . VAL A 1 172 ? -10.621 8.887   -15.397 1.00 12.53  ? 172 VAL A CG2 1 
ATOM   1466 N  N   . LEU A 1 173 ? -8.082  11.241  -12.199 1.00 10.04  ? 173 LEU A N   1 
ATOM   1467 C  CA  . LEU A 1 173 ? -7.738  12.385  -11.357 1.00 10.36  ? 173 LEU A CA  1 
ATOM   1468 C  C   . LEU A 1 173 ? -7.930  13.671  -12.174 1.00 12.02  ? 173 LEU A C   1 
ATOM   1469 O  O   . LEU A 1 173 ? -7.706  13.674  -13.385 1.00 13.51  ? 173 LEU A O   1 
ATOM   1470 C  CB  . LEU A 1 173 ? -6.315  12.284  -10.858 1.00 10.77  ? 173 LEU A CB  1 
ATOM   1471 C  CG  . LEU A 1 173 ? -6.044  11.155  -9.883  1.00 13.94  ? 173 LEU A CG  1 
ATOM   1472 C  CD1 . LEU A 1 173 ? -4.696  11.320  -9.219  1.00 14.25  ? 173 LEU A CD1 1 
ATOM   1473 C  CD2 . LEU A 1 173 ? -7.079  10.959  -8.795  1.00 19.77  ? 173 LEU A CD2 1 
ATOM   1474 N  N   . PRO A 1 174 ? -8.281  14.764  -11.534 1.00 13.24  ? 174 PRO A N   1 
ATOM   1475 C  CA  . PRO A 1 174 ? -8.332  16.047  -12.228 1.00 15.13  ? 174 PRO A CA  1 
ATOM   1476 C  C   . PRO A 1 174 ? -6.912  16.502  -12.488 1.00 14.27  ? 174 PRO A C   1 
ATOM   1477 O  O   . PRO A 1 174 ? -5.952  16.031  -11.872 1.00 15.42  ? 174 PRO A O   1 
ATOM   1478 C  CB  . PRO A 1 174 ? -9.014  16.998  -11.233 1.00 17.98  ? 174 PRO A CB  1 
ATOM   1479 C  CG  . PRO A 1 174 ? -8.663  16.396  -9.914  1.00 16.31  ? 174 PRO A CG  1 
ATOM   1480 C  CD  . PRO A 1 174 ? -8.618  14.882  -10.123 1.00 13.61  ? 174 PRO A CD  1 
ATOM   1481 N  N   . PRO A 1 175 ? -6.777  17.449  -13.411 1.00 16.59  ? 175 PRO A N   1 
ATOM   1482 C  CA  . PRO A 1 175 ? -5.438  17.921  -13.787 1.00 18.59  ? 175 PRO A CA  1 
ATOM   1483 C  C   . PRO A 1 175 ? -4.636  18.535  -12.656 1.00 19.22  ? 175 PRO A C   1 
ATOM   1484 O  O   . PRO A 1 175 ? -3.403  18.757  -12.755 1.00 22.54  ? 175 PRO A O   1 
ATOM   1485 C  CB  . PRO A 1 175 ? -5.702  18.967  -14.869 1.00 22.45  ? 175 PRO A CB  1 
ATOM   1486 C  CG  . PRO A 1 175 ? -7.136  18.843  -15.236 1.00 25.19  ? 175 PRO A CG  1 
ATOM   1487 C  CD  . PRO A 1 175 ? -7.867  18.051  -14.229 1.00 19.47  ? 175 PRO A CD  1 
ATOM   1488 N  N   . THR A 1 176 ? -5.248  18.864  -11.529 1.00 18.45  ? 176 THR A N   1 
ATOM   1489 C  CA  . THR A 1 176 ? -4.572  19.439  -10.387 1.00 18.86  ? 176 THR A CA  1 
ATOM   1490 C  C   . THR A 1 176 ? -3.935  18.393  -9.485  1.00 19.07  ? 176 THR A C   1 
ATOM   1491 O  O   . THR A 1 176 ? -3.314  18.751  -8.476  1.00 22.21  ? 176 THR A O   1 
ATOM   1492 C  CB  . THR A 1 176 ? -5.595  20.206  -9.526  1.00 20.69  ? 176 THR A CB  1 
ATOM   1493 O  OG1 . THR A 1 176 ? -6.696  19.327  -9.288  1.00 20.13  ? 176 THR A OG1 1 
ATOM   1494 C  CG2 . THR A 1 176 ? -6.047  21.506  -10.213 1.00 26.73  ? 176 THR A CG2 1 
ATOM   1495 N  N   . ARG A 1 177 ? -4.074  17.130  -9.847  1.00 16.27  ? 177 ARG A N   1 
ATOM   1496 C  CA  . ARG A 1 177 ? -3.519  16.040  -9.093  1.00 13.96  ? 177 ARG A CA  1 
ATOM   1497 C  C   . ARG A 1 177 ? -2.695  15.097  -9.980  1.00 16.67  ? 177 ARG A C   1 
ATOM   1498 O  O   . ARG A 1 177 ? -2.843  15.065  -11.181 1.00 22.36  ? 177 ARG A O   1 
ATOM   1499 C  CB  . ARG A 1 177 ? -4.612  15.244  -8.370  1.00 15.05  ? 177 ARG A CB  1 
ATOM   1500 C  CG  . ARG A 1 177 ? -5.230  16.107  -7.264  1.00 15.51  ? 177 ARG A CG  1 
ATOM   1501 C  CD  . ARG A 1 177 ? -6.313  15.412  -6.475  1.00 17.17  ? 177 ARG A CD  1 
ATOM   1502 N  NE  . ARG A 1 177 ? -5.802  14.083  -6.088  1.00 15.75  ? 177 ARG A NE  1 
ATOM   1503 C  CZ  . ARG A 1 177 ? -6.497  12.980  -5.956  1.00 14.64  ? 177 ARG A CZ  1 
ATOM   1504 N  NH1 . ARG A 1 177 ? -5.908  11.856  -5.639  1.00 14.85  ? 177 ARG A NH1 1 
ATOM   1505 N  NH2 . ARG A 1 177 ? -7.810  12.974  -6.159  1.00 17.77  ? 177 ARG A NH2 1 
ATOM   1506 N  N   . ARG A 1 178 ? -1.853  14.309  -9.301  1.00 17.36  ? 178 ARG A N   1 
ATOM   1507 C  CA  A ARG A 1 178 ? -0.974  13.365  -9.931  0.69 16.31  ? 178 ARG A CA  1 
ATOM   1508 C  CA  B ARG A 1 178 ? -0.948  13.371  -9.914  0.31 16.81  ? 178 ARG A CA  1 
ATOM   1509 C  C   . ARG A 1 178 ? -1.110  11.929  -9.415  1.00 13.27  ? 178 ARG A C   1 
ATOM   1510 O  O   . ARG A 1 178 ? -1.317  11.729  -8.219  1.00 15.80  ? 178 ARG A O   1 
ATOM   1511 C  CB  A ARG A 1 178 ? 0.491   13.701  -9.626  0.69 21.45  ? 178 ARG A CB  1 
ATOM   1512 C  CB  B ARG A 1 178 ? 0.505   13.807  -9.622  0.31 18.66  ? 178 ARG A CB  1 
ATOM   1513 C  CG  A ARG A 1 178 ? 0.848   15.134  -9.408  0.69 20.84  ? 178 ARG A CG  1 
ATOM   1514 C  CG  B ARG A 1 178 ? 1.495   12.692  -9.998  0.31 11.85  ? 178 ARG A CG  1 
ATOM   1515 C  CD  A ARG A 1 178 ? 2.366   15.270  -9.361  0.69 18.79  ? 178 ARG A CD  1 
ATOM   1516 C  CD  B ARG A 1 178 ? 1.599   12.678  -11.531 0.31 13.06  ? 178 ARG A CD  1 
ATOM   1517 N  NE  A ARG A 1 178 ? 2.747   15.928  -8.104  0.69 16.25  ? 178 ARG A NE  1 
ATOM   1518 N  NE  B ARG A 1 178 ? 2.304   11.485  -11.976 0.31 14.62  ? 178 ARG A NE  1 
ATOM   1519 C  CZ  A ARG A 1 178 ? 3.892   16.574  -7.930  0.69 12.87  ? 178 ARG A CZ  1 
ATOM   1520 C  CZ  B ARG A 1 178 ? 3.618   11.430  -12.217 0.31 14.11  ? 178 ARG A CZ  1 
ATOM   1521 N  NH1 A ARG A 1 178 ? 4.783   16.657  -8.886  0.69 15.43  ? 178 ARG A NH1 1 
ATOM   1522 N  NH1 B ARG A 1 178 ? 4.443   12.459  -12.084 0.31 17.91  ? 178 ARG A NH1 1 
ATOM   1523 N  NH2 A ARG A 1 178 ? 4.129   17.142  -6.766  0.69 12.29  ? 178 ARG A NH2 1 
ATOM   1524 N  NH2 B ARG A 1 178 ? 4.103   10.261  -12.613 0.31 14.46  ? 178 ARG A NH2 1 
ATOM   1525 N  N   . ARG A 1 179 ? -0.977  11.008  -10.316 1.00 17.60  ? 179 ARG A N   1 
ATOM   1526 C  CA  . ARG A 1 179 ? -1.035  9.573   -10.159 1.00 16.15  ? 179 ARG A CA  1 
ATOM   1527 C  C   . ARG A 1 179 ? 0.360   9.033   -10.452 1.00 15.20  ? 179 ARG A C   1 
ATOM   1528 O  O   . ARG A 1 179 ? 0.963   9.439   -11.464 1.00 23.29  ? 179 ARG A O   1 
ATOM   1529 C  CB  . ARG A 1 179 ? -2.095  8.995   -11.112 1.00 19.95  ? 179 ARG A CB  1 
ATOM   1530 C  CG  . ARG A 1 179 ? -2.306  7.505   -11.206 1.00 19.74  ? 179 ARG A CG  1 
ATOM   1531 C  CD  . ARG A 1 179 ? -3.359  7.084   -12.191 1.00 20.06  ? 179 ARG A CD  1 
ATOM   1532 N  NE  . ARG A 1 179 ? -4.763  7.052   -11.873 1.00 17.62  ? 179 ARG A NE  1 
ATOM   1533 C  CZ  . ARG A 1 179 ? -5.421  6.212   -11.138 1.00 10.99  ? 179 ARG A CZ  1 
ATOM   1534 N  NH1 . ARG A 1 179 ? -6.756  6.288   -10.934 1.00 17.47  ? 179 ARG A NH1 1 
ATOM   1535 N  NH2 . ARG A 1 179 ? -4.889  5.191   -10.511 1.00 14.73  ? 179 ARG A NH2 1 
ATOM   1536 N  N   . LEU A 1 180 ? 0.886   8.114   -9.669  1.00 10.54  ? 180 LEU A N   1 
ATOM   1537 C  CA  A LEU A 1 180 ? 2.003   7.246   -10.053 0.45 10.73  ? 180 LEU A CA  1 
ATOM   1538 C  CA  B LEU A 1 180 ? 1.954   7.252   -10.104 0.55 9.20   ? 180 LEU A CA  1 
ATOM   1539 C  C   . LEU A 1 180 ? 1.378   5.979   -10.673 1.00 10.02  ? 180 LEU A C   1 
ATOM   1540 O  O   . LEU A 1 180 ? 0.693   5.251   -9.972  1.00 11.48  ? 180 LEU A O   1 
ATOM   1541 C  CB  A LEU A 1 180 ? 2.910   7.113   -8.821  0.45 9.08   ? 180 LEU A CB  1 
ATOM   1542 C  CB  B LEU A 1 180 ? 2.901   6.734   -9.015  0.55 12.55  ? 180 LEU A CB  1 
ATOM   1543 C  CG  A LEU A 1 180 ? 4.294   6.520   -8.957  0.45 8.92   ? 180 LEU A CG  1 
ATOM   1544 C  CG  B LEU A 1 180 ? 3.932   7.780   -8.657  0.55 8.91   ? 180 LEU A CG  1 
ATOM   1545 C  CD1 A LEU A 1 180 ? 5.178   7.345   -9.876  0.45 8.00   ? 180 LEU A CD1 1 
ATOM   1546 C  CD1 B LEU A 1 180 ? 4.520   7.392   -7.313  0.55 11.17  ? 180 LEU A CD1 1 
ATOM   1547 C  CD2 A LEU A 1 180 ? 5.019   6.377   -7.622  0.45 12.79  ? 180 LEU A CD2 1 
ATOM   1548 C  CD2 B LEU A 1 180 ? 4.950   7.942   -9.779  0.55 9.52   ? 180 LEU A CD2 1 
ATOM   1549 N  N   . LEU A 1 181 ? 1.659   5.733   -11.948 1.00 9.77   ? 181 LEU A N   1 
ATOM   1550 C  CA  . LEU A 1 181 ? 1.118   4.562   -12.617 1.00 10.38  ? 181 LEU A CA  1 
ATOM   1551 C  C   . LEU A 1 181 ? 1.741   3.276   -12.070 1.00 10.07  ? 181 LEU A C   1 
ATOM   1552 O  O   . LEU A 1 181 ? 1.095   2.246   -12.110 1.00 10.66  ? 181 LEU A O   1 
ATOM   1553 C  CB  . LEU A 1 181 ? 1.297   4.669   -14.123 1.00 10.95  ? 181 LEU A CB  1 
ATOM   1554 C  CG  . LEU A 1 181 ? 0.476   5.719   -14.830 1.00 17.49  ? 181 LEU A CG  1 
ATOM   1555 C  CD1 . LEU A 1 181 ? 0.917   5.797   -16.298 1.00 20.97  ? 181 LEU A CD1 1 
ATOM   1556 C  CD2 . LEU A 1 181 ? -1.021  5.436   -14.769 1.00 25.53  ? 181 LEU A CD2 1 
ATOM   1557 N  N   . SER A 1 182 ? 2.985   3.324   -11.657 1.00 9.09   ? 182 SER A N   1 
ATOM   1558 C  CA  . SER A 1 182 ? 3.786   2.199   -11.190 1.00 9.40   ? 182 SER A CA  1 
ATOM   1559 C  C   . SER A 1 182 ? 5.089   2.770   -10.685 1.00 8.73   ? 182 SER A C   1 
ATOM   1560 O  O   . SER A 1 182 ? 5.378   3.964   -10.849 1.00 10.01  ? 182 SER A O   1 
ATOM   1561 C  CB  . SER A 1 182 ? 4.029   1.171   -12.313 1.00 10.65  ? 182 SER A CB  1 
ATOM   1562 O  OG  . SER A 1 182 ? 4.942   1.732   -13.221 1.00 12.61  ? 182 SER A OG  1 
ATOM   1563 N  N   . TRP A 1 183 ? 5.977   1.922   -10.185 1.00 8.85   ? 183 TRP A N   1 
ATOM   1564 C  CA  . TRP A 1 183 ? 7.296   2.384   -9.733  1.00 9.00   ? 183 TRP A CA  1 
ATOM   1565 C  C   . TRP A 1 183 ? 8.230   2.724   -10.874 1.00 10.15  ? 183 TRP A C   1 
ATOM   1566 O  O   . TRP A 1 183 ? 9.227   3.407   -10.699 1.00 13.06  ? 183 TRP A O   1 
ATOM   1567 C  CB  . TRP A 1 183 ? 7.910   1.376   -8.791  1.00 9.60   ? 183 TRP A CB  1 
ATOM   1568 C  CG  . TRP A 1 183 ? 7.330   1.471   -7.402  1.00 8.20   ? 183 TRP A CG  1 
ATOM   1569 C  CD1 . TRP A 1 183 ? 6.540   0.587   -6.773  1.00 7.71   ? 183 TRP A CD1 1 
ATOM   1570 C  CD2 . TRP A 1 183 ? 7.484   2.587   -6.494  1.00 8.16   ? 183 TRP A CD2 1 
ATOM   1571 N  NE1 . TRP A 1 183 ? 6.219   1.042   -5.536  1.00 7.49   ? 183 TRP A NE1 1 
ATOM   1572 C  CE2 . TRP A 1 183 ? 6.770   2.268   -5.316  1.00 7.63   ? 183 TRP A CE2 1 
ATOM   1573 C  CE3 . TRP A 1 183 ? 8.159   3.811   -6.577  1.00 9.38   ? 183 TRP A CE3 1 
ATOM   1574 C  CZ2 . TRP A 1 183 ? 6.743   3.136   -4.256  1.00 8.57   ? 183 TRP A CZ2 1 
ATOM   1575 C  CZ3 . TRP A 1 183 ? 8.124   4.673   -5.498  1.00 9.66   ? 183 TRP A CZ3 1 
ATOM   1576 C  CH2 . TRP A 1 183 ? 7.416   4.325   -4.355  1.00 9.72   ? 183 TRP A CH2 1 
ATOM   1577 N  N   . SER A 1 184 ? 7.976   2.325   -12.074 1.00 11.86  ? 184 SER A N   1 
ATOM   1578 C  CA  A SER A 1 184 ? 8.647   2.817   -13.294 0.65 11.78  ? 184 SER A CA  1 
ATOM   1579 C  CA  B SER A 1 184 ? 8.595   2.757   -13.325 0.35 12.71  ? 184 SER A CA  1 
ATOM   1580 C  C   . SER A 1 184 ? 8.158   4.145   -13.777 1.00 11.82  ? 184 SER A C   1 
ATOM   1581 O  O   . SER A 1 184 ? 8.815   4.689   -14.735 1.00 14.73  ? 184 SER A O   1 
ATOM   1582 C  CB  A SER A 1 184 ? 8.570   1.719   -14.373 0.65 13.80  ? 184 SER A CB  1 
ATOM   1583 C  CB  B SER A 1 184 ? 8.252   1.815   -14.488 0.35 12.13  ? 184 SER A CB  1 
ATOM   1584 O  OG  A SER A 1 184 ? 7.337   1.671   -15.057 0.65 15.66  ? 184 SER A OG  1 
ATOM   1585 O  OG  B SER A 1 184 ? 8.742   0.531   -14.184 0.35 17.60  ? 184 SER A OG  1 
ATOM   1586 N  N   A ASP A 1 185 ? 7.189   4.878   -13.263 0.57 9.15   ? 185 ASP A N   1 
ATOM   1587 N  N   B ASP A 1 185 ? 7.149   4.613   -13.129 0.43 14.28  ? 185 ASP A N   1 
ATOM   1588 C  CA  A ASP A 1 185 ? 6.524   6.093   -13.729 0.57 8.93   ? 185 ASP A CA  1 
ATOM   1589 C  CA  B ASP A 1 185 ? 6.767   5.976   -13.508 0.43 12.61  ? 185 ASP A CA  1 
ATOM   1590 C  C   A ASP A 1 185 ? 7.119   7.404   -13.171 0.57 7.85   ? 185 ASP A C   1 
ATOM   1591 C  C   B ASP A 1 185 ? 7.829   6.857   -12.837 0.43 13.21  ? 185 ASP A C   1 
ATOM   1592 O  O   A ASP A 1 185 ? 6.463   8.392   -12.893 0.57 8.36   ? 185 ASP A O   1 
ATOM   1593 O  O   B ASP A 1 185 ? 8.706   6.377   -12.101 0.43 12.18  ? 185 ASP A O   1 
ATOM   1594 C  CB  A ASP A 1 185 ? 5.030   6.022   -13.462 0.57 9.33   ? 185 ASP A CB  1 
ATOM   1595 C  CB  B ASP A 1 185 ? 5.330   6.176   -13.139 0.43 12.53  ? 185 ASP A CB  1 
ATOM   1596 C  CG  A ASP A 1 185 ? 4.172   7.073   -14.092 0.57 8.87   ? 185 ASP A CG  1 
ATOM   1597 C  CG  B ASP A 1 185 ? 4.629   7.409   -13.641 0.43 11.39  ? 185 ASP A CG  1 
ATOM   1598 O  OD1 A ASP A 1 185 ? 4.466   7.489   -15.251 0.57 9.80   ? 185 ASP A OD1 1 
ATOM   1599 O  OD1 B ASP A 1 185 ? 5.275   8.066   -14.529 0.43 20.68  ? 185 ASP A OD1 1 
ATOM   1600 O  OD2 A ASP A 1 185 ? 3.185   7.555   -13.514 0.57 9.02   ? 185 ASP A OD2 1 
ATOM   1601 O  OD2 B ASP A 1 185 ? 3.530   7.778   -13.188 0.43 12.33  ? 185 ASP A OD2 1 
ATOM   1602 N  N   A ASN A 1 186 ? 8.449   7.414   -13.126 0.57 8.01   ? 186 ASN A N   1 
ATOM   1603 N  N   B ASN A 1 186 ? 7.752   8.140   -13.135 0.43 11.89  ? 186 ASN A N   1 
ATOM   1604 C  CA  A ASN A 1 186 ? 9.323   8.556   -12.868 0.57 8.18   ? 186 ASN A CA  1 
ATOM   1605 C  CA  B ASN A 1 186 ? 8.914   8.992   -12.800 0.43 8.63   ? 186 ASN A CA  1 
ATOM   1606 C  C   A ASN A 1 186 ? 8.983   9.262   -11.571 0.57 9.29   ? 186 ASN A C   1 
ATOM   1607 C  C   B ASN A 1 186 ? 8.702   9.535   -11.407 0.43 10.30  ? 186 ASN A C   1 
ATOM   1608 O  O   A ASN A 1 186 ? 8.720   10.469  -11.488 0.57 10.79  ? 186 ASN A O   1 
ATOM   1609 O  O   B ASN A 1 186 ? 8.311   10.698  -11.233 0.43 11.31  ? 186 ASN A O   1 
ATOM   1610 C  CB  A ASN A 1 186 ? 9.234   9.493   -14.082 0.57 10.95  ? 186 ASN A CB  1 
ATOM   1611 C  CB  B ASN A 1 186 ? 9.007   9.893   -14.029 0.43 8.52   ? 186 ASN A CB  1 
ATOM   1612 C  CG  A ASN A 1 186 ? 9.611   8.697   -15.326 0.57 25.40  ? 186 ASN A CG  1 
ATOM   1613 C  CG  B ASN A 1 186 ? 9.586   9.035   -15.167 0.43 8.45   ? 186 ASN A CG  1 
ATOM   1614 O  OD1 A ASN A 1 186 ? 8.801   8.637   -16.253 0.57 16.17  ? 186 ASN A OD1 1 
ATOM   1615 O  OD1 B ASN A 1 186 ? 10.745  8.650   -15.307 0.43 10.08  ? 186 ASN A OD1 1 
ATOM   1616 N  ND2 A ASN A 1 186 ? 10.785  8.074   -15.371 0.57 32.30  ? 186 ASN A ND2 1 
ATOM   1617 N  ND2 B ASN A 1 186 ? 8.635   8.684   -16.043 0.43 41.47  ? 186 ASN A ND2 1 
ATOM   1618 N  N   . TRP A 1 187 ? 8.955   8.582   -10.450 1.00 10.76  ? 187 TRP A N   1 
ATOM   1619 C  CA  . TRP A 1 187 ? 8.779   9.090   -9.077  1.00 9.96   ? 187 TRP A CA  1 
ATOM   1620 C  C   . TRP A 1 187 ? 9.821   10.145  -8.704  1.00 9.16   ? 187 TRP A C   1 
ATOM   1621 O  O   . TRP A 1 187 ? 9.535   11.039  -7.900  1.00 9.87   ? 187 TRP A O   1 
ATOM   1622 C  CB  . TRP A 1 187 ? 8.789   7.925   -8.102  1.00 10.53  ? 187 TRP A CB  1 
ATOM   1623 C  CG  . TRP A 1 187 ? 9.995   7.097   -8.081  1.00 9.21   ? 187 TRP A CG  1 
ATOM   1624 C  CD1 . TRP A 1 187 ? 10.148  5.898   -8.759  1.00 10.80  ? 187 TRP A CD1 1 
ATOM   1625 C  CD2 . TRP A 1 187 ? 11.232  7.291   -7.381  1.00 9.40   ? 187 TRP A CD2 1 
ATOM   1626 N  NE1 . TRP A 1 187 ? 11.380  5.359   -8.529  1.00 10.87  ? 187 TRP A NE1 1 
ATOM   1627 C  CE2 . TRP A 1 187 ? 12.073  6.211   -7.670  1.00 9.96   ? 187 TRP A CE2 1 
ATOM   1628 C  CE3 . TRP A 1 187 ? 11.723  8.262   -6.529  1.00 9.58   ? 187 TRP A CE3 1 
ATOM   1629 C  CZ2 . TRP A 1 187 ? 13.350  6.067   -7.167  1.00 11.45  ? 187 TRP A CZ2 1 
ATOM   1630 C  CZ3 . TRP A 1 187 ? 12.997  8.167   -6.001  1.00 10.14  ? 187 TRP A CZ3 1 
ATOM   1631 C  CH2 . TRP A 1 187 ? 13.797  7.081   -6.329  1.00 11.22  ? 187 TRP A CH2 1 
ATOM   1632 N  N   . ARG A 1 188 ? 11.028  10.067  -9.292  1.00 9.45   ? 188 ARG A N   1 
ATOM   1633 C  CA  . ARG A 1 188 ? 12.041  11.059  -8.920  1.00 9.23   ? 188 ARG A CA  1 
ATOM   1634 C  C   . ARG A 1 188 ? 11.567  12.465  -9.240  1.00 10.14  ? 188 ARG A C   1 
ATOM   1635 O  O   . ARG A 1 188 ? 11.899  13.422  -8.494  1.00 10.21  ? 188 ARG A O   1 
ATOM   1636 C  CB  . ARG A 1 188 ? 13.347  10.774  -9.655  1.00 10.53  ? 188 ARG A CB  1 
ATOM   1637 C  CG  . ARG A 1 188 ? 14.098  9.580   -9.140  1.00 11.08  ? 188 ARG A CG  1 
ATOM   1638 C  CD  . ARG A 1 188 ? 15.208  9.221   -10.071 1.00 11.88  ? 188 ARG A CD  1 
ATOM   1639 N  NE  . ARG A 1 188 ? 16.049  8.161   -9.545  1.00 12.59  ? 188 ARG A NE  1 
ATOM   1640 C  CZ  . ARG A 1 188 ? 15.765  6.886   -9.628  1.00 12.22  ? 188 ARG A CZ  1 
ATOM   1641 N  NH1 . ARG A 1 188 ? 14.658  6.459   -10.202 1.00 12.97  ? 188 ARG A NH1 1 
ATOM   1642 N  NH2 . ARG A 1 188 ? 16.585  5.957   -9.130  1.00 14.48  ? 188 ARG A NH2 1 
ATOM   1643 N  N   . GLU A 1 189 ? 10.798  12.670  -10.314 1.00 9.90   ? 189 GLU A N   1 
ATOM   1644 C  CA  . GLU A 1 189 ? 10.339  13.992  -10.681 1.00 10.58  ? 189 GLU A CA  1 
ATOM   1645 C  C   . GLU A 1 189 ? 9.353   14.538  -9.652  1.00 11.04  ? 189 GLU A C   1 
ATOM   1646 O  O   . GLU A 1 189 ? 9.301   15.727  -9.389  1.00 11.51  ? 189 GLU A O   1 
ATOM   1647 C  CB  . GLU A 1 189 ? 9.658   13.987  -12.083 1.00 12.79  ? 189 GLU A CB  1 
ATOM   1648 C  CG  . GLU A 1 189 ? 10.654  13.745  -13.179 1.00 17.51  ? 189 GLU A CG  1 
ATOM   1649 C  CD  . GLU A 1 189 ? 10.157  13.161  -14.476 1.00 17.70  ? 189 GLU A CD  1 
ATOM   1650 O  OE1 . GLU A 1 189 ? 8.951   13.293  -14.757 1.00 19.04  ? 189 GLU A OE1 1 
ATOM   1651 O  OE2 . GLU A 1 189 ? 11.014  12.667  -15.251 1.00 20.95  ? 189 GLU A OE2 1 
ATOM   1652 N  N   . ILE A 1 190 ? 8.522   13.661  -9.077  1.00 10.21  ? 190 ILE A N   1 
ATOM   1653 C  CA  . ILE A 1 190 ? 7.596   14.080  -8.011  1.00 10.56  ? 190 ILE A CA  1 
ATOM   1654 C  C   . ILE A 1 190 ? 8.364   14.542  -6.784  1.00 9.15   ? 190 ILE A C   1 
ATOM   1655 O  O   . ILE A 1 190 ? 8.123   15.613  -6.245  1.00 10.27  ? 190 ILE A O   1 
ATOM   1656 C  CB  . ILE A 1 190 ? 6.634   12.924  -7.697  1.00 10.36  ? 190 ILE A CB  1 
ATOM   1657 C  CG1 . ILE A 1 190 ? 5.889   12.450  -8.947  1.00 12.44  ? 190 ILE A CG1 1 
ATOM   1658 C  CG2 . ILE A 1 190 ? 5.713   13.355  -6.587  1.00 11.98  ? 190 ILE A CG2 1 
ATOM   1659 C  CD1 . ILE A 1 190 ? 4.957   11.246  -8.670  1.00 14.30  ? 190 ILE A CD1 1 
ATOM   1660 N  N   . LEU A 1 191 ? 9.379   13.782  -6.368  1.00 8.70   ? 191 LEU A N   1 
ATOM   1661 C  CA  . LEU A 1 191 ? 10.196  14.240  -5.253  1.00 8.59   ? 191 LEU A CA  1 
ATOM   1662 C  C   . LEU A 1 191 ? 10.882  15.567  -5.585  1.00 9.75   ? 191 LEU A C   1 
ATOM   1663 O  O   . LEU A 1 191 ? 10.957  16.476  -4.735  1.00 10.29  ? 191 LEU A O   1 
ATOM   1664 C  CB  . LEU A 1 191 ? 11.246  13.239  -4.859  1.00 9.29   ? 191 LEU A CB  1 
ATOM   1665 C  CG  . LEU A 1 191 ? 10.847  12.109  -3.908  1.00 9.25   ? 191 LEU A CG  1 
ATOM   1666 C  CD1 . LEU A 1 191 ? 9.687   11.276  -4.470  1.00 9.89   ? 191 LEU A CD1 1 
ATOM   1667 C  CD2 . LEU A 1 191 ? 12.005  11.228  -3.597  1.00 10.68  ? 191 LEU A CD2 1 
ATOM   1668 N  N   . ASP A 1 192 ? 11.378  15.706  -6.816  1.00 10.54  ? 192 ASP A N   1 
ATOM   1669 C  CA  . ASP A 1 192 ? 12.074  16.933  -7.195  1.00 12.13  ? 192 ASP A CA  1 
ATOM   1670 C  C   . ASP A 1 192 ? 11.184  18.147  -7.112  1.00 13.56  ? 192 ASP A C   1 
ATOM   1671 O  O   . ASP A 1 192 ? 11.683  19.280  -6.850  1.00 15.13  ? 192 ASP A O   1 
ATOM   1672 C  CB  . ASP A 1 192 ? 12.680  16.780  -8.587  1.00 13.54  ? 192 ASP A CB  1 
ATOM   1673 C  CG  . ASP A 1 192 ? 13.902  15.874  -8.657  1.00 16.54  ? 192 ASP A CG  1 
ATOM   1674 O  OD1 . ASP A 1 192 ? 14.463  15.497  -7.600  1.00 16.21  ? 192 ASP A OD1 1 
ATOM   1675 O  OD2 . ASP A 1 192 ? 14.272  15.572  -9.809  1.00 19.50  ? 192 ASP A OD2 1 
ATOM   1676 N  N   . SER A 1 193 ? 9.901   18.020  -7.275  1.00 13.18  ? 193 SER A N   1 
ATOM   1677 C  CA  . SER A 1 193 ? 8.996   19.162  -7.152  1.00 15.14  ? 193 SER A CA  1 
ATOM   1678 C  C   . SER A 1 193 ? 8.954   19.715  -5.735  1.00 15.12  ? 193 SER A C   1 
ATOM   1679 O  O   . SER A 1 193 ? 8.498   20.843  -5.492  1.00 18.03  ? 193 SER A O   1 
ATOM   1680 C  CB  . SER A 1 193 ? 7.575   18.797  -7.602  1.00 16.35  ? 193 SER A CB  1 
ATOM   1681 O  OG  . SER A 1 193 ? 6.918   17.909  -6.724  1.00 15.56  ? 193 SER A OG  1 
ATOM   1682 N  N   . LYS A 1 194 ? 9.436   18.978  -4.751  1.00 12.48  ? 194 LYS A N   1 
ATOM   1683 C  CA  . LYS A 1 194 ? 9.444   19.438  -3.375  1.00 13.05  ? 194 LYS A CA  1 
ATOM   1684 C  C   . LYS A 1 194 ? 10.785  19.949  -2.894  1.00 13.86  ? 194 LYS A C   1 
ATOM   1685 O  O   . LYS A 1 194 ? 10.968  20.352  -1.757  1.00 19.69  ? 194 LYS A O   1 
ATOM   1686 C  CB  . LYS A 1 194 ? 9.026   18.288  -2.451  1.00 12.10  ? 194 LYS A CB  1 
ATOM   1687 C  CG  . LYS A 1 194 ? 7.684   17.684  -2.802  1.00 10.06  ? 194 LYS A CG  1 
ATOM   1688 C  CD  . LYS A 1 194 ? 6.532   18.668  -2.783  1.00 10.35  ? 194 LYS A CD  1 
ATOM   1689 C  CE  . LYS A 1 194 ? 5.232   17.971  -3.213  1.00 9.96   ? 194 LYS A CE  1 
ATOM   1690 N  NZ  . LYS A 1 194 ? 4.087   18.916  -3.191  1.00 9.98   ? 194 LYS A NZ  1 
ATOM   1691 N  N   . ARG A 1 195 ? 11.789  19.937  -3.765  1.00 16.58  ? 195 ARG A N   1 
ATOM   1692 C  CA  . ARG A 1 195 ? 13.128  20.389  -3.409  1.00 17.96  ? 195 ARG A CA  1 
ATOM   1693 C  C   . ARG A 1 195 ? 13.299  21.871  -3.649  1.00 26.33  ? 195 ARG A C   1 
ATOM   1694 O  O   . ARG A 1 195 ? 12.481  22.555  -4.284  1.00 36.68  ? 195 ARG A O   1 
ATOM   1695 C  CB  . ARG A 1 195 ? 14.146  19.637  -4.263  1.00 16.16  ? 195 ARG A CB  1 
ATOM   1696 C  CG  . ARG A 1 195 ? 14.054  18.160  -3.997  1.00 14.22  ? 195 ARG A CG  1 
ATOM   1697 C  CD  . ARG A 1 195 ? 15.165  17.390  -4.710  1.00 15.25  ? 195 ARG A CD  1 
ATOM   1698 N  NE  . ARG A 1 195 ? 14.989  15.934  -4.691  1.00 14.72  ? 195 ARG A NE  1 
ATOM   1699 C  CZ  . ARG A 1 195 ? 15.137  15.141  -3.634  1.00 13.63  ? 195 ARG A CZ  1 
ATOM   1700 N  NH1 . ARG A 1 195 ? 15.478  15.647  -2.468  1.00 14.98  ? 195 ARG A NH1 1 
ATOM   1701 N  NH2 . ARG A 1 195 ? 14.921  13.822  -3.716  1.00 13.89  ? 195 ARG A NH2 1 
ATOM   1702 O  OXT . ARG A 1 195 ? 14.320  22.245  -3.124  1.00 37.59  ? 195 ARG A OXT 1 
ATOM   1703 N  N   . SER B 1 4   ? -18.264 0.899   -38.341 1.00 34.28  ? 4   SER B N   1 
ATOM   1704 C  CA  . SER B 1 4   ? -17.911 -0.376  -37.655 1.00 23.59  ? 4   SER B CA  1 
ATOM   1705 C  C   . SER B 1 4   ? -16.453 -0.535  -37.286 1.00 17.07  ? 4   SER B C   1 
ATOM   1706 O  O   . SER B 1 4   ? -15.631 -0.278  -38.182 1.00 27.48  ? 4   SER B O   1 
ATOM   1707 C  CB  . SER B 1 4   ? -18.290 -1.558  -38.548 1.00 32.95  ? 4   SER B CB  1 
ATOM   1708 O  OG  . SER B 1 4   ? -19.189 -2.453  -37.921 1.00 44.46  ? 4   SER B OG  1 
ATOM   1709 N  N   . VAL B 1 5   ? -16.216 -0.947  -36.049 1.00 14.81  ? 5   VAL B N   1 
ATOM   1710 C  CA  . VAL B 1 5   ? -14.845 -1.232  -35.554 1.00 14.31  ? 5   VAL B CA  1 
ATOM   1711 C  C   . VAL B 1 5   ? -14.549 -2.708  -35.681 1.00 12.15  ? 5   VAL B C   1 
ATOM   1712 O  O   . VAL B 1 5   ? -15.312 -3.541  -35.197 1.00 13.69  ? 5   VAL B O   1 
ATOM   1713 C  CB  . VAL B 1 5   ? -14.643 -0.768  -34.094 1.00 15.30  ? 5   VAL B CB  1 
ATOM   1714 C  CG1 . VAL B 1 5   ? -13.281 -1.196  -33.595 1.00 19.20  ? 5   VAL B CG1 1 
ATOM   1715 C  CG2 . VAL B 1 5   ? -14.738 0.751   -34.003 1.00 21.72  ? 5   VAL B CG2 1 
ATOM   1716 N  N   . ARG B 1 6   ? -13.440 -3.016  -36.354 1.00 11.85  ? 6   ARG B N   1 
ATOM   1717 C  CA  . ARG B 1 6   ? -13.069 -4.422  -36.563 1.00 10.61  ? 6   ARG B CA  1 
ATOM   1718 C  C   . ARG B 1 6   ? -11.900 -4.761  -35.629 1.00 9.59   ? 6   ARG B C   1 
ATOM   1719 O  O   . ARG B 1 6   ? -10.848 -4.077  -35.640 1.00 10.71  ? 6   ARG B O   1 
ATOM   1720 C  CB  . ARG B 1 6   ? -12.718 -4.739  -38.006 1.00 11.95  ? 6   ARG B CB  1 
ATOM   1721 C  CG  . ARG B 1 6   ? -12.422 -6.213  -38.261 1.00 12.94  ? 6   ARG B CG  1 
ATOM   1722 C  CD  . ARG B 1 6   ? -11.987 -6.523  -39.692 1.00 13.92  ? 6   ARG B CD  1 
ATOM   1723 N  NE  . ARG B 1 6   ? -12.976 -5.958  -40.605 1.00 13.40  ? 6   ARG B NE  1 
ATOM   1724 C  CZ  . ARG B 1 6   ? -12.827 -5.137  -41.605 1.00 13.37  ? 6   ARG B CZ  1 
ATOM   1725 N  NH1 . ARG B 1 6   ? -11.646 -4.686  -41.973 1.00 15.76  ? 6   ARG B NH1 1 
ATOM   1726 N  NH2 . ARG B 1 6   ? -13.868 -4.716  -42.300 1.00 14.76  ? 6   ARG B NH2 1 
ATOM   1727 N  N   . VAL B 1 7   ? -12.151 -5.781  -34.834 1.00 9.71   ? 7   VAL B N   1 
ATOM   1728 C  CA  . VAL B 1 7   ? -11.208 -6.218  -33.822 1.00 9.74   ? 7   VAL B CA  1 
ATOM   1729 C  C   . VAL B 1 7   ? -10.690 -7.611  -34.235 1.00 9.02   ? 7   VAL B C   1 
ATOM   1730 O  O   . VAL B 1 7   ? -11.453 -8.536  -34.404 1.00 9.41   ? 7   VAL B O   1 
ATOM   1731 C  CB  . VAL B 1 7   ? -11.802 -6.302  -32.401 1.00 10.21  ? 7   VAL B CB  1 
ATOM   1732 C  CG1 . VAL B 1 7   ? -10.740 -6.597  -31.343 1.00 10.70  ? 7   VAL B CG1 1 
ATOM   1733 C  CG2 . VAL B 1 7   ? -12.524 -5.005  -32.094 1.00 13.15  ? 7   VAL B CG2 1 
ATOM   1734 N  N   . LEU B 1 8   ? -9.377  -7.699  -34.381 1.00 9.27   ? 8   LEU B N   1 
ATOM   1735 C  CA  . LEU B 1 8   ? -8.674  -8.966  -34.621 1.00 8.77   ? 8   LEU B CA  1 
ATOM   1736 C  C   . LEU B 1 8   ? -8.229  -9.485  -33.263 1.00 8.54   ? 8   LEU B C   1 
ATOM   1737 O  O   . LEU B 1 8   ? -7.507  -8.795  -32.540 1.00 9.63   ? 8   LEU B O   1 
ATOM   1738 C  CB  . LEU B 1 8   ? -7.493  -8.727  -35.546 1.00 7.93   ? 8   LEU B CB  1 
ATOM   1739 C  CG  . LEU B 1 8   ? -7.753  -7.998  -36.865 1.00 9.69   ? 8   LEU B CG  1 
ATOM   1740 C  CD1 . LEU B 1 8   ? -6.451  -7.876  -37.663 1.00 11.08  ? 8   LEU B CD1 1 
ATOM   1741 C  CD2 . LEU B 1 8   ? -8.870  -8.650  -37.665 1.00 10.04  ? 8   LEU B CD2 1 
ATOM   1742 N  N   . VAL B 1 9   ? -8.702  -10.669 -32.916 1.00 8.42   ? 9   VAL B N   1 
ATOM   1743 C  CA  . VAL B 1 9   ? -8.438  -11.225 -31.614 1.00 8.60   ? 9   VAL B CA  1 
ATOM   1744 C  C   . VAL B 1 9   ? -7.500  -12.411 -31.811 1.00 8.05   ? 9   VAL B C   1 
ATOM   1745 O  O   . VAL B 1 9   ? -7.837  -13.380 -32.530 1.00 8.60   ? 9   VAL B O   1 
ATOM   1746 C  CB  . VAL B 1 9   ? -9.725  -11.632 -30.896 1.00 9.12   ? 9   VAL B CB  1 
ATOM   1747 C  CG1 . VAL B 1 9   ? -9.443  -12.211 -29.519 1.00 10.54  ? 9   VAL B CG1 1 
ATOM   1748 C  CG2 . VAL B 1 9   ? -10.624 -10.392 -30.760 1.00 11.51  ? 9   VAL B CG2 1 
ATOM   1749 N  N   . ASP B 1 10  ? -6.326  -12.365 -31.216 1.00 9.04   ? 10  ASP B N   1 
ATOM   1750 C  CA  . ASP B 1 10  ? -5.376  -13.480 -31.255 1.00 8.50   ? 10  ASP B CA  1 
ATOM   1751 C  C   . ASP B 1 10  ? -5.958  -14.693 -30.567 1.00 8.49   ? 10  ASP B C   1 
ATOM   1752 O  O   . ASP B 1 10  ? -6.848  -14.638 -29.723 1.00 10.14  ? 10  ASP B O   1 
ATOM   1753 C  CB  . ASP B 1 10  ? -4.131  -12.967 -30.523 1.00 9.37   ? 10  ASP B CB  1 
ATOM   1754 C  CG  . ASP B 1 10  ? -2.974  -13.893 -30.563 1.00 9.63   ? 10  ASP B CG  1 
ATOM   1755 O  OD1 . ASP B 1 10  ? -2.852  -14.609 -31.580 1.00 9.91   ? 10  ASP B OD1 1 
ATOM   1756 O  OD2 . ASP B 1 10  ? -2.209  -13.915 -29.584 1.00 9.49   ? 10  ASP B OD2 1 
ATOM   1757 N  N   . MET B 1 11  ? -5.398  -15.859 -30.882 1.00 9.49   ? 11  MET B N   1 
ATOM   1758 C  CA  . MET B 1 11  ? -5.832  -17.120 -30.247 1.00 8.32   ? 11  MET B CA  1 
ATOM   1759 C  C   . MET B 1 11  ? -4.890  -17.524 -29.147 1.00 7.55   ? 11  MET B C   1 
ATOM   1760 O  O   . MET B 1 11  ? -5.268  -17.474 -27.973 1.00 8.75   ? 11  MET B O   1 
ATOM   1761 C  CB  . MET B 1 11  ? -6.036  -18.144 -31.354 1.00 9.70   ? 11  MET B CB  1 
ATOM   1762 C  CG  . MET B 1 11  ? -6.727  -19.398 -30.905 1.00 10.41  ? 11  MET B CG  1 
ATOM   1763 S  SD  . MET B 1 11  ? -7.230  -20.399 -32.339 1.00 10.36  ? 11  MET B SD  1 
ATOM   1764 C  CE  . MET B 1 11  ? -7.950  -21.763 -31.456 1.00 9.91   ? 11  MET B CE  1 
ATOM   1765 N  N   . ASP B 1 12  ? -3.682  -17.999 -29.426 1.00 7.98   ? 12  ASP B N   1 
ATOM   1766 C  CA  . ASP B 1 12  ? -2.794  -18.439 -28.346 1.00 8.27   ? 12  ASP B CA  1 
ATOM   1767 C  C   . ASP B 1 12  ? -2.419  -17.264 -27.470 1.00 8.24   ? 12  ASP B C   1 
ATOM   1768 O  O   . ASP B 1 12  ? -1.922  -16.248 -27.944 1.00 8.90   ? 12  ASP B O   1 
ATOM   1769 C  CB  . ASP B 1 12  ? -1.566  -19.115 -28.900 1.00 8.44   ? 12  ASP B CB  1 
ATOM   1770 C  CG  . ASP B 1 12  ? -1.852  -20.393 -29.678 1.00 9.20   ? 12  ASP B CG  1 
ATOM   1771 O  OD1 . ASP B 1 12  ? -2.509  -21.243 -29.084 1.00 10.07  ? 12  ASP B OD1 1 
ATOM   1772 O  OD2 . ASP B 1 12  ? -1.406  -20.491 -30.867 1.00 10.66  ? 12  ASP B OD2 1 
ATOM   1773 N  N   . GLY B 1 13  ? -2.633  -17.450 -26.166 1.00 8.82   ? 13  GLY B N   1 
ATOM   1774 C  CA  . GLY B 1 13  ? -2.303  -16.405 -25.188 1.00 9.47   ? 13  GLY B CA  1 
ATOM   1775 C  C   . GLY B 1 13  ? -3.377  -15.407 -24.940 1.00 9.94   ? 13  GLY B C   1 
ATOM   1776 O  O   . GLY B 1 13  ? -3.236  -14.563 -24.044 1.00 12.13  ? 13  GLY B O   1 
ATOM   1777 N  N   . VAL B 1 14  ? -4.452  -15.436 -25.729 1.00 9.13   ? 14  VAL B N   1 
ATOM   1778 C  CA  . VAL B 1 14  ? -5.543  -14.474 -25.638 1.00 8.38   ? 14  VAL B CA  1 
ATOM   1779 C  C   . VAL B 1 14  ? -6.871  -15.202 -25.487 1.00 8.19   ? 14  VAL B C   1 
ATOM   1780 O  O   . VAL B 1 14  ? -7.679  -14.832 -24.595 1.00 9.69   ? 14  VAL B O   1 
ATOM   1781 C  CB  . VAL B 1 14  ? -5.521  -13.495 -26.820 1.00 8.90   ? 14  VAL B CB  1 
ATOM   1782 C  CG1 . VAL B 1 14  ? -6.739  -12.566 -26.772 1.00 10.21  ? 14  VAL B CG1 1 
ATOM   1783 C  CG2 . VAL B 1 14  ? -4.190  -12.762 -26.863 1.00 10.00  ? 14  VAL B CG2 1 
ATOM   1784 N  N   . LEU B 1 15  ? -7.137  -16.205 -26.312 1.00 8.22   ? 15  LEU B N   1 
ATOM   1785 C  CA  . LEU B 1 15  ? -8.311  -17.091 -26.189 1.00 9.06   ? 15  LEU B CA  1 
ATOM   1786 C  C   . LEU B 1 15  ? -7.987  -18.401 -25.543 1.00 8.72   ? 15  LEU B C   1 
ATOM   1787 O  O   . LEU B 1 15  ? -8.718  -18.921 -24.691 1.00 9.54   ? 15  LEU B O   1 
ATOM   1788 C  CB  . LEU B 1 15  ? -9.029  -17.343 -27.522 1.00 8.75   ? 15  LEU B CB  1 
ATOM   1789 C  CG  . LEU B 1 15  ? -9.579  -16.080 -28.148 1.00 11.01  ? 15  LEU B CG  1 
ATOM   1790 C  CD1 . LEU B 1 15  ? -10.280 -16.421 -29.466 1.00 12.43  ? 15  LEU B CD1 1 
ATOM   1791 C  CD2 . LEU B 1 15  ? -10.411 -15.233 -27.238 1.00 14.55  ? 15  LEU B CD2 1 
ATOM   1792 N  N   . ALA B 1 16  ? -6.878  -19.012 -25.972 1.00 9.31   ? 16  ALA B N   1 
ATOM   1793 C  CA  . ALA B 1 16  ? -6.443  -20.348 -25.600 1.00 9.77   ? 16  ALA B CA  1 
ATOM   1794 C  C   . ALA B 1 16  ? -5.138  -20.285 -24.843 1.00 9.89   ? 16  ALA B C   1 
ATOM   1795 O  O   . ALA B 1 16  ? -4.203  -19.568 -25.246 1.00 9.58   ? 16  ALA B O   1 
ATOM   1796 C  CB  . ALA B 1 16  ? -6.264  -21.259 -26.798 1.00 11.02  ? 16  ALA B CB  1 
ATOM   1797 N  N   . ASP B 1 17  ? -5.028  -21.002 -23.724 1.00 9.93   ? 17  ASP B N   1 
ATOM   1798 C  CA  . ASP B 1 17  ? -3.884  -20.856 -22.837 1.00 9.95   ? 17  ASP B CA  1 
ATOM   1799 C  C   . ASP B 1 17  ? -2.783  -21.837 -23.228 1.00 9.43   ? 17  ASP B C   1 
ATOM   1800 O  O   . ASP B 1 17  ? -2.563  -22.923 -22.697 1.00 10.49  ? 17  ASP B O   1 
ATOM   1801 C  CB  . ASP B 1 17  ? -4.301  -21.066 -21.375 1.00 11.80  ? 17  ASP B CB  1 
ATOM   1802 C  CG  . ASP B 1 17  ? -3.247  -20.555 -20.423 1.00 12.54  ? 17  ASP B CG  1 
ATOM   1803 O  OD1 . ASP B 1 17  ? -2.081  -20.382 -20.856 1.00 13.24  ? 17  ASP B OD1 1 
ATOM   1804 O  OD2 . ASP B 1 17  ? -3.632  -20.344 -19.255 1.00 18.52  ? 17  ASP B OD2 1 
ATOM   1805 N  N   . PHE B 1 18  ? -2.049  -21.401 -24.237 1.00 9.23   ? 18  PHE B N   1 
ATOM   1806 C  CA  . PHE B 1 18  ? -0.917  -22.135 -24.784 1.00 9.26   ? 18  PHE B CA  1 
ATOM   1807 C  C   . PHE B 1 18  ? 0.144   -22.384 -23.722 1.00 8.97   ? 18  PHE B C   1 
ATOM   1808 O  O   . PHE B 1 18  ? 0.670   -23.497 -23.594 1.00 9.50   ? 18  PHE B O   1 
ATOM   1809 C  CB  . PHE B 1 18  ? -0.385  -21.357 -26.022 1.00 10.07  ? 18  PHE B CB  1 
ATOM   1810 C  CG  . PHE B 1 18  ? 0.824   -21.949 -26.690 1.00 10.44  ? 18  PHE B CG  1 
ATOM   1811 C  CD1 . PHE B 1 18  ? 2.119   -21.708 -26.196 1.00 12.19  ? 18  PHE B CD1 1 
ATOM   1812 C  CD2 . PHE B 1 18  ? 0.663   -22.750 -27.805 1.00 11.58  ? 18  PHE B CD2 1 
ATOM   1813 C  CE1 . PHE B 1 18  ? 3.208   -22.315 -26.772 1.00 12.49  ? 18  PHE B CE1 1 
ATOM   1814 C  CE2 . PHE B 1 18  ? 1.774   -23.326 -28.397 1.00 12.74  ? 18  PHE B CE2 1 
ATOM   1815 C  CZ  . PHE B 1 18  ? 3.023   -23.107 -27.883 1.00 12.40  ? 18  PHE B CZ  1 
ATOM   1816 N  N   . GLU B 1 19  ? 0.574   -21.302 -23.034 1.00 9.29   ? 19  GLU B N   1 
ATOM   1817 C  CA  . GLU B 1 19  ? 1.655   -21.465 -22.083 1.00 10.75  ? 19  GLU B CA  1 
ATOM   1818 C  C   . GLU B 1 19  ? 1.338   -22.428 -20.952 1.00 9.55   ? 19  GLU B C   1 
ATOM   1819 O  O   . GLU B 1 19  ? 2.163   -23.279 -20.565 1.00 9.91   ? 19  GLU B O   1 
ATOM   1820 C  CB  . GLU B 1 19  ? 2.000   -20.073 -21.484 1.00 11.50  ? 19  GLU B CB  1 
ATOM   1821 C  CG  . GLU B 1 19  ? 2.709   -19.205 -22.537 1.00 13.40  ? 19  GLU B CG  1 
ATOM   1822 C  CD  . GLU B 1 19  ? 4.161   -19.543 -22.812 1.00 13.57  ? 19  GLU B CD  1 
ATOM   1823 O  OE1 . GLU B 1 19  ? 4.851   -20.213 -21.984 1.00 13.94  ? 19  GLU B OE1 1 
ATOM   1824 O  OE2 . GLU B 1 19  ? 4.684   -19.080 -23.853 1.00 18.20  ? 19  GLU B OE2 1 
ATOM   1825 N  N   . ALA B 1 20  ? 0.152   -22.362 -20.390 1.00 10.16  ? 20  ALA B N   1 
ATOM   1826 C  CA  . ALA B 1 20  ? -0.218  -23.296 -19.334 1.00 10.73  ? 20  ALA B CA  1 
ATOM   1827 C  C   . ALA B 1 20  ? -0.306  -24.714 -19.903 1.00 10.21  ? 20  ALA B C   1 
ATOM   1828 O  O   . ALA B 1 20  ? 0.094   -25.688 -19.238 1.00 11.67  ? 20  ALA B O   1 
ATOM   1829 C  CB  . ALA B 1 20  ? -1.530  -22.865 -18.703 1.00 12.98  ? 20  ALA B CB  1 
ATOM   1830 N  N   . GLY B 1 21  ? -0.821  -24.860 -21.124 1.00 10.23  ? 21  GLY B N   1 
ATOM   1831 C  CA  . GLY B 1 21  ? -0.883  -26.214 -21.718 1.00 10.62  ? 21  GLY B CA  1 
ATOM   1832 C  C   . GLY B 1 21  ? 0.512   -26.760 -21.984 1.00 9.31   ? 21  GLY B C   1 
ATOM   1833 O  O   . GLY B 1 21  ? 0.743   -27.962 -21.818 1.00 9.65   ? 21  GLY B O   1 
ATOM   1834 N  N   . LEU B 1 22  ? 1.390   -25.890 -22.441 1.00 9.13   ? 22  LEU B N   1 
ATOM   1835 C  CA  . LEU B 1 22  ? 2.782   -26.327 -22.679 1.00 9.49   ? 22  LEU B CA  1 
ATOM   1836 C  C   . LEU B 1 22  ? 3.441   -26.850 -21.420 1.00 9.31   ? 22  LEU B C   1 
ATOM   1837 O  O   . LEU B 1 22  ? 4.044   -27.919 -21.390 1.00 9.75   ? 22  LEU B O   1 
ATOM   1838 C  CB  . LEU B 1 22  ? 3.567   -25.178 -23.343 1.00 9.95   ? 22  LEU B CB  1 
ATOM   1839 C  CG  . LEU B 1 22  ? 4.989   -25.513 -23.703 1.00 11.16  ? 22  LEU B CG  1 
ATOM   1840 C  CD1 . LEU B 1 22  ? 5.040   -26.754 -24.583 1.00 16.63  ? 22  LEU B CD1 1 
ATOM   1841 C  CD2 . LEU B 1 22  ? 5.648   -24.351 -24.409 1.00 14.35  ? 22  LEU B CD2 1 
ATOM   1842 N  N   . LEU B 1 23  ? 3.329   -26.061 -20.342 1.00 9.16   ? 23  LEU B N   1 
ATOM   1843 C  CA  . LEU B 1 23  ? 3.971   -26.472 -19.102 1.00 10.14  ? 23  LEU B CA  1 
ATOM   1844 C  C   . LEU B 1 23  ? 3.336   -27.765 -18.575 1.00 10.18  ? 23  LEU B C   1 
ATOM   1845 O  O   . LEU B 1 23  ? 4.051   -28.705 -18.158 1.00 10.82  ? 23  LEU B O   1 
ATOM   1846 C  CB  . LEU B 1 23  ? 3.915   -25.364 -18.085 1.00 11.19  ? 23  LEU B CB  1 
ATOM   1847 C  CG  . LEU B 1 23  ? 4.573   -25.741 -16.748 1.00 11.21  ? 23  LEU B CG  1 
ATOM   1848 C  CD1 . LEU B 1 23  ? 6.033   -26.115 -16.886 1.00 14.13  ? 23  LEU B CD1 1 
ATOM   1849 C  CD2 . LEU B 1 23  ? 4.445   -24.568 -15.774 1.00 14.89  ? 23  LEU B CD2 1 
ATOM   1850 N  N   . ARG B 1 24  ? 2.002   -27.827 -18.592 1.00 10.54  ? 24  ARG B N   1 
ATOM   1851 C  CA  . ARG B 1 24  ? 1.341   -29.048 -18.122 1.00 11.55  ? 24  ARG B CA  1 
ATOM   1852 C  C   . ARG B 1 24  ? 1.789   -30.247 -18.916 1.00 10.54  ? 24  ARG B C   1 
ATOM   1853 O  O   . ARG B 1 24  ? 2.127   -31.327 -18.381 1.00 11.12  ? 24  ARG B O   1 
ATOM   1854 C  CB  . ARG B 1 24  ? -0.160  -28.833 -18.185 1.00 16.25  ? 24  ARG B CB  1 
ATOM   1855 C  CG  . ARG B 1 24  ? -0.971  -30.027 -17.754 1.00 22.37  ? 24  ARG B CG  1 
ATOM   1856 C  CD  . ARG B 1 24  ? -2.347  -29.479 -17.372 1.00 23.57  ? 24  ARG B CD  1 
ATOM   1857 N  NE  . ARG B 1 24  ? -2.929  -29.062 -18.626 1.00 24.08  ? 24  ARG B NE  1 
ATOM   1858 C  CZ  . ARG B 1 24  ? -3.222  -27.842 -19.021 1.00 25.19  ? 24  ARG B CZ  1 
ATOM   1859 N  NH1 . ARG B 1 24  ? -3.028  -26.717 -18.363 1.00 30.15  ? 24  ARG B NH1 1 
ATOM   1860 N  NH2 . ARG B 1 24  ? -3.770  -27.747 -20.232 1.00 43.48  ? 24  ARG B NH2 1 
ATOM   1861 N  N   . GLY B 1 25  ? 1.800   -30.120 -20.238 1.00 9.97   ? 25  GLY B N   1 
ATOM   1862 C  CA  . GLY B 1 25  ? 2.244   -31.238 -21.032 1.00 9.79   ? 25  GLY B CA  1 
ATOM   1863 C  C   . GLY B 1 25  ? 3.686   -31.623 -20.863 1.00 8.94   ? 25  GLY B C   1 
ATOM   1864 O  O   . GLY B 1 25  ? 4.048   -32.822 -20.888 1.00 10.19  ? 25  GLY B O   1 
ATOM   1865 N  N   . PHE B 1 26  ? 4.546   -30.635 -20.679 1.00 8.97   ? 26  PHE B N   1 
ATOM   1866 C  CA  . PHE B 1 26  ? 5.970   -30.903 -20.421 1.00 9.13   ? 26  PHE B CA  1 
ATOM   1867 C  C   . PHE B 1 26  ? 6.155   -31.660 -19.094 1.00 9.20   ? 26  PHE B C   1 
ATOM   1868 O  O   . PHE B 1 26  ? 6.913   -32.625 -19.076 1.00 9.62   ? 26  PHE B O   1 
ATOM   1869 C  CB  . PHE B 1 26  ? 6.737   -29.568 -20.428 1.00 8.78   ? 26  PHE B CB  1 
ATOM   1870 C  CG  . PHE B 1 26  ? 8.233   -29.751 -20.219 1.00 8.70   ? 26  PHE B CG  1 
ATOM   1871 C  CD1 . PHE B 1 26  ? 9.099   -29.995 -21.279 1.00 11.12  ? 26  PHE B CD1 1 
ATOM   1872 C  CD2 . PHE B 1 26  ? 8.763   -29.667 -18.953 1.00 9.41   ? 26  PHE B CD2 1 
ATOM   1873 C  CE1 . PHE B 1 26  ? 10.456  -30.185 -21.030 1.00 11.98  ? 26  PHE B CE1 1 
ATOM   1874 C  CE2 . PHE B 1 26  ? 10.098  -29.854 -18.712 1.00 10.39  ? 26  PHE B CE2 1 
ATOM   1875 C  CZ  . PHE B 1 26  ? 10.964  -30.096 -19.751 1.00 10.98  ? 26  PHE B CZ  1 
ATOM   1876 N  N   . ARG B 1 27  ? 5.477   -31.195 -18.058 1.00 9.31   ? 27  ARG B N   1 
ATOM   1877 C  CA  . ARG B 1 27  ? 5.657   -31.884 -16.761 1.00 9.95   ? 27  ARG B CA  1 
ATOM   1878 C  C   . ARG B 1 27  ? 5.113   -33.300 -16.801 1.00 9.75   ? 27  ARG B C   1 
ATOM   1879 O  O   . ARG B 1 27  ? 5.603   -34.187 -16.101 1.00 11.16  ? 27  ARG B O   1 
ATOM   1880 C  CB  . ARG B 1 27  ? 5.006   -31.017 -15.689 1.00 11.36  ? 27  ARG B CB  1 
ATOM   1881 C  CG  . ARG B 1 27  ? 5.681   -29.710 -15.471 1.00 13.21  ? 27  ARG B CG  1 
ATOM   1882 C  CD  . ARG B 1 27  ? 5.419   -28.890 -14.243 1.00 17.26  ? 27  ARG B CD  1 
ATOM   1883 N  NE  . ARG B 1 27  ? 5.997   -29.600 -13.074 1.00 17.68  ? 27  ARG B NE  1 
ATOM   1884 C  CZ  . ARG B 1 27  ? 5.613   -29.210 -11.845 1.00 20.58  ? 27  ARG B CZ  1 
ATOM   1885 N  NH1 . ARG B 1 27  ? 4.756   -28.247 -11.603 1.00 23.30  ? 27  ARG B NH1 1 
ATOM   1886 N  NH2 . ARG B 1 27  ? 6.182   -29.887 -10.854 1.00 31.74  ? 27  ARG B NH2 1 
ATOM   1887 N  N   . ARG B 1 28  ? 4.061   -33.534 -17.585 1.00 10.46  ? 28  ARG B N   1 
ATOM   1888 C  CA  . ARG B 1 28  ? 3.510   -34.881 -17.685 1.00 11.07  ? 28  ARG B CA  1 
ATOM   1889 C  C   . ARG B 1 28  ? 4.392   -35.811 -18.483 1.00 11.19  ? 28  ARG B C   1 
ATOM   1890 O  O   . ARG B 1 28  ? 4.569   -36.955 -18.114 1.00 12.88  ? 28  ARG B O   1 
ATOM   1891 C  CB  . ARG B 1 28  ? 2.160   -34.802 -18.354 1.00 11.48  ? 28  ARG B CB  1 
ATOM   1892 C  CG  . ARG B 1 28  ? 1.036   -34.234 -17.541 1.00 14.90  ? 28  ARG B CG  1 
ATOM   1893 C  CD  . ARG B 1 28  ? -0.264  -34.260 -18.360 1.00 14.44  ? 28  ARG B CD  1 
ATOM   1894 N  NE  . ARG B 1 28  ? -1.323  -33.594 -17.642 1.00 16.38  ? 28  ARG B NE  1 
ATOM   1895 C  CZ  . ARG B 1 28  ? -2.609  -33.518 -17.917 1.00 16.60  ? 28  ARG B CZ  1 
ATOM   1896 N  NH1 . ARG B 1 28  ? -3.045  -34.120 -19.029 1.00 23.40  ? 28  ARG B NH1 1 
ATOM   1897 N  NH2 . ARG B 1 28  ? -3.445  -32.854 -17.149 1.00 20.25  ? 28  ARG B NH2 1 
ATOM   1898 N  N   . ARG B 1 29  ? 4.954   -35.321 -19.589 1.00 10.49  ? 29  ARG B N   1 
ATOM   1899 C  CA  . ARG B 1 29  ? 5.768   -36.139 -20.469 1.00 11.03  ? 29  ARG B CA  1 
ATOM   1900 C  C   . ARG B 1 29  ? 7.200   -36.333 -19.988 1.00 10.41  ? 29  ARG B C   1 
ATOM   1901 O  O   . ARG B 1 29  ? 7.787   -37.388 -20.213 1.00 12.30  ? 29  ARG B O   1 
ATOM   1902 C  CB  . ARG B 1 29  ? 5.770   -35.505 -21.879 1.00 12.19  ? 29  ARG B CB  1 
ATOM   1903 C  CG  . ARG B 1 29  ? 6.474   -36.375 -22.922 1.00 14.45  ? 29  ARG B CG  1 
ATOM   1904 C  CD  . ARG B 1 29  ? 5.857   -35.947 -24.249 1.00 23.39  ? 29  ARG B CD  1 
ATOM   1905 N  NE  . ARG B 1 29  ? 6.723   -36.527 -25.267 1.00 25.04  ? 29  ARG B NE  1 
ATOM   1906 C  CZ  . ARG B 1 29  ? 6.556   -36.339 -26.553 1.00 23.83  ? 29  ARG B CZ  1 
ATOM   1907 N  NH1 . ARG B 1 29  ? 5.527   -35.590 -26.900 1.00 28.81  ? 29  ARG B NH1 1 
ATOM   1908 N  NH2 . ARG B 1 29  ? 7.366   -36.876 -27.441 1.00 37.63  ? 29  ARG B NH2 1 
ATOM   1909 N  N   . PHE B 1 30  ? 7.741   -35.327 -19.321 1.00 9.92   ? 30  PHE B N   1 
ATOM   1910 C  CA  . PHE B 1 30  ? 9.117   -35.288 -18.857 1.00 10.27  ? 30  PHE B CA  1 
ATOM   1911 C  C   . PHE B 1 30  ? 9.134   -35.009 -17.362 1.00 10.11  ? 30  PHE B C   1 
ATOM   1912 O  O   . PHE B 1 30  ? 9.672   -33.963 -16.932 1.00 10.08  ? 30  PHE B O   1 
ATOM   1913 C  CB  . PHE B 1 30  ? 9.945   -34.221 -19.606 1.00 11.40  ? 30  PHE B CB  1 
ATOM   1914 C  CG  . PHE B 1 30  ? 9.927   -34.459 -21.109 1.00 10.92  ? 30  PHE B CG  1 
ATOM   1915 C  CD1 . PHE B 1 30  ? 10.672  -35.479 -21.659 1.00 12.76  ? 30  PHE B CD1 1 
ATOM   1916 C  CD2 . PHE B 1 30  ? 9.166   -33.666 -21.935 1.00 11.01  ? 30  PHE B CD2 1 
ATOM   1917 C  CE1 . PHE B 1 30  ? 10.651  -35.725 -23.022 1.00 12.80  ? 30  PHE B CE1 1 
ATOM   1918 C  CE2 . PHE B 1 30  ? 9.139   -33.909 -23.310 1.00 11.89  ? 30  PHE B CE2 1 
ATOM   1919 C  CZ  . PHE B 1 30  ? 9.883   -34.909 -23.850 1.00 12.19  ? 30  PHE B CZ  1 
ATOM   1920 N  N   . PRO B 1 31  ? 8.553   -35.864 -16.549 1.00 10.74  ? 31  PRO B N   1 
ATOM   1921 C  CA  . PRO B 1 31  ? 8.351   -35.519 -15.132 1.00 11.41  ? 31  PRO B CA  1 
ATOM   1922 C  C   . PRO B 1 31  ? 9.651   -35.325 -14.349 1.00 11.71  ? 31  PRO B C   1 
ATOM   1923 O  O   . PRO B 1 31  ? 9.604   -34.698 -13.291 1.00 14.71  ? 31  PRO B O   1 
ATOM   1924 C  CB  . PRO B 1 31  ? 7.602   -36.730 -14.562 1.00 13.91  ? 31  PRO B CB  1 
ATOM   1925 C  CG  . PRO B 1 31  ? 7.839   -37.826 -15.544 1.00 13.11  ? 31  PRO B CG  1 
ATOM   1926 C  CD  . PRO B 1 31  ? 7.989   -37.162 -16.888 1.00 11.52  ? 31  PRO B CD  1 
ATOM   1927 N  N   . GLU B 1 32  ? 10.761  -35.872 -14.805 1.00 9.80   ? 32  GLU B N   1 
ATOM   1928 C  CA  . GLU B 1 32  ? 12.019  -35.711 -14.079 1.00 9.24   ? 32  GLU B CA  1 
ATOM   1929 C  C   . GLU B 1 32  ? 12.702  -34.366 -14.363 1.00 9.25   ? 32  GLU B C   1 
ATOM   1930 O  O   . GLU B 1 32  ? 13.612  -33.967 -13.595 1.00 10.35  ? 32  GLU B O   1 
ATOM   1931 C  CB  . GLU B 1 32  ? 13.045  -36.806 -14.376 1.00 10.04  ? 32  GLU B CB  1 
ATOM   1932 C  CG  . GLU B 1 32  ? 12.524  -38.224 -14.097 1.00 11.67  ? 32  GLU B CG  1 
ATOM   1933 C  CD  . GLU B 1 32  ? 12.501  -38.637 -12.648 1.00 12.42  ? 32  GLU B CD  1 
ATOM   1934 O  OE1 . GLU B 1 32  ? 12.831  -37.804 -11.759 1.00 13.42  ? 32  GLU B OE1 1 
ATOM   1935 O  OE2 . GLU B 1 32  ? 12.142  -39.817 -12.391 1.00 15.57  ? 32  GLU B OE2 1 
ATOM   1936 N  N   . GLU B 1 33  ? 12.358  -33.701 -15.448 1.00 10.28  ? 33  GLU B N   1 
ATOM   1937 C  CA  . GLU B 1 33  ? 13.171  -32.605 -15.955 1.00 10.45  ? 33  GLU B CA  1 
ATOM   1938 C  C   . GLU B 1 33  ? 12.900  -31.301 -15.249 1.00 11.17  ? 33  GLU B C   1 
ATOM   1939 O  O   . GLU B 1 33  ? 11.760  -31.053 -14.864 1.00 11.95  ? 33  GLU B O   1 
ATOM   1940 C  CB  . GLU B 1 33  ? 12.883  -32.419 -17.459 1.00 11.53  ? 33  GLU B CB  1 
ATOM   1941 C  CG  . GLU B 1 33  ? 13.323  -33.588 -18.275 1.00 11.44  ? 33  GLU B CG  1 
ATOM   1942 C  CD  . GLU B 1 33  ? 14.829  -33.786 -18.411 1.00 12.82  ? 33  GLU B CD  1 
ATOM   1943 O  OE1 . GLU B 1 33  ? 15.576  -32.843 -17.987 1.00 14.15  ? 33  GLU B OE1 1 
ATOM   1944 O  OE2 . GLU B 1 33  ? 15.278  -34.855 -18.906 1.00 17.71  ? 33  GLU B OE2 1 
ATOM   1945 N  N   . PRO B 1 34  ? 13.864  -30.403 -15.178 1.00 12.84  ? 34  PRO B N   1 
ATOM   1946 C  CA  . PRO B 1 34  ? 13.601  -29.026 -14.717 1.00 13.93  ? 34  PRO B CA  1 
ATOM   1947 C  C   . PRO B 1 34  ? 12.629  -28.380 -15.700 1.00 11.36  ? 34  PRO B C   1 
ATOM   1948 O  O   . PRO B 1 34  ? 12.592  -28.699 -16.874 1.00 13.18  ? 34  PRO B O   1 
ATOM   1949 C  CB  . PRO B 1 34  ? 14.974  -28.369 -14.717 1.00 17.31  ? 34  PRO B CB  1 
ATOM   1950 C  CG  . PRO B 1 34  ? 15.744  -29.156 -15.674 1.00 19.51  ? 34  PRO B CG  1 
ATOM   1951 C  CD  . PRO B 1 34  ? 15.270  -30.568 -15.667 1.00 13.61  ? 34  PRO B CD  1 
ATOM   1952 N  N   . HIS B 1 35  ? 11.859  -27.429 -15.176 1.00 11.95  ? 35  HIS B N   1 
ATOM   1953 C  CA  . HIS B 1 35  ? 10.887  -26.689 -15.983 1.00 12.22  ? 35  HIS B CA  1 
ATOM   1954 C  C   . HIS B 1 35  ? 10.996  -25.205 -15.678 1.00 12.01  ? 35  HIS B C   1 
ATOM   1955 O  O   . HIS B 1 35  ? 11.689  -24.810 -14.728 1.00 13.94  ? 35  HIS B O   1 
ATOM   1956 C  CB  . HIS B 1 35  ? 9.451   -27.199 -15.791 1.00 13.36  ? 35  HIS B CB  1 
ATOM   1957 C  CG  . HIS B 1 35  ? 8.878   -26.808 -14.441 1.00 12.96  ? 35  HIS B CG  1 
ATOM   1958 N  ND1 . HIS B 1 35  ? 9.066   -27.521 -13.261 1.00 14.82  ? 35  HIS B ND1 1 
ATOM   1959 C  CD2 . HIS B 1 35  ? 8.091   -25.755 -14.104 1.00 16.20  ? 35  HIS B CD2 1 
ATOM   1960 C  CE1 . HIS B 1 35  ? 8.418   -26.916 -12.286 1.00 16.38  ? 35  HIS B CE1 1 
ATOM   1961 N  NE2 . HIS B 1 35  ? 7.815   -25.820 -12.733 1.00 18.68  ? 35  HIS B NE2 1 
ATOM   1962 N  N   . VAL B 1 36  ? 10.312  -24.421 -16.514 1.00 12.34  ? 36  VAL B N   1 
ATOM   1963 C  CA  . VAL B 1 36  ? 10.254  -22.971 -16.356 1.00 12.48  ? 36  VAL B CA  1 
ATOM   1964 C  C   . VAL B 1 36  ? 8.876   -22.615 -15.799 1.00 11.72  ? 36  VAL B C   1 
ATOM   1965 O  O   . VAL B 1 36  ? 7.892   -22.718 -16.524 1.00 11.82  ? 36  VAL B O   1 
ATOM   1966 C  CB  . VAL B 1 36  ? 10.493  -22.214 -17.658 1.00 11.70  ? 36  VAL B CB  1 
ATOM   1967 C  CG1 . VAL B 1 36  ? 10.380  -20.722 -17.443 1.00 14.88  ? 36  VAL B CG1 1 
ATOM   1968 C  CG2 . VAL B 1 36  ? 11.878  -22.521 -18.243 1.00 14.97  ? 36  VAL B CG2 1 
ATOM   1969 N  N   . PRO B 1 37  ? 8.787   -22.272 -14.527 1.00 14.30  ? 37  PRO B N   1 
ATOM   1970 C  CA  . PRO B 1 37  ? 7.472   -21.870 -14.016 1.00 13.98  ? 37  PRO B CA  1 
ATOM   1971 C  C   . PRO B 1 37  ? 6.932   -20.684 -14.821 1.00 13.05  ? 37  PRO B C   1 
ATOM   1972 O  O   . PRO B 1 37  ? 7.695   -19.851 -15.310 1.00 14.79  ? 37  PRO B O   1 
ATOM   1973 C  CB  . PRO B 1 37  ? 7.757   -21.473 -12.562 1.00 17.51  ? 37  PRO B CB  1 
ATOM   1974 C  CG  . PRO B 1 37  ? 8.964   -22.282 -12.206 1.00 19.06  ? 37  PRO B CG  1 
ATOM   1975 C  CD  . PRO B 1 37  ? 9.822   -22.238 -13.474 1.00 16.00  ? 37  PRO B CD  1 
ATOM   1976 N  N   . LEU B 1 38  ? 5.620   -20.634 -14.948 1.00 14.43  ? 38  LEU B N   1 
ATOM   1977 C  CA  . LEU B 1 38  ? 5.036   -19.548 -15.702 1.00 14.86  ? 38  LEU B CA  1 
ATOM   1978 C  C   . LEU B 1 38  ? 5.488   -18.168 -15.248 1.00 15.56  ? 38  LEU B C   1 
ATOM   1979 O  O   . LEU B 1 38  ? 5.754   -17.293 -16.067 1.00 16.09  ? 38  LEU B O   1 
ATOM   1980 C  CB  . LEU B 1 38  ? 3.495   -19.647 -15.689 1.00 18.58  ? 38  LEU B CB  1 
ATOM   1981 C  CG  . LEU B 1 38  ? 2.903   -20.953 -16.286 1.00 20.55  ? 38  LEU B CG  1 
ATOM   1982 C  CD1 . LEU B 1 38  ? 1.388   -20.883 -16.151 1.00 30.57  ? 38  LEU B CD1 1 
ATOM   1983 C  CD2 . LEU B 1 38  ? 3.343   -21.167 -17.711 1.00 18.21  ? 38  LEU B CD2 1 
ATOM   1984 N  N   . GLU B 1 39  ? 5.590   -17.938 -13.949 1.00 18.14  ? 39  GLU B N   1 
ATOM   1985 C  CA  . GLU B 1 39  ? 6.013   -16.635 -13.482 1.00 18.74  ? 39  GLU B CA  1 
ATOM   1986 C  C   . GLU B 1 39  ? 7.447   -16.290 -13.905 1.00 19.25  ? 39  GLU B C   1 
ATOM   1987 O  O   . GLU B 1 39  ? 7.744   -15.090 -13.942 1.00 20.15  ? 39  GLU B O   1 
ATOM   1988 C  CB  . GLU B 1 39  ? 5.912   -16.555 -11.954 0.01 20.00  ? 39  GLU B CB  1 
ATOM   1989 C  CG  . GLU B 1 39  ? 4.491   -16.648 -11.424 0.01 20.00  ? 39  GLU B CG  1 
ATOM   1990 C  CD  . GLU B 1 39  ? 4.185   -18.001 -10.813 0.01 20.00  ? 39  GLU B CD  1 
ATOM   1991 O  OE1 . GLU B 1 39  ? 4.998   -18.935 -10.998 0.01 20.00  ? 39  GLU B OE1 1 
ATOM   1992 O  OE2 . GLU B 1 39  ? 3.132   -18.131 -10.151 0.01 20.00  ? 39  GLU B OE2 1 
ATOM   1993 N  N   . GLN B 1 40  ? 8.301   -17.235 -14.204 1.00 16.76  ? 40  GLN B N   1 
ATOM   1994 C  CA  A GLN B 1 40  ? 9.664   -17.000 -14.685 0.39 17.28  ? 40  GLN B CA  1 
ATOM   1995 C  CA  B GLN B 1 40  ? 9.663   -16.971 -14.683 0.61 16.79  ? 40  GLN B CA  1 
ATOM   1996 C  C   . GLN B 1 40  ? 9.763   -16.899 -16.202 1.00 14.81  ? 40  GLN B C   1 
ATOM   1997 O  O   . GLN B 1 40  ? 10.842  -16.621 -16.726 1.00 17.56  ? 40  GLN B O   1 
ATOM   1998 C  CB  A GLN B 1 40  ? 10.564  -18.122 -14.139 0.39 17.77  ? 40  GLN B CB  1 
ATOM   1999 C  CB  B GLN B 1 40  ? 10.579  -18.048 -14.032 0.61 17.63  ? 40  GLN B CB  1 
ATOM   2000 C  CG  A GLN B 1 40  ? 11.891  -18.331 -14.793 0.39 19.40  ? 40  GLN B CG  1 
ATOM   2001 C  CG  B GLN B 1 40  ? 10.360  -18.089 -12.499 0.61 14.95  ? 40  GLN B CG  1 
ATOM   2002 C  CD  A GLN B 1 40  ? 13.084  -18.629 -13.912 0.39 23.15  ? 40  GLN B CD  1 
ATOM   2003 C  CD  B GLN B 1 40  ? 11.128  -19.167 -11.763 0.61 25.06  ? 40  GLN B CD  1 
ATOM   2004 O  OE1 A GLN B 1 40  ? 13.003  -19.454 -13.003 0.39 20.76  ? 40  GLN B OE1 1 
ATOM   2005 O  OE1 B GLN B 1 40  ? 12.094  -19.732 -12.281 0.61 22.69  ? 40  GLN B OE1 1 
ATOM   2006 N  NE2 A GLN B 1 40  ? 14.193  -17.960 -14.189 0.39 24.85  ? 40  GLN B NE2 1 
ATOM   2007 N  NE2 B GLN B 1 40  ? 10.729  -19.484 -10.528 0.61 28.10  ? 40  GLN B NE2 1 
ATOM   2008 N  N   . ARG B 1 41  ? 8.657   -17.092 -16.918 1.00 13.30  ? 41  ARG B N   1 
ATOM   2009 C  CA  . ARG B 1 41  ? 8.731   -16.995 -18.384 1.00 12.72  ? 41  ARG B CA  1 
ATOM   2010 C  C   . ARG B 1 41  ? 9.081   -15.590 -18.836 1.00 14.07  ? 41  ARG B C   1 
ATOM   2011 O  O   . ARG B 1 41  ? 8.496   -14.633 -18.367 1.00 15.69  ? 41  ARG B O   1 
ATOM   2012 C  CB  . ARG B 1 41  ? 7.442   -17.474 -19.038 1.00 14.29  ? 41  ARG B CB  1 
ATOM   2013 C  CG  . ARG B 1 41  ? 7.256   -18.980 -19.116 1.00 13.59  ? 41  ARG B CG  1 
ATOM   2014 C  CD  . ARG B 1 41  ? 8.031   -19.633 -20.264 1.00 12.30  ? 41  ARG B CD  1 
ATOM   2015 N  NE  . ARG B 1 41  ? 7.447   -19.203 -21.522 1.00 11.89  ? 41  ARG B NE  1 
ATOM   2016 C  CZ  . ARG B 1 41  ? 7.946   -18.321 -22.387 1.00 11.73  ? 41  ARG B CZ  1 
ATOM   2017 N  NH1 . ARG B 1 41  ? 9.118   -17.743 -22.243 1.00 12.87  ? 41  ARG B NH1 1 
ATOM   2018 N  NH2 . ARG B 1 41  ? 7.216   -18.007 -23.458 1.00 11.75  ? 41  ARG B NH2 1 
ATOM   2019 N  N   . ARG B 1 42  ? 10.053  -15.485 -19.748 1.00 13.63  ? 42  ARG B N   1 
ATOM   2020 C  CA  . ARG B 1 42  ? 10.467  -14.251 -20.355 1.00 16.27  ? 42  ARG B CA  1 
ATOM   2021 C  C   . ARG B 1 42  ? 10.669  -14.490 -21.871 1.00 14.47  ? 42  ARG B C   1 
ATOM   2022 O  O   . ARG B 1 42  ? 11.331  -15.466 -22.208 1.00 15.25  ? 42  ARG B O   1 
ATOM   2023 C  CB  . ARG B 1 42  ? 11.803  -13.664 -19.817 1.00 18.23  ? 42  ARG B CB  1 
ATOM   2024 C  CG  . ARG B 1 42  ? 11.809  -13.410 -18.311 1.00 20.78  ? 42  ARG B CG  1 
ATOM   2025 C  CD  . ARG B 1 42  ? 10.899  -12.241 -17.951 1.00 21.51  ? 42  ARG B CD  1 
ATOM   2026 N  NE  . ARG B 1 42  ? 11.011  -11.996 -16.524 1.00 24.31  ? 42  ARG B NE  1 
ATOM   2027 C  CZ  . ARG B 1 42  ? 10.304  -12.497 -15.529 1.00 27.39  ? 42  ARG B CZ  1 
ATOM   2028 N  NH1 . ARG B 1 42  ? 9.325   -13.354 -15.794 1.00 29.17  ? 42  ARG B NH1 1 
ATOM   2029 N  NH2 . ARG B 1 42  ? 10.617  -12.099 -14.295 1.00 38.92  ? 42  ARG B NH2 1 
ATOM   2030 N  N   . GLY B 1 43  ? 10.126  -13.631 -22.711 1.00 16.12  ? 43  GLY B N   1 
ATOM   2031 C  CA  . GLY B 1 43  ? 10.302  -13.743 -24.141 1.00 14.79  ? 43  GLY B CA  1 
ATOM   2032 C  C   . GLY B 1 43  ? 9.238   -14.607 -24.740 1.00 13.86  ? 43  GLY B C   1 
ATOM   2033 O  O   . GLY B 1 43  ? 8.761   -15.576 -24.112 1.00 14.28  ? 43  GLY B O   1 
ATOM   2034 N  N   . PHE B 1 44  ? 8.838   -14.282 -25.940 1.00 14.50  ? 44  PHE B N   1 
ATOM   2035 C  CA  . PHE B 1 44  ? 7.698   -14.902 -26.594 1.00 13.36  ? 44  PHE B CA  1 
ATOM   2036 C  C   . PHE B 1 44  ? 7.872   -16.404 -26.775 1.00 13.71  ? 44  PHE B C   1 
ATOM   2037 O  O   . PHE B 1 44  ? 6.911   -17.145 -26.625 1.00 15.78  ? 44  PHE B O   1 
ATOM   2038 C  CB  . PHE B 1 44  ? 7.474   -14.264 -27.961 1.00 12.22  ? 44  PHE B CB  1 
ATOM   2039 C  CG  . PHE B 1 44  ? 6.253   -14.716 -28.710 1.00 11.96  ? 44  PHE B CG  1 
ATOM   2040 C  CD1 . PHE B 1 44  ? 5.010   -14.526 -28.200 1.00 11.95  ? 44  PHE B CD1 1 
ATOM   2041 C  CD2 . PHE B 1 44  ? 6.374   -15.337 -29.934 1.00 12.43  ? 44  PHE B CD2 1 
ATOM   2042 C  CE1 . PHE B 1 44  ? 3.887   -14.896 -28.880 1.00 12.79  ? 44  PHE B CE1 1 
ATOM   2043 C  CE2 . PHE B 1 44  ? 5.260   -15.724 -30.656 1.00 14.42  ? 44  PHE B CE2 1 
ATOM   2044 C  CZ  . PHE B 1 44  ? 4.022   -15.495 -30.117 1.00 12.35  ? 44  PHE B CZ  1 
ATOM   2045 N  N   . LEU B 1 45  ? 9.076   -16.843 -27.104 1.00 13.92  ? 45  LEU B N   1 
ATOM   2046 C  CA  . LEU B 1 45  ? 9.260   -18.250 -27.457 1.00 16.83  ? 45  LEU B CA  1 
ATOM   2047 C  C   . LEU B 1 45  ? 9.764   -19.049 -26.272 1.00 14.62  ? 45  LEU B C   1 
ATOM   2048 O  O   . LEU B 1 45  ? 10.946  -19.004 -25.844 1.00 14.03  ? 45  LEU B O   1 
ATOM   2049 C  CB  . LEU B 1 45  ? 10.264  -18.363 -28.593 1.00 22.32  ? 45  LEU B CB  1 
ATOM   2050 C  CG  . LEU B 1 45  ? 9.935   -17.628 -29.893 1.00 32.67  ? 45  LEU B CG  1 
ATOM   2051 C  CD1 . LEU B 1 45  ? 11.079  -17.790 -30.900 1.00 45.17  ? 45  LEU B CD1 1 
ATOM   2052 C  CD2 . LEU B 1 45  ? 8.596   -18.082 -30.481 1.00 42.28  ? 45  LEU B CD2 1 
ATOM   2053 N  N   . ALA B 1 46  ? 8.882   -19.838 -25.686 1.00 14.54  ? 46  ALA B N   1 
ATOM   2054 C  CA  . ALA B 1 46  ? 9.255   -20.707 -24.593 1.00 14.47  ? 46  ALA B CA  1 
ATOM   2055 C  C   . ALA B 1 46  ? 10.401  -21.627 -24.990 1.00 12.79  ? 46  ALA B C   1 
ATOM   2056 O  O   . ALA B 1 46  ? 11.257  -21.898 -24.160 1.00 12.20  ? 46  ALA B O   1 
ATOM   2057 C  CB  . ALA B 1 46  ? 8.041   -21.552 -24.221 1.00 15.35  ? 46  ALA B CB  1 
ATOM   2058 N  N   . ARG B 1 47  ? 10.381  -22.147 -26.194 1.00 12.55  ? 47  ARG B N   1 
ATOM   2059 C  CA  . ARG B 1 47  ? 11.421  -23.065 -26.622 1.00 12.58  ? 47  ARG B CA  1 
ATOM   2060 C  C   . ARG B 1 47  ? 12.827  -22.525 -26.422 1.00 12.85  ? 47  ARG B C   1 
ATOM   2061 O  O   . ARG B 1 47  ? 13.766  -23.267 -26.044 1.00 11.84  ? 47  ARG B O   1 
ATOM   2062 C  CB  . ARG B 1 47  ? 11.195  -23.396 -28.115 1.00 15.35  ? 47  ARG B CB  1 
ATOM   2063 C  CG  . ARG B 1 47  ? 12.175  -24.390 -28.656 1.00 18.00  ? 47  ARG B CG  1 
ATOM   2064 C  CD  . ARG B 1 47  ? 12.009  -24.676 -30.140 1.00 23.36  ? 47  ARG B CD  1 
ATOM   2065 N  NE  . ARG B 1 47  ? 12.651  -25.952 -30.432 1.00 28.76  ? 47  ARG B NE  1 
ATOM   2066 C  CZ  . ARG B 1 47  ? 12.553  -26.698 -31.503 1.00 31.12  ? 47  ARG B CZ  1 
ATOM   2067 N  NH1 . ARG B 1 47  ? 13.231  -27.848 -31.568 1.00 45.07  ? 47  ARG B NH1 1 
ATOM   2068 N  NH2 . ARG B 1 47  ? 11.802  -26.391 -32.557 1.00 42.21  ? 47  ARG B NH2 1 
ATOM   2069 N  N   . GLU B 1 48  ? 13.011  -21.224 -26.669 1.00 11.94  ? 48  GLU B N   1 
ATOM   2070 C  CA  . GLU B 1 48  ? 14.363  -20.630 -26.523 1.00 12.74  ? 48  GLU B CA  1 
ATOM   2071 C  C   . GLU B 1 48  ? 14.704  -20.450 -25.062 1.00 11.98  ? 48  GLU B C   1 
ATOM   2072 O  O   . GLU B 1 48  ? 15.892  -20.516 -24.718 1.00 13.25  ? 48  GLU B O   1 
ATOM   2073 C  CB  . GLU B 1 48  ? 14.379  -19.338 -27.364 1.00 14.27  ? 48  GLU B CB  1 
ATOM   2074 C  CG  . GLU B 1 48  ? 14.200  -19.601 -28.847 1.00 17.37  ? 48  GLU B CG  1 
ATOM   2075 C  CD  . GLU B 1 48  ? 15.040  -20.714 -29.441 1.00 19.00  ? 48  GLU B CD  1 
ATOM   2076 O  OE1 . GLU B 1 48  ? 14.474  -21.570 -30.179 1.00 21.64  ? 48  GLU B OE1 1 
ATOM   2077 O  OE2 . GLU B 1 48  ? 16.256  -20.805 -29.154 1.00 20.15  ? 48  GLU B OE2 1 
ATOM   2078 N  N   . GLN B 1 49  ? 13.715  -20.215 -24.177 1.00 11.75  ? 49  GLN B N   1 
ATOM   2079 C  CA  . GLN B 1 49  ? 14.080  -20.162 -22.741 1.00 12.17  ? 49  GLN B CA  1 
ATOM   2080 C  C   . GLN B 1 49  ? 14.467  -21.512 -22.215 1.00 11.88  ? 49  GLN B C   1 
ATOM   2081 O  O   . GLN B 1 49  ? 15.365  -21.649 -21.401 1.00 13.37  ? 49  GLN B O   1 
ATOM   2082 C  CB  . GLN B 1 49  ? 12.930  -19.530 -21.970 1.00 12.48  ? 49  GLN B CB  1 
ATOM   2083 C  CG  . GLN B 1 49  ? 13.284  -19.266 -20.516 1.00 12.96  ? 49  GLN B CG  1 
ATOM   2084 C  CD  . GLN B 1 49  ? 12.244  -18.419 -19.774 1.00 13.21  ? 49  GLN B CD  1 
ATOM   2085 O  OE1 . GLN B 1 49  ? 11.154  -18.115 -20.295 1.00 13.83  ? 49  GLN B OE1 1 
ATOM   2086 N  NE2 . GLN B 1 49  ? 12.544  -17.993 -18.557 1.00 15.27  ? 49  GLN B NE2 1 
ATOM   2087 N  N   . TYR B 1 50  ? 13.759  -22.555 -22.693 1.00 10.99  ? 50  TYR B N   1 
ATOM   2088 C  CA  . TYR B 1 50  ? 14.153  -23.890 -22.316 1.00 10.86  ? 50  TYR B CA  1 
ATOM   2089 C  C   . TYR B 1 50  ? 15.530  -24.238 -22.849 1.00 10.69  ? 50  TYR B C   1 
ATOM   2090 O  O   . TYR B 1 50  ? 16.326  -24.879 -22.148 1.00 11.81  ? 50  TYR B O   1 
ATOM   2091 C  CB  . TYR B 1 50  ? 13.101  -24.956 -22.766 1.00 10.92  ? 50  TYR B CB  1 
ATOM   2092 C  CG  . TYR B 1 50  ? 11.940  -25.030 -21.805 1.00 10.53  ? 50  TYR B CG  1 
ATOM   2093 C  CD1 . TYR B 1 50  ? 10.903  -24.108 -21.786 1.00 10.80  ? 50  TYR B CD1 1 
ATOM   2094 C  CD2 . TYR B 1 50  ? 11.849  -26.043 -20.860 1.00 11.57  ? 50  TYR B CD2 1 
ATOM   2095 C  CE1 . TYR B 1 50  ? 9.843   -24.200 -20.887 1.00 11.16  ? 50  TYR B CE1 1 
ATOM   2096 C  CE2 . TYR B 1 50  ? 10.806  -26.174 -19.965 1.00 11.29  ? 50  TYR B CE2 1 
ATOM   2097 C  CZ  . TYR B 1 50  ? 9.798   -25.229 -19.971 1.00 11.80  ? 50  TYR B CZ  1 
ATOM   2098 O  OH  . TYR B 1 50  ? 8.792   -25.344 -19.034 1.00 11.86  ? 50  TYR B OH  1 
ATOM   2099 N  N   . ARG B 1 51  ? 15.843  -23.821 -24.085 1.00 11.56  ? 51  ARG B N   1 
ATOM   2100 C  CA  . ARG B 1 51  ? 17.152  -24.073 -24.639 1.00 11.25  ? 51  ARG B CA  1 
ATOM   2101 C  C   . ARG B 1 51  ? 18.237  -23.454 -23.754 1.00 11.40  ? 51  ARG B C   1 
ATOM   2102 O  O   . ARG B 1 51  ? 19.292  -24.028 -23.529 1.00 11.94  ? 51  ARG B O   1 
ATOM   2103 C  CB  . ARG B 1 51  ? 17.284  -23.516 -26.081 1.00 12.16  ? 51  ARG B CB  1 
ATOM   2104 C  CG  . ARG B 1 51  ? 18.479  -24.092 -26.830 1.00 14.07  ? 51  ARG B CG  1 
ATOM   2105 C  CD  . ARG B 1 51  ? 18.769  -23.318 -28.136 1.00 13.70  ? 51  ARG B CD  1 
ATOM   2106 N  NE  . ARG B 1 51  ? 17.600  -23.267 -29.017 1.00 16.29  ? 51  ARG B NE  1 
ATOM   2107 C  CZ  . ARG B 1 51  ? 17.109  -24.154 -29.842 1.00 16.36  ? 51  ARG B CZ  1 
ATOM   2108 N  NH1 . ARG B 1 51  ? 17.699  -25.308 -29.999 1.00 18.73  ? 51  ARG B NH1 1 
ATOM   2109 N  NH2 . ARG B 1 51  ? 16.008  -23.906 -30.557 1.00 18.50  ? 51  ARG B NH2 1 
ATOM   2110 N  N   . ALA B 1 52  ? 17.981  -22.260 -23.244 1.00 12.75  ? 52  ALA B N   1 
ATOM   2111 C  CA  . ALA B 1 52  ? 18.914  -21.552 -22.374 1.00 14.08  ? 52  ALA B CA  1 
ATOM   2112 C  C   . ALA B 1 52  ? 19.067  -22.316 -21.058 1.00 13.84  ? 52  ALA B C   1 
ATOM   2113 O  O   . ALA B 1 52  ? 20.153  -22.277 -20.468 1.00 18.22  ? 52  ALA B O   1 
ATOM   2114 C  CB  . ALA B 1 52  ? 18.426  -20.133 -22.171 1.00 16.29  ? 52  ALA B CB  1 
ATOM   2115 N  N   . LEU B 1 53  ? 18.011  -22.942 -20.575 1.00 13.83  ? 53  LEU B N   1 
ATOM   2116 C  CA  . LEU B 1 53  ? 17.999  -23.689 -19.305 1.00 13.80  ? 53  LEU B CA  1 
ATOM   2117 C  C   . LEU B 1 53  ? 18.954  -24.881 -19.469 1.00 14.87  ? 53  LEU B C   1 
ATOM   2118 O  O   . LEU B 1 53  ? 19.821  -25.105 -18.639 1.00 16.22  ? 53  LEU B O   1 
ATOM   2119 C  CB  . LEU B 1 53  ? 16.592  -24.078 -18.886 1.00 15.32  ? 53  LEU B CB  1 
ATOM   2120 C  CG  . LEU B 1 53  ? 16.425  -24.845 -17.541 1.00 17.33  ? 53  LEU B CG  1 
ATOM   2121 C  CD1 . LEU B 1 53  ? 17.038  -24.047 -16.393 1.00 22.06  ? 53  LEU B CD1 1 
ATOM   2122 C  CD2 . LEU B 1 53  ? 14.952  -25.131 -17.391 1.00 18.86  ? 53  LEU B CD2 1 
ATOM   2123 N  N   . ARG B 1 54  ? 18.797  -25.641 -20.553 1.00 12.82  ? 54  ARG B N   1 
ATOM   2124 C  CA  . ARG B 1 54  ? 19.701  -26.755 -20.917 1.00 12.93  ? 54  ARG B CA  1 
ATOM   2125 C  C   . ARG B 1 54  ? 19.439  -27.076 -22.386 1.00 12.48  ? 54  ARG B C   1 
ATOM   2126 O  O   . ARG B 1 54  ? 18.260  -27.242 -22.760 1.00 12.69  ? 54  ARG B O   1 
ATOM   2127 C  CB  . ARG B 1 54  ? 19.470  -28.010 -20.102 1.00 14.52  ? 54  ARG B CB  1 
ATOM   2128 C  CG  . ARG B 1 54  ? 20.685  -28.936 -20.098 1.00 13.15  ? 54  ARG B CG  1 
ATOM   2129 C  CD  . ARG B 1 54  ? 20.470  -30.157 -19.257 1.00 12.88  ? 54  ARG B CD  1 
ATOM   2130 N  NE  . ARG B 1 54  ? 19.488  -31.068 -19.835 1.00 14.44  ? 54  ARG B NE  1 
ATOM   2131 C  CZ  . ARG B 1 54  ? 18.460  -31.657 -19.219 1.00 13.06  ? 54  ARG B CZ  1 
ATOM   2132 N  NH1 . ARG B 1 54  ? 17.683  -32.468 -19.918 1.00 14.24  ? 54  ARG B NH1 1 
ATOM   2133 N  NH2 . ARG B 1 54  ? 18.173  -31.476 -17.955 1.00 16.03  ? 54  ARG B NH2 1 
ATOM   2134 N  N   . PRO B 1 55  ? 20.428  -27.113 -23.244 1.00 13.33  ? 55  PRO B N   1 
ATOM   2135 C  CA  . PRO B 1 55  ? 20.166  -27.209 -24.712 1.00 13.28  ? 55  PRO B CA  1 
ATOM   2136 C  C   . PRO B 1 55  ? 19.201  -28.288 -25.164 1.00 13.63  ? 55  PRO B C   1 
ATOM   2137 O  O   . PRO B 1 55  ? 18.345  -27.971 -26.026 1.00 16.76  ? 55  PRO B O   1 
ATOM   2138 C  CB  . PRO B 1 55  ? 21.572  -27.515 -25.266 1.00 15.98  ? 55  PRO B CB  1 
ATOM   2139 C  CG  . PRO B 1 55  ? 22.455  -26.691 -24.384 1.00 15.16  ? 55  PRO B CG  1 
ATOM   2140 C  CD  . PRO B 1 55  ? 21.859  -26.892 -23.007 1.00 14.95  ? 55  PRO B CD  1 
ATOM   2141 N  N   . ASP B 1 56  ? 19.242  -29.488 -24.623 1.00 14.96  ? 56  ASP B N   1 
ATOM   2142 C  CA  . ASP B 1 56  ? 18.380  -30.565 -25.130 1.00 13.39  ? 56  ASP B CA  1 
ATOM   2143 C  C   . ASP B 1 56  ? 16.909  -30.365 -24.737 1.00 13.40  ? 56  ASP B C   1 
ATOM   2144 O  O   . ASP B 1 56  ? 16.043  -31.055 -25.275 1.00 13.72  ? 56  ASP B O   1 
ATOM   2145 C  CB  . ASP B 1 56  ? 18.863  -31.941 -24.688 1.00 16.68  ? 56  ASP B CB  1 
ATOM   2146 C  CG  . ASP B 1 56  ? 18.773  -32.067 -23.189 1.00 15.77  ? 56  ASP B CG  1 
ATOM   2147 O  OD1 . ASP B 1 56  ? 19.707  -31.607 -22.473 1.00 21.96  ? 56  ASP B OD1 1 
ATOM   2148 O  OD2 . ASP B 1 56  ? 17.788  -32.640 -22.712 1.00 19.18  ? 56  ASP B OD2 1 
ATOM   2149 N  N   . LEU B 1 57  ? 16.624  -29.457 -23.838 1.00 11.62  ? 57  LEU B N   1 
ATOM   2150 C  CA  . LEU B 1 57  ? 15.224  -29.191 -23.445 1.00 11.39  ? 57  LEU B CA  1 
ATOM   2151 C  C   . LEU B 1 57  ? 14.459  -28.542 -24.562 1.00 11.17  ? 57  LEU B C   1 
ATOM   2152 O  O   . LEU B 1 57  ? 13.211  -28.618 -24.584 1.00 12.10  ? 57  LEU B O   1 
ATOM   2153 C  CB  . LEU B 1 57  ? 15.194  -28.377 -22.157 1.00 12.34  ? 57  LEU B CB  1 
ATOM   2154 C  CG  . LEU B 1 57  ? 15.730  -29.048 -20.893 1.00 12.15  ? 57  LEU B CG  1 
ATOM   2155 C  CD1 . LEU B 1 57  ? 15.711  -28.043 -19.726 1.00 16.03  ? 57  LEU B CD1 1 
ATOM   2156 C  CD2 . LEU B 1 57  ? 14.950  -30.307 -20.604 1.00 16.15  ? 57  LEU B CD2 1 
ATOM   2157 N  N   . ALA B 1 58  ? 15.125  -27.878 -25.513 1.00 13.10  ? 58  ALA B N   1 
ATOM   2158 C  CA  . ALA B 1 58  ? 14.414  -27.215 -26.585 1.00 11.54  ? 58  ALA B CA  1 
ATOM   2159 C  C   . ALA B 1 58  ? 13.581  -28.175 -27.410 1.00 11.42  ? 58  ALA B C   1 
ATOM   2160 O  O   . ALA B 1 58  ? 12.406  -27.930 -27.691 1.00 13.06  ? 58  ALA B O   1 
ATOM   2161 C  CB  . ALA B 1 58  ? 15.431  -26.532 -27.505 1.00 14.55  ? 58  ALA B CB  1 
ATOM   2162 N  N   . ASP B 1 59  ? 14.175  -29.290 -27.810 1.00 13.71  ? 59  ASP B N   1 
ATOM   2163 C  CA  . ASP B 1 59  ? 13.437  -30.245 -28.618 1.00 14.67  ? 59  ASP B CA  1 
ATOM   2164 C  C   . ASP B 1 59  ? 12.381  -30.934 -27.770 1.00 12.16  ? 59  ASP B C   1 
ATOM   2165 O  O   . ASP B 1 59  ? 11.363  -31.381 -28.322 1.00 13.13  ? 59  ASP B O   1 
ATOM   2166 C  CB  . ASP B 1 59  ? 14.363  -31.262 -29.271 1.00 20.75  ? 59  ASP B CB  1 
ATOM   2167 C  CG  . ASP B 1 59  ? 15.139  -30.666 -30.427 1.00 28.39  ? 59  ASP B CG  1 
ATOM   2168 O  OD1 . ASP B 1 59  ? 14.941  -29.475 -30.764 1.00 28.72  ? 59  ASP B OD1 1 
ATOM   2169 O  OD2 . ASP B 1 59  ? 15.960  -31.399 -31.007 1.00 38.07  ? 59  ASP B OD2 1 
ATOM   2170 N  N   . LYS B 1 60  ? 12.630  -31.097 -26.448 1.00 12.74  ? 60  LYS B N   1 
ATOM   2171 C  CA  A LYS B 1 60  ? 11.656  -31.745 -25.578 0.34 10.74  ? 60  LYS B CA  1 
ATOM   2172 C  CA  B LYS B 1 60  ? 11.615  -31.800 -25.658 0.66 10.93  ? 60  LYS B CA  1 
ATOM   2173 C  C   . LYS B 1 60  ? 10.384  -30.918 -25.555 1.00 11.66  ? 60  LYS B C   1 
ATOM   2174 O  O   . LYS B 1 60  ? 9.247   -31.412 -25.691 1.00 11.55  ? 60  LYS B O   1 
ATOM   2175 C  CB  A LYS B 1 60  ? 12.105  -31.913 -24.118 0.34 8.40   ? 60  LYS B CB  1 
ATOM   2176 C  CB  B LYS B 1 60  ? 12.216  -32.193 -24.318 0.66 12.72  ? 60  LYS B CB  1 
ATOM   2177 C  CG  A LYS B 1 60  ? 13.210  -32.938 -23.979 0.34 8.48   ? 60  LYS B CG  1 
ATOM   2178 C  CG  B LYS B 1 60  ? 13.394  -33.167 -24.453 0.66 17.35  ? 60  LYS B CG  1 
ATOM   2179 C  CD  A LYS B 1 60  ? 13.534  -33.264 -22.522 0.34 8.62   ? 60  LYS B CD  1 
ATOM   2180 C  CD  B LYS B 1 60  ? 13.940  -33.494 -23.054 0.66 17.03  ? 60  LYS B CD  1 
ATOM   2181 C  CE  A LYS B 1 60  ? 14.699  -34.261 -22.467 0.34 13.00  ? 60  LYS B CE  1 
ATOM   2182 C  CE  B LYS B 1 60  ? 14.678  -34.820 -22.980 0.66 23.26  ? 60  LYS B CE  1 
ATOM   2183 N  NZ  A LYS B 1 60  ? 15.761  -33.799 -21.527 0.34 33.30  ? 60  LYS B NZ  1 
ATOM   2184 N  NZ  B LYS B 1 60  ? 16.086  -34.665 -23.419 0.66 19.51  ? 60  LYS B NZ  1 
ATOM   2185 N  N   . VAL B 1 61  ? 10.559  -29.625 -25.332 1.00 10.70  ? 61  VAL B N   1 
ATOM   2186 C  CA  A VAL B 1 61  ? 9.327   -28.820 -25.198 0.48 12.01  ? 61  VAL B CA  1 
ATOM   2187 C  CA  B VAL B 1 61  ? 9.397   -28.754 -25.244 0.52 11.47  ? 61  VAL B CA  1 
ATOM   2188 C  C   . VAL B 1 61  ? 8.681   -28.692 -26.579 1.00 12.27  ? 61  VAL B C   1 
ATOM   2189 O  O   . VAL B 1 61  ? 7.455   -28.716 -26.640 1.00 12.27  ? 61  VAL B O   1 
ATOM   2190 C  CB  A VAL B 1 61  ? 9.753   -27.583 -24.395 0.48 12.66  ? 61  VAL B CB  1 
ATOM   2191 C  CB  B VAL B 1 61  ? 9.762   -27.309 -24.860 0.52 17.90  ? 61  VAL B CB  1 
ATOM   2192 C  CG1 A VAL B 1 61  ? 10.381  -26.523 -25.258 0.48 10.08  ? 61  VAL B CG1 1 
ATOM   2193 C  CG1 B VAL B 1 61  ? 10.357  -27.361 -23.480 0.52 19.53  ? 61  VAL B CG1 1 
ATOM   2194 C  CG2 A VAL B 1 61  ? 8.584   -26.955 -23.646 0.48 14.17  ? 61  VAL B CG2 1 
ATOM   2195 C  CG2 B VAL B 1 61  ? 10.721  -26.698 -25.840 0.52 44.03  ? 61  VAL B CG2 1 
ATOM   2196 N  N   . ALA B 1 62  ? 9.418   -28.665 -27.692 1.00 11.95  ? 62  ALA B N   1 
ATOM   2197 C  CA  . ALA B 1 62  ? 8.764   -28.642 -28.988 1.00 12.80  ? 62  ALA B CA  1 
ATOM   2198 C  C   . ALA B 1 62  ? 7.931   -29.901 -29.212 1.00 12.13  ? 62  ALA B C   1 
ATOM   2199 O  O   . ALA B 1 62  ? 6.866   -29.855 -29.812 1.00 12.73  ? 62  ALA B O   1 
ATOM   2200 C  CB  . ALA B 1 62  ? 9.802   -28.470 -30.101 1.00 16.51  ? 62  ALA B CB  1 
ATOM   2201 N  N   . SER B 1 63  ? 8.389   -31.025 -28.693 1.00 11.88  ? 63  SER B N   1 
ATOM   2202 C  CA  . SER B 1 63  ? 7.665   -32.280 -28.907 1.00 11.79  ? 63  SER B CA  1 
ATOM   2203 C  C   . SER B 1 63  ? 6.298   -32.210 -28.212 1.00 11.60  ? 63  SER B C   1 
ATOM   2204 O  O   . SER B 1 63  ? 5.390   -32.904 -28.649 1.00 12.74  ? 63  SER B O   1 
ATOM   2205 C  CB  . SER B 1 63  ? 8.494   -33.496 -28.489 1.00 13.73  ? 63  SER B CB  1 
ATOM   2206 O  OG  . SER B 1 63  ? 8.495   -33.598 -27.057 1.00 15.61  ? 63  SER B OG  1 
ATOM   2207 N  N   . VAL B 1 64  ? 6.165   -31.413 -27.163 1.00 10.07  ? 64  VAL B N   1 
ATOM   2208 C  CA  . VAL B 1 64  ? 4.879   -31.244 -26.517 1.00 9.63   ? 64  VAL B CA  1 
ATOM   2209 C  C   . VAL B 1 64  ? 3.914   -30.495 -27.410 1.00 9.78   ? 64  VAL B C   1 
ATOM   2210 O  O   . VAL B 1 64  ? 2.789   -30.934 -27.639 1.00 10.12  ? 64  VAL B O   1 
ATOM   2211 C  CB  . VAL B 1 64  ? 5.066   -30.560 -25.140 1.00 9.92   ? 64  VAL B CB  1 
ATOM   2212 C  CG1 . VAL B 1 64  ? 3.702   -30.298 -24.503 1.00 11.07  ? 64  VAL B CG1 1 
ATOM   2213 C  CG2 . VAL B 1 64  ? 5.905   -31.389 -24.212 1.00 11.24  ? 64  VAL B CG2 1 
ATOM   2214 N  N   . TYR B 1 65  ? 4.320   -29.318 -27.947 1.00 9.98   ? 65  TYR B N   1 
ATOM   2215 C  CA  . TYR B 1 65  ? 3.357   -28.477 -28.674 1.00 10.31  ? 65  TYR B CA  1 
ATOM   2216 C  C   . TYR B 1 65  ? 3.176   -29.010 -30.129 1.00 9.90   ? 65  TYR B C   1 
ATOM   2217 O  O   . TYR B 1 65  ? 2.232   -28.579 -30.780 1.00 11.48  ? 65  TYR B O   1 
ATOM   2218 C  CB  . TYR B 1 65  ? 3.657   -26.994 -28.628 1.00 11.72  ? 65  TYR B CB  1 
ATOM   2219 C  CG  . TYR B 1 65  ? 4.942   -26.472 -29.180 1.00 11.46  ? 65  TYR B CG  1 
ATOM   2220 C  CD1 . TYR B 1 65  ? 5.253   -26.545 -30.541 1.00 13.48  ? 65  TYR B CD1 1 
ATOM   2221 C  CD2 . TYR B 1 65  ? 5.901   -25.891 -28.352 1.00 14.87  ? 65  TYR B CD2 1 
ATOM   2222 C  CE1 . TYR B 1 65  ? 6.416   -26.078 -31.057 1.00 15.44  ? 65  TYR B CE1 1 
ATOM   2223 C  CE2 . TYR B 1 65  ? 7.108   -25.402 -28.889 1.00 18.96  ? 65  TYR B CE2 1 
ATOM   2224 C  CZ  . TYR B 1 65  ? 7.347   -25.514 -30.218 1.00 19.12  ? 65  TYR B CZ  1 
ATOM   2225 O  OH  . TYR B 1 65  ? 8.510   -25.030 -30.803 1.00 22.43  ? 65  TYR B OH  1 
ATOM   2226 N  N   . GLU B 1 66  ? 4.029   -29.924 -30.580 1.00 10.69  ? 66  GLU B N   1 
ATOM   2227 C  CA  . GLU B 1 66  ? 3.891   -30.553 -31.891 1.00 12.05  ? 66  GLU B CA  1 
ATOM   2228 C  C   . GLU B 1 66  ? 3.064   -31.819 -31.830 1.00 12.87  ? 66  GLU B C   1 
ATOM   2229 O  O   . GLU B 1 66  ? 2.774   -32.373 -32.886 1.00 15.98  ? 66  GLU B O   1 
ATOM   2230 C  CB  . GLU B 1 66  ? 5.258   -30.830 -32.498 1.00 14.03  ? 66  GLU B CB  1 
ATOM   2231 C  CG  . GLU B 1 66  ? 6.037   -29.575 -32.839 1.00 17.13  ? 66  GLU B CG  1 
ATOM   2232 C  CD  . GLU B 1 66  ? 7.435   -29.758 -33.389 1.00 25.42  ? 66  GLU B CD  1 
ATOM   2233 O  OE1 . GLU B 1 66  ? 7.912   -30.894 -33.392 1.00 33.86  ? 66  GLU B OE1 1 
ATOM   2234 O  OE2 . GLU B 1 66  ? 8.039   -28.742 -33.820 1.00 35.29  ? 66  GLU B OE2 1 
ATOM   2235 N  N   . ALA B 1 67  ? 2.662   -32.296 -30.654 1.00 11.61  ? 67  ALA B N   1 
ATOM   2236 C  CA  . ALA B 1 67  ? 1.962   -33.559 -30.527 1.00 13.48  ? 67  ALA B CA  1 
ATOM   2237 C  C   . ALA B 1 67  ? 0.481   -33.427 -30.902 1.00 11.82  ? 67  ALA B C   1 
ATOM   2238 O  O   . ALA B 1 67  ? -0.163  -32.412 -30.614 1.00 11.82  ? 67  ALA B O   1 
ATOM   2239 C  CB  . ALA B 1 67  ? 2.075   -34.025 -29.089 1.00 12.54  ? 67  ALA B CB  1 
ATOM   2240 N  N   . PRO B 1 68  ? -0.037  -34.500 -31.513 1.00 12.64  ? 68  PRO B N   1 
ATOM   2241 C  CA  . PRO B 1 68  ? -1.470  -34.570 -31.735 1.00 12.90  ? 68  PRO B CA  1 
ATOM   2242 C  C   . PRO B 1 68  ? -2.217  -34.285 -30.426 1.00 12.28  ? 68  PRO B C   1 
ATOM   2243 O  O   . PRO B 1 68  ? -1.885  -34.776 -29.336 1.00 13.66  ? 68  PRO B O   1 
ATOM   2244 C  CB  . PRO B 1 68  ? -1.701  -36.005 -32.202 1.00 17.21  ? 68  PRO B CB  1 
ATOM   2245 C  CG  . PRO B 1 68  ? -0.357  -36.421 -32.760 1.00 18.04  ? 68  PRO B CG  1 
ATOM   2246 C  CD  . PRO B 1 68  ? 0.686   -35.680 -31.995 1.00 14.17  ? 68  PRO B CD  1 
ATOM   2247 N  N   . GLY B 1 69  ? -3.271  -33.470 -30.532 1.00 11.57  ? 69  GLY B N   1 
ATOM   2248 C  CA  . GLY B 1 69  ? -4.118  -33.155 -29.402 1.00 12.04  ? 69  GLY B CA  1 
ATOM   2249 C  C   . GLY B 1 69  ? -3.747  -31.903 -28.623 1.00 10.39  ? 69  GLY B C   1 
ATOM   2250 O  O   . GLY B 1 69  ? -4.587  -31.399 -27.900 1.00 12.42  ? 69  GLY B O   1 
ATOM   2251 N  N   . PHE B 1 70  ? -2.514  -31.456 -28.760 1.00 9.67   ? 70  PHE B N   1 
ATOM   2252 C  CA  . PHE B 1 70  ? -2.014  -30.354 -27.953 1.00 10.24  ? 70  PHE B CA  1 
ATOM   2253 C  C   . PHE B 1 70  ? -2.927  -29.128 -28.111 1.00 9.12   ? 70  PHE B C   1 
ATOM   2254 O  O   . PHE B 1 70  ? -3.392  -28.554 -27.121 1.00 10.44  ? 70  PHE B O   1 
ATOM   2255 C  CB  . PHE B 1 70  ? -0.562  -30.015 -28.298 1.00 9.11   ? 70  PHE B CB  1 
ATOM   2256 C  CG  . PHE B 1 70  ? -0.092  -28.791 -27.495 1.00 9.45   ? 70  PHE B CG  1 
ATOM   2257 C  CD1 . PHE B 1 70  ? 0.321   -28.960 -26.172 1.00 9.67   ? 70  PHE B CD1 1 
ATOM   2258 C  CD2 . PHE B 1 70  ? -0.087  -27.531 -28.053 1.00 9.46   ? 70  PHE B CD2 1 
ATOM   2259 C  CE1 . PHE B 1 70  ? 0.700   -27.869 -25.435 1.00 11.34  ? 70  PHE B CE1 1 
ATOM   2260 C  CE2 . PHE B 1 70  ? 0.277   -26.457 -27.314 1.00 10.36  ? 70  PHE B CE2 1 
ATOM   2261 C  CZ  . PHE B 1 70  ? 0.666   -26.597 -26.000 1.00 11.33  ? 70  PHE B CZ  1 
ATOM   2262 N  N   . PHE B 1 71  ? -3.122  -28.689 -29.346 1.00 9.10   ? 71  PHE B N   1 
ATOM   2263 C  CA  . PHE B 1 71  ? -3.965  -27.501 -29.556 1.00 9.52   ? 71  PHE B CA  1 
ATOM   2264 C  C   . PHE B 1 71  ? -5.405  -27.765 -29.197 1.00 9.44   ? 71  PHE B C   1 
ATOM   2265 O  O   . PHE B 1 71  ? -6.083  -26.903 -28.618 1.00 10.12  ? 71  PHE B O   1 
ATOM   2266 C  CB  . PHE B 1 71  ? -3.805  -26.999 -31.006 1.00 9.71   ? 71  PHE B CB  1 
ATOM   2267 C  CG  . PHE B 1 71  ? -2.544  -26.173 -31.152 1.00 9.68   ? 71  PHE B CG  1 
ATOM   2268 C  CD1 . PHE B 1 71  ? -2.513  -24.838 -30.809 1.00 10.62  ? 71  PHE B CD1 1 
ATOM   2269 C  CD2 . PHE B 1 71  ? -1.392  -26.791 -31.616 1.00 9.80   ? 71  PHE B CD2 1 
ATOM   2270 C  CE1 . PHE B 1 71  ? -1.353  -24.114 -30.934 1.00 11.48  ? 71  PHE B CE1 1 
ATOM   2271 C  CE2 . PHE B 1 71  ? -0.225  -26.058 -31.754 1.00 10.57  ? 71  PHE B CE2 1 
ATOM   2272 C  CZ  . PHE B 1 71  ? -0.211  -24.733 -31.409 1.00 10.96  ? 71  PHE B CZ  1 
ATOM   2273 N  N   . LEU B 1 72  ? -5.920  -28.943 -29.561 1.00 10.01  ? 72  LEU B N   1 
ATOM   2274 C  CA  . LEU B 1 72  ? -7.327  -29.253 -29.317 1.00 11.25  ? 72  LEU B CA  1 
ATOM   2275 C  C   . LEU B 1 72  ? -7.658  -29.142 -27.838 1.00 10.99  ? 72  LEU B C   1 
ATOM   2276 O  O   . LEU B 1 72  ? -8.782  -28.775 -27.485 1.00 11.20  ? 72  LEU B O   1 
ATOM   2277 C  CB  . LEU B 1 72  ? -7.648  -30.638 -29.815 1.00 13.18  ? 72  LEU B CB  1 
ATOM   2278 C  CG  . LEU B 1 72  ? -9.065  -31.135 -29.753 1.00 15.78  ? 72  LEU B CG  1 
ATOM   2279 C  CD1 . LEU B 1 72  ? -9.935  -30.351 -30.746 1.00 20.65  ? 72  LEU B CD1 1 
ATOM   2280 C  CD2 . LEU B 1 72  ? -9.141  -32.622 -30.102 1.00 19.35  ? 72  LEU B CD2 1 
ATOM   2281 N  N   . ASP B 1 73  ? -6.702  -29.559 -26.988 1.00 10.46  ? 73  ASP B N   1 
ATOM   2282 C  CA  . ASP B 1 73  ? -6.958  -29.713 -25.568 1.00 10.98  ? 73  ASP B CA  1 
ATOM   2283 C  C   . ASP B 1 73  ? -6.603  -28.474 -24.739 1.00 10.35  ? 73  ASP B C   1 
ATOM   2284 O  O   . ASP B 1 73  ? -6.776  -28.516 -23.487 1.00 12.83  ? 73  ASP B O   1 
ATOM   2285 C  CB  . ASP B 1 73  ? -6.201  -30.922 -25.008 1.00 13.51  ? 73  ASP B CB  1 
ATOM   2286 C  CG  . ASP B 1 73  ? -6.653  -32.233 -25.605 1.00 17.47  ? 73  ASP B CG  1 
ATOM   2287 O  OD1 . ASP B 1 73  ? -7.742  -32.317 -26.216 1.00 20.27  ? 73  ASP B OD1 1 
ATOM   2288 O  OD2 . ASP B 1 73  ? -5.863  -33.181 -25.462 1.00 19.85  ? 73  ASP B OD2 1 
ATOM   2289 N  N   . LEU B 1 74  ? -6.178  -27.391 -25.307 1.00 9.11   ? 74  LEU B N   1 
ATOM   2290 C  CA  . LEU B 1 74  ? -5.897  -26.204 -24.525 1.00 9.87   ? 74  LEU B CA  1 
ATOM   2291 C  C   . LEU B 1 74  ? -7.113  -25.705 -23.787 1.00 10.12  ? 74  LEU B C   1 
ATOM   2292 O  O   . LEU B 1 74  ? -8.239  -25.748 -24.299 1.00 11.29  ? 74  LEU B O   1 
ATOM   2293 C  CB  . LEU B 1 74  ? -5.309  -25.100 -25.416 1.00 9.13   ? 74  LEU B CB  1 
ATOM   2294 C  CG  . LEU B 1 74  ? -3.967  -25.377 -26.048 1.00 9.58   ? 74  LEU B CG  1 
ATOM   2295 C  CD1 . LEU B 1 74  ? -3.550  -24.155 -26.899 1.00 9.83   ? 74  LEU B CD1 1 
ATOM   2296 C  CD2 . LEU B 1 74  ? -2.906  -25.729 -25.016 1.00 10.36  ? 74  LEU B CD2 1 
ATOM   2297 N  N   . GLU B 1 75  ? -6.876  -25.208 -22.584 1.00 10.43  ? 75  GLU B N   1 
ATOM   2298 C  CA  . GLU B 1 75  ? -7.979  -24.586 -21.869 1.00 11.17  ? 75  GLU B CA  1 
ATOM   2299 C  C   . GLU B 1 75  ? -8.144  -23.129 -22.277 1.00 10.34  ? 75  GLU B C   1 
ATOM   2300 O  O   . GLU B 1 75  ? -7.209  -22.467 -22.662 1.00 12.31  ? 75  GLU B O   1 
ATOM   2301 C  CB  . GLU B 1 75  ? -7.701  -24.680 -20.378 1.00 15.05  ? 75  GLU B CB  1 
ATOM   2302 C  CG  . GLU B 1 75  ? -7.493  -26.101 -19.880 1.00 27.70  ? 75  GLU B CG  1 
ATOM   2303 C  CD  . GLU B 1 75  ? -7.368  -26.358 -18.404 1.00 35.69  ? 75  GLU B CD  1 
ATOM   2304 O  OE1 . GLU B 1 75  ? -7.822  -27.458 -18.008 1.00 60.74  ? 75  GLU B OE1 1 
ATOM   2305 O  OE2 . GLU B 1 75  ? -6.805  -25.511 -17.679 1.00 50.63  ? 75  GLU B OE2 1 
ATOM   2306 N  N   . PRO B 1 76  ? -9.367  -22.586 -22.184 1.00 10.29  ? 76  PRO B N   1 
ATOM   2307 C  CA  . PRO B 1 76  ? -9.553  -21.183 -22.487 1.00 10.44  ? 76  PRO B CA  1 
ATOM   2308 C  C   . PRO B 1 76  ? -8.867  -20.285 -21.455 1.00 10.81  ? 76  PRO B C   1 
ATOM   2309 O  O   . PRO B 1 76  ? -8.711  -20.606 -20.274 1.00 14.62  ? 76  PRO B O   1 
ATOM   2310 C  CB  . PRO B 1 76  ? -11.075 -20.990 -22.366 1.00 11.60  ? 76  PRO B CB  1 
ATOM   2311 C  CG  . PRO B 1 76  ? -11.672 -22.341 -22.381 1.00 17.07  ? 76  PRO B CG  1 
ATOM   2312 C  CD  . PRO B 1 76  ? -10.623 -23.298 -21.869 1.00 13.22  ? 76  PRO B CD  1 
ATOM   2313 N  N   . ILE B 1 77  ? -8.449  -19.101 -21.876 1.00 11.11  ? 77  ILE B N   1 
ATOM   2314 C  CA  . ILE B 1 77  ? -7.983  -18.016 -21.027 1.00 12.03  ? 77  ILE B CA  1 
ATOM   2315 C  C   . ILE B 1 77  ? -9.181  -17.491 -20.206 1.00 12.25  ? 77  ILE B C   1 
ATOM   2316 O  O   . ILE B 1 77  ? -10.296 -17.350 -20.746 1.00 12.46  ? 77  ILE B O   1 
ATOM   2317 C  CB  . ILE B 1 77  ? -7.368  -16.903 -21.896 1.00 11.46  ? 77  ILE B CB  1 
ATOM   2318 C  CG1 . ILE B 1 77  ? -6.049  -17.304 -22.587 1.00 12.89  ? 77  ILE B CG1 1 
ATOM   2319 C  CG2 . ILE B 1 77  ? -7.248  -15.603 -21.126 1.00 12.51  ? 77  ILE B CG2 1 
ATOM   2320 C  CD1 . ILE B 1 77  ? -4.856  -17.378 -21.675 1.00 14.77  ? 77  ILE B CD1 1 
ATOM   2321 N  N   . PRO B 1 78  ? -9.022  -17.251 -18.894 1.00 14.00  ? 78  PRO B N   1 
ATOM   2322 C  CA  . PRO B 1 78  ? -10.181 -16.797 -18.095 1.00 14.92  ? 78  PRO B CA  1 
ATOM   2323 C  C   . PRO B 1 78  ? -10.845 -15.563 -18.678 1.00 13.87  ? 78  PRO B C   1 
ATOM   2324 O  O   . PRO B 1 78  ? -10.160 -14.648 -19.071 1.00 14.87  ? 78  PRO B O   1 
ATOM   2325 C  CB  . PRO B 1 78  ? -9.557  -16.418 -16.737 1.00 20.84  ? 78  PRO B CB  1 
ATOM   2326 C  CG  . PRO B 1 78  ? -8.296  -17.191 -16.671 1.00 23.74  ? 78  PRO B CG  1 
ATOM   2327 C  CD  . PRO B 1 78  ? -7.835  -17.432 -18.071 1.00 18.16  ? 78  PRO B CD  1 
ATOM   2328 N  N   . GLY B 1 79  ? -12.166 -15.582 -18.752 1.00 14.88  ? 79  GLY B N   1 
ATOM   2329 C  CA  . GLY B 1 79  ? -12.893 -14.423 -19.230 1.00 13.56  ? 79  GLY B CA  1 
ATOM   2330 C  C   . GLY B 1 79  ? -12.919 -14.256 -20.752 1.00 11.98  ? 79  GLY B C   1 
ATOM   2331 O  O   . GLY B 1 79  ? -13.703 -13.440 -21.273 1.00 14.42  ? 79  GLY B O   1 
ATOM   2332 N  N   . ALA B 1 80  ? -12.095 -14.990 -21.492 1.00 12.03  ? 80  ALA B N   1 
ATOM   2333 C  CA  . ALA B 1 80  ? -11.906 -14.711 -22.912 1.00 11.99  ? 80  ALA B CA  1 
ATOM   2334 C  C   . ALA B 1 80  ? -13.107 -15.052 -23.758 1.00 10.92  ? 80  ALA B C   1 
ATOM   2335 O  O   . ALA B 1 80  ? -13.528 -14.264 -24.652 1.00 12.44  ? 80  ALA B O   1 
ATOM   2336 C  CB  . ALA B 1 80  ? -10.701 -15.502 -23.438 1.00 11.00  ? 80  ALA B CB  1 
ATOM   2337 N  N   . LEU B 1 81  ? -13.706 -16.233 -23.527 1.00 11.15  ? 81  LEU B N   1 
ATOM   2338 C  CA  . LEU B 1 81  ? -14.821 -16.628 -24.340 1.00 12.83  ? 81  LEU B CA  1 
ATOM   2339 C  C   . LEU B 1 81  ? -16.030 -15.736 -24.090 1.00 12.36  ? 81  LEU B C   1 
ATOM   2340 O  O   . LEU B 1 81  ? -16.698 -15.371 -25.077 1.00 13.94  ? 81  LEU B O   1 
ATOM   2341 C  CB  . LEU B 1 81  ? -15.192 -18.088 -24.081 1.00 12.57  ? 81  LEU B CB  1 
ATOM   2342 C  CG  . LEU B 1 81  ? -14.098 -19.123 -24.332 1.00 14.27  ? 81  LEU B CG  1 
ATOM   2343 C  CD1 . LEU B 1 81  ? -14.701 -20.476 -24.012 1.00 18.75  ? 81  LEU B CD1 1 
ATOM   2344 C  CD2 . LEU B 1 81  ? -13.574 -19.033 -25.751 1.00 19.91  ? 81  LEU B CD2 1 
ATOM   2345 N  N   . ASP B 1 82  ? -16.285 -15.395 -22.826 1.00 13.04  ? 82  ASP B N   1 
ATOM   2346 C  CA  . ASP B 1 82  ? -17.391 -14.486 -22.563 1.00 14.02  ? 82  ASP B CA  1 
ATOM   2347 C  C   . ASP B 1 82  ? -17.115 -13.143 -23.225 1.00 13.74  ? 82  ASP B C   1 
ATOM   2348 O  O   . ASP B 1 82  ? -18.028 -12.552 -23.789 1.00 15.26  ? 82  ASP B O   1 
ATOM   2349 C  CB  . ASP B 1 82  ? -17.620 -14.358 -21.054 1.00 20.21  ? 82  ASP B CB  1 
ATOM   2350 C  CG  . ASP B 1 82  ? -18.142 -15.612 -20.371 1.00 28.86  ? 82  ASP B CG  1 
ATOM   2351 O  OD1 . ASP B 1 82  ? -18.676 -16.508 -21.062 1.00 36.88  ? 82  ASP B OD1 1 
ATOM   2352 O  OD2 . ASP B 1 82  ? -18.034 -15.694 -19.117 1.00 46.86  ? 82  ASP B OD2 1 
ATOM   2353 N  N   . ALA B 1 83  ? -15.886 -12.626 -23.120 1.00 13.40  ? 83  ALA B N   1 
ATOM   2354 C  CA  . ALA B 1 83  ? -15.608 -11.314 -23.698 1.00 13.99  ? 83  ALA B CA  1 
ATOM   2355 C  C   . ALA B 1 83  ? -15.775 -11.332 -25.194 1.00 13.02  ? 83  ALA B C   1 
ATOM   2356 O  O   . ALA B 1 83  ? -16.354 -10.403 -25.786 1.00 14.50  ? 83  ALA B O   1 
ATOM   2357 C  CB  . ALA B 1 83  ? -14.199 -10.934 -23.285 1.00 15.97  ? 83  ALA B CB  1 
ATOM   2358 N  N   . VAL B 1 84  ? -15.295 -12.366 -25.893 1.00 13.26  ? 84  VAL B N   1 
ATOM   2359 C  CA  A VAL B 1 84  ? -15.438 -12.436 -27.348 0.47 12.49  ? 84  VAL B CA  1 
ATOM   2360 C  CA  B VAL B 1 84  ? -15.422 -12.358 -27.368 0.53 11.76  ? 84  VAL B CA  1 
ATOM   2361 C  C   . VAL B 1 84  ? -16.874 -12.562 -27.784 1.00 14.40  ? 84  VAL B C   1 
ATOM   2362 O  O   . VAL B 1 84  ? -17.328 -11.995 -28.790 1.00 14.84  ? 84  VAL B O   1 
ATOM   2363 C  CB  A VAL B 1 84  ? -14.663 -13.618 -27.979 0.47 14.48  ? 84  VAL B CB  1 
ATOM   2364 C  CB  B VAL B 1 84  ? -14.348 -13.309 -27.951 0.53 13.33  ? 84  VAL B CB  1 
ATOM   2365 C  CG1 A VAL B 1 84  ? -15.117 -13.886 -29.398 0.47 14.20  ? 84  VAL B CG1 1 
ATOM   2366 C  CG1 B VAL B 1 84  ? -14.790 -14.765 -27.947 0.53 16.12  ? 84  VAL B CG1 1 
ATOM   2367 C  CG2 A VAL B 1 84  ? -13.214 -13.218 -27.879 0.47 14.55  ? 84  VAL B CG2 1 
ATOM   2368 C  CG2 B VAL B 1 84  ? -13.974 -12.854 -29.346 0.53 14.23  ? 84  VAL B CG2 1 
ATOM   2369 N  N   . ARG B 1 85  ? -17.675 -13.293 -27.042 1.00 14.29  ? 85  ARG B N   1 
ATOM   2370 C  CA  A ARG B 1 85  ? -19.117 -13.411 -27.252 0.37 17.30  ? 85  ARG B CA  1 
ATOM   2371 C  CA  B ARG B 1 85  ? -19.111 -13.377 -27.273 0.63 15.46  ? 85  ARG B CA  1 
ATOM   2372 C  C   . ARG B 1 85  ? -19.796 -12.051 -27.141 1.00 15.77  ? 85  ARG B C   1 
ATOM   2373 O  O   . ARG B 1 85  ? -20.601 -11.682 -28.006 1.00 19.40  ? 85  ARG B O   1 
ATOM   2374 C  CB  A ARG B 1 85  ? -19.747 -14.382 -26.246 0.37 16.93  ? 85  ARG B CB  1 
ATOM   2375 C  CB  B ARG B 1 85  ? -19.752 -14.305 -26.225 0.63 17.66  ? 85  ARG B CB  1 
ATOM   2376 C  CG  A ARG B 1 85  ? -19.533 -15.864 -26.381 0.37 27.44  ? 85  ARG B CG  1 
ATOM   2377 C  CG  B ARG B 1 85  ? -19.607 -15.763 -26.540 0.63 23.03  ? 85  ARG B CG  1 
ATOM   2378 C  CD  A ARG B 1 85  ? -20.362 -16.697 -25.394 0.37 34.10  ? 85  ARG B CD  1 
ATOM   2379 C  CD  B ARG B 1 85  ? -20.323 -16.594 -25.450 0.63 34.82  ? 85  ARG B CD  1 
ATOM   2380 N  NE  A ARG B 1 85  ? -21.783 -16.532 -25.545 0.37 41.78  ? 85  ARG B NE  1 
ATOM   2381 N  NE  B ARG B 1 85  ? -19.701 -17.887 -25.437 0.63 49.29  ? 85  ARG B NE  1 
ATOM   2382 C  CZ  A ARG B 1 85  ? -22.881 -16.562 -24.819 0.37 25.34  ? 85  ARG B CZ  1 
ATOM   2383 C  CZ  B ARG B 1 85  ? -18.899 -18.538 -24.610 0.63 28.30  ? 85  ARG B CZ  1 
ATOM   2384 N  NH1 A ARG B 1 85  ? -24.075 -16.329 -25.372 0.37 22.07  ? 85  ARG B NH1 1 
ATOM   2385 N  NH1 B ARG B 1 85  ? -18.526 -19.764 -24.989 0.63 12.11  ? 85  ARG B NH1 1 
ATOM   2386 N  NH2 A ARG B 1 85  ? -22.918 -16.818 -23.525 0.37 15.71  ? 85  ARG B NH2 1 
ATOM   2387 N  NH2 B ARG B 1 85  ? -18.553 -17.905 -23.480 0.63 28.59  ? 85  ARG B NH2 1 
ATOM   2388 N  N   . GLU B 1 86  ? -19.524 -11.310 -26.078 1.00 17.14  ? 86  GLU B N   1 
ATOM   2389 C  CA  . GLU B 1 86  ? -20.089 -9.976  -25.869 1.00 17.60  ? 86  GLU B CA  1 
ATOM   2390 C  C   . GLU B 1 86  ? -19.588 -9.024  -26.957 1.00 17.23  ? 86  GLU B C   1 
ATOM   2391 O  O   . GLU B 1 86  ? -20.367 -8.243  -27.559 1.00 19.12  ? 86  GLU B O   1 
ATOM   2392 C  CB  . GLU B 1 86  ? -19.676 -9.453  -24.504 1.00 19.82  ? 86  GLU B CB  1 
ATOM   2393 C  CG  . GLU B 1 86  ? -20.239 -10.161 -23.306 1.00 24.38  ? 86  GLU B CG  1 
ATOM   2394 C  CD  . GLU B 1 86  ? -19.450 -10.169 -22.018 1.00 29.16  ? 86  GLU B CD  1 
ATOM   2395 O  OE1 . GLU B 1 86  ? -18.560 -9.336  -21.738 1.00 36.79  ? 86  GLU B OE1 1 
ATOM   2396 O  OE2 . GLU B 1 86  ? -19.784 -11.091 -21.193 1.00 52.12  ? 86  GLU B OE2 1 
ATOM   2397 N  N   . MET B 1 87  ? -18.283 -9.026  -27.232 1.00 14.81  ? 87  MET B N   1 
ATOM   2398 C  CA  . MET B 1 87  ? -17.770 -8.132  -28.244 1.00 14.11  ? 87  MET B CA  1 
ATOM   2399 C  C   . MET B 1 87  ? -18.431 -8.348  -29.587 1.00 14.26  ? 87  MET B C   1 
ATOM   2400 O  O   . MET B 1 87  ? -18.769 -7.378  -30.272 1.00 16.78  ? 87  MET B O   1 
ATOM   2401 C  CB  . MET B 1 87  ? -16.267 -8.469  -28.389 1.00 12.98  ? 87  MET B CB  1 
ATOM   2402 C  CG  . MET B 1 87  ? -15.515 -7.500  -29.246 1.00 14.08  ? 87  MET B CG  1 
ATOM   2403 S  SD  . MET B 1 87  ? -13.786 -7.864  -29.497 1.00 13.65  ? 87  MET B SD  1 
ATOM   2404 C  CE  . MET B 1 87  ? -13.090 -7.688  -27.881 1.00 14.60  ? 87  MET B CE  1 
ATOM   2405 N  N   . ASN B 1 88  ? -18.641 -9.597  -29.990 1.00 17.09  ? 88  ASN B N   1 
ATOM   2406 C  CA  . ASN B 1 88  ? -19.190 -9.955  -31.307 1.00 16.33  ? 88  ASN B CA  1 
ATOM   2407 C  C   . ASN B 1 88  ? -20.608 -9.453  -31.434 1.00 20.34  ? 88  ASN B C   1 
ATOM   2408 O  O   . ASN B 1 88  ? -21.056 -9.148  -32.536 1.00 23.67  ? 88  ASN B O   1 
ATOM   2409 C  CB  . ASN B 1 88  ? -19.159 -11.468 -31.548 1.00 18.97  ? 88  ASN B CB  1 
ATOM   2410 C  CG  . ASN B 1 88  ? -19.515 -11.789 -33.004 1.00 25.36  ? 88  ASN B CG  1 
ATOM   2411 O  OD1 . ASN B 1 88  ? -18.703 -11.610 -33.925 1.00 32.14  ? 88  ASN B OD1 1 
ATOM   2412 N  ND2 . ASN B 1 88  ? -20.742 -12.262 -33.116 1.00 36.71  ? 88  ASN B ND2 1 
ATOM   2413 N  N   . ASP B 1 89  ? -21.283 -9.339  -30.304 1.00 21.87  ? 89  ASP B N   1 
ATOM   2414 C  CA  . ASP B 1 89  ? -22.673 -8.830  -30.334 1.00 25.32  ? 89  ASP B CA  1 
ATOM   2415 C  C   . ASP B 1 89  ? -22.768 -7.325  -30.174 1.00 21.16  ? 89  ASP B C   1 
ATOM   2416 O  O   . ASP B 1 89  ? -23.882 -6.778  -30.241 1.00 28.01  ? 89  ASP B O   1 
ATOM   2417 C  CB  . ASP B 1 89  ? -23.495 -9.522  -29.254 1.00 30.39  ? 89  ASP B CB  1 
ATOM   2418 C  CG  . ASP B 1 89  ? -23.686 -10.996 -29.571 1.00 35.10  ? 89  ASP B CG  1 
ATOM   2419 O  OD1 . ASP B 1 89  ? -23.931 -11.298 -30.766 1.00 42.73  ? 89  ASP B OD1 1 
ATOM   2420 O  OD2 . ASP B 1 89  ? -23.569 -11.835 -28.652 1.00 48.85  ? 89  ASP B OD2 1 
ATOM   2421 N  N   . LEU B 1 90  ? -21.692 -6.582  -29.962 1.00 18.42  ? 90  LEU B N   1 
ATOM   2422 C  CA  . LEU B 1 90  ? -21.827 -5.130  -29.818 1.00 17.85  ? 90  LEU B CA  1 
ATOM   2423 C  C   . LEU B 1 90  ? -22.267 -4.497  -31.121 1.00 19.68  ? 90  LEU B C   1 
ATOM   2424 O  O   . LEU B 1 90  ? -21.829 -4.883  -32.204 1.00 20.44  ? 90  LEU B O   1 
ATOM   2425 C  CB  . LEU B 1 90  ? -20.506 -4.486  -29.373 1.00 17.72  ? 90  LEU B CB  1 
ATOM   2426 C  CG  . LEU B 1 90  ? -20.028 -4.823  -27.952 1.00 15.66  ? 90  LEU B CG  1 
ATOM   2427 C  CD1 . LEU B 1 90  ? -18.685 -4.268  -27.639 1.00 18.61  ? 90  LEU B CD1 1 
ATOM   2428 C  CD2 . LEU B 1 90  ? -21.085 -4.336  -26.912 1.00 20.52  ? 90  LEU B CD2 1 
ATOM   2429 N  N   . PRO B 1 91  ? -23.088 -3.479  -31.068 1.00 22.00  ? 91  PRO B N   1 
ATOM   2430 C  CA  . PRO B 1 91  ? -23.395 -2.741  -32.308 1.00 24.22  ? 91  PRO B CA  1 
ATOM   2431 C  C   . PRO B 1 91  ? -22.105 -2.214  -32.949 1.00 18.72  ? 91  PRO B C   1 
ATOM   2432 O  O   . PRO B 1 91  ? -21.119 -1.880  -32.302 1.00 20.96  ? 91  PRO B O   1 
ATOM   2433 C  CB  . PRO B 1 91  ? -24.212 -1.548  -31.817 1.00 37.88  ? 91  PRO B CB  1 
ATOM   2434 C  CG  . PRO B 1 91  ? -24.679 -1.889  -30.448 1.00 34.11  ? 91  PRO B CG  1 
ATOM   2435 C  CD  . PRO B 1 91  ? -23.699 -2.868  -29.885 1.00 23.09  ? 91  PRO B CD  1 
ATOM   2436 N  N   . ASP B 1 92  ? -22.139 -2.180  -34.286 1.00 19.75  ? 92  ASP B N   1 
ATOM   2437 C  CA  . ASP B 1 92  ? -21.065 -1.597  -35.102 1.00 17.56  ? 92  ASP B CA  1 
ATOM   2438 C  C   . ASP B 1 92  ? -19.702 -2.160  -34.700 1.00 14.68  ? 92  ASP B C   1 
ATOM   2439 O  O   . ASP B 1 92  ? -18.721 -1.405  -34.570 1.00 15.54  ? 92  ASP B O   1 
ATOM   2440 C  CB  . ASP B 1 92  ? -21.095 -0.069  -34.979 1.00 24.23  ? 92  ASP B CB  1 
ATOM   2441 C  CG  . ASP B 1 92  ? -22.472 0.494   -35.316 1.00 29.52  ? 92  ASP B CG  1 
ATOM   2442 O  OD1 . ASP B 1 92  ? -23.114 -0.105  -36.209 1.00 32.42  ? 92  ASP B OD1 1 
ATOM   2443 O  OD2 . ASP B 1 92  ? -22.918 1.493   -34.701 1.00 38.90  ? 92  ASP B OD2 1 
ATOM   2444 N  N   . THR B 1 93  ? -19.613 -3.442  -34.511 1.00 15.26  ? 93  THR B N   1 
ATOM   2445 C  CA  . THR B 1 93  ? -18.391 -4.162  -34.140 1.00 14.39  ? 93  THR B CA  1 
ATOM   2446 C  C   . THR B 1 93  ? -18.322 -5.478  -34.908 1.00 14.49  ? 93  THR B C   1 
ATOM   2447 O  O   . THR B 1 93  ? -19.317 -6.222  -34.920 1.00 18.43  ? 93  THR B O   1 
ATOM   2448 C  CB  . THR B 1 93  ? -18.396 -4.424  -32.626 1.00 13.26  ? 93  THR B CB  1 
ATOM   2449 O  OG1 . THR B 1 93  ? -18.633 -3.188  -31.952 1.00 14.85  ? 93  THR B OG1 1 
ATOM   2450 C  CG2 . THR B 1 93  ? -17.090 -4.952  -32.116 1.00 13.40  ? 93  THR B CG2 1 
ATOM   2451 N  N   . GLN B 1 94  ? -17.157 -5.788  -35.435 1.00 14.26  ? 94  GLN B N   1 
ATOM   2452 C  CA  A GLN B 1 94  ? -16.914 -7.093  -36.053 0.36 13.05  ? 94  GLN B CA  1 
ATOM   2453 C  CA  B GLN B 1 94  ? -16.727 -6.919  -36.261 0.64 14.20  ? 94  GLN B CA  1 
ATOM   2454 C  C   . GLN B 1 94  ? -15.608 -7.661  -35.514 1.00 11.83  ? 94  GLN B C   1 
ATOM   2455 O  O   . GLN B 1 94  ? -14.671 -6.982  -35.185 1.00 14.55  ? 94  GLN B O   1 
ATOM   2456 C  CB  A GLN B 1 94  ? -16.926 -6.933  -37.559 0.36 11.80  ? 94  GLN B CB  1 
ATOM   2457 C  CB  B GLN B 1 94  ? -16.230 -6.481  -37.656 0.64 10.64  ? 94  GLN B CB  1 
ATOM   2458 C  CG  A GLN B 1 94  ? -18.324 -6.640  -38.103 0.36 15.86  ? 94  GLN B CG  1 
ATOM   2459 C  CG  B GLN B 1 94  ? -17.383 -5.957  -38.500 0.64 12.21  ? 94  GLN B CG  1 
ATOM   2460 C  CD  A GLN B 1 94  ? -19.367 -7.628  -37.645 0.36 36.21  ? 94  GLN B CD  1 
ATOM   2461 C  CD  B GLN B 1 94  ? -17.002 -5.188  -39.753 0.64 19.19  ? 94  GLN B CD  1 
ATOM   2462 O  OE1 A GLN B 1 94  ? -19.240 -8.826  -37.932 0.36 32.14  ? 94  GLN B OE1 1 
ATOM   2463 O  OE1 B GLN B 1 94  ? -15.828 -4.848  -39.914 0.64 34.39  ? 94  GLN B OE1 1 
ATOM   2464 N  NE2 A GLN B 1 94  ? -20.408 -7.208  -36.938 0.36 38.47  ? 94  GLN B NE2 1 
ATOM   2465 N  NE2 B GLN B 1 94  ? -18.004 -4.926  -40.598 0.64 20.77  ? 94  GLN B NE2 1 
ATOM   2466 N  N   . VAL B 1 95  ? -15.646 -8.945  -35.322 1.00 13.19  ? 95  VAL B N   1 
ATOM   2467 C  CA  . VAL B 1 95  ? -14.579 -9.729  -34.714 1.00 10.74  ? 95  VAL B CA  1 
ATOM   2468 C  C   . VAL B 1 95  ? -14.080 -10.779 -35.667 1.00 9.42   ? 95  VAL B C   1 
ATOM   2469 O  O   . VAL B 1 95  ? -14.867 -11.546 -36.253 1.00 10.54  ? 95  VAL B O   1 
ATOM   2470 C  CB  . VAL B 1 95  ? -15.098 -10.375 -33.421 1.00 12.80  ? 95  VAL B CB  1 
ATOM   2471 C  CG1 . VAL B 1 95  ? -14.027 -11.235 -32.752 1.00 13.54  ? 95  VAL B CG1 1 
ATOM   2472 C  CG2 . VAL B 1 95  ? -15.590 -9.289  -32.471 1.00 17.34  ? 95  VAL B CG2 1 
ATOM   2473 N  N   . PHE B 1 96  ? -12.776 -10.905 -35.778 1.00 8.98   ? 96  PHE B N   1 
ATOM   2474 C  CA  . PHE B 1 96  ? -12.130 -12.053 -36.389 1.00 9.03   ? 96  PHE B CA  1 
ATOM   2475 C  C   . PHE B 1 96  ? -11.129 -12.642 -35.397 1.00 8.42   ? 96  PHE B C   1 
ATOM   2476 O  O   . PHE B 1 96  ? -10.538 -11.871 -34.649 1.00 10.44  ? 96  PHE B O   1 
ATOM   2477 C  CB  . PHE B 1 96  ? -11.423 -11.714 -37.703 1.00 8.67   ? 96  PHE B CB  1 
ATOM   2478 C  CG  . PHE B 1 96  ? -12.347 -11.363 -38.851 1.00 9.36   ? 96  PHE B CG  1 
ATOM   2479 C  CD1 . PHE B 1 96  ? -12.830 -10.080 -39.039 1.00 13.39  ? 96  PHE B CD1 1 
ATOM   2480 C  CD2 . PHE B 1 96  ? -12.733 -12.358 -39.756 1.00 10.23  ? 96  PHE B CD2 1 
ATOM   2481 C  CE1 . PHE B 1 96  ? -13.648 -9.785  -40.095 1.00 14.31  ? 96  PHE B CE1 1 
ATOM   2482 C  CE2 . PHE B 1 96  ? -13.571 -12.080 -40.842 1.00 11.69  ? 96  PHE B CE2 1 
ATOM   2483 C  CZ  . PHE B 1 96  ? -13.993 -10.783 -41.010 1.00 13.06  ? 96  PHE B CZ  1 
ATOM   2484 N  N   . ILE B 1 97  ? -10.954 -13.944 -35.442 1.00 7.93   ? 97  ILE B N   1 
ATOM   2485 C  CA  . ILE B 1 97  ? -9.922  -14.622 -34.682 1.00 8.03   ? 97  ILE B CA  1 
ATOM   2486 C  C   . ILE B 1 97  ? -8.727  -14.790 -35.592 1.00 8.08   ? 97  ILE B C   1 
ATOM   2487 O  O   . ILE B 1 97  ? -8.834  -15.540 -36.562 1.00 10.20  ? 97  ILE B O   1 
ATOM   2488 C  CB  . ILE B 1 97  ? -10.442 -15.969 -34.151 1.00 8.15   ? 97  ILE B CB  1 
ATOM   2489 C  CG1 . ILE B 1 97  ? -11.623 -15.779 -33.203 1.00 9.63   ? 97  ILE B CG1 1 
ATOM   2490 C  CG2 . ILE B 1 97  ? -9.293  -16.708 -33.488 1.00 10.48  ? 97  ILE B CG2 1 
ATOM   2491 C  CD1 . ILE B 1 97  ? -12.360 -17.074 -32.894 1.00 13.28  ? 97  ILE B CD1 1 
ATOM   2492 N  N   . CYS B 1 98  ? -7.633  -14.088 -35.341 1.00 8.26   ? 98  CYS B N   1 
ATOM   2493 C  CA  . CYS B 1 98  ? -6.506  -13.999 -36.233 1.00 8.26   ? 98  CYS B CA  1 
ATOM   2494 C  C   . CYS B 1 98  ? -5.288  -14.659 -35.591 1.00 9.27   ? 98  CYS B C   1 
ATOM   2495 O  O   . CYS B 1 98  ? -4.758  -14.141 -34.595 1.00 9.45   ? 98  CYS B O   1 
ATOM   2496 C  CB  . CYS B 1 98  ? -6.206  -12.511 -36.547 1.00 10.51  ? 98  CYS B CB  1 
ATOM   2497 S  SG  . CYS B 1 98  ? -4.958  -12.306 -37.824 1.00 11.23  ? 98  CYS B SG  1 
ATOM   2498 N  N   . THR B 1 99  ? -4.957  -15.836 -36.119 1.00 8.67   ? 99  THR B N   1 
ATOM   2499 C  CA  . THR B 1 99  ? -4.016  -16.744 -35.452 1.00 8.08   ? 99  THR B CA  1 
ATOM   2500 C  C   . THR B 1 99  ? -3.036  -17.281 -36.453 1.00 8.38   ? 99  THR B C   1 
ATOM   2501 O  O   . THR B 1 99  ? -3.337  -17.522 -37.629 1.00 8.85   ? 99  THR B O   1 
ATOM   2502 C  CB  . THR B 1 99  ? -4.835  -17.860 -34.792 1.00 9.78   ? 99  THR B CB  1 
ATOM   2503 O  OG1 . THR B 1 99  ? -3.969  -18.809 -34.148 1.00 10.02  ? 99  THR B OG1 1 
ATOM   2504 C  CG2 . THR B 1 99  ? -5.713  -18.642 -35.732 1.00 10.88  ? 99  THR B CG2 1 
ATOM   2505 N  N   . SER B 1 100 ? -1.810  -17.472 -35.998 1.00 9.00   ? 100 SER B N   1 
ATOM   2506 C  CA  . SER B 1 100 ? -0.729  -18.027 -36.804 1.00 10.30  ? 100 SER B CA  1 
ATOM   2507 C  C   . SER B 1 100 ? -0.482  -19.508 -36.534 1.00 11.41  ? 100 SER B C   1 
ATOM   2508 O  O   . SER B 1 100 ? -0.290  -19.911 -35.380 1.00 17.40  ? 100 SER B O   1 
ATOM   2509 C  CB  . SER B 1 100 ? 0.578   -17.295 -36.502 1.00 10.29  ? 100 SER B CB  1 
ATOM   2510 O  OG  . SER B 1 100 ? 0.498   -15.949 -36.923 1.00 10.88  ? 100 SER B OG  1 
ATOM   2511 N  N   . PRO B 1 101 ? -0.494  -20.354 -37.518 1.00 9.61   ? 101 PRO B N   1 
ATOM   2512 C  CA  . PRO B 1 101 ? -0.141  -21.737 -37.278 1.00 10.19  ? 101 PRO B CA  1 
ATOM   2513 C  C   . PRO B 1 101 ? 1.353   -21.853 -37.010 1.00 10.61  ? 101 PRO B C   1 
ATOM   2514 O  O   . PRO B 1 101 ? 2.135   -21.034 -37.493 1.00 12.13  ? 101 PRO B O   1 
ATOM   2515 C  CB  . PRO B 1 101 ? -0.500  -22.392 -38.594 1.00 12.89  ? 101 PRO B CB  1 
ATOM   2516 C  CG  . PRO B 1 101 ? -0.424  -21.333 -39.617 1.00 18.01  ? 101 PRO B CG  1 
ATOM   2517 C  CD  . PRO B 1 101 ? -0.775  -20.049 -38.948 1.00 11.39  ? 101 PRO B CD  1 
ATOM   2518 N  N   . LEU B 1 102 ? 1.763   -22.876 -36.303 1.00 10.26  ? 102 LEU B N   1 
ATOM   2519 C  CA  . LEU B 1 102 ? 3.108   -23.311 -36.239 1.00 10.32  ? 102 LEU B CA  1 
ATOM   2520 C  C   . LEU B 1 102 ? 3.685   -23.587 -37.634 1.00 11.35  ? 102 LEU B C   1 
ATOM   2521 O  O   . LEU B 1 102 ? 2.954   -23.986 -38.530 1.00 12.28  ? 102 LEU B O   1 
ATOM   2522 C  CB  . LEU B 1 102 ? 3.267   -24.608 -35.436 1.00 12.29  ? 102 LEU B CB  1 
ATOM   2523 C  CG  . LEU B 1 102 ? 2.869   -24.589 -33.975 1.00 12.63  ? 102 LEU B CG  1 
ATOM   2524 C  CD1 . LEU B 1 102 ? 3.001   -25.986 -33.382 1.00 16.16  ? 102 LEU B CD1 1 
ATOM   2525 C  CD2 . LEU B 1 102 ? 3.676   -23.604 -33.175 1.00 18.11  ? 102 LEU B CD2 1 
ATOM   2526 N  N   . LEU B 1 103 ? 5.002   -23.453 -37.799 1.00 13.64  ? 103 LEU B N   1 
ATOM   2527 C  CA  . LEU B 1 103 ? 5.634   -23.989 -39.003 1.00 13.79  ? 103 LEU B CA  1 
ATOM   2528 C  C   . LEU B 1 103 ? 5.392   -25.487 -39.153 1.00 12.94  ? 103 LEU B C   1 
ATOM   2529 O  O   . LEU B 1 103 ? 5.181   -26.019 -40.255 1.00 14.60  ? 103 LEU B O   1 
ATOM   2530 C  CB  . LEU B 1 103 ? 7.154   -23.698 -39.040 1.00 18.13  ? 103 LEU B CB  1 
ATOM   2531 C  CG  . LEU B 1 103 ? 7.500   -22.191 -39.033 1.00 17.04  ? 103 LEU B CG  1 
ATOM   2532 C  CD1 . LEU B 1 103 ? 9.005   -22.012 -38.923 1.00 24.73  ? 103 LEU B CD1 1 
ATOM   2533 C  CD2 . LEU B 1 103 ? 6.892   -21.514 -40.263 1.00 22.76  ? 103 LEU B CD2 1 
ATOM   2534 N  N   . LYS B 1 104 ? 5.439   -26.211 -38.028 1.00 14.94  ? 104 LYS B N   1 
ATOM   2535 C  CA  . LYS B 1 104 ? 5.039   -27.630 -38.009 1.00 15.71  ? 104 LYS B CA  1 
ATOM   2536 C  C   . LYS B 1 104 ? 3.515   -27.632 -37.867 1.00 14.14  ? 104 LYS B C   1 
ATOM   2537 O  O   . LYS B 1 104 ? 2.912   -27.756 -36.802 1.00 16.75  ? 104 LYS B O   1 
ATOM   2538 C  CB  . LYS B 1 104 ? 5.701   -28.430 -36.912 1.00 22.77  ? 104 LYS B CB  1 
ATOM   2539 C  CG  . LYS B 1 104 ? 7.187   -28.761 -37.057 1.00 34.50  ? 104 LYS B CG  1 
ATOM   2540 C  CD  . LYS B 1 104 ? 7.336   -30.220 -36.652 1.00 43.43  ? 104 LYS B CD  1 
ATOM   2541 C  CE  . LYS B 1 104 ? 8.796   -30.578 -36.436 1.00 49.90  ? 104 LYS B CE  1 
ATOM   2542 N  NZ  . LYS B 1 104 ? 9.565   -30.434 -37.706 1.00 40.20  ? 104 LYS B NZ  1 
ATOM   2543 N  N   . TYR B 1 105 ? 2.834   -27.407 -39.001 1.00 13.59  ? 105 TYR B N   1 
ATOM   2544 C  CA  . TYR B 1 105 ? 1.399   -27.145 -39.035 1.00 13.61  ? 105 TYR B CA  1 
ATOM   2545 C  C   . TYR B 1 105 ? 0.523   -28.353 -38.775 1.00 11.15  ? 105 TYR B C   1 
ATOM   2546 O  O   . TYR B 1 105 ? -0.675  -28.164 -38.574 1.00 12.86  ? 105 TYR B O   1 
ATOM   2547 C  CB  . TYR B 1 105 ? 1.046   -26.478 -40.409 1.00 14.89  ? 105 TYR B CB  1 
ATOM   2548 C  CG  . TYR B 1 105 ? 1.261   -27.380 -41.576 1.00 14.10  ? 105 TYR B CG  1 
ATOM   2549 C  CD1 . TYR B 1 105 ? 0.340   -28.345 -41.945 1.00 14.68  ? 105 TYR B CD1 1 
ATOM   2550 C  CD2 . TYR B 1 105 ? 2.460   -27.302 -42.298 1.00 13.13  ? 105 TYR B CD2 1 
ATOM   2551 C  CE1 . TYR B 1 105 ? 0.549   -29.206 -42.964 1.00 16.19  ? 105 TYR B CE1 1 
ATOM   2552 C  CE2 . TYR B 1 105 ? 2.670   -28.147 -43.351 1.00 13.62  ? 105 TYR B CE2 1 
ATOM   2553 C  CZ  . TYR B 1 105 ? 1.719   -29.070 -43.660 1.00 13.76  ? 105 TYR B CZ  1 
ATOM   2554 O  OH  . TYR B 1 105 ? 1.800   -30.000 -44.668 1.00 17.52  ? 105 TYR B OH  1 
ATOM   2555 N  N   . HIS B 1 106 ? 1.032   -29.553 -39.031 1.00 12.49  ? 106 HIS B N   1 
ATOM   2556 C  CA  A HIS B 1 106 ? 0.231   -30.769 -39.174 0.27 13.30  ? 106 HIS B CA  1 
ATOM   2557 C  CA  B HIS B 1 106 ? 0.195   -30.745 -39.220 0.73 12.45  ? 106 HIS B CA  1 
ATOM   2558 C  C   . HIS B 1 106 ? -0.887  -30.924 -38.141 1.00 15.17  ? 106 HIS B C   1 
ATOM   2559 O  O   . HIS B 1 106 ? -2.061  -31.174 -38.444 1.00 16.92  ? 106 HIS B O   1 
ATOM   2560 C  CB  A HIS B 1 106 ? 1.140   -32.006 -39.113 0.27 16.00  ? 106 HIS B CB  1 
ATOM   2561 C  CB  B HIS B 1 106 ? 1.094   -31.972 -39.313 0.73 15.70  ? 106 HIS B CB  1 
ATOM   2562 C  CG  A HIS B 1 106 ? 0.444   -33.300 -39.426 0.27 11.36  ? 106 HIS B CG  1 
ATOM   2563 C  CG  B HIS B 1 106 ? 1.953   -31.964 -40.530 0.73 42.72  ? 106 HIS B CG  1 
ATOM   2564 N  ND1 A HIS B 1 106 ? -0.878  -33.462 -39.748 0.27 13.58  ? 106 HIS B ND1 1 
ATOM   2565 N  ND1 B HIS B 1 106 ? 2.838   -30.939 -40.811 0.73 45.89  ? 106 HIS B ND1 1 
ATOM   2566 C  CD2 A HIS B 1 106 ? 0.986   -34.548 -39.466 0.27 14.15  ? 106 HIS B CD2 1 
ATOM   2567 C  CD2 B HIS B 1 106 ? 2.066   -32.883 -41.528 0.73 49.97  ? 106 HIS B CD2 1 
ATOM   2568 C  CE1 A HIS B 1 106 ? -1.128  -34.753 -39.968 0.27 16.61  ? 106 HIS B CE1 1 
ATOM   2569 C  CE1 B HIS B 1 106 ? 3.451   -31.257 -41.936 0.73 50.82  ? 106 HIS B CE1 1 
ATOM   2570 N  NE2 A HIS B 1 106 ? -0.017  -35.430 -39.797 0.27 18.16  ? 106 HIS B NE2 1 
ATOM   2571 N  NE2 B HIS B 1 106 ? 3.002   -32.409 -42.400 0.73 52.30  ? 106 HIS B NE2 1 
ATOM   2572 N  N   . HIS B 1 107 ? -0.537  -30.798 -36.884 1.00 12.95  ? 107 HIS B N   1 
ATOM   2573 C  CA  . HIS B 1 107 ? -1.472  -31.077 -35.795 1.00 13.29  ? 107 HIS B CA  1 
ATOM   2574 C  C   . HIS B 1 107 ? -1.975  -29.769 -35.163 1.00 15.01  ? 107 HIS B C   1 
ATOM   2575 O  O   . HIS B 1 107 ? -2.572  -29.773 -34.077 1.00 13.62  ? 107 HIS B O   1 
ATOM   2576 C  CB  . HIS B 1 107 ? -0.897  -31.971 -34.735 1.00 16.49  ? 107 HIS B CB  1 
ATOM   2577 C  CG  . HIS B 1 107 ? -0.534  -33.310 -35.306 1.00 19.57  ? 107 HIS B CG  1 
ATOM   2578 N  ND1 . HIS B 1 107 ? -1.464  -34.161 -35.839 1.00 21.76  ? 107 HIS B ND1 1 
ATOM   2579 C  CD2 . HIS B 1 107 ? 0.679   -33.876 -35.440 1.00 23.47  ? 107 HIS B CD2 1 
ATOM   2580 C  CE1 . HIS B 1 107 ? -0.835  -35.231 -36.279 1.00 23.33  ? 107 HIS B CE1 1 
ATOM   2581 N  NE2 . HIS B 1 107 ? 0.453   -35.085 -36.042 1.00 26.05  ? 107 HIS B NE2 1 
ATOM   2582 N  N   . CYS B 1 108 ? -1.788  -28.651 -35.841 1.00 11.43  ? 108 CYS B N   1 
ATOM   2583 C  CA  . CYS B 1 108 ? -2.143  -27.335 -35.340 1.00 10.92  ? 108 CYS B CA  1 
ATOM   2584 C  C   . CYS B 1 108 ? -3.376  -26.802 -36.079 1.00 10.24  ? 108 CYS B C   1 
ATOM   2585 O  O   . CYS B 1 108 ? -4.342  -26.347 -35.473 1.00 11.12  ? 108 CYS B O   1 
ATOM   2586 C  CB  . CYS B 1 108 ? -0.918  -26.456 -35.526 1.00 12.08  ? 108 CYS B CB  1 
ATOM   2587 S  SG  . CYS B 1 108 ? -1.177  -24.693 -35.205 1.00 12.35  ? 108 CYS B SG  1 
ATOM   2588 N  N   . VAL B 1 109 ? -3.374  -26.813 -37.416 1.00 9.97   ? 109 VAL B N   1 
ATOM   2589 C  CA  A VAL B 1 109 ? -4.332  -26.064 -38.257 0.23 8.99   ? 109 VAL B CA  1 
ATOM   2590 C  CA  B VAL B 1 109 ? -4.343  -26.065 -38.185 0.77 10.68  ? 109 VAL B CA  1 
ATOM   2591 C  C   . VAL B 1 109 ? -5.732  -26.622 -37.986 1.00 10.04  ? 109 VAL B C   1 
ATOM   2592 O  O   . VAL B 1 109 ? -6.667  -25.873 -37.648 1.00 10.01  ? 109 VAL B O   1 
ATOM   2593 C  CB  A VAL B 1 109 ? -3.676  -26.050 -39.645 0.23 11.69  ? 109 VAL B CB  1 
ATOM   2594 C  CB  B VAL B 1 109 ? -4.026  -25.977 -39.683 0.77 11.39  ? 109 VAL B CB  1 
ATOM   2595 C  CG1 A VAL B 1 109 ? -4.096  -25.187 -40.808 0.23 35.70  ? 109 VAL B CG1 1 
ATOM   2596 C  CG1 B VAL B 1 109 ? -2.723  -25.143 -39.860 0.77 12.97  ? 109 VAL B CG1 1 
ATOM   2597 C  CG2 A VAL B 1 109 ? -2.280  -25.352 -39.490 0.23 32.63  ? 109 VAL B CG2 1 
ATOM   2598 C  CG2 B VAL B 1 109 ? -3.823  -27.269 -40.352 0.77 15.50  ? 109 VAL B CG2 1 
ATOM   2599 N  N   . GLY B 1 110 ? -5.931  -27.918 -38.171 1.00 10.48  ? 110 GLY B N   1 
ATOM   2600 C  CA  . GLY B 1 110 ? -7.273  -28.490 -37.987 1.00 10.95  ? 110 GLY B CA  1 
ATOM   2601 C  C   . GLY B 1 110 ? -7.747  -28.431 -36.531 1.00 9.60   ? 110 GLY B C   1 
ATOM   2602 O  O   . GLY B 1 110 ? -8.931  -28.227 -36.259 1.00 11.11  ? 110 GLY B O   1 
ATOM   2603 N  N   . GLU B 1 111 ? -6.803  -28.594 -35.618 1.00 9.78   ? 111 GLU B N   1 
ATOM   2604 C  CA  . GLU B 1 111 ? -7.146  -28.560 -34.207 1.00 9.62   ? 111 GLU B CA  1 
ATOM   2605 C  C   . GLU B 1 111 ? -7.600  -27.182 -33.748 1.00 9.20   ? 111 GLU B C   1 
ATOM   2606 O  O   . GLU B 1 111 ? -8.492  -27.097 -32.901 1.00 9.81   ? 111 GLU B O   1 
ATOM   2607 C  CB  . GLU B 1 111 ? -6.000  -29.087 -33.350 1.00 9.84   ? 111 GLU B CB  1 
ATOM   2608 C  CG  . GLU B 1 111 ? -5.683  -30.554 -33.512 1.00 11.01  ? 111 GLU B CG  1 
ATOM   2609 C  CD  . GLU B 1 111 ? -4.728  -31.172 -32.537 1.00 10.76  ? 111 GLU B CD  1 
ATOM   2610 O  OE1 . GLU B 1 111 ? -4.448  -30.535 -31.505 1.00 11.92  ? 111 GLU B OE1 1 
ATOM   2611 O  OE2 . GLU B 1 111 ? -4.279  -32.324 -32.832 1.00 13.79  ? 111 GLU B OE2 1 
ATOM   2612 N  N   . LYS B 1 112 ? -7.039  -26.132 -34.291 1.00 8.74   ? 112 LYS B N   1 
ATOM   2613 C  CA  . LYS B 1 112 ? -7.483  -24.781 -33.972 1.00 9.03   ? 112 LYS B CA  1 
ATOM   2614 C  C   . LYS B 1 112 ? -8.924  -24.536 -34.411 1.00 8.96   ? 112 LYS B C   1 
ATOM   2615 O  O   . LYS B 1 112 ? -9.720  -23.952 -33.704 1.00 9.16   ? 112 LYS B O   1 
ATOM   2616 C  CB  . LYS B 1 112 ? -6.540  -23.765 -34.608 1.00 8.87   ? 112 LYS B CB  1 
ATOM   2617 C  CG  . LYS B 1 112 ? -5.243  -23.562 -33.864 1.00 10.52  ? 112 LYS B CG  1 
ATOM   2618 C  CD  . LYS B 1 112 ? -4.306  -22.578 -34.576 1.00 10.60  ? 112 LYS B CD  1 
ATOM   2619 C  CE  . LYS B 1 112 ? -3.148  -22.097 -33.753 1.00 11.25  ? 112 LYS B CE  1 
ATOM   2620 N  NZ  . LYS B 1 112 ? -3.548  -21.203 -32.675 1.00 10.73  ? 112 LYS B NZ  1 
ATOM   2621 N  N   . TYR B 1 113 ? -9.278  -25.015 -35.627 1.00 8.65   ? 113 TYR B N   1 
ATOM   2622 C  CA  . TYR B 1 113 ? -10.654 -24.865 -36.117 1.00 9.14   ? 113 TYR B CA  1 
ATOM   2623 C  C   . TYR B 1 113 ? -11.603 -25.615 -35.164 1.00 8.84   ? 113 TYR B C   1 
ATOM   2624 O  O   . TYR B 1 113 ? -12.657 -25.082 -34.795 1.00 9.34   ? 113 TYR B O   1 
ATOM   2625 C  CB  . TYR B 1 113 ? -10.787 -25.368 -37.570 1.00 8.78   ? 113 TYR B CB  1 
ATOM   2626 C  CG  . TYR B 1 113 ? -10.402 -24.249 -38.568 1.00 8.88   ? 113 TYR B CG  1 
ATOM   2627 C  CD1 . TYR B 1 113 ? -9.108  -23.803 -38.657 1.00 10.10  ? 113 TYR B CD1 1 
ATOM   2628 C  CD2 . TYR B 1 113 ? -11.363 -23.679 -39.365 1.00 9.18   ? 113 TYR B CD2 1 
ATOM   2629 C  CE1 . TYR B 1 113 ? -8.772  -22.791 -39.551 1.00 10.74  ? 113 TYR B CE1 1 
ATOM   2630 C  CE2 . TYR B 1 113 ? -11.013 -22.645 -40.244 1.00 9.54   ? 113 TYR B CE2 1 
ATOM   2631 C  CZ  . TYR B 1 113 ? -9.729  -22.235 -40.322 1.00 9.72   ? 113 TYR B CZ  1 
ATOM   2632 O  OH  . TYR B 1 113 ? -9.343  -21.189 -41.176 1.00 12.35  ? 113 TYR B OH  1 
ATOM   2633 N  N   . ARG B 1 114 ? -11.239 -26.856 -34.804 1.00 8.80   ? 114 ARG B N   1 
ATOM   2634 C  CA  . ARG B 1 114 ? -12.107 -27.642 -33.915 1.00 9.76   ? 114 ARG B CA  1 
ATOM   2635 C  C   . ARG B 1 114 ? -12.188 -27.006 -32.540 1.00 9.59   ? 114 ARG B C   1 
ATOM   2636 O  O   . ARG B 1 114 ? -13.274 -27.042 -31.959 1.00 10.21  ? 114 ARG B O   1 
ATOM   2637 C  CB  . ARG B 1 114 ? -11.627 -29.069 -33.826 1.00 11.66  ? 114 ARG B CB  1 
ATOM   2638 C  CG  . ARG B 1 114 ? -12.553 -29.848 -32.929 1.00 18.22  ? 114 ARG B CG  1 
ATOM   2639 C  CD  . ARG B 1 114 ? -13.949 -30.129 -33.375 1.00 27.58  ? 114 ARG B CD  1 
ATOM   2640 N  NE  . ARG B 1 114 ? -14.339 -31.485 -32.879 1.00 35.62  ? 114 ARG B NE  1 
ATOM   2641 C  CZ  . ARG B 1 114 ? -15.565 -31.941 -33.074 1.00 38.80  ? 114 ARG B CZ  1 
ATOM   2642 N  NH1 . ARG B 1 114 ? -15.968 -33.145 -32.643 1.00 39.66  ? 114 ARG B NH1 1 
ATOM   2643 N  NH2 . ARG B 1 114 ? -16.420 -31.142 -33.729 1.00 60.08  ? 114 ARG B NH2 1 
ATOM   2644 N  N   . TRP B 1 115 ? -11.101 -26.431 -32.053 1.00 8.91   ? 115 TRP B N   1 
ATOM   2645 C  CA  . TRP B 1 115 ? -11.165 -25.774 -30.763 1.00 9.34   ? 115 TRP B CA  1 
ATOM   2646 C  C   . TRP B 1 115 ? -12.181 -24.641 -30.772 1.00 8.53   ? 115 TRP B C   1 
ATOM   2647 O  O   . TRP B 1 115 ? -12.983 -24.462 -29.847 1.00 9.25   ? 115 TRP B O   1 
ATOM   2648 C  CB  . TRP B 1 115 ? -9.790  -25.195 -30.367 1.00 9.78   ? 115 TRP B CB  1 
ATOM   2649 C  CG  . TRP B 1 115 ? -9.646  -24.694 -28.959 1.00 8.69   ? 115 TRP B CG  1 
ATOM   2650 C  CD1 . TRP B 1 115 ? -9.131  -25.446 -27.951 1.00 10.24  ? 115 TRP B CD1 1 
ATOM   2651 C  CD2 . TRP B 1 115 ? -9.981  -23.415 -28.430 1.00 8.80   ? 115 TRP B CD2 1 
ATOM   2652 N  NE1 . TRP B 1 115 ? -9.116  -24.703 -26.807 1.00 9.91   ? 115 TRP B NE1 1 
ATOM   2653 C  CE2 . TRP B 1 115 ? -9.644  -23.451 -27.059 1.00 9.56   ? 115 TRP B CE2 1 
ATOM   2654 C  CE3 . TRP B 1 115 ? -10.527 -22.250 -28.912 1.00 9.56   ? 115 TRP B CE3 1 
ATOM   2655 C  CZ2 . TRP B 1 115 ? -9.831  -22.378 -26.207 1.00 10.92  ? 115 TRP B CZ2 1 
ATOM   2656 C  CZ3 . TRP B 1 115 ? -10.725 -21.161 -28.090 1.00 10.84  ? 115 TRP B CZ3 1 
ATOM   2657 C  CH2 . TRP B 1 115 ? -10.373 -21.219 -26.726 1.00 10.81  ? 115 TRP B CH2 1 
ATOM   2658 N  N   . VAL B 1 116 ? -12.150 -23.820 -31.816 1.00 8.32   ? 116 VAL B N   1 
ATOM   2659 C  CA  . VAL B 1 116 ? -13.122 -22.722 -31.916 1.00 9.05   ? 116 VAL B CA  1 
ATOM   2660 C  C   . VAL B 1 116 ? -14.542 -23.264 -32.032 1.00 9.81   ? 116 VAL B C   1 
ATOM   2661 O  O   . VAL B 1 116 ? -15.468 -22.798 -31.396 1.00 10.28  ? 116 VAL B O   1 
ATOM   2662 C  CB  . VAL B 1 116 ? -12.773 -21.801 -33.098 1.00 8.93   ? 116 VAL B CB  1 
ATOM   2663 C  CG1 . VAL B 1 116 ? -13.876 -20.783 -33.378 1.00 9.59   ? 116 VAL B CG1 1 
ATOM   2664 C  CG2 . VAL B 1 116 ? -11.402 -21.100 -32.827 1.00 8.76   ? 116 VAL B CG2 1 
ATOM   2665 N  N   . GLU B 1 117 ? -14.756 -24.281 -32.882 1.00 9.43   ? 117 GLU B N   1 
ATOM   2666 C  CA  . GLU B 1 117 ? -16.065 -24.887 -33.033 1.00 10.18  ? 117 GLU B CA  1 
ATOM   2667 C  C   . GLU B 1 117 ? -16.617 -25.360 -31.699 1.00 10.99  ? 117 GLU B C   1 
ATOM   2668 O  O   . GLU B 1 117 ? -17.762 -25.104 -31.346 1.00 12.72  ? 117 GLU B O   1 
ATOM   2669 C  CB  . GLU B 1 117 ? -16.067 -26.081 -34.011 1.00 11.77  ? 117 GLU B CB  1 
ATOM   2670 C  CG  . GLU B 1 117 ? -17.449 -26.560 -34.392 1.00 15.86  ? 117 GLU B CG  1 
ATOM   2671 C  CD  . GLU B 1 117 ? -17.509 -27.821 -35.189 1.00 20.01  ? 117 GLU B CD  1 
ATOM   2672 O  OE1 . GLU B 1 117 ? -16.487 -28.459 -35.452 1.00 24.10  ? 117 GLU B OE1 1 
ATOM   2673 O  OE2 . GLU B 1 117 ? -18.680 -28.216 -35.524 1.00 30.27  ? 117 GLU B OE2 1 
ATOM   2674 N  N   . GLN B 1 118 ? -15.778 -26.036 -30.919 1.00 11.04  ? 118 GLN B N   1 
ATOM   2675 C  CA  . GLN B 1 118 ? -16.230 -26.581 -29.635 1.00 11.81  ? 118 GLN B CA  1 
ATOM   2676 C  C   . GLN B 1 118 ? -16.460 -25.508 -28.601 1.00 11.06  ? 118 GLN B C   1 
ATOM   2677 O  O   . GLN B 1 118 ? -17.463 -25.506 -27.878 1.00 12.72  ? 118 GLN B O   1 
ATOM   2678 C  CB  . GLN B 1 118 ? -15.253 -27.638 -29.147 1.00 13.69  ? 118 GLN B CB  1 
ATOM   2679 C  CG  . GLN B 1 118 ? -15.353 -28.902 -30.012 1.00 14.98  ? 118 GLN B CG  1 
ATOM   2680 C  CD  . GLN B 1 118 ? -14.546 -30.037 -29.433 1.00 22.71  ? 118 GLN B CD  1 
ATOM   2681 O  OE1 . GLN B 1 118 ? -13.464 -29.864 -28.901 1.00 29.52  ? 118 GLN B OE1 1 
ATOM   2682 N  NE2 . GLN B 1 118 ? -15.061 -31.277 -29.506 1.00 31.96  ? 118 GLN B NE2 1 
ATOM   2683 N  N   . HIS B 1 119 ? -15.558 -24.532 -28.450 1.00 11.30  ? 119 HIS B N   1 
ATOM   2684 C  CA  . HIS B 1 119 ? -15.635 -23.553 -27.380 1.00 10.40  ? 119 HIS B CA  1 
ATOM   2685 C  C   . HIS B 1 119 ? -16.544 -22.359 -27.676 1.00 11.58  ? 119 HIS B C   1 
ATOM   2686 O  O   . HIS B 1 119 ? -17.125 -21.816 -26.745 1.00 12.00  ? 119 HIS B O   1 
ATOM   2687 C  CB  . HIS B 1 119 ? -14.234 -23.085 -26.927 1.00 10.41  ? 119 HIS B CB  1 
ATOM   2688 C  CG  . HIS B 1 119 ? -13.440 -24.173 -26.303 1.00 10.17  ? 119 HIS B CG  1 
ATOM   2689 N  ND1 . HIS B 1 119 ? -13.484 -24.477 -24.955 1.00 13.13  ? 119 HIS B ND1 1 
ATOM   2690 C  CD2 . HIS B 1 119 ? -12.600 -25.078 -26.879 1.00 11.98  ? 119 HIS B CD2 1 
ATOM   2691 C  CE1 . HIS B 1 119 ? -12.673 -25.499 -24.739 1.00 15.19  ? 119 HIS B CE1 1 
ATOM   2692 N  NE2 . HIS B 1 119 ? -12.113 -25.898 -25.853 1.00 15.57  ? 119 HIS B NE2 1 
ATOM   2693 N  N   . LEU B 1 120 ? -16.599 -21.956 -28.951 1.00 10.99  ? 120 LEU B N   1 
ATOM   2694 C  CA  . LEU B 1 120 ? -17.366 -20.792 -29.347 1.00 12.28  ? 120 LEU B CA  1 
ATOM   2695 C  C   . LEU B 1 120 ? -18.490 -21.074 -30.324 1.00 12.42  ? 120 LEU B C   1 
ATOM   2696 O  O   . LEU B 1 120 ? -19.411 -20.264 -30.460 1.00 14.37  ? 120 LEU B O   1 
ATOM   2697 C  CB  . LEU B 1 120 ? -16.413 -19.743 -29.967 1.00 11.02  ? 120 LEU B CB  1 
ATOM   2698 C  CG  . LEU B 1 120 ? -15.543 -19.027 -28.930 1.00 12.18  ? 120 LEU B CG  1 
ATOM   2699 C  CD1 . LEU B 1 120 ? -14.396 -18.311 -29.655 1.00 15.68  ? 120 LEU B CD1 1 
ATOM   2700 C  CD2 . LEU B 1 120 ? -16.344 -18.012 -28.115 1.00 14.32  ? 120 LEU B CD2 1 
ATOM   2701 N  N   . GLY B 1 121 ? -18.476 -22.232 -30.991 1.00 12.57  ? 121 GLY B N   1 
ATOM   2702 C  CA  . GLY B 1 121 ? -19.550 -22.572 -31.904 1.00 14.18  ? 121 GLY B CA  1 
ATOM   2703 C  C   . GLY B 1 121 ? -19.220 -22.380 -33.351 1.00 14.63  ? 121 GLY B C   1 
ATOM   2704 O  O   . GLY B 1 121 ? -18.276 -21.682 -33.771 1.00 13.30  ? 121 GLY B O   1 
ATOM   2705 N  N   . PRO B 1 122 ? -20.044 -23.009 -34.216 1.00 18.14  ? 122 PRO B N   1 
ATOM   2706 C  CA  . PRO B 1 122 ? -19.808 -22.936 -35.657 1.00 22.21  ? 122 PRO B CA  1 
ATOM   2707 C  C   . PRO B 1 122 ? -19.743 -21.546 -36.258 1.00 21.59  ? 122 PRO B C   1 
ATOM   2708 O  O   . PRO B 1 122 ? -19.010 -21.287 -37.220 1.00 20.88  ? 122 PRO B O   1 
ATOM   2709 C  CB  . PRO B 1 122 ? -21.033 -23.665 -36.235 1.00 28.12  ? 122 PRO B CB  1 
ATOM   2710 C  CG  . PRO B 1 122 ? -21.403 -24.640 -35.178 1.00 27.97  ? 122 PRO B CG  1 
ATOM   2711 C  CD  . PRO B 1 122 ? -21.151 -23.934 -33.875 1.00 21.98  ? 122 PRO B CD  1 
ATOM   2712 N  N   . GLN B 1 123 ? -20.534 -20.628 -35.768 1.00 21.61  ? 123 GLN B N   1 
ATOM   2713 C  CA  . GLN B 1 123 ? -20.505 -19.315 -36.368 1.00 25.66  ? 123 GLN B CA  1 
ATOM   2714 C  C   . GLN B 1 123 ? -19.160 -18.654 -36.167 1.00 20.68  ? 123 GLN B C   1 
ATOM   2715 O  O   . GLN B 1 123 ? -18.666 -17.883 -37.024 1.00 27.25  ? 123 GLN B O   1 
ATOM   2716 C  CB  . GLN B 1 123 ? -21.614 -18.447 -35.751 1.00 32.75  ? 123 GLN B CB  1 
ATOM   2717 C  CG  . GLN B 1 123 ? -21.587 -18.355 -34.238 1.00 51.16  ? 123 GLN B CG  1 
ATOM   2718 C  CD  . GLN B 1 123 ? -22.176 -19.481 -33.425 1.00 60.45  ? 123 GLN B CD  1 
ATOM   2719 O  OE1 . GLN B 1 123 ? -21.993 -20.680 -33.605 1.00 69.53  ? 123 GLN B OE1 1 
ATOM   2720 N  NE2 . GLN B 1 123 ? -22.960 -19.106 -32.404 1.00 67.11  ? 123 GLN B NE2 1 
ATOM   2721 N  N   . PHE B 1 124 ? -18.454 -18.903 -35.061 1.00 16.03  ? 124 PHE B N   1 
ATOM   2722 C  CA  . PHE B 1 124 ? -17.130 -18.297 -34.860 1.00 14.30  ? 124 PHE B CA  1 
ATOM   2723 C  C   . PHE B 1 124 ? -16.077 -18.963 -35.741 1.00 11.79  ? 124 PHE B C   1 
ATOM   2724 O  O   . PHE B 1 124 ? -15.089 -18.330 -36.095 1.00 11.92  ? 124 PHE B O   1 
ATOM   2725 C  CB  . PHE B 1 124 ? -16.729 -18.357 -33.384 1.00 13.94  ? 124 PHE B CB  1 
ATOM   2726 C  CG  . PHE B 1 124 ? -17.191 -17.159 -32.616 1.00 15.14  ? 124 PHE B CG  1 
ATOM   2727 C  CD1 . PHE B 1 124 ? -16.485 -15.946 -32.641 1.00 20.92  ? 124 PHE B CD1 1 
ATOM   2728 C  CD2 . PHE B 1 124 ? -18.357 -17.239 -31.904 1.00 18.44  ? 124 PHE B CD2 1 
ATOM   2729 C  CE1 . PHE B 1 124 ? -16.972 -14.893 -31.920 1.00 27.19  ? 124 PHE B CE1 1 
ATOM   2730 C  CE2 . PHE B 1 124 ? -18.847 -16.175 -31.153 1.00 25.52  ? 124 PHE B CE2 1 
ATOM   2731 C  CZ  . PHE B 1 124 ? -18.142 -14.998 -31.194 1.00 28.52  ? 124 PHE B CZ  1 
ATOM   2732 N  N   . VAL B 1 125 ? -16.272 -20.212 -36.164 1.00 11.54  ? 125 VAL B N   1 
ATOM   2733 C  CA  . VAL B 1 125 ? -15.315 -20.844 -37.076 1.00 9.86   ? 125 VAL B CA  1 
ATOM   2734 C  C   . VAL B 1 125 ? -15.199 -20.042 -38.355 1.00 9.49   ? 125 VAL B C   1 
ATOM   2735 O  O   . VAL B 1 125 ? -14.113 -19.879 -38.904 1.00 9.94   ? 125 VAL B O   1 
ATOM   2736 C  CB  . VAL B 1 125 ? -15.657 -22.310 -37.359 1.00 11.97  ? 125 VAL B CB  1 
ATOM   2737 C  CG1 . VAL B 1 125 ? -14.691 -22.945 -38.335 1.00 12.92  ? 125 VAL B CG1 1 
ATOM   2738 C  CG2 . VAL B 1 125 ? -15.649 -23.089 -36.051 1.00 13.68  ? 125 VAL B CG2 1 
ATOM   2739 N  N   . GLU B 1 126 ? -16.304 -19.515 -38.838 1.00 10.65  ? 126 GLU B N   1 
ATOM   2740 C  CA  . GLU B 1 126 ? -16.305 -18.627 -40.006 1.00 10.62  ? 126 GLU B CA  1 
ATOM   2741 C  C   . GLU B 1 126 ? -15.565 -17.328 -39.829 1.00 9.05   ? 126 GLU B C   1 
ATOM   2742 O  O   . GLU B 1 126 ? -15.319 -16.636 -40.847 1.00 10.38  ? 126 GLU B O   1 
ATOM   2743 C  CB  . GLU B 1 126 ? -17.772 -18.359 -40.378 1.00 14.42  ? 126 GLU B CB  1 
ATOM   2744 C  CG  . GLU B 1 126 ? -18.466 -19.674 -40.815 1.00 20.02  ? 126 GLU B CG  1 
ATOM   2745 C  CD  . GLU B 1 126 ? -19.943 -19.473 -41.107 1.00 19.75  ? 126 GLU B CD  1 
ATOM   2746 O  OE1 . GLU B 1 126 ? -20.235 -18.439 -41.781 1.00 30.62  ? 126 GLU B OE1 1 
ATOM   2747 O  OE2 . GLU B 1 126 ? -20.734 -20.373 -40.729 1.00 23.06  ? 126 GLU B OE2 1 
ATOM   2748 N  N   . ARG B 1 127 ? -15.164 -16.958 -38.640 1.00 9.19   ? 127 ARG B N   1 
ATOM   2749 C  CA  . ARG B 1 127 ? -14.455 -15.743 -38.335 1.00 8.80   ? 127 ARG B CA  1 
ATOM   2750 C  C   . ARG B 1 127 ? -12.965 -15.994 -38.122 1.00 7.87   ? 127 ARG B C   1 
ATOM   2751 O  O   . ARG B 1 127 ? -12.260 -15.063 -37.729 1.00 8.70   ? 127 ARG B O   1 
ATOM   2752 C  CB  . ARG B 1 127 ? -15.085 -15.089 -37.111 1.00 12.41  ? 127 ARG B CB  1 
ATOM   2753 C  CG  . ARG B 1 127 ? -16.591 -14.966 -37.165 1.00 17.18  ? 127 ARG B CG  1 
ATOM   2754 C  CD  . ARG B 1 127 ? -17.045 -14.311 -38.423 1.00 27.25  ? 127 ARG B CD  1 
ATOM   2755 N  NE  . ARG B 1 127 ? -16.593 -12.955 -38.250 1.00 33.90  ? 127 ARG B NE  1 
ATOM   2756 C  CZ  . ARG B 1 127 ? -16.704 -11.897 -39.033 1.00 33.74  ? 127 ARG B CZ  1 
ATOM   2757 N  NH1 . ARG B 1 127 ? -16.152 -10.791 -38.530 1.00 22.04  ? 127 ARG B NH1 1 
ATOM   2758 N  NH2 . ARG B 1 127 ? -17.358 -12.171 -40.170 1.00 25.63  ? 127 ARG B NH2 1 
ATOM   2759 N  N   . ILE B 1 128 ? -12.477 -17.195 -38.372 1.00 8.02   ? 128 ILE B N   1 
ATOM   2760 C  CA  . ILE B 1 128 ? -11.061 -17.494 -38.248 1.00 7.84   ? 128 ILE B CA  1 
ATOM   2761 C  C   . ILE B 1 128 ? -10.309 -17.006 -39.492 1.00 7.79   ? 128 ILE B C   1 
ATOM   2762 O  O   . ILE B 1 128 ? -10.730 -17.246 -40.622 1.00 8.24   ? 128 ILE B O   1 
ATOM   2763 C  CB  . ILE B 1 128 ? -10.792 -19.014 -38.032 1.00 8.00   ? 128 ILE B CB  1 
ATOM   2764 C  CG1 . ILE B 1 128 ? -11.434 -19.505 -36.744 1.00 9.23   ? 128 ILE B CG1 1 
ATOM   2765 C  CG2 . ILE B 1 128 ? -9.306  -19.308 -38.065 1.00 8.43   ? 128 ILE B CG2 1 
ATOM   2766 C  CD1 . ILE B 1 128 ? -11.473 -21.024 -36.675 1.00 9.51   ? 128 ILE B CD1 1 
ATOM   2767 N  N   . ILE B 1 129 ? -9.177  -16.364 -39.242 1.00 7.53   ? 129 ILE B N   1 
ATOM   2768 C  CA  . ILE B 1 129 ? -8.186  -16.029 -40.259 1.00 7.41   ? 129 ILE B CA  1 
ATOM   2769 C  C   . ILE B 1 129 ? -6.873  -16.678 -39.802 1.00 7.75   ? 129 ILE B C   1 
ATOM   2770 O  O   . ILE B 1 129 ? -6.335  -16.262 -38.760 1.00 8.97   ? 129 ILE B O   1 
ATOM   2771 C  CB  . ILE B 1 129 ? -8.026  -14.546 -40.457 1.00 8.20   ? 129 ILE B CB  1 
ATOM   2772 C  CG1 . ILE B 1 129 ? -9.339  -13.884 -40.877 1.00 9.07   ? 129 ILE B CG1 1 
ATOM   2773 C  CG2 . ILE B 1 129 ? -6.931  -14.249 -41.494 1.00 9.07   ? 129 ILE B CG2 1 
ATOM   2774 C  CD1 . ILE B 1 129 ? -9.263  -12.383 -40.947 1.00 11.54  ? 129 ILE B CD1 1 
ATOM   2775 N  N   . LEU B 1 130 ? -6.384  -17.638 -40.567 1.00 7.47   ? 130 LEU B N   1 
ATOM   2776 C  CA  . LEU B 1 130 ? -5.087  -18.235 -40.279 1.00 7.94   ? 130 LEU B CA  1 
ATOM   2777 C  C   . LEU B 1 130 ? -4.042  -17.601 -41.173 1.00 7.86   ? 130 LEU B C   1 
ATOM   2778 O  O   . LEU B 1 130 ? -4.211  -17.584 -42.408 1.00 9.53   ? 130 LEU B O   1 
ATOM   2779 C  CB  . LEU B 1 130 ? -5.057  -19.692 -40.632 1.00 11.92  ? 130 LEU B CB  1 
ATOM   2780 C  CG  . LEU B 1 130 ? -5.799  -20.798 -39.988 1.00 18.28  ? 130 LEU B CG  1 
ATOM   2781 C  CD1 . LEU B 1 130 ? -5.041  -22.115 -40.273 1.00 15.21  ? 130 LEU B CD1 1 
ATOM   2782 C  CD2 . LEU B 1 130 ? -5.978  -20.549 -38.507 1.00 17.69  ? 130 LEU B CD2 1 
ATOM   2783 N  N   . THR B 1 131 ? -3.001  -17.046 -40.577 1.00 7.96   ? 131 THR B N   1 
ATOM   2784 C  CA  . THR B 1 131 ? -1.959  -16.306 -41.339 1.00 8.73   ? 131 THR B CA  1 
ATOM   2785 C  C   . THR B 1 131 ? -0.716  -16.221 -40.511 1.00 8.45   ? 131 THR B C   1 
ATOM   2786 O  O   . THR B 1 131 ? -0.803  -16.067 -39.288 1.00 9.51   ? 131 THR B O   1 
ATOM   2787 C  CB  . THR B 1 131 ? -2.483  -14.911 -41.687 1.00 8.91   ? 131 THR B CB  1 
ATOM   2788 O  OG1 . THR B 1 131 ? -1.456  -14.253 -42.460 1.00 9.80   ? 131 THR B OG1 1 
ATOM   2789 C  CG2 . THR B 1 131 ? -2.807  -14.079 -40.487 1.00 9.92   ? 131 THR B CG2 1 
ATOM   2790 N  N   . ARG B 1 132 ? 0.427   -16.302 -41.178 1.00 9.00   ? 132 ARG B N   1 
ATOM   2791 C  CA  . ARG B 1 132 ? 1.721   -16.022 -40.524 1.00 9.44   ? 132 ARG B CA  1 
ATOM   2792 C  C   . ARG B 1 132 ? 2.061   -14.557 -40.596 1.00 9.56   ? 132 ARG B C   1 
ATOM   2793 O  O   . ARG B 1 132 ? 3.106   -14.155 -40.061 1.00 13.40  ? 132 ARG B O   1 
ATOM   2794 C  CB  . ARG B 1 132 ? 2.818   -16.856 -41.162 1.00 12.56  ? 132 ARG B CB  1 
ATOM   2795 C  CG  . ARG B 1 132 ? 2.781   -18.323 -41.257 1.00 17.01  ? 132 ARG B CG  1 
ATOM   2796 C  CD  . ARG B 1 132 ? 3.355   -19.071 -40.132 1.00 19.25  ? 132 ARG B CD  1 
ATOM   2797 N  NE  . ARG B 1 132 ? 4.707   -18.709 -39.712 1.00 15.35  ? 132 ARG B NE  1 
ATOM   2798 C  CZ  . ARG B 1 132 ? 5.225   -18.895 -38.519 1.00 16.82  ? 132 ARG B CZ  1 
ATOM   2799 N  NH1 . ARG B 1 132 ? 6.455   -18.509 -38.263 1.00 19.40  ? 132 ARG B NH1 1 
ATOM   2800 N  NH2 . ARG B 1 132 ? 4.513   -19.472 -37.548 1.00 18.17  ? 132 ARG B NH2 1 
ATOM   2801 N  N   . ASP B 1 133 ? 1.285   -13.750 -41.243 1.00 9.44   ? 133 ASP B N   1 
ATOM   2802 C  CA  . ASP B 1 133 ? 1.449   -12.306 -41.368 1.00 10.00  ? 133 ASP B CA  1 
ATOM   2803 C  C   . ASP B 1 133 ? 0.120   -11.634 -41.040 1.00 9.02   ? 133 ASP B C   1 
ATOM   2804 O  O   . ASP B 1 133 ? -0.776  -11.590 -41.878 1.00 10.04  ? 133 ASP B O   1 
ATOM   2805 C  CB  . ASP B 1 133 ? 1.956   -11.923 -42.756 1.00 10.01  ? 133 ASP B CB  1 
ATOM   2806 C  CG  . ASP B 1 133 ? 2.446   -10.490 -42.846 1.00 11.36  ? 133 ASP B CG  1 
ATOM   2807 O  OD1 . ASP B 1 133 ? 1.919   -9.686  -42.018 1.00 11.49  ? 133 ASP B OD1 1 
ATOM   2808 O  OD2 . ASP B 1 133 ? 3.330   -10.189 -43.709 1.00 13.02  ? 133 ASP B OD2 1 
ATOM   2809 N  N   . LYS B 1 134 ? 0.039   -11.088 -39.832 1.00 9.02   ? 134 LYS B N   1 
ATOM   2810 C  CA  . LYS B 1 134 ? -1.168  -10.397 -39.409 1.00 8.43   ? 134 LYS B CA  1 
ATOM   2811 C  C   . LYS B 1 134 ? -1.209  -8.962  -39.905 1.00 8.38   ? 134 LYS B C   1 
ATOM   2812 O  O   . LYS B 1 134 ? -2.266  -8.316  -39.855 1.00 8.40   ? 134 LYS B O   1 
ATOM   2813 C  CB  . LYS B 1 134 ? -1.293  -10.458 -37.868 1.00 8.71   ? 134 LYS B CB  1 
ATOM   2814 C  CG  . LYS B 1 134 ? -1.285  -11.883 -37.339 1.00 8.82   ? 134 LYS B CG  1 
ATOM   2815 C  CD  . LYS B 1 134 ? -1.667  -12.071 -35.898 1.00 8.73   ? 134 LYS B CD  1 
ATOM   2816 C  CE  . LYS B 1 134 ? -1.458  -13.514 -35.466 1.00 8.57   ? 134 LYS B CE  1 
ATOM   2817 N  NZ  . LYS B 1 134 ? -1.932  -13.760 -34.073 1.00 8.92   ? 134 LYS B NZ  1 
ATOM   2818 N  N   . THR B 1 135 ? -0.065  -8.449  -40.386 1.00 8.81   ? 135 THR B N   1 
ATOM   2819 C  CA  . THR B 1 135 ? -0.006  -7.060  -40.844 1.00 9.29   ? 135 THR B CA  1 
ATOM   2820 C  C   . THR B 1 135 ? -0.739  -6.848  -42.195 1.00 9.04   ? 135 THR B C   1 
ATOM   2821 O  O   . THR B 1 135 ? -1.067  -5.706  -42.500 1.00 10.82  ? 135 THR B O   1 
ATOM   2822 C  CB  . THR B 1 135 ? 1.411   -6.500  -40.946 1.00 10.91  ? 135 THR B CB  1 
ATOM   2823 O  OG1 . THR B 1 135 ? 2.080   -7.019  -42.095 1.00 11.44  ? 135 THR B OG1 1 
ATOM   2824 C  CG2 . THR B 1 135 ? 2.258   -6.803  -39.700 1.00 12.89  ? 135 THR B CG2 1 
ATOM   2825 N  N   . VAL B 1 136 ? -1.016  -7.936  -42.903 1.00 9.38   ? 136 VAL B N   1 
ATOM   2826 C  CA  . VAL B 1 136 ? -1.784  -7.822  -44.151 1.00 9.42   ? 136 VAL B CA  1 
ATOM   2827 C  C   . VAL B 1 136 ? -3.300  -8.028  -43.929 1.00 10.02  ? 136 VAL B C   1 
ATOM   2828 O  O   . VAL B 1 136 ? -4.063  -8.071  -44.906 1.00 11.87  ? 136 VAL B O   1 
ATOM   2829 C  CB  . VAL B 1 136 ? -1.257  -8.737  -45.262 1.00 9.49   ? 136 VAL B CB  1 
ATOM   2830 C  CG1 . VAL B 1 136 ? 0.229   -8.378  -45.539 1.00 11.72  ? 136 VAL B CG1 1 
ATOM   2831 C  CG2 . VAL B 1 136 ? -1.405  -10.213 -44.954 1.00 11.60  ? 136 VAL B CG2 1 
ATOM   2832 N  N   . VAL B 1 137 ? -3.719  -8.116  -42.673 1.00 9.29   ? 137 VAL B N   1 
ATOM   2833 C  CA  . VAL B 1 137 ? -5.135  -8.200  -42.306 1.00 9.15   ? 137 VAL B CA  1 
ATOM   2834 C  C   . VAL B 1 137 ? -5.603  -6.822  -41.875 1.00 9.48   ? 137 VAL B C   1 
ATOM   2835 O  O   . VAL B 1 137 ? -4.994  -6.221  -40.979 1.00 10.74  ? 137 VAL B O   1 
ATOM   2836 C  CB  . VAL B 1 137 ? -5.385  -9.275  -41.274 1.00 9.73   ? 137 VAL B CB  1 
ATOM   2837 C  CG1 . VAL B 1 137 ? -6.896  -9.388  -40.973 1.00 10.71  ? 137 VAL B CG1 1 
ATOM   2838 C  CG2 . VAL B 1 137 ? -4.853  -10.638 -41.714 1.00 11.09  ? 137 VAL B CG2 1 
ATOM   2839 N  N   A LEU B 1 138 ? -6.611  -6.270  -42.508 0.42 9.46   ? 138 LEU B N   1 
ATOM   2840 N  N   B LEU B 1 138 ? -6.686  -6.390  -42.473 0.58 9.42   ? 138 LEU B N   1 
ATOM   2841 C  CA  A LEU B 1 138 ? -7.173  -4.955  -42.250 0.42 10.09  ? 138 LEU B CA  1 
ATOM   2842 C  CA  B LEU B 1 138 ? -7.297  -5.123  -42.144 0.58 11.47  ? 138 LEU B CA  1 
ATOM   2843 C  C   A LEU B 1 138 ? -8.115  -4.940  -41.058 0.42 10.92  ? 138 LEU B C   1 
ATOM   2844 C  C   B LEU B 1 138 ? -8.118  -5.153  -40.874 0.58 11.14  ? 138 LEU B C   1 
ATOM   2845 O  O   A LEU B 1 138 ? -9.144  -5.629  -41.063 0.42 12.03  ? 138 LEU B O   1 
ATOM   2846 O  O   B LEU B 1 138 ? -8.996  -5.977  -40.662 0.58 13.59  ? 138 LEU B O   1 
ATOM   2847 C  CB  A LEU B 1 138 ? -7.933  -4.509  -43.510 0.42 10.22  ? 138 LEU B CB  1 
ATOM   2848 C  CB  B LEU B 1 138 ? -8.219  -4.666  -43.299 0.58 12.54  ? 138 LEU B CB  1 
ATOM   2849 C  CG  A LEU B 1 138 ? -8.679  -3.180  -43.473 0.42 12.64  ? 138 LEU B CG  1 
ATOM   2850 C  CG  B LEU B 1 138 ? -7.435  -4.192  -44.527 0.58 14.34  ? 138 LEU B CG  1 
ATOM   2851 C  CD1 A LEU B 1 138 ? -7.707  -2.009  -43.275 0.42 12.49  ? 138 LEU B CD1 1 
ATOM   2852 C  CD1 B LEU B 1 138 ? -8.320  -3.937  -45.744 0.58 21.27  ? 138 LEU B CD1 1 
ATOM   2853 C  CD2 A LEU B 1 138 ? -9.466  -2.872  -44.745 0.42 19.15  ? 138 LEU B CD2 1 
ATOM   2854 C  CD2 B LEU B 1 138 ? -6.632  -2.909  -44.256 0.58 20.60  ? 138 LEU B CD2 1 
ATOM   2855 N  N   . GLY B 1 139 ? -7.820  -4.185  -40.008 1.00 12.26  ? 139 GLY B N   1 
ATOM   2856 C  CA  . GLY B 1 139 ? -8.671  -4.002  -38.877 1.00 12.61  ? 139 GLY B CA  1 
ATOM   2857 C  C   . GLY B 1 139 ? -8.307  -2.732  -38.098 1.00 10.77  ? 139 GLY B C   1 
ATOM   2858 O  O   . GLY B 1 139 ? -7.284  -2.105  -38.408 1.00 12.37  ? 139 GLY B O   1 
ATOM   2859 N  N   . ASP B 1 140 ? -9.097  -2.414  -37.063 1.00 10.97  ? 140 ASP B N   1 
ATOM   2860 C  CA  . ASP B 1 140 ? -8.820  -1.242  -36.233 1.00 11.51  ? 140 ASP B CA  1 
ATOM   2861 C  C   . ASP B 1 140 ? -7.918  -1.573  -35.064 1.00 10.77  ? 140 ASP B C   1 
ATOM   2862 O  O   . ASP B 1 140 ? -7.140  -0.758  -34.604 1.00 11.32  ? 140 ASP B O   1 
ATOM   2863 C  CB  . ASP B 1 140 ? -10.161 -0.653  -35.721 1.00 12.58  ? 140 ASP B CB  1 
ATOM   2864 C  CG  . ASP B 1 140 ? -10.970 -0.202  -36.909 1.00 13.36  ? 140 ASP B CG  1 
ATOM   2865 O  OD1 . ASP B 1 140 ? -10.590 0.859   -37.456 1.00 26.14  ? 140 ASP B OD1 1 
ATOM   2866 O  OD2 . ASP B 1 140 ? -11.909 -0.889  -37.331 1.00 16.31  ? 140 ASP B OD2 1 
ATOM   2867 N  N   . LEU B 1 141 ? -8.027  -2.807  -34.534 1.00 10.44  ? 141 LEU B N   1 
ATOM   2868 C  CA  . LEU B 1 141 ? -7.357  -3.219  -33.332 1.00 10.08  ? 141 LEU B CA  1 
ATOM   2869 C  C   . LEU B 1 141 ? -6.902  -4.680  -33.527 1.00 9.57   ? 141 LEU B C   1 
ATOM   2870 O  O   . LEU B 1 141 ? -7.618  -5.462  -34.140 1.00 9.93   ? 141 LEU B O   1 
ATOM   2871 C  CB  . LEU B 1 141 ? -8.282  -3.218  -32.119 1.00 10.98  ? 141 LEU B CB  1 
ATOM   2872 C  CG  . LEU B 1 141 ? -8.678  -1.811  -31.642 1.00 11.84  ? 141 LEU B CG  1 
ATOM   2873 C  CD1 . LEU B 1 141 ? -9.899  -1.926  -30.749 1.00 16.36  ? 141 LEU B CD1 1 
ATOM   2874 C  CD2 . LEU B 1 141 ? -7.556  -1.153  -30.893 1.00 13.30  ? 141 LEU B CD2 1 
ATOM   2875 N  N   . LEU B 1 142 ? -5.722  -5.009  -33.001 1.00 9.40   ? 142 LEU B N   1 
ATOM   2876 C  CA  . LEU B 1 142 ? -5.259  -6.374  -32.880 1.00 8.70   ? 142 LEU B CA  1 
ATOM   2877 C  C   . LEU B 1 142 ? -4.913  -6.592  -31.395 1.00 9.46   ? 142 LEU B C   1 
ATOM   2878 O  O   . LEU B 1 142 ? -4.003  -5.922  -30.892 1.00 10.07  ? 142 LEU B O   1 
ATOM   2879 C  CB  . LEU B 1 142 ? -4.040  -6.616  -33.757 1.00 9.77   ? 142 LEU B CB  1 
ATOM   2880 C  CG  . LEU B 1 142 ? -3.311  -7.969  -33.517 1.00 9.05   ? 142 LEU B CG  1 
ATOM   2881 C  CD1 . LEU B 1 142 ? -4.196  -9.167  -33.861 1.00 10.00  ? 142 LEU B CD1 1 
ATOM   2882 C  CD2 . LEU B 1 142 ? -2.010  -8.016  -34.270 1.00 11.47  ? 142 LEU B CD2 1 
ATOM   2883 N  N   . ILE B 1 143 ? -5.602  -7.506  -30.751 1.00 8.71   ? 143 ILE B N   1 
ATOM   2884 C  CA  . ILE B 1 143 ? -5.356  -7.825  -29.327 1.00 8.67   ? 143 ILE B CA  1 
ATOM   2885 C  C   . ILE B 1 143 ? -4.528  -9.106  -29.343 1.00 8.73   ? 143 ILE B C   1 
ATOM   2886 O  O   . ILE B 1 143 ? -5.070  -10.159 -29.744 1.00 9.24   ? 143 ILE B O   1 
ATOM   2887 C  CB  . ILE B 1 143 ? -6.666  -7.996  -28.587 1.00 10.19  ? 143 ILE B CB  1 
ATOM   2888 C  CG1 . ILE B 1 143 ? -7.487  -6.711  -28.647 1.00 10.90  ? 143 ILE B CG1 1 
ATOM   2889 C  CG2 . ILE B 1 143 ? -6.442  -8.437  -27.151 1.00 10.48  ? 143 ILE B CG2 1 
ATOM   2890 C  CD1 . ILE B 1 143 ? -8.895  -6.810  -28.078 1.00 11.84  ? 143 ILE B CD1 1 
ATOM   2891 N  N   . ASP B 1 144 ? -3.251  -9.056  -28.998 1.00 8.86   ? 144 ASP B N   1 
ATOM   2892 C  CA  . ASP B 1 144 ? -2.282  -10.111 -29.265 1.00 8.22   ? 144 ASP B CA  1 
ATOM   2893 C  C   . ASP B 1 144 ? -1.220  -10.048 -28.157 1.00 8.04   ? 144 ASP B C   1 
ATOM   2894 O  O   . ASP B 1 144 ? -0.778  -8.964  -27.795 1.00 9.28   ? 144 ASP B O   1 
ATOM   2895 C  CB  . ASP B 1 144 ? -1.775  -9.978  -30.686 1.00 8.43   ? 144 ASP B CB  1 
ATOM   2896 C  CG  . ASP B 1 144 ? -0.967  -11.139 -31.225 1.00 8.77   ? 144 ASP B CG  1 
ATOM   2897 O  OD1 . ASP B 1 144 ? -0.029  -11.576 -30.502 1.00 9.69   ? 144 ASP B OD1 1 
ATOM   2898 O  OD2 . ASP B 1 144 ? -1.257  -11.556 -32.376 1.00 10.70  ? 144 ASP B OD2 1 
ATOM   2899 N  N   . ASP B 1 145 ? -0.816  -11.213 -27.641 1.00 8.73   ? 145 ASP B N   1 
ATOM   2900 C  CA  . ASP B 1 145 ? 0.215   -11.244 -26.585 1.00 8.56   ? 145 ASP B CA  1 
ATOM   2901 C  C   . ASP B 1 145 ? 1.610   -11.188 -27.100 1.00 8.43   ? 145 ASP B C   1 
ATOM   2902 O  O   . ASP B 1 145 ? 2.541   -11.095 -26.264 1.00 9.89   ? 145 ASP B O   1 
ATOM   2903 C  CB  . ASP B 1 145 ? 0.085   -12.533 -25.733 1.00 9.08   ? 145 ASP B CB  1 
ATOM   2904 C  CG  . ASP B 1 145 ? 0.278   -13.835 -26.474 1.00 8.46   ? 145 ASP B CG  1 
ATOM   2905 O  OD1 . ASP B 1 145 ? -0.205  -13.968 -27.628 1.00 9.16   ? 145 ASP B OD1 1 
ATOM   2906 O  OD2 . ASP B 1 145 ? 0.877   -14.756 -25.871 1.00 11.97  ? 145 ASP B OD2 1 
ATOM   2907 N  N   . LYS B 1 146 ? 1.877   -11.249 -28.390 1.00 9.08   ? 146 LYS B N   1 
ATOM   2908 C  CA  . LYS B 1 146 ? 3.245   -11.218 -28.904 1.00 9.35   ? 146 LYS B CA  1 
ATOM   2909 C  C   . LYS B 1 146 ? 3.766   -9.796  -28.752 1.00 9.63   ? 146 LYS B C   1 
ATOM   2910 O  O   . LYS B 1 146 ? 3.050   -8.838  -29.054 1.00 11.61  ? 146 LYS B O   1 
ATOM   2911 C  CB  . LYS B 1 146 ? 3.272   -11.659 -30.362 1.00 9.61   ? 146 LYS B CB  1 
ATOM   2912 C  CG  . LYS B 1 146 ? 4.679   -11.862 -30.928 1.00 10.02  ? 146 LYS B CG  1 
ATOM   2913 C  CD  . LYS B 1 146 ? 4.639   -12.474 -32.333 1.00 10.60  ? 146 LYS B CD  1 
ATOM   2914 C  CE  . LYS B 1 146 ? 5.994   -12.722 -32.920 1.00 12.11  ? 146 LYS B CE  1 
ATOM   2915 N  NZ  . LYS B 1 146 ? 6.772   -11.514 -33.175 1.00 12.95  ? 146 LYS B NZ  1 
ATOM   2916 N  N   . ASP B 1 147 ? 5.013   -9.640  -28.328 1.00 10.81  ? 147 ASP B N   1 
ATOM   2917 C  CA  . ASP B 1 147 ? 5.498   -8.296  -27.929 1.00 13.47  ? 147 ASP B CA  1 
ATOM   2918 C  C   . ASP B 1 147 ? 5.530   -7.357  -29.119 1.00 13.53  ? 147 ASP B C   1 
ATOM   2919 O  O   . ASP B 1 147 ? 5.221   -6.171  -28.936 1.00 14.65  ? 147 ASP B O   1 
ATOM   2920 C  CB  . ASP B 1 147 ? 6.775   -8.373  -27.139 1.00 21.43  ? 147 ASP B CB  1 
ATOM   2921 C  CG  . ASP B 1 147 ? 8.115   -8.902  -27.145 1.00 38.44  ? 147 ASP B CG  1 
ATOM   2922 O  OD1 . ASP B 1 147 ? 8.774   -8.661  -28.198 1.00 37.14  ? 147 ASP B OD1 1 
ATOM   2923 O  OD2 . ASP B 1 147 ? 8.642   -9.469  -26.137 1.00 24.99  ? 147 ASP B OD2 1 
ATOM   2924 N  N   . THR B 1 148 ? 5.895   -7.809  -30.297 1.00 12.29  ? 148 THR B N   1 
ATOM   2925 C  CA  A THR B 1 148 ? 5.727   -6.996  -31.494 0.50 13.00  ? 148 THR B CA  1 
ATOM   2926 C  CA  B THR B 1 148 ? 5.956   -7.093  -31.546 0.50 12.34  ? 148 THR B CA  1 
ATOM   2927 C  C   . THR B 1 148 ? 5.223   -7.898  -32.605 1.00 12.46  ? 148 THR B C   1 
ATOM   2928 O  O   . THR B 1 148 ? 5.598   -9.048  -32.764 1.00 16.83  ? 148 THR B O   1 
ATOM   2929 C  CB  A THR B 1 148 ? 7.032   -6.319  -31.890 0.50 12.18  ? 148 THR B CB  1 
ATOM   2930 C  CB  B THR B 1 148 ? 7.411   -6.943  -32.005 0.50 17.04  ? 148 THR B CB  1 
ATOM   2931 O  OG1 A THR B 1 148 ? 7.308   -5.338  -30.857 0.50 15.42  ? 148 THR B OG1 1 
ATOM   2932 O  OG1 B THR B 1 148 ? 7.914   -8.274  -32.164 0.50 26.19  ? 148 THR B OG1 1 
ATOM   2933 C  CG2 A THR B 1 148 ? 6.956   -5.628  -33.222 0.50 16.36  ? 148 THR B CG2 1 
ATOM   2934 C  CG2 B THR B 1 148 ? 8.183   -6.216  -30.914 0.50 13.60  ? 148 THR B CG2 1 
ATOM   2935 N  N   . VAL B 1 149 ? 4.284   -7.346  -33.328 1.00 12.27  ? 149 VAL B N   1 
ATOM   2936 C  CA  . VAL B 1 149 ? 3.597   -8.053  -34.392 1.00 11.37  ? 149 VAL B CA  1 
ATOM   2937 C  C   . VAL B 1 149 ? 4.041   -7.415  -35.693 1.00 12.92  ? 149 VAL B C   1 
ATOM   2938 O  O   . VAL B 1 149 ? 3.656   -6.259  -35.958 1.00 15.81  ? 149 VAL B O   1 
ATOM   2939 C  CB  . VAL B 1 149 ? 2.083   -8.061  -34.251 1.00 11.44  ? 149 VAL B CB  1 
ATOM   2940 C  CG1 . VAL B 1 149 ? 1.484   -8.825  -35.427 1.00 11.25  ? 149 VAL B CG1 1 
ATOM   2941 C  CG2 . VAL B 1 149 ? 1.630   -8.727  -32.973 1.00 12.91  ? 149 VAL B CG2 1 
ATOM   2942 N  N   . ARG B 1 150 ? 4.847   -8.140  -36.450 1.00 12.73  ? 150 ARG B N   1 
ATOM   2943 C  CA  . ARG B 1 150 ? 5.453   -7.597  -37.663 1.00 16.73  ? 150 ARG B CA  1 
ATOM   2944 C  C   . ARG B 1 150 ? 5.182   -8.446  -38.888 1.00 13.62  ? 150 ARG B C   1 
ATOM   2945 O  O   . ARG B 1 150 ? 4.741   -9.577  -38.812 1.00 13.34  ? 150 ARG B O   1 
ATOM   2946 C  CB  . ARG B 1 150 ? 6.953   -7.485  -37.434 1.00 23.40  ? 150 ARG B CB  1 
ATOM   2947 C  CG  . ARG B 1 150 ? 7.720   -8.650  -36.871 1.00 36.22  ? 150 ARG B CG  1 
ATOM   2948 C  CD  . ARG B 1 150 ? 9.213   -8.597  -37.164 1.00 37.81  ? 150 ARG B CD  1 
ATOM   2949 N  NE  . ARG B 1 150 ? 9.977   -7.626  -36.441 1.00 46.17  ? 150 ARG B NE  1 
ATOM   2950 C  CZ  . ARG B 1 150 ? 11.236  -7.219  -36.513 1.00 44.92  ? 150 ARG B CZ  1 
ATOM   2951 N  NH1 . ARG B 1 150 ? 11.645  -6.265  -35.671 1.00 70.79  ? 150 ARG B NH1 1 
ATOM   2952 N  NH2 . ARG B 1 150 ? 12.133  -7.689  -37.371 1.00 62.58  ? 150 ARG B NH2 1 
ATOM   2953 N  N   . GLY B 1 151 ? 5.472   -7.865  -40.056 1.00 13.12  ? 151 GLY B N   1 
ATOM   2954 C  CA  . GLY B 1 151 ? 5.208   -8.491  -41.315 1.00 12.39  ? 151 GLY B CA  1 
ATOM   2955 C  C   . GLY B 1 151 ? 5.461   -7.568  -42.475 1.00 14.02  ? 151 GLY B C   1 
ATOM   2956 O  O   . GLY B 1 151 ? 6.182   -6.574  -42.357 1.00 16.27  ? 151 GLY B O   1 
ATOM   2957 N  N   . GLN B 1 152 ? 4.834   -7.816  -43.621 1.00 15.35  ? 152 GLN B N   1 
ATOM   2958 C  CA  . GLN B 1 152 ? 5.073   -7.026  -44.850 1.00 16.33  ? 152 GLN B CA  1 
ATOM   2959 C  C   . GLN B 1 152 ? 4.521   -5.617  -44.843 1.00 21.15  ? 152 GLN B C   1 
ATOM   2960 O  O   . GLN B 1 152 ? 5.086   -4.807  -45.579 1.00 27.78  ? 152 GLN B O   1 
ATOM   2961 C  CB  . GLN B 1 152 ? 4.446   -7.788  -46.021 1.00 20.21  ? 152 GLN B CB  1 
ATOM   2962 C  CG  . GLN B 1 152 ? 5.286   -9.022  -46.293 1.00 23.34  ? 152 GLN B CG  1 
ATOM   2963 C  CD  . GLN B 1 152 ? 4.817   -9.592  -47.630 1.00 24.11  ? 152 GLN B CD  1 
ATOM   2964 O  OE1 . GLN B 1 152 ? 3.821   -9.032  -48.127 1.00 31.31  ? 152 GLN B OE1 1 
ATOM   2965 N  NE2 . GLN B 1 152 ? 5.679   -10.489 -48.006 1.00 35.97  ? 152 GLN B NE2 1 
ATOM   2966 N  N   . GLU B 1 153 ? 3.510   -5.292  -44.083 1.00 17.04  ? 153 GLU B N   1 
ATOM   2967 C  CA  . GLU B 1 153 ? 3.119   -3.889  -43.928 1.00 19.68  ? 153 GLU B CA  1 
ATOM   2968 C  C   . GLU B 1 153 ? 3.878   -3.230  -42.780 1.00 20.28  ? 153 GLU B C   1 
ATOM   2969 O  O   . GLU B 1 153 ? 3.660   -3.628  -41.664 1.00 19.92  ? 153 GLU B O   1 
ATOM   2970 C  CB  . GLU B 1 153 ? 1.643   -3.687  -43.606 1.00 18.51  ? 153 GLU B CB  1 
ATOM   2971 C  CG  . GLU B 1 153 ? 0.690   -4.006  -44.699 1.00 19.16  ? 153 GLU B CG  1 
ATOM   2972 C  CD  . GLU B 1 153 ? 0.832   -3.025  -45.862 1.00 19.90  ? 153 GLU B CD  1 
ATOM   2973 O  OE1 . GLU B 1 153 ? 0.601   -1.823  -45.614 1.00 21.08  ? 153 GLU B OE1 1 
ATOM   2974 O  OE2 . GLU B 1 153 ? 1.098   -3.502  -46.972 1.00 25.80  ? 153 GLU B OE2 1 
ATOM   2975 N  N   . GLU B 1 154 ? 4.742   -2.262  -43.103 1.00 22.78  ? 154 GLU B N   1 
ATOM   2976 C  CA  . GLU B 1 154 ? 5.538   -1.580  -42.079 1.00 25.11  ? 154 GLU B CA  1 
ATOM   2977 C  C   . GLU B 1 154 ? 4.648   -0.847  -41.100 1.00 21.49  ? 154 GLU B C   1 
ATOM   2978 O  O   . GLU B 1 154 ? 4.947   -0.727  -39.908 1.00 24.58  ? 154 GLU B O   1 
ATOM   2979 C  CB  . GLU B 1 154 ? 6.506   -0.710  -42.847 1.00 32.51  ? 154 GLU B CB  1 
ATOM   2980 C  CG  . GLU B 1 154 ? 7.463   0.211   -42.146 1.00 42.32  ? 154 GLU B CG  1 
ATOM   2981 C  CD  . GLU B 1 154 ? 7.934   1.349   -43.048 1.00 54.38  ? 154 GLU B CD  1 
ATOM   2982 O  OE1 . GLU B 1 154 ? 8.052   2.520   -42.612 1.00 61.61  ? 154 GLU B OE1 1 
ATOM   2983 O  OE2 . GLU B 1 154 ? 8.181   1.030   -44.234 1.00 73.58  ? 154 GLU B OE2 1 
ATOM   2984 N  N   . THR B 1 155 ? 3.504   -0.326  -41.564 1.00 21.52  ? 155 THR B N   1 
ATOM   2985 C  CA  . THR B 1 155 ? 2.543   0.333   -40.709 1.00 20.34  ? 155 THR B CA  1 
ATOM   2986 C  C   . THR B 1 155 ? 1.162   -0.309  -40.864 1.00 19.41  ? 155 THR B C   1 
ATOM   2987 O  O   . THR B 1 155 ? 0.347   0.027   -41.721 1.00 19.86  ? 155 THR B O   1 
ATOM   2988 C  CB  . THR B 1 155 ? 2.432   1.851   -40.959 1.00 22.19  ? 155 THR B CB  1 
ATOM   2989 O  OG1 . THR B 1 155 ? 3.736   2.414   -41.025 1.00 32.32  ? 155 THR B OG1 1 
ATOM   2990 C  CG2 . THR B 1 155 ? 1.709   2.497   -39.783 1.00 25.76  ? 155 THR B CG2 1 
ATOM   2991 N  N   . PRO B 1 156 ? 0.934   -1.308  -40.022 1.00 17.52  ? 156 PRO B N   1 
ATOM   2992 C  CA  . PRO B 1 156 ? -0.372  -1.975  -40.069 1.00 17.32  ? 156 PRO B CA  1 
ATOM   2993 C  C   . PRO B 1 156 ? -1.543  -1.024  -39.915 1.00 15.03  ? 156 PRO B C   1 
ATOM   2994 O  O   . PRO B 1 156 ? -1.464  0.065   -39.340 1.00 17.27  ? 156 PRO B O   1 
ATOM   2995 C  CB  . PRO B 1 156 ? -0.279  -2.937  -38.880 1.00 17.02  ? 156 PRO B CB  1 
ATOM   2996 C  CG  . PRO B 1 156 ? 1.183   -3.208  -38.673 1.00 18.53  ? 156 PRO B CG  1 
ATOM   2997 C  CD  . PRO B 1 156 ? 1.831   -1.875  -39.001 1.00 17.90  ? 156 PRO B CD  1 
ATOM   2998 N  N   . SER B 1 157 ? -2.710  -1.437  -40.427 1.00 13.77  ? 157 SER B N   1 
ATOM   2999 C  CA  . SER B 1 157 ? -3.936  -0.655  -40.297 1.00 13.97  ? 157 SER B CA  1 
ATOM   3000 C  C   . SER B 1 157 ? -4.397  -0.589  -38.845 1.00 13.03  ? 157 SER B C   1 
ATOM   3001 O  O   . SER B 1 157 ? -5.014  0.409   -38.406 1.00 16.22  ? 157 SER B O   1 
ATOM   3002 C  CB  . SER B 1 157 ? -5.091  -1.196  -41.141 1.00 16.88  ? 157 SER B CB  1 
ATOM   3003 O  OG  . SER B 1 157 ? -5.335  -2.567  -40.810 1.00 16.86  ? 157 SER B OG  1 
ATOM   3004 N  N   . TRP B 1 158 ? -4.105  -1.661  -38.091 1.00 11.80  ? 158 TRP B N   1 
ATOM   3005 C  CA  . TRP B 1 158 ? -4.587  -1.800  -36.739 1.00 11.01  ? 158 TRP B CA  1 
ATOM   3006 C  C   . TRP B 1 158 ? -3.606  -1.204  -35.736 1.00 11.09  ? 158 TRP B C   1 
ATOM   3007 O  O   . TRP B 1 158 ? -2.384  -1.127  -35.990 1.00 13.18  ? 158 TRP B O   1 
ATOM   3008 C  CB  . TRP B 1 158 ? -4.810  -3.287  -36.390 1.00 10.85  ? 158 TRP B CB  1 
ATOM   3009 C  CG  . TRP B 1 158 ? -3.899  -4.296  -36.979 1.00 10.03  ? 158 TRP B CG  1 
ATOM   3010 C  CD1 . TRP B 1 158 ? -4.244  -5.125  -38.054 1.00 10.08  ? 158 TRP B CD1 1 
ATOM   3011 C  CD2 . TRP B 1 158 ? -2.565  -4.658  -36.599 1.00 10.10  ? 158 TRP B CD2 1 
ATOM   3012 N  NE1 . TRP B 1 158 ? -3.188  -5.926  -38.322 1.00 10.29  ? 158 TRP B NE1 1 
ATOM   3013 C  CE2 . TRP B 1 158 ? -2.142  -5.675  -37.454 1.00 10.29  ? 158 TRP B CE2 1 
ATOM   3014 C  CE3 . TRP B 1 158 ? -1.697  -4.187  -35.599 1.00 10.72  ? 158 TRP B CE3 1 
ATOM   3015 C  CZ2 . TRP B 1 158 ? -0.872  -6.266  -37.355 1.00 10.21  ? 158 TRP B CZ2 1 
ATOM   3016 C  CZ3 . TRP B 1 158 ? -0.442  -4.756  -35.509 1.00 10.95  ? 158 TRP B CZ3 1 
ATOM   3017 C  CH2 . TRP B 1 158 ? -0.010  -5.783  -36.378 1.00 10.36  ? 158 TRP B CH2 1 
ATOM   3018 N  N   . GLU B 1 159 ? -4.151  -0.843  -34.593 1.00 11.47  ? 159 GLU B N   1 
ATOM   3019 C  CA  . GLU B 1 159 ? -3.365  -0.600  -33.387 1.00 11.78  ? 159 GLU B CA  1 
ATOM   3020 C  C   . GLU B 1 159 ? -3.219  -1.905  -32.624 1.00 11.11  ? 159 GLU B C   1 
ATOM   3021 O  O   . GLU B 1 159 ? -4.229  -2.578  -32.341 1.00 10.66  ? 159 GLU B O   1 
ATOM   3022 C  CB  . GLU B 1 159 ? -4.024  0.453   -32.505 1.00 12.62  ? 159 GLU B CB  1 
ATOM   3023 C  CG  . GLU B 1 159 ? -3.264  0.637   -31.207 1.00 13.96  ? 159 GLU B CG  1 
ATOM   3024 C  CD  . GLU B 1 159 ? -3.879  1.613   -30.211 1.00 16.66  ? 159 GLU B CD  1 
ATOM   3025 O  OE1 . GLU B 1 159 ? -4.969  2.143   -30.502 1.00 16.51  ? 159 GLU B OE1 1 
ATOM   3026 O  OE2 . GLU B 1 159 ? -3.257  1.848   -29.139 1.00 17.87  ? 159 GLU B OE2 1 
ATOM   3027 N  N   . HIS B 1 160 ? -1.972  -2.264  -32.297 1.00 10.41  ? 160 HIS B N   1 
ATOM   3028 C  CA  . HIS B 1 160 ? -1.698  -3.453  -31.467 1.00 10.32  ? 160 HIS B CA  1 
ATOM   3029 C  C   . HIS B 1 160 ? -1.906  -3.113  -30.013 1.00 9.87   ? 160 HIS B C   1 
ATOM   3030 O  O   . HIS B 1 160 ? -1.245  -2.241  -29.473 1.00 11.77  ? 160 HIS B O   1 
ATOM   3031 C  CB  . HIS B 1 160 ? -0.280  -3.940  -31.707 1.00 10.47  ? 160 HIS B CB  1 
ATOM   3032 C  CG  . HIS B 1 160 ? 0.118   -5.083  -30.877 1.00 10.26  ? 160 HIS B CG  1 
ATOM   3033 N  ND1 . HIS B 1 160 ? 1.438   -5.300  -30.609 1.00 12.34  ? 160 HIS B ND1 1 
ATOM   3034 C  CD2 . HIS B 1 160 ? -0.577  -6.088  -30.261 1.00 10.25  ? 160 HIS B CD2 1 
ATOM   3035 C  CE1 . HIS B 1 160 ? 1.563   -6.394  -29.863 1.00 12.58  ? 160 HIS B CE1 1 
ATOM   3036 N  NE2 . HIS B 1 160 ? 0.368   -6.871  -29.639 1.00 10.52  ? 160 HIS B NE2 1 
ATOM   3037 N  N   . ILE B 1 161 ? -2.812  -3.835  -29.385 1.00 9.51   ? 161 ILE B N   1 
ATOM   3038 C  CA  . ILE B 1 161 ? -3.055  -3.838  -27.971 1.00 10.31  ? 161 ILE B CA  1 
ATOM   3039 C  C   . ILE B 1 161 ? -2.354  -5.072  -27.402 1.00 9.81   ? 161 ILE B C   1 
ATOM   3040 O  O   . ILE B 1 161 ? -2.724  -6.181  -27.745 1.00 9.91   ? 161 ILE B O   1 
ATOM   3041 C  CB  . ILE B 1 161 ? -4.561  -3.833  -27.649 1.00 10.29  ? 161 ILE B CB  1 
ATOM   3042 C  CG1 . ILE B 1 161 ? -5.353  -2.769  -28.385 1.00 11.11  ? 161 ILE B CG1 1 
ATOM   3043 C  CG2 . ILE B 1 161 ? -4.814  -3.764  -26.140 1.00 11.69  ? 161 ILE B CG2 1 
ATOM   3044 C  CD1 . ILE B 1 161 ? -4.913  -1.342  -28.063 1.00 11.83  ? 161 ILE B CD1 1 
ATOM   3045 N  N   . LEU B 1 162 ? -1.375  -4.872  -26.558 1.00 10.15  ? 162 LEU B N   1 
ATOM   3046 C  CA  . LEU B 1 162 ? -0.624  -5.999  -26.006 1.00 10.22  ? 162 LEU B CA  1 
ATOM   3047 C  C   . LEU B 1 162 ? -1.438  -6.649  -24.909 1.00 9.99   ? 162 LEU B C   1 
ATOM   3048 O  O   . LEU B 1 162 ? -1.679  -6.047  -23.851 1.00 11.41  ? 162 LEU B O   1 
ATOM   3049 C  CB  . LEU B 1 162 ? 0.717   -5.536  -25.441 1.00 10.64  ? 162 LEU B CB  1 
ATOM   3050 C  CG  . LEU B 1 162 ? 1.640   -6.631  -24.919 1.00 11.93  ? 162 LEU B CG  1 
ATOM   3051 C  CD1 . LEU B 1 162 ? 2.072   -7.572  -26.056 1.00 11.71  ? 162 LEU B CD1 1 
ATOM   3052 C  CD2 . LEU B 1 162 ? 2.880   -6.032  -24.287 1.00 16.57  ? 162 LEU B CD2 1 
ATOM   3053 N  N   . PHE B 1 163 ? -1.838  -7.904  -25.140 1.00 9.45   ? 163 PHE B N   1 
ATOM   3054 C  CA  . PHE B 1 163 ? -2.559  -8.658  -24.120 1.00 9.27   ? 163 PHE B CA  1 
ATOM   3055 C  C   . PHE B 1 163 ? -1.555  -9.264  -23.161 1.00 9.41   ? 163 PHE B C   1 
ATOM   3056 O  O   . PHE B 1 163 ? -0.630  -9.976  -23.572 1.00 10.56  ? 163 PHE B O   1 
ATOM   3057 C  CB  . PHE B 1 163 ? -3.350  -9.774  -24.794 1.00 9.49   ? 163 PHE B CB  1 
ATOM   3058 C  CG  . PHE B 1 163 ? -4.382  -10.394 -23.860 1.00 10.00  ? 163 PHE B CG  1 
ATOM   3059 C  CD1 . PHE B 1 163 ? -5.657  -9.876  -23.688 1.00 11.53  ? 163 PHE B CD1 1 
ATOM   3060 C  CD2 . PHE B 1 163 ? -4.007  -11.506 -23.120 1.00 9.97   ? 163 PHE B CD2 1 
ATOM   3061 C  CE1 . PHE B 1 163 ? -6.527  -10.390 -22.769 1.00 12.17  ? 163 PHE B CE1 1 
ATOM   3062 C  CE2 . PHE B 1 163 ? -4.902  -12.048 -22.205 1.00 11.42  ? 163 PHE B CE2 1 
ATOM   3063 C  CZ  . PHE B 1 163 ? -6.159  -11.495 -22.034 1.00 11.69  ? 163 PHE B CZ  1 
ATOM   3064 N  N   . THR B 1 164 ? -1.718  -8.978  -21.871 1.00 10.71  ? 164 THR B N   1 
ATOM   3065 C  CA  . THR B 1 164 ? -0.719  -9.427  -20.910 1.00 12.67  ? 164 THR B CA  1 
ATOM   3066 C  C   . THR B 1 164 ? -0.733  -10.932 -20.762 1.00 11.57  ? 164 THR B C   1 
ATOM   3067 O  O   . THR B 1 164 ? -1.789  -11.583 -20.686 1.00 15.01  ? 164 THR B O   1 
ATOM   3068 C  CB  . THR B 1 164 ? -0.993  -8.755  -19.554 1.00 14.05  ? 164 THR B CB  1 
ATOM   3069 O  OG1 . THR B 1 164 ? -0.838  -7.343  -19.731 1.00 14.07  ? 164 THR B OG1 1 
ATOM   3070 C  CG2 . THR B 1 164 ? -0.058  -9.257  -18.448 1.00 14.35  ? 164 THR B CG2 1 
ATOM   3071 N  N   . CYS B 1 165 ? 0.452   -11.512 -20.736 1.00 13.55  ? 165 CYS B N   1 
ATOM   3072 C  CA  . CYS B 1 165 ? 0.680   -12.951 -20.555 1.00 14.50  ? 165 CYS B CA  1 
ATOM   3073 C  C   . CYS B 1 165 ? 1.924   -13.079 -19.713 1.00 16.03  ? 165 CYS B C   1 
ATOM   3074 O  O   . CYS B 1 165 ? 2.737   -12.121 -19.655 1.00 15.89  ? 165 CYS B O   1 
ATOM   3075 C  CB  . CYS B 1 165 ? 0.907   -13.620 -21.903 1.00 16.14  ? 165 CYS B CB  1 
ATOM   3076 S  SG  . CYS B 1 165 ? 0.834   -15.410 -22.076 1.00 18.73  ? 165 CYS B SG  1 
ATOM   3077 N  N   . CYS B 1 166 ? 2.169   -14.261 -19.129 1.00 17.62  ? 166 CYS B N   1 
ATOM   3078 C  CA  . CYS B 1 166 ? 3.344   -14.472 -18.289 1.00 15.98  ? 166 CYS B CA  1 
ATOM   3079 C  C   . CYS B 1 166 ? 4.651   -13.990 -18.922 1.00 15.52  ? 166 CYS B C   1 
ATOM   3080 O  O   . CYS B 1 166 ? 5.531   -13.366 -18.314 1.00 17.17  ? 166 CYS B O   1 
ATOM   3081 C  CB  . CYS B 1 166 ? 3.516   -15.940 -17.873 1.00 19.86  ? 166 CYS B CB  1 
ATOM   3082 S  SG  . CYS B 1 166 ? 3.587   -17.160 -19.221 1.00 21.98  ? 166 CYS B SG  1 
ATOM   3083 N  N   . HIS B 1 167 ? 4.794   -14.240 -20.214 1.00 14.77  ? 167 HIS B N   1 
ATOM   3084 C  CA  . HIS B 1 167 ? 6.075   -14.003 -20.878 1.00 14.27  ? 167 HIS B CA  1 
ATOM   3085 C  C   . HIS B 1 167 ? 6.315   -12.552 -21.253 1.00 13.54  ? 167 HIS B C   1 
ATOM   3086 O  O   . HIS B 1 167 ? 7.456   -12.161 -21.553 1.00 14.91  ? 167 HIS B O   1 
ATOM   3087 C  CB  . HIS B 1 167 ? 6.082   -14.881 -22.109 1.00 15.72  ? 167 HIS B CB  1 
ATOM   3088 C  CG  . HIS B 1 167 ? 5.070   -14.536 -23.153 1.00 15.25  ? 167 HIS B CG  1 
ATOM   3089 N  ND1 . HIS B 1 167 ? 5.136   -13.417 -23.930 1.00 14.01  ? 167 HIS B ND1 1 
ATOM   3090 C  CD2 . HIS B 1 167 ? 3.964   -15.212 -23.554 1.00 16.23  ? 167 HIS B CD2 1 
ATOM   3091 C  CE1 . HIS B 1 167 ? 4.118   -13.391 -24.735 1.00 15.21  ? 167 HIS B CE1 1 
ATOM   3092 N  NE2 . HIS B 1 167 ? 3.373   -14.465 -24.546 1.00 15.92  ? 167 HIS B NE2 1 
ATOM   3093 N  N   . ASN B 1 168 ? 5.285   -11.705 -21.225 1.00 12.43  ? 168 ASN B N   1 
ATOM   3094 C  CA  . ASN B 1 168 ? 5.427   -10.292 -21.565 1.00 13.01  ? 168 ASN B CA  1 
ATOM   3095 C  C   . ASN B 1 168 ? 5.169   -9.309  -20.404 1.00 14.04  ? 168 ASN B C   1 
ATOM   3096 O  O   . ASN B 1 168 ? 5.246   -8.090  -20.558 1.00 15.14  ? 168 ASN B O   1 
ATOM   3097 C  CB  . ASN B 1 168 ? 4.555   -9.882  -22.762 1.00 12.72  ? 168 ASN B CB  1 
ATOM   3098 C  CG  . ASN B 1 168 ? 3.083   -9.896  -22.509 1.00 10.83  ? 168 ASN B CG  1 
ATOM   3099 O  OD1 . ASN B 1 168 ? 2.615   -9.519  -21.451 1.00 11.60  ? 168 ASN B OD1 1 
ATOM   3100 N  ND2 . ASN B 1 168 ? 2.276   -10.330 -23.494 1.00 11.07  ? 168 ASN B ND2 1 
ATOM   3101 N  N   . ARG B 1 169 ? 4.792   -9.789  -19.260 1.00 15.10  ? 169 ARG B N   1 
ATOM   3102 C  CA  . ARG B 1 169 ? 4.364   -8.965  -18.136 1.00 19.69  ? 169 ARG B CA  1 
ATOM   3103 C  C   . ARG B 1 169 ? 5.468   -8.016  -17.706 1.00 18.23  ? 169 ARG B C   1 
ATOM   3104 O  O   . ARG B 1 169 ? 5.178   -6.865  -17.338 1.00 25.57  ? 169 ARG B O   1 
ATOM   3105 C  CB  . ARG B 1 169 ? 3.954   -9.844  -16.960 1.00 19.99  ? 169 ARG B CB  1 
ATOM   3106 C  CG  . ARG B 1 169 ? 3.040   -9.184  -15.955 1.00 36.06  ? 169 ARG B CG  1 
ATOM   3107 C  CD  . ARG B 1 169 ? 2.904   -10.114 -14.739 1.00 43.42  ? 169 ARG B CD  1 
ATOM   3108 N  NE  . ARG B 1 169 ? 2.598   -11.509 -15.071 1.00 48.33  ? 169 ARG B NE  1 
ATOM   3109 C  CZ  . ARG B 1 169 ? 1.413   -11.945 -15.501 1.00 53.60  ? 169 ARG B CZ  1 
ATOM   3110 N  NH1 . ARG B 1 169 ? 0.410   -11.081 -15.672 1.00 67.59  ? 169 ARG B NH1 1 
ATOM   3111 N  NH2 . ARG B 1 169 ? 1.218   -13.231 -15.772 1.00 60.00  ? 169 ARG B NH2 1 
ATOM   3112 N  N   A HIS B 1 170 ? 6.697   -8.490  -17.801 0.44 17.29  ? 170 HIS B N   1 
ATOM   3113 N  N   B HIS B 1 170 ? 6.692   -8.507  -17.742 0.56 17.84  ? 170 HIS B N   1 
ATOM   3114 C  CA  A HIS B 1 170 ? 8.008   -7.943  -17.507 0.44 20.79  ? 170 HIS B CA  1 
ATOM   3115 C  CA  B HIS B 1 170 ? 7.733   -7.600  -17.231 0.56 16.89  ? 170 HIS B CA  1 
ATOM   3116 C  C   A HIS B 1 170 ? 8.457   -6.821  -18.433 0.44 24.21  ? 170 HIS B C   1 
ATOM   3117 C  C   B HIS B 1 170 ? 8.097   -6.544  -18.265 0.56 19.65  ? 170 HIS B C   1 
ATOM   3118 O  O   A HIS B 1 170 ? 9.409   -6.080  -18.191 0.44 18.61  ? 170 HIS B O   1 
ATOM   3119 O  O   B HIS B 1 170 ? 8.664   -5.526  -17.838 0.56 30.34  ? 170 HIS B O   1 
ATOM   3120 C  CB  A HIS B 1 170 ? 9.086   -9.041  -17.589 0.44 27.43  ? 170 HIS B CB  1 
ATOM   3121 C  CB  B HIS B 1 170 ? 8.887   -8.483  -16.717 0.56 18.21  ? 170 HIS B CB  1 
ATOM   3122 C  CG  A HIS B 1 170 ? 9.718   -9.272  -18.926 0.44 27.10  ? 170 HIS B CG  1 
ATOM   3123 C  CG  B HIS B 1 170 ? 8.430   -9.199  -15.464 0.56 21.10  ? 170 HIS B CG  1 
ATOM   3124 N  ND1 A HIS B 1 170 ? 9.089   -9.804  -20.029 0.44 26.41  ? 170 HIS B ND1 1 
ATOM   3125 N  ND1 B HIS B 1 170 ? 7.785   -10.412 -15.426 0.56 21.00  ? 170 HIS B ND1 1 
ATOM   3126 C  CD2 A HIS B 1 170 ? 10.996  -9.025  -19.332 0.44 28.03  ? 170 HIS B CD2 1 
ATOM   3127 C  CD2 B HIS B 1 170 ? 8.528   -8.833  -14.167 0.56 28.18  ? 170 HIS B CD2 1 
ATOM   3128 C  CE1 A HIS B 1 170 ? 9.923   -9.885  -21.034 0.44 28.31  ? 170 HIS B CE1 1 
ATOM   3129 C  CE1 B HIS B 1 170 ? 7.509   -10.766 -14.189 0.56 25.57  ? 170 HIS B CE1 1 
ATOM   3130 N  NE2 A HIS B 1 170 ? 11.089  -9.412  -20.641 0.44 28.12  ? 170 HIS B NE2 1 
ATOM   3131 N  NE2 B HIS B 1 170 ? 7.959   -9.812  -13.397 0.56 30.36  ? 170 HIS B NE2 1 
ATOM   3132 N  N   . LEU B 1 171 ? 7.763   -6.688  -19.548 1.00 23.57  ? 171 LEU B N   1 
ATOM   3133 C  CA  . LEU B 1 171 ? 8.114   -5.767  -20.611 1.00 26.33  ? 171 LEU B CA  1 
ATOM   3134 C  C   . LEU B 1 171 ? 7.668   -4.354  -20.282 1.00 33.73  ? 171 LEU B C   1 
ATOM   3135 O  O   . LEU B 1 171 ? 6.519   -3.989  -20.002 1.00 31.39  ? 171 LEU B O   1 
ATOM   3136 C  CB  . LEU B 1 171 ? 7.466   -6.240  -21.915 1.00 31.05  ? 171 LEU B CB  1 
ATOM   3137 C  CG  . LEU B 1 171 ? 8.018   -5.794  -23.244 1.00 30.10  ? 171 LEU B CG  1 
ATOM   3138 C  CD1 . LEU B 1 171 ? 9.476   -6.183  -23.443 1.00 33.84  ? 171 LEU B CD1 1 
ATOM   3139 C  CD2 . LEU B 1 171 ? 7.125   -6.430  -24.315 1.00 32.26  ? 171 LEU B CD2 1 
ATOM   3140 N  N   . VAL B 1 172 ? 8.683   -3.476  -20.317 1.00 38.80  ? 172 VAL B N   1 
ATOM   3141 C  CA  . VAL B 1 172 ? 8.210   -2.115  -20.079 1.00 44.31  ? 172 VAL B CA  1 
ATOM   3142 C  C   . VAL B 1 172 ? 8.285   -1.413  -21.456 1.00 44.88  ? 172 VAL B C   1 
ATOM   3143 O  O   . VAL B 1 172 ? 9.338   -1.485  -22.100 1.00 60.75  ? 172 VAL B O   1 
ATOM   3144 C  CB  . VAL B 1 172 ? 8.901   -1.308  -18.979 1.00 54.41  ? 172 VAL B CB  1 
ATOM   3145 C  CG1 . VAL B 1 172 ? 8.120   -0.049  -18.599 1.00 52.55  ? 172 VAL B CG1 1 
ATOM   3146 C  CG2 . VAL B 1 172 ? 9.074   -2.197  -17.742 1.00 90.49  ? 172 VAL B CG2 1 
ATOM   3147 N  N   . LEU B 1 173 ? 7.188   -0.817  -21.846 1.00 43.74  ? 173 LEU B N   1 
ATOM   3148 C  CA  . LEU B 1 173 ? 6.722   -0.169  -23.023 1.00 43.77  ? 173 LEU B CA  1 
ATOM   3149 C  C   . LEU B 1 173 ? 6.571   1.336   -22.789 1.00 37.97  ? 173 LEU B C   1 
ATOM   3150 O  O   . LEU B 1 173 ? 6.314   1.864   -21.720 1.00 38.50  ? 173 LEU B O   1 
ATOM   3151 C  CB  . LEU B 1 173 ? 5.353   -0.685  -23.484 1.00 38.54  ? 173 LEU B CB  1 
ATOM   3152 C  CG  . LEU B 1 173 ? 4.180   -0.710  -22.520 1.00 43.11  ? 173 LEU B CG  1 
ATOM   3153 C  CD1 . LEU B 1 173 ? 3.375   0.587   -22.491 1.00 55.46  ? 173 LEU B CD1 1 
ATOM   3154 C  CD2 . LEU B 1 173 ? 3.243   -1.861  -22.862 1.00 49.31  ? 173 LEU B CD2 1 
ATOM   3155 N  N   . PRO B 1 174 ? 6.684   2.034   -23.899 1.00 40.15  ? 174 PRO B N   1 
ATOM   3156 C  CA  . PRO B 1 174 ? 6.440   3.486   -23.839 1.00 40.07  ? 174 PRO B CA  1 
ATOM   3157 C  C   . PRO B 1 174 ? 4.927   3.626   -23.783 1.00 38.29  ? 174 PRO B C   1 
ATOM   3158 O  O   . PRO B 1 174 ? 4.211   2.669   -24.154 1.00 31.72  ? 174 PRO B O   1 
ATOM   3159 C  CB  . PRO B 1 174 ? 7.026   3.972   -25.146 1.00 46.15  ? 174 PRO B CB  1 
ATOM   3160 C  CG  . PRO B 1 174 ? 6.886   2.812   -26.091 1.00 46.36  ? 174 PRO B CG  1 
ATOM   3161 C  CD  . PRO B 1 174 ? 7.004   1.556   -25.254 1.00 45.51  ? 174 PRO B CD  1 
ATOM   3162 N  N   . PRO B 1 175 ? 4.507   4.789   -23.325 1.00 39.47  ? 175 PRO B N   1 
ATOM   3163 C  CA  . PRO B 1 175 ? 3.082   5.103   -23.195 1.00 40.07  ? 175 PRO B CA  1 
ATOM   3164 C  C   . PRO B 1 175 ? 2.349   5.135   -24.528 1.00 38.75  ? 175 PRO B C   1 
ATOM   3165 O  O   . PRO B 1 175 ? 1.108   5.216   -24.544 1.00 59.82  ? 175 PRO B O   1 
ATOM   3166 C  CB  . PRO B 1 175 ? 3.089   6.506   -22.561 1.00 43.90  ? 175 PRO B CB  1 
ATOM   3167 C  CG  . PRO B 1 175 ? 4.413   7.061   -22.973 1.00 47.41  ? 175 PRO B CG  1 
ATOM   3168 C  CD  . PRO B 1 175 ? 5.368   5.894   -22.872 1.00 44.04  ? 175 PRO B CD  1 
ATOM   3169 N  N   . THR B 1 176 ? 3.074   5.072   -25.640 1.00 38.38  ? 176 THR B N   1 
ATOM   3170 C  CA  . THR B 1 176 ? 2.436   4.919   -26.953 1.00 32.80  ? 176 THR B CA  1 
ATOM   3171 C  C   . THR B 1 176 ? 1.828   3.536   -27.111 1.00 28.01  ? 176 THR B C   1 
ATOM   3172 O  O   . THR B 1 176 ? 0.823   3.323   -27.798 1.00 36.70  ? 176 THR B O   1 
ATOM   3173 C  CB  . THR B 1 176 ? 3.481   5.182   -28.054 1.00 41.14  ? 176 THR B CB  1 
ATOM   3174 O  OG1 . THR B 1 176 ? 3.840   6.575   -28.107 1.00 56.44  ? 176 THR B OG1 1 
ATOM   3175 C  CG2 . THR B 1 176 ? 2.884   4.821   -29.403 1.00 46.96  ? 176 THR B CG2 1 
ATOM   3176 N  N   . ARG B 1 177 ? 2.410   2.525   -26.456 1.00 24.67  ? 177 ARG B N   1 
ATOM   3177 C  CA  . ARG B 1 177 ? 1.847   1.159   -26.585 1.00 25.64  ? 177 ARG B CA  1 
ATOM   3178 C  C   . ARG B 1 177 ? 0.916   0.871   -25.438 1.00 23.73  ? 177 ARG B C   1 
ATOM   3179 O  O   . ARG B 1 177 ? 1.255   0.970   -24.270 1.00 29.50  ? 177 ARG B O   1 
ATOM   3180 C  CB  . ARG B 1 177 ? 2.970   0.134   -26.692 1.00 31.35  ? 177 ARG B CB  1 
ATOM   3181 C  CG  . ARG B 1 177 ? 3.866   0.457   -27.881 1.00 35.37  ? 177 ARG B CG  1 
ATOM   3182 C  CD  . ARG B 1 177 ? 4.071   -0.542  -28.982 1.00 31.50  ? 177 ARG B CD  1 
ATOM   3183 N  NE  . ARG B 1 177 ? 3.485   -1.849  -28.641 1.00 27.27  ? 177 ARG B NE  1 
ATOM   3184 C  CZ  . ARG B 1 177 ? 4.139   -2.987  -28.437 1.00 30.86  ? 177 ARG B CZ  1 
ATOM   3185 N  NH1 . ARG B 1 177 ? 3.365   -4.021  -28.144 1.00 24.34  ? 177 ARG B NH1 1 
ATOM   3186 N  NH2 . ARG B 1 177 ? 5.465   -3.138  -28.510 1.00 27.93  ? 177 ARG B NH2 1 
ATOM   3187 N  N   . ARG B 1 178 ? -0.297  0.498   -25.774 1.00 15.75  ? 178 ARG B N   1 
ATOM   3188 C  CA  . ARG B 1 178 ? -1.319  0.167   -24.827 1.00 14.91  ? 178 ARG B CA  1 
ATOM   3189 C  C   . ARG B 1 178 ? -1.320  -1.332  -24.579 1.00 13.26  ? 178 ARG B C   1 
ATOM   3190 O  O   . ARG B 1 178 ? -1.039  -2.175  -25.433 1.00 13.28  ? 178 ARG B O   1 
ATOM   3191 C  CB  . ARG B 1 178 ? -2.693  0.607   -25.334 1.00 16.83  ? 178 ARG B CB  1 
ATOM   3192 C  CG  . ARG B 1 178 ? -2.719  2.130   -25.500 1.00 20.43  ? 178 ARG B CG  1 
ATOM   3193 C  CD  . ARG B 1 178 ? -4.190  2.558   -25.446 1.00 21.13  ? 178 ARG B CD  1 
ATOM   3194 N  NE  . ARG B 1 178 ? -4.767  2.471   -26.804 1.00 17.01  ? 178 ARG B NE  1 
ATOM   3195 C  CZ  . ARG B 1 178 ? -6.043  2.799   -27.047 1.00 18.27  ? 178 ARG B CZ  1 
ATOM   3196 N  NH1 . ARG B 1 178 ? -6.838  3.190   -26.059 1.00 20.76  ? 178 ARG B NH1 1 
ATOM   3197 N  NH2 . ARG B 1 178 ? -6.504  2.730   -28.288 1.00 19.15  ? 178 ARG B NH2 1 
ATOM   3198 N  N   . ARG B 1 179 ? -1.665  -1.647  -23.349 1.00 14.24  ? 179 ARG B N   1 
ATOM   3199 C  CA  . ARG B 1 179 ? -1.760  -2.986  -22.810 1.00 12.95  ? 179 ARG B CA  1 
ATOM   3200 C  C   . ARG B 1 179 ? -3.155  -3.245  -22.279 1.00 14.98  ? 179 ARG B C   1 
ATOM   3201 O  O   . ARG B 1 179 ? -3.767  -2.385  -21.661 1.00 22.11  ? 179 ARG B O   1 
ATOM   3202 C  CB  . ARG B 1 179 ? -0.715  -3.124  -21.684 1.00 16.75  ? 179 ARG B CB  1 
ATOM   3203 C  CG  . ARG B 1 179 ? -0.585  -4.399  -20.893 1.00 17.04  ? 179 ARG B CG  1 
ATOM   3204 C  CD  . ARG B 1 179 ? 0.523   -4.372  -19.876 1.00 19.71  ? 179 ARG B CD  1 
ATOM   3205 N  NE  . ARG B 1 179 ? 1.927   -4.453  -20.187 1.00 20.59  ? 179 ARG B NE  1 
ATOM   3206 C  CZ  . ARG B 1 179 ? 2.623   -5.522  -20.523 1.00 17.24  ? 179 ARG B CZ  1 
ATOM   3207 N  NH1 . ARG B 1 179 ? 3.922   -5.396  -20.762 1.00 18.08  ? 179 ARG B NH1 1 
ATOM   3208 N  NH2 . ARG B 1 179 ? 2.080   -6.724  -20.666 1.00 18.25  ? 179 ARG B NH2 1 
ATOM   3209 N  N   . LEU B 1 180 ? -3.656  -4.461  -22.466 1.00 12.40  ? 180 LEU B N   1 
ATOM   3210 C  CA  . LEU B 1 180 ? -4.820  -4.990  -21.775 1.00 12.47  ? 180 LEU B CA  1 
ATOM   3211 C  C   . LEU B 1 180 ? -4.333  -5.976  -20.733 1.00 12.41  ? 180 LEU B C   1 
ATOM   3212 O  O   . LEU B 1 180 ? -3.619  -6.938  -21.050 1.00 12.99  ? 180 LEU B O   1 
ATOM   3213 C  CB  . LEU B 1 180 ? -5.769  -5.689  -22.727 1.00 14.56  ? 180 LEU B CB  1 
ATOM   3214 C  CG  . LEU B 1 180 ? -7.173  -6.012  -22.325 1.00 18.17  ? 180 LEU B CG  1 
ATOM   3215 C  CD1 . LEU B 1 180 ? -7.983  -4.800  -21.878 1.00 23.10  ? 180 LEU B CD1 1 
ATOM   3216 C  CD2 . LEU B 1 180 ? -7.873  -6.644  -23.543 1.00 24.79  ? 180 LEU B CD2 1 
ATOM   3217 N  N   . LEU B 1 181 ? -4.621  -5.792  -19.444 1.00 12.09  ? 181 LEU B N   1 
ATOM   3218 C  CA  . LEU B 1 181 ? -4.054  -6.627  -18.399 1.00 11.68  ? 181 LEU B CA  1 
ATOM   3219 C  C   . LEU B 1 181 ? -4.681  -8.010  -18.394 1.00 11.59  ? 181 LEU B C   1 
ATOM   3220 O  O   . LEU B 1 181 ? -4.059  -8.972  -17.945 1.00 12.60  ? 181 LEU B O   1 
ATOM   3221 C  CB  . LEU B 1 181 ? -4.172  -6.007  -16.969 1.00 13.11  ? 181 LEU B CB  1 
ATOM   3222 C  CG  . LEU B 1 181 ? -3.240  -4.813  -16.740 1.00 17.86  ? 181 LEU B CG  1 
ATOM   3223 C  CD1 . LEU B 1 181 ? -3.758  -3.965  -15.593 1.00 20.37  ? 181 LEU B CD1 1 
ATOM   3224 C  CD2 . LEU B 1 181 ? -1.780  -5.228  -16.486 1.00 17.88  ? 181 LEU B CD2 1 
ATOM   3225 N  N   . SER B 1 182 ? -5.895  -8.134  -18.844 1.00 10.78  ? 182 SER B N   1 
ATOM   3226 C  CA  . SER B 1 182 ? -6.724  -9.315  -18.801 1.00 10.34  ? 182 SER B CA  1 
ATOM   3227 C  C   . SER B 1 182 ? -8.046  -9.014  -19.481 1.00 10.60  ? 182 SER B C   1 
ATOM   3228 O  O   . SER B 1 182 ? -8.315  -7.833  -19.768 1.00 11.46  ? 182 SER B O   1 
ATOM   3229 C  CB  . SER B 1 182 ? -6.982  -9.800  -17.371 1.00 11.63  ? 182 SER B CB  1 
ATOM   3230 O  OG  . SER B 1 182 ? -7.858  -8.901  -16.698 1.00 12.67  ? 182 SER B OG  1 
ATOM   3231 N  N   . TRP B 1 183 ? -8.898  -10.019 -19.681 1.00 10.42  ? 183 TRP B N   1 
ATOM   3232 C  CA  . TRP B 1 183 ? -10.227 -9.747  -20.171 1.00 10.39  ? 183 TRP B CA  1 
ATOM   3233 C  C   . TRP B 1 183 ? -11.158 -9.098  -19.164 1.00 10.66  ? 183 TRP B C   1 
ATOM   3234 O  O   . TRP B 1 183 ? -12.211 -8.599  -19.548 1.00 12.61  ? 183 TRP B O   1 
ATOM   3235 C  CB  . TRP B 1 183 ? -10.853 -11.020 -20.727 1.00 11.26  ? 183 TRP B CB  1 
ATOM   3236 C  CG  . TRP B 1 183 ? -10.271 -11.395 -22.062 1.00 9.82   ? 183 TRP B CG  1 
ATOM   3237 C  CD1 . TRP B 1 183 ? -9.486  -12.455 -22.351 1.00 10.59  ? 183 TRP B CD1 1 
ATOM   3238 C  CD2 . TRP B 1 183 ? -10.448 -10.669 -23.269 1.00 9.93   ? 183 TRP B CD2 1 
ATOM   3239 N  NE1 . TRP B 1 183 ? -9.161  -12.454 -23.666 1.00 10.05  ? 183 TRP B NE1 1 
ATOM   3240 C  CE2 . TRP B 1 183 ? -9.738  -11.366 -24.268 1.00 10.14  ? 183 TRP B CE2 1 
ATOM   3241 C  CE3 . TRP B 1 183 ? -11.127 -9.503  -23.649 1.00 11.41  ? 183 TRP B CE3 1 
ATOM   3242 C  CZ2 . TRP B 1 183 ? -9.676  -10.975 -25.597 1.00 11.39  ? 183 TRP B CZ2 1 
ATOM   3243 C  CZ3 . TRP B 1 183 ? -11.069 -9.095  -24.968 1.00 12.11  ? 183 TRP B CZ3 1 
ATOM   3244 C  CH2 . TRP B 1 183 ? -10.357 -9.813  -25.912 1.00 11.91  ? 183 TRP B CH2 1 
ATOM   3245 N  N   . SER B 1 184 ? -10.866 -9.077  -17.907 1.00 12.21  ? 184 SER B N   1 
ATOM   3246 C  CA  A SER B 1 184 ? -11.561 -8.211  -16.928 0.50 13.67  ? 184 SER B CA  1 
ATOM   3247 C  CA  B SER B 1 184 ? -11.458 -8.234  -16.863 0.50 10.30  ? 184 SER B CA  1 
ATOM   3248 C  C   . SER B 1 184 ? -11.039 -6.765  -16.863 1.00 12.31  ? 184 SER B C   1 
ATOM   3249 O  O   . SER B 1 184 ? -11.643 -5.939  -16.155 1.00 13.24  ? 184 SER B O   1 
ATOM   3250 C  CB  A SER B 1 184 ? -11.598 -8.776  -15.512 0.50 14.64  ? 184 SER B CB  1 
ATOM   3251 C  CB  B SER B 1 184 ? -11.180 -8.860  -15.495 0.50 11.11  ? 184 SER B CB  1 
ATOM   3252 O  OG  A SER B 1 184 ? -10.309 -9.063  -15.009 0.50 32.25  ? 184 SER B OG  1 
ATOM   3253 O  OG  B SER B 1 184 ? -11.919 -10.087 -15.449 0.50 13.88  ? 184 SER B OG  1 
ATOM   3254 N  N   . ASP B 1 185 ? -10.014 -6.393  -17.619 1.00 11.44  ? 185 ASP B N   1 
ATOM   3255 C  CA  . ASP B 1 185 ? -9.595  -5.016  -17.826 1.00 11.62  ? 185 ASP B CA  1 
ATOM   3256 C  C   . ASP B 1 185 ? -10.583 -4.371  -18.785 1.00 11.95  ? 185 ASP B C   1 
ATOM   3257 O  O   . ASP B 1 185 ? -11.463 -5.053  -19.345 1.00 13.02  ? 185 ASP B O   1 
ATOM   3258 C  CB  . ASP B 1 185 ? -8.122  -4.963  -18.243 1.00 11.45  ? 185 ASP B CB  1 
ATOM   3259 C  CG  . ASP B 1 185 ? -7.428  -3.618  -18.165 1.00 12.34  ? 185 ASP B CG  1 
ATOM   3260 O  OD1 . ASP B 1 185 ? -7.998  -2.643  -17.622 1.00 13.36  ? 185 ASP B OD1 1 
ATOM   3261 O  OD2 . ASP B 1 185 ? -6.265  -3.607  -18.619 1.00 15.02  ? 185 ASP B OD2 1 
ATOM   3262 N  N   . ASN B 1 186 ? -10.465 -3.066  -19.013 1.00 12.53  ? 186 ASN B N   1 
ATOM   3263 C  CA  . ASN B 1 186 ? -11.470 -2.294  -19.725 1.00 14.46  ? 186 ASN B CA  1 
ATOM   3264 C  C   . ASN B 1 186 ? -11.263 -2.293  -21.242 1.00 13.97  ? 186 ASN B C   1 
ATOM   3265 O  O   . ASN B 1 186 ? -10.830 -1.338  -21.845 1.00 17.79  ? 186 ASN B O   1 
ATOM   3266 C  CB  . ASN B 1 186 ? -11.415 -0.901  -19.063 1.00 23.83  ? 186 ASN B CB  1 
ATOM   3267 C  CG  . ASN B 1 186 ? -12.397 -0.942  -17.897 1.00 33.77  ? 186 ASN B CG  1 
ATOM   3268 O  OD1 . ASN B 1 186 ? -12.857 -1.992  -17.433 1.00 47.58  ? 186 ASN B OD1 1 
ATOM   3269 N  ND2 . ASN B 1 186 ? -12.723 0.276   -17.484 1.00 59.76  ? 186 ASN B ND2 1 
ATOM   3270 N  N   . TRP B 1 187 ? -11.566 -3.408  -21.830 1.00 13.36  ? 187 TRP B N   1 
ATOM   3271 C  CA  . TRP B 1 187 ? -11.468 -3.604  -23.284 1.00 13.25  ? 187 TRP B CA  1 
ATOM   3272 C  C   . TRP B 1 187 ? -12.533 -2.793  -24.000 1.00 12.80  ? 187 TRP B C   1 
ATOM   3273 O  O   . TRP B 1 187 ? -12.335 -2.331  -25.148 1.00 14.14  ? 187 TRP B O   1 
ATOM   3274 C  CB  . TRP B 1 187 ? -11.530 -5.055  -23.704 1.00 13.72  ? 187 TRP B CB  1 
ATOM   3275 C  CG  . TRP B 1 187 ? -12.719 -5.852  -23.304 1.00 14.02  ? 187 TRP B CG  1 
ATOM   3276 C  CD1 . TRP B 1 187 ? -12.849 -6.619  -22.189 1.00 14.11  ? 187 TRP B CD1 1 
ATOM   3277 C  CD2 . TRP B 1 187 ? -13.957 -5.973  -24.018 1.00 14.34  ? 187 TRP B CD2 1 
ATOM   3278 N  NE1 . TRP B 1 187 ? -14.107 -7.207  -22.171 1.00 15.07  ? 187 TRP B NE1 1 
ATOM   3279 C  CE2 . TRP B 1 187 ? -14.806 -6.822  -23.291 1.00 13.80  ? 187 TRP B CE2 1 
ATOM   3280 C  CE3 . TRP B 1 187 ? -14.425 -5.431  -25.223 1.00 14.78  ? 187 TRP B CE3 1 
ATOM   3281 C  CZ2 . TRP B 1 187 ? -16.096 -7.160  -23.696 1.00 16.55  ? 187 TRP B CZ2 1 
ATOM   3282 C  CZ3 . TRP B 1 187 ? -15.709 -5.760  -25.638 1.00 17.36  ? 187 TRP B CZ3 1 
ATOM   3283 C  CH2 . TRP B 1 187 ? -16.542 -6.611  -24.891 1.00 16.55  ? 187 TRP B CH2 1 
ATOM   3284 N  N   . ARG B 1 188 ? -13.685 -2.540  -23.397 1.00 12.95  ? 188 ARG B N   1 
ATOM   3285 C  CA  . ARG B 1 188 ? -14.707 -1.779  -24.119 1.00 15.34  ? 188 ARG B CA  1 
ATOM   3286 C  C   . ARG B 1 188 ? -14.276 -0.359  -24.386 1.00 15.37  ? 188 ARG B C   1 
ATOM   3287 O  O   . ARG B 1 188 ? -14.549 0.216   -25.430 1.00 15.94  ? 188 ARG B O   1 
ATOM   3288 C  CB  . ARG B 1 188 ? -15.997 -1.778  -23.317 1.00 16.87  ? 188 ARG B CB  1 
ATOM   3289 C  CG  . ARG B 1 188 ? -16.791 -3.058  -23.360 1.00 17.67  ? 188 ARG B CG  1 
ATOM   3290 C  CD  . ARG B 1 188 ? -17.964 -2.974  -22.398 1.00 19.88  ? 188 ARG B CD  1 
ATOM   3291 N  NE  . ARG B 1 188 ? -18.781 -4.183  -22.462 1.00 24.28  ? 188 ARG B NE  1 
ATOM   3292 C  CZ  . ARG B 1 188 ? -18.528 -5.379  -21.944 1.00 25.74  ? 188 ARG B CZ  1 
ATOM   3293 N  NH1 . ARG B 1 188 ? -17.427 -5.669  -21.268 1.00 45.20  ? 188 ARG B NH1 1 
ATOM   3294 N  NH2 . ARG B 1 188 ? -19.402 -6.395  -22.090 1.00 28.89  ? 188 ARG B NH2 1 
ATOM   3295 N  N   . GLU B 1 189 ? -13.614 0.243   -23.406 1.00 17.50  ? 189 GLU B N   1 
ATOM   3296 C  CA  . GLU B 1 189 ? -13.091 1.596   -23.637 1.00 16.82  ? 189 GLU B CA  1 
ATOM   3297 C  C   . GLU B 1 189 ? -12.085 1.656   -24.771 1.00 16.74  ? 189 GLU B C   1 
ATOM   3298 O  O   . GLU B 1 189 ? -12.016 2.653   -25.517 1.00 17.84  ? 189 GLU B O   1 
ATOM   3299 C  CB  . GLU B 1 189 ? -12.444 2.081   -22.321 1.00 22.87  ? 189 GLU B CB  1 
ATOM   3300 C  CG  . GLU B 1 189 ? -12.238 3.587   -22.358 1.00 36.50  ? 189 GLU B CG  1 
ATOM   3301 C  CD  . GLU B 1 189 ? -10.835 4.080   -22.074 1.00 56.44  ? 189 GLU B CD  1 
ATOM   3302 O  OE1 . GLU B 1 189 ? -10.166 3.528   -21.162 1.00 76.44  ? 189 GLU B OE1 1 
ATOM   3303 O  OE2 . GLU B 1 189 ? -10.402 5.046   -22.772 1.00 82.44  ? 189 GLU B OE2 1 
ATOM   3304 N  N   . ILE B 1 190 ? -11.238 0.631   -24.872 1.00 15.15  ? 190 ILE B N   1 
ATOM   3305 C  CA  . ILE B 1 190 ? -10.300 0.607   -25.992 1.00 15.56  ? 190 ILE B CA  1 
ATOM   3306 C  C   . ILE B 1 190 ? -11.020 0.537   -27.330 1.00 14.27  ? 190 ILE B C   1 
ATOM   3307 O  O   . ILE B 1 190 ? -10.666 1.284   -28.253 1.00 14.76  ? 190 ILE B O   1 
ATOM   3308 C  CB  . ILE B 1 190 ? -9.288  -0.547  -25.814 1.00 15.10  ? 190 ILE B CB  1 
ATOM   3309 C  CG1 . ILE B 1 190 ? -8.477  -0.364  -24.530 1.00 17.21  ? 190 ILE B CG1 1 
ATOM   3310 C  CG2 . ILE B 1 190 ? -8.438  -0.730  -27.067 1.00 16.20  ? 190 ILE B CG2 1 
ATOM   3311 C  CD1 . ILE B 1 190 ? -7.463  -1.469  -24.284 1.00 20.51  ? 190 ILE B CD1 1 
ATOM   3312 N  N   . LEU B 1 191 ? -12.044 -0.317  -27.439 1.00 13.82  ? 191 LEU B N   1 
ATOM   3313 C  CA  . LEU B 1 191 ? -12.883 -0.334  -28.644 1.00 13.54  ? 191 LEU B CA  1 
ATOM   3314 C  C   . LEU B 1 191 ? -13.511 1.040   -28.885 1.00 15.57  ? 191 LEU B C   1 
ATOM   3315 O  O   . LEU B 1 191 ? -13.509 1.523   -30.025 1.00 16.21  ? 191 LEU B O   1 
ATOM   3316 C  CB  . LEU B 1 191 ? -13.921 -1.431  -28.551 1.00 13.80  ? 191 LEU B CB  1 
ATOM   3317 C  CG  . LEU B 1 191 ? -13.507 -2.781  -29.121 1.00 12.91  ? 191 LEU B CG  1 
ATOM   3318 C  CD1 . LEU B 1 191 ? -12.366 -3.378  -28.313 1.00 13.71  ? 191 LEU B CD1 1 
ATOM   3319 C  CD2 . LEU B 1 191 ? -14.731 -3.686  -29.152 1.00 14.62  ? 191 LEU B CD2 1 
ATOM   3320 N  N   . ASP B 1 192 ? -13.996 1.657   -27.840 1.00 15.14  ? 192 ASP B N   1 
ATOM   3321 C  CA  . ASP B 1 192 ? -14.677 2.949   -27.995 1.00 15.22  ? 192 ASP B CA  1 
ATOM   3322 C  C   . ASP B 1 192 ? -13.724 4.002   -28.524 1.00 16.56  ? 192 ASP B C   1 
ATOM   3323 O  O   . ASP B 1 192 ? -14.115 4.945   -29.223 1.00 19.26  ? 192 ASP B O   1 
ATOM   3324 C  CB  . ASP B 1 192 ? -15.334 3.386   -26.687 1.00 17.94  ? 192 ASP B CB  1 
ATOM   3325 C  CG  . ASP B 1 192 ? -16.554 2.540   -26.356 1.00 17.93  ? 192 ASP B CG  1 
ATOM   3326 O  OD1 . ASP B 1 192 ? -17.068 1.847   -27.239 1.00 20.92  ? 192 ASP B OD1 1 
ATOM   3327 O  OD2 . ASP B 1 192 ? -16.956 2.577   -25.164 1.00 20.91  ? 192 ASP B OD2 1 
ATOM   3328 N  N   . SER B 1 193 ? -12.437 3.838   -28.211 1.00 17.45  ? 193 SER B N   1 
ATOM   3329 C  CA  . SER B 1 193 ? -11.471 4.850   -28.627 1.00 17.88  ? 193 SER B CA  1 
ATOM   3330 C  C   . SER B 1 193 ? -11.309 4.844   -30.126 1.00 18.23  ? 193 SER B C   1 
ATOM   3331 O  O   . SER B 1 193 ? -10.739 5.786   -30.666 1.00 23.38  ? 193 SER B O   1 
ATOM   3332 C  CB  . SER B 1 193 ? -10.192 4.599   -27.877 1.00 21.04  ? 193 SER B CB  1 
ATOM   3333 O  OG  . SER B 1 193 ? -9.435  3.505   -28.424 1.00 26.11  ? 193 SER B OG  1 
ATOM   3334 N  N   . LYS B 1 194 ? -11.796 3.831   -30.815 1.00 17.37  ? 194 LYS B N   1 
ATOM   3335 C  CA  . LYS B 1 194 ? -11.735 3.762   -32.273 1.00 19.95  ? 194 LYS B CA  1 
ATOM   3336 C  C   . LYS B 1 194 ? -13.057 4.074   -32.942 1.00 21.20  ? 194 LYS B C   1 
ATOM   3337 O  O   . LYS B 1 194 ? -13.117 4.059   -34.179 1.00 26.40  ? 194 LYS B O   1 
ATOM   3338 C  CB  . LYS B 1 194 ? -11.296 2.355   -32.665 1.00 19.06  ? 194 LYS B CB  1 
ATOM   3339 C  CG  . LYS B 1 194 ? -9.961  1.913   -32.053 1.00 20.48  ? 194 LYS B CG  1 
ATOM   3340 C  CD  . LYS B 1 194 ? -8.882  2.749   -32.748 1.00 22.29  ? 194 LYS B CD  1 
ATOM   3341 C  CE  . LYS B 1 194 ? -7.586  2.377   -32.082 1.00 22.83  ? 194 LYS B CE  1 
ATOM   3342 N  NZ  . LYS B 1 194 ? -6.496  3.234   -32.582 1.00 20.52  ? 194 LYS B NZ  1 
ATOM   3343 N  N   . ARG B 1 195 ? -14.127 4.360   -32.215 1.00 20.98  ? 195 ARG B N   1 
ATOM   3344 C  CA  . ARG B 1 195 ? -15.418 4.638   -32.844 1.00 24.99  ? 195 ARG B CA  1 
ATOM   3345 C  C   . ARG B 1 195 ? -15.644 6.078   -33.265 1.00 40.53  ? 195 ARG B C   1 
ATOM   3346 O  O   . ARG B 1 195 ? -14.789 6.917   -32.996 1.00 49.72  ? 195 ARG B O   1 
ATOM   3347 C  CB  . ARG B 1 195 ? -16.536 4.283   -31.851 1.00 22.67  ? 195 ARG B CB  1 
ATOM   3348 C  CG  . ARG B 1 195 ? -16.387 2.844   -31.390 1.00 19.55  ? 195 ARG B CG  1 
ATOM   3349 C  CD  . ARG B 1 195 ? -17.663 2.426   -30.672 1.00 20.39  ? 195 ARG B CD  1 
ATOM   3350 N  NE  . ARG B 1 195 ? -17.506 1.096   -30.035 1.00 19.66  ? 195 ARG B NE  1 
ATOM   3351 C  CZ  . ARG B 1 195 ? -17.736 -0.051  -30.694 1.00 21.08  ? 195 ARG B CZ  1 
ATOM   3352 N  NH1 . ARG B 1 195 ? -18.122 -0.095  -31.970 1.00 22.57  ? 195 ARG B NH1 1 
ATOM   3353 N  NH2 . ARG B 1 195 ? -17.570 -1.206  -30.068 1.00 18.12  ? 195 ARG B NH2 1 
HETATM 3354 MG MG  . MG  C 2 .   ? -2.394  0.723   0.698   1.00 6.73   ? 201 MG  A MG  1 
HETATM 3355 P  P   . PO4 D 3 .   ? -1.685  -0.019  4.208   1.00 7.86   ? 202 PO4 A P   1 
HETATM 3356 O  O1  . PO4 D 3 .   ? -2.730  -1.148  4.439   1.00 9.34   ? 202 PO4 A O1  1 
HETATM 3357 O  O2  . PO4 D 3 .   ? -1.838  0.416   2.715   1.00 8.02   ? 202 PO4 A O2  1 
HETATM 3358 O  O3  . PO4 D 3 .   ? -0.298  -0.607  4.363   1.00 9.24   ? 202 PO4 A O3  1 
HETATM 3359 O  O4  . PO4 D 3 .   ? -1.978  1.169   5.098   1.00 8.62   ? 202 PO4 A O4  1 
HETATM 3360 C  C1  . GOL E 4 .   ? 12.466  9.424   -13.313 1.00 27.47  ? 203 GOL A C1  1 
HETATM 3361 O  O1  . GOL E 4 .   ? 13.434  8.535   -13.584 1.00 33.32  ? 203 GOL A O1  1 
HETATM 3362 C  C2  . GOL E 4 .   ? 12.363  10.762  -12.779 1.00 32.32  ? 203 GOL A C2  1 
HETATM 3363 O  O2  . GOL E 4 .   ? 11.003  11.060  -12.506 1.00 41.06  ? 203 GOL A O2  1 
HETATM 3364 C  C3  . GOL E 4 .   ? 13.270  11.750  -13.326 1.00 30.81  ? 203 GOL A C3  1 
HETATM 3365 O  O3  . GOL E 4 .   ? 14.623  11.996  -13.088 1.00 29.06  ? 203 GOL A O3  1 
HETATM 3366 C  C1  . GOL F 4 .   ? -7.285  -3.376  -0.418  1.00 23.77  ? 204 GOL A C1  1 
HETATM 3367 O  O1  . GOL F 4 .   ? -6.265  -3.260  -1.364  1.00 18.43  ? 204 GOL A O1  1 
HETATM 3368 C  C2  . GOL F 4 .   ? -6.924  -2.771  0.891   1.00 17.99  ? 204 GOL A C2  1 
HETATM 3369 O  O2  . GOL F 4 .   ? -8.140  -2.575  1.551   1.00 14.99  ? 204 GOL A O2  1 
HETATM 3370 C  C3  . GOL F 4 .   ? -5.820  -3.325  1.754   1.00 24.06  ? 204 GOL A C3  1 
HETATM 3371 O  O3  . GOL F 4 .   ? -5.239  -2.205  2.532   1.00 20.70  ? 204 GOL A O3  1 
HETATM 3372 C  C1  . GOL G 4 .   ? -7.514  2.550   6.167   1.00 25.64  ? 205 GOL A C1  1 
HETATM 3373 O  O1  . GOL G 4 .   ? -6.483  1.740   5.636   1.00 15.17  ? 205 GOL A O1  1 
HETATM 3374 C  C2  . GOL G 4 .   ? -7.051  3.061   7.548   1.00 25.06  ? 205 GOL A C2  1 
HETATM 3375 O  O2  . GOL G 4 .   ? -5.920  3.930   7.405   1.00 12.18  ? 205 GOL A O2  1 
HETATM 3376 C  C3  . GOL G 4 .   ? -8.182  4.053   7.993   1.00 27.73  ? 205 GOL A C3  1 
HETATM 3377 O  O3  . GOL G 4 .   ? -7.858  4.229   9.374   1.00 20.92  ? 205 GOL A O3  1 
HETATM 3378 C  C1  . GOL H 4 .   ? -22.988 -10.820 7.972   1.00 25.53  ? 206 GOL A C1  1 
HETATM 3379 O  O1  . GOL H 4 .   ? -23.445 -11.641 6.910   1.00 23.40  ? 206 GOL A O1  1 
HETATM 3380 C  C2  . GOL H 4 .   ? -21.561 -11.265 8.332   1.00 44.97  ? 206 GOL A C2  1 
HETATM 3381 O  O2  . GOL H 4 .   ? -20.664 -11.037 7.219   1.00 23.33  ? 206 GOL A O2  1 
HETATM 3382 C  C3  . GOL H 4 .   ? -21.164 -10.488 9.579   1.00 40.80  ? 206 GOL A C3  1 
HETATM 3383 O  O3  . GOL H 4 .   ? -21.092 -9.090  9.279   1.00 31.09  ? 206 GOL A O3  1 
HETATM 3384 C  C1  . GOL I 4 .   ? -9.870  -4.691  1.689   1.00 11.97  ? 207 GOL A C1  1 
HETATM 3385 O  O1  . GOL I 4 .   ? -9.390  -4.978  0.384   1.00 28.89  ? 207 GOL A O1  1 
HETATM 3386 C  C2  . GOL I 4 .   ? -10.339 -5.876  2.519   1.00 23.44  ? 207 GOL A C2  1 
HETATM 3387 O  O2  . GOL I 4 .   ? -11.175 -6.774  1.763   1.00 44.52  ? 207 GOL A O2  1 
HETATM 3388 C  C3  . GOL I 4 .   ? -11.221 -5.281  3.629   1.00 21.42  ? 207 GOL A C3  1 
HETATM 3389 O  O3  . GOL I 4 .   ? -12.369 -4.789  2.983   1.00 20.11  ? 207 GOL A O3  1 
HETATM 3390 NA NA  . NA  J 5 .   ? 19.026  9.762   2.007   1.00 43.00  ? 208 NA  A NA  1 
HETATM 3391 MG MG  . MG  K 2 .   ? -0.585  -15.240 -29.150 1.00 8.62   ? 201 MG  B MG  1 
HETATM 3392 P  P   . PO4 L 3 .   ? -1.327  -17.246 -32.146 1.00 8.99   ? 202 PO4 B P   1 
HETATM 3393 O  O1  . PO4 L 3 .   ? -0.313  -18.393 -31.943 1.00 10.57  ? 202 PO4 B O1  1 
HETATM 3394 O  O2  . PO4 L 3 .   ? -1.125  -16.289 -30.911 1.00 9.63   ? 202 PO4 B O2  1 
HETATM 3395 O  O3  . PO4 L 3 .   ? -2.735  -17.783 -32.103 1.00 10.55  ? 202 PO4 B O3  1 
HETATM 3396 O  O4  . PO4 L 3 .   ? -0.998  -16.457 -33.399 1.00 8.86   ? 202 PO4 B O4  1 
HETATM 3397 C  C1  . GOL M 4 .   ? 2.608   -21.044 -30.618 1.00 66.05  ? 203 GOL B C1  1 
HETATM 3398 O  O1  . GOL M 4 .   ? 1.461   -21.513 -31.341 1.00 36.89  ? 203 GOL B O1  1 
HETATM 3399 C  C2  . GOL M 4 .   ? 3.583   -20.314 -31.519 1.00 74.99  ? 203 GOL B C2  1 
HETATM 3400 O  O2  . GOL M 4 .   ? 3.999   -20.885 -32.721 1.00 126.51 ? 203 GOL B O2  1 
HETATM 3401 C  C3  . GOL M 4 .   ? 4.812   -19.846 -30.705 1.00 65.92  ? 203 GOL B C3  1 
HETATM 3402 O  O3  . GOL M 4 .   ? 5.243   -18.496 -31.147 1.00 81.61  ? 203 GOL B O3  1 
HETATM 3403 O  O   . HOH N 6 .   ? -4.286  2.339   4.174   1.00 9.28   ? 301 HOH A O   1 
HETATM 3404 O  O   . HOH N 6 .   ? -12.682 -19.000 -5.653  1.00 13.01  ? 302 HOH A O   1 
HETATM 3405 O  O   . HOH N 6 .   ? -10.530 0.009   -11.241 1.00 11.89  ? 303 HOH A O   1 
HETATM 3406 O  O   . HOH N 6 .   ? -3.878  -10.570 9.461   1.00 11.33  ? 304 HOH A O   1 
HETATM 3407 O  O   . HOH N 6 .   ? 8.138   1.545   14.418  1.00 10.56  ? 305 HOH A O   1 
HETATM 3408 O  O   . HOH N 6 .   ? 3.224   -7.617  4.210   1.00 10.55  ? 306 HOH A O   1 
HETATM 3409 O  O   . HOH N 6 .   ? -10.351 -10.245 -5.488  1.00 9.42   ? 307 HOH A O   1 
HETATM 3410 O  O   . HOH N 6 .   ? -4.134  5.091   3.765   1.00 9.04   ? 308 HOH A O   1 
HETATM 3411 O  O   . HOH N 6 .   ? -2.470  -4.633  -3.022  1.00 11.20  ? 309 HOH A O   1 
HETATM 3412 O  O   . HOH N 6 .   ? 3.965   18.803  -0.282  1.00 10.04  ? 310 HOH A O   1 
HETATM 3413 O  O   . HOH N 6 .   ? -3.643  2.216   1.441   1.00 7.01   ? 311 HOH A O   1 
HETATM 3414 O  O   . HOH N 6 .   ? 9.810   4.721   12.877  1.00 10.61  ? 312 HOH A O   1 
HETATM 3415 O  O   . HOH N 6 .   ? 1.450   19.346  0.576   1.00 11.15  ? 313 HOH A O   1 
HETATM 3416 O  O   . HOH N 6 .   ? 1.622   -5.319  4.396   1.00 9.43   ? 314 HOH A O   1 
HETATM 3417 O  O   . HOH N 6 .   ? 5.218   -0.901  -9.791  1.00 12.85  ? 315 HOH A O   1 
HETATM 3418 O  O   . HOH N 6 .   ? 1.121   -11.183 -2.719  1.00 10.73  ? 316 HOH A O   1 
HETATM 3419 O  O   . HOH N 6 .   ? -8.057  -9.139  -4.523  1.00 12.15  ? 317 HOH A O   1 
HETATM 3420 O  O   . HOH N 6 .   ? -22.694 -10.608 4.544   1.00 11.79  ? 318 HOH A O   1 
HETATM 3421 O  O   . HOH N 6 .   ? -5.302  8.268   7.376   1.00 9.90   ? 319 HOH A O   1 
HETATM 3422 O  O   . HOH N 6 .   ? -3.856  -0.714  0.717   1.00 8.99   ? 320 HOH A O   1 
HETATM 3423 O  O   . HOH N 6 .   ? -10.114 2.860   -4.848  1.00 12.24  ? 321 HOH A O   1 
HETATM 3424 O  O   . HOH N 6 .   ? -12.817 3.313   -2.109  1.00 13.49  ? 322 HOH A O   1 
HETATM 3425 O  O   . HOH N 6 .   ? -12.993 9.405   -11.411 1.00 11.34  ? 323 HOH A O   1 
HETATM 3426 O  O   . HOH N 6 .   ? -1.697  -12.193 8.637   1.00 10.48  ? 324 HOH A O   1 
HETATM 3427 O  O   . HOH N 6 .   ? 9.882   -5.089  -5.564  1.00 10.51  ? 325 HOH A O   1 
HETATM 3428 O  O   . HOH N 6 .   ? -3.832  -2.558  -1.480  1.00 13.71  ? 326 HOH A O   1 
HETATM 3429 O  O   . HOH N 6 .   ? -2.025  -17.266 5.433   1.00 15.28  ? 327 HOH A O   1 
HETATM 3430 O  O   . HOH N 6 .   ? -5.941  -1.715  14.717  1.00 15.95  ? 328 HOH A O   1 
HETATM 3431 O  O   . HOH N 6 .   ? -15.413 -2.281  -2.610  1.00 11.30  ? 329 HOH A O   1 
HETATM 3432 O  O   . HOH N 6 .   ? 12.085  -3.912  -6.840  1.00 12.50  ? 330 HOH A O   1 
HETATM 3433 O  O   . HOH N 6 .   ? -4.453  -16.531 4.299   1.00 13.48  ? 331 HOH A O   1 
HETATM 3434 O  O   . HOH N 6 .   ? -20.268 -13.202 5.242   1.00 12.67  ? 332 HOH A O   1 
HETATM 3435 O  O   . HOH N 6 .   ? -0.218  -14.353 1.787   1.00 12.48  ? 333 HOH A O   1 
HETATM 3436 O  O   . HOH N 6 .   ? -8.270  7.252   5.113   1.00 11.18  ? 334 HOH A O   1 
HETATM 3437 O  O   . HOH N 6 .   ? 12.153  7.868   -11.059 1.00 12.03  ? 335 HOH A O   1 
HETATM 3438 O  O   . HOH N 6 .   ? -4.551  -19.873 -5.406  1.00 15.23  ? 336 HOH A O   1 
HETATM 3439 O  O   . HOH N 6 .   ? 14.289  12.810  -6.488  1.00 15.07  ? 337 HOH A O   1 
HETATM 3440 O  O   . HOH N 6 .   ? -2.976  11.908  -6.211  1.00 12.53  ? 338 HOH A O   1 
HETATM 3441 O  O   . HOH N 6 .   ? 12.041  0.320   -9.399  1.00 14.96  ? 339 HOH A O   1 
HETATM 3442 O  O   . HOH N 6 .   ? 2.679   -1.813  -10.153 1.00 13.03  ? 340 HOH A O   1 
HETATM 3443 O  O   . HOH N 6 .   ? -9.779  -3.381  9.138   1.00 20.56  ? 341 HOH A O   1 
HETATM 3444 O  O   . HOH N 6 .   ? 6.289   22.603  -6.071  1.00 19.59  ? 342 HOH A O   1 
HETATM 3445 O  O   . HOH N 6 .   ? 0.718   0.132   -10.402 1.00 13.02  ? 343 HOH A O   1 
HETATM 3446 O  O   . HOH N 6 .   ? -3.574  -17.201 1.927   1.00 16.45  ? 344 HOH A O   1 
HETATM 3447 O  O   . HOH N 6 .   ? -19.493 -7.544  -6.490  1.00 16.80  ? 345 HOH A O   1 
HETATM 3448 O  O   . HOH N 6 .   ? -5.993  9.523   -13.234 1.00 13.37  ? 346 HOH A O   1 
HETATM 3449 O  O   . HOH N 6 .   ? -4.855  -10.221 11.983  1.00 15.19  ? 347 HOH A O   1 
HETATM 3450 O  O   . HOH N 6 .   ? -7.411  -24.230 -5.257  1.00 19.68  ? 348 HOH A O   1 
HETATM 3451 O  O   . HOH N 6 .   ? -5.927  -24.792 1.147   1.00 14.83  ? 349 HOH A O   1 
HETATM 3452 O  O   . HOH N 6 .   ? -24.977 -8.567  -0.780  1.00 15.34  ? 350 HOH A O   1 
HETATM 3453 O  O   . HOH N 6 .   ? -12.467 2.928   -6.139  1.00 13.68  ? 351 HOH A O   1 
HETATM 3454 O  O   . HOH N 6 .   ? -17.079 -2.768  -5.666  1.00 15.33  ? 352 HOH A O   1 
HETATM 3455 O  O   . HOH N 6 .   ? -21.152 -2.846  1.976   1.00 18.03  ? 353 HOH A O   1 
HETATM 3456 O  O   . HOH N 6 .   ? -2.244  -15.421 0.172   1.00 15.82  ? 354 HOH A O   1 
HETATM 3457 O  O   . HOH N 6 .   ? 6.835   -12.531 1.753   1.00 14.04  ? 355 HOH A O   1 
HETATM 3458 O  O   . HOH N 6 .   ? 0.185   15.944  8.038   1.00 21.30  ? 356 HOH A O   1 
HETATM 3459 O  O   . HOH N 6 .   ? 19.635  6.579   -5.272  1.00 20.87  ? 357 HOH A O   1 
HETATM 3460 O  O   . HOH N 6 .   ? -7.551  -11.937 -11.508 1.00 16.89  ? 358 HOH A O   1 
HETATM 3461 O  O   . HOH N 6 .   ? -0.182  -16.861 3.432   1.00 18.74  ? 359 HOH A O   1 
HETATM 3462 O  O   . HOH N 6 .   ? -14.339 -18.637 -8.683  1.00 21.09  ? 360 HOH A O   1 
HETATM 3463 O  O   . HOH N 6 .   ? 1.416   -10.366 13.625  1.00 22.07  ? 361 HOH A O   1 
HETATM 3464 O  O   . HOH N 6 .   ? -7.447  9.600   -5.472  1.00 15.85  ? 362 HOH A O   1 
HETATM 3465 O  O   . HOH N 6 .   ? -8.231  14.636  6.491   1.00 17.19  ? 363 HOH A O   1 
HETATM 3466 O  O   . HOH N 6 .   ? -8.190  6.172   -15.309 1.00 19.61  ? 364 HOH A O   1 
HETATM 3467 O  O   . HOH N 6 .   ? -6.375  8.228   -15.602 1.00 23.41  ? 365 HOH A O   1 
HETATM 3468 O  O   . HOH N 6 .   ? -7.938  7.948   9.683   1.00 17.77  ? 366 HOH A O   1 
HETATM 3469 O  O   . HOH N 6 .   ? -21.438 -4.925  0.220   1.00 16.27  ? 367 HOH A O   1 
HETATM 3470 O  O   . HOH N 6 .   ? 8.285   -11.713 4.694   1.00 15.10  ? 368 HOH A O   1 
HETATM 3471 O  O   . HOH N 6 .   ? -3.313  14.791  -4.673  1.00 15.87  ? 369 HOH A O   1 
HETATM 3472 O  O   . HOH N 6 .   ? -0.642  -1.447  -6.889  0.72 11.70  ? 370 HOH A O   1 
HETATM 3473 O  O   . HOH N 6 .   ? -9.909  -6.378  10.207  1.00 18.81  ? 371 HOH A O   1 
HETATM 3474 O  O   . HOH N 6 .   ? -7.890  9.658   13.829  1.00 22.97  ? 372 HOH A O   1 
HETATM 3475 O  O   . HOH N 6 .   ? -2.624  -19.717 8.310   1.00 28.11  ? 373 HOH A O   1 
HETATM 3476 O  O   . HOH N 6 .   ? -6.557  12.415  -2.146  1.00 22.65  ? 374 HOH A O   1 
HETATM 3477 O  O   . HOH N 6 .   ? -10.889 5.650   0.304   1.00 20.90  ? 375 HOH A O   1 
HETATM 3478 O  O   . HOH N 6 .   ? -23.627 -5.086  -1.002  1.00 22.62  ? 376 HOH A O   1 
HETATM 3479 O  O   . HOH N 6 .   ? 0.864   -13.491 13.278  1.00 18.88  ? 377 HOH A O   1 
HETATM 3480 O  O   . HOH N 6 .   ? -14.729 -24.028 -1.974  1.00 17.20  ? 378 HOH A O   1 
HETATM 3481 O  O   . HOH N 6 .   ? -12.283 13.266  -12.472 1.00 19.11  ? 379 HOH A O   1 
HETATM 3482 O  O   . HOH N 6 .   ? 10.840  5.565   -12.104 1.00 20.05  ? 380 HOH A O   1 
HETATM 3483 O  O   . HOH N 6 .   ? -13.249 10.416  -9.024  1.00 21.08  ? 381 HOH A O   1 
HETATM 3484 O  O   . HOH N 6 .   ? -1.428  15.069  -6.533  1.00 18.99  ? 382 HOH A O   1 
HETATM 3485 O  O   . HOH N 6 .   ? -2.079  -4.935  -5.775  1.00 20.39  ? 383 HOH A O   1 
HETATM 3486 O  O   . HOH N 6 .   ? -19.672 -17.106 5.295   1.00 20.44  ? 384 HOH A O   1 
HETATM 3487 O  O   . HOH N 6 .   ? -2.941  15.817  -1.371  1.00 18.50  ? 385 HOH A O   1 
HETATM 3488 O  O   . HOH N 6 .   ? -14.831 0.335   -0.714  1.00 24.04  ? 386 HOH A O   1 
HETATM 3489 O  O   . HOH N 6 .   ? 16.467  -2.224  13.326  1.00 25.12  ? 387 HOH A O   1 
HETATM 3490 O  O   . HOH N 6 .   ? -16.530 -4.385  -10.943 1.00 24.50  ? 388 HOH A O   1 
HETATM 3491 O  O   . HOH N 6 .   ? -5.801  6.093   5.708   1.00 9.31   ? 389 HOH A O   1 
HETATM 3492 O  O   . HOH N 6 .   ? -3.424  -13.554 -7.220  1.00 21.60  ? 390 HOH A O   1 
HETATM 3493 O  O   . HOH N 6 .   ? 13.241  13.556  -15.392 1.00 21.75  ? 391 HOH A O   1 
HETATM 3494 O  O   . HOH N 6 .   ? -5.771  -19.337 1.666   0.80 28.02  ? 392 HOH A O   1 
HETATM 3495 O  O   . HOH N 6 .   ? -7.751  14.867  -15.861 1.00 21.07  ? 393 HOH A O   1 
HETATM 3496 O  O   . HOH N 6 .   ? -5.276  20.437  8.969   1.00 20.54  ? 394 HOH A O   1 
HETATM 3497 O  O   . HOH N 6 .   ? -8.479  -16.557 9.446   1.00 21.48  ? 395 HOH A O   1 
HETATM 3498 O  O   . HOH N 6 .   ? 16.199  18.360  -1.538  1.00 26.62  ? 396 HOH A O   1 
HETATM 3499 O  O   . HOH N 6 .   ? 18.438  14.554  -3.974  1.00 23.11  ? 397 HOH A O   1 
HETATM 3500 O  O   . HOH N 6 .   ? -1.448  18.983  8.760   1.00 22.72  ? 398 HOH A O   1 
HETATM 3501 O  O   . HOH N 6 .   ? -17.841 -7.534  -8.589  1.00 21.06  ? 399 HOH A O   1 
HETATM 3502 O  O   . HOH N 6 .   ? -10.908 11.440  -9.089  1.00 24.53  ? 400 HOH A O   1 
HETATM 3503 O  O   . HOH N 6 .   ? 4.102   2.797   -15.293 1.00 24.03  ? 401 HOH A O   1 
HETATM 3504 O  O   . HOH N 6 .   ? -25.177 -15.844 0.923   1.00 23.93  ? 402 HOH A O   1 
HETATM 3505 O  O   . HOH N 6 .   ? 10.583  -6.195  -8.928  1.00 21.84  ? 403 HOH A O   1 
HETATM 3506 O  O   . HOH N 6 .   ? 4.551   19.858  3.713   1.00 24.50  ? 404 HOH A O   1 
HETATM 3507 O  O   . HOH N 6 .   ? 12.791  2.964   -9.434  1.00 22.32  ? 405 HOH A O   1 
HETATM 3508 O  O   . HOH N 6 .   ? -5.073  -15.887 -7.927  1.00 26.41  ? 406 HOH A O   1 
HETATM 3509 O  O   . HOH N 6 .   ? -9.646  3.524   12.823  1.00 19.75  ? 407 HOH A O   1 
HETATM 3510 O  O   . HOH N 6 .   ? -4.247  14.225  -13.335 1.00 22.08  ? 408 HOH A O   1 
HETATM 3511 O  O   . HOH N 6 .   ? 15.655  13.374  -10.325 1.00 27.92  ? 409 HOH A O   1 
HETATM 3512 O  O   . HOH N 6 .   ? -14.480 -3.963  4.858   1.00 24.59  ? 410 HOH A O   1 
HETATM 3513 O  O   . HOH N 6 .   ? 18.154  10.154  -9.167  1.00 25.10  ? 411 HOH A O   1 
HETATM 3514 O  O   . HOH N 6 .   ? -8.106  -2.708  -12.520 0.61 17.39  ? 412 HOH A O   1 
HETATM 3515 O  O   . HOH N 6 .   ? -14.331 -14.256 8.967   1.00 22.05  ? 413 HOH A O   1 
HETATM 3516 O  O   . HOH N 6 .   ? 18.260  13.669  -6.307  1.00 26.94  ? 414 HOH A O   1 
HETATM 3517 O  O   . HOH N 6 .   ? 16.625  12.074  -7.982  1.00 25.00  ? 415 HOH A O   1 
HETATM 3518 O  O   . HOH N 6 .   ? 15.648  3.913   15.411  1.00 23.41  ? 416 HOH A O   1 
HETATM 3519 O  O   . HOH N 6 .   ? -10.429 -0.134  -14.037 1.00 21.41  ? 417 HOH A O   1 
HETATM 3520 O  O   . HOH N 6 .   ? 3.118   20.093  -7.775  1.00 21.27  ? 418 HOH A O   1 
HETATM 3521 O  O   . HOH N 6 .   ? -16.116 -12.434 -12.968 1.00 26.04  ? 419 HOH A O   1 
HETATM 3522 O  O   . HOH N 6 .   ? -8.942  12.150  -2.827  1.00 25.25  ? 420 HOH A O   1 
HETATM 3523 O  O   . HOH N 6 .   ? -0.268  18.467  -7.387  1.00 39.96  ? 421 HOH A O   1 
HETATM 3524 O  O   . HOH N 6 .   ? -18.216 -3.243  -8.039  1.00 29.85  ? 422 HOH A O   1 
HETATM 3525 O  O   . HOH N 6 .   ? 17.519  8.588   3.731   1.00 31.31  ? 423 HOH A O   1 
HETATM 3526 O  O   . HOH N 6 .   ? -19.846 -4.878  -6.885  1.00 27.63  ? 424 HOH A O   1 
HETATM 3527 O  O   . HOH N 6 .   ? 18.790  7.335   -8.007  1.00 22.78  ? 425 HOH A O   1 
HETATM 3528 O  O   . HOH N 6 .   ? -6.094  -18.701 4.533   1.00 26.89  ? 426 HOH A O   1 
HETATM 3529 O  O   . HOH N 6 .   ? 0.129   9.502   -14.427 1.00 29.17  ? 427 HOH A O   1 
HETATM 3530 O  O   . HOH N 6 .   ? -0.472  1.191   -14.216 1.00 29.79  ? 428 HOH A O   1 
HETATM 3531 O  O   . HOH N 6 .   ? 19.251  12.191  3.245   1.00 31.79  ? 429 HOH A O   1 
HETATM 3532 O  O   . HOH N 6 .   ? -7.014  -8.818  16.286  1.00 33.50  ? 430 HOH A O   1 
HETATM 3533 O  O   . HOH N 6 .   ? 15.348  7.658   4.780   1.00 31.79  ? 431 HOH A O   1 
HETATM 3534 O  O   . HOH N 6 .   ? 17.266  15.668  -7.750  1.00 26.42  ? 432 HOH A O   1 
HETATM 3535 O  O   . HOH N 6 .   ? 10.386  19.905  1.475   1.00 31.42  ? 433 HOH A O   1 
HETATM 3536 O  O   . HOH N 6 .   ? 1.228   -14.844 -0.629  1.00 25.58  ? 434 HOH A O   1 
HETATM 3537 O  O   . HOH N 6 .   ? -9.617  10.560  -6.778  1.00 22.29  ? 435 HOH A O   1 
HETATM 3538 O  O   . HOH N 6 .   ? 3.369   10.119  -12.162 0.50 19.31  ? 436 HOH A O   1 
HETATM 3539 O  O   . HOH N 6 .   ? -1.206  18.701  -0.445  1.00 23.82  ? 437 HOH A O   1 
HETATM 3540 O  O   . HOH N 6 .   ? -7.466  14.277  3.999   1.00 25.68  ? 438 HOH A O   1 
HETATM 3541 O  O   . HOH N 6 .   ? 10.337  -0.032  -11.777 1.00 26.45  ? 439 HOH A O   1 
HETATM 3542 O  O   . HOH N 6 .   ? 18.751  2.292   0.683   1.00 23.34  ? 440 HOH A O   1 
HETATM 3543 O  O   . HOH N 6 .   ? -13.889 6.659   -1.694  1.00 33.28  ? 441 HOH A O   1 
HETATM 3544 O  O   . HOH N 6 .   ? -3.877  11.158  -13.780 1.00 29.85  ? 442 HOH A O   1 
HETATM 3545 O  O   . HOH N 6 .   ? -17.078 -12.167 -10.209 1.00 23.42  ? 443 HOH A O   1 
HETATM 3546 O  O   . HOH N 6 .   ? -2.927  18.772  2.038   1.00 30.48  ? 444 HOH A O   1 
HETATM 3547 O  O   . HOH N 6 .   ? -6.579  -12.038 12.992  1.00 25.48  ? 445 HOH A O   1 
HETATM 3548 O  O   . HOH N 6 .   ? 19.271  -0.588  1.067   1.00 29.32  ? 446 HOH A O   1 
HETATM 3549 O  O   . HOH N 6 .   ? 12.049  -9.585  -2.136  1.00 20.44  ? 447 HOH A O   1 
HETATM 3550 O  O   . HOH N 6 .   ? 10.022  17.745  -11.099 1.00 26.41  ? 448 HOH A O   1 
HETATM 3551 O  O   . HOH N 6 .   ? 17.942  -0.132  -4.753  1.00 30.10  ? 449 HOH A O   1 
HETATM 3552 O  O   . HOH N 6 .   ? 21.865  8.078   -4.526  1.00 29.69  ? 450 HOH A O   1 
HETATM 3553 O  O   . HOH N 6 .   ? -1.198  -7.851  -8.727  1.00 26.48  ? 451 HOH A O   1 
HETATM 3554 O  O   . HOH N 6 .   ? 22.076  10.509  -6.382  1.00 30.83  ? 452 HOH A O   1 
HETATM 3555 O  O   . HOH N 6 .   ? -1.243  -10.305 -9.653  1.00 30.81  ? 453 HOH A O   1 
HETATM 3556 O  O   . HOH N 6 .   ? -16.129 -16.122 -10.196 1.00 27.81  ? 454 HOH A O   1 
HETATM 3557 O  O   . HOH N 6 .   ? -14.647 -14.813 -12.169 1.00 30.53  ? 455 HOH A O   1 
HETATM 3558 O  O   . HOH N 6 .   ? -25.077 -7.202  -5.076  1.00 31.71  ? 456 HOH A O   1 
HETATM 3559 O  O   . HOH N 6 .   ? 3.391   -8.577  -6.964  1.00 28.65  ? 457 HOH A O   1 
HETATM 3560 O  O   . HOH N 6 .   ? 12.824  16.340  -11.987 0.50 22.55  ? 458 HOH A O   1 
HETATM 3561 O  O   . HOH N 6 .   ? -3.271  -4.287  -8.683  1.00 33.45  ? 459 HOH A O   1 
HETATM 3562 O  O   . HOH N 6 .   ? 10.560  -13.145 3.128   1.00 38.01  ? 460 HOH A O   1 
HETATM 3563 O  O   . HOH N 6 .   ? 3.130   -15.787 10.910  1.00 30.95  ? 461 HOH A O   1 
HETATM 3564 O  O   . HOH N 6 .   ? 0.753   -9.001  15.943  1.00 32.71  ? 462 HOH A O   1 
HETATM 3565 O  O   . HOH N 6 .   ? -17.900 -29.808 -1.977  1.00 37.72  ? 463 HOH A O   1 
HETATM 3566 O  O   . HOH N 6 .   ? 6.065   9.608   -16.138 1.00 25.55  ? 464 HOH A O   1 
HETATM 3567 O  O   . HOH N 6 .   ? 9.549   -15.212 9.453   1.00 33.91  ? 465 HOH A O   1 
HETATM 3568 O  O   . HOH N 6 .   ? -9.761  15.076  -6.428  1.00 27.55  ? 466 HOH A O   1 
HETATM 3569 O  O   . HOH N 6 .   ? -0.606  -17.021 -0.915  1.00 36.82  ? 467 HOH A O   1 
HETATM 3570 O  O   . HOH N 6 .   ? -16.216 0.992   -12.616 1.00 34.60  ? 468 HOH A O   1 
HETATM 3571 O  O   . HOH N 6 .   ? -6.073  12.236  -16.236 1.00 36.08  ? 469 HOH A O   1 
HETATM 3572 O  O   . HOH N 6 .   ? -16.708 0.654   -5.068  1.00 32.41  ? 470 HOH A O   1 
HETATM 3573 O  O   . HOH N 6 .   ? 8.486   -12.555 -1.452  1.00 32.12  ? 471 HOH A O   1 
HETATM 3574 O  O   . HOH N 6 .   ? 2.400   9.243   -15.956 1.00 28.97  ? 472 HOH A O   1 
HETATM 3575 O  O   . HOH N 6 .   ? 12.452  0.456   -13.656 1.00 36.58  ? 473 HOH A O   1 
HETATM 3576 O  O   . HOH N 6 .   ? 5.328   -18.530 5.932   1.00 47.56  ? 474 HOH A O   1 
HETATM 3577 O  O   . HOH N 6 .   ? 15.138  3.812   -11.978 1.00 32.87  ? 475 HOH A O   1 
HETATM 3578 O  O   . HOH N 6 .   ? -23.625 -10.959 -7.443  1.00 44.81  ? 476 HOH A O   1 
HETATM 3579 O  O   . HOH N 6 .   ? 7.104   -10.438 13.974  1.00 38.34  ? 477 HOH A O   1 
HETATM 3580 O  O   . HOH N 6 .   ? -22.616 -14.868 -6.748  1.00 31.89  ? 478 HOH A O   1 
HETATM 3581 O  O   . HOH N 6 .   ? -0.995  -1.794  -11.727 1.00 28.07  ? 479 HOH A O   1 
HETATM 3582 O  O   . HOH N 6 .   ? 1.455   -4.086  -9.088  1.00 25.52  ? 480 HOH A O   1 
HETATM 3583 O  O   . HOH N 6 .   ? -0.532  -3.677  -7.970  1.00 23.89  ? 481 HOH A O   1 
HETATM 3584 O  O   . HOH N 6 .   ? 7.673   -15.424 11.534  1.00 34.63  ? 482 HOH A O   1 
HETATM 3585 O  O   . HOH N 6 .   ? -17.691 -18.372 6.764   1.00 32.38  ? 483 HOH A O   1 
HETATM 3586 O  O   . HOH N 6 .   ? -15.095 -18.164 6.739   1.00 31.99  ? 484 HOH A O   1 
HETATM 3587 O  O   . HOH N 6 .   ? 17.220  5.657   -12.650 1.00 28.02  ? 485 HOH A O   1 
HETATM 3588 O  O   . HOH N 6 .   ? -9.926  6.973   7.334   1.00 25.19  ? 486 HOH A O   1 
HETATM 3589 O  O   . HOH N 6 .   ? -12.281 4.780   -16.024 1.00 33.35  ? 487 HOH A O   1 
HETATM 3590 O  O   . HOH N 6 .   ? -9.230  6.829   -17.866 1.00 34.28  ? 488 HOH A O   1 
HETATM 3591 O  O   . HOH N 6 .   ? -8.996  -14.175 -11.425 1.00 26.81  ? 489 HOH A O   1 
HETATM 3592 O  O   . HOH N 6 .   ? -27.895 -7.525  -5.398  1.00 30.65  ? 490 HOH A O   1 
HETATM 3593 O  O   . HOH N 6 .   ? -12.738 -5.872  11.215  1.00 30.44  ? 491 HOH A O   1 
HETATM 3594 O  O   . HOH N 6 .   ? -9.364  1.456   -16.079 1.00 35.33  ? 492 HOH A O   1 
HETATM 3595 O  O   . HOH N 6 .   ? 3.281   -2.704  -12.625 1.00 34.72  ? 493 HOH A O   1 
HETATM 3596 O  O   . HOH N 6 .   ? -20.626 -0.353  -7.034  1.00 33.90  ? 494 HOH A O   1 
HETATM 3597 O  O   . HOH N 6 .   ? -14.408 -24.121 1.105   1.00 33.94  ? 495 HOH A O   1 
HETATM 3598 O  O   . HOH N 6 .   ? -4.541  -18.445 -7.673  1.00 25.84  ? 496 HOH A O   1 
HETATM 3599 O  O   . HOH N 6 .   ? -9.297  -22.268 -7.256  1.00 33.90  ? 497 HOH A O   1 
HETATM 3600 O  O   . HOH N 6 .   ? 7.488   15.523  -14.268 1.00 42.01  ? 498 HOH A O   1 
HETATM 3601 O  O   . HOH N 6 .   ? -11.588 -13.955 9.928   1.00 34.69  ? 499 HOH A O   1 
HETATM 3602 O  O   . HOH N 6 .   ? -4.536  -4.118  4.780   1.00 26.35  ? 500 HOH A O   1 
HETATM 3603 O  O   . HOH N 6 .   ? -17.326 -10.208 7.241   0.55 23.36  ? 501 HOH A O   1 
HETATM 3604 O  O   . HOH N 6 .   ? -12.419 -15.222 -14.157 1.00 40.05  ? 502 HOH A O   1 
HETATM 3605 O  O   . HOH N 6 .   ? -6.575  -15.825 -10.052 1.00 36.03  ? 503 HOH A O   1 
HETATM 3606 O  O   . HOH N 6 .   ? -24.069 -14.872 4.737   1.00 45.11  ? 504 HOH A O   1 
HETATM 3607 O  O   . HOH N 6 .   ? -26.386 -15.387 3.148   1.00 46.49  ? 505 HOH A O   1 
HETATM 3608 O  O   . HOH N 6 .   ? -19.157 -23.175 2.387   1.00 51.33  ? 506 HOH A O   1 
HETATM 3609 O  O   . HOH N 6 .   ? -16.610 -23.183 1.417   1.00 35.16  ? 507 HOH A O   1 
HETATM 3610 O  O   . HOH N 6 .   ? 21.578  13.709  2.534   1.00 35.25  ? 508 HOH A O   1 
HETATM 3611 O  O   . HOH N 6 .   ? -4.765  -12.371 -11.395 1.00 31.09  ? 509 HOH A O   1 
HETATM 3612 O  O   . HOH N 6 .   ? -7.771  -2.172  4.107   1.00 29.28  ? 510 HOH A O   1 
HETATM 3613 O  O   . HOH N 6 .   ? -9.127  -4.110  5.004   1.00 29.78  ? 511 HOH A O   1 
HETATM 3614 O  O   . HOH N 6 .   ? -11.813 12.296  8.552   1.00 37.09  ? 512 HOH A O   1 
HETATM 3615 O  O   . HOH N 6 .   ? 11.347  4.437   -15.847 1.00 30.74  ? 513 HOH A O   1 
HETATM 3616 O  O   . HOH N 6 .   ? 8.030   6.878   -18.710 1.00 48.20  ? 514 HOH A O   1 
HETATM 3617 O  O   . HOH N 6 .   ? 6.162   -0.693  -14.780 1.00 38.56  ? 515 HOH A O   1 
HETATM 3618 O  O   . HOH N 6 .   ? -7.234  -15.399 12.474  1.00 37.53  ? 516 HOH A O   1 
HETATM 3619 O  O   . HOH N 6 .   ? 11.102  2.271   -17.574 1.00 36.80  ? 517 HOH A O   1 
HETATM 3620 O  O   . HOH N 6 .   ? -7.956  -9.750  -13.621 0.35 15.24  ? 518 HOH A O   1 
HETATM 3621 O  O   . HOH N 6 .   ? -2.217  9.051   -15.277 1.00 35.87  ? 519 HOH A O   1 
HETATM 3622 O  O   . HOH N 6 .   ? -19.134 -8.641  8.073   1.00 40.16  ? 520 HOH A O   1 
HETATM 3623 O  O   . HOH N 6 .   ? 7.125   -1.117  -12.139 1.00 34.98  ? 521 HOH A O   1 
HETATM 3624 O  O   . HOH N 6 .   ? -12.234 5.502   4.063   1.00 34.87  ? 522 HOH A O   1 
HETATM 3625 O  O   . HOH N 6 .   ? -10.407 16.274  9.621   1.00 40.72  ? 523 HOH A O   1 
HETATM 3626 O  O   . HOH N 6 .   ? 13.721  14.015  -11.743 1.00 33.82  ? 524 HOH A O   1 
HETATM 3627 O  O   . HOH N 6 .   ? -20.773 -21.337 -5.092  1.00 35.21  ? 525 HOH A O   1 
HETATM 3628 O  O   . HOH N 6 .   ? 24.045  3.999   -3.183  1.00 36.37  ? 526 HOH A O   1 
HETATM 3629 O  O   . HOH N 6 .   ? -19.349 -24.536 -1.128  0.50 29.68  ? 527 HOH A O   1 
HETATM 3630 O  O   . HOH N 6 .   ? -13.912 9.456   -6.639  1.00 35.30  ? 528 HOH A O   1 
HETATM 3631 O  O   . HOH N 6 .   ? 17.801  21.446  2.463   1.00 38.58  ? 529 HOH A O   1 
HETATM 3632 O  O   . HOH N 6 .   ? 1.592   -11.886 -5.441  1.00 30.54  ? 530 HOH A O   1 
HETATM 3633 O  O   . HOH N 6 .   ? 8.253   16.980  5.661   1.00 30.77  ? 531 HOH A O   1 
HETATM 3634 O  O   . HOH N 6 .   ? -12.025 5.934   -17.997 1.00 32.37  ? 532 HOH A O   1 
HETATM 3635 O  O   . HOH N 6 .   ? 20.884  3.984   -5.328  1.00 37.47  ? 533 HOH A O   1 
HETATM 3636 O  O   . HOH N 6 .   ? -16.812 1.932   -9.405  1.00 30.76  ? 534 HOH A O   1 
HETATM 3637 O  O   . HOH N 6 .   ? -4.634  -1.796  6.656   1.00 27.51  ? 535 HOH A O   1 
HETATM 3638 O  O   . HOH N 6 .   ? 2.754   -12.173 14.053  1.00 30.06  ? 536 HOH A O   1 
HETATM 3639 O  O   . HOH N 6 .   ? 16.111  5.640   11.215  1.00 34.66  ? 537 HOH A O   1 
HETATM 3640 O  O   . HOH N 6 .   ? -2.997  16.221  1.037   1.00 39.24  ? 538 HOH A O   1 
HETATM 3641 O  O   . HOH N 6 .   ? 10.437  17.570  5.320   1.00 33.93  ? 539 HOH A O   1 
HETATM 3642 O  O   . HOH N 6 .   ? 14.713  23.954  -5.966  1.00 41.04  ? 540 HOH A O   1 
HETATM 3643 O  O   . HOH N 6 .   ? -8.114  19.804  11.044  1.00 35.83  ? 541 HOH A O   1 
HETATM 3644 O  O   . HOH N 6 .   ? -6.298  14.210  2.014   1.00 46.72  ? 542 HOH A O   1 
HETATM 3645 O  O   . HOH N 6 .   ? -1.139  16.690  -12.901 1.00 42.44  ? 543 HOH A O   1 
HETATM 3646 O  O   . HOH N 6 .   ? -3.520  1.801   -15.601 1.00 49.66  ? 544 HOH A O   1 
HETATM 3647 O  O   . HOH N 6 .   ? 13.992  20.348  -8.398  1.00 42.65  ? 545 HOH A O   1 
HETATM 3648 O  O   . HOH N 6 .   ? -10.451 5.350   10.547  1.00 45.34  ? 546 HOH A O   1 
HETATM 3649 O  O   . HOH N 6 .   ? 17.045  3.705   9.001   1.00 35.55  ? 547 HOH A O   1 
HETATM 3650 O  O   . HOH O 6 .   ? 1.331   -15.093 -32.935 1.00 10.40  ? 301 HOH B O   1 
HETATM 3651 O  O   . HOH O 6 .   ? -6.343  -24.245 -29.337 1.00 11.97  ? 302 HOH B O   1 
HETATM 3652 O  O   . HOH O 6 .   ? -11.238 -19.547 -42.180 1.00 10.33  ? 303 HOH B O   1 
HETATM 3653 O  O   . HOH O 6 .   ? 0.796   -29.107 -33.031 1.00 12.04  ? 304 HOH B O   1 
HETATM 3654 O  O   . HOH O 6 .   ? -4.736  -22.213 -30.357 1.00 10.56  ? 305 HOH B O   1 
HETATM 3655 O  O   . HOH O 6 .   ? 2.305   -10.903 -38.162 1.00 10.58  ? 306 HOH B O   1 
HETATM 3656 O  O   . HOH O 6 .   ? -12.806 -15.982 -41.972 1.00 10.71  ? 307 HOH B O   1 
HETATM 3657 O  O   . HOH O 6 .   ? 1.167   -12.449 -33.687 1.00 10.93  ? 308 HOH B O   1 
HETATM 3658 O  O   . HOH O 6 .   ? -1.453  -30.209 -31.653 1.00 11.73  ? 309 HOH B O   1 
HETATM 3659 O  O   . HOH O 6 .   ? 9.100   -31.550 -15.621 1.00 15.30  ? 310 HOH B O   1 
HETATM 3660 O  O   . HOH O 6 .   ? -4.255  -24.928 -21.510 1.00 12.47  ? 311 HOH B O   1 
HETATM 3661 O  O   . HOH O 6 .   ? -0.604  -18.745 -23.638 1.00 16.58  ? 312 HOH B O   1 
HETATM 3662 O  O   . HOH O 6 .   ? -13.008 -18.151 -21.198 1.00 13.13  ? 313 HOH B O   1 
HETATM 3663 O  O   . HOH O 6 .   ? 0.660   -14.159 -30.386 1.00 8.98   ? 314 HOH B O   1 
HETATM 3664 O  O   . HOH O 6 .   ? 0.828   -16.629 -28.664 1.00 9.98   ? 315 HOH B O   1 
HETATM 3665 O  O   . HOH O 6 .   ? 11.327  -37.174 -17.316 1.00 12.06  ? 316 HOH B O   1 
HETATM 3666 O  O   . HOH O 6 .   ? 1.262   -32.601 -26.006 1.00 13.63  ? 317 HOH B O   1 
HETATM 3667 O  O   . HOH O 6 .   ? 7.210   -23.235 -19.176 1.00 11.38  ? 318 HOH B O   1 
HETATM 3668 O  O   . HOH O 6 .   ? 2.841   -12.248 -35.819 1.00 11.16  ? 319 HOH B O   1 
HETATM 3669 O  O   . HOH O 6 .   ? 0.872   -2.400  -27.633 1.00 15.94  ? 320 HOH B O   1 
HETATM 3670 O  O   . HOH O 6 .   ? 5.271   -10.945 -35.672 1.00 12.88  ? 321 HOH B O   1 
HETATM 3671 O  O   . HOH O 6 .   ? -13.732 -20.626 -41.628 1.00 10.79  ? 322 HOH B O   1 
HETATM 3672 O  O   . HOH O 6 .   ? 4.964   -22.554 -20.619 1.00 12.62  ? 323 HOH B O   1 
HETATM 3673 O  O   . HOH O 6 .   ? -15.098 -16.619 -20.434 1.00 15.27  ? 324 HOH B O   1 
HETATM 3674 O  O   . HOH O 6 .   ? -9.972  -27.824 -25.171 1.00 15.96  ? 325 HOH B O   1 
HETATM 3675 O  O   . HOH O 6 .   ? 2.967   -14.865 -36.608 1.00 17.51  ? 326 HOH B O   1 
HETATM 3676 O  O   . HOH O 6 .   ? -1.090  -29.829 -22.574 1.00 16.00  ? 327 HOH B O   1 
HETATM 3677 O  O   . HOH O 6 .   ? 0.252   -32.126 -23.628 1.00 18.47  ? 328 HOH B O   1 
HETATM 3678 O  O   . HOH O 6 .   ? 2.887   -22.876 -41.216 1.00 18.19  ? 329 HOH B O   1 
HETATM 3679 O  O   . HOH O 6 .   ? 21.806  -23.080 -24.241 1.00 20.02  ? 330 HOH B O   1 
HETATM 3680 O  O   . HOH O 6 .   ? -1.031  0.399   -28.593 1.00 16.73  ? 331 HOH B O   1 
HETATM 3681 O  O   . HOH O 6 .   ? 12.185  -16.798 -24.554 1.00 17.40  ? 332 HOH B O   1 
HETATM 3682 O  O   . HOH O 6 .   ? 19.506  -26.887 -28.536 1.00 20.03  ? 333 HOH B O   1 
HETATM 3683 O  O   . HOH O 6 .   ? -8.274  -12.736 -18.826 1.00 17.77  ? 334 HOH B O   1 
HETATM 3684 O  O   . HOH O 6 .   ? 0.921   -17.415 -25.973 1.00 15.36  ? 335 HOH B O   1 
HETATM 3685 O  O   . HOH O 6 .   ? 4.835   -34.628 -13.567 1.00 16.96  ? 336 HOH B O   1 
HETATM 3686 O  O   . HOH O 6 .   ? -1.180  -33.748 -26.774 1.00 16.72  ? 337 HOH B O   1 
HETATM 3687 O  O   . HOH O 6 .   ? -11.972 -3.254  -15.740 1.00 17.68  ? 338 HOH B O   1 
HETATM 3688 O  O   . HOH O 6 .   ? -3.007  -29.639 -24.556 1.00 15.33  ? 339 HOH B O   1 
HETATM 3689 O  O   . HOH O 6 .   ? 7.743   -31.820 -13.217 1.00 18.81  ? 340 HOH B O   1 
HETATM 3690 O  O   . HOH O 6 .   ? -3.778  -11.594 -18.761 1.00 15.04  ? 341 HOH B O   1 
HETATM 3691 O  O   . HOH O 6 .   ? 5.345   -4.702  -39.772 1.00 18.04  ? 342 HOH B O   1 
HETATM 3692 O  O   . HOH O 6 .   ? -9.409  -2.406  -15.112 1.00 21.95  ? 343 HOH B O   1 
HETATM 3693 O  O   . HOH O 6 .   ? 2.435   -34.600 -22.369 1.00 18.21  ? 344 HOH B O   1 
HETATM 3694 O  O   . HOH O 6 .   ? -5.768  -13.453 -18.221 1.00 16.77  ? 345 HOH B O   1 
HETATM 3695 O  O   . HOH O 6 .   ? -4.363  -29.194 -22.168 1.00 24.54  ? 346 HOH B O   1 
HETATM 3696 O  O   . HOH O 6 .   ? 8.069   -22.048 -27.854 1.00 21.34  ? 347 HOH B O   1 
HETATM 3697 O  O   . HOH O 6 .   ? 0.253   -0.502  -32.830 1.00 17.43  ? 348 HOH B O   1 
HETATM 3698 O  O   . HOH O 6 .   ? 17.056  -29.521 -28.103 1.00 18.76  ? 349 HOH B O   1 
HETATM 3699 O  O   . HOH O 6 .   ? 1.688   -29.790 -35.527 1.00 17.65  ? 350 HOH B O   1 
HETATM 3700 O  O   . HOH O 6 .   ? 16.486  -20.191 -19.164 1.00 21.26  ? 351 HOH B O   1 
HETATM 3701 O  O   . HOH O 6 .   ? 6.140   -20.298 -26.403 1.00 20.21  ? 352 HOH B O   1 
HETATM 3702 O  O   . HOH O 6 .   ? 3.784   -37.169 -13.635 1.00 21.74  ? 353 HOH B O   1 
HETATM 3703 O  O   . HOH O 6 .   ? -2.351  -14.360 -21.241 1.00 19.25  ? 354 HOH B O   1 
HETATM 3704 O  O   . HOH O 6 .   ? 7.952   -10.342 -30.747 1.00 25.26  ? 355 HOH B O   1 
HETATM 3705 O  O   . HOH O 6 .   ? 5.039   -12.058 -40.133 1.00 19.94  ? 356 HOH B O   1 
HETATM 3706 O  O   . HOH O 6 .   ? -14.891 -11.567 -19.568 1.00 25.27  ? 357 HOH B O   1 
HETATM 3707 O  O   . HOH O 6 .   ? 9.911   -11.821 -27.001 1.00 20.45  ? 358 HOH B O   1 
HETATM 3708 O  O   . HOH O 6 .   ? 4.203   -22.366 -13.014 1.00 22.99  ? 359 HOH B O   1 
HETATM 3709 O  O   . HOH O 6 .   ? 7.200   -11.730 -24.468 1.00 21.82  ? 360 HOH B O   1 
HETATM 3710 O  O   . HOH O 6 .   ? 10.384  -29.942 -12.764 1.00 19.49  ? 361 HOH B O   1 
HETATM 3711 O  O   . HOH O 6 .   ? 6.679   -22.369 -35.295 1.00 19.99  ? 362 HOH B O   1 
HETATM 3712 O  O   . HOH O 6 .   ? 21.909  -30.448 -23.341 1.00 21.07  ? 363 HOH B O   1 
HETATM 3713 O  O   . HOH O 6 .   ? 4.806   -12.118 -44.741 1.00 23.35  ? 364 HOH B O   1 
HETATM 3714 O  O   . HOH O 6 .   ? 3.617   -16.328 -33.986 1.00 21.07  ? 365 HOH B O   1 
HETATM 3715 O  O   . HOH O 6 .   ? -4.051  -33.323 -35.351 1.00 23.76  ? 366 HOH B O   1 
HETATM 3716 O  O   . HOH O 6 .   ? 9.204   -10.474 -23.313 0.56 20.64  ? 367 HOH B O   1 
HETATM 3717 O  O   . HOH O 6 .   ? 1.504   -20.910 -42.634 1.00 10.67  ? 368 HOH B O   1 
HETATM 3718 O  O   . HOH O 6 .   ? 17.771  -35.794 -18.932 1.00 19.21  ? 369 HOH B O   1 
HETATM 3719 O  O   . HOH O 6 .   ? -2.927  -3.883  -41.812 1.00 24.35  ? 370 HOH B O   1 
HETATM 3720 O  O   . HOH O 6 .   ? 2.022   -18.328 -30.362 1.00 24.31  ? 371 HOH B O   1 
HETATM 3721 O  O   . HOH O 6 .   ? -13.720 -0.775  -20.539 1.00 27.93  ? 372 HOH B O   1 
HETATM 3722 O  O   . HOH O 6 .   ? 4.954   -24.282 -42.396 1.00 18.92  ? 373 HOH B O   1 
HETATM 3723 O  O   . HOH O 6 .   ? 7.500   -11.252 -18.355 1.00 20.53  ? 374 HOH B O   1 
HETATM 3724 O  O   . HOH O 6 .   ? -16.956 -1.164  -27.111 1.00 21.57  ? 375 HOH B O   1 
HETATM 3725 O  O   . HOH O 6 .   ? 5.682   -26.660 -44.271 1.00 25.68  ? 376 HOH B O   1 
HETATM 3726 O  O   . HOH O 6 .   ? 3.391   -4.640  -32.441 1.00 18.74  ? 377 HOH B O   1 
HETATM 3727 O  O   . HOH O 6 .   ? 12.273  -26.967 -12.240 1.00 20.66  ? 378 HOH B O   1 
HETATM 3728 O  O   . HOH O 6 .   ? 3.568   -17.817 -25.826 1.00 23.94  ? 379 HOH B O   1 
HETATM 3729 O  O   . HOH O 6 .   ? -14.147 -5.916  -18.859 1.00 19.27  ? 380 HOH B O   1 
HETATM 3730 O  O   . HOH O 6 .   ? -14.822 -3.868  -20.864 1.00 19.36  ? 381 HOH B O   1 
HETATM 3731 O  O   . HOH O 6 .   ? -3.047  -32.484 -24.928 1.00 21.79  ? 382 HOH B O   1 
HETATM 3732 O  O   . HOH O 6 .   ? -4.479  -30.239 -37.019 1.00 20.28  ? 383 HOH B O   1 
HETATM 3733 O  O   . HOH O 6 .   ? 5.143   -18.601 -28.343 1.00 26.92  ? 384 HOH B O   1 
HETATM 3734 O  O   . HOH O 6 .   ? 14.057  -16.302 -21.791 1.00 21.99  ? 385 HOH B O   1 
HETATM 3735 O  O   . HOH O 6 .   ? 6.793   -25.400 -35.384 1.00 23.85  ? 386 HOH B O   1 
HETATM 3736 O  O   . HOH O 6 .   ? 5.518   -34.532 -30.971 1.00 23.87  ? 387 HOH B O   1 
HETATM 3737 O  O   . HOH O 6 .   ? 0.465   -25.297 -16.395 1.00 23.58  ? 388 HOH B O   1 
HETATM 3738 O  O   . HOH O 6 .   ? 3.529   -38.342 -16.162 1.00 28.23  ? 389 HOH B O   1 
HETATM 3739 O  O   . HOH O 6 .   ? 3.011   -34.510 -25.150 1.00 19.65  ? 390 HOH B O   1 
HETATM 3740 O  O   . HOH O 6 .   ? -19.272 -1.016  -25.514 1.00 22.03  ? 391 HOH B O   1 
HETATM 3741 O  O   . HOH O 6 .   ? 3.518   -31.713 -35.686 1.00 24.70  ? 392 HOH B O   1 
HETATM 3742 O  O   . HOH O 6 .   ? -4.979  -24.126 -18.593 1.00 22.64  ? 393 HOH B O   1 
HETATM 3743 O  O   . HOH O 6 .   ? 13.607  -36.823 -18.920 1.00 25.49  ? 394 HOH B O   1 
HETATM 3744 O  O   . HOH O 6 .   ? 4.369   -4.024  -37.355 1.00 28.90  ? 395 HOH B O   1 
HETATM 3745 O  O   . HOH O 6 .   ? -21.043 -0.148  -30.159 1.00 26.39  ? 396 HOH B O   1 
HETATM 3746 O  O   . HOH O 6 .   ? -19.552 -22.779 -39.609 1.00 36.87  ? 397 HOH B O   1 
HETATM 3747 O  O   . HOH O 6 .   ? 7.007   -34.520 -11.720 1.00 26.88  ? 398 HOH B O   1 
HETATM 3748 O  O   . HOH O 6 .   ? 13.992  -23.552 -13.944 1.00 24.87  ? 399 HOH B O   1 
HETATM 3749 O  O   . HOH O 6 .   ? -22.389 -7.002  -33.759 1.00 30.88  ? 400 HOH B O   1 
HETATM 3750 O  O   . HOH O 6 .   ? -11.533 -28.174 -28.183 1.00 21.35  ? 401 HOH B O   1 
HETATM 3751 O  O   . HOH O 6 .   ? -18.156 -10.239 -35.996 1.00 22.89  ? 402 HOH B O   1 
HETATM 3752 O  O   . HOH O 6 .   ? 0.149   -37.898 -17.397 1.00 30.15  ? 403 HOH B O   1 
HETATM 3753 O  O   . HOH O 6 .   ? 14.782  -19.483 -17.146 1.00 22.03  ? 404 HOH B O   1 
HETATM 3754 O  O   . HOH O 6 .   ? -6.583  1.760   -35.678 1.00 28.70  ? 405 HOH B O   1 
HETATM 3755 O  O   . HOH O 6 .   ? -16.615 -14.555 -42.247 1.00 27.39  ? 406 HOH B O   1 
HETATM 3756 O  O   . HOH O 6 .   ? 11.255  -41.642 -13.959 1.00 25.19  ? 407 HOH B O   1 
HETATM 3757 O  O   . HOH O 6 .   ? -15.146 -23.480 -22.760 1.00 23.94  ? 408 HOH B O   1 
HETATM 3758 O  O   . HOH O 6 .   ? -0.871  -17.936 -21.223 1.00 24.13  ? 409 HOH B O   1 
HETATM 3759 O  O   . HOH O 6 .   ? -2.609  -9.100  -15.611 1.00 24.64  ? 410 HOH B O   1 
HETATM 3760 O  O   . HOH O 6 .   ? -18.706 0.879   -23.939 1.00 22.65  ? 411 HOH B O   1 
HETATM 3761 O  O   . HOH O 6 .   ? 4.590   -15.528 -38.277 1.00 28.13  ? 412 HOH B O   1 
HETATM 3762 O  O   . HOH O 6 .   ? 2.535   -0.084  -44.280 1.00 25.03  ? 413 HOH B O   1 
HETATM 3763 O  O   . HOH O 6 .   ? -21.021 -2.354  -23.791 1.00 32.51  ? 414 HOH B O   1 
HETATM 3764 O  O   . HOH O 6 .   ? 10.256  -33.350 -11.087 1.00 29.35  ? 415 HOH B O   1 
HETATM 3765 O  O   . HOH O 6 .   ? 18.165  -18.967 -28.760 1.00 29.18  ? 416 HOH B O   1 
HETATM 3766 O  O   . HOH O 6 .   ? 4.430   -19.672 -11.847 1.00 30.56  ? 417 HOH B O   1 
HETATM 3767 O  O   . HOH O 6 .   ? -21.634 -13.672 -29.693 1.00 29.76  ? 418 HOH B O   1 
HETATM 3768 O  O   . HOH O 6 .   ? 20.651  -22.928 -16.938 1.00 27.59  ? 419 HOH B O   1 
HETATM 3769 O  O   . HOH O 6 .   ? -4.471  -1.464  -18.749 1.00 33.02  ? 420 HOH B O   1 
HETATM 3770 O  O   . HOH O 6 .   ? -7.843  0.104   -18.069 1.00 30.51  ? 421 HOH B O   1 
HETATM 3771 O  O   . HOH O 6 .   ? -17.222 -23.881 -40.522 1.00 18.26  ? 422 HOH B O   1 
HETATM 3772 O  O   . HOH O 6 .   ? -15.168 -9.012  -20.306 1.00 25.58  ? 423 HOH B O   1 
HETATM 3773 O  O   . HOH O 6 .   ? 22.469  -25.967 -18.560 1.00 25.55  ? 424 HOH B O   1 
HETATM 3774 O  O   . HOH O 6 .   ? 11.610  -15.309 -27.527 1.00 30.16  ? 425 HOH B O   1 
HETATM 3775 O  O   . HOH O 6 .   ? -22.619 -7.423  -26.024 1.00 29.14  ? 426 HOH B O   1 
HETATM 3776 O  O   . HOH O 6 .   ? -8.697  0.206   -20.900 1.00 31.11  ? 427 HOH B O   1 
HETATM 3777 O  O   . HOH O 6 .   ? -13.588 -17.985 -17.807 1.00 27.51  ? 428 HOH B O   1 
HETATM 3778 O  O   . HOH O 6 .   ? 22.025  -20.369 -20.996 1.00 36.28  ? 429 HOH B O   1 
HETATM 3779 O  O   . HOH O 6 .   ? -1.498  -1.232  -43.472 1.00 27.06  ? 430 HOH B O   1 
HETATM 3780 O  O   . HOH O 6 .   ? 2.238   -6.089  -17.109 1.00 36.31  ? 431 HOH B O   1 
HETATM 3781 O  O   . HOH O 6 .   ? -6.279  -34.182 -32.691 1.00 32.10  ? 432 HOH B O   1 
HETATM 3782 O  O   . HOH O 6 .   ? -2.975  4.429   -28.702 1.00 36.90  ? 433 HOH B O   1 
HETATM 3783 O  O   . HOH O 6 .   ? 12.963  -15.743 -15.372 1.00 34.33  ? 434 HOH B O   1 
HETATM 3784 O  O   . HOH O 6 .   ? -1.872  -13.038 -17.168 1.00 31.99  ? 435 HOH B O   1 
HETATM 3785 O  O   . HOH O 6 .   ? -24.259 -3.253  -35.844 1.00 34.64  ? 436 HOH B O   1 
HETATM 3786 O  O   . HOH O 6 .   ? 6.838   -12.355 -37.490 1.00 31.05  ? 437 HOH B O   1 
HETATM 3787 O  O   . HOH O 6 .   ? -9.207  -28.904 -22.160 1.00 37.36  ? 438 HOH B O   1 
HETATM 3788 O  O   . HOH O 6 .   ? -8.694  2.721   -36.489 1.00 34.99  ? 439 HOH B O   1 
HETATM 3789 O  O   . HOH O 6 .   ? -13.773 -28.780 -25.759 1.00 29.88  ? 440 HOH B O   1 
HETATM 3790 O  O   . HOH O 6 .   ? -2.078  0.602   -21.560 1.00 29.73  ? 441 HOH B O   1 
HETATM 3791 O  O   . HOH O 6 .   ? -22.206 -5.471  -35.772 1.00 37.23  ? 442 HOH B O   1 
HETATM 3792 O  O   . HOH O 6 .   ? -13.080 -33.599 -31.539 1.00 34.22  ? 443 HOH B O   1 
HETATM 3793 O  O   . HOH O 6 .   ? -2.016  -19.443 -17.352 1.00 33.41  ? 444 HOH B O   1 
HETATM 3794 O  O   . HOH O 6 .   ? 19.003  -20.406 -17.811 1.00 30.58  ? 445 HOH B O   1 
HETATM 3795 O  O   . HOH O 6 .   ? -0.637  -37.049 -28.576 1.00 28.71  ? 446 HOH B O   1 
HETATM 3796 O  O   . HOH O 6 .   ? -6.747  -35.474 -30.187 1.00 32.00  ? 447 HOH B O   1 
HETATM 3797 O  O   . HOH O 6 .   ? 3.556   -26.473 -12.851 1.00 42.82  ? 448 HOH B O   1 
HETATM 3798 O  O   . HOH O 6 .   ? 16.087  -33.511 -26.565 1.00 33.91  ? 449 HOH B O   1 
HETATM 3799 O  O   . HOH O 6 .   ? -19.740 2.090   -26.961 1.00 29.52  ? 450 HOH B O   1 
HETATM 3800 O  O   . HOH O 6 .   ? -22.433 -16.382 -28.859 1.00 33.30  ? 451 HOH B O   1 
HETATM 3801 O  O   . HOH O 6 .   ? 9.190   -12.299 -34.306 1.00 38.29  ? 452 HOH B O   1 
HETATM 3802 O  O   . HOH O 6 .   ? -2.065  -26.371 -15.388 1.00 37.42  ? 453 HOH B O   1 
HETATM 3803 O  O   . HOH O 6 .   ? 1.868   -26.995 -14.906 1.00 30.45  ? 454 HOH B O   1 
HETATM 3804 O  O   . HOH O 6 .   ? -20.871 -0.187  -27.464 1.00 26.74  ? 455 HOH B O   1 
HETATM 3805 O  O   . HOH O 6 .   ? -1.800  -21.108 -14.996 1.00 43.37  ? 456 HOH B O   1 
HETATM 3806 O  O   . HOH O 6 .   ? 9.001   -14.900 -32.848 1.00 41.16  ? 457 HOH B O   1 
HETATM 3807 O  O   . HOH O 6 .   ? 6.575   -16.081 -34.066 1.00 33.39  ? 458 HOH B O   1 
HETATM 3808 O  O   . HOH O 6 .   ? 18.161  -20.042 -26.324 1.00 18.62  ? 459 HOH B O   1 
HETATM 3809 O  O   . HOH O 6 .   ? 15.903  -25.342 -13.188 1.00 26.32  ? 460 HOH B O   1 
HETATM 3810 O  O   . HOH O 6 .   ? 5.632   -24.374 -11.948 1.00 26.41  ? 461 HOH B O   1 
HETATM 3811 O  O   . HOH O 6 .   ? 14.709  -27.013 -11.229 1.00 33.05  ? 462 HOH B O   1 
HETATM 3812 O  O   . HOH O 6 .   ? -17.861 -25.167 -37.931 1.00 26.72  ? 463 HOH B O   1 
HETATM 3813 O  O   . HOH O 6 .   ? 11.404  -38.033 -9.471  1.00 25.98  ? 464 HOH B O   1 
HETATM 3814 O  O   . HOH O 6 .   ? -4.543  -15.874 -18.236 1.00 29.76  ? 465 HOH B O   1 
HETATM 3815 O  O   . HOH O 6 .   ? -5.837  -32.170 -37.062 1.00 31.28  ? 466 HOH B O   1 
HETATM 3816 O  O   . HOH O 6 .   ? 10.412  -39.699 -17.608 1.00 27.43  ? 467 HOH B O   1 
HETATM 3817 O  O   . HOH O 6 .   ? 20.110  -35.050 -17.684 1.00 28.49  ? 468 HOH B O   1 
HETATM 3818 O  O   . HOH O 6 .   ? 2.530   -37.290 -21.424 1.00 27.49  ? 469 HOH B O   1 
HETATM 3819 O  O   . HOH O 6 .   ? 6.173   -27.945 -42.094 1.00 41.08  ? 470 HOH B O   1 
HETATM 3820 O  O   . HOH O 6 .   ? -6.259  3.478   -23.200 1.00 35.84  ? 471 HOH B O   1 
HETATM 3821 O  O   . HOH O 6 .   ? -6.015  -12.926 -15.477 1.00 33.45  ? 472 HOH B O   1 
HETATM 3822 O  O   . HOH O 6 .   ? -14.721 -9.152  -15.498 1.00 38.15  ? 473 HOH B O   1 
HETATM 3823 O  O   . HOH O 6 .   ? 0.271   -16.812 -18.704 1.00 38.09  ? 474 HOH B O   1 
HETATM 3824 O  O   . HOH O 6 .   ? -2.595  -30.704 -20.478 1.00 39.38  ? 475 HOH B O   1 
HETATM 3825 O  O   . HOH O 6 .   ? 11.170  -31.713 -30.973 1.00 48.68  ? 476 HOH B O   1 
HETATM 3826 O  O   . HOH O 6 .   ? 7.996   -22.113 -30.532 1.00 35.56  ? 477 HOH B O   1 
HETATM 3827 O  O   . HOH O 6 .   ? 5.718   -13.421 -15.594 0.77 30.82  ? 478 HOH B O   1 
HETATM 3828 O  O   . HOH O 6 .   ? 5.222   -20.343 -34.759 1.00 34.11  ? 479 HOH B O   1 
HETATM 3829 O  O   . HOH O 6 .   ? 6.192   -39.550 -19.305 1.00 39.06  ? 480 HOH B O   1 
HETATM 3830 O  O   . HOH O 6 .   ? 13.366  -22.215 -11.891 1.00 42.22  ? 481 HOH B O   1 
HETATM 3831 O  O   . HOH O 6 .   ? -21.612 -5.796  -23.693 1.00 37.95  ? 482 HOH B O   1 
HETATM 3832 O  O   . HOH O 6 .   ? -12.349 -32.293 -27.971 1.00 31.25  ? 483 HOH B O   1 
HETATM 3833 O  O   . HOH O 6 .   ? -21.670 -0.795  -38.772 1.00 42.30  ? 484 HOH B O   1 
HETATM 3834 O  O   . HOH O 6 .   ? -12.334 5.472   -25.043 1.00 34.70  ? 485 HOH B O   1 
HETATM 3835 O  O   . HOH O 6 .   ? 10.745  -35.145 -27.287 1.00 40.03  ? 486 HOH B O   1 
HETATM 3836 O  O   . HOH O 6 .   ? 10.966  -24.886 -10.746 1.00 37.21  ? 487 HOH B O   1 
HETATM 3837 O  O   . HOH O 6 .   ? -0.162  -34.327 -22.377 1.00 29.76  ? 488 HOH B O   1 
HETATM 3838 O  O   . HOH O 6 .   ? -9.687  -11.956 -16.198 0.50 20.69  ? 489 HOH B O   1 
HETATM 3839 O  O   . HOH O 6 .   ? 15.177  -25.477 -32.986 1.00 39.67  ? 490 HOH B O   1 
HETATM 3840 O  O   . HOH O 6 .   ? -7.746  -34.642 -27.572 1.00 38.80  ? 491 HOH B O   1 
HETATM 3841 O  O   . HOH O 6 .   ? 23.940  -29.798 -21.689 1.00 32.25  ? 492 HOH B O   1 
HETATM 3842 O  O   . HOH O 6 .   ? 10.456  -7.356  -26.955 1.00 47.08  ? 493 HOH B O   1 
HETATM 3843 O  O   . HOH O 6 .   ? 0.226   -0.879  -35.534 1.00 36.45  ? 494 HOH B O   1 
HETATM 3844 O  O   . HOH O 6 .   ? 17.274  -28.039 -31.220 1.00 44.71  ? 495 HOH B O   1 
HETATM 3845 O  O   . HOH O 6 .   ? 3.424   -1.856  -48.220 1.00 39.43  ? 496 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . SER A 4   ? 0.1744 0.2087 0.6805 -0.0126 -0.0973 -0.2365 4   SER A N   
2    C  CA  . SER A 4   ? 0.1769 0.2688 0.3651 -0.0751 0.0501  -0.1484 4   SER A CA  
3    C  C   . SER A 4   ? 0.1642 0.2201 0.2711 -0.0400 0.0362  -0.1026 4   SER A C   
4    O  O   . SER A 4   ? 0.1960 0.2559 0.3909 -0.0218 0.0387  -0.1785 4   SER A O   
5    C  CB  . SER A 4   ? 0.1784 0.6492 0.4157 0.0202  -0.0468 -0.0724 4   SER A CB  
6    O  OG  . SER A 4   ? 0.7451 0.6603 0.1993 0.1155  -0.0047 0.0046  4   SER A OG  
7    N  N   . VAL A 5   ? 0.1317 0.1237 0.1746 -0.0362 0.0470  -0.0057 5   VAL A N   
8    C  CA  . VAL A 5   ? 0.1360 0.1191 0.1477 -0.0284 0.0285  0.0159  5   VAL A CA  
9    C  C   . VAL A 5   ? 0.1311 0.1149 0.1159 -0.0191 0.0283  -0.0024 5   VAL A C   
10   O  O   . VAL A 5   ? 0.1313 0.1152 0.1550 -0.0186 0.0286  0.0199  5   VAL A O   
11   C  CB  . VAL A 5   ? 0.1728 0.1434 0.1433 -0.0549 0.0397  0.0186  5   VAL A CB  
12   C  CG1 . VAL A 5   ? 0.1863 0.1510 0.1429 -0.0451 0.0086  0.0238  5   VAL A CG1 
13   C  CG2 . VAL A 5   ? 0.2180 0.1693 0.1913 -0.0681 -0.0111 0.0653  5   VAL A CG2 
14   N  N   . ARG A 6   ? 0.1347 0.0942 0.1133 -0.0368 0.0167  -0.0113 6   ARG A N   
15   C  CA  . ARG A 6   ? 0.1189 0.1039 0.0974 -0.0332 0.0018  -0.0036 6   ARG A CA  
16   C  C   . ARG A 6   ? 0.0962 0.0930 0.0844 -0.0221 0.0145  0.0069  6   ARG A C   
17   O  O   . ARG A 6   ? 0.1105 0.0886 0.1154 -0.0206 0.0124  -0.0060 6   ARG A O   
18   C  CB  . ARG A 6   ? 0.1294 0.1284 0.1105 -0.0358 0.0063  -0.0175 6   ARG A CB  
19   C  CG  . ARG A 6   ? 0.1530 0.1655 0.0991 -0.0595 0.0031  0.0003  6   ARG A CG  
20   C  CD  . ARG A 6   ? 0.1528 0.2434 0.1012 -0.0383 0.0001  -0.0016 6   ARG A CD  
21   N  NE  . ARG A 6   ? 0.1628 0.2491 0.0930 -0.0376 -0.0017 -0.0188 6   ARG A NE  
22   C  CZ  . ARG A 6   ? 0.1724 0.2137 0.0760 -0.0257 0.0062  0.0118  6   ARG A CZ  
23   N  NH1 . ARG A 6   ? 0.1936 0.2380 0.1587 0.0110  -0.0029 0.0276  6   ARG A NH1 
24   N  NH2 . ARG A 6   ? 0.1938 0.2334 0.1285 -0.0491 0.0117  -0.0287 6   ARG A NH2 
25   N  N   . VAL A 7   ? 0.1009 0.0925 0.1020 -0.0211 -0.0061 0.0047  7   VAL A N   
26   C  CA  . VAL A 7   ? 0.0958 0.0898 0.0874 -0.0121 0.0028  0.0042  7   VAL A CA  
27   C  C   . VAL A 7   ? 0.0910 0.0827 0.0874 -0.0069 0.0009  0.0044  7   VAL A C   
28   O  O   . VAL A 7   ? 0.0943 0.1088 0.0987 -0.0092 -0.0027 0.0235  7   VAL A O   
29   C  CB  . VAL A 7   ? 0.0908 0.0895 0.0909 -0.0043 0.0090  0.0075  7   VAL A CB  
30   C  CG1 . VAL A 7   ? 0.1214 0.0972 0.1083 -0.0233 0.0046  -0.0064 7   VAL A CG1 
31   C  CG2 . VAL A 7   ? 0.1223 0.1051 0.0985 -0.0207 0.0138  0.0125  7   VAL A CG2 
32   N  N   . LEU A 8   ? 0.0937 0.0745 0.0924 0.0024  0.0112  0.0056  8   LEU A N   
33   C  CA  . LEU A 8   ? 0.0884 0.0777 0.0811 -0.0074 0.0031  0.0045  8   LEU A CA  
34   C  C   . LEU A 8   ? 0.0738 0.0797 0.0976 0.0031  0.0019  0.0000  8   LEU A C   
35   O  O   . LEU A 8   ? 0.1086 0.0744 0.1053 0.0033  -0.0213 -0.0030 8   LEU A O   
36   C  CB  . LEU A 8   ? 0.1011 0.0767 0.0823 -0.0077 0.0084  0.0040  8   LEU A CB  
37   C  CG  . LEU A 8   ? 0.1053 0.0788 0.1140 0.0042  0.0013  -0.0073 8   LEU A CG  
38   C  CD1 . LEU A 8   ? 0.1442 0.1225 0.1079 0.0396  0.0182  0.0007  8   LEU A CD1 
39   C  CD2 . LEU A 8   ? 0.1217 0.1158 0.0927 -0.0068 -0.0050 -0.0056 8   LEU A CD2 
40   N  N   . VAL A 9   ? 0.0821 0.0769 0.0819 -0.0007 -0.0051 0.0007  9   VAL A N   
41   C  CA  . VAL A 9   ? 0.0971 0.0791 0.0825 -0.0115 -0.0119 -0.0010 9   VAL A CA  
42   C  C   . VAL A 9   ? 0.0951 0.0828 0.0864 0.0047  0.0003  0.0001  9   VAL A C   
43   O  O   . VAL A 9   ? 0.0878 0.0888 0.0982 -0.0035 -0.0051 0.0099  9   VAL A O   
44   C  CB  . VAL A 9   ? 0.1113 0.0941 0.0991 -0.0058 0.0143  -0.0083 9   VAL A CB  
45   C  CG1 . VAL A 9   ? 0.1275 0.0961 0.1255 -0.0053 0.0079  -0.0154 9   VAL A CG1 
46   C  CG2 . VAL A 9   ? 0.1151 0.0895 0.1271 -0.0015 0.0178  0.0079  9   VAL A CG2 
47   N  N   . ASP A 10  ? 0.0987 0.0942 0.0884 -0.0125 -0.0037 0.0133  10  ASP A N   
48   C  CA  . ASP A 10  ? 0.0781 0.1022 0.0931 0.0116  0.0106  0.0083  10  ASP A CA  
49   C  C   . ASP A 10  ? 0.0774 0.0878 0.0883 -0.0065 -0.0051 -0.0092 10  ASP A C   
50   O  O   . ASP A 10  ? 0.1001 0.0825 0.1157 -0.0057 0.0208  -0.0091 10  ASP A O   
51   C  CB  . ASP A 10  ? 0.1001 0.0877 0.1045 -0.0015 -0.0059 0.0123  10  ASP A CB  
52   C  CG  . ASP A 10  ? 0.0910 0.0996 0.1062 -0.0043 0.0026  0.0104  10  ASP A CG  
53   O  OD1 . ASP A 10  ? 0.1106 0.1052 0.1032 -0.0106 0.0084  0.0179  10  ASP A OD1 
54   O  OD2 . ASP A 10  ? 0.1151 0.0844 0.1006 -0.0057 0.0016  0.0052  10  ASP A OD2 
55   N  N   . MET A 11  ? 0.0868 0.0849 0.1123 0.0044  0.0167  -0.0062 11  MET A N   
56   C  CA  . MET A 11  ? 0.0894 0.0910 0.0873 0.0028  0.0111  0.0062  11  MET A CA  
57   C  C   . MET A 11  ? 0.0853 0.0760 0.0984 0.0063  0.0020  0.0112  11  MET A C   
58   O  O   . MET A 11  ? 0.1009 0.0774 0.1063 -0.0083 0.0174  0.0003  11  MET A O   
59   C  CB  . MET A 11  ? 0.1010 0.1161 0.0909 0.0068  -0.0030 0.0112  11  MET A CB  
60   C  CG  . MET A 11  ? 0.1348 0.1062 0.0985 0.0018  0.0271  0.0193  11  MET A CG  
61   S  SD  . MET A 11  ? 0.1179 0.1124 0.1287 0.0123  0.0087  0.0321  11  MET A SD  
62   C  CE  . MET A 11  ? 0.1121 0.1066 0.1302 0.0001  0.0069  0.0000  11  MET A CE  
63   N  N   . ASP A 12  ? 0.0964 0.0723 0.0937 -0.0088 0.0082  0.0058  12  ASP A N   
64   C  CA  . ASP A 12  ? 0.0948 0.0765 0.0963 -0.0015 0.0098  0.0036  12  ASP A CA  
65   C  C   . ASP A 12  ? 0.0717 0.0754 0.1074 -0.0017 -0.0037 0.0074  12  ASP A C   
66   O  O   . ASP A 12  ? 0.1008 0.0794 0.1122 0.0136  0.0085  0.0072  12  ASP A O   
67   C  CB  . ASP A 12  ? 0.0808 0.0853 0.1201 -0.0016 0.0049  0.0110  12  ASP A CB  
68   C  CG  . ASP A 12  ? 0.1046 0.0933 0.1232 -0.0123 0.0208  0.0229  12  ASP A CG  
69   O  OD1 . ASP A 12  ? 0.1225 0.0845 0.1416 -0.0119 -0.0089 0.0230  12  ASP A OD1 
70   O  OD2 . ASP A 12  ? 0.1308 0.1227 0.1272 -0.0027 0.0203  0.0290  12  ASP A OD2 
71   N  N   . GLY A 13  ? 0.0926 0.0682 0.1053 -0.0068 -0.0035 0.0026  13  GLY A N   
72   C  CA  . GLY A 13  ? 0.1019 0.0866 0.1023 -0.0183 -0.0059 0.0076  13  GLY A CA  
73   C  C   . GLY A 13  ? 0.1154 0.0971 0.1138 -0.0250 -0.0085 0.0154  13  GLY A C   
74   O  O   . GLY A 13  ? 0.1336 0.1302 0.1191 -0.0494 -0.0226 0.0303  13  GLY A O   
75   N  N   . VAL A 14  ? 0.0875 0.0785 0.0986 -0.0026 0.0054  0.0001  14  VAL A N   
76   C  CA  . VAL A 14  ? 0.0904 0.0835 0.0908 -0.0067 0.0147  0.0060  14  VAL A CA  
77   C  C   . VAL A 14  ? 0.0893 0.0674 0.1016 -0.0147 0.0078  0.0117  14  VAL A C   
78   O  O   . VAL A 14  ? 0.1042 0.0833 0.1037 -0.0029 0.0236  0.0149  14  VAL A O   
79   C  CB  . VAL A 14  ? 0.0966 0.0777 0.0953 -0.0095 0.0111  0.0111  14  VAL A CB  
80   C  CG1 . VAL A 14  ? 0.1087 0.0807 0.1278 -0.0116 0.0031  0.0109  14  VAL A CG1 
81   C  CG2 . VAL A 14  ? 0.1086 0.0861 0.0956 0.0033  -0.0079 0.0020  14  VAL A CG2 
82   N  N   . LEU A 15  ? 0.0865 0.0773 0.0860 -0.0104 0.0060  0.0023  15  LEU A N   
83   C  CA  . LEU A 15  ? 0.0768 0.0805 0.0958 -0.0161 0.0058  0.0064  15  LEU A CA  
84   C  C   . LEU A 15  ? 0.0923 0.0847 0.0896 0.0035  0.0111  -0.0061 15  LEU A C   
85   O  O   . LEU A 15  ? 0.0947 0.0780 0.1144 -0.0027 0.0189  -0.0031 15  LEU A O   
86   C  CB  . LEU A 15  ? 0.0936 0.0874 0.1041 -0.0022 -0.0015 0.0050  15  LEU A CB  
87   C  CG  . LEU A 15  ? 0.1238 0.1049 0.1089 -0.0264 0.0185  -0.0369 15  LEU A CG  
88   C  CD1 . LEU A 15  ? 0.1365 0.1224 0.1547 -0.0309 -0.0188 -0.0184 15  LEU A CD1 
89   C  CD2 . LEU A 15  ? 0.1286 0.1165 0.1783 -0.0199 0.0435  0.0032  15  LEU A CD2 
90   N  N   . ALA A 16  ? 0.0892 0.0750 0.1066 -0.0103 0.0121  -0.0052 16  ALA A N   
91   C  CA  . ALA A 16  ? 0.0957 0.0787 0.1311 0.0003  0.0131  -0.0020 16  ALA A CA  
92   C  C   . ALA A 16  ? 0.0810 0.0632 0.1455 -0.0076 0.0082  0.0199  16  ALA A C   
93   O  O   . ALA A 16  ? 0.0956 0.0736 0.1441 -0.0085 -0.0013 0.0025  16  ALA A O   
94   C  CB  . ALA A 16  ? 0.1013 0.0843 0.1403 -0.0051 0.0041  0.0139  16  ALA A CB  
95   N  N   . ASP A 17  ? 0.0873 0.0766 0.1548 -0.0107 0.0004  0.0104  17  ASP A N   
96   C  CA  . ASP A 17  ? 0.1001 0.0740 0.1311 -0.0023 0.0083  0.0097  17  ASP A CA  
97   C  C   . ASP A 17  ? 0.0980 0.0641 0.1111 -0.0064 -0.0032 0.0084  17  ASP A C   
98   O  O   . ASP A 17  ? 0.1120 0.0652 0.1354 -0.0057 0.0166  0.0113  17  ASP A O   
99   C  CB  . ASP A 17  ? 0.0961 0.0859 0.1522 -0.0085 0.0227  -0.0122 17  ASP A CB  
100  C  CG  . ASP A 17  ? 0.1343 0.1122 0.1316 -0.0318 0.0127  0.0025  17  ASP A CG  
101  O  OD1 . ASP A 17  ? 0.1271 0.1086 0.1296 -0.0077 -0.0115 0.0154  17  ASP A OD1 
102  O  OD2 . ASP A 17  ? 0.2246 0.1798 0.1360 -0.0632 0.0417  -0.0155 17  ASP A OD2 
103  N  N   . PHE A 18  ? 0.0845 0.0726 0.1204 -0.0065 -0.0004 0.0059  18  PHE A N   
104  C  CA  . PHE A 18  ? 0.1035 0.0737 0.1088 -0.0128 0.0018  0.0019  18  PHE A CA  
105  C  C   . PHE A 18  ? 0.0922 0.0804 0.1157 -0.0115 0.0016  0.0084  18  PHE A C   
106  O  O   . PHE A 18  ? 0.1138 0.0791 0.1054 -0.0165 0.0006  0.0084  18  PHE A O   
107  C  CB  . PHE A 18  ? 0.1031 0.0965 0.1141 0.0142  -0.0031 -0.0015 18  PHE A CB  
108  C  CG  . PHE A 18  ? 0.1051 0.0783 0.1348 -0.0058 0.0114  0.0066  18  PHE A CG  
109  C  CD1 . PHE A 18  ? 0.1159 0.1128 0.1495 -0.0090 0.0010  -0.0130 18  PHE A CD1 
110  C  CD2 . PHE A 18  ? 0.1263 0.0974 0.1413 -0.0016 0.0101  0.0167  18  PHE A CD2 
111  C  CE1 . PHE A 18  ? 0.0969 0.1479 0.1926 0.0135  0.0154  0.0226  18  PHE A CE1 
112  C  CE2 . PHE A 18  ? 0.1334 0.1390 0.1630 0.0067  0.0254  0.0395  18  PHE A CE2 
113  C  CZ  . PHE A 18  ? 0.1273 0.1201 0.1992 0.0062  0.0283  0.0317  18  PHE A CZ  
114  N  N   . GLU A 19  ? 0.0915 0.0676 0.1189 -0.0169 0.0031  0.0063  19  GLU A N   
115  C  CA  . GLU A 19  ? 0.0948 0.0784 0.1403 -0.0042 -0.0156 0.0058  19  GLU A CA  
116  C  C   . GLU A 19  ? 0.1074 0.0715 0.1147 -0.0130 -0.0115 0.0095  19  GLU A C   
117  O  O   . GLU A 19  ? 0.1009 0.0858 0.1226 -0.0221 -0.0188 0.0183  19  GLU A O   
118  C  CB  . GLU A 19  ? 0.1301 0.0799 0.1707 -0.0085 -0.0370 0.0222  19  GLU A CB  
119  C  CG  . GLU A 19  ? 0.1339 0.0812 0.2083 -0.0031 -0.0558 0.0008  19  GLU A CG  
120  C  CD  . GLU A 19  ? 0.1290 0.0828 0.2835 0.0060  -0.0548 -0.0229 19  GLU A CD  
121  O  OE1 . GLU A 19  ? 0.1296 0.0962 0.2294 -0.0020 -0.0547 -0.0210 19  GLU A OE1 
122  O  OE2 . GLU A 19  ? 0.1241 0.1625 0.5138 0.0313  -0.0711 -0.1613 19  GLU A OE2 
123  N  N   . ALA A 20  ? 0.1114 0.0863 0.1200 -0.0260 0.0029  0.0021  20  ALA A N   
124  C  CA  . ALA A 20  ? 0.1151 0.0884 0.1313 -0.0163 0.0110  0.0079  20  ALA A CA  
125  C  C   . ALA A 20  ? 0.1016 0.0883 0.1087 -0.0073 0.0191  -0.0071 20  ALA A C   
126  O  O   . ALA A 20  ? 0.1150 0.0796 0.1326 -0.0168 0.0122  -0.0084 20  ALA A O   
127  C  CB  . ALA A 20  ? 0.1416 0.1222 0.1374 -0.0126 0.0348  0.0139  20  ALA A CB  
128  N  N   . GLY A 21  ? 0.1152 0.0794 0.1241 -0.0075 -0.0003 -0.0043 21  GLY A N   
129  C  CA  . GLY A 21  ? 0.1096 0.0785 0.1497 -0.0184 -0.0278 0.0179  21  GLY A CA  
130  C  C   . GLY A 21  ? 0.1108 0.0754 0.1024 -0.0075 -0.0217 0.0035  21  GLY A C   
131  O  O   . GLY A 21  ? 0.1137 0.0721 0.1403 -0.0066 -0.0167 0.0132  21  GLY A O   
132  N  N   . LEU A 22  ? 0.1102 0.0718 0.1141 -0.0144 -0.0198 0.0152  22  LEU A N   
135  C  C   . LEU A 22  ? 0.0881 0.0652 0.1100 -0.0005 0.0059  -0.0079 22  LEU A C   
136  O  O   . LEU A 22  ? 0.1186 0.0762 0.1208 -0.0216 -0.0003 0.0123  22  LEU A O   
145  N  N   . LEU A 23  ? 0.1064 0.0739 0.1076 -0.0175 -0.0042 0.0018  23  LEU A N   
146  C  CA  . LEU A 23  ? 0.1129 0.0925 0.1059 -0.0093 -0.0110 0.0011  23  LEU A CA  
147  C  C   . LEU A 23  ? 0.1137 0.0813 0.1080 -0.0225 -0.0077 -0.0050 23  LEU A C   
148  O  O   . LEU A 23  ? 0.1319 0.0932 0.1187 -0.0313 -0.0024 0.0035  23  LEU A O   
149  C  CB  . LEU A 23  ? 0.1250 0.1148 0.1110 -0.0120 -0.0148 0.0121  23  LEU A CB  
150  C  CG  . LEU A 23  ? 0.1680 0.1091 0.1099 0.0028  -0.0294 0.0045  23  LEU A CG  
151  C  CD1 . LEU A 23  ? 0.1605 0.1138 0.1661 -0.0137 -0.0452 0.0021  23  LEU A CD1 
152  C  CD2 . LEU A 23  ? 0.2376 0.1605 0.1014 0.0108  -0.0161 0.0090  23  LEU A CD2 
153  N  N   . ARG A 24  ? 0.1198 0.0799 0.1206 -0.0106 0.0120  -0.0090 24  ARG A N   
156  C  C   . ARG A 24  ? 0.1126 0.0853 0.1324 -0.0068 0.0099  0.0013  24  ARG A C   
157  O  O   . ARG A 24  ? 0.1408 0.0843 0.1300 -0.0164 0.0050  -0.0062 24  ARG A O   
172  N  N   . GLY A 25  ? 0.1207 0.0667 0.1411 -0.0052 -0.0023 0.0072  25  GLY A N   
173  C  CA  . GLY A 25  ? 0.1040 0.0783 0.1204 0.0020  -0.0072 0.0037  25  GLY A CA  
174  C  C   . GLY A 25  ? 0.1104 0.0835 0.1057 -0.0026 0.0004  0.0026  25  GLY A C   
175  O  O   . GLY A 25  ? 0.1284 0.0843 0.1612 -0.0075 -0.0075 0.0318  25  GLY A O   
176  N  N   . PHE A 26  ? 0.1083 0.0712 0.1189 -0.0066 0.0010  -0.0005 26  PHE A N   
177  C  CA  . PHE A 26  ? 0.1074 0.0856 0.1079 -0.0122 0.0019  0.0089  26  PHE A CA  
178  C  C   . PHE A 26  ? 0.1149 0.0700 0.1224 -0.0051 -0.0040 0.0083  26  PHE A C   
179  O  O   . PHE A 26  ? 0.1165 0.0797 0.1397 -0.0134 0.0004  0.0101  26  PHE A O   
180  C  CB  . PHE A 26  ? 0.1138 0.0734 0.1147 -0.0009 0.0024  -0.0041 26  PHE A CB  
181  C  CG  . PHE A 26  ? 0.1151 0.0718 0.1373 -0.0116 0.0042  -0.0031 26  PHE A CG  
182  C  CD1 . PHE A 26  ? 0.1235 0.0850 0.1423 -0.0172 -0.0068 0.0036  26  PHE A CD1 
183  C  CD2 . PHE A 26  ? 0.1207 0.0993 0.1523 -0.0037 0.0183  -0.0069 26  PHE A CD2 
184  C  CE1 . PHE A 26  ? 0.1253 0.0946 0.1827 -0.0286 -0.0161 0.0130  26  PHE A CE1 
185  C  CE2 . PHE A 26  ? 0.1269 0.1242 0.1807 -0.0017 0.0361  0.0191  26  PHE A CE2 
186  C  CZ  . PHE A 26  ? 0.1140 0.1057 0.2165 -0.0192 0.0080  0.0250  26  PHE A CZ  
187  N  N   . ARG A 27  ? 0.1295 0.0607 0.1122 -0.0179 -0.0057 -0.0013 27  ARG A N   
190  C  C   . ARG A 27  ? 0.1592 0.0542 0.1702 -0.0134 0.0054  0.0126  27  ARG A C   
191  O  O   . ARG A 27  ? 0.1497 0.0765 0.2033 -0.0187 -0.0199 -0.0132 27  ARG A O   
200  C  CZ  A ARG A 27  ? 0.4965 0.2880 0.1043 0.1749  -0.0586 -0.0032 27  ARG A CZ  
201  C  CZ  B ARG A 27  ? 0.2552 0.1285 0.1714 -0.0199 -0.0109 -0.0370 27  ARG A CZ  
202  N  NH1 A ARG A 27  ? 0.8367 0.2565 0.1173 0.0883  -0.0639 0.0574  27  ARG A NH1 
203  N  NH1 B ARG A 27  ? 0.4185 0.3942 0.2026 -0.1142 0.0114  -0.1761 27  ARG A NH1 
204  N  NH2 A ARG A 27  ? 0.6802 0.3190 0.2861 0.1399  0.0386  -0.1922 27  ARG A NH2 
205  N  NH2 B ARG A 27  ? 0.1778 0.0987 0.2204 -0.0080 -0.0108 -0.0327 27  ARG A NH2 
217  N  N   . ARG A 29  ? 0.1548 0.0943 0.1194 -0.0075 0.0311  0.0140  29  ARG A N   
220  C  C   . ARG A 29  ? 0.1461 0.0644 0.1413 -0.0099 0.0099  0.0126  29  ARG A C   
221  O  O   . ARG A 29  ? 0.1515 0.0748 0.1706 -0.0145 0.0197  0.0133  29  ARG A O   
226  C  CD  A ARG A 29  ? 0.2736 0.1310 0.1179 -0.0135 -0.0905 -0.0146 29  ARG A CD  
227  C  CD  B ARG A 29  ? 0.3465 0.4133 0.3263 0.1047  0.1401  0.1489  29  ARG A CD  
228  N  NE  A ARG A 29  ? 0.3522 0.2256 0.1255 0.0602  -0.0584 0.0447  29  ARG A NE  
229  N  NE  B ARG A 29  ? 0.3877 0.3786 0.2108 -0.1590 0.0658  0.0709  29  ARG A NE  
230  C  CZ  A ARG A 29  ? 0.4332 0.0906 0.1546 -0.0134 0.0399  0.0518  29  ARG A CZ  
231  C  CZ  B ARG A 29  ? 0.2982 0.3807 0.1663 -0.0390 0.0270  0.0232  29  ARG A CZ  
232  N  NH1 A ARG A 29  ? 0.3340 0.1096 0.3702 0.0350  0.1110  -0.0511 29  ARG A NH1 
233  N  NH1 B ARG A 29  ? 0.3006 0.0418 0.1398 0.0392  0.0787  0.0324  29  ARG A NH1 
234  N  NH2 A ARG A 29  ? 0.3834 0.1310 0.2522 -0.0080 0.0854  -0.0346 29  ARG A NH2 
235  N  NH2 B ARG A 29  ? 0.1693 0.6285 0.1795 0.0169  -0.0108 -0.1230 29  ARG A NH2 
236  N  N   . PHE A 30  ? 0.1281 0.0661 0.1648 0.0047  0.0059  0.0093  30  PHE A N   
237  C  CA  . PHE A 30  ? 0.1275 0.0783 0.1740 -0.0077 0.0092  0.0048  30  PHE A CA  
238  C  C   . PHE A 30  ? 0.1320 0.0830 0.1759 -0.0205 0.0052  0.0036  30  PHE A C   
239  O  O   . PHE A 30  ? 0.1278 0.0970 0.1798 -0.0202 -0.0059 -0.0033 30  PHE A O   
240  C  CB  . PHE A 30  ? 0.1283 0.0969 0.1785 0.0155  0.0036  0.0105  30  PHE A CB  
241  C  CG  . PHE A 30  ? 0.1211 0.0749 0.1804 0.0088  0.0212  0.0030  30  PHE A CG  
242  C  CD1 . PHE A 30  ? 0.1274 0.1022 0.1808 -0.0185 0.0240  -0.0110 30  PHE A CD1 
243  C  CD2 . PHE A 30  ? 0.1326 0.0787 0.1725 -0.0044 0.0253  0.0104  30  PHE A CD2 
244  C  CE1 . PHE A 30  ? 0.1772 0.0903 0.1822 -0.0077 0.0416  -0.0103 30  PHE A CE1 
245  C  CE2 . PHE A 30  ? 0.1255 0.1062 0.1741 0.0064  0.0053  0.0052  30  PHE A CE2 
246  C  CZ  . PHE A 30  ? 0.1458 0.1120 0.1527 0.0176  0.0098  -0.0020 30  PHE A CZ  
247  N  N   . PRO A 31  ? 0.1500 0.0939 0.1737 -0.0175 0.0048  0.0037  31  PRO A N   
248  C  CA  . PRO A 31  ? 0.1559 0.1087 0.1809 -0.0237 0.0096  -0.0107 31  PRO A CA  
249  C  C   . PRO A 31  ? 0.1705 0.1024 0.1939 -0.0263 -0.0104 -0.0183 31  PRO A C   
250  O  O   . PRO A 31  ? 0.1814 0.1387 0.2025 -0.0393 -0.0144 -0.0176 31  PRO A O   
251  C  CB  . PRO A 31  ? 0.1510 0.1091 0.2129 -0.0281 0.0048  -0.0250 31  PRO A CB  
252  C  CG  . PRO A 31  ? 0.1723 0.0948 0.2091 -0.0285 -0.0192 -0.0180 31  PRO A CG  
253  C  CD  . PRO A 31  ? 0.2145 0.0614 0.2045 -0.0109 -0.0002 0.0032  31  PRO A CD  
254  N  N   . GLU A 32  ? 0.1589 0.1120 0.2148 -0.0257 -0.0242 -0.0024 32  GLU A N   
255  C  CA  . GLU A 32  ? 0.1668 0.1296 0.2966 -0.0323 -0.0355 -0.0331 32  GLU A CA  
256  C  C   . GLU A 32  ? 0.1690 0.1369 0.2747 -0.0266 -0.0617 -0.0219 32  GLU A C   
257  O  O   . GLU A 32  ? 0.2096 0.2137 0.3266 0.0070  -0.1040 -0.0774 32  GLU A O   
258  C  CB  . GLU A 32  ? 0.1622 0.1097 0.3269 -0.0325 -0.0122 -0.0491 32  GLU A CB  
259  C  CG  . GLU A 32  ? 0.2139 0.1329 0.4819 -0.0016 0.0141  0.0101  32  GLU A CG  
260  C  CD  . GLU A 32  ? 0.3229 0.1755 0.5496 -0.0940 -0.1278 0.1104  32  GLU A CD  
261  O  OE1 . GLU A 32  ? 0.2746 0.2872 0.3939 -0.1418 0.0077  -0.0601 32  GLU A OE1 
262  O  OE2 . GLU A 32  ? 0.6753 0.1716 0.7425 -0.0377 -0.2829 0.1394  32  GLU A OE2 
263  N  N   . GLU A 33  ? 0.1431 0.1156 0.2125 -0.0149 -0.0279 -0.0016 33  GLU A N   
266  C  C   . GLU A 33  ? 0.1720 0.1060 0.2171 -0.0161 0.0024  -0.0009 33  GLU A C   
267  O  O   . GLU A 33  ? 0.1615 0.1454 0.1766 -0.0244 -0.0014 0.0039  33  GLU A O   
278  N  N   . PRO A 34  ? 0.1631 0.0961 0.2313 -0.0309 -0.0353 -0.0047 34  PRO A N   
279  C  CA  . PRO A 34  ? 0.1723 0.1322 0.2310 -0.0507 -0.0706 0.0245  34  PRO A CA  
280  C  C   . PRO A 34  ? 0.1382 0.1193 0.1766 -0.0269 -0.0326 -0.0119 34  PRO A C   
281  O  O   . PRO A 34  ? 0.1328 0.1182 0.1716 -0.0095 -0.0140 -0.0027 34  PRO A O   
282  C  CB  . PRO A 34  ? 0.1742 0.1556 0.3571 -0.0449 -0.1332 0.0623  34  PRO A CB  
283  C  CG  . PRO A 34  ? 0.1837 0.1877 0.2554 0.0112  -0.0287 0.0267  34  PRO A CG  
284  C  CD  . PRO A 34  ? 0.1466 0.1471 0.2822 -0.0266 -0.0493 0.0230  34  PRO A CD  
285  N  N   . HIS A 35  ? 0.1764 0.1284 0.1501 -0.0536 -0.0575 -0.0021 35  HIS A N   
286  C  CA  . HIS A 35  ? 0.1447 0.1225 0.1492 -0.0379 -0.0457 0.0083  35  HIS A CA  
287  C  C   . HIS A 35  ? 0.1192 0.1197 0.1626 -0.0219 -0.0258 0.0043  35  HIS A C   
288  O  O   . HIS A 35  ? 0.1497 0.1277 0.1701 -0.0363 -0.0432 0.0155  35  HIS A O   
289  C  CB  . HIS A 35  ? 0.1669 0.1166 0.1554 -0.0166 -0.0546 0.0033  35  HIS A CB  
290  C  CG  . HIS A 35  ? 0.1822 0.1437 0.1680 -0.0080 -0.0318 0.0086  35  HIS A CG  
291  N  ND1 . HIS A 35  ? 0.2075 0.1939 0.1565 -0.0188 -0.0190 -0.0227 35  HIS A ND1 
292  C  CD2 . HIS A 35  ? 0.1816 0.2183 0.1951 -0.0324 -0.0415 0.0476  35  HIS A CD2 
293  C  CE1 . HIS A 35  ? 0.2838 0.2200 0.1777 0.0186  0.0265  0.0082  35  HIS A CE1 
294  N  NE2 . HIS A 35  ? 0.2085 0.2558 0.2154 0.0139  0.0159  0.0425  35  HIS A NE2 
295  N  N   . VAL A 36  ? 0.1281 0.1078 0.1073 -0.0146 -0.0041 -0.0029 36  VAL A N   
296  C  CA  . VAL A 36  ? 0.1267 0.1135 0.1243 -0.0208 -0.0181 0.0050  36  VAL A CA  
297  C  C   . VAL A 36  ? 0.1295 0.1169 0.1156 -0.0140 -0.0138 0.0181  36  VAL A C   
298  O  O   . VAL A 36  ? 0.1266 0.1210 0.1262 0.0032  -0.0074 0.0097  36  VAL A O   
299  C  CB  . VAL A 36  ? 0.1141 0.1042 0.1373 -0.0099 -0.0140 0.0052  36  VAL A CB  
300  C  CG1 . VAL A 36  ? 0.1858 0.1205 0.1221 -0.0460 -0.0282 0.0063  36  VAL A CG1 
301  C  CG2 . VAL A 36  ? 0.1425 0.1218 0.1558 -0.0108 0.0053  -0.0022 36  VAL A CG2 
302  N  N   . PRO A 37  ? 0.1636 0.1123 0.1222 -0.0292 -0.0098 0.0146  37  PRO A N   
303  C  CA  . PRO A 37  ? 0.1784 0.1165 0.1165 -0.0024 0.0044  0.0124  37  PRO A CA  
304  C  C   . PRO A 37  ? 0.1349 0.1261 0.1138 -0.0069 0.0009  0.0264  37  PRO A C   
305  O  O   . PRO A 37  ? 0.1309 0.1217 0.1090 -0.0140 -0.0090 0.0120  37  PRO A O   
306  C  CB  . PRO A 37  ? 0.2405 0.1747 0.1189 -0.0517 -0.0085 0.0166  37  PRO A CB  
307  C  CG  . PRO A 37  ? 0.2287 0.2355 0.1210 -0.0581 -0.0048 0.0082  37  PRO A CG  
308  C  CD  . PRO A 37  ? 0.2059 0.1510 0.1265 -0.0459 -0.0281 -0.0091 37  PRO A CD  
309  N  N   . LEU A 38  ? 0.1428 0.1316 0.1365 0.0084  -0.0034 0.0129  38  LEU A N   
310  C  CA  . LEU A 38  ? 0.1273 0.1493 0.0870 0.0082  -0.0009 -0.0068 38  LEU A CA  
311  C  C   . LEU A 38  ? 0.1176 0.1300 0.0861 -0.0128 0.0089  -0.0057 38  LEU A C   
312  O  O   . LEU A 38  ? 0.1278 0.1264 0.1058 -0.0211 -0.0041 -0.0181 38  LEU A O   
313  C  CB  . LEU A 38  ? 0.1307 0.2003 0.1153 0.0112  -0.0079 0.0229  38  LEU A CB  
314  C  CG  . LEU A 38  ? 0.1473 0.2117 0.1757 0.0122  -0.0456 0.0281  38  LEU A CG  
315  C  CD1 . LEU A 38  ? 0.1425 0.4008 0.3557 0.0374  -0.0301 0.1624  38  LEU A CD1 
316  C  CD2 . LEU A 38  ? 0.2722 0.2272 0.1467 -0.0004 -0.0622 0.0547  38  LEU A CD2 
317  N  N   . GLU A 39  ? 0.1413 0.1032 0.0926 -0.0007 0.0051  -0.0057 39  GLU A N   
320  C  C   . GLU A 39  ? 0.1343 0.1325 0.0820 0.0049  0.0033  0.0016  39  GLU A C   
321  O  O   . GLU A 39  ? 0.1620 0.1256 0.1023 0.0186  0.0095  0.0006  39  GLU A O   
326  C  CD  A GLU A 39  ? 0.1295 0.3644 0.1436 0.0521  0.0449  0.0571  39  GLU A CD  
327  C  CD  B GLU A 39  ? 0.2126 0.1623 0.1754 0.0707  0.0755  0.0798  39  GLU A CD  
328  O  OE1 A GLU A 39  ? 0.4764 0.3159 0.1897 0.1859  -0.1127 -0.1638 39  GLU A OE1 
329  O  OE1 B GLU A 39  ? 0.2167 0.1408 0.2036 0.0600  0.0842  0.0632  39  GLU A OE1 
330  O  OE2 A GLU A 39  ? 0.1587 0.6499 0.1435 -0.0168 0.0168  0.1547  39  GLU A OE2 
331  O  OE2 B GLU A 39  ? 0.2440 0.2074 0.1797 0.0852  0.0531  0.0507  39  GLU A OE2 
336  C  C   A GLN A 40  ? 0.1194 0.0749 0.0997 -0.0346 0.0148  -0.0094 40  GLN A C   
337  C  C   B GLN A 40  ? 0.1269 0.1091 0.0794 0.0114  0.0050  0.0082  40  GLN A C   
338  O  O   A GLN A 40  ? 0.1183 0.0847 0.0834 -0.0042 -0.0163 0.0030  40  GLN A O   
339  O  O   B GLN A 40  ? 0.1044 0.0871 0.1411 -0.0161 0.0099  -0.0074 40  GLN A O   
342  C  CG  A GLN A 40  ? 0.1293 0.2172 0.1013 -0.0496 -0.0248 0.0271  40  GLN A CG  
343  C  CG  B GLN A 40  ? 0.1586 0.1990 0.0755 -0.0396 0.0219  -0.0253 40  GLN A CG  
344  C  CD  A GLN A 40  ? 0.3035 0.2207 0.2189 -0.1017 -0.0681 0.0633  40  GLN A CD  
345  C  CD  B GLN A 40  ? 0.1391 0.3248 0.1469 -0.0086 -0.0235 0.0020  40  GLN A CD  
346  O  OE1 A GLN A 40  ? 0.2151 0.2297 0.2709 -0.1587 -0.0659 -0.0042 40  GLN A OE1 
347  O  OE1 B GLN A 40  ? 0.1760 0.3930 0.1722 0.0298  0.0176  -0.0019 40  GLN A OE1 
348  N  NE2 A GLN A 40  ? 0.1949 0.2089 0.2060 -0.1304 -0.1176 0.0589  40  GLN A NE2 
349  N  NE2 B GLN A 40  ? 0.1254 0.2235 0.1414 0.0552  -0.0169 0.0022  40  GLN A NE2 
350  N  N   . ARG A 41  ? 0.1113 0.1072 0.0958 -0.0091 0.0064  0.0092  41  ARG A N   
351  C  CA  . ARG A 41  ? 0.1110 0.1043 0.1064 -0.0003 -0.0088 -0.0015 41  ARG A CA  
352  C  C   . ARG A 41  ? 0.0914 0.1043 0.1087 -0.0090 0.0018  0.0044  41  ARG A C   
353  O  O   . ARG A 41  ? 0.1039 0.1104 0.1105 -0.0118 0.0040  0.0042  41  ARG A O   
354  C  CB  . ARG A 41  ? 0.0888 0.1051 0.1027 -0.0045 0.0024  0.0020  41  ARG A CB  
355  C  CG  . ARG A 41  ? 0.1057 0.1020 0.1073 -0.0071 -0.0077 -0.0061 41  ARG A CG  
356  C  CD  . ARG A 41  ? 0.1083 0.0977 0.1035 -0.0131 -0.0145 0.0019  41  ARG A CD  
357  N  NE  . ARG A 41  ? 0.0957 0.0849 0.1025 0.0020  -0.0099 0.0007  41  ARG A NE  
358  C  CZ  . ARG A 41  ? 0.1020 0.0730 0.0978 -0.0074 -0.0008 0.0097  41  ARG A CZ  
359  N  NH1 . ARG A 41  ? 0.1024 0.0865 0.1096 0.0025  -0.0023 -0.0058 41  ARG A NH1 
360  N  NH2 . ARG A 41  ? 0.1107 0.0820 0.1045 -0.0092 -0.0137 0.0003  41  ARG A NH2 
361  N  N   . ARG A 42  ? 0.0989 0.0933 0.1075 -0.0100 -0.0025 -0.0011 42  ARG A N   
362  C  CA  . ARG A 42  ? 0.1023 0.1057 0.1159 0.0100  0.0008  0.0194  42  ARG A CA  
363  C  C   . ARG A 42  ? 0.1005 0.1021 0.1192 0.0027  -0.0032 0.0071  42  ARG A C   
364  O  O   . ARG A 42  ? 0.0891 0.1234 0.1216 -0.0095 0.0002  0.0118  42  ARG A O   
365  C  CB  . ARG A 42  ? 0.1126 0.1215 0.1254 0.0087  -0.0083 0.0012  42  ARG A CB  
366  C  CG  . ARG A 42  ? 0.1255 0.1187 0.1200 -0.0010 -0.0129 0.0057  42  ARG A CG  
367  C  CD  . ARG A 42  ? 0.1480 0.1158 0.1191 -0.0038 -0.0171 0.0021  42  ARG A CD  
368  N  NE  . ARG A 42  ? 0.1666 0.1481 0.1149 0.0084  -0.0042 0.0133  42  ARG A NE  
369  C  CZ  . ARG A 42  ? 0.1480 0.1720 0.1156 0.0005  0.0088  0.0069  42  ARG A CZ  
370  N  NH1 . ARG A 42  ? 0.1507 0.1270 0.1215 -0.0156 -0.0003 -0.0049 42  ARG A NH1 
371  N  NH2 . ARG A 42  ? 0.2281 0.2007 0.1225 0.0331  -0.0099 -0.0062 42  ARG A NH2 
372  N  N   . GLY A 43  ? 0.1397 0.0995 0.1216 -0.0111 -0.0148 0.0224  43  GLY A N   
373  C  CA  . GLY A 43  ? 0.1326 0.0986 0.1402 0.0005  -0.0178 -0.0042 43  GLY A CA  
374  C  C   . GLY A 43  ? 0.1362 0.0860 0.1147 0.0013  0.0004  -0.0019 43  GLY A C   
375  O  O   . GLY A 43  ? 0.1145 0.0952 0.1266 0.0001  -0.0083 0.0017  43  GLY A O   
376  N  N   . PHE A 44  ? 0.1004 0.0883 0.1289 0.0024  -0.0014 0.0040  44  PHE A N   
377  C  CA  . PHE A 44  ? 0.1098 0.0915 0.1519 -0.0140 -0.0169 0.0078  44  PHE A CA  
378  C  C   . PHE A 44  ? 0.1195 0.0926 0.1572 -0.0076 -0.0332 0.0168  44  PHE A C   
379  O  O   . PHE A 44  ? 0.1414 0.0842 0.2759 -0.0086 -0.0757 0.0192  44  PHE A O   
380  C  CB  . PHE A 44  ? 0.1164 0.0883 0.1333 -0.0100 -0.0030 0.0111  44  PHE A CB  
381  C  CG  . PHE A 44  ? 0.1104 0.0896 0.1448 -0.0144 -0.0057 -0.0077 44  PHE A CG  
382  C  CD1 . PHE A 44  ? 0.1169 0.1046 0.1554 -0.0193 -0.0026 0.0118  44  PHE A CD1 
383  C  CD2 . PHE A 44  ? 0.1374 0.1164 0.1356 0.0060  -0.0091 -0.0169 44  PHE A CD2 
384  C  CE1 . PHE A 44  ? 0.1157 0.1372 0.1758 0.0049  -0.0077 -0.0163 44  PHE A CE1 
385  C  CE2 . PHE A 44  ? 0.1469 0.1534 0.1487 -0.0167 -0.0186 -0.0070 44  PHE A CE2 
386  C  CZ  . PHE A 44  ? 0.1391 0.1561 0.1755 0.0293  -0.0203 -0.0025 44  PHE A CZ  
387  N  N   . LEU A 45  ? 0.1426 0.0868 0.1499 -0.0190 -0.0120 0.0141  45  LEU A N   
388  C  CA  . LEU A 45  ? 0.2006 0.1182 0.1342 -0.0529 -0.0178 0.0172  45  LEU A CA  
389  C  C   . LEU A 45  ? 0.1595 0.1020 0.1238 -0.0172 -0.0424 0.0245  45  LEU A C   
390  O  O   . LEU A 45  ? 0.1308 0.1054 0.1243 -0.0111 -0.0179 0.0124  45  LEU A O   
391  C  CB  . LEU A 45  ? 0.2849 0.1792 0.1394 -0.0619 0.0412  -0.0118 45  LEU A CB  
392  C  CG  . LEU A 45  ? 0.2940 0.1978 0.1658 -0.0852 0.0512  -0.0304 45  LEU A CG  
393  C  CD1 . LEU A 45  ? 0.3814 0.1965 0.2858 -0.0796 0.1475  -0.0533 45  LEU A CD1 
394  C  CD2 . LEU A 45  ? 0.3655 0.2986 0.1896 -0.1424 -0.0139 0.0056  45  LEU A CD2 
395  N  N   . ALA A 46  ? 0.1259 0.1122 0.1596 -0.0335 -0.0340 0.0368  46  ALA A N   
396  C  CA  . ALA A 46  ? 0.1056 0.1109 0.1434 -0.0079 0.0005  0.0257  46  ALA A CA  
397  C  C   . ALA A 46  ? 0.1027 0.0894 0.1339 -0.0065 -0.0008 0.0095  46  ALA A C   
398  O  O   . ALA A 46  ? 0.1094 0.0989 0.1483 -0.0077 0.0084  -0.0161 46  ALA A O   
399  C  CB  . ALA A 46  ? 0.0972 0.1519 0.1751 0.0032  -0.0092 0.0384  46  ALA A CB  
400  N  N   . ARG A 47  ? 0.1080 0.0884 0.1380 -0.0233 -0.0122 0.0270  47  ARG A N   
403  C  C   . ARG A 47  ? 0.1137 0.0942 0.1097 -0.0087 0.0125  0.0176  47  ARG A C   
404  O  O   . ARG A 47  ? 0.1108 0.0859 0.1510 -0.0070 -0.0018 0.0119  47  ARG A O   
411  N  NE  A ARG A 47  ? 0.3117 0.2572 0.2717 0.0035  0.0924  0.1058  47  ARG A NE  
412  N  NE  B ARG A 47  ? 0.1898 0.2629 0.1272 -0.0118 -0.0170 0.0724  47  ARG A NE  
413  C  CZ  A ARG A 47  ? 0.5134 0.1805 0.2393 0.0640  0.1173  0.0662  47  ARG A CZ  
414  C  CZ  B ARG A 47  ? 0.2098 0.2752 0.1541 -0.1074 -0.0092 0.0225  47  ARG A CZ  
415  N  NH1 A ARG A 47  ? 0.5343 0.1738 0.3005 0.2095  0.3013  0.0965  47  ARG A NH1 
416  N  NH1 B ARG A 47  ? 0.4553 0.2400 0.1413 -0.0916 0.0112  0.0278  47  ARG A NH1 
417  N  NH2 A ARG A 47  ? 0.9379 0.1419 0.2920 0.0413  -0.0224 -0.0574 47  ARG A NH2 
418  N  NH2 B ARG A 47  ? 0.4689 0.2943 0.0861 -0.0225 0.0166  0.0004  47  ARG A NH2 
419  N  N   . GLU A 48  ? 0.0893 0.0915 0.1449 -0.0028 -0.0031 0.0028  48  GLU A N   
420  C  CA  . GLU A 48  ? 0.0957 0.1040 0.1326 0.0001  0.0058  0.0095  48  GLU A CA  
421  C  C   . GLU A 48  ? 0.0962 0.1040 0.1321 0.0060  -0.0014 0.0143  48  GLU A C   
422  O  O   . GLU A 48  ? 0.0880 0.1205 0.1497 0.0029  -0.0008 0.0165  48  GLU A O   
423  C  CB  . GLU A 48  ? 0.1272 0.1053 0.1472 0.0160  -0.0151 0.0051  48  GLU A CB  
424  C  CG  . GLU A 48  ? 0.1390 0.1100 0.1587 0.0149  -0.0129 -0.0130 48  GLU A CG  
425  C  CD  . GLU A 48  ? 0.1870 0.1552 0.1480 0.0220  0.0201  -0.0056 48  GLU A CD  
426  O  OE1 . GLU A 48  ? 0.2803 0.2012 0.1611 -0.0217 -0.0300 0.0294  48  GLU A OE1 
427  O  OE2 . GLU A 48  ? 0.1784 0.1881 0.2146 0.0071  0.0466  0.0343  48  GLU A OE2 
428  N  N   . GLN A 49  ? 0.0777 0.1031 0.1240 -0.0062 -0.0112 0.0046  49  GLN A N   
429  C  CA  . GLN A 49  ? 0.0952 0.1020 0.1244 -0.0091 -0.0104 0.0087  49  GLN A CA  
430  C  C   . GLN A 49  ? 0.1022 0.1051 0.1131 -0.0134 0.0080  0.0129  49  GLN A C   
431  O  O   . GLN A 49  ? 0.1205 0.1240 0.1193 -0.0314 -0.0174 0.0131  49  GLN A O   
432  C  CB  . GLN A 49  ? 0.1096 0.1011 0.1239 -0.0177 -0.0077 0.0056  49  GLN A CB  
433  C  CG  . GLN A 49  ? 0.1091 0.1393 0.1188 -0.0208 -0.0056 0.0143  49  GLN A CG  
434  C  CD  . GLN A 49  ? 0.1068 0.1062 0.1246 -0.0155 -0.0139 0.0202  49  GLN A CD  
435  O  OE1 . GLN A 49  ? 0.1119 0.1141 0.1201 -0.0263 -0.0054 0.0116  49  GLN A OE1 
436  N  NE2 . GLN A 49  ? 0.1104 0.1756 0.1227 -0.0218 -0.0124 0.0187  49  GLN A NE2 
437  N  N   . TYR A 50  ? 0.0961 0.0981 0.1118 -0.0165 0.0023  0.0085  50  TYR A N   
438  C  CA  . TYR A 50  ? 0.1013 0.0901 0.1190 -0.0112 0.0088  0.0014  50  TYR A CA  
439  C  C   . TYR A 50  ? 0.0981 0.1104 0.1040 -0.0103 0.0039  0.0107  50  TYR A C   
440  O  O   . TYR A 50  ? 0.1058 0.1111 0.1352 -0.0180 0.0003  0.0048  50  TYR A O   
441  C  CB  . TYR A 50  ? 0.0977 0.0943 0.1258 -0.0133 0.0070  0.0065  50  TYR A CB  
442  C  CG  . TYR A 50  ? 0.0977 0.0939 0.1096 -0.0122 0.0073  0.0050  50  TYR A CG  
443  C  CD1 . TYR A 50  ? 0.1029 0.0822 0.1203 -0.0061 0.0074  0.0019  50  TYR A CD1 
444  C  CD2 . TYR A 50  ? 0.1169 0.1006 0.1339 -0.0244 0.0211  -0.0058 50  TYR A CD2 
445  C  CE1 . TYR A 50  ? 0.1076 0.1036 0.1096 -0.0126 0.0119  0.0012  50  TYR A CE1 
446  C  CE2 . TYR A 50  ? 0.1214 0.0964 0.1432 0.0022  0.0202  0.0082  50  TYR A CE2 
447  C  CZ  . TYR A 50  ? 0.1146 0.0926 0.1269 0.0037  0.0223  0.0072  50  TYR A CZ  
448  O  OH  . TYR A 50  ? 0.1241 0.1041 0.1234 -0.0090 0.0152  -0.0047 50  TYR A OH  
449  N  N   . ARG A 51  ? 0.0792 0.1221 0.1103 -0.0070 0.0017  0.0020  51  ARG A N   
450  C  CA  . ARG A 51  ? 0.0815 0.1152 0.1161 0.0027  0.0067  0.0120  51  ARG A CA  
451  C  C   . ARG A 51  ? 0.0923 0.1143 0.1199 -0.0016 -0.0018 0.0052  51  ARG A C   
452  O  O   . ARG A 51  ? 0.0853 0.1217 0.1363 -0.0014 -0.0042 0.0029  51  ARG A O   
453  C  CB  . ARG A 51  ? 0.0867 0.1299 0.1215 0.0032  0.0018  0.0044  51  ARG A CB  
454  C  CG  . ARG A 51  ? 0.1153 0.1549 0.1034 0.0072  0.0152  0.0131  51  ARG A CG  
455  C  CD  . ARG A 51  ? 0.1244 0.1606 0.1245 0.0289  0.0154  0.0110  51  ARG A CD  
456  N  NE  . ARG A 51  ? 0.1389 0.1356 0.1382 0.0140  0.0112  -0.0046 51  ARG A NE  
457  C  CZ  . ARG A 51  ? 0.1524 0.1393 0.1538 0.0140  -0.0111 -0.0063 51  ARG A CZ  
458  N  NH1 . ARG A 51  ? 0.1493 0.1602 0.1500 0.0250  0.0180  0.0164  51  ARG A NH1 
459  N  NH2 . ARG A 51  ? 0.1326 0.2085 0.1625 0.0134  -0.0027 -0.0258 51  ARG A NH2 
460  N  N   . ALA A 52  ? 0.1010 0.1149 0.1379 0.0078  -0.0149 0.0220  52  ALA A N   
461  C  CA  . ALA A 52  ? 0.1150 0.1245 0.1597 0.0063  -0.0270 0.0273  52  ALA A CA  
462  C  C   . ALA A 52  ? 0.1253 0.1313 0.1475 -0.0056 -0.0256 0.0260  52  ALA A C   
463  O  O   . ALA A 52  ? 0.1293 0.1809 0.2059 -0.0122 -0.0493 0.0156  52  ALA A O   
464  C  CB  . ALA A 52  ? 0.1971 0.1360 0.1417 -0.0240 -0.0469 0.0380  52  ALA A CB  
465  N  N   . LEU A 53  ? 0.1379 0.1359 0.1226 -0.0042 -0.0299 0.0044  53  LEU A N   
466  C  CA  . LEU A 53  ? 0.1494 0.1237 0.1551 -0.0217 -0.0253 -0.0034 53  LEU A CA  
467  C  C   . LEU A 53  ? 0.1232 0.1570 0.1703 -0.0260 -0.0295 0.0012  53  LEU A C   
468  O  O   . LEU A 53  ? 0.1813 0.1598 0.1813 -0.0453 -0.0532 0.0032  53  LEU A O   
469  C  CB  . LEU A 53  ? 0.1506 0.1543 0.1222 -0.0165 -0.0073 0.0092  53  LEU A CB  
470  C  CG  . LEU A 53  ? 0.1739 0.1926 0.1594 -0.0099 -0.0095 -0.0253 53  LEU A CG  
471  C  CD1 . LEU A 53  ? 0.2516 0.2531 0.1575 -0.0581 -0.0427 -0.0316 53  LEU A CD1 
472  C  CD2 . LEU A 53  ? 0.1669 0.2010 0.1953 -0.0335 0.0338  -0.0310 53  LEU A CD2 
473  N  N   . ARG A 54  ? 0.1271 0.1218 0.1688 -0.0138 -0.0204 0.0045  54  ARG A N   
474  C  CA  . ARG A 54  ? 0.0911 0.1353 0.1850 -0.0069 -0.0163 0.0044  54  ARG A CA  
475  C  C   . ARG A 54  ? 0.1095 0.1235 0.1736 0.0157  -0.0153 0.0190  54  ARG A C   
476  O  O   . ARG A 54  ? 0.1025 0.1174 0.1610 -0.0031 -0.0056 0.0276  54  ARG A O   
477  C  CB  . ARG A 54  ? 0.1262 0.1315 0.2136 -0.0271 -0.0279 -0.0053 54  ARG A CB  
478  C  CG  . ARG A 54  ? 0.1510 0.1378 0.3362 -0.0415 -0.0343 0.0120  54  ARG A CG  
479  C  CD  . ARG A 54  ? 0.1936 0.1637 0.3262 -0.0486 -0.0789 -0.0467 54  ARG A CD  
480  N  NE  . ARG A 54  ? 0.1928 0.1242 0.2952 -0.0325 -0.0111 -0.0220 54  ARG A NE  
481  C  CZ  . ARG A 54  ? 0.1431 0.1415 0.2831 -0.0492 0.0467  -0.0129 54  ARG A CZ  
482  N  NH1 . ARG A 54  ? 0.1794 0.1529 0.3980 -0.0295 0.0048  0.0208  54  ARG A NH1 
483  N  NH2 . ARG A 54  ? 0.2188 0.2168 0.3190 -0.0296 0.0648  -0.0718 54  ARG A NH2 
484  N  N   . PRO A 55  ? 0.0969 0.1235 0.1854 -0.0073 -0.0223 -0.0045 55  PRO A N   
485  C  CA  . PRO A 55  ? 0.1040 0.1316 0.1709 0.0019  -0.0011 0.0147  55  PRO A CA  
486  C  C   . PRO A 55  ? 0.0913 0.1237 0.1565 0.0071  0.0151  0.0016  55  PRO A C   
487  O  O   . PRO A 55  ? 0.1096 0.1328 0.1763 0.0133  -0.0092 0.0088  55  PRO A O   
488  C  CB  . PRO A 55  ? 0.0954 0.1347 0.2178 0.0010  -0.0011 -0.0069 55  PRO A CB  
489  C  CG  . PRO A 55  ? 0.1008 0.1676 0.2316 -0.0007 -0.0128 -0.0028 55  PRO A CG  
490  C  CD  . PRO A 55  ? 0.1001 0.1688 0.2202 0.0094  -0.0261 -0.0009 55  PRO A CD  
491  N  N   . ASP A 56  ? 0.1089 0.1190 0.1881 -0.0031 0.0153  0.0208  56  ASP A N   
492  C  CA  . ASP A 56  ? 0.1054 0.1089 0.1796 0.0013  0.0266  0.0129  56  ASP A CA  
493  C  C   . ASP A 56  ? 0.1040 0.1312 0.1851 0.0030  0.0214  0.0372  56  ASP A C   
494  O  O   . ASP A 56  ? 0.1156 0.1512 0.1833 0.0241  0.0294  0.0480  56  ASP A O   
495  C  CB  . ASP A 56  ? 0.1775 0.1153 0.2601 -0.0383 -0.0019 0.0498  56  ASP A CB  
496  C  CG  . ASP A 56  ? 0.1913 0.1154 0.2819 -0.0208 -0.0523 -0.0228 56  ASP A CG  
497  O  OD1 . ASP A 56  ? 0.2910 0.1723 0.2701 0.0600  -0.0756 -0.0430 56  ASP A OD1 
498  O  OD2 . ASP A 56  ? 0.2168 0.1628 0.3175 0.0240  0.0074  0.0399  56  ASP A OD2 
499  N  N   . LEU A 57  ? 0.0944 0.1065 0.1624 0.0085  0.0206  0.0157  57  LEU A N   
500  C  CA  . LEU A 57  ? 0.0860 0.1181 0.1433 0.0058  0.0044  0.0133  57  LEU A CA  
501  C  C   . LEU A 57  ? 0.0922 0.1033 0.1269 0.0049  0.0114  0.0268  57  LEU A C   
502  O  O   . LEU A 57  ? 0.0933 0.1415 0.1490 0.0008  -0.0011 0.0142  57  LEU A O   
503  C  CB  . LEU A 57  ? 0.1074 0.1207 0.1381 0.0156  0.0062  0.0062  57  LEU A CB  
504  C  CG  . LEU A 57  ? 0.1076 0.1432 0.1559 0.0100  0.0080  -0.0155 57  LEU A CG  
505  C  CD1 . LEU A 57  ? 0.1595 0.2373 0.1410 -0.0283 0.0299  -0.0213 57  LEU A CD1 
506  C  CD2 . LEU A 57  ? 0.1077 0.1391 0.2361 0.0012  0.0251  -0.0359 57  LEU A CD2 
507  N  N   . ALA A 58  ? 0.1062 0.1004 0.1704 0.0122  -0.0083 0.0089  58  ALA A N   
508  C  CA  . ALA A 58  ? 0.1060 0.1033 0.1588 0.0003  0.0019  0.0109  58  ALA A CA  
509  C  C   . ALA A 58  ? 0.1034 0.1165 0.1668 0.0172  0.0050  0.0155  58  ALA A C   
510  O  O   . ALA A 58  ? 0.1146 0.1242 0.1605 0.0013  -0.0047 0.0010  58  ALA A O   
511  C  CB  . ALA A 58  ? 0.0989 0.1080 0.1758 0.0139  -0.0150 0.0093  58  ALA A CB  
512  N  N   . ASP A 59  ? 0.1073 0.1233 0.1437 0.0152  0.0121  0.0126  59  ASP A N   
513  C  CA  . ASP A 59  ? 0.1080 0.1336 0.1571 0.0297  0.0108  0.0159  59  ASP A CA  
514  C  C   . ASP A 59  ? 0.0991 0.0980 0.1420 0.0053  0.0103  0.0195  59  ASP A C   
515  O  O   . ASP A 59  ? 0.0988 0.1457 0.1233 0.0231  0.0114  0.0167  59  ASP A O   
516  C  CB  . ASP A 59  ? 0.1206 0.2422 0.1856 0.0542  0.0406  0.0789  59  ASP A CB  
517  C  CG  . ASP A 59  ? 0.1573 0.3499 0.1689 0.0527  0.0420  0.0211  59  ASP A CG  
518  O  OD1 . ASP A 59  ? 0.2289 0.3413 0.2144 0.0832  0.0464  -0.0346 59  ASP A OD1 
519  O  OD2 . ASP A 59  ? 0.2624 0.4811 0.2780 0.0007  0.1628  0.0025  59  ASP A OD2 
520  N  N   . LYS A 60  ? 0.0954 0.1048 0.1405 -0.0052 0.0142  0.0144  60  LYS A N   
521  C  CA  . LYS A 60  ? 0.0998 0.1116 0.1367 0.0092  0.0147  0.0229  60  LYS A CA  
522  C  C   . LYS A 60  ? 0.1140 0.0959 0.1232 0.0131  0.0172  0.0016  60  LYS A C   
523  O  O   . LYS A 60  ? 0.0980 0.1083 0.1289 0.0078  0.0033  0.0059  60  LYS A O   
524  C  CB  . LYS A 60  ? 0.1183 0.0806 0.1678 0.0100  0.0104  0.0115  60  LYS A CB  
525  C  CG  . LYS A 60  ? 0.1264 0.1065 0.1790 -0.0036 0.0017  0.0194  60  LYS A CG  
526  C  CD  . LYS A 60  ? 0.1622 0.1071 0.2061 -0.0037 -0.0269 0.0125  60  LYS A CD  
527  C  CE  . LYS A 60  ? 0.1831 0.1466 0.3124 -0.0516 -0.0001 -0.0017 60  LYS A CE  
528  N  NZ  . LYS A 60  ? 0.2614 0.2253 0.2994 -0.1046 -0.0080 0.0060  60  LYS A NZ  
529  N  N   . VAL A 61  ? 0.0911 0.1119 0.1238 0.0072  0.0120  0.0181  61  VAL A N   
530  C  CA  . VAL A 61  ? 0.0952 0.1239 0.1452 -0.0064 0.0070  0.0255  61  VAL A CA  
531  C  C   . VAL A 61  ? 0.0912 0.0938 0.1546 0.0098  0.0127  0.0223  61  VAL A C   
532  O  O   . VAL A 61  ? 0.0990 0.1194 0.1334 -0.0035 0.0077  0.0205  61  VAL A O   
533  C  CB  . VAL A 61  ? 0.1106 0.1246 0.1718 -0.0063 0.0018  0.0459  61  VAL A CB  
534  C  CG1 . VAL A 61  ? 0.1319 0.1254 0.1775 -0.0084 0.0026  0.0267  61  VAL A CG1 
535  C  CG2 . VAL A 61  ? 0.1385 0.1503 0.1990 0.0187  0.0308  0.0753  61  VAL A CG2 
536  N  N   . ALA A 62  ? 0.0986 0.1046 0.1605 -0.0058 0.0159  0.0083  62  ALA A N   
537  C  CA  . ALA A 62  ? 0.1084 0.1168 0.1802 0.0119  0.0036  -0.0132 62  ALA A CA  
538  C  C   . ALA A 62  ? 0.1074 0.1193 0.1677 -0.0150 -0.0017 0.0073  62  ALA A C   
539  O  O   . ALA A 62  ? 0.1081 0.1287 0.1662 0.0010  -0.0165 -0.0278 62  ALA A O   
540  C  CB  . ALA A 62  ? 0.1388 0.1642 0.1731 0.0187  0.0106  -0.0201 62  ALA A CB  
541  N  N   . SER A 63  ? 0.1074 0.1229 0.1275 -0.0164 0.0067  0.0200  63  SER A N   
542  C  CA  . SER A 63  ? 0.1165 0.1280 0.1458 -0.0101 0.0119  0.0299  63  SER A CA  
543  C  C   . SER A 63  ? 0.1140 0.1267 0.1337 -0.0073 0.0110  0.0415  63  SER A C   
544  O  O   . SER A 63  ? 0.1302 0.1726 0.1255 0.0096  0.0086  0.0403  63  SER A O   
545  C  CB  . SER A 63  ? 0.1112 0.1237 0.1896 -0.0098 0.0122  0.0372  63  SER A CB  
546  O  OG  . SER A 63  ? 0.1776 0.1470 0.1799 -0.0357 -0.0332 0.0404  63  SER A OG  
547  N  N   . VAL A 64  ? 0.0978 0.0948 0.1198 -0.0065 -0.0059 0.0133  64  VAL A N   
548  C  CA  . VAL A 64  ? 0.1006 0.0928 0.1196 -0.0110 -0.0024 0.0110  64  VAL A CA  
549  C  C   . VAL A 64  ? 0.1051 0.0995 0.1024 -0.0134 0.0010  0.0058  64  VAL A C   
550  O  O   . VAL A 64  ? 0.1008 0.0987 0.1225 -0.0096 0.0022  0.0003  64  VAL A O   
551  C  CB  . VAL A 64  ? 0.1200 0.0956 0.1134 -0.0019 0.0059  -0.0195 64  VAL A CB  
552  C  CG1 . VAL A 64  ? 0.0908 0.1206 0.1273 -0.0071 -0.0049 0.0131  64  VAL A CG1 
553  C  CG2 . VAL A 64  ? 0.1211 0.1169 0.1188 -0.0271 0.0213  -0.0193 64  VAL A CG2 
554  N  N   . TYR A 65  ? 0.0976 0.0958 0.1280 -0.0120 -0.0045 -0.0025 65  TYR A N   
555  C  CA  . TYR A 65  ? 0.1080 0.0989 0.1220 -0.0171 -0.0050 -0.0030 65  TYR A CA  
556  C  C   . TYR A 65  ? 0.1151 0.1180 0.1285 -0.0185 -0.0055 -0.0016 65  TYR A C   
557  O  O   . TYR A 65  ? 0.1389 0.1467 0.1337 -0.0471 -0.0002 -0.0236 65  TYR A O   
558  C  CB  . TYR A 65  ? 0.1301 0.0996 0.1629 -0.0205 0.0070  0.0193  65  TYR A CB  
559  C  CG  . TYR A 65  ? 0.1195 0.0846 0.2231 -0.0280 -0.0062 0.0278  65  TYR A CG  
560  C  CD1 . TYR A 65  ? 0.1209 0.1187 0.3069 -0.0146 -0.0012 -0.0706 65  TYR A CD1 
561  C  CD2 . TYR A 65  ? 0.1374 0.1970 0.2505 -0.0333 -0.0202 0.1187  65  TYR A CD2 
562  C  CE1 . TYR A 65  ? 0.1205 0.1029 0.4273 -0.0143 0.0312  -0.0455 65  TYR A CE1 
563  C  CE2 . TYR A 65  ? 0.1747 0.1802 0.3911 0.0255  -0.0431 0.1493  65  TYR A CE2 
564  C  CZ  . TYR A 65  ? 0.1319 0.1122 0.4746 0.0017  0.0173  0.0844  65  TYR A CZ  
565  O  OH  . TYR A 65  ? 0.1609 0.1850 0.6763 0.0620  0.0428  0.1179  65  TYR A OH  
566  N  N   . GLU A 66  ? 0.1303 0.1136 0.1232 -0.0261 0.0023  -0.0062 66  GLU A N   
567  C  CA  . GLU A 66  ? 0.1465 0.1369 0.1233 -0.0212 -0.0006 -0.0142 66  GLU A CA  
568  C  C   . GLU A 66  ? 0.1650 0.1405 0.1133 -0.0322 0.0095  0.0173  66  GLU A C   
569  O  O   . GLU A 66  ? 0.2214 0.1628 0.1151 -0.0523 -0.0025 0.0243  66  GLU A O   
570  C  CB  . GLU A 66  ? 0.1567 0.2090 0.1313 -0.0327 0.0150  -0.0285 66  GLU A CB  
571  C  CG  . GLU A 66  ? 0.1542 0.2275 0.2379 0.0026  0.0213  -0.0669 66  GLU A CG  
572  C  CD  . GLU A 66  ? 0.1400 0.3825 0.2422 0.0278  -0.0231 -0.0869 66  GLU A CD  
573  O  OE1 . GLU A 66  ? 0.2051 0.5423 0.4114 -0.1749 0.1039  -0.2344 66  GLU A OE1 
574  O  OE2 . GLU A 66  ? 0.2516 0.4970 0.4020 0.1922  -0.0759 -0.1296 66  GLU A OE2 
575  N  N   . ALA A 67  ? 0.1272 0.1269 0.1313 -0.0141 -0.0033 0.0182  67  ALA A N   
576  C  CA  . ALA A 67  ? 0.1326 0.1403 0.1394 -0.0152 -0.0075 0.0471  67  ALA A CA  
577  C  C   . ALA A 67  ? 0.1294 0.1279 0.1107 -0.0119 0.0036  0.0243  67  ALA A C   
578  O  O   . ALA A 67  ? 0.1343 0.1280 0.1340 -0.0170 -0.0173 0.0466  67  ALA A O   
579  C  CB  . ALA A 67  ? 0.1613 0.1025 0.2189 -0.0354 -0.0232 0.0212  67  ALA A CB  
580  N  N   . PRO A 68  ? 0.1384 0.1267 0.1569 -0.0334 -0.0190 0.0525  68  PRO A N   
581  C  CA  . PRO A 68  ? 0.1406 0.1610 0.1277 -0.0178 -0.0190 0.0542  68  PRO A CA  
582  C  C   . PRO A 68  ? 0.1472 0.0946 0.1393 -0.0172 -0.0235 0.0363  68  PRO A C   
583  O  O   . PRO A 68  ? 0.1499 0.1045 0.1643 -0.0191 -0.0153 0.0239  68  PRO A O   
584  C  CB  . PRO A 68  ? 0.1837 0.1894 0.1839 0.0022  -0.0096 0.1004  68  PRO A CB  
585  C  CG  . PRO A 68  ? 0.1989 0.2033 0.1870 -0.0253 -0.0101 0.1002  68  PRO A CG  
586  C  CD  . PRO A 68  ? 0.1721 0.1567 0.1443 -0.0378 0.0021  0.0572  68  PRO A CD  
587  N  N   . GLY A 69  ? 0.1301 0.1251 0.1377 -0.0178 -0.0273 0.0477  69  GLY A N   
588  C  CA  . GLY A 69  ? 0.1428 0.1030 0.1518 -0.0058 -0.0184 0.0316  69  GLY A CA  
589  C  C   . GLY A 69  ? 0.1075 0.1118 0.1208 -0.0144 -0.0155 0.0106  69  GLY A C   
590  O  O   . GLY A 69  ? 0.1197 0.1162 0.1537 -0.0157 0.0108  0.0205  69  GLY A O   
591  N  N   . PHE A 70  ? 0.1085 0.0994 0.1314 -0.0135 -0.0063 0.0269  70  PHE A N   
592  C  CA  . PHE A 70  ? 0.1079 0.1045 0.1266 -0.0213 -0.0162 0.0215  70  PHE A CA  
593  C  C   . PHE A 70  ? 0.1081 0.0877 0.1167 -0.0108 0.0074  0.0102  70  PHE A C   
594  O  O   . PHE A 70  ? 0.1097 0.0974 0.1066 -0.0113 0.0024  0.0076  70  PHE A O   
595  C  CB  . PHE A 70  ? 0.1050 0.1459 0.1097 -0.0228 -0.0121 0.0268  70  PHE A CB  
596  C  CG  . PHE A 70  ? 0.0861 0.1341 0.1069 -0.0179 0.0012  0.0237  70  PHE A CG  
597  C  CD1 . PHE A 70  ? 0.1066 0.1398 0.1198 -0.0395 -0.0136 0.0252  70  PHE A CD1 
598  C  CD2 . PHE A 70  ? 0.0986 0.1342 0.1158 -0.0187 -0.0033 0.0203  70  PHE A CD2 
599  C  CE1 . PHE A 70  ? 0.1030 0.1615 0.1076 -0.0160 -0.0047 0.0190  70  PHE A CE1 
600  C  CE2 . PHE A 70  ? 0.0943 0.1314 0.1260 -0.0012 0.0082  0.0271  70  PHE A CE2 
601  C  CZ  . PHE A 70  ? 0.0829 0.1611 0.1160 -0.0112 0.0027  0.0311  70  PHE A CZ  
602  N  N   . PHE A 71  ? 0.1059 0.0949 0.1058 -0.0106 -0.0112 0.0200  71  PHE A N   
603  C  CA  . PHE A 71  ? 0.1098 0.0821 0.1124 -0.0083 -0.0047 0.0081  71  PHE A CA  
604  C  C   . PHE A 71  ? 0.1073 0.0836 0.1167 -0.0088 -0.0111 0.0071  71  PHE A C   
605  O  O   . PHE A 71  ? 0.1028 0.1066 0.1438 -0.0077 -0.0023 0.0230  71  PHE A O   
606  C  CB  . PHE A 71  ? 0.1054 0.1073 0.1036 -0.0150 0.0016  0.0046  71  PHE A CB  
607  C  CG  . PHE A 71  ? 0.1158 0.0857 0.1061 -0.0135 -0.0072 -0.0019 71  PHE A CG  
608  C  CD1 . PHE A 71  ? 0.1257 0.1120 0.1230 -0.0044 0.0085  0.0200  71  PHE A CD1 
609  C  CD2 . PHE A 71  ? 0.1351 0.1173 0.1186 -0.0063 0.0233  0.0120  71  PHE A CD2 
610  C  CE1 . PHE A 71  ? 0.1338 0.1109 0.1429 0.0070  0.0046  0.0230  71  PHE A CE1 
611  C  CE2 . PHE A 71  ? 0.1398 0.1214 0.1396 -0.0030 0.0280  0.0041  71  PHE A CE2 
612  C  CZ  . PHE A 71  ? 0.1428 0.1153 0.1485 0.0151  0.0261  0.0072  71  PHE A CZ  
613  N  N   . LEU A 72  ? 0.1036 0.1081 0.1229 -0.0101 -0.0087 0.0179  72  LEU A N   
614  C  CA  . LEU A 72  ? 0.1093 0.1034 0.1445 -0.0079 -0.0143 0.0157  72  LEU A CA  
615  C  C   . LEU A 72  ? 0.1059 0.0919 0.1538 0.0068  -0.0001 0.0176  72  LEU A C   
616  O  O   . LEU A 72  ? 0.1131 0.1234 0.1724 0.0008  0.0010  0.0248  72  LEU A O   
617  C  CB  . LEU A 72  ? 0.1482 0.1285 0.1622 -0.0130 -0.0385 0.0430  72  LEU A CB  
618  C  CG  . LEU A 72  ? 0.1757 0.1339 0.2139 0.0384  -0.0409 -0.0051 72  LEU A CG  
619  C  CD1 . LEU A 72  ? 0.1606 0.2068 0.3240 0.0101  -0.0899 -0.0267 72  LEU A CD1 
620  C  CD2 . LEU A 72  ? 0.3292 0.1691 0.2953 0.0591  -0.1278 0.0487  72  LEU A CD2 
621  N  N   . ASP A 73  ? 0.1149 0.0863 0.1407 0.0060  0.0030  0.0187  73  ASP A N   
622  C  CA  . ASP A 73  ? 0.1180 0.0999 0.1568 0.0062  0.0004  0.0112  73  ASP A CA  
623  C  C   . ASP A 73  ? 0.1541 0.1017 0.1433 0.0102  0.0285  0.0106  73  ASP A C   
624  O  O   . ASP A 73  ? 0.1783 0.0861 0.1518 -0.0064 0.0199  -0.0093 73  ASP A O   
625  C  CB  . ASP A 73  ? 0.1578 0.0935 0.1817 -0.0119 0.0004  0.0048  73  ASP A CB  
626  C  CG  . ASP A 73  ? 0.1643 0.0960 0.2436 0.0313  0.0144  0.0294  73  ASP A CG  
627  O  OD1 . ASP A 73  ? 0.1966 0.1424 0.3324 0.0340  -0.0411 0.0721  73  ASP A OD1 
628  O  OD2 . ASP A 73  ? 0.2645 0.1284 0.3165 -0.0268 0.0025  0.0663  73  ASP A OD2 
629  N  N   . LEU A 74  ? 0.1147 0.0771 0.1300 -0.0112 0.0021  0.0034  74  LEU A N   
630  C  CA  . LEU A 74  ? 0.1053 0.0942 0.1124 -0.0163 -0.0037 -0.0096 74  LEU A CA  
631  C  C   . LEU A 74  ? 0.1068 0.0847 0.1202 -0.0047 -0.0001 -0.0106 74  LEU A C   
632  O  O   . LEU A 74  ? 0.0998 0.1050 0.1363 -0.0014 0.0063  -0.0242 74  LEU A O   
633  C  CB  . LEU A 74  ? 0.0865 0.0868 0.1055 -0.0140 -0.0054 0.0044  74  LEU A CB  
634  C  CG  . LEU A 74  ? 0.0984 0.0946 0.1064 -0.0056 0.0022  0.0142  74  LEU A CG  
635  C  CD1 . LEU A 74  ? 0.0956 0.0999 0.1660 0.0027  0.0028  0.0117  74  LEU A CD1 
636  C  CD2 . LEU A 74  ? 0.0892 0.1147 0.1443 -0.0174 0.0000  0.0210  74  LEU A CD2 
637  N  N   . GLU A 75  ? 0.1116 0.1032 0.1241 -0.0197 0.0084  -0.0015 75  GLU A N   
638  C  CA  . GLU A 75  ? 0.1170 0.0926 0.1323 -0.0077 0.0170  -0.0039 75  GLU A CA  
639  C  C   . GLU A 75  ? 0.1066 0.0956 0.1135 0.0105  0.0182  0.0095  75  GLU A C   
640  O  O   . GLU A 75  ? 0.1037 0.1079 0.1560 0.0153  -0.0114 -0.0197 75  GLU A O   
641  C  CB  . GLU A 75  ? 0.2036 0.1533 0.1315 -0.0603 0.0355  -0.0151 75  GLU A CB  
642  C  CG  . GLU A 75  ? 0.3752 0.1432 0.3192 -0.1163 0.0016  -0.0645 75  GLU A CG  
643  C  CD  . GLU A 75  ? 0.4008 0.2125 0.3636 0.0201  0.0297  -0.1279 75  GLU A CD  
644  O  OE1 . GLU A 75  ? 0.9433 1.0081 0.4066 0.7729  0.0164  -0.0138 75  GLU A OE1 
645  O  OE2 . GLU A 75  ? 0.5993 0.5984 0.3509 0.1821  -0.1094 -0.2129 75  GLU A OE2 
646  N  N   . PRO A 76  ? 0.1076 0.0910 0.1145 0.0049  0.0072  0.0110  76  PRO A N   
647  C  CA  . PRO A 76  ? 0.1301 0.0900 0.1057 -0.0113 0.0072  -0.0036 76  PRO A CA  
648  C  C   . PRO A 76  ? 0.1311 0.0943 0.1118 -0.0008 0.0026  -0.0041 76  PRO A C   
649  O  O   . PRO A 76  ? 0.2340 0.1112 0.1157 -0.0216 -0.0297 -0.0004 76  PRO A O   
650  C  CB  . PRO A 76  ? 0.1251 0.1512 0.1564 -0.0239 -0.0075 0.0337  76  PRO A CB  
651  C  CG  . PRO A 76  ? 0.1180 0.1545 0.2828 -0.0056 0.0074  0.0469  76  PRO A CG  
652  C  CD  . PRO A 76  ? 0.1090 0.1185 0.1390 0.0164  0.0228  0.0023  76  PRO A CD  
653  N  N   . ILE A 77  ? 0.1616 0.0936 0.1146 -0.0192 -0.0193 0.0122  77  ILE A N   
654  C  CA  . ILE A 77  ? 0.1581 0.0965 0.1183 -0.0344 -0.0284 0.0122  77  ILE A CA  
655  C  C   . ILE A 77  ? 0.1455 0.1054 0.1143 -0.0020 -0.0272 0.0087  77  ILE A C   
656  O  O   . ILE A 77  ? 0.1438 0.1117 0.0960 -0.0019 -0.0128 -0.0032 77  ILE A O   
657  C  CB  . ILE A 77  ? 0.1353 0.0999 0.1429 -0.0237 0.0083  0.0322  77  ILE A CB  
658  C  CG1 . ILE A 77  ? 0.1199 0.1793 0.2037 -0.0174 0.0029  0.1114  77  ILE A CG1 
659  C  CG2 . ILE A 77  ? 0.1207 0.1316 0.1299 0.0023  0.0080  0.0332  77  ILE A CG2 
660  C  CD1 . ILE A 77  ? 0.1426 0.2277 0.2151 -0.0231 -0.0164 0.0994  77  ILE A CD1 
661  N  N   . PRO A 78  ? 0.1565 0.1190 0.1186 -0.0192 -0.0301 -0.0052 78  PRO A N   
662  C  CA  . PRO A 78  ? 0.2010 0.1561 0.1238 -0.0409 -0.0073 -0.0391 78  PRO A CA  
663  C  C   . PRO A 78  ? 0.1525 0.1268 0.0870 0.0047  -0.0071 -0.0042 78  PRO A C   
664  O  O   . PRO A 78  ? 0.1551 0.1488 0.1320 0.0090  -0.0215 0.0036  78  PRO A O   
665  C  CB  . PRO A 78  ? 0.2954 0.2235 0.1151 -0.0832 -0.0133 -0.0248 78  PRO A CB  
666  C  CG  . PRO A 78  ? 0.2693 0.3803 0.1469 -0.1022 -0.0519 -0.0548 78  PRO A CG  
667  C  CD  . PRO A 78  ? 0.2161 0.2326 0.1220 -0.0869 -0.0606 0.0341  78  PRO A CD  
668  N  N   . GLY A 79  ? 0.1469 0.1549 0.1053 -0.0047 0.0030  -0.0066 79  GLY A N   
669  C  CA  . GLY A 79  ? 0.1399 0.1470 0.1109 0.0030  0.0181  -0.0047 79  GLY A CA  
670  C  C   . GLY A 79  ? 0.1342 0.1334 0.1131 -0.0015 0.0260  -0.0045 79  GLY A C   
671  O  O   . GLY A 79  ? 0.1245 0.1549 0.1092 -0.0254 0.0350  -0.0025 79  GLY A O   
672  N  N   . ALA A 80  ? 0.0984 0.1022 0.1036 -0.0045 0.0057  0.0003  80  ALA A N   
673  C  CA  . ALA A 80  ? 0.0915 0.1145 0.1055 -0.0011 0.0086  -0.0015 80  ALA A CA  
674  C  C   . ALA A 80  ? 0.0925 0.1297 0.0838 -0.0054 0.0219  -0.0009 80  ALA A C   
675  O  O   . ALA A 80  ? 0.1017 0.1328 0.1076 -0.0160 0.0161  -0.0169 80  ALA A O   
676  C  CB  . ALA A 80  ? 0.0971 0.1135 0.1037 -0.0109 0.0087  0.0024  80  ALA A CB  
677  N  N   . LEU A 81  ? 0.0916 0.1313 0.1151 -0.0044 0.0055  0.0015  81  LEU A N   
678  C  CA  . LEU A 81  ? 0.0973 0.1799 0.1256 -0.0227 -0.0023 0.0294  81  LEU A CA  
679  C  C   . LEU A 81  ? 0.0935 0.1413 0.1279 -0.0015 0.0113  0.0149  81  LEU A C   
680  O  O   . LEU A 81  ? 0.1130 0.1511 0.1407 -0.0229 0.0188  0.0146  81  LEU A O   
681  C  CB  . LEU A 81  ? 0.1151 0.1910 0.1340 -0.0279 -0.0181 0.0542  81  LEU A CB  
682  C  CG  . LEU A 81  ? 0.1493 0.2286 0.1436 -0.0626 -0.0218 0.0658  81  LEU A CG  
683  C  CD1 . LEU A 81  ? 0.2944 0.2256 0.2235 -0.0769 -0.0631 0.1082  81  LEU A CD1 
684  C  CD2 . LEU A 81  ? 0.1811 0.3377 0.1809 -0.1262 0.0389  0.0190  81  LEU A CD2 
685  N  N   . ASP A 82  ? 0.1134 0.1363 0.1386 -0.0110 0.0278  0.0062  82  ASP A N   
686  C  CA  . ASP A 82  ? 0.1043 0.1624 0.1734 -0.0122 0.0557  -0.0060 82  ASP A CA  
687  C  C   . ASP A 82  ? 0.1108 0.1544 0.1261 -0.0165 0.0400  0.0199  82  ASP A C   
688  O  O   . ASP A 82  ? 0.1241 0.1567 0.1439 -0.0151 0.0350  0.0216  82  ASP A O   
689  C  CB  . ASP A 82  ? 0.1734 0.1922 0.2042 -0.0591 0.1004  -0.0399 82  ASP A CB  
690  C  CG  . ASP A 82  ? 0.2182 0.2232 0.4307 -0.0235 0.1943  -0.0997 82  ASP A CG  
691  O  OD1 . ASP A 82  ? 0.4292 0.2174 0.5215 0.0932  0.2527  0.0591  82  ASP A OD1 
692  O  OD2 . ASP A 82  ? 0.7604 0.3694 0.4658 0.0384  0.3131  -0.1854 82  ASP A OD2 
693  N  N   . ALA A 83  ? 0.1255 0.1406 0.1187 -0.0285 0.0136  0.0203  83  ALA A N   
694  C  CA  . ALA A 83  ? 0.1222 0.1385 0.1282 -0.0303 0.0145  0.0171  83  ALA A CA  
695  C  C   . ALA A 83  ? 0.1011 0.1200 0.1359 -0.0062 0.0038  0.0231  83  ALA A C   
696  O  O   . ALA A 83  ? 0.1165 0.0998 0.1473 -0.0066 0.0003  0.0160  83  ALA A O   
697  C  CB  . ALA A 83  ? 0.1417 0.1665 0.1471 -0.0310 -0.0202 0.0322  83  ALA A CB  
698  N  N   . VAL A 84  ? 0.0924 0.1206 0.1307 0.0030  0.0174  0.0217  84  VAL A N   
699  C  CA  . VAL A 84  ? 0.1381 0.1267 0.1385 0.0075  0.0169  0.0085  84  VAL A CA  
700  C  C   . VAL A 84  ? 0.1661 0.0947 0.1159 0.0160  -0.0019 0.0207  84  VAL A C   
701  O  O   . VAL A 84  ? 0.1718 0.1161 0.1290 0.0030  0.0005  0.0059  84  VAL A O   
702  C  CB  . VAL A 84  ? 0.2230 0.1901 0.1394 -0.0188 0.0595  0.0122  84  VAL A CB  
703  C  CG1 . VAL A 84  ? 0.2010 0.5190 0.7147 0.1797  0.2542  0.3171  84  VAL A CG1 
704  C  CG2 . VAL A 84  ? 0.1817 0.2260 0.2351 -0.0092 0.0001  0.0958  84  VAL A CG2 
705  N  N   . ARG A 85  ? 0.1410 0.0995 0.1315 0.0130  0.0145  0.0263  85  ARG A N   
708  C  C   . ARG A 85  ? 0.1127 0.1309 0.1712 0.0171  -0.0159 0.0018  85  ARG A C   
709  O  O   . ARG A 85  ? 0.1259 0.1496 0.2036 -0.0013 -0.0249 -0.0077 85  ARG A O   
714  C  CD  A ARG A 85  ? 0.1491 0.3106 0.2028 0.1121  0.0292  0.0441  85  ARG A CD  
715  C  CD  B ARG A 85  ? 0.3949 0.3358 0.2610 0.3102  0.1775  0.1084  85  ARG A CD  
716  N  NE  A ARG A 85  ? 0.1475 0.1366 0.2854 0.0856  0.0455  0.0874  85  ARG A NE  
717  N  NE  B ARG A 85  ? 0.2903 0.3995 0.3193 0.2993  0.1647  0.1210  85  ARG A NE  
718  C  CZ  A ARG A 85  ? 0.1526 0.1959 0.2613 0.0988  0.0428  0.0892  85  ARG A CZ  
719  C  CZ  B ARG A 85  ? 0.1322 0.4102 0.3029 0.2251  0.0840  0.2297  85  ARG A CZ  
720  N  NH1 A ARG A 85  ? 0.1367 0.2826 0.2484 0.0922  0.0327  0.1357  85  ARG A NH1 
721  N  NH1 B ARG A 85  ? 0.1843 0.3332 0.3352 0.2016  0.1922  0.1868  85  ARG A NH1 
722  N  NH2 A ARG A 85  ? 0.2783 0.1211 0.2821 0.0506  0.1169  0.1001  85  ARG A NH2 
723  N  NH2 B ARG A 85  ? 0.4556 0.4901 0.3317 -0.0383 -0.0007 0.3043  85  ARG A NH2 
724  N  N   . GLU A 86  ? 0.0857 0.1334 0.1682 0.0214  0.0064  -0.0015 86  GLU A N   
725  C  CA  . GLU A 86  ? 0.0734 0.1469 0.1678 -0.0031 0.0219  -0.0061 86  GLU A CA  
726  C  C   . GLU A 86  ? 0.0967 0.1430 0.1605 -0.0011 0.0221  -0.0072 86  GLU A C   
727  O  O   . GLU A 86  ? 0.0917 0.1426 0.2523 -0.0029 0.0275  -0.0124 86  GLU A O   
728  C  CB  . GLU A 86  ? 0.1254 0.1376 0.1648 -0.0155 0.0212  -0.0077 86  GLU A CB  
729  C  CG  . GLU A 86  ? 0.1578 0.1587 0.1787 0.0032  0.0590  -0.0102 86  GLU A CG  
730  C  CD  . GLU A 86  ? 0.2719 0.1733 0.1311 0.0166  0.0531  -0.0008 86  GLU A CD  
731  O  OE1 . GLU A 86  ? 0.2578 0.1654 0.1942 -0.0145 -0.0015 -0.0248 86  GLU A OE1 
732  O  OE2 . GLU A 86  ? 0.3372 0.1851 0.2242 0.0170  0.0156  -0.0407 86  GLU A OE2 
733  N  N   . MET A 87  ? 0.1066 0.1092 0.1545 -0.0068 0.0301  -0.0080 87  MET A N   
734  C  CA  . MET A 87  ? 0.1035 0.1271 0.1217 0.0029  0.0290  0.0084  87  MET A CA  
735  C  C   . MET A 87  ? 0.1053 0.1128 0.1333 0.0061  0.0248  -0.0034 87  MET A C   
736  O  O   . MET A 87  ? 0.1225 0.1228 0.1593 -0.0068 0.0111  0.0050  87  MET A O   
737  C  CB  . MET A 87  ? 0.1080 0.1143 0.1156 0.0054  0.0187  0.0082  87  MET A CB  
738  C  CG  . MET A 87  ? 0.1240 0.1124 0.1207 0.0064  0.0234  -0.0096 87  MET A CG  
739  S  SD  . MET A 87  ? 0.1146 0.1276 0.1395 -0.0015 0.0215  0.0047  87  MET A SD  
740  C  CE  . MET A 87  ? 0.1368 0.1440 0.1608 0.0172  0.0015  -0.0170 87  MET A CE  
741  N  N   . ASN A 88  ? 0.1739 0.1331 0.1303 -0.0326 0.0072  0.0045  88  ASN A N   
742  C  CA  . ASN A 88  ? 0.1773 0.1591 0.1603 -0.0254 -0.0300 0.0094  88  ASN A CA  
743  C  C   . ASN A 88  ? 0.1749 0.1433 0.2287 -0.0135 -0.0199 -0.0114 88  ASN A C   
744  O  O   . ASN A 88  ? 0.1710 0.2573 0.2186 -0.0461 -0.0416 -0.0062 88  ASN A O   
745  C  CB  . ASN A 88  ? 0.3362 0.1957 0.1934 -0.0991 -0.0863 0.0522  88  ASN A CB  
746  C  CG  . ASN A 88  ? 0.5704 0.2209 0.2217 -0.1048 -0.1629 0.0538  88  ASN A CG  
747  O  OD1 . ASN A 88  ? 0.6170 0.3508 0.2507 -0.2332 -0.0744 -0.0555 88  ASN A OD1 
748  N  ND2 . ASN A 88  ? 0.5419 0.3129 0.4425 -0.1405 -0.3238 0.1051  88  ASN A ND2 
749  N  N   . ASP A 89  ? 0.1532 0.1571 0.2595 0.0424  -0.0237 -0.0090 89  ASP A N   
750  C  CA  . ASP A 89  ? 0.1376 0.2481 0.2942 0.0518  -0.0341 -0.0207 89  ASP A CA  
751  C  C   . ASP A 89  ? 0.1232 0.2785 0.2676 -0.0061 -0.0202 -0.0069 89  ASP A C   
752  O  O   . ASP A 89  ? 0.1154 0.3087 0.4339 -0.0043 0.0053  -0.0696 89  ASP A O   
753  C  CB  . ASP A 89  ? 0.2190 0.3442 0.3463 0.1381  0.0196  -0.0150 89  ASP A CB  
754  C  CG  . ASP A 89  ? 0.2810 0.3085 0.4700 0.1466  -0.0815 -0.0269 89  ASP A CG  
755  O  OD1 . ASP A 89  ? 0.3666 0.5763 0.5741 0.2124  0.0860  0.2575  89  ASP A OD1 
756  O  OD2 . ASP A 89  ? 1.0110 0.4797 0.9226 0.5172  0.2001  0.0596  89  ASP A OD2 
757  N  N   . LEU A 90  ? 0.1179 0.2002 0.1879 -0.0138 0.0174  -0.0255 90  LEU A N   
758  C  CA  . LEU A 90  ? 0.1279 0.2093 0.1828 -0.0453 0.0474  -0.0214 90  LEU A CA  
759  C  C   . LEU A 90  ? 0.1177 0.2055 0.1966 -0.0351 0.0138  -0.0129 90  LEU A C   
760  O  O   . LEU A 90  ? 0.1347 0.2157 0.2100 -0.0509 0.0379  -0.0464 90  LEU A O   
761  C  CB  . LEU A 90  ? 0.1414 0.1538 0.1680 -0.0462 0.0344  -0.0247 90  LEU A CB  
762  C  CG  . LEU A 90  ? 0.1980 0.1904 0.1647 -0.0438 0.0224  -0.0329 90  LEU A CG  
763  C  CD1 . LEU A 90  ? 0.2038 0.1640 0.1809 -0.0575 -0.0046 -0.0060 90  LEU A CD1 
764  C  CD2 . LEU A 90  ? 0.2750 0.2224 0.2149 -0.0551 0.0968  -0.0754 90  LEU A CD2 
765  N  N   . PRO A 91  ? 0.1245 0.2344 0.2459 -0.0619 0.0474  -0.0396 91  PRO A N   
766  C  CA  . PRO A 91  ? 0.1083 0.2776 0.2587 -0.0821 0.0481  -0.0661 91  PRO A CA  
767  C  C   . PRO A 91  ? 0.1227 0.2288 0.2051 -0.0752 0.0296  -0.0400 91  PRO A C   
768  O  O   . PRO A 91  ? 0.1387 0.2127 0.1702 -0.0760 0.0349  -0.0032 91  PRO A O   
769  C  CB  . PRO A 91  ? 0.1861 0.2685 0.3539 -0.1101 0.1241  -0.0928 91  PRO A CB  
770  C  CG  . PRO A 91  ? 0.2400 0.2685 0.3543 -0.1145 0.1584  -0.0772 91  PRO A CG  
771  C  CD  . PRO A 91  ? 0.1818 0.2344 0.2584 -0.0625 0.0784  -0.0414 91  PRO A CD  
772  N  N   . ASP A 92  ? 0.1393 0.1811 0.1951 -0.0651 0.0175  -0.0224 92  ASP A N   
773  C  CA  . ASP A 92  ? 0.1318 0.2024 0.1798 -0.0555 0.0219  -0.0095 92  ASP A CA  
774  C  C   . ASP A 92  ? 0.1411 0.1639 0.1355 -0.0504 0.0075  -0.0042 92  ASP A C   
775  O  O   . ASP A 92  ? 0.1324 0.1674 0.1876 -0.0528 0.0050  0.0048  92  ASP A O   
776  C  CB  . ASP A 92  ? 0.1949 0.1635 0.3089 -0.0748 0.0445  -0.0226 92  ASP A CB  
777  C  CG  . ASP A 92  ? 0.2077 0.2298 0.3257 -0.1041 0.0593  -0.0405 92  ASP A CG  
778  O  OD1 . ASP A 92  ? 0.2960 0.3339 0.3921 -0.1508 -0.0320 -0.0322 92  ASP A OD1 
779  O  OD2 . ASP A 92  ? 0.3302 0.4370 0.4530 -0.2124 0.0915  0.0864  92  ASP A OD2 
780  N  N   . THR A 93  ? 0.1364 0.1822 0.1384 -0.0471 -0.0035 0.0115  93  THR A N   
781  C  CA  . THR A 93  ? 0.0981 0.1469 0.1457 -0.0219 0.0037  0.0140  93  THR A CA  
782  C  C   . THR A 93  ? 0.1274 0.1702 0.1516 -0.0147 0.0125  0.0258  93  THR A C   
783  O  O   . THR A 93  ? 0.1415 0.2627 0.2123 0.0001  -0.0007 0.0917  93  THR A O   
784  C  CB  . THR A 93  ? 0.1197 0.1444 0.1471 -0.0298 0.0016  0.0239  93  THR A CB  
785  O  OG1 . THR A 93  ? 0.1514 0.1422 0.1452 -0.0402 0.0114  0.0113  93  THR A OG1 
786  C  CG2 . THR A 93  ? 0.1359 0.1103 0.1638 -0.0256 -0.0011 0.0013  93  THR A CG2 
787  N  N   . GLN A 94  ? 0.1194 0.1779 0.1580 -0.0425 -0.0092 0.0621  94  GLN A N   
790  C  C   . GLN A 94  ? 0.0918 0.1602 0.1201 -0.0233 0.0008  0.0381  94  GLN A C   
791  O  O   . GLN A 94  ? 0.1212 0.1365 0.2016 -0.0119 -0.0448 0.0090  94  GLN A O   
796  C  CD  A GLN A 94  ? 0.1380 0.2001 0.1893 -0.0394 0.0542  -0.0813 94  GLN A CD  
797  C  CD  B GLN A 94  ? 0.1858 0.3424 0.2899 -0.0190 -0.0268 0.1249  94  GLN A CD  
798  O  OE1 A GLN A 94  ? 0.0908 0.5053 0.3446 0.0064  -0.0134 -0.3261 94  GLN A OE1 
799  O  OE1 B GLN A 94  ? 0.2900 0.3662 0.3106 -0.1413 -0.0164 0.0851  94  GLN A OE1 
800  N  NE2 A GLN A 94  ? 0.2159 0.4409 0.2692 -0.1649 -0.0115 -0.0890 94  GLN A NE2 
801  N  NE2 B GLN A 94  ? 0.2328 0.2462 0.7606 -0.0070 -0.0909 -0.0028 94  GLN A NE2 
802  N  N   . VAL A 95  ? 0.0854 0.1641 0.1351 -0.0124 -0.0109 0.0496  95  VAL A N   
803  C  CA  . VAL A 95  ? 0.0945 0.1416 0.1065 -0.0083 -0.0030 0.0259  95  VAL A CA  
804  C  C   . VAL A 95  ? 0.0909 0.0943 0.1095 0.0082  0.0052  0.0109  95  VAL A C   
805  O  O   . VAL A 95  ? 0.0856 0.1285 0.1355 -0.0063 -0.0027 0.0401  95  VAL A O   
806  C  CB  . VAL A 95  ? 0.1464 0.1929 0.1035 0.0228  0.0068  0.0104  95  VAL A CB  
807  C  CG1 . VAL A 95  ? 0.1951 0.1924 0.1893 0.0333  -0.0168 -0.0663 95  VAL A CG1 
808  C  CG2 . VAL A 95  ? 0.1948 0.2835 0.1254 0.1028  0.0443  0.0535  95  VAL A CG2 
809  N  N   . PHE A 96  ? 0.0867 0.0790 0.1022 0.0037  -0.0085 0.0160  96  PHE A N   
810  C  CA  . PHE A 96  ? 0.0977 0.0783 0.0922 -0.0036 0.0004  0.0089  96  PHE A CA  
811  C  C   . PHE A 96  ? 0.0871 0.0834 0.0874 0.0038  0.0001  0.0109  96  PHE A C   
812  O  O   . PHE A 96  ? 0.1423 0.0929 0.1296 -0.0273 -0.0447 0.0359  96  PHE A O   
813  C  CB  . PHE A 96  ? 0.1055 0.0890 0.1125 -0.0063 0.0061  -0.0028 96  PHE A CB  
814  C  CG  . PHE A 96  ? 0.1019 0.0945 0.1263 0.0074  -0.0038 -0.0157 96  PHE A CG  
815  C  CD1 . PHE A 96  ? 0.1677 0.1214 0.1552 -0.0415 -0.0162 -0.0128 96  PHE A CD1 
816  C  CD2 . PHE A 96  ? 0.1054 0.1127 0.1394 0.0119  -0.0176 -0.0167 96  PHE A CD2 
817  C  CE1 . PHE A 96  ? 0.2010 0.1265 0.1850 -0.0458 -0.0318 -0.0266 96  PHE A CE1 
818  C  CE2 . PHE A 96  ? 0.1427 0.1420 0.1079 0.0040  -0.0010 -0.0450 96  PHE A CE2 
819  C  CZ  . PHE A 96  ? 0.1726 0.1550 0.1633 -0.0278 -0.0245 -0.0498 96  PHE A CZ  
820  N  N   . ILE A 97  ? 0.0826 0.0923 0.0873 -0.0053 -0.0062 0.0127  97  ILE A N   
821  C  CA  . ILE A 97  ? 0.0882 0.0850 0.0910 -0.0049 0.0005  0.0029  97  ILE A CA  
822  C  C   . ILE A 97  ? 0.0910 0.0750 0.0849 -0.0040 -0.0013 0.0029  97  ILE A C   
823  O  O   . ILE A 97  ? 0.1092 0.1553 0.0835 0.0227  0.0048  0.0071  97  ILE A O   
824  C  CB  . ILE A 97  ? 0.0903 0.0839 0.0952 0.0033  -0.0011 0.0003  97  ILE A CB  
825  C  CG1 . ILE A 97  ? 0.0938 0.1018 0.1125 0.0120  -0.0002 -0.0028 97  ILE A CG1 
826  C  CG2 . ILE A 97  ? 0.1178 0.0894 0.1291 -0.0174 -0.0002 -0.0054 97  ILE A CG2 
827  C  CD1 . ILE A 97  ? 0.0991 0.1306 0.1864 0.0358  0.0236  0.0186  97  ILE A CD1 
828  N  N   . CYS A 98  ? 0.0864 0.1010 0.0926 -0.0001 0.0063  0.0088  98  CYS A N   
829  C  CA  . CYS A 98  ? 0.0897 0.1105 0.0919 0.0014  0.0114  0.0079  98  CYS A CA  
830  C  C   . CYS A 98  ? 0.0871 0.1150 0.0932 0.0091  0.0046  0.0116  98  CYS A C   
831  O  O   . CYS A 98  ? 0.1009 0.1242 0.0850 0.0020  0.0012  0.0085  98  CYS A O   
832  C  CB  . CYS A 98  ? 0.1206 0.1067 0.1325 0.0134  0.0216  0.0087  98  CYS A CB  
833  S  SG  . CYS A 98  ? 0.1176 0.1356 0.1280 0.0116  0.0121  -0.0082 98  CYS A SG  
834  N  N   . THR A 99  ? 0.1098 0.0990 0.0895 -0.0070 -0.0056 0.0022  99  THR A N   
835  C  CA  . THR A 99  ? 0.0887 0.1067 0.0796 -0.0048 -0.0156 -0.0003 99  THR A CA  
836  C  C   . THR A 99  ? 0.0926 0.0928 0.0951 0.0019  -0.0071 0.0038  99  THR A C   
837  O  O   . THR A 99  ? 0.0928 0.1243 0.0864 0.0034  -0.0048 -0.0023 99  THR A O   
838  C  CB  . THR A 99  ? 0.0923 0.1115 0.1056 0.0041  -0.0143 -0.0055 99  THR A CB  
839  O  OG1 . THR A 99  ? 0.1276 0.0964 0.1130 -0.0014 -0.0033 0.0082  99  THR A OG1 
840  C  CG2 . THR A 99  ? 0.1633 0.1271 0.1275 0.0362  -0.0420 -0.0038 99  THR A CG2 
841  N  N   . SER A 100 ? 0.1016 0.1183 0.0757 -0.0180 -0.0053 -0.0013 100 SER A N   
842  C  CA  . SER A 100 ? 0.1070 0.1175 0.1018 -0.0095 0.0115  0.0080  100 SER A CA  
843  C  C   . SER A 100 ? 0.1243 0.1255 0.1046 -0.0291 0.0039  0.0087  100 SER A C   
844  O  O   . SER A 100 ? 0.2459 0.1329 0.1236 -0.0454 0.0065  -0.0043 100 SER A O   
845  C  CB  . SER A 100 ? 0.0988 0.1375 0.1201 -0.0252 0.0042  0.0056  100 SER A CB  
846  O  OG  . SER A 100 ? 0.1025 0.1366 0.1284 0.0033  -0.0063 0.0214  100 SER A OG  
847  N  N   . PRO A 101 ? 0.1054 0.1016 0.1133 -0.0126 -0.0128 0.0142  101 PRO A N   
848  C  CA  . PRO A 101 ? 0.1132 0.1156 0.1286 -0.0206 -0.0049 0.0262  101 PRO A CA  
849  C  C   . PRO A 101 ? 0.1156 0.1160 0.1352 -0.0191 0.0159  0.0100  101 PRO A C   
850  O  O   . PRO A 101 ? 0.1155 0.1335 0.1781 -0.0145 0.0098  0.0041  101 PRO A O   
851  C  CB  . PRO A 101 ? 0.2226 0.1438 0.1398 -0.0423 -0.0434 0.0533  101 PRO A CB  
852  C  CG  . PRO A 101 ? 0.3564 0.1603 0.1122 -0.0419 -0.0120 0.0314  101 PRO A CG  
853  C  CD  . PRO A 101 ? 0.1456 0.1233 0.1065 -0.0126 -0.0329 0.0207  101 PRO A CD  
854  N  N   . LEU A 102 ? 0.1123 0.1233 0.1203 -0.0241 0.0061  0.0102  102 LEU A N   
855  C  CA  . LEU A 102 ? 0.1141 0.1290 0.1343 -0.0231 0.0148  0.0178  102 LEU A CA  
856  C  C   . LEU A 102 ? 0.1158 0.1229 0.1426 -0.0199 0.0100  -0.0024 102 LEU A C   
857  O  O   . LEU A 102 ? 0.1308 0.1548 0.1383 -0.0176 0.0013  -0.0069 102 LEU A O   
858  C  CB  . LEU A 102 ? 0.1295 0.1592 0.1617 -0.0488 0.0280  -0.0293 102 LEU A CB  
859  C  CG  . LEU A 102 ? 0.0947 0.1912 0.1747 -0.0199 0.0147  -0.0455 102 LEU A CG  
860  C  CD1 . LEU A 102 ? 0.1540 0.2105 0.3357 -0.0759 0.0839  -0.1282 102 LEU A CD1 
861  C  CD2 . LEU A 102 ? 0.1858 0.4317 0.1847 -0.0203 -0.0531 -0.0079 102 LEU A CD2 
862  N  N   . LEU A 103 ? 0.1144 0.1589 0.1376 -0.0139 0.0095  0.0144  103 LEU A N   
863  C  CA  . LEU A 103 ? 0.1342 0.1700 0.1288 -0.0158 0.0168  -0.0040 103 LEU A CA  
864  C  C   . LEU A 103 ? 0.1351 0.1588 0.1504 -0.0343 0.0266  0.0105  103 LEU A C   
865  O  O   . LEU A 103 ? 0.1913 0.1802 0.1452 -0.0269 0.0264  0.0122  103 LEU A O   
866  C  CB  . LEU A 103 ? 0.1466 0.1905 0.2105 0.0215  0.0465  0.0109  103 LEU A CB  
867  C  CG  . LEU A 103 ? 0.1535 0.1889 0.2453 -0.0115 0.0067  0.0341  103 LEU A CG  
868  C  CD1 . LEU A 103 ? 0.1678 0.3133 0.4695 0.0728  -0.0992 -0.0308 103 LEU A CD1 
869  C  CD2 . LEU A 103 ? 0.1963 0.1949 0.2819 -0.0194 -0.0031 0.0145  103 LEU A CD2 
870  N  N   . LYS A 104 ? 0.1438 0.1697 0.1560 -0.0224 0.0376  0.0028  104 LYS A N   
871  C  CA  . LYS A 104 ? 0.1521 0.1648 0.1410 -0.0203 0.0293  0.0011  104 LYS A CA  
872  C  C   . LYS A 104 ? 0.1620 0.1753 0.1396 -0.0077 0.0341  0.0091  104 LYS A C   
873  O  O   . LYS A 104 ? 0.1905 0.1920 0.1539 0.0383  0.0455  0.0211  104 LYS A O   
874  C  CB  . LYS A 104 ? 0.2045 0.1758 0.2881 -0.0097 -0.0288 -0.0486 104 LYS A CB  
875  C  CG  . LYS A 104 ? 0.2150 0.2952 0.4573 -0.0984 -0.0095 -0.0377 104 LYS A CG  
876  C  CD  . LYS A 104 ? 0.3344 0.4295 0.6393 -0.1507 0.0303  0.0908  104 LYS A CD  
877  C  CE  . LYS A 104 ? 0.3232 0.5501 0.6545 -0.1316 0.0698  0.1833  104 LYS A CE  
878  N  NZ  . LYS A 104 ? 0.3517 0.9213 0.6291 -0.1048 0.0367  0.1243  104 LYS A NZ  
879  N  N   . TYR A 105 ? 0.1572 0.1851 0.1470 -0.0344 0.0194  0.0291  105 TYR A N   
880  C  CA  . TYR A 105 ? 0.1686 0.1667 0.1533 -0.0290 0.0521  0.0194  105 TYR A CA  
881  C  C   . TYR A 105 ? 0.1548 0.1736 0.1279 -0.0311 0.0241  0.0073  105 TYR A C   
882  O  O   . TYR A 105 ? 0.1553 0.1814 0.1383 -0.0354 0.0261  -0.0001 105 TYR A O   
883  C  CB  . TYR A 105 ? 0.1821 0.1616 0.1925 -0.0597 0.0371  0.0128  105 TYR A CB  
884  C  CG  . TYR A 105 ? 0.1607 0.1355 0.1754 -0.0488 0.0253  -0.0087 105 TYR A CG  
885  C  CD1 . TYR A 105 ? 0.1463 0.1955 0.1637 -0.0386 0.0061  -0.0341 105 TYR A CD1 
886  C  CD2 . TYR A 105 ? 0.1639 0.1779 0.1438 -0.0205 0.0042  -0.0195 105 TYR A CD2 
887  C  CE1 . TYR A 105 ? 0.2057 0.2819 0.1646 0.0310  0.0121  -0.0056 105 TYR A CE1 
888  C  CE2 . TYR A 105 ? 0.1582 0.1839 0.1584 -0.0354 0.0185  -0.0021 105 TYR A CE2 
889  C  CZ  . TYR A 105 ? 0.1792 0.1709 0.1345 -0.0247 0.0003  -0.0301 105 TYR A CZ  
890  O  OH  . TYR A 105 ? 0.2327 0.2638 0.1247 -0.0368 -0.0093 -0.0222 105 TYR A OH  
891  N  N   . HIS A 106 ? 0.1329 0.1663 0.1253 -0.0294 0.0137  -0.0029 106 HIS A N   
892  C  CA  . HIS A 106 ? 0.1573 0.1868 0.1304 -0.0265 0.0003  0.0155  106 HIS A CA  
893  C  C   . HIS A 106 ? 0.1643 0.1531 0.1722 -0.0084 0.0152  0.0449  106 HIS A C   
894  O  O   . HIS A 106 ? 0.1807 0.3388 0.2622 0.0465  -0.0156 0.0261  106 HIS A O   
895  C  CB  . HIS A 106 ? 0.2424 0.2362 0.2167 -0.0408 0.0775  0.0641  106 HIS A CB  
896  C  CG  . HIS A 106 ? 0.3839 0.3854 0.4581 -0.0837 -0.0364 0.2579  106 HIS A CG  
897  N  ND1 . HIS A 106 ? 0.4511 0.4884 0.6567 -0.0966 -0.1563 0.3616  106 HIS A ND1 
898  C  CD2 . HIS A 106 ? 0.4925 0.3584 0.6196 -0.1062 -0.0876 0.2779  106 HIS A CD2 
899  C  CE1 . HIS A 106 ? 0.5953 0.4112 0.6015 -0.0762 -0.2211 0.2713  106 HIS A CE1 
900  N  NE2 . HIS A 106 ? 0.6775 0.2641 0.5688 -0.0959 -0.2353 0.1589  106 HIS A NE2 
901  N  N   . HIS A 107 ? 0.1852 0.1340 0.1649 0.0009  0.0460  0.0267  107 HIS A N   
902  C  CA  . HIS A 107 ? 0.2374 0.1288 0.2314 0.0064  0.0862  0.0260  107 HIS A CA  
903  C  C   . HIS A 107 ? 0.1536 0.1389 0.2059 0.0284  0.0731  0.0307  107 HIS A C   
904  O  O   . HIS A 107 ? 0.1681 0.1714 0.1957 -0.0097 0.0487  -0.0280 107 HIS A O   
905  C  CB  . HIS A 107 ? 0.2668 0.1161 0.1899 0.0265  0.0751  0.0294  107 HIS A CB  
906  C  CG  . HIS A 107 ? 0.2697 0.1598 0.1609 -0.0202 0.0361  0.0398  107 HIS A CG  
907  N  ND1 . HIS A 107 ? 0.3140 0.2019 0.2362 -0.0479 -0.0160 0.0880  107 HIS A ND1 
908  C  CD2 . HIS A 107 ? 0.2707 0.2913 0.2493 -0.0299 0.0645  0.1087  107 HIS A CD2 
909  C  CE1 . HIS A 107 ? 0.3993 0.3408 0.3004 -0.0794 -0.0206 0.1985  107 HIS A CE1 
910  N  NE2 . HIS A 107 ? 0.3544 0.2873 0.3420 -0.0663 0.0558  0.1618  107 HIS A NE2 
911  N  N   . CYS A 108 ? 0.1153 0.1283 0.1242 -0.0115 0.0134  0.0137  108 CYS A N   
912  C  CA  . CYS A 108 ? 0.1211 0.1278 0.1146 -0.0161 -0.0057 0.0089  108 CYS A CA  
913  C  C   . CYS A 108 ? 0.1228 0.1418 0.1041 -0.0231 0.0129  0.0055  108 CYS A C   
914  O  O   . CYS A 108 ? 0.1054 0.1656 0.1189 0.0145  0.0087  0.0218  108 CYS A O   
915  C  CB  . CYS A 108 ? 0.1327 0.1593 0.1326 -0.0114 -0.0118 0.0375  108 CYS A CB  
916  S  SG  . CYS A 108 ? 0.1371 0.1468 0.1612 -0.0187 0.0055  0.0326  108 CYS A SG  
917  N  N   . VAL A 109 ? 0.1474 0.1126 0.1131 -0.0298 0.0138  -0.0031 109 VAL A N   
918  C  CA  . VAL A 109 ? 0.1120 0.1157 0.1521 -0.0175 0.0229  -0.0059 109 VAL A CA  
919  C  C   . VAL A 109 ? 0.1317 0.1126 0.1014 -0.0066 0.0263  0.0104  109 VAL A C   
920  O  O   . VAL A 109 ? 0.0997 0.1336 0.1246 -0.0079 0.0052  0.0273  109 VAL A O   
921  C  CB  . VAL A 109 ? 0.1372 0.1674 0.2347 -0.0288 0.0328  -0.1154 109 VAL A CB  
922  C  CG1 . VAL A 109 ? 0.2362 0.2397 0.1946 -0.0779 -0.0379 -0.0243 109 VAL A CG1 
923  C  CG2 . VAL A 109 ? 0.1334 0.2183 0.3290 -0.0086 0.0356  -0.1446 109 VAL A CG2 
924  N  N   . GLY A 110 ? 0.1370 0.1131 0.0974 -0.0108 0.0207  0.0038  110 GLY A N   
925  C  CA  . GLY A 110 ? 0.1218 0.1486 0.0979 -0.0146 -0.0040 0.0190  110 GLY A CA  
926  C  C   . GLY A 110 ? 0.1008 0.1325 0.0973 -0.0024 0.0009  0.0225  110 GLY A C   
927  O  O   . GLY A 110 ? 0.1096 0.1274 0.0994 -0.0004 -0.0042 0.0144  110 GLY A O   
928  N  N   . GLU A 111 ? 0.1020 0.1035 0.1094 -0.0064 0.0090  0.0189  111 GLU A N   
929  C  CA  . GLU A 111 ? 0.1059 0.1090 0.1011 0.0036  -0.0046 0.0233  111 GLU A CA  
930  C  C   . GLU A 111 ? 0.1038 0.0966 0.1137 0.0005  0.0072  0.0193  111 GLU A C   
931  O  O   . GLU A 111 ? 0.1074 0.0962 0.1091 0.0003  0.0034  0.0043  111 GLU A O   
932  C  CB  . GLU A 111 ? 0.1003 0.1134 0.1191 -0.0073 -0.0007 0.0255  111 GLU A CB  
933  C  CG  . GLU A 111 ? 0.1238 0.0961 0.1172 0.0124  -0.0056 0.0157  111 GLU A CG  
934  C  CD  . GLU A 111 ? 0.1485 0.1138 0.1207 -0.0192 -0.0077 0.0239  111 GLU A CD  
935  O  OE1 . GLU A 111 ? 0.1257 0.1329 0.1340 -0.0251 -0.0175 0.0305  111 GLU A OE1 
936  O  OE2 . GLU A 111 ? 0.1776 0.1367 0.1360 -0.0376 -0.0125 0.0310  111 GLU A OE2 
937  N  N   . LYS A 112 ? 0.1006 0.0980 0.0779 -0.0001 -0.0019 0.0057  112 LYS A N   
938  C  CA  . LYS A 112 ? 0.0982 0.1001 0.0907 0.0020  -0.0018 0.0141  112 LYS A CA  
939  C  C   . LYS A 112 ? 0.0931 0.0947 0.0914 0.0063  0.0116  0.0108  112 LYS A C   
940  O  O   . LYS A 112 ? 0.0952 0.0987 0.0896 0.0066  0.0010  -0.0007 112 LYS A O   
941  C  CB  . LYS A 112 ? 0.1106 0.1064 0.0964 0.0102  0.0055  0.0191  112 LYS A CB  
942  C  CG  . LYS A 112 ? 0.1111 0.1139 0.0888 0.0022  0.0020  0.0228  112 LYS A CG  
943  C  CD  . LYS A 112 ? 0.0851 0.1439 0.1225 0.0016  0.0169  0.0154  112 LYS A CD  
944  C  CE  . LYS A 112 ? 0.1137 0.1290 0.1248 0.0020  0.0005  0.0145  112 LYS A CE  
945  N  NZ  . LYS A 112 ? 0.1194 0.1095 0.1264 0.0108  0.0086  0.0174  112 LYS A NZ  
946  N  N   . TYR A 113 ? 0.0959 0.1068 0.0907 -0.0090 0.0063  0.0028  113 TYR A N   
947  C  CA  . TYR A 113 ? 0.0986 0.0920 0.0948 -0.0030 0.0018  0.0094  113 TYR A CA  
948  C  C   . TYR A 113 ? 0.0998 0.1087 0.1021 -0.0008 0.0040  0.0074  113 TYR A C   
949  O  O   . TYR A 113 ? 0.0965 0.1226 0.1051 0.0001  0.0066  0.0126  113 TYR A O   
950  C  CB  . TYR A 113 ? 0.0993 0.1121 0.0852 -0.0080 -0.0028 0.0175  113 TYR A CB  
951  C  CG  . TYR A 113 ? 0.1175 0.0965 0.1002 -0.0180 0.0147  0.0158  113 TYR A CG  
952  C  CD1 . TYR A 113 ? 0.1203 0.1185 0.1242 -0.0097 0.0169  -0.0248 113 TYR A CD1 
953  C  CD2 . TYR A 113 ? 0.1203 0.1220 0.1062 -0.0165 0.0157  0.0071  113 TYR A CD2 
954  C  CE1 . TYR A 113 ? 0.1267 0.1342 0.1445 -0.0010 0.0141  -0.0397 113 TYR A CE1 
955  C  CE2 . TYR A 113 ? 0.1366 0.1176 0.1003 -0.0380 0.0231  -0.0076 113 TYR A CE2 
956  C  CZ  . TYR A 113 ? 0.1511 0.1132 0.1193 -0.0152 0.0195  -0.0202 113 TYR A CZ  
957  O  OH  . TYR A 113 ? 0.1748 0.1333 0.1387 -0.0087 0.0116  -0.0389 113 TYR A OH  
958  N  N   . ARG A 114 ? 0.1008 0.0969 0.1104 0.0057  0.0069  0.0083  114 ARG A N   
959  C  CA  . ARG A 114 ? 0.0975 0.1053 0.1047 0.0039  -0.0007 0.0005  114 ARG A CA  
960  C  C   . ARG A 114 ? 0.1025 0.0770 0.1128 0.0131  0.0013  0.0065  114 ARG A C   
961  O  O   . ARG A 114 ? 0.1002 0.0993 0.1015 0.0190  -0.0019 0.0006  114 ARG A O   
962  C  CB  . ARG A 114 ? 0.1630 0.1061 0.0947 0.0039  0.0080  0.0170  114 ARG A CB  
963  C  CG  . ARG A 114 ? 0.1904 0.1259 0.2008 0.0326  0.0179  0.0319  114 ARG A CG  
964  C  CD  . ARG A 114 ? 0.1797 0.1968 0.3259 0.0386  0.0109  0.0397  114 ARG A CD  
965  N  NE  . ARG A 114 ? 0.2139 0.2262 0.3963 0.0762  0.0662  0.0718  114 ARG A NE  
966  C  CZ  . ARG A 114 ? 0.2325 0.2196 0.3443 0.0765  -0.0124 0.0048  114 ARG A CZ  
967  N  NH1 . ARG A 114 ? 0.3921 0.3075 0.3159 0.2064  -0.1180 -0.0601 114 ARG A NH1 
968  N  NH2 . ARG A 114 ? 0.3643 0.2491 0.5188 -0.0406 -0.0695 0.0825  114 ARG A NH2 
969  N  N   . TRP A 115 ? 0.0952 0.0789 0.1048 0.0156  0.0046  0.0006  115 TRP A N   
970  C  CA  . TRP A 115 ? 0.0802 0.0972 0.1060 -0.0057 0.0053  0.0030  115 TRP A CA  
971  C  C   . TRP A 115 ? 0.0942 0.0848 0.0951 -0.0017 -0.0018 0.0066  115 TRP A C   
972  O  O   . TRP A 115 ? 0.0894 0.0930 0.1137 0.0097  0.0053  0.0025  115 TRP A O   
973  C  CB  . TRP A 115 ? 0.0894 0.0945 0.1034 -0.0074 0.0032  0.0081  115 TRP A CB  
974  C  CG  . TRP A 115 ? 0.0961 0.1072 0.1018 -0.0013 -0.0034 0.0088  115 TRP A CG  
975  C  CD1 . TRP A 115 ? 0.0934 0.0936 0.1136 -0.0034 0.0050  0.0010  115 TRP A CD1 
976  C  CD2 . TRP A 115 ? 0.0917 0.0992 0.1057 -0.0046 0.0031  0.0022  115 TRP A CD2 
977  N  NE1 . TRP A 115 ? 0.0935 0.1065 0.1153 -0.0033 0.0035  -0.0110 115 TRP A NE1 
978  C  CE2 . TRP A 115 ? 0.1063 0.1050 0.1003 -0.0014 0.0000  -0.0008 115 TRP A CE2 
979  C  CE3 . TRP A 115 ? 0.0893 0.0950 0.1043 0.0073  -0.0023 0.0051  115 TRP A CE3 
980  C  CZ2 . TRP A 115 ? 0.1035 0.1346 0.1105 -0.0008 0.0131  0.0043  115 TRP A CZ2 
981  C  CZ3 . TRP A 115 ? 0.1176 0.0998 0.1225 0.0064  0.0084  0.0158  115 TRP A CZ3 
982  C  CH2 . TRP A 115 ? 0.0991 0.1326 0.1139 0.0035  0.0037  0.0221  115 TRP A CH2 
983  N  N   . VAL A 116 ? 0.0963 0.0789 0.1056 0.0066  0.0092  0.0056  116 VAL A N   
984  C  CA  . VAL A 116 ? 0.0926 0.0855 0.0909 0.0073  0.0019  0.0031  116 VAL A CA  
985  C  C   . VAL A 116 ? 0.0883 0.1019 0.0940 0.0104  -0.0023 -0.0112 116 VAL A C   
986  O  O   . VAL A 116 ? 0.0933 0.1096 0.1053 0.0114  0.0140  -0.0059 116 VAL A O   
987  C  CB  . VAL A 116 ? 0.0790 0.0926 0.0978 0.0042  0.0108  -0.0069 116 VAL A CB  
988  C  CG1 . VAL A 116 ? 0.0988 0.0892 0.1172 -0.0060 -0.0011 -0.0056 116 VAL A CG1 
989  C  CG2 . VAL A 116 ? 0.1007 0.0855 0.1366 -0.0022 -0.0234 -0.0010 116 VAL A CG2 
990  N  N   . GLU A 117 ? 0.0702 0.1120 0.1126 0.0112  0.0021  0.0059  117 GLU A N   
991  C  CA  . GLU A 117 ? 0.0905 0.1237 0.1299 0.0298  -0.0113 0.0030  117 GLU A CA  
992  C  C   . GLU A 117 ? 0.0927 0.1028 0.1375 0.0200  0.0064  0.0114  117 GLU A C   
993  O  O   . GLU A 117 ? 0.0843 0.1414 0.1685 0.0305  0.0094  0.0073  117 GLU A O   
994  C  CB  . GLU A 117 ? 0.1030 0.1300 0.1413 0.0256  0.0079  0.0218  117 GLU A CB  
995  C  CG  . GLU A 117 ? 0.1481 0.1885 0.1494 0.0769  -0.0325 -0.0166 117 GLU A CG  
996  C  CD  . GLU A 117 ? 0.2203 0.2698 0.1893 0.0557  -0.0718 0.0358  117 GLU A CD  
997  O  OE1 . GLU A 117 ? 0.2662 0.3036 0.2076 0.1340  0.0309  0.0695  117 GLU A OE1 
998  O  OE2 . GLU A 117 ? 0.2431 0.4336 0.2325 0.1224  -0.0982 0.0442  117 GLU A OE2 
999  N  N   . GLN A 118 ? 0.0903 0.1069 0.1259 0.0195  0.0165  0.0119  118 GLN A N   
1000 C  CA  . GLN A 118 ? 0.1248 0.1074 0.1239 0.0398  0.0005  0.0060  118 GLN A CA  
1001 C  C   . GLN A 118 ? 0.0984 0.1067 0.1215 0.0295  -0.0007 -0.0057 118 GLN A C   
1002 O  O   . GLN A 118 ? 0.0962 0.1422 0.1297 0.0426  0.0060  0.0076  118 GLN A O   
1003 C  CB  . GLN A 118 ? 0.1430 0.1196 0.1430 0.0213  0.0118  -0.0017 118 GLN A CB  
1004 C  CG  . GLN A 118 ? 0.1730 0.1399 0.1858 0.0263  0.0409  0.0334  118 GLN A CG  
1005 C  CD  . GLN A 118 ? 0.2167 0.1457 0.2303 -0.0012 -0.0244 0.0397  118 GLN A CD  
1006 O  OE1 . GLN A 118 ? 0.2020 0.1727 0.3469 0.0208  -0.0256 0.0195  118 GLN A OE1 
1007 N  NE2 . GLN A 118 ? 0.2561 0.1419 0.5463 0.0261  -0.1115 -0.0033 118 GLN A NE2 
1008 N  N   . HIS A 119 ? 0.0857 0.1043 0.1144 0.0212  0.0143  0.0034  119 HIS A N   
1009 C  CA  . HIS A 119 ? 0.0876 0.1066 0.1106 0.0154  0.0171  0.0021  119 HIS A CA  
1010 C  C   . HIS A 119 ? 0.0993 0.1152 0.1151 0.0135  0.0144  0.0040  119 HIS A C   
1011 O  O   . HIS A 119 ? 0.1094 0.1214 0.1214 -0.0034 0.0256  -0.0091 119 HIS A O   
1012 C  CB  . HIS A 119 ? 0.0982 0.1045 0.1215 0.0258  -0.0015 -0.0008 119 HIS A CB  
1013 C  CG  . HIS A 119 ? 0.0965 0.1141 0.1111 0.0157  0.0008  -0.0063 119 HIS A CG  
1014 N  ND1 . HIS A 119 ? 0.1423 0.1606 0.1281 -0.0081 -0.0182 -0.0193 119 HIS A ND1 
1015 C  CD2 . HIS A 119 ? 0.0983 0.1116 0.1546 0.0309  0.0210  0.0059  119 HIS A CD2 
1016 C  CE1 . HIS A 119 ? 0.1313 0.1102 0.1915 0.0132  -0.0533 -0.0223 119 HIS A CE1 
1017 N  NE2 . HIS A 119 ? 0.1363 0.1463 0.2484 -0.0151 0.0064  0.0042  119 HIS A NE2 
1018 N  N   . LEU A 120 ? 0.0987 0.1180 0.1158 0.0025  0.0115  -0.0024 120 LEU A N   
1019 C  CA  . LEU A 120 ? 0.0848 0.1131 0.1449 0.0094  0.0056  0.0129  120 LEU A CA  
1020 C  C   . LEU A 120 ? 0.0925 0.1141 0.1219 0.0103  0.0174  -0.0135 120 LEU A C   
1021 O  O   . LEU A 120 ? 0.0977 0.1347 0.1763 -0.0081 -0.0024 0.0264  120 LEU A O   
1022 C  CB  . LEU A 120 ? 0.1244 0.1191 0.1085 0.0144  0.0022  0.0024  120 LEU A CB  
1023 C  CG  . LEU A 120 ? 0.1157 0.1243 0.1277 0.0271  0.0038  0.0257  120 LEU A CG  
1024 C  CD1 . LEU A 120 ? 0.1254 0.1701 0.1345 0.0449  0.0175  0.0053  120 LEU A CD1 
1025 C  CD2 . LEU A 120 ? 0.1669 0.1480 0.1114 0.0372  0.0352  0.0096  120 LEU A CD2 
1026 N  N   . GLY A 121 ? 0.0965 0.1228 0.1374 0.0078  0.0020  0.0056  121 GLY A N   
1027 C  CA  . GLY A 121 ? 0.1099 0.1394 0.1454 0.0008  -0.0014 0.0188  121 GLY A CA  
1028 C  C   . GLY A 121 ? 0.0991 0.1816 0.1333 -0.0015 -0.0002 0.0119  121 GLY A C   
1029 O  O   . GLY A 121 ? 0.1028 0.1593 0.1155 -0.0116 0.0016  -0.0007 121 GLY A O   
1030 N  N   . PRO A 122 ? 0.1200 0.2953 0.1405 0.0569  -0.0036 -0.0104 122 PRO A N   
1031 C  CA  . PRO A 122 ? 0.1186 0.3284 0.1359 0.0394  -0.0106 -0.0154 122 PRO A CA  
1032 C  C   . PRO A 122 ? 0.1166 0.3230 0.1781 0.0046  -0.0043 -0.0589 122 PRO A C   
1033 O  O   . PRO A 122 ? 0.1351 0.3698 0.1930 0.0438  -0.0161 -0.0893 122 PRO A O   
1034 C  CB  . PRO A 122 ? 0.1726 0.4627 0.1644 0.0701  -0.0527 -0.0026 122 PRO A CB  
1035 C  CG  . PRO A 122 ? 0.1759 0.5084 0.2518 0.1388  -0.0690 -0.0539 122 PRO A CG  
1036 C  CD  . PRO A 122 ? 0.1622 0.3007 0.1895 0.0933  -0.0191 0.0222  122 PRO A CD  
1037 N  N   . GLN A 123 ? 0.1075 0.2739 0.2691 -0.0464 0.0321  -0.1184 123 GLN A N   
1038 C  CA  . GLN A 123 ? 0.1401 0.2774 0.3568 -0.0813 0.0204  -0.1180 123 GLN A CA  
1039 C  C   . GLN A 123 ? 0.1418 0.2090 0.2734 -0.0759 0.0605  -0.1027 123 GLN A C   
1040 O  O   . GLN A 123 ? 0.2016 0.2212 0.3971 -0.0725 0.0515  -0.1553 123 GLN A O   
1041 C  CB  . GLN A 123 ? 0.1532 0.2574 0.5407 -0.0703 0.1031  -0.1157 123 GLN A CB  
1042 C  CG  . GLN A 123 ? 0.5940 0.3513 0.5104 0.0526  0.2884  -0.0328 123 GLN A CG  
1043 C  CD  . GLN A 123 ? 0.9024 0.3791 0.3989 0.2272  0.3143  -0.1048 123 GLN A CD  
1044 O  OE1 . GLN A 123 ? 0.5146 0.3102 0.3916 -0.0886 0.1588  -0.0865 123 GLN A OE1 
1045 N  NE2 . GLN A 123 ? 1.2295 0.2901 0.4840 0.2616  0.0869  -0.0207 123 GLN A NE2 
1046 N  N   . PHE A 124 ? 0.1449 0.1572 0.1648 -0.0306 0.0531  -0.0463 124 PHE A N   
1047 C  CA  . PHE A 124 ? 0.1574 0.1235 0.1514 -0.0218 0.0581  -0.0206 124 PHE A CA  
1048 C  C   . PHE A 124 ? 0.1220 0.1214 0.1130 -0.0075 0.0082  0.0039  124 PHE A C   
1049 O  O   . PHE A 124 ? 0.1359 0.1228 0.1051 0.0124  0.0104  0.0097  124 PHE A O   
1050 C  CB  . PHE A 124 ? 0.1782 0.1374 0.1273 -0.0012 0.0435  0.0010  124 PHE A CB  
1051 C  CG  . PHE A 124 ? 0.2026 0.1137 0.1532 -0.0211 0.0518  -0.0107 124 PHE A CG  
1052 C  CD1 . PHE A 124 ? 0.3594 0.1351 0.1624 0.0212  0.0244  0.0069  124 PHE A CD1 
1053 C  CD2 . PHE A 124 ? 0.2144 0.2120 0.1480 -0.0555 0.0760  -0.0394 124 PHE A CD2 
1054 C  CE1 . PHE A 124 ? 0.4299 0.1973 0.2543 0.0152  0.0648  0.0804  124 PHE A CE1 
1055 C  CE2 . PHE A 124 ? 0.3084 0.2121 0.2106 -0.0734 0.1200  -0.0143 124 PHE A CE2 
1056 C  CZ  . PHE A 124 ? 0.4140 0.1702 0.2866 -0.0759 0.0900  0.0062  124 PHE A CZ  
1057 N  N   . VAL A 125 ? 0.1167 0.1038 0.1560 0.0091  0.0309  0.0100  125 VAL A N   
1058 C  CA  . VAL A 125 ? 0.0981 0.1122 0.1287 0.0084  0.0096  0.0139  125 VAL A CA  
1059 C  C   . VAL A 125 ? 0.1085 0.1132 0.1013 0.0003  -0.0079 0.0215  125 VAL A C   
1060 O  O   . VAL A 125 ? 0.1211 0.1246 0.0986 0.0058  0.0093  0.0159  125 VAL A O   
1061 C  CB  . VAL A 125 ? 0.1206 0.1158 0.1355 0.0156  0.0003  0.0147  125 VAL A CB  
1062 C  CG1 . VAL A 125 ? 0.2085 0.1811 0.1315 0.0354  0.0303  0.0467  125 VAL A CG1 
1063 C  CG2 . VAL A 125 ? 0.1573 0.1100 0.1633 0.0221  0.0079  0.0163  125 VAL A CG2 
1064 N  N   . GLU A 126 ? 0.1065 0.1334 0.1060 0.0076  -0.0113 0.0086  126 GLU A N   
1065 C  CA  . GLU A 126 ? 0.1091 0.1485 0.1322 0.0050  -0.0290 -0.0102 126 GLU A CA  
1066 C  C   . GLU A 126 ? 0.1079 0.1334 0.1039 -0.0017 0.0039  -0.0084 126 GLU A C   
1067 O  O   . GLU A 126 ? 0.1115 0.1517 0.1266 0.0112  -0.0072 -0.0202 126 GLU A O   
1068 C  CB  . GLU A 126 ? 0.1336 0.1605 0.2245 -0.0173 -0.0643 0.0127  126 GLU A CB  
1069 C  CG  . GLU A 126 ? 0.1889 0.1980 0.3156 0.0057  -0.1252 0.0388  126 GLU A CG  
1070 C  CD  . GLU A 126 ? 0.1650 0.2814 0.4836 0.0395  -0.1213 0.0324  126 GLU A CD  
1071 O  OE1 . GLU A 126 ? 0.1249 0.3290 0.7629 -0.0375 -0.0406 -0.0442 126 GLU A OE1 
1072 O  OE2 . GLU A 126 ? 0.2178 0.3857 0.3551 0.1094  -0.0012 0.0357  126 GLU A OE2 
1073 N  N   . ARG A 127 ? 0.0861 0.1061 0.1069 0.0048  0.0041  -0.0012 127 ARG A N   
1076 C  C   . ARG A 127 ? 0.0827 0.0937 0.0914 0.0031  0.0050  -0.0054 127 ARG A C   
1077 O  O   . ARG A 127 ? 0.0989 0.0939 0.1016 0.0021  -0.0081 -0.0036 127 ARG A O   
1084 N  NE  A ARG A 127 ? 0.1867 0.6418 0.3481 -0.2299 -0.1006 0.2835  127 ARG A NE  
1085 N  NE  B ARG A 127 ? 0.1503 0.2355 0.3124 0.0535  -0.0181 0.0259  127 ARG A NE  
1086 C  CZ  A ARG A 127 ? 0.2480 0.6478 0.3903 -0.2869 -0.0214 0.2704  127 ARG A CZ  
1087 C  CZ  B ARG A 127 ? 0.2438 0.2635 0.3526 -0.0779 -0.1133 0.0267  127 ARG A CZ  
1088 N  NH1 A ARG A 127 ? 0.3002 0.5133 0.3728 -0.3209 -0.1420 0.2004  127 ARG A NH1 
1089 N  NH1 B ARG A 127 ? 0.2496 0.3688 0.3334 -0.2533 -0.1061 0.1509  127 ARG A NH1 
1090 N  NH2 A ARG A 127 ? 0.2823 0.6808 0.4138 -0.3012 -0.0995 0.3046  127 ARG A NH2 
1091 N  NH2 B ARG A 127 ? 0.4202 0.1716 0.2239 -0.0513 -0.1011 -0.0505 127 ARG A NH2 
1092 N  N   . ILE A 128 ? 0.0855 0.1056 0.0880 0.0091  0.0011  0.0052  128 ILE A N   
1093 C  CA  . ILE A 128 ? 0.0831 0.1011 0.0953 0.0042  -0.0030 -0.0036 128 ILE A CA  
1094 C  C   . ILE A 128 ? 0.0769 0.0913 0.0827 -0.0042 0.0061  -0.0015 128 ILE A C   
1095 O  O   . ILE A 128 ? 0.0859 0.1079 0.0882 0.0108  0.0007  0.0011  128 ILE A O   
1096 C  CB  . ILE A 128 ? 0.1040 0.0937 0.0840 0.0022  0.0028  0.0006  128 ILE A CB  
1097 C  CG1 . ILE A 128 ? 0.0961 0.1035 0.0938 0.0083  0.0014  0.0033  128 ILE A CG1 
1098 C  CG2 . ILE A 128 ? 0.1057 0.0886 0.1164 0.0026  0.0140  -0.0036 128 ILE A CG2 
1099 C  CD1 . ILE A 128 ? 0.1346 0.1003 0.1243 0.0261  0.0037  0.0073  128 ILE A CD1 
1100 N  N   . ILE A 129 ? 0.0787 0.1139 0.0811 0.0002  0.0025  -0.0055 129 ILE A N   
1101 C  CA  . ILE A 129 ? 0.0889 0.1041 0.0717 0.0070  -0.0041 0.0024  129 ILE A CA  
1102 C  C   . ILE A 129 ? 0.0904 0.1077 0.0793 0.0042  0.0062  -0.0045 129 ILE A C   
1103 O  O   . ILE A 129 ? 0.0977 0.1563 0.0792 -0.0224 -0.0031 0.0015  129 ILE A O   
1104 C  CB  . ILE A 129 ? 0.0945 0.1067 0.0984 0.0090  -0.0043 0.0078  129 ILE A CB  
1105 C  CG1 . ILE A 129 ? 0.1069 0.1105 0.1169 0.0013  0.0241  -0.0045 129 ILE A CG1 
1106 C  CG2 . ILE A 129 ? 0.1026 0.1164 0.1533 0.0102  0.0110  -0.0074 129 ILE A CG2 
1107 C  CD1 . ILE A 129 ? 0.1265 0.1192 0.2165 -0.0018 0.0478  0.0182  129 ILE A CD1 
1108 N  N   . LEU A 130 ? 0.0906 0.1157 0.0825 0.0025  -0.0078 0.0104  130 LEU A N   
1109 C  CA  . LEU A 130 ? 0.1155 0.0983 0.0766 -0.0166 -0.0165 0.0080  130 LEU A CA  
1110 C  C   . LEU A 130 ? 0.0898 0.1417 0.0878 -0.0238 -0.0006 0.0145  130 LEU A C   
1111 O  O   . LEU A 130 ? 0.0917 0.1793 0.0805 0.0071  0.0091  -0.0045 130 LEU A O   
1112 C  CB  . LEU A 130 ? 0.2445 0.1166 0.1736 -0.0488 -0.0692 0.0537  130 LEU A CB  
1113 C  CG  . LEU A 130 ? 0.6927 0.1052 0.2390 -0.0436 -0.0189 0.0666  130 LEU A CG  
1114 C  CD1 . LEU A 130 ? 0.3073 0.1037 0.2081 -0.0080 0.0072  0.0463  130 LEU A CD1 
1115 C  CD2 . LEU A 130 ? 1.0194 0.1682 0.0957 -0.0900 -0.0370 -0.0466 130 LEU A CD2 
1116 N  N   . THR A 131 ? 0.0860 0.1157 0.0791 -0.0145 0.0105  0.0115  131 THR A N   
1117 C  CA  . THR A 131 ? 0.0968 0.1125 0.1061 -0.0115 0.0041  -0.0032 131 THR A CA  
1118 C  C   . THR A 131 ? 0.0965 0.1224 0.1034 -0.0039 -0.0032 0.0205  131 THR A C   
1119 O  O   . THR A 131 ? 0.1067 0.1304 0.1036 -0.0034 0.0048  0.0052  131 THR A O   
1120 C  CB  . THR A 131 ? 0.0977 0.1123 0.0891 -0.0091 0.0096  -0.0032 131 THR A CB  
1121 O  OG1 . THR A 131 ? 0.1199 0.1228 0.1047 0.0001  0.0068  0.0055  131 THR A OG1 
1122 C  CG2 . THR A 131 ? 0.1198 0.1405 0.0985 0.0025  0.0081  0.0161  131 THR A CG2 
1123 N  N   . ARG A 132 ? 0.0950 0.1202 0.0955 -0.0071 0.0033  0.0108  132 ARG A N   
1124 C  CA  . ARG A 132 ? 0.0925 0.1215 0.1387 -0.0080 -0.0048 0.0182  132 ARG A CA  
1125 C  C   . ARG A 132 ? 0.1032 0.1143 0.1236 -0.0020 0.0019  0.0154  132 ARG A C   
1126 O  O   . ARG A 132 ? 0.1177 0.1386 0.1668 -0.0144 -0.0279 0.0428  132 ARG A O   
1127 C  CB  . ARG A 132 ? 0.1008 0.1995 0.1910 -0.0108 0.0061  0.0931  132 ARG A CB  
1128 C  CG  . ARG A 132 ? 0.1600 0.1676 0.2925 -0.0468 -0.0154 0.0744  132 ARG A CG  
1129 C  CD  . ARG A 132 ? 0.2191 0.1725 0.2999 0.0803  -0.1172 -0.0077 132 ARG A CD  
1130 N  NE  . ARG A 132 ? 0.1686 0.1953 0.2204 0.0435  -0.0448 0.0152  132 ARG A NE  
1131 C  CZ  . ARG A 132 ? 0.1510 0.1862 0.1913 -0.0019 -0.0244 0.0517  132 ARG A CZ  
1132 N  NH1 . ARG A 132 ? 0.1614 0.2059 0.2976 -0.0127 -0.0654 0.0496  132 ARG A NH1 
1133 N  NH2 . ARG A 132 ? 0.1761 0.1707 0.2472 -0.0274 -0.0410 0.0011  132 ARG A NH2 
1134 N  N   . ASP A 133 ? 0.1126 0.1217 0.0902 -0.0028 0.0039  0.0140  133 ASP A N   
1135 C  CA  . ASP A 133 ? 0.1151 0.1155 0.0925 -0.0059 0.0087  0.0150  133 ASP A CA  
1136 C  C   . ASP A 133 ? 0.1089 0.1057 0.0909 0.0110  0.0150  0.0040  133 ASP A C   
1137 O  O   . ASP A 133 ? 0.1092 0.1216 0.0989 -0.0063 0.0097  0.0111  133 ASP A O   
1138 C  CB  . ASP A 133 ? 0.1323 0.1298 0.1272 0.0031  0.0587  0.0169  133 ASP A CB  
1139 C  CG  . ASP A 133 ? 0.1078 0.1406 0.1004 0.0127  0.0170  -0.0019 133 ASP A CG  
1140 O  OD1 . ASP A 133 ? 0.1357 0.1276 0.1008 0.0218  0.0266  0.0071  133 ASP A OD1 
1141 O  OD2 . ASP A 133 ? 0.1446 0.1483 0.1032 0.0145  0.0288  -0.0112 133 ASP A OD2 
1142 N  N   . LYS A 134 ? 0.0991 0.0993 0.0899 -0.0027 0.0174  -0.0024 134 LYS A N   
1143 C  CA  . LYS A 134 ? 0.1115 0.0959 0.0913 0.0063  0.0135  0.0085  134 LYS A CA  
1144 C  C   . LYS A 134 ? 0.1099 0.0953 0.0783 0.0103  0.0117  0.0108  134 LYS A C   
1145 O  O   . LYS A 134 ? 0.1101 0.1014 0.0804 0.0099  0.0132  0.0118  134 LYS A O   
1146 C  CB  . LYS A 134 ? 0.0833 0.0908 0.0941 0.0033  0.0087  0.0061  134 LYS A CB  
1147 C  CG  . LYS A 134 ? 0.1251 0.0965 0.0841 0.0183  0.0103  0.0072  134 LYS A CG  
1148 C  CD  . LYS A 134 ? 0.1151 0.1010 0.0961 -0.0010 0.0208  -0.0009 134 LYS A CD  
1149 C  CE  . LYS A 134 ? 0.0965 0.0947 0.1082 0.0087  0.0088  0.0076  134 LYS A CE  
1150 N  NZ  . LYS A 134 ? 0.0895 0.0989 0.1041 0.0022  -0.0004 0.0043  134 LYS A NZ  
1151 N  N   . THR A 135 ? 0.1043 0.0916 0.0859 0.0039  0.0138  0.0042  135 THR A N   
1152 C  CA  . THR A 135 ? 0.1206 0.0894 0.1014 0.0101  0.0194  -0.0048 135 THR A CA  
1153 C  C   . THR A 135 ? 0.1136 0.0975 0.0964 0.0062  0.0098  0.0031  135 THR A C   
1154 O  O   . THR A 135 ? 0.1456 0.0931 0.1051 0.0037  0.0071  0.0027  135 THR A O   
1155 C  CB  . THR A 135 ? 0.1201 0.1036 0.0965 0.0167  0.0052  0.0156  135 THR A CB  
1156 O  OG1 . THR A 135 ? 0.1269 0.1330 0.1033 0.0295  0.0170  -0.0005 135 THR A OG1 
1157 C  CG2 . THR A 135 ? 0.1413 0.1297 0.1069 0.0186  -0.0012 -0.0004 135 THR A CG2 
1158 N  N   . VAL A 136 ? 0.1058 0.0843 0.1075 0.0074  0.0115  -0.0014 136 VAL A N   
1159 C  CA  . VAL A 136 ? 0.1297 0.0973 0.0891 0.0196  0.0120  -0.0189 136 VAL A CA  
1160 C  C   . VAL A 136 ? 0.1246 0.1139 0.0876 0.0106  0.0033  -0.0184 136 VAL A C   
1161 O  O   . VAL A 136 ? 0.1210 0.1674 0.1209 0.0163  0.0008  -0.0500 136 VAL A O   
1162 C  CB  . VAL A 136 ? 0.1284 0.1223 0.1017 0.0000  0.0053  0.0007  136 VAL A CB  
1163 C  CG1 . VAL A 136 ? 0.1398 0.1586 0.0912 0.0106  0.0259  -0.0091 136 VAL A CG1 
1164 C  CG2 . VAL A 136 ? 0.1818 0.1207 0.0991 -0.0008 0.0067  -0.0034 136 VAL A CG2 
1165 N  N   . VAL A 137 ? 0.1144 0.0970 0.0924 0.0182  0.0035  -0.0024 137 VAL A N   
1166 C  CA  . VAL A 137 ? 0.1175 0.1129 0.0908 0.0150  0.0049  0.0060  137 VAL A CA  
1167 C  C   . VAL A 137 ? 0.1219 0.1244 0.0931 -0.0028 -0.0044 0.0102  137 VAL A C   
1168 O  O   . VAL A 137 ? 0.1210 0.1198 0.0990 -0.0005 -0.0088 0.0103  137 VAL A O   
1169 C  CB  . VAL A 137 ? 0.1233 0.1171 0.0888 0.0391  0.0157  0.0049  137 VAL A CB  
1170 C  CG1 . VAL A 137 ? 0.1165 0.1473 0.1135 0.0216  -0.0059 -0.0190 137 VAL A CG1 
1171 C  CG2 . VAL A 137 ? 0.1504 0.1174 0.1366 0.0234  0.0164  0.0175  137 VAL A CG2 
1172 N  N   . LEU A 138 ? 0.1154 0.1273 0.0790 -0.0032 -0.0075 0.0096  138 LEU A N   
1175 C  C   . LEU A 138 ? 0.1504 0.1217 0.1108 -0.0034 0.0193  0.0230  138 LEU A C   
1176 O  O   . LEU A 138 ? 0.2065 0.2170 0.1236 0.0706  0.0536  0.0563  138 LEU A O   
1179 C  CG  A LEU A 138 ? 0.2254 0.2157 0.1669 0.0125  -0.0086 0.0044  138 LEU A CG  
1180 C  CG  B LEU A 138 ? 0.2249 0.1779 0.0944 -0.0005 -0.0186 -0.0368 138 LEU A CG  
1181 C  CD1 A LEU A 138 ? 0.2232 0.2318 0.2217 -0.0228 -0.0344 0.0495  138 LEU A CD1 
1182 C  CD1 B LEU A 138 ? 0.1864 0.0890 0.2186 -0.0254 -0.0395 -0.1187 138 LEU A CD1 
1183 C  CD2 A LEU A 138 ? 0.3473 0.2338 0.2381 -0.0543 -0.1002 0.0369  138 LEU A CD2 
1184 C  CD2 B LEU A 138 ? 0.5194 0.1127 0.2909 0.0920  -0.0998 -0.0370 138 LEU A CD2 
1185 N  N   . GLY A 139 ? 0.1538 0.1515 0.1032 0.0040  0.0185  0.0178  139 GLY A N   
1186 C  CA  . GLY A 139 ? 0.1517 0.1523 0.1168 0.0079  0.0340  0.0324  139 GLY A CA  
1187 C  C   . GLY A 139 ? 0.1032 0.1058 0.0973 -0.0082 0.0067  0.0007  139 GLY A C   
1188 O  O   . GLY A 139 ? 0.1122 0.1486 0.0977 -0.0054 0.0137  0.0071  139 GLY A O   
1189 N  N   . ASP A 140 ? 0.1215 0.0813 0.1020 -0.0124 0.0081  0.0032  140 ASP A N   
1190 C  CA  . ASP A 140 ? 0.1181 0.0749 0.0956 -0.0051 0.0239  -0.0024 140 ASP A CA  
1191 C  C   . ASP A 140 ? 0.0993 0.0707 0.1052 0.0084  0.0154  -0.0055 140 ASP A C   
1192 O  O   . ASP A 140 ? 0.1309 0.0640 0.1090 0.0013  0.0087  0.0022  140 ASP A O   
1193 C  CB  . ASP A 140 ? 0.1274 0.1132 0.0948 -0.0259 0.0186  -0.0045 140 ASP A CB  
1194 C  CG  . ASP A 140 ? 0.1465 0.0993 0.1436 -0.0295 0.0060  -0.0119 140 ASP A CG  
1195 O  OD1 . ASP A 140 ? 0.2881 0.1063 0.5072 0.0044  -0.1980 -0.0652 140 ASP A OD1 
1196 O  OD2 . ASP A 140 ? 0.1566 0.1143 0.1902 -0.0253 -0.0237 -0.0329 140 ASP A OD2 
1197 N  N   . LEU A 141 ? 0.1063 0.0698 0.0941 -0.0047 0.0013  0.0119  141 LEU A N   
1198 C  CA  . LEU A 141 ? 0.1002 0.0662 0.1027 -0.0018 0.0123  0.0007  141 LEU A CA  
1199 C  C   . LEU A 141 ? 0.0881 0.0713 0.0965 0.0032  0.0101  0.0081  141 LEU A C   
1200 O  O   . LEU A 141 ? 0.0898 0.0834 0.1113 -0.0056 0.0034  0.0155  141 LEU A O   
1201 C  CB  . LEU A 141 ? 0.0895 0.0868 0.0920 -0.0141 0.0088  0.0056  141 LEU A CB  
1202 C  CG  . LEU A 141 ? 0.1282 0.0595 0.0941 -0.0173 0.0054  -0.0062 141 LEU A CG  
1203 C  CD1 . LEU A 141 ? 0.1343 0.1342 0.1252 -0.0091 0.0381  0.0284  141 LEU A CD1 
1204 C  CD2 . LEU A 141 ? 0.1419 0.0840 0.1134 -0.0152 -0.0092 0.0086  141 LEU A CD2 
1205 N  N   . LEU A 142 ? 0.1020 0.0645 0.1025 -0.0008 -0.0057 0.0205  142 LEU A N   
1206 C  CA  . LEU A 142 ? 0.1034 0.0567 0.0885 -0.0021 0.0054  0.0053  142 LEU A CA  
1207 C  C   . LEU A 142 ? 0.0940 0.0592 0.0873 -0.0013 -0.0019 0.0142  142 LEU A C   
1208 O  O   . LEU A 142 ? 0.1204 0.0696 0.0966 0.0067  -0.0091 0.0072  142 LEU A O   
1209 C  CB  . LEU A 142 ? 0.1082 0.0711 0.0942 -0.0118 0.0029  -0.0019 142 LEU A CB  
1210 C  CG  . LEU A 142 ? 0.0995 0.0794 0.1263 -0.0036 0.0163  0.0105  142 LEU A CG  
1211 C  CD1 . LEU A 142 ? 0.1155 0.0872 0.1144 -0.0174 0.0022  0.0228  142 LEU A CD1 
1212 C  CD2 . LEU A 142 ? 0.1096 0.1301 0.1459 -0.0134 0.0296  0.0081  142 LEU A CD2 
1213 N  N   . ILE A 143 ? 0.0893 0.0648 0.0883 -0.0058 -0.0095 0.0026  143 ILE A N   
1214 C  CA  . ILE A 143 ? 0.0775 0.0724 0.0994 -0.0130 -0.0039 -0.0029 143 ILE A CA  
1215 C  C   . ILE A 143 ? 0.0886 0.0735 0.0853 -0.0081 0.0006  0.0030  143 ILE A C   
1216 O  O   . ILE A 143 ? 0.1031 0.0797 0.0847 -0.0044 -0.0091 0.0029  143 ILE A O   
1217 C  CB  . ILE A 143 ? 0.0819 0.0787 0.0828 -0.0005 -0.0016 0.0117  143 ILE A CB  
1218 C  CG1 . ILE A 143 ? 0.1006 0.0931 0.1241 -0.0192 0.0186  -0.0037 143 ILE A CG1 
1219 C  CG2 . ILE A 143 ? 0.1030 0.1019 0.0924 -0.0156 0.0010  -0.0038 143 ILE A CG2 
1220 C  CD1 . ILE A 143 ? 0.0968 0.1146 0.1125 -0.0325 0.0149  -0.0143 143 ILE A CD1 
1221 N  N   . ASP A 144 ? 0.0826 0.0785 0.0944 -0.0073 0.0019  0.0117  144 ASP A N   
1222 C  CA  . ASP A 144 ? 0.0897 0.0746 0.0873 -0.0127 0.0002  0.0115  144 ASP A CA  
1223 C  C   . ASP A 144 ? 0.0760 0.0792 0.0940 0.0022  0.0084  0.0131  144 ASP A C   
1224 O  O   . ASP A 144 ? 0.0917 0.0862 0.0963 0.0032  -0.0097 0.0162  144 ASP A O   
1225 C  CB  . ASP A 144 ? 0.0816 0.0795 0.1101 0.0056  0.0165  0.0081  144 ASP A CB  
1226 C  CG  . ASP A 144 ? 0.1005 0.0786 0.0913 -0.0059 0.0092  0.0043  144 ASP A CG  
1227 O  OD1 . ASP A 144 ? 0.1162 0.0914 0.0932 -0.0253 -0.0004 0.0140  144 ASP A OD1 
1228 O  OD2 . ASP A 144 ? 0.1246 0.1272 0.0958 -0.0273 -0.0044 0.0059  144 ASP A OD2 
1229 N  N   . ASP A 145 ? 0.0784 0.0854 0.0876 -0.0066 -0.0033 0.0175  145 ASP A N   
1230 C  CA  . ASP A 145 ? 0.0818 0.0828 0.0925 0.0082  -0.0012 0.0038  145 ASP A CA  
1231 C  C   . ASP A 145 ? 0.0751 0.0893 0.0858 0.0048  0.0046  0.0235  145 ASP A C   
1232 O  O   . ASP A 145 ? 0.0885 0.0953 0.0983 -0.0038 -0.0089 0.0069  145 ASP A O   
1233 C  CB  . ASP A 145 ? 0.1049 0.0822 0.0922 0.0013  -0.0002 0.0024  145 ASP A CB  
1234 C  CG  . ASP A 145 ? 0.0876 0.0876 0.1102 -0.0038 -0.0118 0.0096  145 ASP A CG  
1235 O  OD1 . ASP A 145 ? 0.1014 0.0826 0.0914 0.0027  0.0011  0.0065  145 ASP A OD1 
1236 O  OD2 . ASP A 145 ? 0.1442 0.0946 0.1481 -0.0339 -0.0480 0.0294  145 ASP A OD2 
1237 N  N   . LYS A 146 ? 0.0654 0.0880 0.0899 -0.0068 -0.0061 0.0100  146 LYS A N   
1238 C  CA  . LYS A 146 ? 0.0724 0.0830 0.0925 0.0027  -0.0013 0.0037  146 LYS A CA  
1239 C  C   . LYS A 146 ? 0.0831 0.0853 0.1157 0.0074  0.0129  0.0117  146 LYS A C   
1240 O  O   . LYS A 146 ? 0.0884 0.0912 0.1227 -0.0019 0.0016  0.0137  146 LYS A O   
1241 C  CB  . LYS A 146 ? 0.0930 0.0989 0.0975 -0.0095 -0.0020 -0.0044 146 LYS A CB  
1242 C  CG  . LYS A 146 ? 0.0981 0.1145 0.1090 -0.0034 0.0178  0.0034  146 LYS A CG  
1243 C  CD  . LYS A 146 ? 0.1348 0.1143 0.1084 0.0046  0.0219  0.0237  146 LYS A CD  
1244 C  CE  . LYS A 146 ? 0.1396 0.1539 0.1208 -0.0087 0.0376  0.0192  146 LYS A CE  
1245 N  NZ  . LYS A 146 ? 0.1263 0.1714 0.1400 0.0007  0.0316  0.0146  146 LYS A NZ  
1246 N  N   . ASP A 147 ? 0.0813 0.1078 0.1093 0.0012  -0.0010 0.0169  147 ASP A N   
1247 C  CA  . ASP A 147 ? 0.1150 0.1198 0.1084 0.0153  -0.0083 0.0033  147 ASP A CA  
1248 C  C   . ASP A 147 ? 0.1158 0.1148 0.1239 0.0340  -0.0068 0.0190  147 ASP A C   
1249 O  O   . ASP A 147 ? 0.2543 0.1145 0.1546 0.0455  0.0275  0.0362  147 ASP A O   
1250 C  CB  . ASP A 147 ? 0.1462 0.1822 0.1709 -0.0023 -0.0648 0.0236  147 ASP A CB  
1251 C  CG  . ASP A 147 ? 0.1110 0.1659 0.2095 0.0208  -0.0340 -0.0142 147 ASP A CG  
1252 O  OD1 . ASP A 147 ? 0.1503 0.1422 0.2368 -0.0215 -0.0148 -0.0205 147 ASP A OD1 
1253 O  OD2 . ASP A 147 ? 0.1827 0.1753 0.4040 0.0505  0.0206  -0.0725 147 ASP A OD2 
1254 N  N   . THR A 148 ? 0.1077 0.1143 0.1164 0.0249  -0.0031 -0.0065 148 THR A N   
1256 C  C   . THR A 148 ? 0.1261 0.1275 0.1157 0.0200  -0.0097 -0.0045 148 THR A C   
1257 O  O   . THR A 148 ? 0.2737 0.1782 0.1490 -0.0969 -0.0629 0.0350  148 THR A O   
1261 N  N   . VAL A 149 ? 0.1688 0.0951 0.1220 0.0112  -0.0048 -0.0013 149 VAL A N   
1262 C  CA  . VAL A 149 ? 0.1405 0.1058 0.1052 -0.0044 0.0040  0.0058  149 VAL A CA  
1263 C  C   . VAL A 149 ? 0.1530 0.1373 0.1289 0.0050  -0.0006 -0.0153 149 VAL A C   
1264 O  O   . VAL A 149 ? 0.2006 0.1287 0.1760 -0.0030 0.0032  -0.0448 149 VAL A O   
1265 C  CB  . VAL A 149 ? 0.1456 0.1184 0.1027 -0.0243 0.0207  0.0016  149 VAL A CB  
1266 C  CG1 . VAL A 149 ? 0.1287 0.1118 0.1352 -0.0032 0.0067  0.0146  149 VAL A CG1 
1267 C  CG2 . VAL A 149 ? 0.1258 0.1073 0.1530 0.0067  0.0074  -0.0103 149 VAL A CG2 
1268 N  N   . ARG A 150 ? 0.1572 0.1508 0.1212 0.0436  0.0070  -0.0109 150 ARG A N   
1269 C  CA  . ARG A 150 ? 0.1838 0.2361 0.1231 0.1002  -0.0192 -0.0357 150 ARG A CA  
1270 C  C   . ARG A 150 ? 0.1180 0.1495 0.1218 0.0255  -0.0005 -0.0151 150 ARG A C   
1271 O  O   . ARG A 150 ? 0.1189 0.1363 0.1584 0.0256  0.0025  -0.0112 150 ARG A O   
1272 C  CB  . ARG A 150 ? 0.1813 0.4299 0.1787 0.1615  -0.0610 -0.1209 150 ARG A CB  
1273 C  CG  . ARG A 150 ? 0.2394 0.4433 0.2482 0.0487  -0.1191 -0.0412 150 ARG A CG  
1279 N  N   . GLY A 151 ? 0.1294 0.1662 0.1312 0.0550  0.0044  -0.0257 151 GLY A N   
1280 C  CA  . GLY A 151 ? 0.1186 0.1803 0.1319 0.0408  0.0124  -0.0256 151 GLY A CA  
1281 C  C   . GLY A 151 ? 0.1147 0.1688 0.1273 0.0268  0.0255  -0.0129 151 GLY A C   
1282 O  O   . GLY A 151 ? 0.1613 0.1904 0.1746 0.0601  -0.0024 -0.0108 151 GLY A O   
1283 N  N   . GLN A 152 ? 0.1498 0.1687 0.1336 0.0387  0.0149  -0.0185 152 GLN A N   
1284 C  CA  . GLN A 152 ? 0.1685 0.1943 0.1330 0.0227  0.0456  -0.0355 152 GLN A CA  
1285 C  C   . GLN A 152 ? 0.2605 0.1783 0.2025 0.0099  0.1054  -0.0404 152 GLN A C   
1286 O  O   . GLN A 152 ? 0.3647 0.1946 0.3962 0.0270  0.2149  -0.0767 152 GLN A O   
1287 C  CB  . GLN A 152 ? 0.2231 0.1976 0.1749 0.0622  -0.0250 -0.0468 152 GLN A CB  
1288 C  CG  . GLN A 152 ? 0.3337 0.2101 0.1413 0.0984  0.0655  -0.0189 152 GLN A CG  
1289 C  CD  . GLN A 152 ? 0.3514 0.4032 0.1619 0.1436  0.0465  -0.0129 152 GLN A CD  
1290 O  OE1 . GLN A 152 ? 0.4235 0.3724 0.2799 0.1635  -0.1076 0.0499  152 GLN A OE1 
1291 N  NE2 . GLN A 152 ? 0.8223 0.2831 0.1842 -0.0258 0.0713  0.0455  152 GLN A NE2 
1292 N  N   . GLU A 153 ? 0.2211 0.1351 0.1842 -0.0040 0.0749  -0.0619 153 GLU A N   
1293 C  CA  . GLU A 153 ? 0.2698 0.1384 0.2574 0.0358  0.1342  -0.0238 153 GLU A CA  
1294 C  C   . GLU A 153 ? 0.2111 0.1322 0.3078 0.0222  0.1152  0.0149  153 GLU A C   
1295 O  O   . GLU A 153 ? 0.2436 0.1708 0.2633 0.0664  0.0700  0.0130  153 GLU A O   
1296 C  CB  . GLU A 153 ? 0.2494 0.1547 0.2198 -0.0091 0.0757  -0.0181 153 GLU A CB  
1297 C  CG  . GLU A 153 ? 0.3647 0.1642 0.2054 0.0472  0.0412  -0.0193 153 GLU A CG  
1298 C  CD  . GLU A 153 ? 0.4023 0.1567 0.1694 0.0508  0.0430  -0.0106 153 GLU A CD  
1299 O  OE1 . GLU A 153 ? 0.4147 0.1671 0.1958 0.0140  -0.0168 0.0105  153 GLU A OE1 
1300 O  OE2 . GLU A 153 ? 0.4904 0.2088 0.1701 0.0138  0.0436  -0.0146 153 GLU A OE2 
1301 N  N   . GLU A 154 ? 0.2022 0.1611 0.3989 0.0383  0.1467  0.0163  154 GLU A N   
1302 C  CA  . GLU A 154 ? 0.1714 0.3004 0.5083 0.0705  0.1105  0.1040  154 GLU A CA  
1303 C  C   . GLU A 154 ? 0.1452 0.3044 0.4195 0.0404  0.0310  0.1037  154 GLU A C   
1304 O  O   . GLU A 154 ? 0.2229 0.2223 0.4536 0.0008  -0.0034 0.0736  154 GLU A O   
1305 C  CB  . GLU A 154 ? 0.1935 0.3117 0.7671 0.0986  0.1998  0.1917  154 GLU A CB  
1306 C  CG  . GLU A 154 ? 0.3387 0.6874 0.9107 0.2798  0.2450  0.4664  154 GLU A CG  
1307 C  CD  . GLU A 154 ? 0.5970 1.0115 1.1712 0.6099  0.4258  0.5958  154 GLU A CD  
1308 O  OE1 . GLU A 154 ? 0.6318 1.4006 1.3537 0.8138  0.5821  0.8826  154 GLU A OE1 
1309 O  OE2 . GLU A 154 ? 0.9478 1.2805 1.2444 0.9203  0.5942  0.5336  154 GLU A OE2 
1310 N  N   . THR A 155 ? 0.1528 0.1655 0.3587 0.0718  0.0529  0.0632  155 THR A N   
1311 C  CA  . THR A 155 ? 0.1723 0.1381 0.2736 0.0474  0.0433  0.0021  155 THR A CA  
1312 C  C   . THR A 155 ? 0.1506 0.1187 0.2254 0.0146  0.0395  0.0096  155 THR A C   
1313 O  O   . THR A 155 ? 0.2038 0.1430 0.2089 0.0241  0.0203  -0.0257 155 THR A O   
1314 C  CB  . THR A 155 ? 0.2065 0.1393 0.2427 0.0408  0.0269  0.0144  155 THR A CB  
1315 O  OG1 . THR A 155 ? 0.2367 0.1697 0.3485 0.0668  0.0333  0.0761  155 THR A OG1 
1316 C  CG2 . THR A 155 ? 0.2306 0.2515 0.2354 0.0000  0.0069  0.0624  155 THR A CG2 
1317 N  N   . PRO A 156 ? 0.1594 0.1229 0.1977 0.0280  0.0243  -0.0106 156 PRO A N   
1318 C  CA  . PRO A 156 ? 0.1563 0.1339 0.1829 0.0255  0.0454  0.0065  156 PRO A CA  
1319 C  C   . PRO A 156 ? 0.1598 0.1056 0.1661 0.0240  0.0209  0.0213  156 PRO A C   
1320 O  O   . PRO A 156 ? 0.1533 0.1045 0.1727 0.0218  0.0005  0.0208  156 PRO A O   
1321 C  CB  . PRO A 156 ? 0.2039 0.0966 0.2953 0.0201  0.0695  0.0054  156 PRO A CB  
1322 C  CG  . PRO A 156 ? 0.2081 0.1309 0.2256 0.0183  0.0351  -0.0258 156 PRO A CG  
1323 C  CD  . PRO A 156 ? 0.1684 0.1324 0.2220 -0.0086 0.0341  0.0130  156 PRO A CD  
1324 N  N   . SER A 157 ? 0.1713 0.1023 0.1017 0.0027  0.0121  0.0025  157 SER A N   
1325 C  CA  . SER A 157 ? 0.1710 0.0990 0.1075 0.0032  0.0090  0.0036  157 SER A CA  
1326 C  C   . SER A 157 ? 0.1461 0.0859 0.1157 0.0091  0.0151  0.0156  157 SER A C   
1327 O  O   . SER A 157 ? 0.1668 0.0864 0.1182 -0.0064 0.0223  0.0097  157 SER A O   
1328 C  CB  . SER A 157 ? 0.1755 0.1051 0.1350 0.0157  -0.0099 -0.0134 157 SER A CB  
1329 O  OG  . SER A 157 ? 0.2576 0.1253 0.1332 0.0225  -0.0251 0.0143  157 SER A OG  
1330 N  N   . TRP A 158 ? 0.1459 0.0939 0.0900 -0.0071 0.0211  0.0162  158 TRP A N   
1331 C  CA  . TRP A 158 ? 0.1301 0.0925 0.0971 0.0136  0.0084  0.0183  158 TRP A CA  
1332 C  C   . TRP A 158 ? 0.1294 0.0797 0.0986 -0.0082 0.0086  0.0152  158 TRP A C   
1333 O  O   . TRP A 158 ? 0.1275 0.1040 0.1019 0.0085  0.0063  0.0129  158 TRP A O   
1334 C  CB  . TRP A 158 ? 0.1276 0.0982 0.0966 -0.0033 0.0023  0.0131  158 TRP A CB  
1335 C  CG  . TRP A 158 ? 0.1282 0.0835 0.0873 0.0013  0.0138  0.0071  158 TRP A CG  
1336 C  CD1 . TRP A 158 ? 0.1171 0.0923 0.0985 -0.0006 0.0108  0.0029  158 TRP A CD1 
1337 C  CD2 . TRP A 158 ? 0.1169 0.0862 0.0939 0.0178  0.0149  0.0069  158 TRP A CD2 
1338 N  NE1 . TRP A 158 ? 0.1329 0.0849 0.0915 -0.0063 0.0072  0.0142  158 TRP A NE1 
1339 C  CE2 . TRP A 158 ? 0.1146 0.0849 0.0976 0.0084  0.0114  0.0056  158 TRP A CE2 
1340 C  CE3 . TRP A 158 ? 0.1205 0.1058 0.0970 0.0012  0.0148  0.0080  158 TRP A CE3 
1341 C  CZ2 . TRP A 158 ? 0.1309 0.0813 0.1024 -0.0083 0.0052  0.0118  158 TRP A CZ2 
1342 C  CZ3 . TRP A 158 ? 0.1250 0.0986 0.0958 0.0086  0.0046  0.0012  158 TRP A CZ3 
1343 C  CH2 . TRP A 158 ? 0.1197 0.0868 0.0955 -0.0047 0.0135  -0.0128 158 TRP A CH2 
1344 N  N   . GLU A 159 ? 0.1120 0.0711 0.1030 -0.0116 0.0051  -0.0017 159 GLU A N   
1345 C  CA  . GLU A 159 ? 0.1311 0.0721 0.1066 -0.0052 -0.0072 0.0005  159 GLU A CA  
1346 C  C   . GLU A 159 ? 0.1164 0.0696 0.0851 0.0030  -0.0119 0.0066  159 GLU A C   
1347 O  O   . GLU A 159 ? 0.1099 0.0713 0.1121 -0.0104 -0.0061 0.0059  159 GLU A O   
1348 C  CB  . GLU A 159 ? 0.1369 0.0700 0.1093 -0.0197 -0.0130 0.0081  159 GLU A CB  
1349 C  CG  . GLU A 159 ? 0.1394 0.0766 0.1189 -0.0123 -0.0249 0.0203  159 GLU A CG  
1350 C  CD  . GLU A 159 ? 0.1957 0.0874 0.1190 -0.0260 -0.0206 0.0274  159 GLU A CD  
1351 O  OE1 . GLU A 159 ? 0.1854 0.1115 0.0935 -0.0305 0.0065  0.0069  159 GLU A OE1 
1352 O  OE2 . GLU A 159 ? 0.2361 0.1765 0.1258 -0.0888 -0.0287 0.0407  159 GLU A OE2 
1353 N  N   . HIS A 160 ? 0.1155 0.0790 0.1000 -0.0056 0.0001  0.0021  160 HIS A N   
1354 C  CA  . HIS A 160 ? 0.1068 0.0714 0.1041 0.0052  0.0064  0.0058  160 HIS A CA  
1355 C  C   . HIS A 160 ? 0.0831 0.0702 0.1038 -0.0054 -0.0059 0.0104  160 HIS A C   
1356 O  O   . HIS A 160 ? 0.1282 0.0819 0.1101 0.0185  -0.0194 0.0138  160 HIS A O   
1357 C  CB  . HIS A 160 ? 0.1034 0.0889 0.1048 -0.0054 0.0086  -0.0008 160 HIS A CB  
1358 C  CG  . HIS A 160 ? 0.1137 0.0914 0.0870 -0.0023 0.0051  0.0014  160 HIS A CG  
1359 N  ND1 . HIS A 160 ? 0.1108 0.0890 0.1762 -0.0141 0.0115  -0.0005 160 HIS A ND1 
1360 C  CD2 . HIS A 160 ? 0.1331 0.0808 0.1055 -0.0071 0.0070  0.0112  160 HIS A CD2 
1361 C  CE1 . HIS A 160 ? 0.1187 0.0871 0.1512 -0.0085 0.0162  0.0041  160 HIS A CE1 
1362 N  NE2 . HIS A 160 ? 0.1172 0.0890 0.1072 -0.0129 0.0076  0.0150  160 HIS A NE2 
1363 N  N   . ILE A 161 ? 0.0897 0.0802 0.0925 0.0017  0.0000  0.0108  161 ILE A N   
1364 C  CA  . ILE A 161 ? 0.0965 0.0799 0.0930 -0.0025 0.0033  0.0103  161 ILE A CA  
1365 C  C   . ILE A 161 ? 0.0925 0.0746 0.0929 0.0030  0.0079  0.0133  161 ILE A C   
1366 O  O   . ILE A 161 ? 0.1046 0.0833 0.0965 -0.0082 -0.0079 0.0059  161 ILE A O   
1367 C  CB  . ILE A 161 ? 0.0916 0.0783 0.0988 -0.0020 0.0000  0.0066  161 ILE A CB  
1368 C  CG1 . ILE A 161 ? 0.1141 0.0967 0.0940 -0.0204 0.0079  0.0023  161 ILE A CG1 
1369 C  CG2 . ILE A 161 ? 0.1104 0.1152 0.1115 -0.0137 0.0148  -0.0110 161 ILE A CG2 
1370 C  CD1 . ILE A 161 ? 0.1243 0.0852 0.1491 -0.0044 0.0144  0.0141  161 ILE A CD1 
1371 N  N   . LEU A 162 ? 0.1008 0.0753 0.0929 0.0052  -0.0006 0.0095  162 LEU A N   
1372 C  CA  . LEU A 162 ? 0.1126 0.0795 0.0855 -0.0036 -0.0025 0.0148  162 LEU A CA  
1373 C  C   . LEU A 162 ? 0.1131 0.0822 0.0930 -0.0122 0.0011  0.0019  162 LEU A C   
1374 O  O   . LEU A 162 ? 0.1350 0.1246 0.1075 0.0155  0.0191  0.0323  162 LEU A O   
1375 C  CB  . LEU A 162 ? 0.1153 0.0979 0.0961 -0.0097 -0.0088 0.0179  162 LEU A CB  
1376 C  CG  . LEU A 162 ? 0.1015 0.0859 0.1147 -0.0020 -0.0011 0.0146  162 LEU A CG  
1377 C  CD1 . LEU A 162 ? 0.1006 0.0988 0.1124 -0.0183 0.0014  -0.0009 162 LEU A CD1 
1378 C  CD2 . LEU A 162 ? 0.1240 0.1086 0.1293 -0.0098 -0.0204 0.0067  162 LEU A CD2 
1379 N  N   . PHE A 163 ? 0.1070 0.0810 0.0900 -0.0013 0.0096  0.0001  163 PHE A N   
1380 C  CA  . PHE A 163 ? 0.0735 0.0912 0.1044 0.0004  0.0015  0.0081  163 PHE A CA  
1381 C  C   . PHE A 163 ? 0.0700 0.0813 0.1051 0.0099  0.0054  -0.0050 163 PHE A C   
1382 O  O   . PHE A 163 ? 0.0823 0.1054 0.1220 -0.0120 0.0026  0.0067  163 PHE A O   
1383 C  CB  . PHE A 163 ? 0.0852 0.0877 0.1213 0.0017  -0.0113 0.0106  163 PHE A CB  
1384 C  CG  . PHE A 163 ? 0.0970 0.0874 0.0912 0.0000  0.0059  0.0088  163 PHE A CG  
1385 C  CD1 . PHE A 163 ? 0.0937 0.1179 0.1236 0.0043  0.0020  0.0070  163 PHE A CD1 
1386 C  CD2 . PHE A 163 ? 0.1151 0.0885 0.0972 0.0047  0.0016  0.0022  163 PHE A CD2 
1387 C  CE1 . PHE A 163 ? 0.0905 0.1390 0.1130 -0.0042 0.0132  0.0027  163 PHE A CE1 
1388 C  CE2 . PHE A 163 ? 0.1319 0.0928 0.1192 0.0078  0.0195  0.0084  163 PHE A CE2 
1389 C  CZ  . PHE A 163 ? 0.1234 0.1308 0.0812 0.0153  0.0123  0.0002  163 PHE A CZ  
1390 N  N   . THR A 164 ? 0.1057 0.1070 0.1113 -0.0297 0.0130  -0.0072 164 THR A N   
1391 C  CA  . THR A 164 ? 0.1145 0.1048 0.1084 -0.0225 0.0003  -0.0075 164 THR A CA  
1392 C  C   . THR A 164 ? 0.0978 0.0934 0.1182 0.0025  0.0041  -0.0252 164 THR A C   
1393 O  O   . THR A 164 ? 0.0911 0.1102 0.1719 0.0056  -0.0019 -0.0332 164 THR A O   
1394 C  CB  . THR A 164 ? 0.1436 0.1300 0.1088 -0.0342 0.0158  -0.0140 164 THR A CB  
1395 O  OG1 . THR A 164 ? 0.1342 0.1524 0.1187 0.0013  0.0087  0.0162  164 THR A OG1 
1396 C  CG2 . THR A 164 ? 0.1445 0.1953 0.1321 -0.0155 -0.0258 -0.0344 164 THR A CG2 
1397 N  N   . CYS A 165 ? 0.1011 0.0943 0.1367 -0.0076 0.0053  -0.0068 165 CYS A N   
1400 C  C   . CYS A 165 ? 0.0951 0.1007 0.1476 -0.0081 0.0042  -0.0002 165 CYS A C   
1401 O  O   . CYS A 165 ? 0.0918 0.1099 0.2051 -0.0120 -0.0104 0.0069  165 CYS A O   
1404 S  SG  A CYS A 165 ? 0.1779 0.1097 0.1339 0.0049  -0.0273 0.0301  165 CYS A SG  
1405 S  SG  B CYS A 165 ? 0.2030 0.1915 0.2589 0.0183  -0.0285 -0.0189 165 CYS A SG  
1406 N  N   . CYS A 166 ? 0.1054 0.1013 0.1602 -0.0073 0.0051  -0.0136 166 CYS A N   
1407 C  CA  . CYS A 166 ? 0.1096 0.1209 0.1894 -0.0181 0.0079  -0.0294 166 CYS A CA  
1408 C  C   . CYS A 166 ? 0.1015 0.0978 0.1537 -0.0178 0.0006  -0.0150 166 CYS A C   
1409 O  O   . CYS A 166 ? 0.1315 0.1546 0.1363 -0.0158 -0.0038 0.0017  166 CYS A O   
1410 C  CB  . CYS A 166 ? 0.1243 0.1143 0.2213 -0.0072 0.0179  -0.0450 166 CYS A CB  
1411 S  SG  . CYS A 166 ? 0.1836 0.1474 0.2708 0.0004  -0.0126 0.0325  166 CYS A SG  
1412 N  N   . HIS A 167 ? 0.0902 0.1003 0.1433 -0.0245 -0.0211 -0.0046 167 HIS A N   
1413 C  CA  . HIS A 167 ? 0.0980 0.0939 0.1153 -0.0190 -0.0108 0.0118  167 HIS A CA  
1414 C  C   . HIS A 167 ? 0.0944 0.1014 0.0823 -0.0135 -0.0100 0.0015  167 HIS A C   
1415 O  O   . HIS A 167 ? 0.0989 0.1021 0.1311 -0.0154 -0.0024 0.0098  167 HIS A O   
1416 C  CB  . HIS A 167 ? 0.1360 0.1127 0.1143 -0.0433 -0.0171 0.0239  167 HIS A CB  
1417 C  CG  . HIS A 167 ? 0.1279 0.0941 0.1078 -0.0333 -0.0131 0.0251  167 HIS A CG  
1418 N  ND1 . HIS A 167 ? 0.1429 0.1103 0.0868 -0.0178 -0.0157 0.0124  167 HIS A ND1 
1419 C  CD2 . HIS A 167 ? 0.1659 0.1035 0.1512 -0.0198 -0.0543 0.0106  167 HIS A CD2 
1420 C  CE1 . HIS A 167 ? 0.1717 0.1045 0.0876 -0.0352 -0.0375 0.0145  167 HIS A CE1 
1421 N  NE2 . HIS A 167 ? 0.1535 0.1018 0.1275 -0.0391 -0.0308 0.0228  167 HIS A NE2 
1422 N  N   . ASN A 168 ? 0.0927 0.0837 0.1169 -0.0077 -0.0152 0.0084  168 ASN A N   
1423 C  CA  . ASN A 168 ? 0.0916 0.0907 0.0996 0.0032  -0.0089 0.0067  168 ASN A CA  
1424 C  C   . ASN A 168 ? 0.1024 0.1103 0.1007 0.0122  -0.0133 0.0194  168 ASN A C   
1425 O  O   . ASN A 168 ? 0.1170 0.1205 0.1098 0.0058  -0.0183 0.0234  168 ASN A O   
1426 C  CB  . ASN A 168 ? 0.0976 0.0833 0.1026 -0.0108 0.0006  0.0112  168 ASN A CB  
1427 C  CG  . ASN A 168 ? 0.0949 0.0785 0.0995 -0.0004 -0.0022 0.0163  168 ASN A CG  
1428 O  OD1 . ASN A 168 ? 0.0946 0.1044 0.0963 -0.0070 0.0024  0.0167  168 ASN A OD1 
1429 N  ND2 . ASN A 168 ? 0.0884 0.0939 0.0962 -0.0068 0.0001  0.0054  168 ASN A ND2 
1430 N  N   . ARG A 169 ? 0.1267 0.1211 0.0959 -0.0142 -0.0038 0.0042  169 ARG A N   
1431 C  CA  . ARG A 169 ? 0.1427 0.1543 0.0928 -0.0092 -0.0077 0.0104  169 ARG A CA  
1432 C  C   . ARG A 169 ? 0.1489 0.1290 0.0998 -0.0083 -0.0127 0.0043  169 ARG A C   
1433 O  O   . ARG A 169 ? 0.1605 0.1714 0.0978 -0.0079 0.0043  0.0203  169 ARG A O   
1434 C  CB  . ARG A 169 ? 0.1334 0.1712 0.1210 0.0201  0.0166  -0.0006 169 ARG A CB  
1435 C  CG  . ARG A 169 ? 0.2702 0.1870 0.1063 -0.0066 0.0275  -0.0150 169 ARG A CG  
1436 C  CD  . ARG A 169 ? 0.1923 0.2537 0.1844 0.0173  0.0368  -0.0812 169 ARG A CD  
1437 N  NE  . ARG A 169 ? 0.2404 0.2019 0.2768 0.0137  -0.0004 -0.0903 169 ARG A NE  
1438 C  CZ  . ARG A 169 ? 0.2533 0.2034 0.1741 0.0140  -0.0164 -0.0996 169 ARG A CZ  
1439 N  NH1 . ARG A 169 ? 0.3069 0.2582 0.4128 -0.0721 0.0447  -0.1449 169 ARG A NH1 
1440 N  NH2 . ARG A 169 ? 0.5020 0.2581 0.2648 0.1558  -0.0606 -0.0886 169 ARG A NH2 
1441 N  N   . HIS A 170 ? 0.1416 0.1479 0.1046 -0.0094 -0.0237 0.0302  170 HIS A N   
1442 C  CA  . HIS A 170 ? 0.1527 0.1383 0.1102 -0.0216 -0.0375 0.0216  170 HIS A CA  
1443 C  C   . HIS A 170 ? 0.1067 0.1407 0.1294 -0.0132 -0.0351 0.0148  170 HIS A C   
1444 O  O   . HIS A 170 ? 0.1308 0.1599 0.1362 -0.0164 -0.0329 0.0418  170 HIS A O   
1445 C  CB  . HIS A 170 ? 0.1497 0.1433 0.1489 -0.0223 -0.0459 0.0239  170 HIS A CB  
1446 C  CG  . HIS A 170 ? 0.1037 0.1544 0.1579 -0.0205 -0.0271 0.0309  170 HIS A CG  
1447 N  ND1 . HIS A 170 ? 0.1212 0.1965 0.1955 0.0208  -0.0008 0.0685  170 HIS A ND1 
1448 C  CD2 . HIS A 170 ? 0.1264 0.1256 0.1512 0.0011  -0.0261 0.0112  170 HIS A CD2 
1449 C  CE1 . HIS A 170 ? 0.1204 0.1918 0.1995 0.0344  0.0239  0.0705  170 HIS A CE1 
1450 N  NE2 . HIS A 170 ? 0.1234 0.1443 0.1684 0.0009  -0.0067 0.0253  170 HIS A NE2 
1451 N  N   . LEU A 171 ? 0.1324 0.1166 0.1239 -0.0040 -0.0272 0.0184  171 LEU A N   
1452 C  CA  . LEU A 171 ? 0.0949 0.1257 0.1155 0.0046  -0.0075 0.0097  171 LEU A CA  
1453 C  C   . LEU A 171 ? 0.1076 0.1227 0.1140 -0.0009 -0.0164 0.0162  171 LEU A C   
1454 O  O   . LEU A 171 ? 0.1069 0.1442 0.1278 0.0114  -0.0044 0.0234  171 LEU A O   
1455 C  CB  . LEU A 171 ? 0.1330 0.1355 0.1089 0.0128  -0.0050 0.0110  171 LEU A CB  
1456 C  CG  . LEU A 171 ? 0.1351 0.1250 0.1160 0.0031  -0.0084 0.0145  171 LEU A CG  
1457 C  CD1 . LEU A 171 ? 0.1657 0.1567 0.1122 0.0190  -0.0203 0.0186  171 LEU A CD1 
1458 C  CD2 . LEU A 171 ? 0.1438 0.2355 0.1232 0.0413  0.0210  0.0507  171 LEU A CD2 
1459 N  N   . VAL A 172 ? 0.1150 0.1250 0.1184 0.0019  -0.0017 0.0092  172 VAL A N   
1460 C  CA  . VAL A 172 ? 0.1111 0.1246 0.1499 -0.0129 -0.0211 0.0257  172 VAL A CA  
1461 C  C   . VAL A 172 ? 0.1271 0.1248 0.1477 -0.0074 -0.0293 0.0314  172 VAL A C   
1462 O  O   . VAL A 172 ? 0.1324 0.1630 0.2453 -0.0077 -0.0127 -0.0216 172 VAL A O   
1463 C  CB  . VAL A 172 ? 0.1180 0.1323 0.1385 -0.0109 -0.0128 0.0304  172 VAL A CB  
1464 C  CG1 . VAL A 172 ? 0.1717 0.1913 0.1930 -0.0457 -0.0020 0.0808  172 VAL A CG1 
1465 C  CG2 . VAL A 172 ? 0.1659 0.1619 0.1482 -0.0087 -0.0297 0.0091  172 VAL A CG2 
1466 N  N   . LEU A 173 ? 0.1304 0.1128 0.1383 -0.0172 -0.0145 0.0213  173 LEU A N   
1467 C  CA  . LEU A 173 ? 0.1357 0.1100 0.1480 -0.0105 -0.0184 0.0214  173 LEU A CA  
1468 C  C   . LEU A 173 ? 0.1606 0.1221 0.1740 -0.0028 -0.0188 0.0394  173 LEU A C   
1469 O  O   . LEU A 173 ? 0.2148 0.1400 0.1584 -0.0158 -0.0403 0.0379  173 LEU A O   
1470 C  CB  . LEU A 173 ? 0.1473 0.1267 0.1350 -0.0119 -0.0293 0.0131  173 LEU A CB  
1471 C  CG  . LEU A 173 ? 0.1644 0.1482 0.2172 0.0091  -0.0461 0.0468  173 LEU A CG  
1472 C  CD1 . LEU A 173 ? 0.1743 0.1481 0.2191 0.0673  -0.0663 -0.0187 173 LEU A CD1 
1473 C  CD2 . LEU A 173 ? 0.2181 0.2855 0.2477 -0.0220 -0.0303 0.1538  173 LEU A CD2 
1474 N  N   . PRO A 174 ? 0.1933 0.1129 0.1967 -0.0042 -0.0510 0.0224  174 PRO A N   
1475 C  CA  . PRO A 174 ? 0.2185 0.1221 0.2343 -0.0077 -0.0750 0.0415  174 PRO A CA  
1476 C  C   . PRO A 174 ? 0.2243 0.1183 0.1997 -0.0176 -0.0783 0.0365  174 PRO A C   
1477 O  O   . PRO A 174 ? 0.2224 0.1413 0.2220 -0.0315 -0.0941 0.0395  174 PRO A O   
1478 C  CB  . PRO A 174 ? 0.2460 0.1304 0.3067 0.0217  -0.0479 0.0299  174 PRO A CB  
1479 C  CG  . PRO A 174 ? 0.2309 0.1267 0.2623 0.0085  -0.0447 -0.0086 174 PRO A CG  
1480 C  CD  . PRO A 174 ? 0.2012 0.1259 0.1900 -0.0034 -0.0675 -0.0036 174 PRO A CD  
1481 N  N   . PRO A 175 ? 0.2375 0.1688 0.2241 -0.0026 -0.0520 0.0669  175 PRO A N   
1482 C  CA  . PRO A 175 ? 0.2508 0.2099 0.2457 -0.0256 -0.0396 0.0716  175 PRO A CA  
1483 C  C   . PRO A 175 ? 0.2265 0.2427 0.2612 -0.0269 -0.0387 0.0640  175 PRO A C   
1484 O  O   . PRO A 175 ? 0.2361 0.2048 0.4154 -0.0665 -0.0071 0.0146  175 PRO A O   
1485 C  CB  . PRO A 175 ? 0.3134 0.2530 0.2864 -0.0547 -0.0674 0.1221  175 PRO A CB  
1486 C  CG  . PRO A 175 ? 0.3212 0.3480 0.2878 -0.0635 -0.0880 0.1793  175 PRO A CG  
1487 C  CD  . PRO A 175 ? 0.2538 0.2584 0.2275 0.0507  -0.0265 0.1094  175 PRO A CD  
1488 N  N   . THR A 176 ? 0.2759 0.1311 0.2941 -0.0596 -0.0169 0.0282  176 THR A N   
1489 C  CA  . THR A 176 ? 0.2675 0.1160 0.3330 -0.0638 -0.0193 -0.0053 176 THR A CA  
1490 C  C   . THR A 176 ? 0.2248 0.1378 0.3619 -0.0338 -0.0686 -0.0401 176 THR A C   
1491 O  O   . THR A 176 ? 0.2976 0.1513 0.3950 -0.0422 -0.1012 -0.0631 176 THR A O   
1492 C  CB  . THR A 176 ? 0.2398 0.1803 0.3661 -0.0035 -0.0792 -0.0423 176 THR A CB  
1493 O  OG1 . THR A 176 ? 0.1994 0.2061 0.3595 0.0050  -0.0697 -0.0599 176 THR A OG1 
1494 C  CG2 . THR A 176 ? 0.3701 0.1579 0.4876 0.0043  -0.1628 -0.0515 176 THR A CG2 
1495 N  N   . ARG A 177 ? 0.1865 0.1357 0.2959 -0.0188 -0.0588 -0.0301 177 ARG A N   
1496 C  CA  . ARG A 177 ? 0.1487 0.1598 0.2220 -0.0038 -0.0414 -0.0377 177 ARG A CA  
1497 C  C   . ARG A 177 ? 0.2148 0.2034 0.2154 0.0384  -0.0106 -0.0115 177 ARG A C   
1498 O  O   . ARG A 177 ? 0.2910 0.3277 0.2310 0.1217  -0.0514 -0.0712 177 ARG A O   
1499 C  CB  . ARG A 177 ? 0.1355 0.1401 0.2961 0.0173  -0.0235 -0.0245 177 ARG A CB  
1500 C  CG  . ARG A 177 ? 0.1890 0.1716 0.2285 0.0289  -0.0167 0.0108  177 ARG A CG  
1501 C  CD  . ARG A 177 ? 0.1986 0.1953 0.2584 0.0363  -0.0086 0.0383  177 ARG A CD  
1502 N  NE  . ARG A 177 ? 0.1900 0.1904 0.2180 0.0382  -0.0066 0.0279  177 ARG A NE  
1503 C  CZ  . ARG A 177 ? 0.1757 0.1847 0.1959 0.0405  0.0065  0.0022  177 ARG A CZ  
1504 N  NH1 . ARG A 177 ? 0.1934 0.1836 0.1874 0.0203  -0.0161 0.0239  177 ARG A NH1 
1505 N  NH2 . ARG A 177 ? 0.1654 0.2642 0.2455 0.0349  0.0320  0.0493  177 ARG A NH2 
1506 N  N   . ARG A 178 ? 0.2273 0.1598 0.2725 0.0349  -0.0507 -0.0356 178 ARG A N   
1509 C  C   . ARG A 178 ? 0.1235 0.1849 0.1957 0.0581  -0.0152 0.0073  178 ARG A C   
1510 O  O   . ARG A 178 ? 0.1795 0.2372 0.1837 -0.0165 -0.0232 -0.0330 178 ARG A O   
1511 C  CB  A ARG A 178 ? 0.2027 0.2656 0.3467 -0.0200 -0.0004 0.0281  178 ARG A CB  
1512 C  CB  B ARG A 178 ? 0.2490 0.1803 0.2797 0.0197  0.0646  0.0067  178 ARG A CB  
1513 C  CG  A ARG A 178 ? 0.2317 0.3135 0.2468 -0.0194 -0.0370 -0.1292 178 ARG A CG  
1514 C  CG  B ARG A 178 ? 0.1120 0.1499 0.1885 -0.0222 0.0123  0.0703  178 ARG A CG  
1515 C  CD  A ARG A 178 ? 0.2280 0.3146 0.1712 -0.0473 0.0314  -0.0776 178 ARG A CD  
1516 C  CD  B ARG A 178 ? 0.1319 0.1718 0.1926 -0.0049 0.0363  0.0680  178 ARG A CD  
1517 N  NE  A ARG A 178 ? 0.2362 0.2271 0.1541 -0.0631 -0.0275 0.0024  178 ARG A NE  
1518 N  NE  B ARG A 178 ? 0.1312 0.1932 0.2312 0.0047  0.0496  0.0555  178 ARG A NE  
1519 C  CZ  A ARG A 178 ? 0.1730 0.2063 0.1097 -0.0019 -0.0129 0.0307  178 ARG A CZ  
1520 C  CZ  B ARG A 178 ? 0.1369 0.1719 0.2274 -0.0179 0.0694  0.0548  178 ARG A CZ  
1521 N  NH1 A ARG A 178 ? 0.2414 0.2119 0.1329 0.0250  0.0395  0.0414  178 ARG A NH1 
1522 N  NH1 B ARG A 178 ? 0.1591 0.1476 0.3738 -0.0139 0.0468  0.0820  178 ARG A NH1 
1523 N  NH2 A ARG A 178 ? 0.1311 0.2134 0.1226 -0.0309 0.0031  0.0072  178 ARG A NH2 
1524 N  NH2 B ARG A 178 ? 0.1046 0.2130 0.2318 -0.0217 0.0206  -0.0273 178 ARG A NH2 
1525 N  N   . ARG A 179 ? 0.3293 0.1629 0.1765 0.1062  0.0719  0.0521  179 ARG A N   
1526 C  CA  . ARG A 179 ? 0.2733 0.1622 0.1782 0.0815  0.0681  0.0407  179 ARG A CA  
1527 C  C   . ARG A 179 ? 0.2735 0.1434 0.1607 0.0729  0.0906  0.0623  179 ARG A C   
1528 O  O   . ARG A 179 ? 0.4117 0.2335 0.2396 0.1556  0.1921  0.1397  179 ARG A O   
1529 C  CB  . ARG A 179 ? 0.3019 0.2414 0.2149 0.1057  0.0263  0.0042  179 ARG A CB  
1530 C  CG  . ARG A 179 ? 0.1685 0.2780 0.3037 -0.0109 0.0016  0.0823  179 ARG A CG  
1531 C  CD  . ARG A 179 ? 0.1205 0.3355 0.3061 -0.0253 -0.0051 0.1473  179 ARG A CD  
1532 N  NE  . ARG A 179 ? 0.1507 0.2511 0.2678 -0.0184 0.0359  0.0877  179 ARG A NE  
1533 C  CZ  . ARG A 179 ? 0.1208 0.1764 0.1204 -0.0125 -0.0159 0.0103  179 ARG A CZ  
1534 N  NH1 . ARG A 179 ? 0.1467 0.2867 0.2302 -0.0120 0.0381  0.1054  179 ARG A NH1 
1535 N  NH2 . ARG A 179 ? 0.2230 0.1850 0.1517 0.0233  0.0208  0.0317  179 ARG A NH2 
1536 N  N   . LEU A 180 ? 0.1900 0.1163 0.0940 0.0031  0.0184  0.0069  180 LEU A N   
1539 C  C   . LEU A 180 ? 0.1485 0.1163 0.1161 0.0143  0.0363  0.0229  180 LEU A C   
1540 O  O   . LEU A 180 ? 0.1529 0.1193 0.1639 0.0201  0.0657  0.0375  180 LEU A O   
1549 N  N   . LEU A 181 ? 0.1298 0.1278 0.1135 -0.0006 0.0162  0.0179  181 LEU A N   
1550 C  CA  . LEU A 181 ? 0.1388 0.1300 0.1257 -0.0071 0.0092  0.0188  181 LEU A CA  
1551 C  C   . LEU A 181 ? 0.1307 0.1320 0.1200 -0.0079 0.0152  0.0189  181 LEU A C   
1552 O  O   . LEU A 181 ? 0.1217 0.1380 0.1452 -0.0136 0.0101  0.0193  181 LEU A O   
1553 C  CB  . LEU A 181 ? 0.1401 0.1541 0.1218 -0.0059 -0.0074 0.0177  181 LEU A CB  
1554 C  CG  . LEU A 181 ? 0.2413 0.2594 0.1640 0.0428  -0.0099 0.0857  181 LEU A CG  
1555 C  CD1 . LEU A 181 ? 0.3881 0.3040 0.1046 -0.0940 -0.0775 0.0427  181 LEU A CD1 
1556 C  CD2 . LEU A 181 ? 0.2113 0.4011 0.3576 0.0996  -0.0557 0.1319  181 LEU A CD2 
1557 N  N   . SER A 182 ? 0.1369 0.1165 0.0918 -0.0092 0.0112  0.0093  182 SER A N   
1558 C  CA  . SER A 182 ? 0.1319 0.1160 0.1091 -0.0036 0.0175  -0.0096 182 SER A CA  
1559 C  C   . SER A 182 ? 0.1277 0.1019 0.1021 -0.0026 0.0186  0.0131  182 SER A C   
1560 O  O   . SER A 182 ? 0.1621 0.1022 0.1160 -0.0174 0.0146  0.0158  182 SER A O   
1561 C  CB  . SER A 182 ? 0.1283 0.1470 0.1294 0.0064  0.0230  -0.0296 182 SER A CB  
1562 O  OG  . SER A 182 ? 0.1692 0.2066 0.1032 -0.0097 0.0167  -0.0355 182 SER A OG  
1563 N  N   . TRP A 183 ? 0.1263 0.0988 0.1111 -0.0136 0.0199  0.0066  183 TRP A N   
1564 C  CA  . TRP A 183 ? 0.1252 0.1239 0.0929 -0.0204 0.0148  0.0060  183 TRP A CA  
1565 C  C   . TRP A 183 ? 0.1332 0.1593 0.0929 -0.0273 0.0255  -0.0026 183 TRP A C   
1566 O  O   . TRP A 183 ? 0.1340 0.2302 0.1322 -0.0642 0.0109  0.0252  183 TRP A O   
1567 C  CB  . TRP A 183 ? 0.1207 0.1391 0.1051 -0.0082 0.0187  0.0066  183 TRP A CB  
1568 C  CG  . TRP A 183 ? 0.1010 0.1080 0.1026 0.0002  0.0121  0.0104  183 TRP A CG  
1569 C  CD1 . TRP A 183 ? 0.0981 0.1027 0.0920 -0.0128 0.0062  -0.0009 183 TRP A CD1 
1570 C  CD2 . TRP A 183 ? 0.1056 0.1124 0.0922 -0.0251 0.0017  0.0120  183 TRP A CD2 
1571 N  NE1 . TRP A 183 ? 0.0990 0.0900 0.0955 -0.0078 0.0123  0.0104  183 TRP A NE1 
1572 C  CE2 . TRP A 183 ? 0.0957 0.0972 0.0970 -0.0161 -0.0022 0.0074  183 TRP A CE2 
1573 C  CE3 . TRP A 183 ? 0.1267 0.1092 0.1204 -0.0189 0.0168  0.0191  183 TRP A CE3 
1574 C  CZ2 . TRP A 183 ? 0.1094 0.1236 0.0925 -0.0191 0.0017  -0.0029 183 TRP A CZ2 
1575 C  CZ3 . TRP A 183 ? 0.1315 0.0963 0.1392 -0.0163 0.0101  0.0122  183 TRP A CZ3 
1576 C  CH2 . TRP A 183 ? 0.1398 0.1006 0.1290 -0.0110 0.0125  0.0001  183 TRP A CH2 
1577 N  N   . SER A 184 ? 0.1804 0.1698 0.1002 -0.0615 0.0497  -0.0072 184 SER A N   
1580 C  C   . SER A 184 ? 0.1728 0.1507 0.1256 -0.0308 0.0243  0.0045  184 SER A C   
1581 O  O   . SER A 184 ? 0.1785 0.2484 0.1326 -0.0354 0.0597  0.0177  184 SER A O   
1584 O  OG  A SER A 184 ? 0.1875 0.3151 0.0924 -0.0218 0.0192  -0.0467 184 SER A OG  
1585 O  OG  B SER A 184 ? 0.3341 0.1658 0.1690 0.0853  0.0926  0.0018  184 SER A OG  
1618 N  N   . TRP A 187 ? 0.1413 0.1577 0.1097 -0.0451 0.0065  0.0234  187 TRP A N   
1619 C  CA  . TRP A 187 ? 0.1124 0.1512 0.1149 -0.0186 0.0132  0.0236  187 TRP A CA  
1620 C  C   . TRP A 187 ? 0.1095 0.1326 0.1060 -0.0074 0.0127  0.0244  187 TRP A C   
1621 O  O   . TRP A 187 ? 0.1265 0.1315 0.1168 -0.0027 0.0226  0.0237  187 TRP A O   
1622 C  CB  . TRP A 187 ? 0.1395 0.1490 0.1115 -0.0331 0.0089  0.0184  187 TRP A CB  
1623 C  CG  . TRP A 187 ? 0.1364 0.1176 0.0961 -0.0261 0.0255  0.0212  187 TRP A CG  
1624 C  CD1 . TRP A 187 ? 0.1715 0.1383 0.1007 -0.0383 0.0192  0.0132  187 TRP A CD1 
1625 C  CD2 . TRP A 187 ? 0.1482 0.1049 0.1040 -0.0182 0.0186  0.0168  187 TRP A CD2 
1626 N  NE1 . TRP A 187 ? 0.1860 0.0956 0.1312 -0.0181 0.0277  0.0104  187 TRP A NE1 
1627 C  CE2 . TRP A 187 ? 0.1459 0.0936 0.1390 -0.0216 0.0277  0.0228  187 TRP A CE2 
1628 C  CE3 . TRP A 187 ? 0.1412 0.1078 0.1149 -0.0036 0.0131  0.0178  187 TRP A CE3 
1629 C  CZ2 . TRP A 187 ? 0.1669 0.1299 0.1385 0.0053  0.0173  0.0195  187 TRP A CZ2 
1630 C  CZ3 . TRP A 187 ? 0.1570 0.1337 0.0946 -0.0040 0.0016  0.0206  187 TRP A CZ3 
1631 C  CH2 . TRP A 187 ? 0.1523 0.1447 0.1293 0.0081  0.0015  0.0277  187 TRP A CH2 
1632 N  N   . ARG A 188 ? 0.1263 0.1264 0.1064 -0.0277 0.0201  -0.0024 188 ARG A N   
1633 C  CA  . ARG A 188 ? 0.1167 0.1221 0.1117 -0.0299 0.0077  0.0072  188 ARG A CA  
1634 C  C   . ARG A 188 ? 0.1232 0.1289 0.1333 -0.0310 0.0104  0.0293  188 ARG A C   
1635 O  O   . ARG A 188 ? 0.1242 0.1184 0.1454 -0.0183 0.0179  0.0159  188 ARG A O   
1636 C  CB  . ARG A 188 ? 0.1274 0.1329 0.1397 -0.0262 0.0116  -0.0001 188 ARG A CB  
1637 C  CG  . ARG A 188 ? 0.1287 0.1471 0.1454 -0.0190 0.0106  0.0186  188 ARG A CG  
1638 C  CD  . ARG A 188 ? 0.1351 0.1791 0.1370 -0.0027 0.0040  0.0154  188 ARG A CD  
1639 N  NE  . ARG A 188 ? 0.1236 0.1802 0.1744 -0.0030 0.0241  0.0248  188 ARG A NE  
1640 C  CZ  . ARG A 188 ? 0.1298 0.1738 0.1609 -0.0005 0.0332  0.0089  188 ARG A CZ  
1641 N  NH1 . ARG A 188 ? 0.1469 0.1755 0.1705 0.0022  0.0097  0.0211  188 ARG A NH1 
1642 N  NH2 . ARG A 188 ? 0.1690 0.1767 0.2046 0.0017  -0.0067 0.0196  188 ARG A NH2 
1643 N  N   . GLU A 189 ? 0.1174 0.1339 0.1250 -0.0114 0.0183  0.0251  189 GLU A N   
1644 C  CA  . GLU A 189 ? 0.1268 0.1409 0.1344 -0.0080 0.0199  0.0307  189 GLU A CA  
1645 C  C   . GLU A 189 ? 0.1492 0.1318 0.1385 0.0064  0.0265  0.0431  189 GLU A C   
1646 O  O   . GLU A 189 ? 0.1786 0.1273 0.1313 -0.0104 0.0274  0.0355  189 GLU A O   
1647 C  CB  . GLU A 189 ? 0.1711 0.1818 0.1330 0.0184  0.0188  0.0561  189 GLU A CB  
1648 C  CG  . GLU A 189 ? 0.2208 0.3137 0.1309 0.0029  0.0363  0.0327  189 GLU A CG  
1649 C  CD  . GLU A 189 ? 0.1830 0.3423 0.1472 0.0006  0.0215  0.0224  189 GLU A CD  
1650 O  OE1 . GLU A 189 ? 0.1783 0.3066 0.2384 -0.0240 0.0012  0.1014  189 GLU A OE1 
1651 O  OE2 . GLU A 189 ? 0.2453 0.3545 0.1963 0.0533  0.0098  -0.0412 189 GLU A OE2 
1652 N  N   . ILE A 190 ? 0.1291 0.1317 0.1270 -0.0140 0.0210  0.0121  190 ILE A N   
1653 C  CA  . ILE A 190 ? 0.1146 0.1473 0.1392 -0.0081 0.0135  0.0136  190 ILE A CA  
1654 C  C   . ILE A 190 ? 0.1186 0.1004 0.1287 -0.0044 0.0186  0.0255  190 ILE A C   
1655 O  O   . ILE A 190 ? 0.1501 0.1106 0.1297 0.0152  0.0188  0.0209  190 ILE A O   
1656 C  CB  . ILE A 190 ? 0.1233 0.1456 0.1247 -0.0150 0.0165  0.0095  190 ILE A CB  
1657 C  CG1 . ILE A 190 ? 0.1492 0.1803 0.1433 -0.0333 -0.0029 0.0013  190 ILE A CG1 
1658 C  CG2 . ILE A 190 ? 0.1398 0.1768 0.1387 -0.0065 0.0356  0.0113  190 ILE A CG2 
1659 C  CD1 . ILE A 190 ? 0.1799 0.2152 0.1482 -0.0766 0.0592  -0.0414 190 ILE A CD1 
1660 N  N   . LEU A 191 ? 0.1155 0.1031 0.1117 0.0016  0.0191  0.0087  191 LEU A N   
1661 C  CA  . LEU A 191 ? 0.1129 0.1026 0.1108 -0.0030 0.0244  0.0021  191 LEU A CA  
1662 C  C   . LEU A 191 ? 0.1395 0.1035 0.1274 -0.0109 0.0183  0.0085  191 LEU A C   
1663 O  O   . LEU A 191 ? 0.1589 0.1052 0.1271 -0.0177 0.0114  0.0119  191 LEU A O   
1664 C  CB  . LEU A 191 ? 0.1188 0.1103 0.1237 -0.0110 0.0091  0.0189  191 LEU A CB  
1665 C  CG  . LEU A 191 ? 0.1163 0.1351 0.1000 -0.0060 0.0121  0.0276  191 LEU A CG  
1666 C  CD1 . LEU A 191 ? 0.1470 0.1123 0.1165 -0.0166 0.0175  0.0155  191 LEU A CD1 
1667 C  CD2 . LEU A 191 ? 0.1320 0.1162 0.1575 0.0089  0.0242  0.0280  191 LEU A CD2 
1668 N  N   . ASP A 192 ? 0.1596 0.1235 0.1173 -0.0450 0.0105  0.0099  192 ASP A N   
1669 C  CA  . ASP A 192 ? 0.1873 0.1345 0.1390 -0.0429 0.0286  0.0199  192 ASP A CA  
1670 C  C   . ASP A 192 ? 0.1998 0.1293 0.1860 -0.0437 0.0243  0.0350  192 ASP A C   
1671 O  O   . ASP A 192 ? 0.2374 0.1288 0.2088 -0.0628 0.0558  0.0210  192 ASP A O   
1672 C  CB  . ASP A 192 ? 0.2461 0.1337 0.1345 -0.0722 0.0366  0.0175  192 ASP A CB  
1673 C  CG  . ASP A 192 ? 0.2717 0.1661 0.1905 -0.0449 0.1075  0.0306  192 ASP A CG  
1674 O  OD1 . ASP A 192 ? 0.2069 0.1849 0.2240 -0.0347 0.0766  0.0148  192 ASP A OD1 
1675 O  OD2 . ASP A 192 ? 0.2836 0.2459 0.2113 -0.0815 0.1174  -0.0229 192 ASP A OD2 
1676 N  N   . SER A 193 ? 0.2020 0.1285 0.1702 -0.0207 -0.0129 0.0592  193 SER A N   
1677 C  CA  . SER A 193 ? 0.2451 0.1237 0.2064 -0.0013 -0.0231 0.0706  193 SER A CA  
1678 C  C   . SER A 193 ? 0.2146 0.1328 0.2271 0.0066  -0.0008 0.0470  193 SER A C   
1679 O  O   . SER A 193 ? 0.2739 0.1240 0.2870 0.0154  0.0006  0.0453  193 SER A O   
1680 C  CB  . SER A 193 ? 0.2231 0.2056 0.1924 0.0352  -0.0130 0.0577  193 SER A CB  
1681 O  OG  . SER A 193 ? 0.2183 0.1376 0.2352 -0.0053 -0.0389 0.0277  193 SER A OG  
1682 N  N   . LYS A 194 ? 0.1715 0.1177 0.1849 -0.0067 0.0275  0.0264  194 LYS A N   
1683 C  CA  . LYS A 194 ? 0.1804 0.1085 0.2069 -0.0265 0.0242  -0.0028 194 LYS A CA  
1684 C  C   . LYS A 194 ? 0.1792 0.1073 0.2403 -0.0245 0.0324  -0.0282 194 LYS A C   
1685 O  O   . LYS A 194 ? 0.2381 0.2242 0.2858 -0.1011 0.0548  -0.1155 194 LYS A O   
1686 C  CB  . LYS A 194 ? 0.1510 0.1384 0.1703 -0.0155 0.0179  0.0038  194 LYS A CB  
1687 C  CG  . LYS A 194 ? 0.1545 0.0994 0.1283 -0.0106 0.0092  0.0124  194 LYS A CG  
1688 C  CD  . LYS A 194 ? 0.1508 0.1028 0.1397 -0.0113 0.0138  -0.0056 194 LYS A CD  
1689 C  CE  . LYS A 194 ? 0.1494 0.0855 0.1434 -0.0081 0.0294  0.0027  194 LYS A CE  
1690 N  NZ  . LYS A 194 ? 0.1544 0.0936 0.1311 -0.0050 0.0026  0.0081  194 LYS A NZ  
1691 N  N   . ARG A 195 ? 0.1952 0.1725 0.2623 -0.0701 0.0482  -0.0438 195 ARG A N   
1692 C  CA  . ARG A 195 ? 0.1867 0.1907 0.3052 -0.0613 0.0247  -0.0310 195 ARG A CA  
1693 C  C   . ARG A 195 ? 0.2613 0.1762 0.5630 -0.0988 0.0813  -0.0596 195 ARG A C   
1694 O  O   . ARG A 195 ? 0.4742 0.1434 0.7761 -0.1051 -0.0371 0.0538  195 ARG A O   
1695 C  CB  . ARG A 195 ? 0.1840 0.1854 0.2444 -0.0658 0.0206  -0.0039 195 ARG A CB  
1696 C  CG  . ARG A 195 ? 0.1487 0.1871 0.2045 -0.0690 0.0313  0.0147  195 ARG A CG  
1697 C  CD  . ARG A 195 ? 0.2033 0.1951 0.1810 -0.0406 0.0360  0.0204  195 ARG A CD  
1698 N  NE  . ARG A 195 ? 0.2003 0.1901 0.1690 -0.0519 0.0477  0.0269  195 ARG A NE  
1699 C  CZ  . ARG A 195 ? 0.1499 0.1970 0.1708 -0.0229 0.0309  0.0196  195 ARG A CZ  
1700 N  NH1 . ARG A 195 ? 0.1823 0.2126 0.1741 -0.0279 0.0391  0.0039  195 ARG A NH1 
1701 N  NH2 . ARG A 195 ? 0.1592 0.1932 0.1752 -0.0344 0.0129  0.0315  195 ARG A NH2 
1702 O  OXT . ARG A 195 ? 0.3676 0.3055 0.7551 -0.1872 0.0024  -0.1085 195 ARG A OXT 
1703 N  N   . SER B 4   ? 0.2380 0.6629 0.4017 0.0752  -0.0472 0.3528  4   SER B N   
1704 C  CA  . SER B 4   ? 0.2459 0.4598 0.1906 0.1399  0.0112  0.0840  4   SER B CA  
1705 C  C   . SER B 4   ? 0.2403 0.2351 0.1734 0.0957  0.0070  0.0164  4   SER B C   
1706 O  O   . SER B 4   ? 0.2508 0.5878 0.2055 0.1130  0.0228  0.1124  4   SER B O   
1707 C  CB  . SER B 4   ? 0.3279 0.7214 0.2025 -0.0500 -0.0455 0.0018  4   SER B CB  
1708 O  OG  . SER B 4   ? 0.8996 0.5050 0.2847 -0.0774 0.3193  -0.1458 4   SER B OG  
1709 N  N   . VAL B 5   ? 0.2257 0.1693 0.1675 0.0913  0.0047  -0.0043 5   VAL B N   
1710 C  CA  . VAL B 5   ? 0.2133 0.1655 0.1651 0.0970  0.0147  -0.0142 5   VAL B CA  
1711 C  C   . VAL B 5   ? 0.1846 0.1594 0.1175 0.0663  0.0115  -0.0119 5   VAL B C   
1712 O  O   . VAL B 5   ? 0.2032 0.1830 0.1341 0.0566  0.0307  -0.0091 5   VAL B O   
1713 C  CB  . VAL B 5   ? 0.2374 0.1505 0.1934 0.0571  -0.0120 -0.0382 5   VAL B CB  
1714 C  CG1 . VAL B 5   ? 0.2799 0.2561 0.1935 0.1247  -0.0274 -0.0461 5   VAL B CG1 
1715 C  CG2 . VAL B 5   ? 0.2723 0.1538 0.3991 0.0850  0.0258  -0.0891 5   VAL B CG2 
1716 N  N   . ARG B 6   ? 0.1902 0.1453 0.1146 0.0698  0.0077  -0.0097 6   ARG B N   
1717 C  CA  . ARG B 6   ? 0.1531 0.1334 0.1167 0.0596  0.0126  0.0045  6   ARG B CA  
1718 C  C   . ARG B 6   ? 0.1697 0.1031 0.0914 0.0387  0.0002  -0.0237 6   ARG B C   
1719 O  O   . ARG B 6   ? 0.1788 0.1254 0.1027 0.0272  -0.0055 -0.0018 6   ARG B O   
1720 C  CB  . ARG B 6   ? 0.1913 0.1592 0.1035 0.0797  -0.0125 -0.0036 6   ARG B CB  
1721 C  CG  . ARG B 6   ? 0.2181 0.1656 0.1081 0.0665  -0.0059 -0.0242 6   ARG B CG  
1722 C  CD  . ARG B 6   ? 0.2323 0.1948 0.1017 0.0347  -0.0073 -0.0330 6   ARG B CD  
1723 N  NE  . ARG B 6   ? 0.2115 0.1827 0.1148 -0.0046 -0.0172 -0.0136 6   ARG B NE  
1724 C  CZ  . ARG B 6   ? 0.2336 0.1342 0.1402 -0.0085 -0.0164 -0.0159 6   ARG B CZ  
1725 N  NH1 . ARG B 6   ? 0.2486 0.2185 0.1318 -0.0404 -0.0085 -0.0069 6   ARG B NH1 
1726 N  NH2 . ARG B 6   ? 0.2420 0.1981 0.1206 0.0299  0.0007  -0.0044 6   ARG B NH2 
1727 N  N   . VAL B 7   ? 0.1386 0.1290 0.1014 0.0354  0.0006  -0.0058 7   VAL B N   
1728 C  CA  . VAL B 7   ? 0.1531 0.1191 0.0977 0.0241  -0.0014 -0.0095 7   VAL B CA  
1729 C  C   . VAL B 7   ? 0.1400 0.1065 0.0961 0.0156  0.0190  0.0056  7   VAL B C   
1730 O  O   . VAL B 7   ? 0.1374 0.1139 0.1062 0.0065  0.0019  0.0016  7   VAL B O   
1731 C  CB  . VAL B 7   ? 0.1476 0.1390 0.1014 0.0341  0.0105  -0.0061 7   VAL B CB  
1732 C  CG1 . VAL B 7   ? 0.1635 0.1354 0.1076 -0.0004 -0.0103 0.0093  7   VAL B CG1 
1733 C  CG2 . VAL B 7   ? 0.2150 0.1727 0.1119 0.0669  0.0105  -0.0207 7   VAL B CG2 
1734 N  N   . LEU B 8   ? 0.1313 0.1129 0.1079 0.0179  0.0104  0.0121  8   LEU B N   
1735 C  CA  . LEU B 8   ? 0.1380 0.1059 0.0891 0.0131  0.0052  0.0078  8   LEU B CA  
1736 C  C   . LEU B 8   ? 0.1327 0.1025 0.0894 0.0115  0.0013  -0.0002 8   LEU B C   
1737 O  O   . LEU B 8   ? 0.1637 0.1147 0.0874 -0.0172 -0.0110 0.0168  8   LEU B O   
1738 C  CB  . LEU B 8   ? 0.1204 0.0996 0.0814 0.0021  -0.0024 -0.0164 8   LEU B CB  
1739 C  CG  . LEU B 8   ? 0.1670 0.1272 0.0740 -0.0132 0.0058  -0.0085 8   LEU B CG  
1740 C  CD1 . LEU B 8   ? 0.1698 0.1568 0.0943 -0.0189 0.0150  0.0050  8   LEU B CD1 
1741 C  CD2 . LEU B 8   ? 0.1577 0.1419 0.0819 -0.0026 -0.0056 -0.0013 8   LEU B CD2 
1742 N  N   . VAL B 9   ? 0.1357 0.1075 0.0767 0.0096  0.0061  -0.0073 9   VAL B N   
1743 C  CA  . VAL B 9   ? 0.1377 0.1155 0.0734 0.0075  0.0121  0.0007  9   VAL B CA  
1744 C  C   . VAL B 9   ? 0.1157 0.1101 0.0800 -0.0054 0.0134  0.0086  9   VAL B C   
1745 O  O   . VAL B 9   ? 0.1340 0.0994 0.0935 -0.0047 -0.0037 0.0029  9   VAL B O   
1746 C  CB  . VAL B 9   ? 0.1156 0.1389 0.0921 0.0196  0.0077  0.0011  9   VAL B CB  
1747 C  CG1 . VAL B 9   ? 0.1415 0.1540 0.1050 0.0096  0.0151  0.0274  9   VAL B CG1 
1748 C  CG2 . VAL B 9   ? 0.1668 0.1439 0.1266 0.0407  0.0355  0.0161  9   VAL B CG2 
1749 N  N   . ASP B 10  ? 0.1271 0.1272 0.0892 -0.0021 -0.0072 0.0064  10  ASP B N   
1750 C  CA  . ASP B 10  ? 0.1179 0.1253 0.0798 -0.0050 -0.0022 0.0081  10  ASP B CA  
1751 C  C   . ASP B 10  ? 0.1251 0.1288 0.0688 -0.0012 -0.0221 0.0117  10  ASP B C   
1752 O  O   . ASP B 10  ? 0.1526 0.1336 0.0990 0.0129  0.0093  0.0277  10  ASP B O   
1753 C  CB  . ASP B 10  ? 0.1271 0.1316 0.0975 0.0055  -0.0096 0.0035  10  ASP B CB  
1754 C  CG  . ASP B 10  ? 0.1293 0.1509 0.0859 0.0163  0.0101  0.0191  10  ASP B CG  
1755 O  OD1 . ASP B 10  ? 0.1281 0.1472 0.1012 0.0241  -0.0004 0.0031  10  ASP B OD1 
1756 O  OD2 . ASP B 10  ? 0.1226 0.1434 0.0944 0.0015  0.0097  0.0049  10  ASP B OD2 
1757 N  N   . MET B 11  ? 0.1217 0.1283 0.1107 -0.0007 0.0043  0.0330  11  MET B N   
1758 C  CA  . MET B 11  ? 0.1017 0.1192 0.0950 0.0028  -0.0001 0.0052  11  MET B CA  
1759 C  C   . MET B 11  ? 0.1057 0.0958 0.0854 0.0150  0.0091  0.0001  11  MET B C   
1760 O  O   . MET B 11  ? 0.1211 0.1176 0.0939 0.0098  0.0138  0.0062  11  MET B O   
1761 C  CB  . MET B 11  ? 0.1447 0.1282 0.0955 -0.0037 -0.0071 0.0054  11  MET B CB  
1762 C  CG  . MET B 11  ? 0.1592 0.1296 0.1065 -0.0089 -0.0010 0.0050  11  MET B CG  
1763 S  SD  . MET B 11  ? 0.1384 0.1204 0.1349 -0.0131 0.0083  -0.0012 11  MET B SD  
1764 C  CE  . MET B 11  ? 0.1081 0.1511 0.1172 -0.0194 0.0003  0.0130  11  MET B CE  
1765 N  N   . ASP B 12  ? 0.1026 0.1180 0.0827 0.0091  0.0033  0.0066  12  ASP B N   
1766 C  CA  . ASP B 12  ? 0.1027 0.1043 0.1075 0.0031  -0.0057 0.0108  12  ASP B CA  
1767 C  C   . ASP B 12  ? 0.1001 0.1110 0.1019 -0.0064 -0.0036 0.0082  12  ASP B C   
1768 O  O   . ASP B 12  ? 0.1199 0.1109 0.1074 -0.0119 0.0095  0.0115  12  ASP B O   
1769 C  CB  . ASP B 12  ? 0.0973 0.1166 0.1068 0.0050  -0.0065 0.0079  12  ASP B CB  
1770 C  CG  . ASP B 12  ? 0.1349 0.1142 0.1003 -0.0021 -0.0215 0.0086  12  ASP B CG  
1771 O  OD1 . ASP B 12  ? 0.1342 0.1141 0.1342 0.0011  0.0000  0.0036  12  ASP B OD1 
1772 O  OD2 . ASP B 12  ? 0.1455 0.1415 0.1179 0.0064  0.0055  -0.0058 12  ASP B OD2 
1773 N  N   . GLY B 13  ? 0.1080 0.1248 0.1024 -0.0083 -0.0015 0.0109  13  GLY B N   
1774 C  CA  . GLY B 13  ? 0.1344 0.1250 0.1003 -0.0015 -0.0005 0.0085  13  GLY B CA  
1775 C  C   . GLY B 13  ? 0.1349 0.1349 0.1077 0.0007  -0.0177 0.0012  13  GLY B C   
1776 O  O   . GLY B 13  ? 0.1649 0.1629 0.1329 0.0018  -0.0271 -0.0316 13  GLY B O   
1777 N  N   . VAL B 14  ? 0.1152 0.1474 0.0843 0.0093  0.0068  -0.0097 14  VAL B N   
1778 C  CA  . VAL B 14  ? 0.1206 0.1226 0.0751 0.0037  0.0030  -0.0062 14  VAL B CA  
1779 C  C   . VAL B 14  ? 0.1126 0.1080 0.0907 0.0095  -0.0015 0.0054  14  VAL B C   
1780 O  O   . VAL B 14  ? 0.1450 0.1222 0.1011 0.0045  0.0209  0.0016  14  VAL B O   
1781 C  CB  . VAL B 14  ? 0.1427 0.1165 0.0787 -0.0062 0.0062  -0.0075 14  VAL B CB  
1782 C  CG1 . VAL B 14  ? 0.1661 0.1069 0.1150 0.0132  0.0127  0.0025  14  VAL B CG1 
1783 C  CG2 . VAL B 14  ? 0.1612 0.1261 0.0929 -0.0163 0.0176  -0.0046 14  VAL B CG2 
1784 N  N   . LEU B 15  ? 0.1035 0.1090 0.0998 0.0090  0.0077  0.0017  15  LEU B N   
1785 C  CA  . LEU B 15  ? 0.1158 0.1239 0.1046 -0.0025 -0.0156 0.0065  15  LEU B CA  
1786 C  C   . LEU B 15  ? 0.0998 0.1216 0.1099 -0.0006 0.0023  0.0032  15  LEU B C   
1787 O  O   . LEU B 15  ? 0.1129 0.1465 0.1030 0.0065  0.0114  0.0173  15  LEU B O   
1788 C  CB  . LEU B 15  ? 0.1226 0.1131 0.0969 -0.0107 -0.0065 0.0010  15  LEU B CB  
1789 C  CG  . LEU B 15  ? 0.1413 0.1616 0.1154 0.0242  0.0064  0.0339  15  LEU B CG  
1790 C  CD1 . LEU B 15  ? 0.1382 0.2025 0.1318 0.0065  -0.0142 0.0532  15  LEU B CD1 
1791 C  CD2 . LEU B 15  ? 0.1947 0.1997 0.1583 0.0692  0.0364  0.0416  15  LEU B CD2 
1792 N  N   . ALA B 16  ? 0.1080 0.1223 0.1233 0.0096  0.0159  0.0293  16  ALA B N   
1793 C  CA  . ALA B 16  ? 0.1094 0.1266 0.1351 0.0071  0.0141  0.0342  16  ALA B CA  
1794 C  C   . ALA B 16  ? 0.1041 0.1378 0.1337 0.0005  0.0074  0.0274  16  ALA B C   
1795 O  O   . ALA B 16  ? 0.1111 0.1302 0.1226 0.0052  0.0084  0.0303  16  ALA B O   
1796 C  CB  . ALA B 16  ? 0.1329 0.1228 0.1631 -0.0037 -0.0020 0.0115  16  ALA B CB  
1797 N  N   . ASP B 17  ? 0.1128 0.1417 0.1227 -0.0019 0.0003  0.0202  17  ASP B N   
1798 C  CA  . ASP B 17  ? 0.1088 0.1431 0.1262 0.0012  -0.0012 0.0112  17  ASP B CA  
1799 C  C   . ASP B 17  ? 0.1365 0.1317 0.0900 0.0135  -0.0133 0.0111  17  ASP B C   
1800 O  O   . ASP B 17  ? 0.1314 0.1458 0.1213 0.0116  -0.0084 0.0330  17  ASP B O   
1801 C  CB  . ASP B 17  ? 0.1452 0.1830 0.1202 0.0449  0.0078  0.0275  17  ASP B CB  
1802 C  CG  . ASP B 17  ? 0.1773 0.1813 0.1177 0.0528  -0.0027 0.0082  17  ASP B CG  
1803 O  OD1 . ASP B 17  ? 0.1673 0.1835 0.1522 0.0291  -0.0156 -0.0059 17  ASP B OD1 
1804 O  OD2 . ASP B 17  ? 0.2251 0.3479 0.1308 0.1036  -0.0010 -0.0251 17  ASP B OD2 
1805 N  N   . PHE B 18  ? 0.1083 0.1190 0.1234 0.0141  -0.0069 0.0280  18  PHE B N   
1806 C  CA  . PHE B 18  ? 0.1322 0.1194 0.1003 0.0074  -0.0059 0.0213  18  PHE B CA  
1807 C  C   . PHE B 18  ? 0.1001 0.1342 0.1066 0.0135  0.0036  0.0206  18  PHE B C   
1808 O  O   . PHE B 18  ? 0.1240 0.1271 0.1099 0.0078  -0.0058 0.0243  18  PHE B O   
1809 C  CB  . PHE B 18  ? 0.1288 0.1466 0.1074 -0.0154 -0.0138 0.0282  18  PHE B CB  
1810 C  CG  . PHE B 18  ? 0.1353 0.1456 0.1157 -0.0073 -0.0071 0.0287  18  PHE B CG  
1811 C  CD1 . PHE B 18  ? 0.1263 0.1655 0.1713 -0.0290 0.0027  0.0142  18  PHE B CD1 
1812 C  CD2 . PHE B 18  ? 0.1421 0.1544 0.1434 -0.0046 -0.0116 0.0084  18  PHE B CD2 
1813 C  CE1 . PHE B 18  ? 0.1268 0.1835 0.1643 -0.0268 0.0179  0.0298  18  PHE B CE1 
1814 C  CE2 . PHE B 18  ? 0.1670 0.1595 0.1574 -0.0129 0.0192  0.0059  18  PHE B CE2 
1815 C  CZ  . PHE B 18  ? 0.1474 0.1365 0.1873 -0.0035 0.0206  0.0282  18  PHE B CZ  
1816 N  N   . GLU B 19  ? 0.1038 0.1326 0.1168 0.0104  -0.0025 0.0173  19  GLU B N   
1817 C  CA  . GLU B 19  ? 0.1261 0.1451 0.1372 -0.0029 -0.0214 0.0339  19  GLU B CA  
1818 C  C   . GLU B 19  ? 0.1190 0.1533 0.0905 -0.0031 -0.0125 0.0002  19  GLU B C   
1819 O  O   . GLU B 19  ? 0.1199 0.1343 0.1224 -0.0136 -0.0241 0.0109  19  GLU B O   
1820 C  CB  . GLU B 19  ? 0.1343 0.1461 0.1564 0.0117  -0.0446 0.0105  19  GLU B CB  
1821 C  CG  . GLU B 19  ? 0.1568 0.1510 0.2014 -0.0151 -0.0532 0.0421  19  GLU B CG  
1822 C  CD  . GLU B 19  ? 0.1638 0.1713 0.1804 -0.0115 -0.0370 0.0580  19  GLU B CD  
1823 O  OE1 . GLU B 19  ? 0.1540 0.1914 0.1843 0.0069  -0.0148 0.0725  19  GLU B OE1 
1824 O  OE2 . GLU B 19  ? 0.1604 0.3093 0.2218 -0.0444 -0.0520 0.1394  19  GLU B OE2 
1825 N  N   . ALA B 20  ? 0.1131 0.1602 0.1126 -0.0040 -0.0188 0.0091  20  ALA B N   
1826 C  CA  . ALA B 20  ? 0.1049 0.1761 0.1268 0.0046  -0.0134 0.0261  20  ALA B CA  
1827 C  C   . ALA B 20  ? 0.1071 0.1698 0.1110 0.0126  0.0069  0.0284  20  ALA B C   
1828 O  O   . ALA B 20  ? 0.1312 0.1835 0.1285 0.0067  -0.0109 0.0504  20  ALA B O   
1829 C  CB  . ALA B 20  ? 0.1614 0.1765 0.1551 0.0243  0.0315  0.0136  20  ALA B CB  
1830 N  N   . GLY B 21  ? 0.1155 0.1628 0.1101 0.0218  0.0076  0.0233  21  GLY B N   
1831 C  CA  . GLY B 21  ? 0.1169 0.1444 0.1421 0.0069  -0.0152 0.0328  21  GLY B CA  
1832 C  C   . GLY B 21  ? 0.1117 0.1340 0.1081 0.0096  -0.0287 0.0119  21  GLY B C   
1833 O  O   . GLY B 21  ? 0.1133 0.1338 0.1196 -0.0014 -0.0243 0.0217  21  GLY B O   
1834 N  N   . LEU B 22  ? 0.1205 0.1292 0.0973 0.0073  -0.0160 0.0035  22  LEU B N   
1835 C  CA  . LEU B 22  ? 0.1222 0.1327 0.1055 -0.0046 -0.0153 0.0148  22  LEU B CA  
1836 C  C   . LEU B 22  ? 0.1082 0.1374 0.1081 0.0037  -0.0079 0.0207  22  LEU B C   
1837 O  O   . LEU B 22  ? 0.1242 0.1350 0.1112 0.0066  0.0093  0.0188  22  LEU B O   
1838 C  CB  . LEU B 22  ? 0.1355 0.1397 0.1027 0.0009  0.0006  0.0199  22  LEU B CB  
1839 C  CG  . LEU B 22  ? 0.1348 0.1296 0.1597 0.0076  0.0069  0.0247  22  LEU B CG  
1840 C  CD1 . LEU B 22  ? 0.2503 0.1702 0.2113 -0.0079 0.0854  -0.0211 22  LEU B CD1 
1841 C  CD2 . LEU B 22  ? 0.1643 0.1729 0.2079 -0.0246 0.0416  0.0284  22  LEU B CD2 
1842 N  N   . LEU B 23  ? 0.1119 0.1325 0.1038 0.0090  -0.0144 0.0218  23  LEU B N   
1843 C  CA  . LEU B 23  ? 0.1120 0.1636 0.1096 -0.0042 -0.0180 0.0277  23  LEU B CA  
1844 C  C   . LEU B 23  ? 0.1232 0.1576 0.1059 0.0076  -0.0106 0.0287  23  LEU B C   
1845 O  O   . LEU B 23  ? 0.1343 0.1673 0.1097 0.0044  -0.0213 0.0352  23  LEU B O   
1846 C  CB  . LEU B 23  ? 0.1533 0.1711 0.1008 -0.0087 -0.0192 0.0239  23  LEU B CB  
1847 C  CG  . LEU B 23  ? 0.1554 0.1476 0.1228 -0.0123 -0.0332 0.0282  23  LEU B CG  
1848 C  CD1 . LEU B 23  ? 0.1521 0.2296 0.1552 -0.0098 -0.0363 0.0456  23  LEU B CD1 
1849 C  CD2 . LEU B 23  ? 0.2342 0.2194 0.1120 -0.0450 -0.0068 -0.0113 23  LEU B CD2 
1850 N  N   . ARG B 24  ? 0.1226 0.1576 0.1201 -0.0038 -0.0070 0.0378  24  ARG B N   
1851 C  CA  . ARG B 24  ? 0.1338 0.1781 0.1268 -0.0050 0.0013  0.0404  24  ARG B CA  
1852 C  C   . ARG B 24  ? 0.1185 0.1601 0.1218 -0.0209 -0.0074 0.0486  24  ARG B C   
1853 O  O   . ARG B 24  ? 0.1234 0.1601 0.1389 -0.0234 -0.0067 0.0525  24  ARG B O   
1854 C  CB  . ARG B 24  ? 0.1303 0.2230 0.2643 -0.0111 0.0272  0.0430  24  ARG B CB  
1855 C  CG  . ARG B 24  ? 0.1634 0.2839 0.4026 -0.0412 0.0557  0.0966  24  ARG B CG  
1856 C  CD  . ARG B 24  ? 0.1476 0.3323 0.4155 -0.0376 0.0433  0.1203  24  ARG B CD  
1857 N  NE  . ARG B 24  ? 0.1726 0.3306 0.4115 -0.0520 0.0054  0.0799  24  ARG B NE  
1858 C  CZ  . ARG B 24  ? 0.4038 0.3344 0.2189 0.1247  -0.0407 -0.0719 24  ARG B CZ  
1859 N  NH1 . ARG B 24  ? 0.3175 0.3667 0.4612 -0.1093 0.0081  -0.1078 24  ARG B NH1 
1860 N  NH2 . ARG B 24  ? 0.6166 0.6570 0.3785 0.4081  -0.2705 -0.1511 24  ARG B NH2 
1861 N  N   . GLY B 25  ? 0.1035 0.1432 0.1319 -0.0019 -0.0075 0.0438  25  GLY B N   
1862 C  CA  . GLY B 25  ? 0.1069 0.1418 0.1232 -0.0108 -0.0204 0.0360  25  GLY B CA  
1863 C  C   . GLY B 25  ? 0.1105 0.1321 0.0973 -0.0053 -0.0152 0.0268  25  GLY B C   
1864 O  O   . GLY B 25  ? 0.1244 0.1259 0.1370 -0.0068 -0.0254 0.0363  25  GLY B O   
1865 N  N   . PHE B 26  ? 0.1056 0.1201 0.1150 -0.0043 -0.0157 0.0450  26  PHE B N   
1866 C  CA  . PHE B 26  ? 0.1022 0.1274 0.1173 -0.0034 -0.0125 0.0421  26  PHE B CA  
1867 C  C   . PHE B 26  ? 0.1126 0.1273 0.1097 -0.0116 -0.0171 0.0323  26  PHE B C   
1868 O  O   . PHE B 26  ? 0.1196 0.1292 0.1167 -0.0097 -0.0064 0.0419  26  PHE B O   
1869 C  CB  . PHE B 26  ? 0.1147 0.1224 0.0963 -0.0105 -0.0166 0.0229  26  PHE B CB  
1870 C  CG  . PHE B 26  ? 0.1165 0.1199 0.0943 -0.0302 -0.0035 0.0254  26  PHE B CG  
1871 C  CD1 . PHE B 26  ? 0.1204 0.1875 0.1146 -0.0268 0.0085  0.0303  26  PHE B CD1 
1872 C  CD2 . PHE B 26  ? 0.1133 0.1365 0.1078 -0.0253 -0.0203 0.0110  26  PHE B CD2 
1873 C  CE1 . PHE B 26  ? 0.1236 0.1925 0.1390 -0.0075 0.0181  0.0346  26  PHE B CE1 
1874 C  CE2 . PHE B 26  ? 0.1224 0.1376 0.1349 -0.0117 -0.0233 0.0213  26  PHE B CE2 
1875 C  CZ  . PHE B 26  ? 0.1212 0.1362 0.1596 -0.0059 -0.0073 0.0363  26  PHE B CZ  
1876 N  N   . ARG B 27  ? 0.1241 0.1282 0.1014 -0.0171 -0.0235 0.0234  27  ARG B N   
1877 C  CA  . ARG B 27  ? 0.1236 0.1460 0.1086 -0.0104 -0.0134 0.0388  27  ARG B CA  
1878 C  C   . ARG B 27  ? 0.1066 0.1512 0.1127 -0.0105 -0.0016 0.0347  27  ARG B C   
1879 O  O   . ARG B 27  ? 0.1325 0.1569 0.1346 -0.0172 -0.0064 0.0554  27  ARG B O   
1880 C  CB  . ARG B 27  ? 0.1817 0.1510 0.0991 0.0034  -0.0212 0.0348  27  ARG B CB  
1881 C  CG  . ARG B 27  ? 0.2197 0.1467 0.1353 -0.0102 -0.0492 0.0365  27  ARG B CG  
1882 C  CD  . ARG B 27  ? 0.3107 0.2241 0.1208 -0.1187 -0.0118 0.0094  27  ARG B CD  
1883 N  NE  . ARG B 27  ? 0.2938 0.2577 0.1202 -0.0969 0.0058  0.0220  27  ARG B NE  
1884 C  CZ  . ARG B 27  ? 0.3629 0.2973 0.1219 -0.0889 0.0006  0.0182  27  ARG B CZ  
1885 N  NH1 . ARG B 27  ? 0.3054 0.3594 0.2205 -0.1145 0.0938  -0.0276 27  ARG B NH1 
1886 N  NH2 . ARG B 27  ? 0.3008 0.7567 0.1487 -0.0481 -0.0168 0.1505  27  ARG B NH2 
1887 N  N   . ARG B 28  ? 0.1258 0.1472 0.1246 -0.0205 -0.0116 0.0410  28  ARG B N   
1888 C  CA  . ARG B 28  ? 0.1303 0.1500 0.1403 -0.0299 -0.0096 0.0443  28  ARG B CA  
1889 C  C   . ARG B 28  ? 0.1407 0.1408 0.1436 -0.0369 -0.0141 0.0308  28  ARG B C   
1890 O  O   . ARG B 28  ? 0.1414 0.1593 0.1887 -0.0128 -0.0239 0.0571  28  ARG B O   
1891 C  CB  . ARG B 28  ? 0.1414 0.1587 0.1360 -0.0308 -0.0184 0.0337  28  ARG B CB  
1892 C  CG  . ARG B 28  ? 0.1481 0.2238 0.1943 -0.0064 0.0055  0.0437  28  ARG B CG  
1893 C  CD  . ARG B 28  ? 0.1465 0.2182 0.1839 -0.0208 0.0042  0.0169  28  ARG B CD  
1894 N  NE  . ARG B 28  ? 0.1525 0.2228 0.2473 0.0044  0.0263  0.0510  28  ARG B NE  
1895 C  CZ  . ARG B 28  ? 0.1519 0.2578 0.2210 -0.0120 0.0055  -0.0125 28  ARG B CZ  
1896 N  NH1 . ARG B 28  ? 0.2993 0.3840 0.2060 0.0373  -0.0369 -0.0445 28  ARG B NH1 
1897 N  NH2 . ARG B 28  ? 0.1762 0.3826 0.2106 0.0333  0.0098  -0.0271 28  ARG B NH2 
1898 N  N   . ARG B 29  ? 0.1236 0.1382 0.1369 -0.0163 -0.0199 0.0302  29  ARG B N   
1899 C  CA  . ARG B 29  ? 0.1362 0.1325 0.1503 -0.0117 -0.0238 0.0163  29  ARG B CA  
1900 C  C   . ARG B 29  ? 0.1398 0.1310 0.1246 -0.0118 -0.0126 0.0196  29  ARG B C   
1901 O  O   . ARG B 29  ? 0.1463 0.1419 0.1790 0.0059  -0.0499 0.0092  29  ARG B O   
1902 C  CB  . ARG B 29  ? 0.1625 0.1588 0.1418 0.0025  -0.0270 0.0127  29  ARG B CB  
1903 C  CG  . ARG B 29  ? 0.1756 0.1956 0.1779 0.0264  0.0011  0.0116  29  ARG B CG  
1904 C  CD  . ARG B 29  ? 0.4261 0.3104 0.1521 0.0901  -0.0381 -0.0268 29  ARG B CD  
1905 N  NE  . ARG B 29  ? 0.4588 0.3011 0.1915 0.0996  0.0295  0.0289  29  ARG B NE  
1906 C  CZ  . ARG B 29  ? 0.4601 0.2644 0.1809 0.1235  0.0144  -0.0094 29  ARG B CZ  
1907 N  NH1 . ARG B 29  ? 0.4121 0.3104 0.3722 0.0735  -0.0144 0.1224  29  ARG B NH1 
1908 N  NH2 . ARG B 29  ? 0.8051 0.3448 0.2800 0.2341  0.1519  -0.0523 29  ARG B NH2 
1909 N  N   . PHE B 30  ? 0.1196 0.1367 0.1206 -0.0108 -0.0173 0.0227  30  PHE B N   
1910 C  CA  . PHE B 30  ? 0.1295 0.1446 0.1163 -0.0017 -0.0298 0.0313  30  PHE B CA  
1911 C  C   . PHE B 30  ? 0.1020 0.1626 0.1194 0.0003  -0.0186 0.0214  30  PHE B C   
1912 O  O   . PHE B 30  ? 0.1073 0.1620 0.1135 -0.0028 -0.0283 0.0209  30  PHE B O   
1913 C  CB  . PHE B 30  ? 0.1271 0.1882 0.1178 -0.0328 0.0026  0.0059  30  PHE B CB  
1914 C  CG  . PHE B 30  ? 0.1230 0.1769 0.1150 -0.0032 0.0006  0.0083  30  PHE B CG  
1915 C  CD1 . PHE B 30  ? 0.1622 0.2003 0.1224 0.0383  0.0014  0.0247  30  PHE B CD1 
1916 C  CD2 . PHE B 30  ? 0.1355 0.1462 0.1366 -0.0126 -0.0052 0.0187  30  PHE B CD2 
1917 C  CE1 . PHE B 30  ? 0.1553 0.1896 0.1416 0.0269  -0.0052 -0.0168 30  PHE B CE1 
1918 C  CE2 . PHE B 30  ? 0.1376 0.1870 0.1271 0.0048  0.0074  0.0478  30  PHE B CE2 
1919 C  CZ  . PHE B 30  ? 0.1557 0.1902 0.1173 -0.0172 -0.0036 0.0127  30  PHE B CZ  
1920 N  N   . PRO B 31  ? 0.1107 0.1750 0.1225 -0.0040 -0.0199 0.0349  31  PRO B N   
1921 C  CA  . PRO B 31  ? 0.1095 0.1863 0.1375 0.0052  -0.0005 0.0302  31  PRO B CA  
1922 C  C   . PRO B 31  ? 0.1233 0.2170 0.1045 0.0404  -0.0163 0.0238  31  PRO B C   
1923 O  O   . PRO B 31  ? 0.1422 0.2726 0.1443 0.0619  -0.0158 -0.0144 31  PRO B O   
1924 C  CB  . PRO B 31  ? 0.1603 0.1956 0.1727 0.0095  0.0453  0.0509  31  PRO B CB  
1925 C  CG  . PRO B 31  ? 0.1671 0.1840 0.1471 -0.0079 -0.0234 0.0514  31  PRO B CG  
1926 C  CD  . PRO B 31  ? 0.1276 0.1694 0.1407 -0.0056 -0.0318 0.0451  31  PRO B CD  
1927 N  N   . GLU B 32  ? 0.1169 0.1504 0.1049 0.0131  -0.0133 0.0282  32  GLU B N   
1928 C  CA  . GLU B 32  ? 0.1173 0.1336 0.1002 0.0144  -0.0076 0.0144  32  GLU B CA  
1929 C  C   . GLU B 32  ? 0.1137 0.1386 0.0993 0.0154  -0.0149 0.0172  32  GLU B C   
1930 O  O   . GLU B 32  ? 0.1365 0.1427 0.1140 0.0085  -0.0372 0.0135  32  GLU B O   
1931 C  CB  . GLU B 32  ? 0.1200 0.1414 0.1201 0.0223  -0.0146 0.0122  32  GLU B CB  
1932 C  CG  . GLU B 32  ? 0.1447 0.1367 0.1621 0.0255  -0.0148 0.0128  32  GLU B CG  
1933 C  CD  . GLU B 32  ? 0.1125 0.1707 0.1885 -0.0062 -0.0421 0.0592  32  GLU B CD  
1934 O  OE1 . GLU B 32  ? 0.1573 0.2044 0.1482 -0.0110 -0.0373 0.0600  32  GLU B OE1 
1935 O  OE2 . GLU B 32  ? 0.1630 0.1652 0.2634 -0.0007 -0.0253 0.0777  32  GLU B OE2 
1936 N  N   . GLU B 33  ? 0.1243 0.1567 0.1097 -0.0117 -0.0301 0.0271  33  GLU B N   
1937 C  CA  . GLU B 33  ? 0.1149 0.1420 0.1401 0.0005  -0.0270 0.0339  33  GLU B CA  
1938 C  C   . GLU B 33  ? 0.1141 0.1380 0.1722 0.0164  -0.0263 0.0391  33  GLU B C   
1939 O  O   . GLU B 33  ? 0.1333 0.1654 0.1554 0.0093  -0.0124 0.0150  33  GLU B O   
1940 C  CB  . GLU B 33  ? 0.1347 0.1580 0.1452 -0.0252 -0.0312 0.0511  33  GLU B CB  
1941 C  CG  . GLU B 33  ? 0.1239 0.1794 0.1314 -0.0337 -0.0246 0.0339  33  GLU B CG  
1942 C  CD  . GLU B 33  ? 0.1125 0.2425 0.1321 -0.0371 -0.0087 0.0343  33  GLU B CD  
1943 O  OE1 . GLU B 33  ? 0.1282 0.2458 0.1635 -0.0439 -0.0243 0.0519  33  GLU B OE1 
1944 O  OE2 . GLU B 33  ? 0.1353 0.3470 0.1905 -0.0107 -0.0108 -0.0724 33  GLU B OE2 
1945 N  N   . PRO B 34  ? 0.1293 0.1512 0.2073 0.0064  -0.0505 0.0103  34  PRO B N   
1946 C  CA  . PRO B 34  ? 0.1623 0.1621 0.2047 0.0028  -0.0716 -0.0028 34  PRO B CA  
1947 C  C   . PRO B 34  ? 0.1465 0.1153 0.1698 -0.0092 -0.0402 0.0099  34  PRO B C   
1948 O  O   . PRO B 34  ? 0.1649 0.1611 0.1747 -0.0014 -0.0359 -0.0053 34  PRO B O   
1949 C  CB  . PRO B 34  ? 0.1527 0.1836 0.3214 -0.0044 -0.0824 -0.0349 34  PRO B CB  
1950 C  CG  . PRO B 34  ? 0.2185 0.2176 0.3054 -0.0698 0.0219  -0.0190 34  PRO B CG  
1951 C  CD  . PRO B 34  ? 0.1295 0.2046 0.1831 -0.0332 -0.0330 -0.0231 34  PRO B CD  
1952 N  N   . HIS B 35  ? 0.1690 0.1387 0.1463 0.0031  -0.0451 0.0074  35  HIS B N   
1953 C  CA  . HIS B 35  ? 0.1407 0.1468 0.1769 0.0029  -0.0383 0.0188  35  HIS B CA  
1954 C  C   . HIS B 35  ? 0.1336 0.1506 0.1720 0.0059  -0.0336 0.0060  35  HIS B C   
1955 O  O   . HIS B 35  ? 0.1766 0.1575 0.1955 0.0007  -0.0678 0.0097  35  HIS B O   
1956 C  CB  . HIS B 35  ? 0.1614 0.1976 0.1485 -0.0328 -0.0482 0.0231  35  HIS B CB  
1957 C  CG  . HIS B 35  ? 0.1458 0.1838 0.1630 -0.0223 -0.0407 0.0160  35  HIS B CG  
1958 N  ND1 . HIS B 35  ? 0.1709 0.2430 0.1493 -0.0008 -0.0368 0.0197  35  HIS B ND1 
1959 C  CD2 . HIS B 35  ? 0.1709 0.2085 0.2360 -0.0014 -0.0358 0.0018  35  HIS B CD2 
1960 C  CE1 . HIS B 35  ? 0.2085 0.2412 0.1727 -0.0624 -0.0038 -0.0132 35  HIS B CE1 
1961 N  NE2 . HIS B 35  ? 0.1645 0.2806 0.2648 -0.0095 0.0355  -0.0102 35  HIS B NE2 
1962 N  N   . VAL B 36  ? 0.1472 0.1478 0.1740 0.0106  -0.0252 0.0188  36  VAL B N   
1963 C  CA  . VAL B 36  ? 0.1567 0.1508 0.1667 0.0058  -0.0318 0.0154  36  VAL B CA  
1964 C  C   . VAL B 36  ? 0.1621 0.1345 0.1489 0.0067  -0.0338 0.0057  36  VAL B C   
1965 O  O   . VAL B 36  ? 0.1522 0.1619 0.1349 0.0121  -0.0140 -0.0079 36  VAL B O   
1966 C  CB  . VAL B 36  ? 0.1248 0.1493 0.1705 -0.0002 -0.0359 0.0149  36  VAL B CB  
1967 C  CG1 . VAL B 36  ? 0.1886 0.1410 0.2357 -0.0307 -0.0119 0.0154  36  VAL B CG1 
1968 C  CG2 . VAL B 36  ? 0.1283 0.1905 0.2499 -0.0193 -0.0015 0.0219  36  VAL B CG2 
1969 N  N   . PRO B 37  ? 0.2080 0.1751 0.1601 0.0466  -0.0516 -0.0303 37  PRO B N   
1970 C  CA  . PRO B 37  ? 0.2082 0.1672 0.1556 0.0277  -0.0261 0.0009  37  PRO B CA  
1971 C  C   . PRO B 37  ? 0.1806 0.1797 0.1356 0.0401  -0.0004 0.0056  37  PRO B C   
1972 O  O   . PRO B 37  ? 0.2183 0.2017 0.1420 0.0144  -0.0102 0.0180  37  PRO B O   
1973 C  CB  . PRO B 37  ? 0.2734 0.2633 0.1288 0.0597  -0.0068 0.0280  37  PRO B CB  
1974 C  CG  . PRO B 37  ? 0.2786 0.2821 0.1636 0.0590  -0.0506 0.0110  37  PRO B CG  
1975 C  CD  . PRO B 37  ? 0.2310 0.2104 0.1665 0.0445  -0.0651 -0.0231 37  PRO B CD  
1976 N  N   . LEU B 38  ? 0.1903 0.2340 0.1241 0.0367  -0.0135 0.0071  38  LEU B N   
1977 C  CA  . LEU B 38  ? 0.1784 0.2352 0.1511 0.0445  -0.0227 0.0069  38  LEU B CA  
1978 C  C   . LEU B 38  ? 0.2105 0.2361 0.1445 0.0499  -0.0317 0.0003  38  LEU B C   
1979 O  O   . LEU B 38  ? 0.2137 0.2177 0.1798 0.0663  0.0040  0.0022  38  LEU B O   
1980 C  CB  . LEU B 38  ? 0.1745 0.3436 0.1880 0.0511  -0.0435 -0.0815 38  LEU B CB  
1981 C  CG  . LEU B 38  ? 0.2087 0.3758 0.1964 0.0025  -0.0310 -0.0775 38  LEU B CG  
1982 C  CD1 . LEU B 38  ? 0.1924 0.6774 0.2917 -0.0547 -0.0655 -0.0965 38  LEU B CD1 
1983 C  CD2 . LEU B 38  ? 0.2819 0.2529 0.1571 0.0148  -0.0657 -0.0256 38  LEU B CD2 
1984 N  N   . GLU B 39  ? 0.2901 0.2425 0.1567 0.0545  -0.0251 -0.0164 39  GLU B N   
1985 C  CA  . GLU B 39  ? 0.2913 0.2562 0.1647 0.0324  -0.0195 -0.0178 39  GLU B CA  
1986 C  C   . GLU B 39  ? 0.2982 0.2148 0.2185 0.0570  0.0202  -0.0285 39  GLU B C   
1987 O  O   . GLU B 39  ? 0.2842 0.2052 0.2761 0.0555  0.0105  -0.0621 39  GLU B O   
1993 N  N   . GLN B 40  ? 0.2997 0.1806 0.1565 0.0501  -0.0214 -0.0104 40  GLN B N   
1996 C  C   . GLN B 40  ? 0.2020 0.1959 0.1650 0.0161  -0.0524 -0.0192 40  GLN B C   
1997 O  O   . GLN B 40  ? 0.1703 0.2129 0.2839 0.0059  -0.0539 -0.0515 40  GLN B O   
2008 N  N   . ARG B 41  ? 0.1494 0.1854 0.1704 0.0377  -0.0292 -0.0327 41  ARG B N   
2009 C  CA  . ARG B 41  ? 0.1243 0.1896 0.1692 0.0326  -0.0361 -0.0182 41  ARG B CA  
2010 C  C   . ARG B 41  ? 0.1303 0.1835 0.2209 0.0284  -0.0406 -0.0129 41  ARG B C   
2011 O  O   . ARG B 41  ? 0.1906 0.2016 0.2040 0.0341  -0.0284 -0.0363 41  ARG B O   
2012 C  CB  . ARG B 41  ? 0.1605 0.1891 0.1935 0.0164  -0.0614 0.0044  41  ARG B CB  
2013 C  CG  . ARG B 41  ? 0.1506 0.2014 0.1646 -0.0114 -0.0050 0.0013  41  ARG B CG  
2014 C  CD  . ARG B 41  ? 0.1213 0.1843 0.1619 0.0227  -0.0086 0.0277  41  ARG B CD  
2015 N  NE  . ARG B 41  ? 0.1389 0.1548 0.1582 -0.0069 -0.0170 0.0151  41  ARG B NE  
2016 C  CZ  . ARG B 41  ? 0.1288 0.1594 0.1574 -0.0118 -0.0239 0.0162  41  ARG B CZ  
2017 N  NH1 . ARG B 41  ? 0.1473 0.1656 0.1763 -0.0281 -0.0475 0.0309  41  ARG B NH1 
2018 N  NH2 . ARG B 41  ? 0.1031 0.1596 0.1837 0.0118  -0.0208 0.0366  41  ARG B NH2 
2019 N  N   . ARG B 42  ? 0.1399 0.1551 0.2227 0.0266  -0.0402 -0.0059 42  ARG B N   
2020 C  CA  . ARG B 42  ? 0.2064 0.1664 0.2453 -0.0401 -0.0586 -0.0154 42  ARG B CA  
2021 C  C   . ARG B 42  ? 0.1361 0.1703 0.2432 -0.0307 -0.0540 0.0018  42  ARG B C   
2022 O  O   . ARG B 42  ? 0.1791 0.1543 0.2459 -0.0230 -0.0307 0.0132  42  ARG B O   
2023 C  CB  . ARG B 42  ? 0.2215 0.1904 0.2809 -0.0288 -0.1128 -0.0049 42  ARG B CB  
2024 C  CG  . ARG B 42  ? 0.2621 0.2373 0.2903 -0.0345 -0.0966 -0.0385 42  ARG B CG  
2025 C  CD  . ARG B 42  ? 0.2667 0.2206 0.3298 -0.0470 -0.0787 -0.0412 42  ARG B CD  
2026 N  NE  . ARG B 42  ? 0.3530 0.2373 0.3332 0.0198  -0.0793 -0.0432 42  ARG B NE  
2027 C  CZ  . ARG B 42  ? 0.5066 0.2345 0.2997 -0.0787 -0.1202 -0.0132 42  ARG B CZ  
2028 N  NH1 . ARG B 42  ? 0.3855 0.1980 0.5249 -0.0063 -0.1335 0.0294  42  ARG B NH1 
2029 N  NH2 . ARG B 42  ? 0.8819 0.3001 0.2967 -0.0418 -0.1435 -0.0506 42  ARG B NH2 
2030 N  N   . GLY B 43  ? 0.2135 0.1568 0.2423 -0.0104 -0.0382 0.0065  43  GLY B N   
2031 C  CA  . GLY B 43  ? 0.1727 0.1484 0.2409 -0.0211 -0.0128 0.0118  43  GLY B CA  
2032 C  C   . GLY B 43  ? 0.1881 0.1164 0.2221 -0.0074 -0.0289 0.0212  43  GLY B C   
2033 O  O   . GLY B 43  ? 0.1724 0.1529 0.2172 -0.0186 -0.0238 0.0411  43  GLY B O   
2034 N  N   . PHE B 44  ? 0.1651 0.1481 0.2379 -0.0273 -0.0276 0.0569  44  PHE B N   
2035 C  CA  . PHE B 44  ? 0.1461 0.1434 0.2183 0.0019  -0.0267 0.0525  44  PHE B CA  
2036 C  C   . PHE B 44  ? 0.1641 0.1430 0.2139 -0.0039 -0.0282 0.0367  44  PHE B C   
2037 O  O   . PHE B 44  ? 0.1555 0.1603 0.2839 -0.0144 -0.0500 0.0643  44  PHE B O   
2038 C  CB  . PHE B 44  ? 0.1328 0.1370 0.1944 0.0032  0.0132  0.0376  44  PHE B CB  
2039 C  CG  . PHE B 44  ? 0.1357 0.1485 0.1702 0.0159  0.0068  0.0576  44  PHE B CG  
2040 C  CD1 . PHE B 44  ? 0.1388 0.1526 0.1624 0.0043  0.0000  0.0167  44  PHE B CD1 
2041 C  CD2 . PHE B 44  ? 0.1440 0.1454 0.1827 -0.0045 0.0189  0.0415  44  PHE B CD2 
2042 C  CE1 . PHE B 44  ? 0.1412 0.1657 0.1790 -0.0015 -0.0116 0.0300  44  PHE B CE1 
2043 C  CE2 . PHE B 44  ? 0.1660 0.1690 0.2128 -0.0136 0.0123  0.0082  44  PHE B CE2 
2044 C  CZ  . PHE B 44  ? 0.1444 0.1473 0.1774 0.0052  -0.0232 0.0312  44  PHE B CZ  
2045 N  N   . LEU B 45  ? 0.1665 0.1298 0.2325 -0.0085 -0.0263 0.0291  45  LEU B N   
2046 C  CA  . LEU B 45  ? 0.2386 0.1381 0.2629 0.0429  -0.0745 0.0235  45  LEU B CA  
2047 C  C   . LEU B 45  ? 0.1577 0.1474 0.2505 -0.0059 -0.0458 0.0416  45  LEU B C   
2048 O  O   . LEU B 45  ? 0.1711 0.1585 0.2034 -0.0270 -0.0477 0.0281  45  LEU B O   
2049 C  CB  . LEU B 45  ? 0.4194 0.2601 0.1686 0.1344  -0.0672 -0.0053 45  LEU B CB  
2050 C  CG  . LEU B 45  ? 0.6446 0.4325 0.1642 0.3403  -0.0629 -0.0004 45  LEU B CG  
2051 C  CD1 . LEU B 45  ? 0.7570 0.7470 0.2120 0.4261  0.0376  0.1786  45  LEU B CD1 
2052 C  CD2 . LEU B 45  ? 0.6438 0.7032 0.2592 0.5057  -0.1962 -0.1563 45  LEU B CD2 
2053 N  N   . ALA B 46  ? 0.1438 0.1387 0.2700 -0.0013 -0.0517 0.0171  46  ALA B N   
2054 C  CA  . ALA B 46  ? 0.1342 0.1542 0.2616 0.0052  -0.0046 0.0398  46  ALA B CA  
2055 C  C   . ALA B 46  ? 0.1392 0.1482 0.1987 -0.0007 -0.0245 0.0405  46  ALA B C   
2056 O  O   . ALA B 46  ? 0.1325 0.1713 0.1599 -0.0046 -0.0055 0.0550  46  ALA B O   
2057 C  CB  . ALA B 46  ? 0.1442 0.1561 0.2828 -0.0235 0.0014  -0.0213 46  ALA B CB  
2058 N  N   . ARG B 47  ? 0.1401 0.1304 0.2062 -0.0057 -0.0523 0.0336  47  ARG B N   
2059 C  CA  . ARG B 47  ? 0.1507 0.1309 0.1962 -0.0130 -0.0360 0.0331  47  ARG B CA  
2060 C  C   . ARG B 47  ? 0.1424 0.1518 0.1940 -0.0149 -0.0116 0.0412  47  ARG B C   
2061 O  O   . ARG B 47  ? 0.1348 0.1733 0.1418 -0.0104 -0.0133 0.0418  47  ARG B O   
2062 C  CB  . ARG B 47  ? 0.2176 0.1620 0.2035 -0.0282 -0.0405 0.0147  47  ARG B CB  
2063 C  CG  . ARG B 47  ? 0.2283 0.2859 0.1695 0.0133  -0.0023 0.0268  47  ARG B CG  
2064 C  CD  . ARG B 47  ? 0.3035 0.3713 0.2129 0.0182  -0.0885 -0.0777 47  ARG B CD  
2065 N  NE  . ARG B 47  ? 0.4668 0.4148 0.2112 0.0997  -0.0169 -0.0373 47  ARG B NE  
2066 C  CZ  . ARG B 47  ? 0.5832 0.3617 0.2376 0.0129  0.1158  -0.0440 47  ARG B CZ  
2067 N  NH1 . ARG B 47  ? 0.7494 0.3620 0.6010 0.0479  0.4711  -0.0002 47  ARG B NH1 
2068 N  NH2 . ARG B 47  ? 1.0502 0.3553 0.1981 -0.3099 -0.0762 0.0549  47  ARG B NH2 
2069 N  N   . GLU B 48  ? 0.1367 0.1578 0.1594 -0.0204 -0.0150 0.0418  48  GLU B N   
2070 C  CA  . GLU B 48  ? 0.1472 0.1762 0.1607 -0.0352 -0.0108 0.0615  48  GLU B CA  
2071 C  C   . GLU B 48  ? 0.1293 0.1631 0.1626 -0.0386 -0.0174 0.0644  48  GLU B C   
2072 O  O   . GLU B 48  ? 0.1389 0.1838 0.1805 -0.0248 -0.0186 0.0612  48  GLU B O   
2073 C  CB  . GLU B 48  ? 0.1648 0.1910 0.1865 -0.0342 -0.0150 0.0881  48  GLU B CB  
2074 C  CG  . GLU B 48  ? 0.2556 0.2167 0.1876 -0.0383 -0.0246 0.1032  48  GLU B CG  
2075 C  CD  . GLU B 48  ? 0.2314 0.3045 0.1862 -0.0409 -0.0010 0.0490  48  GLU B CD  
2076 O  OE1 . GLU B 48  ? 0.2767 0.3214 0.2242 -0.0275 -0.0271 0.0158  48  GLU B OE1 
2077 O  OE2 . GLU B 48  ? 0.2180 0.3232 0.2246 -0.0553 0.0171  0.0637  48  GLU B OE2 
2078 N  N   . GLN B 49  ? 0.1387 0.1381 0.1697 -0.0365 -0.0179 0.0392  49  GLN B N   
2079 C  CA  . GLN B 49  ? 0.1301 0.1584 0.1739 -0.0122 -0.0092 0.0529  49  GLN B CA  
2080 C  C   . GLN B 49  ? 0.1189 0.1588 0.1738 -0.0039 -0.0082 0.0436  49  GLN B C   
2081 O  O   . GLN B 49  ? 0.1368 0.2014 0.1698 -0.0043 -0.0200 0.0617  49  GLN B O   
2082 C  CB  . GLN B 49  ? 0.1335 0.1496 0.1910 -0.0010 -0.0142 0.0302  49  GLN B CB  
2083 C  CG  . GLN B 49  ? 0.1480 0.1663 0.1782 0.0206  -0.0164 0.0589  49  GLN B CG  
2084 C  CD  . GLN B 49  ? 0.1250 0.2101 0.1667 -0.0069 -0.0084 0.0386  49  GLN B CD  
2085 O  OE1 . GLN B 49  ? 0.1291 0.2167 0.1797 0.0159  -0.0192 0.0050  49  GLN B OE1 
2086 N  NE2 . GLN B 49  ? 0.1609 0.2360 0.1833 -0.0010 -0.0350 0.0141  49  GLN B NE2 
2087 N  N   . TYR B 50  ? 0.1213 0.1525 0.1437 0.0010  0.0100  0.0447  50  TYR B N   
2088 C  CA  . TYR B 50  ? 0.1231 0.1491 0.1403 0.0017  0.0181  0.0365  50  TYR B CA  
2089 C  C   . TYR B 50  ? 0.1108 0.1658 0.1294 -0.0011 0.0018  0.0468  50  TYR B C   
2090 O  O   . TYR B 50  ? 0.1193 0.1874 0.1421 0.0034  0.0080  0.0597  50  TYR B O   
2091 C  CB  . TYR B 50  ? 0.1189 0.1577 0.1382 -0.0072 0.0120  0.0416  50  TYR B CB  
2092 C  CG  . TYR B 50  ? 0.1170 0.1369 0.1460 0.0078  0.0141  0.0384  50  TYR B CG  
2093 C  CD1 . TYR B 50  ? 0.1141 0.1361 0.1602 -0.0022 0.0107  0.0411  50  TYR B CD1 
2094 C  CD2 . TYR B 50  ? 0.1279 0.1627 0.1490 0.0128  0.0220  0.0579  50  TYR B CD2 
2095 C  CE1 . TYR B 50  ? 0.1221 0.1271 0.1750 0.0088  0.0255  0.0380  50  TYR B CE1 
2096 C  CE2 . TYR B 50  ? 0.1332 0.1377 0.1581 0.0136  0.0240  0.0436  50  TYR B CE2 
2097 C  CZ  . TYR B 50  ? 0.1436 0.1456 0.1591 0.0168  0.0347  0.0356  50  TYR B CZ  
2098 O  OH  . TYR B 50  ? 0.1305 0.1652 0.1549 -0.0029 0.0302  0.0272  50  TYR B OH  
2099 N  N   . ARG B 51  ? 0.1047 0.1877 0.1470 0.0098  0.0159  0.0648  51  ARG B N   
2100 C  CA  . ARG B 51  ? 0.1037 0.1884 0.1352 -0.0055 0.0070  0.0620  51  ARG B CA  
2101 C  C   . ARG B 51  ? 0.1080 0.1852 0.1400 -0.0086 0.0059  0.0605  51  ARG B C   
2102 O  O   . ARG B 51  ? 0.1073 0.2105 0.1359 -0.0115 -0.0045 0.0519  51  ARG B O   
2103 C  CB  . ARG B 51  ? 0.1184 0.2113 0.1324 -0.0336 0.0145  0.0583  51  ARG B CB  
2104 C  CG  . ARG B 51  ? 0.1812 0.2100 0.1435 0.0166  0.0392  0.0791  51  ARG B CG  
2105 C  CD  . ARG B 51  ? 0.1685 0.2332 0.1187 -0.0264 0.0280  0.0569  51  ARG B CD  
2106 N  NE  . ARG B 51  ? 0.1903 0.3126 0.1160 -0.0663 0.0085  0.0508  51  ARG B NE  
2107 C  CZ  . ARG B 51  ? 0.1796 0.2842 0.1577 -0.0538 0.0164  0.0451  51  ARG B CZ  
2108 N  NH1 . ARG B 51  ? 0.2232 0.3118 0.1767 -0.0164 0.0587  0.0432  51  ARG B NH1 
2109 N  NH2 . ARG B 51  ? 0.2163 0.3023 0.1842 -0.0515 -0.0280 0.0157  51  ARG B NH2 
2110 N  N   . ALA B 52  ? 0.1266 0.2028 0.1549 -0.0144 0.0037  0.0425  52  ALA B N   
2111 C  CA  . ALA B 52  ? 0.1534 0.1969 0.1848 -0.0296 -0.0274 0.0545  52  ALA B CA  
2112 C  C   . ALA B 52  ? 0.1415 0.2236 0.1606 0.0240  -0.0034 0.0369  52  ALA B C   
2113 O  O   . ALA B 52  ? 0.1922 0.2861 0.2138 0.0084  -0.0634 0.0499  52  ALA B O   
2114 C  CB  . ALA B 52  ? 0.1703 0.1911 0.2576 -0.0297 -0.0526 0.0427  52  ALA B CB  
2115 N  N   . LEU B 53  ? 0.2025 0.1986 0.1243 -0.0233 -0.0216 0.0327  53  LEU B N   
2116 C  CA  . LEU B 53  ? 0.1871 0.1976 0.1396 -0.0042 -0.0308 0.0354  53  LEU B CA  
2117 C  C   . LEU B 53  ? 0.1848 0.2358 0.1444 0.0148  -0.0153 0.0480  53  LEU B C   
2118 O  O   . LEU B 53  ? 0.1907 0.2601 0.1655 0.0099  -0.0365 0.0478  53  LEU B O   
2119 C  CB  . LEU B 53  ? 0.1943 0.2302 0.1576 0.0046  0.0006  0.0569  53  LEU B CB  
2120 C  CG  . LEU B 53  ? 0.2326 0.2679 0.1579 0.0414  0.0327  0.0556  53  LEU B CG  
2121 C  CD1 . LEU B 53  ? 0.3315 0.3575 0.1490 0.0597  0.0039  0.0278  53  LEU B CD1 
2122 C  CD2 . LEU B 53  ? 0.2299 0.2713 0.2155 0.0614  0.0765  0.0909  53  LEU B CD2 
2123 N  N   . ARG B 54  ? 0.1293 0.2064 0.1514 0.0046  0.0016  0.0499  54  ARG B N   
2124 C  CA  . ARG B 54  ? 0.1216 0.2086 0.1611 0.0074  -0.0005 0.0669  54  ARG B CA  
2125 C  C   . ARG B 54  ? 0.1266 0.1796 0.1679 -0.0341 0.0091  0.0371  54  ARG B C   
2126 O  O   . ARG B 54  ? 0.1251 0.1642 0.1926 -0.0105 -0.0011 0.0466  54  ARG B O   
2127 C  CB  . ARG B 54  ? 0.1329 0.2203 0.1987 -0.0005 -0.0160 0.0809  54  ARG B CB  
2128 C  CG  . ARG B 54  ? 0.1347 0.1930 0.1721 -0.0057 -0.0241 0.0481  54  ARG B CG  
2129 C  CD  . ARG B 54  ? 0.1288 0.2287 0.1317 0.0011  -0.0142 0.0566  54  ARG B CD  
2130 N  NE  . ARG B 54  ? 0.1492 0.2267 0.1726 -0.0323 0.0017  0.0788  54  ARG B NE  
2131 C  CZ  . ARG B 54  ? 0.1145 0.2131 0.1685 0.0142  -0.0026 0.1031  54  ARG B CZ  
2132 N  NH1 . ARG B 54  ? 0.1232 0.2005 0.2175 -0.0032 0.0472  0.0514  54  ARG B NH1 
2133 N  NH2 . ARG B 54  ? 0.1825 0.2536 0.1730 -0.0178 0.0133  0.0987  54  ARG B NH2 
2134 N  N   . PRO B 55  ? 0.1248 0.2209 0.1606 -0.0096 -0.0009 0.0726  55  PRO B N   
2135 C  CA  . PRO B 55  ? 0.1266 0.2215 0.1563 -0.0180 0.0103  0.0581  55  PRO B CA  
2136 C  C   . PRO B 55  ? 0.1292 0.2353 0.1534 -0.0209 0.0104  0.0700  55  PRO B C   
2137 O  O   . PRO B 55  ? 0.1345 0.2901 0.2122 -0.0619 -0.0190 0.1091  55  PRO B O   
2138 C  CB  . PRO B 55  ? 0.1214 0.3073 0.1785 -0.0284 0.0167  0.0702  55  PRO B CB  
2139 C  CG  . PRO B 55  ? 0.1217 0.2932 0.1613 0.0017  -0.0001 0.0743  55  PRO B CG  
2140 C  CD  . PRO B 55  ? 0.1164 0.2825 0.1691 -0.0165 -0.0034 0.1011  55  PRO B CD  
2141 N  N   . ASP B 56  ? 0.1286 0.2181 0.2219 -0.0140 0.0409  0.0721  56  ASP B N   
2142 C  CA  . ASP B 56  ? 0.1492 0.2162 0.1434 0.0140  0.0141  0.0354  56  ASP B CA  
2143 C  C   . ASP B 56  ? 0.1483 0.1826 0.1783 -0.0168 0.0324  0.0307  56  ASP B C   
2144 O  O   . ASP B 56  ? 0.1477 0.1887 0.1849 -0.0115 0.0226  0.0170  56  ASP B O   
2145 C  CB  . ASP B 56  ? 0.2571 0.1994 0.1772 0.0514  0.0478  0.0205  56  ASP B CB  
2146 C  CG  . ASP B 56  ? 0.1981 0.2204 0.1807 0.0088  0.0229  0.0627  56  ASP B CG  
2147 O  OD1 . ASP B 56  ? 0.2364 0.3857 0.2124 -0.0502 0.0089  0.0413  56  ASP B OD1 
2148 O  OD2 . ASP B 56  ? 0.2176 0.2702 0.2412 -0.0099 0.0321  0.1008  56  ASP B OD2 
2149 N  N   . LEU B 57  ? 0.1116 0.1801 0.1499 -0.0182 0.0129  0.0475  57  LEU B N   
2150 C  CA  . LEU B 57  ? 0.1154 0.1456 0.1717 -0.0051 0.0044  0.0431  57  LEU B CA  
2151 C  C   . LEU B 57  ? 0.1032 0.1741 0.1468 -0.0053 0.0242  0.0361  57  LEU B C   
2152 O  O   . LEU B 57  ? 0.1087 0.1818 0.1693 -0.0004 0.0073  0.0433  57  LEU B O   
2153 C  CB  . LEU B 57  ? 0.1280 0.1941 0.1469 -0.0078 0.0134  0.0470  57  LEU B CB  
2154 C  CG  . LEU B 57  ? 0.1033 0.1901 0.1683 0.0238  0.0097  0.0462  57  LEU B CG  
2155 C  CD1 . LEU B 57  ? 0.2256 0.2446 0.1387 0.0207  0.0051  0.0395  57  LEU B CD1 
2156 C  CD2 . LEU B 57  ? 0.1890 0.2557 0.1688 -0.0463 -0.0165 0.0912  57  LEU B CD2 
2157 N  N   . ALA B 58  ? 0.1401 0.2052 0.1523 -0.0255 0.0013  0.0580  58  ALA B N   
2158 C  CA  . ALA B 58  ? 0.1313 0.1480 0.1593 -0.0054 0.0001  0.0386  58  ALA B CA  
2159 C  C   . ALA B 58  ? 0.1286 0.1685 0.1367 -0.0205 0.0201  0.0336  58  ALA B C   
2160 O  O   . ALA B 58  ? 0.1376 0.2118 0.1467 -0.0172 0.0057  0.0285  58  ALA B O   
2161 C  CB  . ALA B 58  ? 0.1511 0.1828 0.2190 -0.0369 -0.0131 0.0967  58  ALA B CB  
2162 N  N   . ASP B 59  ? 0.1595 0.1704 0.1910 -0.0214 0.0265  0.0179  59  ASP B N   
2163 C  CA  . ASP B 59  ? 0.1725 0.1999 0.1850 -0.0339 0.0382  -0.0064 59  ASP B CA  
2164 C  C   . ASP B 59  ? 0.1560 0.1457 0.1602 -0.0039 0.0087  0.0101  59  ASP B C   
2165 O  O   . ASP B 59  ? 0.1534 0.2031 0.1424 -0.0220 0.0157  0.0031  59  ASP B O   
2166 C  CB  . ASP B 59  ? 0.2090 0.2536 0.3258 -0.0547 0.1002  -0.0815 59  ASP B CB  
2167 C  CG  . ASP B 59  ? 0.3023 0.4452 0.3312 -0.0581 0.1701  -0.0681 59  ASP B CG  
2168 O  OD1 . ASP B 59  ? 0.3724 0.4878 0.2311 -0.0640 0.1634  -0.0004 59  ASP B OD1 
2169 O  OD2 . ASP B 59  ? 0.3493 0.6468 0.4505 0.0645  0.2203  -0.0374 59  ASP B OD2 
2170 N  N   . LYS B 60  ? 0.1361 0.1851 0.1628 0.0041  0.0051  0.0189  60  LYS B N   
2173 C  C   . LYS B 60  ? 0.1425 0.1447 0.1558 -0.0191 0.0153  0.0359  60  LYS B C   
2174 O  O   . LYS B 60  ? 0.1408 0.1567 0.1412 -0.0263 0.0056  0.0315  60  LYS B O   
2185 N  N   . VAL B 61  ? 0.1362 0.1444 0.1261 -0.0179 0.0120  0.0200  61  VAL B N   
2188 C  C   . VAL B 61  ? 0.1409 0.1405 0.1849 0.0259  0.0261  0.0222  61  VAL B C   
2189 O  O   . VAL B 61  ? 0.1406 0.1493 0.1763 0.0222  0.0185  0.0214  61  VAL B O   
2196 N  N   . ALA B 62  ? 0.1281 0.1607 0.1652 0.0003  0.0073  0.0193  62  ALA B N   
2197 C  CA  . ALA B 62  ? 0.1236 0.1784 0.1844 -0.0018 -0.0055 0.0740  62  ALA B CA  
2198 C  C   . ALA B 62  ? 0.1297 0.1970 0.1341 -0.0070 -0.0107 0.0599  62  ALA B C   
2199 O  O   . ALA B 62  ? 0.1452 0.2180 0.1206 -0.0043 -0.0195 0.0396  62  ALA B O   
2200 C  CB  . ALA B 62  ? 0.1930 0.2652 0.1691 -0.0550 0.0151  0.0564  62  ALA B CB  
2201 N  N   . SER B 63  ? 0.1479 0.1612 0.1424 0.0001  -0.0210 0.0089  63  SER B N   
2202 C  CA  . SER B 63  ? 0.1254 0.1785 0.1441 -0.0012 -0.0023 -0.0169 63  SER B CA  
2203 C  C   . SER B 63  ? 0.1377 0.1734 0.1296 -0.0005 -0.0083 -0.0031 63  SER B C   
2204 O  O   . SER B 63  ? 0.1438 0.1951 0.1453 -0.0264 -0.0065 -0.0074 63  SER B O   
2205 C  CB  . SER B 63  ? 0.1767 0.1561 0.1888 0.0138  0.0129  -0.0141 63  SER B CB  
2206 O  OG  . SER B 63  ? 0.1937 0.2018 0.1978 0.0282  -0.0363 0.0029  63  SER B OG  
2207 N  N   . VAL B 64  ? 0.1249 0.1510 0.1065 0.0050  -0.0061 0.0180  64  VAL B N   
2208 C  CA  . VAL B 64  ? 0.1207 0.1212 0.1239 -0.0002 -0.0139 0.0148  64  VAL B CA  
2209 C  C   . VAL B 64  ? 0.1303 0.1218 0.1194 0.0058  -0.0124 0.0074  64  VAL B C   
2210 O  O   . VAL B 64  ? 0.1297 0.1432 0.1115 -0.0033 -0.0144 0.0115  64  VAL B O   
2211 C  CB  . VAL B 64  ? 0.1280 0.1324 0.1165 0.0112  -0.0063 0.0136  64  VAL B CB  
2212 C  CG1 . VAL B 64  ? 0.1209 0.1724 0.1271 -0.0148 0.0003  0.0163  64  VAL B CG1 
2213 C  CG2 . VAL B 64  ? 0.1410 0.1708 0.1150 0.0022  -0.0111 0.0343  64  VAL B CG2 
2214 N  N   . TYR B 65  ? 0.1402 0.1252 0.1139 0.0026  -0.0009 0.0186  65  TYR B N   
2215 C  CA  . TYR B 65  ? 0.1428 0.1306 0.1184 0.0153  -0.0022 0.0172  65  TYR B CA  
2216 C  C   . TYR B 65  ? 0.1234 0.1232 0.1298 0.0101  -0.0075 0.0174  65  TYR B C   
2217 O  O   . TYR B 65  ? 0.1460 0.1646 0.1257 0.0247  -0.0109 0.0244  65  TYR B O   
2218 C  CB  . TYR B 65  ? 0.1867 0.1336 0.1251 0.0011  0.0042  0.0148  65  TYR B CB  
2219 C  CG  . TYR B 65  ? 0.1604 0.1235 0.1514 0.0025  -0.0151 0.0261  65  TYR B CG  
2220 C  CD1 . TYR B 65  ? 0.1799 0.1762 0.1559 0.0093  0.0046  0.0582  65  TYR B CD1 
2221 C  CD2 . TYR B 65  ? 0.2015 0.1410 0.2223 -0.0038 -0.0614 0.0071  65  TYR B CD2 
2222 C  CE1 . TYR B 65  ? 0.1973 0.1885 0.2010 -0.0090 0.0268  0.0530  65  TYR B CE1 
2223 C  CE2 . TYR B 65  ? 0.2405 0.2020 0.2779 -0.0837 -0.0820 0.0471  65  TYR B CE2 
2224 C  CZ  . TYR B 65  ? 0.2441 0.1838 0.2985 -0.0568 -0.0187 0.0718  65  TYR B CZ  
2225 O  OH  . TYR B 65  ? 0.1830 0.2701 0.3991 -0.0135 -0.0119 0.0831  65  TYR B OH  
2226 N  N   . GLU B 66  ? 0.1486 0.1431 0.1144 0.0215  0.0155  0.0190  66  GLU B N   
2227 C  CA  . GLU B 66  ? 0.1887 0.1698 0.0992 0.0390  -0.0076 0.0281  66  GLU B CA  
2228 C  C   . GLU B 66  ? 0.2137 0.1463 0.1290 0.0478  -0.0228 0.0047  66  GLU B C   
2229 O  O   . GLU B 66  ? 0.2530 0.2076 0.1465 0.0538  -0.0328 -0.0317 66  GLU B O   
2230 C  CB  . GLU B 66  ? 0.1964 0.2130 0.1235 0.0644  -0.0062 -0.0098 66  GLU B CB  
2231 C  CG  . GLU B 66  ? 0.1998 0.3183 0.1328 -0.0041 0.0067  0.0270  66  GLU B CG  
2232 C  CD  . GLU B 66  ? 0.2561 0.5323 0.1774 0.0040  0.0845  0.0276  66  GLU B CD  
2233 O  OE1 . GLU B 66  ? 0.2225 0.5796 0.4846 0.0476  0.1092  -0.0999 66  GLU B OE1 
2234 O  OE2 . GLU B 66  ? 0.3393 0.6183 0.3834 -0.1876 0.1516  -0.0953 66  GLU B OE2 
2235 N  N   . ALA B 67  ? 0.1554 0.1455 0.1402 0.0175  -0.0257 -0.0037 67  ALA B N   
2236 C  CA  . ALA B 67  ? 0.1793 0.1519 0.1808 0.0128  -0.0483 0.0140  67  ALA B CA  
2237 C  C   . ALA B 67  ? 0.1778 0.1319 0.1396 -0.0091 -0.0291 0.0086  67  ALA B C   
2238 O  O   . ALA B 67  ? 0.1654 0.1317 0.1518 -0.0055 -0.0461 0.0029  67  ALA B O   
2239 C  CB  . ALA B 67  ? 0.1574 0.1412 0.1777 -0.0008 -0.0411 0.0107  67  ALA B CB  
2240 N  N   . PRO B 68  ? 0.1822 0.1275 0.1706 0.0089  -0.0404 -0.0009 68  PRO B N   
2241 C  CA  . PRO B 68  ? 0.1780 0.1313 0.1809 -0.0048 -0.0383 -0.0110 68  PRO B CA  
2242 C  C   . PRO B 68  ? 0.1826 0.1160 0.1681 -0.0098 -0.0370 0.0086  68  PRO B C   
2243 O  O   . PRO B 68  ? 0.2016 0.1260 0.1915 0.0012  -0.0392 0.0373  68  PRO B O   
2244 C  CB  . PRO B 68  ? 0.2127 0.1489 0.2923 0.0000  -0.0272 -0.0670 68  PRO B CB  
2245 C  CG  . PRO B 68  ? 0.2212 0.1780 0.2864 0.0066  -0.0219 -0.0662 68  PRO B CG  
2246 C  CD  . PRO B 68  ? 0.2059 0.1496 0.1829 0.0245  -0.0261 -0.0165 68  PRO B CD  
2247 N  N   . GLY B 69  ? 0.1802 0.1101 0.1495 -0.0114 -0.0302 0.0154  69  GLY B N   
2248 C  CA  . GLY B 69  ? 0.1769 0.1145 0.1660 -0.0178 -0.0178 0.0186  69  GLY B CA  
2249 C  C   . GLY B 69  ? 0.1446 0.1240 0.1263 -0.0136 -0.0176 0.0259  69  GLY B C   
2250 O  O   . GLY B 69  ? 0.1715 0.1461 0.1543 -0.0213 0.0164  0.0163  69  GLY B O   
2251 N  N   . PHE B 70  ? 0.1356 0.1009 0.1310 0.0099  -0.0132 0.0094  70  PHE B N   
2252 C  CA  . PHE B 70  ? 0.1431 0.1102 0.1359 -0.0028 -0.0116 0.0128  70  PHE B CA  
2253 C  C   . PHE B 70  ? 0.1248 0.1077 0.1139 0.0025  -0.0193 0.0062  70  PHE B C   
2254 O  O   . PHE B 70  ? 0.1678 0.1267 0.1023 0.0044  -0.0154 0.0093  70  PHE B O   
2255 C  CB  . PHE B 70  ? 0.1288 0.1196 0.0976 0.0158  -0.0126 0.0008  70  PHE B CB  
2256 C  CG  . PHE B 70  ? 0.1219 0.1386 0.0985 0.0027  -0.0155 -0.0032 70  PHE B CG  
2257 C  CD1 . PHE B 70  ? 0.1117 0.1522 0.1034 0.0033  -0.0206 0.0023  70  PHE B CD1 
2258 C  CD2 . PHE B 70  ? 0.1218 0.1304 0.1073 0.0161  -0.0073 0.0001  70  PHE B CD2 
2259 C  CE1 . PHE B 70  ? 0.1543 0.1655 0.1111 -0.0034 -0.0271 -0.0122 70  PHE B CE1 
2260 C  CE2 . PHE B 70  ? 0.1291 0.1372 0.1274 0.0034  0.0023  -0.0095 70  PHE B CE2 
2261 C  CZ  . PHE B 70  ? 0.1353 0.1522 0.1430 0.0096  -0.0302 -0.0156 70  PHE B CZ  
2262 N  N   . PHE B 71  ? 0.1288 0.1081 0.1090 -0.0057 0.0142  0.0216  71  PHE B N   
2263 C  CA  . PHE B 71  ? 0.1287 0.1285 0.1045 0.0054  -0.0100 0.0140  71  PHE B CA  
2264 C  C   . PHE B 71  ? 0.1361 0.1071 0.1156 0.0024  -0.0101 0.0280  71  PHE B C   
2265 O  O   . PHE B 71  ? 0.1259 0.1188 0.1400 0.0065  -0.0043 0.0285  71  PHE B O   
2266 C  CB  . PHE B 71  ? 0.1344 0.1308 0.1038 -0.0050 -0.0112 0.0198  71  PHE B CB  
2267 C  CG  . PHE B 71  ? 0.1316 0.1205 0.1156 0.0058  -0.0033 0.0243  71  PHE B CG  
2268 C  CD1 . PHE B 71  ? 0.1329 0.1280 0.1426 0.0039  0.0082  0.0017  71  PHE B CD1 
2269 C  CD2 . PHE B 71  ? 0.1318 0.1171 0.1232 0.0074  -0.0125 0.0055  71  PHE B CD2 
2270 C  CE1 . PHE B 71  ? 0.1584 0.1225 0.1551 -0.0104 0.0110  0.0193  71  PHE B CE1 
2271 C  CE2 . PHE B 71  ? 0.1456 0.1508 0.1053 -0.0074 0.0082  0.0137  71  PHE B CE2 
2272 C  CZ  . PHE B 71  ? 0.1350 0.1523 0.1290 -0.0288 0.0048  0.0001  71  PHE B CZ  
2273 N  N   . LEU B 72  ? 0.1388 0.1221 0.1195 -0.0079 -0.0098 0.0174  72  LEU B N   
2274 C  CA  . LEU B 72  ? 0.1472 0.1384 0.1418 -0.0101 -0.0057 0.0407  72  LEU B CA  
2275 C  C   . LEU B 72  ? 0.1314 0.1465 0.1399 -0.0243 -0.0096 0.0410  72  LEU B C   
2276 O  O   . LEU B 72  ? 0.1293 0.1454 0.1509 -0.0214 -0.0081 0.0242  72  LEU B O   
2277 C  CB  . LEU B 72  ? 0.1860 0.1682 0.1464 -0.0513 -0.0492 0.0290  72  LEU B CB  
2278 C  CG  . LEU B 72  ? 0.1894 0.1662 0.2440 -0.0493 -0.0080 0.0550  72  LEU B CG  
2279 C  CD1 . LEU B 72  ? 0.2133 0.2616 0.3096 -0.1129 -0.1275 0.0717  72  LEU B CD1 
2280 C  CD2 . LEU B 72  ? 0.2831 0.1964 0.2557 -0.1037 0.0180  -0.0154 72  LEU B CD2 
2281 N  N   . ASP B 73  ? 0.1260 0.1389 0.1324 -0.0156 0.0022  0.0374  73  ASP B N   
2282 C  CA  . ASP B 73  ? 0.1464 0.1350 0.1358 -0.0228 0.0043  0.0475  73  ASP B CA  
2283 C  C   . ASP B 73  ? 0.1239 0.1481 0.1213 -0.0094 -0.0016 0.0406  73  ASP B C   
2284 O  O   . ASP B 73  ? 0.1934 0.1772 0.1167 -0.0220 -0.0040 0.0579  73  ASP B O   
2285 C  CB  . ASP B 73  ? 0.2058 0.1411 0.1665 -0.0226 -0.0408 0.0530  73  ASP B CB  
2286 C  CG  . ASP B 73  ? 0.2995 0.1321 0.2323 -0.0424 -0.0868 0.0628  73  ASP B CG  
2287 O  OD1 . ASP B 73  ? 0.3032 0.1779 0.2889 -0.0937 -0.1012 0.0799  73  ASP B OD1 
2288 O  OD2 . ASP B 73  ? 0.3426 0.1416 0.2700 -0.0150 -0.0552 0.0505  73  ASP B OD2 
2289 N  N   . LEU B 74  ? 0.1195 0.1383 0.0883 -0.0225 -0.0100 0.0256  74  LEU B N   
2290 C  CA  . LEU B 74  ? 0.1314 0.1484 0.0952 -0.0065 -0.0148 0.0197  74  LEU B CA  
2291 C  C   . LEU B 74  ? 0.1315 0.1464 0.1067 -0.0032 -0.0078 0.0293  74  LEU B C   
2292 O  O   . LEU B 74  ? 0.1348 0.1910 0.1031 -0.0041 -0.0157 0.0564  74  LEU B O   
2293 C  CB  . LEU B 74  ? 0.1297 0.1073 0.1098 -0.0022 -0.0047 0.0024  74  LEU B CB  
2294 C  CG  . LEU B 74  ? 0.1120 0.1322 0.1199 0.0032  -0.0074 0.0096  74  LEU B CG  
2295 C  CD1 . LEU B 74  ? 0.1279 0.1345 0.1112 0.0029  -0.0019 0.0078  74  LEU B CD1 
2296 C  CD2 . LEU B 74  ? 0.1403 0.1440 0.1092 0.0039  -0.0172 0.0036  74  LEU B CD2 
2297 N  N   . GLU B 75  ? 0.1185 0.1704 0.1072 0.0098  -0.0067 0.0251  75  GLU B N   
2298 C  CA  . GLU B 75  ? 0.1500 0.1680 0.1065 0.0133  0.0112  0.0314  75  GLU B CA  
2299 C  C   . GLU B 75  ? 0.1311 0.1596 0.1023 0.0027  0.0029  0.0291  75  GLU B C   
2300 O  O   . GLU B 75  ? 0.1272 0.1905 0.1501 -0.0132 -0.0170 0.0427  75  GLU B O   
2301 C  CB  . GLU B 75  ? 0.2648 0.2087 0.0984 0.0514  0.0116  0.0347  75  GLU B CB  
2302 C  CG  . GLU B 75  ? 0.5884 0.2793 0.1847 0.1506  0.0109  0.1125  75  GLU B CG  
2303 C  CD  . GLU B 75  ? 0.6995 0.4496 0.2070 -0.0074 0.0135  0.2082  75  GLU B CD  
2304 O  OE1 . GLU B 75  ? 1.3998 0.4592 0.4488 -0.0685 0.2051  0.2786  75  GLU B OE1 
2305 O  OE2 . GLU B 75  ? 0.6649 1.0640 0.1948 -0.3548 0.0075  0.1401  75  GLU B OE2 
2306 N  N   . PRO B 76  ? 0.1350 0.1461 0.1100 0.0016  0.0156  0.0243  76  PRO B N   
2307 C  CA  . PRO B 76  ? 0.1389 0.1427 0.1150 0.0002  -0.0105 0.0259  76  PRO B CA  
2308 C  C   . PRO B 76  ? 0.1358 0.1576 0.1173 -0.0116 -0.0089 0.0266  76  PRO B C   
2309 O  O   . PRO B 76  ? 0.2645 0.1763 0.1148 -0.0145 -0.0257 0.0206  76  PRO B O   
2310 C  CB  . PRO B 76  ? 0.1382 0.1644 0.1384 0.0126  -0.0125 0.0029  76  PRO B CB  
2311 C  CG  . PRO B 76  ? 0.1222 0.1825 0.3441 0.0038  0.0272  0.0320  76  PRO B CG  
2312 C  CD  . PRO B 76  ? 0.1502 0.1737 0.1784 -0.0281 -0.0025 0.0513  76  PRO B CD  
2313 N  N   . ILE B 77  ? 0.1551 0.1544 0.1126 -0.0112 -0.0167 0.0077  77  ILE B N   
2314 C  CA  . ILE B 77  ? 0.1818 0.1616 0.1137 -0.0094 -0.0287 -0.0012 77  ILE B CA  
2315 C  C   . ILE B 77  ? 0.1950 0.1665 0.1041 -0.0118 -0.0064 0.0132  77  ILE B C   
2316 O  O   . ILE B 77  ? 0.1823 0.1879 0.1033 -0.0251 -0.0046 0.0018  77  ILE B O   
2317 C  CB  . ILE B 77  ? 0.1664 0.1490 0.1201 -0.0072 -0.0181 -0.0020 77  ILE B CB  
2318 C  CG1 . ILE B 77  ? 0.1730 0.1605 0.1565 0.0001  -0.0125 -0.0240 77  ILE B CG1 
2319 C  CG2 . ILE B 77  ? 0.1751 0.1556 0.1445 0.0088  -0.0126 -0.0168 77  ILE B CG2 
2320 C  CD1 . ILE B 77  ? 0.1726 0.1612 0.2273 -0.0029 -0.0310 0.0030  77  ILE B CD1 
2321 N  N   . PRO B 78  ? 0.1942 0.2193 0.1183 -0.0071 -0.0167 -0.0110 78  PRO B N   
2322 C  CA  . PRO B 78  ? 0.2493 0.2086 0.1091 0.0230  -0.0060 -0.0074 78  PRO B CA  
2323 C  C   . PRO B 78  ? 0.2249 0.2038 0.0981 0.0074  0.0047  0.0166  78  PRO B C   
2324 O  O   . PRO B 78  ? 0.2438 0.2062 0.1151 -0.0112 -0.0067 -0.0087 78  PRO B O   
2325 C  CB  . PRO B 78  ? 0.3103 0.3861 0.0954 0.0615  -0.0367 -0.0068 78  PRO B CB  
2326 C  CG  . PRO B 78  ? 0.2871 0.4857 0.1291 0.0686  -0.0317 0.0019  78  PRO B CG  
2327 C  CD  . PRO B 78  ? 0.2434 0.3221 0.1246 0.0204  -0.0399 0.0160  78  PRO B CD  
2328 N  N   . GLY B 79  ? 0.2208 0.2444 0.1004 0.0211  0.0256  -0.0126 79  GLY B N   
2329 C  CA  . GLY B 79  ? 0.1732 0.2183 0.1237 0.0014  0.0374  -0.0257 79  GLY B CA  
2330 C  C   . GLY B 79  ? 0.1449 0.1877 0.1224 -0.0248 0.0204  -0.0175 79  GLY B C   
2331 O  O   . GLY B 79  ? 0.1463 0.2428 0.1590 0.0060  0.0344  0.0004  79  GLY B O   
2332 N  N   . ALA B 80  ? 0.1563 0.1837 0.1172 -0.0184 0.0278  -0.0113 80  ALA B N   
2333 C  CA  . ALA B 80  ? 0.1313 0.1984 0.1259 -0.0043 0.0271  -0.0075 80  ALA B CA  
2334 C  C   . ALA B 80  ? 0.1256 0.1638 0.1255 0.0074  0.0312  -0.0154 80  ALA B C   
2335 O  O   . ALA B 80  ? 0.1710 0.1902 0.1114 -0.0112 0.0187  -0.0010 80  ALA B O   
2336 C  CB  . ALA B 80  ? 0.1350 0.1593 0.1235 -0.0003 0.0118  -0.0136 80  ALA B CB  
2337 N  N   . LEU B 81  ? 0.1270 0.1732 0.1236 0.0023  0.0208  -0.0058 81  LEU B N   
2338 C  CA  . LEU B 81  ? 0.1219 0.2176 0.1482 -0.0117 0.0202  -0.0135 81  LEU B CA  
2339 C  C   . LEU B 81  ? 0.1212 0.1920 0.1562 -0.0137 0.0234  0.0028  81  LEU B C   
2340 O  O   . LEU B 81  ? 0.1345 0.2388 0.1563 0.0074  0.0211  0.0023  81  LEU B O   
2341 C  CB  . LEU B 81  ? 0.1284 0.1973 0.1519 0.0034  -0.0048 -0.0298 81  LEU B CB  
2342 C  CG  . LEU B 81  ? 0.1221 0.2302 0.1898 0.0082  -0.0097 -0.0529 81  LEU B CG  
2343 C  CD1 . LEU B 81  ? 0.1936 0.1980 0.3211 0.0380  -0.0240 -0.0193 81  LEU B CD1 
2344 C  CD2 . LEU B 81  ? 0.2373 0.3111 0.2080 0.1221  0.0355  -0.0240 81  LEU B CD2 
2345 N  N   . ASP B 82  ? 0.1222 0.2219 0.1513 0.0002  0.0264  0.0069  82  ASP B N   
2346 C  CA  . ASP B 82  ? 0.1448 0.2089 0.1790 -0.0001 0.0254  -0.0220 82  ASP B CA  
2347 C  C   . ASP B 82  ? 0.1498 0.2211 0.1510 0.0026  0.0193  -0.0088 82  ASP B C   
2348 O  O   . ASP B 82  ? 0.1617 0.2571 0.1611 0.0206  0.0266  0.0004  82  ASP B O   
2349 C  CB  . ASP B 82  ? 0.2467 0.3225 0.1986 0.0570  0.1177  0.0352  82  ASP B CB  
2350 C  CG  . ASP B 82  ? 0.4746 0.2918 0.3300 0.1041  0.2541  0.0616  82  ASP B CG  
2351 O  OD1 . ASP B 82  ? 0.2642 0.4760 0.6611 -0.1013 0.1560  0.0752  82  ASP B OD1 
2352 O  OD2 . ASP B 82  ? 0.9514 0.5062 0.3229 0.1331  0.3735  0.1356  82  ASP B OD2 
2353 N  N   . ALA B 83  ? 0.1569 0.2076 0.1448 0.0015  0.0408  -0.0299 83  ALA B N   
2354 C  CA  . ALA B 83  ? 0.1554 0.2164 0.1599 0.0012  0.0324  -0.0149 83  ALA B CA  
2355 C  C   . ALA B 83  ? 0.1491 0.1759 0.1698 0.0127  0.0239  -0.0154 83  ALA B C   
2356 O  O   . ALA B 83  ? 0.1722 0.2058 0.1731 0.0450  0.0104  -0.0250 83  ALA B O   
2357 C  CB  . ALA B 83  ? 0.1844 0.1825 0.2399 -0.0033 -0.0174 -0.0369 83  ALA B CB  
2358 N  N   . VAL B 84  ? 0.1564 0.1890 0.1582 0.0301  0.0335  -0.0058 84  VAL B N   
2361 C  C   . VAL B 84  ? 0.2012 0.1862 0.1597 0.0120  0.0130  0.0247  84  VAL B C   
2362 O  O   . VAL B 84  ? 0.2276 0.1875 0.1489 0.0118  0.0024  0.0059  84  VAL B O   
2369 N  N   . ARG B 85  ? 0.1999 0.1937 0.1495 -0.0217 -0.0195 0.0087  85  ARG B N   
2372 C  C   . ARG B 85  ? 0.1635 0.2341 0.2014 -0.0388 0.0104  0.0292  85  ARG B C   
2373 O  O   . ARG B 85  ? 0.1824 0.3106 0.2440 0.0488  -0.0006 0.0276  85  ARG B O   
2380 N  NE  A ARG B 85  ? 0.6153 0.5498 0.4223 0.5276  0.3503  0.3214  85  ARG B NE  
2381 N  NE  B ARG B 85  ? 0.7332 0.6689 0.4705 0.5253  0.3176  0.2931  85  ARG B NE  
2382 C  CZ  A ARG B 85  ? 0.4702 0.1693 0.3235 0.1829  0.2015  0.0449  85  ARG B CZ  
2383 C  CZ  B ARG B 85  ? 0.3289 0.3262 0.4204 0.1718  0.1118  -0.0284 85  ARG B CZ  
2384 N  NH1 A ARG B 85  ? 0.4463 0.2118 0.1804 -0.2017 0.0797  -0.0349 85  ARG B NH1 
2385 N  NH1 B ARG B 85  ? 0.0849 0.2119 0.1633 -0.0220 0.0026  -0.0019 85  ARG B NH1 
2386 N  NH2 A ARG B 85  ? 0.2009 0.1003 0.2959 -0.0296 0.1177  -0.0283 85  ARG B NH2 
2387 N  NH2 B ARG B 85  ? 0.2632 0.2233 0.5998 -0.1305 0.3299  -0.1807 85  ARG B NH2 
2388 N  N   . GLU B 86  ? 0.1971 0.2497 0.2045 0.0127  0.0348  0.0050  86  GLU B N   
2389 C  CA  . GLU B 86  ? 0.1790 0.2743 0.2154 0.0447  0.0575  0.0143  86  GLU B CA  
2390 C  C   . GLU B 86  ? 0.1575 0.2736 0.2235 0.0641  0.0350  0.0323  86  GLU B C   
2391 O  O   . GLU B 86  ? 0.1538 0.2879 0.2848 0.0616  0.0113  0.0479  86  GLU B O   
2392 C  CB  . GLU B 86  ? 0.2486 0.2919 0.2127 0.0726  0.0627  -0.0145 86  GLU B CB  
2393 C  CG  . GLU B 86  ? 0.3960 0.3173 0.2130 -0.0093 0.0349  0.0032  86  GLU B CG  
2394 C  CD  . GLU B 86  ? 0.3314 0.5221 0.2545 -0.1797 0.0156  0.0953  86  GLU B CD  
2395 O  OE1 . GLU B 86  ? 0.4105 0.7218 0.2655 -0.2960 0.1849  -0.1587 86  GLU B OE1 
2396 O  OE2 . GLU B 86  ? 0.5908 0.8917 0.4981 -0.3470 -0.1691 0.4302  86  GLU B OE2 
2397 N  N   . MET B 87  ? 0.1535 0.2438 0.1655 0.0436  0.0243  0.0132  87  MET B N   
2398 C  CA  . MET B 87  ? 0.1790 0.2268 0.1305 0.0482  0.0147  -0.0015 87  MET B CA  
2399 C  C   . MET B 87  ? 0.1576 0.2329 0.1515 0.0815  -0.0026 -0.0218 87  MET B C   
2400 O  O   . MET B 87  ? 0.2047 0.2668 0.1662 0.0829  -0.0193 0.0042  87  MET B O   
2401 C  CB  . MET B 87  ? 0.1566 0.1942 0.1423 0.0113  -0.0054 0.0041  87  MET B CB  
2402 C  CG  . MET B 87  ? 0.2000 0.1784 0.1568 0.0635  0.0384  0.0241  87  MET B CG  
2403 S  SD  . MET B 87  ? 0.1662 0.2139 0.1385 0.0350  0.0136  0.0134  87  MET B SD  
2404 C  CE  . MET B 87  ? 0.2222 0.2149 0.1174 0.0148  0.0284  0.0062  87  MET B CE  
2405 N  N   . ASN B 88  ? 0.2288 0.2500 0.1704 0.0578  -0.0107 -0.0336 88  ASN B N   
2406 C  CA  . ASN B 88  ? 0.2236 0.2117 0.1853 0.0105  -0.0398 0.0105  88  ASN B CA  
2407 C  C   . ASN B 88  ? 0.2305 0.2631 0.2794 0.0274  -0.0483 0.0074  88  ASN B C   
2408 O  O   . ASN B 88  ? 0.2385 0.3842 0.2766 0.0874  -0.1056 -0.1003 88  ASN B O   
2409 C  CB  . ASN B 88  ? 0.2659 0.2234 0.2312 0.0102  -0.0319 -0.0227 88  ASN B CB  
2410 C  CG  . ASN B 88  ? 0.4579 0.2565 0.2491 0.0758  -0.0778 -0.0545 88  ASN B CG  
2411 O  OD1 . ASN B 88  ? 0.3995 0.6036 0.2180 0.2561  -0.0707 -0.0649 88  ASN B OD1 
2412 N  ND2 . ASN B 88  ? 0.4892 0.6290 0.2764 -0.0129 -0.1340 -0.1585 88  ASN B ND2 
2413 N  N   . ASP B 89  ? 0.2237 0.2954 0.3118 0.0348  -0.0259 -0.0141 89  ASP B N   
2414 C  CA  . ASP B 89  ? 0.2110 0.3424 0.4087 0.0270  -0.0323 -0.0113 89  ASP B CA  
2415 C  C   . ASP B 89  ? 0.1865 0.3464 0.2711 0.0626  -0.0231 0.0048  89  ASP B C   
2416 O  O   . ASP B 89  ? 0.1926 0.4250 0.4468 0.0916  -0.0396 -0.0007 89  ASP B O   
2417 C  CB  . ASP B 89  ? 0.2421 0.3575 0.5549 0.0218  0.0407  0.0318  89  ASP B CB  
2418 C  CG  . ASP B 89  ? 0.2643 0.3770 0.6924 -0.0505 -0.1075 0.0329  89  ASP B CG  
2419 O  OD1 . ASP B 89  ? 0.4263 0.4486 0.7485 -0.0872 -0.1904 -0.0266 89  ASP B OD1 
2420 O  OD2 . ASP B 89  ? 0.7091 0.3535 0.7934 0.0301  -0.1667 0.0641  89  ASP B OD2 
2421 N  N   . LEU B 90  ? 0.1918 0.3022 0.2057 0.0743  0.0054  -0.0139 90  LEU B N   
2422 C  CA  . LEU B 90  ? 0.1735 0.3060 0.1985 0.0920  0.0408  0.0118  90  LEU B CA  
2423 C  C   . LEU B 90  ? 0.1997 0.3293 0.2188 0.1008  -0.0020 0.0080  90  LEU B C   
2424 O  O   . LEU B 90  ? 0.2531 0.3264 0.1971 0.1249  -0.0392 0.0095  90  LEU B O   
2425 C  CB  . LEU B 90  ? 0.2024 0.2729 0.1979 0.0804  0.0137  0.0271  90  LEU B CB  
2426 C  CG  . LEU B 90  ? 0.2300 0.1798 0.1852 0.0473  0.0210  0.0056  90  LEU B CG  
2427 C  CD1 . LEU B 90  ? 0.2319 0.2622 0.2130 0.0236  0.0054  0.0291  90  LEU B CD1 
2428 C  CD2 . LEU B 90  ? 0.2816 0.2654 0.2326 0.0170  0.0757  -0.0397 90  LEU B CD2 
2429 N  N   . PRO B 91  ? 0.2193 0.3555 0.2611 0.1259  0.0220  0.0400  91  PRO B N   
2430 C  CA  . PRO B 91  ? 0.2034 0.4410 0.2760 0.1807  0.0447  0.0685  91  PRO B CA  
2431 C  C   . PRO B 91  ? 0.1860 0.2944 0.2310 0.1667  0.0022  0.0205  91  PRO B C   
2432 O  O   . PRO B 91  ? 0.2222 0.3388 0.2354 0.1748  -0.0119 -0.0434 91  PRO B O   
2433 C  CB  . PRO B 91  ? 0.4515 0.6195 0.3684 0.4120  0.2323  0.2020  91  PRO B CB  
2434 C  CG  . PRO B 91  ? 0.4621 0.5414 0.2926 0.3344  0.1351  0.1421  91  PRO B CG  
2435 C  CD  . PRO B 91  ? 0.2267 0.3653 0.2851 0.1407  0.0701  0.0579  91  PRO B CD  
2436 N  N   . ASP B 92  ? 0.1911 0.3318 0.2277 0.1197  -0.0069 0.0409  92  ASP B N   
2437 C  CA  . ASP B 92  ? 0.1854 0.2414 0.2405 0.0846  -0.0243 0.0149  92  ASP B CA  
2438 C  C   . ASP B 92  ? 0.1848 0.2066 0.1664 0.0894  -0.0450 -0.0482 92  ASP B C   
2439 O  O   . ASP B 92  ? 0.2004 0.2139 0.1762 0.0759  -0.0388 -0.0271 92  ASP B O   
2440 C  CB  . ASP B 92  ? 0.3014 0.2442 0.3750 0.1508  0.0015  0.0073  92  ASP B CB  
2441 C  CG  . ASP B 92  ? 0.4071 0.3814 0.3330 0.2610  -0.0761 -0.0095 92  ASP B CG  
2442 O  OD1 . ASP B 92  ? 0.4371 0.3934 0.4013 0.2478  -0.1225 -0.0190 92  ASP B OD1 
2443 O  OD2 . ASP B 92  ? 0.4105 0.4738 0.5936 0.3196  -0.1665 -0.1605 92  ASP B OD2 
2444 N  N   . THR B 93  ? 0.1822 0.2141 0.1836 0.0766  -0.0308 -0.0313 93  THR B N   
2445 C  CA  . THR B 93  ? 0.1914 0.1959 0.1595 0.0921  0.0086  -0.0233 93  THR B CA  
2446 C  C   . THR B 93  ? 0.1949 0.1867 0.1689 0.0468  0.0185  -0.0252 93  THR B C   
2447 O  O   . THR B 93  ? 0.2073 0.2553 0.2375 0.0103  0.0031  -0.0201 93  THR B O   
2448 C  CB  . THR B 93  ? 0.1658 0.1827 0.1554 0.0463  0.0069  -0.0100 93  THR B CB  
2449 O  OG1 . THR B 93  ? 0.2248 0.1925 0.1470 0.0736  0.0170  -0.0092 93  THR B OG1 
2450 C  CG2 . THR B 93  ? 0.1629 0.1805 0.1658 0.0423  0.0158  0.0120  93  THR B CG2 
2451 N  N   . GLN B 94  ? 0.2052 0.1519 0.1846 0.0499  0.0186  -0.0440 94  GLN B N   
2454 C  C   . GLN B 94  ? 0.1510 0.1637 0.1347 0.0315  -0.0100 -0.0209 94  GLN B C   
2455 O  O   . GLN B 94  ? 0.1573 0.1875 0.2080 0.0161  -0.0472 0.0149  94  GLN B O   
2460 C  CD  A GLN B 94  ? 0.3389 0.5927 0.4442 0.4737  0.1156  0.2053  94  GLN B CD  
2461 C  CD  B GLN B 94  ? 0.2174 0.2909 0.2208 0.1903  0.0787  0.0940  94  GLN B CD  
2462 O  OE1 A GLN B 94  ? 0.1938 0.6068 0.4204 0.2589  0.0895  0.0817  94  GLN B OE1 
2463 O  OE1 B GLN B 94  ? 0.1960 0.7898 0.3208 0.1850  0.0780  0.3352  94  GLN B OE1 
2464 N  NE2 A GLN B 94  ? 0.1719 0.6238 0.6659 0.2107  0.1391  -0.0151 94  GLN B NE2 
2465 N  NE2 B GLN B 94  ? 0.2276 0.3473 0.2143 0.1552  0.0568  0.0604  94  GLN B NE2 
2466 N  N   . VAL B 95  ? 0.1581 0.1564 0.1865 0.0455  -0.0129 -0.0260 95  VAL B N   
2467 C  CA  . VAL B 95  ? 0.1354 0.1588 0.1138 0.0142  -0.0013 -0.0134 95  VAL B CA  
2468 C  C   . VAL B 95  ? 0.1220 0.1304 0.1055 0.0177  -0.0033 0.0130  95  VAL B C   
2469 O  O   . VAL B 95  ? 0.1157 0.1527 0.1322 0.0274  -0.0111 -0.0148 95  VAL B O   
2470 C  CB  . VAL B 95  ? 0.1613 0.2127 0.1124 -0.0082 0.0121  -0.0226 95  VAL B CB  
2471 C  CG1 . VAL B 95  ? 0.1963 0.2226 0.0956 -0.0042 0.0119  0.0071  95  VAL B CG1 
2472 C  CG2 . VAL B 95  ? 0.2034 0.2765 0.1788 0.0136  0.0920  -0.0432 95  VAL B CG2 
2473 N  N   . PHE B 96  ? 0.1224 0.1181 0.1006 0.0084  -0.0076 -0.0031 96  PHE B N   
2474 C  CA  . PHE B 96  ? 0.1290 0.1245 0.0898 0.0126  -0.0002 0.0032  96  PHE B CA  
2475 C  C   . PHE B 96  ? 0.1147 0.1093 0.0957 0.0037  0.0042  0.0008  96  PHE B C   
2476 O  O   . PHE B 96  ? 0.1498 0.1071 0.1399 0.0075  -0.0347 -0.0080 96  PHE B O   
2477 C  CB  . PHE B 96  ? 0.1064 0.1139 0.1091 0.0078  0.0037  0.0100  96  PHE B CB  
2478 C  CG  . PHE B 96  ? 0.1209 0.1309 0.1037 0.0035  0.0069  0.0240  96  PHE B CG  
2479 C  CD1 . PHE B 96  ? 0.2206 0.1455 0.1426 0.0320  -0.0443 0.0213  96  PHE B CD1 
2480 C  CD2 . PHE B 96  ? 0.1271 0.1522 0.1094 0.0136  -0.0009 0.0082  96  PHE B CD2 
2481 C  CE1 . PHE B 96  ? 0.2290 0.1647 0.1500 0.0333  -0.0500 0.0388  96  PHE B CE1 
2482 C  CE2 . PHE B 96  ? 0.1473 0.1778 0.1191 -0.0022 -0.0123 0.0182  96  PHE B CE2 
2483 C  CZ  . PHE B 96  ? 0.1660 0.1975 0.1327 0.0136  -0.0279 0.0391  96  PHE B CZ  
2484 N  N   . ILE B 97  ? 0.1035 0.1032 0.0945 -0.0017 0.0001  0.0029  97  ILE B N   
2485 C  CA  . ILE B 97  ? 0.1069 0.1150 0.0833 -0.0011 -0.0051 0.0007  97  ILE B CA  
2486 C  C   . ILE B 97  ? 0.1080 0.1169 0.0820 0.0029  -0.0100 0.0073  97  ILE B C   
2487 O  O   . ILE B 97  ? 0.1183 0.1654 0.1038 -0.0128 0.0107  -0.0233 97  ILE B O   
2488 C  CB  . ILE B 97  ? 0.1105 0.1023 0.0968 -0.0087 -0.0094 -0.0009 97  ILE B CB  
2489 C  CG1 . ILE B 97  ? 0.1362 0.1302 0.0996 -0.0021 0.0110  0.0088  97  ILE B CG1 
2490 C  CG2 . ILE B 97  ? 0.1352 0.1323 0.1307 0.0063  -0.0158 0.0201  97  ILE B CG2 
2491 C  CD1 . ILE B 97  ? 0.1360 0.1873 0.1811 -0.0272 0.0027  0.0620  97  ILE B CD1 
2492 N  N   . CYS B 98  ? 0.1053 0.1101 0.0985 0.0058  0.0075  0.0011  98  CYS B N   
2493 C  CA  . CYS B 98  ? 0.1105 0.1212 0.0820 0.0030  0.0105  -0.0160 98  CYS B CA  
2494 C  C   . CYS B 98  ? 0.1118 0.1338 0.1066 0.0100  0.0162  -0.0044 98  CYS B C   
2495 O  O   . CYS B 98  ? 0.1108 0.1384 0.1099 0.0251  -0.0040 -0.0055 98  CYS B O   
2496 C  CB  . CYS B 98  ? 0.1801 0.1357 0.0834 -0.0057 0.0214  0.0142  98  CYS B CB  
2497 S  SG  . CYS B 98  ? 0.1332 0.1632 0.1305 -0.0099 0.0220  0.0205  98  CYS B SG  
2498 N  N   . THR B 99  ? 0.1113 0.1315 0.0866 0.0085  -0.0066 0.0046  99  THR B N   
2499 C  CA  . THR B 99  ? 0.1036 0.1221 0.0812 -0.0058 -0.0158 0.0041  99  THR B CA  
2500 C  C   . THR B 99  ? 0.1180 0.1055 0.0947 -0.0039 -0.0003 0.0046  99  THR B C   
2501 O  O   . THR B 99  ? 0.1298 0.1216 0.0849 -0.0023 -0.0115 0.0070  99  THR B O   
2502 C  CB  . THR B 99  ? 0.1272 0.1459 0.0985 -0.0025 0.0082  0.0243  99  THR B CB  
2503 O  OG1 . THR B 99  ? 0.1351 0.1390 0.1068 -0.0011 0.0066  0.0186  99  THR B OG1 
2504 C  CG2 . THR B 99  ? 0.1432 0.1489 0.1214 -0.0357 -0.0021 0.0315  99  THR B CG2 
2505 N  N   . SER B 100 ? 0.1263 0.1184 0.0973 0.0089  -0.0084 -0.0024 100 SER B N   
2506 C  CA  . SER B 100 ? 0.1298 0.1370 0.1245 0.0276  -0.0121 -0.0112 100 SER B CA  
2507 C  C   . SER B 100 ? 0.1793 0.1469 0.1075 0.0478  0.0004  0.0011  100 SER B C   
2508 O  O   . SER B 100 ? 0.3558 0.1899 0.1154 0.1187  -0.0353 -0.0001 100 SER B O   
2509 C  CB  . SER B 100 ? 0.1142 0.1715 0.1053 0.0270  -0.0057 0.0092  100 SER B CB  
2510 O  OG  . SER B 100 ? 0.1150 0.1627 0.1356 0.0049  0.0044  -0.0071 100 SER B OG  
2511 N  N   . PRO B 101 ? 0.1234 0.1261 0.1157 0.0207  -0.0110 0.0085  101 PRO B N   
2512 C  CA  . PRO B 101 ? 0.1259 0.1253 0.1360 0.0240  -0.0036 -0.0023 101 PRO B CA  
2513 C  C   . PRO B 101 ? 0.1241 0.1165 0.1626 0.0339  0.0083  0.0091  101 PRO B C   
2514 O  O   . PRO B 101 ? 0.1390 0.1437 0.1782 0.0094  -0.0158 0.0233  101 PRO B O   
2515 C  CB  . PRO B 101 ? 0.2060 0.1336 0.1502 0.0398  -0.0346 -0.0100 101 PRO B CB  
2516 C  CG  . PRO B 101 ? 0.4154 0.1361 0.1330 0.0181  -0.0162 -0.0155 101 PRO B CG  
2517 C  CD  . PRO B 101 ? 0.1962 0.1234 0.1132 -0.0123 -0.0234 -0.0002 101 PRO B CD  
2518 N  N   . LEU B 102 ? 0.1357 0.1363 0.1178 0.0229  0.0020  0.0132  102 LEU B N   
2519 C  CA  . LEU B 102 ? 0.1245 0.1371 0.1304 0.0225  -0.0134 -0.0015 102 LEU B CA  
2520 C  C   . LEU B 102 ? 0.1301 0.1729 0.1283 0.0405  -0.0090 0.0250  102 LEU B C   
2521 O  O   . LEU B 102 ? 0.1892 0.1673 0.1100 0.0101  -0.0052 0.0153  102 LEU B O   
2522 C  CB  . LEU B 102 ? 0.1555 0.1849 0.1267 0.0361  -0.0135 0.0352  102 LEU B CB  
2523 C  CG  . LEU B 102 ? 0.1344 0.2152 0.1303 0.0453  0.0018  0.0136  102 LEU B CG  
2524 C  CD1 . LEU B 102 ? 0.1305 0.2888 0.1946 0.0519  0.0194  0.1158  102 LEU B CD1 
2525 C  CD2 . LEU B 102 ? 0.1980 0.3384 0.1516 -0.0056 -0.0418 -0.0107 102 LEU B CD2 
2526 N  N   . LEU B 103 ? 0.1457 0.2026 0.1701 0.0165  0.0270  0.0109  103 LEU B N   
2527 C  CA  . LEU B 103 ? 0.1409 0.2107 0.1725 0.0277  0.0198  0.0089  103 LEU B CA  
2528 C  C   . LEU B 103 ? 0.1398 0.2122 0.1397 0.0432  -0.0012 0.0188  103 LEU B C   
2529 O  O   . LEU B 103 ? 0.2043 0.2117 0.1388 0.0222  0.0366  0.0081  103 LEU B O   
2530 C  CB  . LEU B 103 ? 0.1464 0.2377 0.3049 0.0240  0.0679  0.0527  103 LEU B CB  
2531 C  CG  . LEU B 103 ? 0.1852 0.2493 0.2128 -0.0107 -0.0459 0.0295  103 LEU B CG  
2532 C  CD1 . LEU B 103 ? 0.1864 0.4140 0.3393 -0.0726 0.0156  0.0452  103 LEU B CD1 
2533 C  CD2 . LEU B 103 ? 0.4441 0.2230 0.1977 -0.0133 -0.1232 0.0003  103 LEU B CD2 
2534 N  N   . LYS B 104 ? 0.1786 0.2251 0.1638 0.0331  -0.0129 0.0392  104 LYS B N   
2535 C  CA  . LYS B 104 ? 0.2239 0.2125 0.1604 0.0356  -0.0189 0.0318  104 LYS B CA  
2536 C  C   . LYS B 104 ? 0.2217 0.1620 0.1538 0.0256  0.0158  0.0211  104 LYS B C   
2537 O  O   . LYS B 104 ? 0.2958 0.1815 0.1589 -0.0094 0.0379  0.0062  104 LYS B O   
2538 C  CB  . LYS B 104 ? 0.2933 0.2900 0.2817 0.0987  -0.0260 0.1133  104 LYS B CB  
2539 C  CG  . LYS B 104 ? 0.2665 0.5333 0.5109 0.1040  -0.0698 0.1931  104 LYS B CG  
2540 C  CD  . LYS B 104 ? 0.4312 0.5310 0.6879 0.2996  0.0530  0.1542  104 LYS B CD  
2541 C  CE  . LYS B 104 ? 0.4295 0.7252 0.7413 0.3880  0.1666  0.1637  104 LYS B CE  
2542 N  NZ  . LYS B 104 ? 0.4643 0.4483 0.6148 -0.0232 0.0974  -0.2640 104 LYS B NZ  
2543 N  N   . TYR B 105 ? 0.1760 0.1771 0.1633 0.0292  0.0325  0.0214  105 TYR B N   
2544 C  CA  . TYR B 105 ? 0.1813 0.1623 0.1735 0.0305  0.0431  0.0405  105 TYR B CA  
2545 C  C   . TYR B 105 ? 0.1669 0.1441 0.1127 0.0251  0.0061  0.0062  105 TYR B C   
2546 O  O   . TYR B 105 ? 0.1638 0.1738 0.1508 0.0251  0.0113  0.0253  105 TYR B O   
2547 C  CB  . TYR B 105 ? 0.2081 0.1741 0.1835 0.0506  0.0419  0.0507  105 TYR B CB  
2548 C  CG  . TYR B 105 ? 0.2007 0.1694 0.1655 0.0277  0.0296  0.0568  105 TYR B CG  
2549 C  CD1 . TYR B 105 ? 0.1788 0.2416 0.1372 0.0170  -0.0004 0.0560  105 TYR B CD1 
2550 C  CD2 . TYR B 105 ? 0.2096 0.1743 0.1148 0.0050  0.0113  0.0298  105 TYR B CD2 
2551 C  CE1 . TYR B 105 ? 0.2176 0.2407 0.1569 -0.0004 0.0115  0.0385  105 TYR B CE1 
2552 C  CE2 . TYR B 105 ? 0.2267 0.1831 0.1076 -0.0045 0.0064  0.0195  105 TYR B CE2 
2553 C  CZ  . TYR B 105 ? 0.1958 0.1975 0.1296 0.0047  -0.0099 0.0176  105 TYR B CZ  
2554 O  OH  . TYR B 105 ? 0.2401 0.2800 0.1457 -0.0327 -0.0190 -0.0390 105 TYR B OH  
2555 N  N   . HIS B 106 ? 0.1753 0.1695 0.1297 0.0445  0.0209  0.0289  106 HIS B N   
2558 C  C   . HIS B 106 ? 0.2364 0.1832 0.1568 -0.0233 -0.0028 0.0254  106 HIS B C   
2559 O  O   . HIS B 106 ? 0.2241 0.2558 0.1629 0.0072  0.0056  0.0002  106 HIS B O   
2562 C  CG  A HIS B 106 ? 0.1759 0.0986 0.1569 0.0175  0.0887  0.0160  106 HIS B CG  
2563 C  CG  B HIS B 106 ? 0.5659 0.6177 0.4394 0.4302  0.2417  0.3361  106 HIS B CG  
2564 N  ND1 A HIS B 106 ? 0.2229 0.1506 0.1425 -0.0034 0.0149  -0.0722 106 HIS B ND1 
2565 N  ND1 B HIS B 106 ? 0.6046 0.5793 0.5599 0.4618  0.3632  0.3270  106 HIS B ND1 
2566 C  CD2 A HIS B 106 ? 0.2835 0.0641 0.1899 0.0077  0.0085  0.0373  106 HIS B CD2 
2567 C  CD2 B HIS B 106 ? 0.6986 0.6421 0.5579 0.4449  0.3019  0.2694  106 HIS B CD2 
2568 C  CE1 A HIS B 106 ? 0.2823 0.1502 0.1988 -0.0161 0.0275  -0.0682 106 HIS B CE1 
2569 C  CE1 B HIS B 106 ? 0.7306 0.6589 0.5415 0.4641  0.3924  0.3479  106 HIS B CE1 
2570 N  NE2 A HIS B 106 ? 0.3067 0.1114 0.2720 -0.0250 0.0085  0.0160  106 HIS B NE2 
2571 N  NE2 B HIS B 106 ? 0.7601 0.6705 0.5566 0.5134  0.3628  0.2915  106 HIS B NE2 
2572 N  N   . HIS B 107 ? 0.1971 0.1402 0.1549 0.0084  0.0166  0.0210  107 HIS B N   
2573 C  CA  . HIS B 107 ? 0.1973 0.1413 0.1664 -0.0293 0.0131  0.0125  107 HIS B CA  
2574 C  C   . HIS B 107 ? 0.2434 0.1571 0.1700 0.0027  0.0426  0.0203  107 HIS B C   
2575 O  O   . HIS B 107 ? 0.1881 0.1806 0.1489 0.0083  0.0018  0.0343  107 HIS B O   
2576 C  CB  . HIS B 107 ? 0.3012 0.1427 0.1827 -0.0142 0.0322  0.0433  107 HIS B CB  
2577 C  CG  . HIS B 107 ? 0.3325 0.1515 0.2594 0.0018  -0.0417 0.0182  107 HIS B CG  
2578 N  ND1 . HIS B 107 ? 0.4032 0.1580 0.2657 -0.0048 -0.1040 0.0226  107 HIS B ND1 
2579 C  CD2 . HIS B 107 ? 0.3645 0.2000 0.3272 0.0488  -0.0389 -0.0207 107 HIS B CD2 
2580 C  CE1 . HIS B 107 ? 0.4759 0.1720 0.2387 -0.0086 -0.0325 0.0113  107 HIS B CE1 
2581 N  NE2 . HIS B 107 ? 0.4635 0.2155 0.3108 0.0531  -0.0418 -0.0372 107 HIS B NE2 
2582 N  N   . CYS B 108 ? 0.1616 0.1387 0.1341 0.0016  0.0022  0.0047  108 CYS B N   
2583 C  CA  . CYS B 108 ? 0.1563 0.1529 0.1057 0.0098  -0.0158 0.0056  108 CYS B CA  
2584 C  C   . CYS B 108 ? 0.1494 0.1311 0.1085 0.0035  0.0055  0.0050  108 CYS B C   
2585 O  O   . CYS B 108 ? 0.1416 0.1634 0.1175 0.0027  0.0005  0.0001  108 CYS B O   
2586 C  CB  . CYS B 108 ? 0.1722 0.1369 0.1498 -0.0040 -0.0311 0.0103  108 CYS B CB  
2587 S  SG  . CYS B 108 ? 0.1499 0.1494 0.1700 0.0165  -0.0094 0.0054  108 CYS B SG  
2588 N  N   . VAL B 109 ? 0.1395 0.1280 0.1115 0.0275  -0.0084 0.0111  109 VAL B N   
2591 C  C   . VAL B 109 ? 0.1338 0.1274 0.1203 0.0043  -0.0075 0.0144  109 VAL B C   
2592 O  O   . VAL B 109 ? 0.1216 0.1287 0.1300 0.0039  -0.0305 -0.0092 109 VAL B O   
2599 N  N   . GLY B 110 ? 0.1551 0.1251 0.1179 0.0050  0.0045  0.0054  110 GLY B N   
2600 C  CA  . GLY B 110 ? 0.1624 0.1347 0.1190 -0.0062 -0.0003 0.0073  110 GLY B CA  
2601 C  C   . GLY B 110 ? 0.1318 0.1142 0.1187 -0.0152 -0.0127 -0.0034 110 GLY B C   
2602 O  O   . GLY B 110 ? 0.1364 0.1624 0.1232 -0.0341 -0.0109 0.0057  110 GLY B O   
2603 N  N   . GLU B 111 ? 0.1376 0.1142 0.1197 -0.0084 -0.0080 0.0085  111 GLU B N   
2604 C  CA  . GLU B 111 ? 0.1272 0.1197 0.1186 -0.0126 -0.0031 0.0235  111 GLU B CA  
2605 C  C   . GLU B 111 ? 0.1275 0.1246 0.0974 -0.0106 -0.0109 0.0198  111 GLU B C   
2606 O  O   . GLU B 111 ? 0.1283 0.1459 0.0986 -0.0174 0.0013  0.0227  111 GLU B O   
2607 C  CB  . GLU B 111 ? 0.1435 0.1158 0.1144 -0.0082 -0.0100 0.0038  111 GLU B CB  
2608 C  CG  . GLU B 111 ? 0.1639 0.1197 0.1346 0.0044  -0.0209 -0.0028 111 GLU B CG  
2609 C  CD  . GLU B 111 ? 0.1508 0.1337 0.1241 0.0081  0.0079  0.0205  111 GLU B CD  
2610 O  OE1 . GLU B 111 ? 0.1576 0.1410 0.1545 -0.0126 -0.0297 0.0122  111 GLU B OE1 
2611 O  OE2 . GLU B 111 ? 0.2174 0.1351 0.1715 0.0282  -0.0274 0.0206  111 GLU B OE2 
2612 N  N   . LYS B 112 ? 0.1150 0.1191 0.0980 -0.0147 0.0100  0.0092  112 LYS B N   
2613 C  CA  . LYS B 112 ? 0.1338 0.1174 0.0920 -0.0163 -0.0043 0.0049  112 LYS B CA  
2614 C  C   . LYS B 112 ? 0.1246 0.1299 0.0861 -0.0094 0.0122  0.0157  112 LYS B C   
2615 O  O   . LYS B 112 ? 0.1318 0.1249 0.0914 -0.0162 0.0179  0.0068  112 LYS B O   
2616 C  CB  . LYS B 112 ? 0.1263 0.1193 0.0917 -0.0222 0.0035  0.0036  112 LYS B CB  
2617 C  CG  . LYS B 112 ? 0.1484 0.1701 0.0811 -0.0372 -0.0148 0.0264  112 LYS B CG  
2618 C  CD  . LYS B 112 ? 0.1134 0.1583 0.1310 -0.0220 0.0017  0.0213  112 LYS B CD  
2619 C  CE  . LYS B 112 ? 0.1251 0.1640 0.1386 -0.0158 -0.0026 0.0028  112 LYS B CE  
2620 N  NZ  . LYS B 112 ? 0.1411 0.1322 0.1343 -0.0061 -0.0008 0.0216  112 LYS B NZ  
2621 N  N   . TYR B 113 ? 0.1170 0.1186 0.0933 -0.0185 0.0027  0.0090  113 TYR B N   
2622 C  CA  . TYR B 113 ? 0.1217 0.1369 0.0885 -0.0249 0.0060  0.0226  113 TYR B CA  
2623 C  C   . TYR B 113 ? 0.1181 0.1387 0.0790 -0.0180 -0.0039 0.0231  113 TYR B C   
2624 O  O   . TYR B 113 ? 0.1198 0.1372 0.0979 -0.0168 0.0064  0.0184  113 TYR B O   
2625 C  CB  . TYR B 113 ? 0.1193 0.1338 0.0804 -0.0136 0.0007  0.0147  113 TYR B CB  
2626 C  CG  . TYR B 113 ? 0.1283 0.1122 0.0968 0.0068  0.0104  0.0195  113 TYR B CG  
2627 C  CD1 . TYR B 113 ? 0.1357 0.1537 0.0942 -0.0066 0.0041  0.0357  113 TYR B CD1 
2628 C  CD2 . TYR B 113 ? 0.1337 0.1222 0.0929 0.0064  0.0049  0.0107  113 TYR B CD2 
2629 C  CE1 . TYR B 113 ? 0.1410 0.1463 0.1209 -0.0079 0.0152  0.0422  113 TYR B CE1 
2630 C  CE2 . TYR B 113 ? 0.1506 0.1277 0.0841 0.0128  0.0114  0.0156  113 TYR B CE2 
2631 C  CZ  . TYR B 113 ? 0.1599 0.1108 0.0988 -0.0118 -0.0009 0.0191  113 TYR B CZ  
2632 O  OH  . TYR B 113 ? 0.1553 0.1763 0.1376 0.0002  0.0135  0.0650  113 TYR B OH  
2633 N  N   . ARG B 114 ? 0.1213 0.1249 0.0881 -0.0197 -0.0011 0.0173  114 ARG B N   
2634 C  CA  . ARG B 114 ? 0.1387 0.1397 0.0923 -0.0261 -0.0044 0.0296  114 ARG B CA  
2635 C  C   . ARG B 114 ? 0.1369 0.1268 0.1009 -0.0364 0.0064  0.0286  114 ARG B C   
2636 O  O   . ARG B 114 ? 0.1326 0.1448 0.1106 -0.0294 0.0140  0.0322  114 ARG B O   
2637 C  CB  . ARG B 114 ? 0.1936 0.1222 0.1273 -0.0326 -0.0170 0.0157  114 ARG B CB  
2638 C  CG  . ARG B 114 ? 0.1987 0.2024 0.2910 -0.0156 0.0054  0.1327  114 ARG B CG  
2639 C  CD  . ARG B 114 ? 0.2112 0.3553 0.4812 -0.0816 -0.0305 0.1907  114 ARG B CD  
2640 N  NE  . ARG B 114 ? 0.2893 0.4457 0.6184 -0.1676 -0.0137 0.2668  114 ARG B NE  
2641 C  CZ  . ARG B 114 ? 0.4000 0.5030 0.5714 -0.2582 -0.2054 0.3011  114 ARG B CZ  
2642 N  NH1 . ARG B 114 ? 0.3864 0.4283 0.6923 -0.1964 0.1160  0.1718  114 ARG B NH1 
2643 N  NH2 . ARG B 114 ? 0.5460 0.9526 0.7840 -0.2730 -0.3673 0.6146  114 ARG B NH2 
2644 N  N   . TRP B 115 ? 0.1114 0.1253 0.1020 -0.0179 0.0009  0.0307  115 TRP B N   
2645 C  CA  . TRP B 115 ? 0.1030 0.1611 0.0907 -0.0083 -0.0091 0.0309  115 TRP B CA  
2646 C  C   . TRP B 115 ? 0.1100 0.1313 0.0827 -0.0272 0.0047  0.0210  115 TRP B C   
2647 O  O   . TRP B 115 ? 0.1112 0.1339 0.1063 -0.0211 0.0078  0.0305  115 TRP B O   
2648 C  CB  . TRP B 115 ? 0.1206 0.1504 0.1007 -0.0029 -0.0084 0.0100  115 TRP B CB  
2649 C  CG  . TRP B 115 ? 0.0927 0.1455 0.0919 -0.0094 0.0086  0.0145  115 TRP B CG  
2650 C  CD1 . TRP B 115 ? 0.1340 0.1566 0.0986 -0.0114 0.0017  0.0197  115 TRP B CD1 
2651 C  CD2 . TRP B 115 ? 0.0957 0.1519 0.0867 -0.0124 0.0040  0.0175  115 TRP B CD2 
2652 N  NE1 . TRP B 115 ? 0.1260 0.1601 0.0906 -0.0012 0.0060  0.0216  115 TRP B NE1 
2653 C  CE2 . TRP B 115 ? 0.1116 0.1675 0.0842 -0.0041 0.0118  0.0156  115 TRP B CE2 
2654 C  CE3 . TRP B 115 ? 0.1206 0.1380 0.1045 -0.0106 0.0010  0.0124  115 TRP B CE3 
2655 C  CZ2 . TRP B 115 ? 0.1262 0.1796 0.1092 0.0038  0.0086  -0.0094 115 TRP B CZ2 
2656 C  CZ3 . TRP B 115 ? 0.1443 0.1433 0.1241 -0.0239 -0.0159 -0.0072 115 TRP B CZ3 
2657 C  CH2 . TRP B 115 ? 0.1303 0.1578 0.1226 -0.0357 -0.0124 -0.0043 115 TRP B CH2 
2658 N  N   . VAL B 116 ? 0.1157 0.1214 0.0790 -0.0081 0.0069  0.0091  116 VAL B N   
2659 C  CA  . VAL B 116 ? 0.1043 0.1484 0.0909 -0.0137 0.0131  0.0291  116 VAL B CA  
2660 C  C   . VAL B 116 ? 0.1066 0.1511 0.1149 -0.0189 0.0017  0.0331  116 VAL B C   
2661 O  O   . VAL B 116 ? 0.1168 0.1558 0.1180 -0.0257 0.0199  0.0304  116 VAL B O   
2662 C  CB  . VAL B 116 ? 0.0981 0.1345 0.1068 -0.0105 0.0180  0.0284  116 VAL B CB  
2663 C  CG1 . VAL B 116 ? 0.1017 0.1508 0.1117 -0.0104 0.0104  0.0281  116 VAL B CG1 
2664 C  CG2 . VAL B 116 ? 0.1104 0.1320 0.0904 -0.0188 0.0038  0.0079  116 VAL B CG2 
2665 N  N   . GLU B 117 ? 0.0890 0.1731 0.0964 -0.0149 0.0049  0.0233  117 GLU B N   
2666 C  CA  . GLU B 117 ? 0.1036 0.1688 0.1145 -0.0186 0.0034  0.0291  117 GLU B CA  
2667 C  C   . GLU B 117 ? 0.1070 0.1800 0.1307 -0.0299 0.0149  0.0393  117 GLU B C   
2668 O  O   . GLU B 117 ? 0.1206 0.2167 0.1460 -0.0235 0.0262  0.0413  117 GLU B O   
2669 C  CB  . GLU B 117 ? 0.1340 0.1721 0.1410 -0.0298 0.0028  0.0132  117 GLU B CB  
2670 C  CG  . GLU B 117 ? 0.1875 0.2339 0.1810 -0.1021 -0.0283 0.0466  117 GLU B CG  
2671 C  CD  . GLU B 117 ? 0.2444 0.2776 0.2384 -0.1416 -0.0191 -0.0032 117 GLU B CD  
2672 O  OE1 . GLU B 117 ? 0.3195 0.3473 0.2488 -0.1161 0.0810  -0.0567 117 GLU B OE1 
2673 O  OE2 . GLU B 117 ? 0.3077 0.4055 0.4370 -0.2229 -0.0632 -0.0519 117 GLU B OE2 
2674 N  N   . GLN B 118 ? 0.1362 0.1684 0.1148 -0.0295 0.0170  0.0316  118 GLN B N   
2675 C  CA  . GLN B 118 ? 0.1631 0.1736 0.1122 -0.0575 0.0105  0.0277  118 GLN B CA  
2676 C  C   . GLN B 118 ? 0.1232 0.1916 0.1053 -0.0525 0.0095  0.0298  118 GLN B C   
2677 O  O   . GLN B 118 ? 0.1453 0.1994 0.1387 -0.0448 0.0368  0.0294  118 GLN B O   
2678 C  CB  . GLN B 118 ? 0.2122 0.2042 0.1039 -0.0256 0.0248  0.0476  118 GLN B CB  
2679 C  CG  . GLN B 118 ? 0.2053 0.1825 0.1812 -0.0314 0.0377  0.0329  118 GLN B CG  
2680 C  CD  . GLN B 118 ? 0.3265 0.1949 0.3415 -0.0227 -0.0829 0.0513  118 GLN B CD  
2681 O  OE1 . GLN B 118 ? 0.2470 0.2921 0.5824 -0.0360 -0.0792 0.1454  118 GLN B OE1 
2682 N  NE2 . GLN B 118 ? 0.4534 0.1952 0.5657 -0.0533 -0.1765 0.0888  118 GLN B NE2 
2683 N  N   . HIS B 119 ? 0.1394 0.1878 0.1023 -0.0497 0.0086  0.0217  119 HIS B N   
2684 C  CA  . HIS B 119 ? 0.1118 0.1760 0.1072 -0.0338 0.0167  0.0239  119 HIS B CA  
2685 C  C   . HIS B 119 ? 0.1163 0.2165 0.1071 -0.0112 0.0303  0.0374  119 HIS B C   
2686 O  O   . HIS B 119 ? 0.1247 0.2210 0.1103 -0.0035 0.0268  0.0267  119 HIS B O   
2687 C  CB  . HIS B 119 ? 0.1097 0.1709 0.1148 -0.0269 0.0134  0.0202  119 HIS B CB  
2688 C  CG  . HIS B 119 ? 0.1212 0.1520 0.1131 -0.0386 0.0074  0.0273  119 HIS B CG  
2689 N  ND1 . HIS B 119 ? 0.1541 0.2224 0.1222 -0.0233 -0.0241 0.0378  119 HIS B ND1 
2690 C  CD2 . HIS B 119 ? 0.1112 0.1742 0.1697 -0.0191 0.0266  0.0442  119 HIS B CD2 
2691 C  CE1 . HIS B 119 ? 0.1627 0.2353 0.1792 -0.0143 -0.0440 0.0738  119 HIS B CE1 
2692 N  NE2 . HIS B 119 ? 0.1631 0.2011 0.2272 -0.0041 -0.0088 0.0712  119 HIS B NE2 
2693 N  N   . LEU B 120 ? 0.1449 0.1687 0.1042 -0.0202 0.0168  0.0198  120 LEU B N   
2694 C  CA  . LEU B 120 ? 0.1505 0.1736 0.1423 -0.0043 0.0317  0.0332  120 LEU B CA  
2695 C  C   . LEU B 120 ? 0.1379 0.1855 0.1487 -0.0115 0.0333  0.0440  120 LEU B C   
2696 O  O   . LEU B 120 ? 0.1420 0.1886 0.2156 -0.0026 0.0065  -0.0028 120 LEU B O   
2697 C  CB  . LEU B 120 ? 0.1483 0.1575 0.1129 -0.0030 0.0303  0.0112  120 LEU B CB  
2698 C  CG  . LEU B 120 ? 0.1513 0.1878 0.1236 -0.0055 0.0216  0.0048  120 LEU B CG  
2699 C  CD1 . LEU B 120 ? 0.2005 0.2164 0.1787 -0.0644 0.0446  -0.0109 120 LEU B CD1 
2700 C  CD2 . LEU B 120 ? 0.1857 0.2036 0.1549 0.0028  0.0148  -0.0296 120 LEU B CD2 
2701 N  N   . GLY B 121 ? 0.1224 0.2046 0.1506 0.0135  0.0132  0.0289  121 GLY B N   
2702 C  CA  . GLY B 121 ? 0.1454 0.2278 0.1654 -0.0276 0.0017  0.0433  121 GLY B CA  
2703 C  C   . GLY B 121 ? 0.1422 0.2516 0.1621 -0.0130 0.0078  0.0022  121 GLY B C   
2704 O  O   . GLY B 121 ? 0.1239 0.2493 0.1322 -0.0022 0.0037  0.0134  121 GLY B O   
2705 N  N   . PRO B 122 ? 0.1592 0.3458 0.1844 -0.0556 0.0434  -0.0768 122 PRO B N   
2706 C  CA  . PRO B 122 ? 0.1858 0.4776 0.1804 -0.0656 0.0015  -0.0320 122 PRO B CA  
2707 C  C   . PRO B 122 ? 0.0736 0.5210 0.2258 -0.0183 -0.0072 0.0319  122 PRO B C   
2708 O  O   . PRO B 122 ? 0.1319 0.4613 0.2000 -0.0431 0.0085  -0.0263 122 PRO B O   
2709 C  CB  . PRO B 122 ? 0.2737 0.5737 0.2209 -0.1265 -0.0401 -0.0641 122 PRO B CB  
2710 C  CG  . PRO B 122 ? 0.3190 0.4409 0.3029 -0.1420 -0.0502 -0.0808 122 PRO B CG  
2711 C  CD  . PRO B 122 ? 0.1621 0.4403 0.2326 -0.0949 0.0135  -0.0417 122 PRO B CD  
2712 N  N   . GLN B 123 ? 0.0867 0.5583 0.1760 0.0350  -0.0072 0.0752  123 GLN B N   
2713 C  CA  . GLN B 123 ? 0.1382 0.6144 0.2222 0.1096  0.0146  0.1528  123 GLN B CA  
2714 C  C   . GLN B 123 ? 0.1594 0.4459 0.1806 0.1239  0.0568  0.1327  123 GLN B C   
2715 O  O   . GLN B 123 ? 0.2566 0.5095 0.2692 0.1127  0.0469  0.2343  123 GLN B O   
2716 C  CB  . GLN B 123 ? 0.1657 0.6808 0.3977 0.1694  0.0665  0.1790  123 GLN B CB  
2717 C  CG  . GLN B 123 ? 0.5702 0.9716 0.4021 0.3974  0.2240  0.1430  123 GLN B CG  
2718 C  CD  . GLN B 123 ? 0.7564 1.1280 0.4125 0.4016  0.3276  0.2362  123 GLN B CD  
2719 O  OE1 . GLN B 123 ? 0.9611 1.1014 0.5793 0.6050  0.5329  0.4987  123 GLN B OE1 
2720 N  NE2 . GLN B 123 ? 0.8630 1.3428 0.3440 0.2976  0.3030  0.1091  123 GLN B NE2 
2721 N  N   . PHE B 124 ? 0.1787 0.3031 0.1274 0.0654  0.0547  0.0490  124 PHE B N   
2722 C  CA  . PHE B 124 ? 0.2107 0.1913 0.1413 0.0567  0.0662  0.0443  124 PHE B CA  
2723 C  C   . PHE B 124 ? 0.1532 0.1488 0.1460 0.0221  0.0363  0.0301  124 PHE B C   
2724 O  O   . PHE B 124 ? 0.1704 0.1596 0.1230 -0.0082 0.0238  0.0200  124 PHE B O   
2725 C  CB  . PHE B 124 ? 0.1895 0.1917 0.1485 0.0615  0.0453  0.0415  124 PHE B CB  
2726 C  CG  . PHE B 124 ? 0.2282 0.1933 0.1536 0.0501  0.0396  0.0352  124 PHE B CG  
2727 C  CD1 . PHE B 124 ? 0.3601 0.1940 0.2409 0.0130  0.0459  0.0309  124 PHE B CD1 
2728 C  CD2 . PHE B 124 ? 0.2847 0.2578 0.1581 0.0940  0.0972  0.0465  124 PHE B CD2 
2729 C  CE1 . PHE B 124 ? 0.6035 0.2118 0.2179 0.0435  0.0333  -0.0003 124 PHE B CE1 
2730 C  CE2 . PHE B 124 ? 0.5065 0.2948 0.1685 0.1836  0.1405  0.0603  124 PHE B CE2 
2731 C  CZ  . PHE B 124 ? 0.6370 0.2562 0.1906 0.1699  0.0731  0.0170  124 PHE B CZ  
2732 N  N   . VAL B 125 ? 0.1319 0.1655 0.1410 -0.0106 0.0393  0.0218  125 VAL B N   
2733 C  CA  . VAL B 125 ? 0.1086 0.1432 0.1229 -0.0272 0.0120  0.0057  125 VAL B CA  
2734 C  C   . VAL B 125 ? 0.1110 0.1352 0.1145 -0.0037 0.0137  -0.0079 125 VAL B C   
2735 O  O   . VAL B 125 ? 0.1245 0.1462 0.1071 -0.0165 0.0199  0.0056  125 VAL B O   
2736 C  CB  . VAL B 125 ? 0.1615 0.1449 0.1484 -0.0365 0.0109  0.0116  125 VAL B CB  
2737 C  CG1 . VAL B 125 ? 0.1997 0.1253 0.1659 -0.0237 0.0125  -0.0035 125 VAL B CG1 
2738 C  CG2 . VAL B 125 ? 0.2167 0.1516 0.1514 -0.0874 -0.0100 0.0155  125 VAL B CG2 
2739 N  N   . GLU B 126 ? 0.1228 0.1657 0.1162 -0.0094 0.0031  0.0094  126 GLU B N   
2740 C  CA  . GLU B 126 ? 0.1169 0.1751 0.1117 -0.0087 -0.0051 0.0067  126 GLU B CA  
2741 C  C   . GLU B 126 ? 0.0910 0.1429 0.1100 0.0230  0.0142  0.0030  126 GLU B C   
2742 O  O   . GLU B 126 ? 0.1168 0.1678 0.1100 0.0124  0.0036  0.0111  126 GLU B O   
2743 C  CB  . GLU B 126 ? 0.1288 0.2157 0.2035 -0.0248 -0.0441 0.0504  126 GLU B CB  
2744 C  CG  . GLU B 126 ? 0.2009 0.2811 0.2785 -0.0877 -0.1026 0.0439  126 GLU B CG  
2745 C  CD  . GLU B 126 ? 0.1813 0.2688 0.3002 -0.0655 -0.0553 0.0206  126 GLU B CD  
2746 O  OE1 . GLU B 126 ? 0.1985 0.4941 0.4708 -0.0411 -0.0562 0.2406  126 GLU B OE1 
2747 O  OE2 . GLU B 126 ? 0.2333 0.3926 0.2503 -0.1250 -0.0145 0.0441  126 GLU B OE2 
2748 N  N   . ARG B 127 ? 0.0913 0.1452 0.1127 0.0067  0.0042  0.0144  127 ARG B N   
2749 C  CA  . ARG B 127 ? 0.1044 0.1269 0.1031 0.0087  0.0087  0.0165  127 ARG B CA  
2750 C  C   . ARG B 127 ? 0.1050 0.1172 0.0769 -0.0021 0.0098  0.0117  127 ARG B C   
2751 O  O   . ARG B 127 ? 0.1173 0.1204 0.0929 -0.0101 0.0011  0.0078  127 ARG B O   
2752 C  CB  . ARG B 127 ? 0.1507 0.1435 0.1772 0.0117  0.0675  -0.0067 127 ARG B CB  
2753 C  CG  . ARG B 127 ? 0.1563 0.2430 0.2536 0.0385  0.0466  -0.0658 127 ARG B CG  
2754 C  CD  . ARG B 127 ? 0.3598 0.2363 0.4393 0.1115  -0.1165 -0.0080 127 ARG B CD  
2755 N  NE  . ARG B 127 ? 0.5111 0.2414 0.5357 0.0736  -0.1304 0.0184  127 ARG B NE  
2756 C  CZ  . ARG B 127 ? 0.5048 0.3397 0.4373 -0.0921 -0.0953 0.0796  127 ARG B CZ  
2757 N  NH1 . ARG B 127 ? 0.3916 0.2788 0.1669 0.0273  0.0374  0.0321  127 ARG B NH1 
2758 N  NH2 . ARG B 127 ? 0.2621 0.2104 0.5013 0.0042  -0.0691 0.0091  127 ARG B NH2 
2759 N  N   . ILE B 128 ? 0.0941 0.1189 0.0919 -0.0063 0.0068  0.0053  128 ILE B N   
2760 C  CA  . ILE B 128 ? 0.0992 0.1022 0.0966 -0.0105 0.0046  0.0078  128 ILE B CA  
2761 C  C   . ILE B 128 ? 0.0962 0.1077 0.0920 0.0053  0.0090  0.0065  128 ILE B C   
2762 O  O   . ILE B 128 ? 0.0988 0.1241 0.0901 0.0039  0.0033  0.0127  128 ILE B O   
2763 C  CB  . ILE B 128 ? 0.1218 0.1015 0.0807 0.0000  0.0158  0.0024  128 ILE B CB  
2764 C  CG1 . ILE B 128 ? 0.1221 0.1262 0.1025 -0.0025 0.0197  0.0226  128 ILE B CG1 
2765 C  CG2 . ILE B 128 ? 0.1272 0.1035 0.0897 0.0123  0.0198  0.0085  128 ILE B CG2 
2766 C  CD1 . ILE B 128 ? 0.1285 0.1241 0.1088 -0.0333 0.0000  0.0118  128 ILE B CD1 
2767 N  N   . ILE B 129 ? 0.0969 0.1139 0.0754 0.0051  0.0110  -0.0019 129 ILE B N   
2768 C  CA  . ILE B 129 ? 0.1038 0.1157 0.0620 -0.0044 0.0015  -0.0006 129 ILE B CA  
2769 C  C   . ILE B 129 ? 0.0971 0.1130 0.0846 -0.0035 0.0107  0.0002  129 ILE B C   
2770 O  O   . ILE B 129 ? 0.0982 0.1531 0.0896 0.0109  -0.0022 -0.0028 129 ILE B O   
2771 C  CB  . ILE B 129 ? 0.1041 0.1159 0.0916 -0.0075 0.0053  -0.0006 129 ILE B CB  
2772 C  CG1 . ILE B 129 ? 0.1054 0.1199 0.1195 0.0001  0.0122  0.0204  129 ILE B CG1 
2773 C  CG2 . ILE B 129 ? 0.1153 0.1280 0.1014 -0.0022 0.0190  0.0058  129 ILE B CG2 
2774 C  CD1 . ILE B 129 ? 0.1333 0.1198 0.1852 -0.0025 0.0202  0.0340  129 ILE B CD1 
2775 N  N   . LEU B 130 ? 0.0895 0.1225 0.0718 -0.0031 0.0051  0.0104  130 LEU B N   
2777 C  C   . LEU B 130 ? 0.0934 0.1134 0.0917 0.0191  -0.0088 -0.0125 130 LEU B C   
2778 O  O   . LEU B 130 ? 0.0876 0.1855 0.0890 0.0056  0.0027  -0.0151 130 LEU B O   
2783 N  N   . THR B 131 ? 0.0876 0.1265 0.0882 0.0143  -0.0057 -0.0030 131 THR B N   
2784 C  CA  . THR B 131 ? 0.0961 0.1366 0.0992 0.0099  0.0040  -0.0100 131 THR B CA  
2785 C  C   . THR B 131 ? 0.1014 0.1155 0.1043 -0.0071 -0.0092 -0.0094 131 THR B C   
2786 O  O   . THR B 131 ? 0.1221 0.1392 0.0999 0.0185  0.0027  0.0156  131 THR B O   
2787 C  CB  . THR B 131 ? 0.1072 0.1345 0.0968 0.0055  -0.0055 -0.0012 131 THR B CB  
2788 O  OG1 . THR B 131 ? 0.1062 0.1685 0.0976 -0.0011 -0.0050 0.0101  131 THR B OG1 
2789 C  CG2 . THR B 131 ? 0.1388 0.1265 0.1115 0.0119  0.0158  0.0072  131 THR B CG2 
2790 N  N   . ARG B 132 ? 0.0998 0.1391 0.1031 -0.0028 -0.0097 -0.0223 132 ARG B N   
2791 C  CA  . ARG B 132 ? 0.1002 0.1539 0.1045 -0.0096 -0.0217 -0.0062 132 ARG B CA  
2792 C  C   . ARG B 132 ? 0.1061 0.1517 0.1055 -0.0054 -0.0159 -0.0060 132 ARG B C   
2793 O  O   . ARG B 132 ? 0.1489 0.1532 0.2071 -0.0084 -0.0813 -0.0274 132 ARG B O   
2794 C  CB  . ARG B 132 ? 0.1021 0.1758 0.1994 0.0015  -0.0100 -0.0393 132 ARG B CB  
2795 C  CG  . ARG B 132 ? 0.1973 0.1645 0.2843 0.0334  -0.0690 -0.0108 132 ARG B CG  
2796 C  CD  . ARG B 132 ? 0.2716 0.2071 0.2526 -0.1494 -0.1100 0.0581  132 ARG B CD  
2797 N  NE  . ARG B 132 ? 0.1969 0.1787 0.2078 -0.0527 -0.0572 0.0213  132 ARG B NE  
2798 C  CZ  . ARG B 132 ? 0.1949 0.2170 0.2271 -0.0504 -0.0651 0.0340  132 ARG B CZ  
2799 N  NH1 . ARG B 132 ? 0.1873 0.2767 0.2732 -0.0447 -0.0910 0.0491  132 ARG B NH1 
2800 N  NH2 . ARG B 132 ? 0.2307 0.2257 0.2339 -0.0379 -0.0623 0.0628  132 ARG B NH2 
2801 N  N   . ASP B 133 ? 0.1098 0.1361 0.1129 -0.0035 -0.0128 -0.0206 133 ASP B N   
2802 C  CA  . ASP B 133 ? 0.1294 0.1421 0.1085 -0.0005 0.0152  -0.0023 133 ASP B CA  
2803 C  C   . ASP B 133 ? 0.1305 0.1114 0.1009 -0.0116 0.0050  -0.0045 133 ASP B C   
2804 O  O   . ASP B 133 ? 0.1375 0.1483 0.0955 -0.0002 0.0010  -0.0127 133 ASP B O   
2805 C  CB  . ASP B 133 ? 0.1289 0.1578 0.0936 0.0062  0.0034  -0.0118 133 ASP B CB  
2806 C  CG  . ASP B 133 ? 0.1519 0.1875 0.0921 -0.0429 0.0112  -0.0105 133 ASP B CG  
2807 O  OD1 . ASP B 133 ? 0.1826 0.1538 0.1003 -0.0423 0.0301  0.0025  133 ASP B OD1 
2808 O  OD2 . ASP B 133 ? 0.1591 0.2286 0.1072 -0.0488 0.0223  -0.0088 133 ASP B OD2 
2809 N  N   . LYS B 134 ? 0.1308 0.1226 0.0894 -0.0222 0.0069  -0.0050 134 LYS B N   
2810 C  CA  . LYS B 134 ? 0.1342 0.1056 0.0807 -0.0201 -0.0015 -0.0046 134 LYS B CA  
2811 C  C   . LYS B 134 ? 0.1141 0.1223 0.0820 -0.0193 -0.0138 0.0001  134 LYS B C   
2812 O  O   . LYS B 134 ? 0.1320 0.1141 0.0732 -0.0085 -0.0022 0.0008  134 LYS B O   
2813 C  CB  . LYS B 134 ? 0.1434 0.1019 0.0855 -0.0043 0.0115  -0.0094 134 LYS B CB  
2814 C  CG  . LYS B 134 ? 0.1374 0.1096 0.0880 -0.0070 0.0060  -0.0007 134 LYS B CG  
2815 C  CD  . LYS B 134 ? 0.1328 0.1161 0.0830 -0.0097 -0.0015 -0.0045 134 LYS B CD  
2816 C  CE  . LYS B 134 ? 0.1249 0.1194 0.0812 -0.0086 0.0119  0.0032  134 LYS B CE  
2817 N  NZ  . LYS B 134 ? 0.1338 0.1179 0.0872 -0.0060 0.0114  -0.0029 134 LYS B NZ  
2818 N  N   . THR B 135 ? 0.1200 0.1184 0.0962 -0.0217 -0.0049 0.0056  135 THR B N   
2819 C  CA  . THR B 135 ? 0.1510 0.1132 0.0889 -0.0127 0.0039  0.0003  135 THR B CA  
2820 C  C   . THR B 135 ? 0.1409 0.1176 0.0848 -0.0240 0.0131  0.0085  135 THR B C   
2821 O  O   . THR B 135 ? 0.1895 0.1147 0.1069 -0.0333 -0.0149 0.0104  135 THR B O   
2822 C  CB  . THR B 135 ? 0.1803 0.1361 0.0979 -0.0557 -0.0167 -0.0033 135 THR B CB  
2823 O  OG1 . THR B 135 ? 0.1466 0.1707 0.1173 -0.0475 0.0070  0.0069  135 THR B OG1 
2824 C  CG2 . THR B 135 ? 0.1873 0.1809 0.1216 -0.0567 -0.0328 0.0343  135 THR B CG2 
2825 N  N   . VAL B 136 ? 0.1485 0.1196 0.0886 -0.0264 -0.0052 0.0047  136 VAL B N   
2826 C  CA  . VAL B 136 ? 0.1486 0.1245 0.0846 -0.0256 0.0024  0.0135  136 VAL B CA  
2827 C  C   . VAL B 136 ? 0.1508 0.1448 0.0850 -0.0319 0.0055  0.0124  136 VAL B C   
2828 O  O   . VAL B 136 ? 0.1516 0.2056 0.0939 -0.0281 -0.0022 0.0211  136 VAL B O   
2829 C  CB  . VAL B 136 ? 0.1587 0.1198 0.0820 -0.0186 -0.0051 0.0071  136 VAL B CB  
2830 C  CG1 . VAL B 136 ? 0.1743 0.1741 0.0970 -0.0378 0.0197  -0.0054 136 VAL B CG1 
2831 C  CG2 . VAL B 136 ? 0.2051 0.1191 0.1166 -0.0196 -0.0092 0.0093  136 VAL B CG2 
2832 N  N   . VAL B 137 ? 0.1430 0.1262 0.0839 -0.0116 0.0055  0.0064  137 VAL B N   
2833 C  CA  . VAL B 137 ? 0.1411 0.1203 0.0861 -0.0078 0.0006  0.0065  137 VAL B CA  
2834 C  C   . VAL B 137 ? 0.1467 0.1249 0.0886 -0.0151 0.0065  -0.0094 137 VAL B C   
2835 O  O   . VAL B 137 ? 0.1693 0.1437 0.0953 -0.0176 -0.0167 -0.0041 137 VAL B O   
2836 C  CB  . VAL B 137 ? 0.1505 0.1392 0.0799 -0.0212 0.0096  0.0002  137 VAL B CB  
2837 C  CG1 . VAL B 137 ? 0.1441 0.1488 0.1140 -0.0348 0.0010  0.0027  137 VAL B CG1 
2838 C  CG2 . VAL B 137 ? 0.1762 0.1204 0.1248 -0.0272 0.0073  0.0053  137 VAL B CG2 
2843 C  C   A LEU B 138 ? 0.1579 0.1441 0.1129 0.0253  0.0264  -0.0135 138 LEU B C   
2844 C  C   B LEU B 138 ? 0.1869 0.1163 0.1199 0.0205  0.0341  -0.0063 138 LEU B C   
2845 O  O   A LEU B 138 ? 0.2234 0.1588 0.0748 -0.0327 0.0342  0.0074  138 LEU B O   
2846 O  O   B LEU B 138 ? 0.2314 0.1594 0.1255 -0.0236 0.0818  -0.0208 138 LEU B O   
2849 C  CG  A LEU B 138 ? 0.1296 0.1599 0.1907 0.0426  -0.0058 -0.0088 138 LEU B CG  
2850 C  CG  B LEU B 138 ? 0.2339 0.1708 0.1402 0.0001  0.0184  0.0251  138 LEU B CG  
2851 C  CD1 A LEU B 138 ? 0.1854 0.1261 0.1630 0.0371  -0.0275 0.0004  138 LEU B CD1 
2852 C  CD1 B LEU B 138 ? 0.4167 0.3004 0.0911 -0.1645 -0.0375 0.0661  138 LEU B CD1 
2853 C  CD2 A LEU B 138 ? 0.2676 0.1290 0.3310 0.1017  -0.1625 -0.0515 138 LEU B CD2 
2854 C  CD2 B LEU B 138 ? 0.3120 0.2714 0.1995 -0.1034 -0.0600 0.0545  138 LEU B CD2 
2855 N  N   . GLY B 139 ? 0.1627 0.1665 0.1365 0.0191  0.0129  -0.0349 139 GLY B N   
2856 C  CA  . GLY B 139 ? 0.1773 0.1837 0.1180 -0.0295 0.0191  -0.0428 139 GLY B CA  
2857 C  C   . GLY B 139 ? 0.1766 0.1347 0.0977 0.0086  -0.0151 -0.0087 139 GLY B C   
2858 O  O   . GLY B 139 ? 0.2032 0.1426 0.1240 -0.0088 -0.0043 -0.0221 139 GLY B O   
2859 N  N   . ASP B 140 ? 0.1876 0.1260 0.1032 0.0413  -0.0194 -0.0042 140 ASP B N   
2860 C  CA  . ASP B 140 ? 0.2134 0.1201 0.1037 0.0300  -0.0019 -0.0033 140 ASP B CA  
2861 C  C   . ASP B 140 ? 0.2107 0.0957 0.1029 0.0136  -0.0072 -0.0078 140 ASP B C   
2862 O  O   . ASP B 140 ? 0.2339 0.0901 0.1061 0.0084  -0.0053 -0.0131 140 ASP B O   
2863 C  CB  . ASP B 140 ? 0.2083 0.1360 0.1338 0.0372  -0.0156 -0.0207 140 ASP B CB  
2864 C  CG  . ASP B 140 ? 0.2447 0.1461 0.1167 0.0675  0.0013  -0.0067 140 ASP B CG  
2865 O  OD1 . ASP B 140 ? 0.4258 0.2129 0.3545 -0.0251 -0.1482 0.1255  140 ASP B OD1 
2866 O  OD2 . ASP B 140 ? 0.2714 0.2018 0.1466 0.0404  -0.0564 0.0169  140 ASP B OD2 
2867 N  N   . LEU B 141 ? 0.1912 0.0951 0.1104 0.0110  -0.0242 -0.0068 141 LEU B N   
2868 C  CA  . LEU B 141 ? 0.1700 0.1023 0.1107 0.0142  -0.0024 -0.0030 141 LEU B CA  
2869 C  C   . LEU B 141 ? 0.1612 0.1031 0.0995 0.0212  -0.0076 -0.0142 141 LEU B C   
2870 O  O   . LEU B 141 ? 0.1703 0.1073 0.0996 0.0080  -0.0164 -0.0128 141 LEU B O   
2871 C  CB  . LEU B 141 ? 0.1695 0.1385 0.1093 0.0462  -0.0021 -0.0126 141 LEU B CB  
2872 C  CG  . LEU B 141 ? 0.1985 0.1482 0.1031 0.0339  -0.0022 -0.0186 141 LEU B CG  
2873 C  CD1 . LEU B 141 ? 0.2125 0.2305 0.1785 0.0320  0.0418  -0.0881 141 LEU B CD1 
2874 C  CD2 . LEU B 141 ? 0.2371 0.1523 0.1161 0.0086  -0.0027 -0.0280 141 LEU B CD2 
2875 N  N   . LEU B 142 ? 0.1644 0.0883 0.1045 0.0043  -0.0115 -0.0202 142 LEU B N   
2876 C  CA  . LEU B 142 ? 0.1337 0.0952 0.1016 0.0045  -0.0171 0.0023  142 LEU B CA  
2877 C  C   . LEU B 142 ? 0.1378 0.1259 0.0958 -0.0071 -0.0030 -0.0042 142 LEU B C   
2878 O  O   . LEU B 142 ? 0.1810 0.1157 0.0860 -0.0245 -0.0217 -0.0017 142 LEU B O   
2879 C  CB  . LEU B 142 ? 0.1516 0.1120 0.1075 0.0199  -0.0028 -0.0004 142 LEU B CB  
2880 C  CG  . LEU B 142 ? 0.1307 0.1065 0.1065 0.0080  0.0036  -0.0095 142 LEU B CG  
2881 C  CD1 . LEU B 142 ? 0.1426 0.1133 0.1242 0.0089  -0.0048 -0.0154 142 LEU B CD1 
2882 C  CD2 . LEU B 142 ? 0.1369 0.1401 0.1587 0.0147  0.0210  -0.0083 142 LEU B CD2 
2883 N  N   . ILE B 143 ? 0.1381 0.1097 0.0830 -0.0033 -0.0145 -0.0047 143 ILE B N   
2884 C  CA  . ILE B 143 ? 0.1385 0.1050 0.0860 -0.0001 -0.0034 -0.0059 143 ILE B CA  
2885 C  C   . ILE B 143 ? 0.1258 0.1147 0.0910 0.0036  -0.0082 -0.0077 143 ILE B C   
2886 O  O   . ILE B 143 ? 0.1425 0.1087 0.1000 -0.0055 0.0015  -0.0064 143 ILE B O   
2887 C  CB  . ILE B 143 ? 0.1592 0.1356 0.0922 0.0173  0.0155  -0.0013 143 ILE B CB  
2888 C  CG1 . ILE B 143 ? 0.1416 0.1459 0.1268 0.0216  0.0085  0.0159  143 ILE B CG1 
2889 C  CG2 . ILE B 143 ? 0.1648 0.1462 0.0872 0.0098  -0.0016 0.0020  143 ILE B CG2 
2890 C  CD1 . ILE B 143 ? 0.1530 0.1656 0.1312 0.0118  0.0249  0.0031  143 ILE B CD1 
2891 N  N   . ASP B 144 ? 0.1301 0.1158 0.0909 -0.0018 -0.0106 -0.0004 144 ASP B N   
2892 C  CA  . ASP B 144 ? 0.1217 0.0945 0.0960 -0.0091 -0.0030 0.0151  144 ASP B CA  
2893 C  C   . ASP B 144 ? 0.1085 0.1022 0.0948 -0.0035 0.0075  0.0028  144 ASP B C   
2894 O  O   . ASP B 144 ? 0.1342 0.1104 0.1081 -0.0015 -0.0006 -0.0106 144 ASP B O   
2895 C  CB  . ASP B 144 ? 0.0995 0.1193 0.1013 -0.0063 -0.0050 0.0051  144 ASP B CB  
2896 C  CG  . ASP B 144 ? 0.1218 0.1148 0.0967 -0.0017 0.0068  0.0173  144 ASP B CG  
2897 O  OD1 . ASP B 144 ? 0.1439 0.1227 0.1014 0.0111  -0.0094 0.0038  144 ASP B OD1 
2898 O  OD2 . ASP B 144 ? 0.1772 0.1322 0.0974 -0.0066 -0.0021 -0.0023 144 ASP B OD2 
2899 N  N   . ASP B 145 ? 0.1206 0.1117 0.0995 0.0084  -0.0089 0.0093  145 ASP B N   
2900 C  CA  . ASP B 145 ? 0.1348 0.1112 0.0791 -0.0017 -0.0111 -0.0067 145 ASP B CA  
2901 C  C   . ASP B 145 ? 0.1336 0.0947 0.0919 0.0011  -0.0103 -0.0076 145 ASP B C   
2902 O  O   . ASP B 145 ? 0.1218 0.1461 0.1079 -0.0011 -0.0069 0.0028  145 ASP B O   
2903 C  CB  . ASP B 145 ? 0.1446 0.1229 0.0774 0.0026  -0.0093 0.0015  145 ASP B CB  
2904 C  CG  . ASP B 145 ? 0.1083 0.1141 0.0989 -0.0002 -0.0104 -0.0024 145 ASP B CG  
2905 O  OD1 . ASP B 145 ? 0.1230 0.1293 0.0958 -0.0047 -0.0195 0.0017  145 ASP B OD1 
2906 O  OD2 . ASP B 145 ? 0.1468 0.1213 0.1867 0.0002  -0.0766 0.0018  145 ASP B OD2 
2907 N  N   . LYS B 146 ? 0.1195 0.1187 0.1068 -0.0156 0.0011  -0.0323 146 LYS B N   
2908 C  CA  . LYS B 146 ? 0.1117 0.1337 0.1098 -0.0092 -0.0070 -0.0007 146 LYS B CA  
2909 C  C   . LYS B 146 ? 0.1302 0.1336 0.1023 -0.0186 -0.0030 0.0085  146 LYS B C   
2910 O  O   . LYS B 146 ? 0.1630 0.1404 0.1379 -0.0115 -0.0225 0.0038  146 LYS B O   
2911 C  CB  . LYS B 146 ? 0.1221 0.1353 0.1076 -0.0132 0.0087  -0.0004 146 LYS B CB  
2912 C  CG  . LYS B 146 ? 0.1102 0.1514 0.1190 0.0049  -0.0079 -0.0061 146 LYS B CG  
2913 C  CD  . LYS B 146 ? 0.1249 0.1429 0.1349 0.0033  0.0027  -0.0302 146 LYS B CD  
2914 C  CE  . LYS B 146 ? 0.1388 0.1764 0.1451 0.0071  0.0174  -0.0185 146 LYS B CE  
2915 N  NZ  . LYS B 146 ? 0.1328 0.2055 0.1537 -0.0036 0.0304  -0.0015 146 LYS B NZ  
2916 N  N   . ASP B 147 ? 0.1341 0.1526 0.1241 -0.0236 -0.0056 -0.0077 147 ASP B N   
2917 C  CA  . ASP B 147 ? 0.1926 0.1702 0.1489 -0.0704 -0.0046 -0.0112 147 ASP B CA  
2918 C  C   . ASP B 147 ? 0.1982 0.1565 0.1593 -0.0466 -0.0017 -0.0134 147 ASP B C   
2919 O  O   . ASP B 147 ? 0.2346 0.1585 0.1637 -0.0339 -0.0124 -0.0229 147 ASP B O   
2920 C  CB  . ASP B 147 ? 0.2577 0.2346 0.3220 -0.0928 -0.1348 0.0436  147 ASP B CB  
2921 C  CG  . ASP B 147 ? 0.3019 0.8442 0.3144 0.1039  -0.0507 0.1703  147 ASP B CG  
2922 O  OD1 . ASP B 147 ? 0.5335 0.4758 0.4018 0.1740  0.0920  0.2049  147 ASP B OD1 
2923 O  OD2 . ASP B 147 ? 0.2367 0.4832 0.2296 0.0541  -0.0323 0.0120  147 ASP B OD2 
2924 N  N   . THR B 148 ? 0.1464 0.1701 0.1505 -0.0288 -0.0160 -0.0090 148 THR B N   
2927 C  C   . THR B 148 ? 0.1748 0.1460 0.1526 -0.0297 -0.0201 0.0029  148 THR B C   
2928 O  O   . THR B 148 ? 0.2899 0.1778 0.1719 0.0336  -0.0745 -0.0256 148 THR B O   
2935 N  N   . VAL B 149 ? 0.1916 0.1447 0.1299 -0.0311 -0.0193 0.0112  149 VAL B N   
2936 C  CA  . VAL B 149 ? 0.1893 0.1235 0.1192 -0.0287 -0.0020 -0.0033 149 VAL B CA  
2937 C  C   . VAL B 149 ? 0.1762 0.1841 0.1306 -0.0125 -0.0167 0.0335  149 VAL B C   
2938 O  O   . VAL B 149 ? 0.2404 0.1818 0.1783 -0.0121 -0.0031 0.0533  149 VAL B O   
2939 C  CB  . VAL B 149 ? 0.1859 0.1359 0.1129 -0.0169 -0.0123 0.0031  149 VAL B CB  
2940 C  CG1 . VAL B 149 ? 0.1724 0.1303 0.1246 0.0008  -0.0074 -0.0091 149 VAL B CG1 
2941 C  CG2 . VAL B 149 ? 0.2181 0.1531 0.1195 -0.0352 0.0057  0.0064  149 VAL B CG2 
2942 N  N   . ARG B 150 ? 0.1764 0.1938 0.1136 -0.0510 -0.0042 0.0053  150 ARG B N   
2943 C  CA  . ARG B 150 ? 0.2347 0.2725 0.1284 -0.1502 0.0091  -0.0008 150 ARG B CA  
2944 C  C   . ARG B 150 ? 0.1985 0.1966 0.1223 -0.0571 0.0192  0.0066  150 ARG B C   
2945 O  O   . ARG B 150 ? 0.1857 0.1859 0.1353 -0.0468 -0.0082 0.0127  150 ARG B O   
2946 C  CB  . ARG B 150 ? 0.2358 0.5132 0.1402 -0.1757 0.0094  0.0112  150 ARG B CB  
2947 C  CG  . ARG B 150 ? 0.2317 0.7489 0.3958 -0.0424 0.0542  0.1711  150 ARG B CG  
2948 C  CD  . ARG B 150 ? 0.2237 0.7887 0.4241 -0.1232 0.0032  0.0433  150 ARG B CD  
2949 N  NE  . ARG B 150 ? 0.3883 0.8351 0.5309 -0.1301 -0.1225 0.0064  150 ARG B NE  
2950 C  CZ  . ARG B 150 ? 0.4394 0.6899 0.5776 -0.1782 -0.0206 -0.1857 150 ARG B CZ  
2951 N  NH1 . ARG B 150 ? 0.9084 1.0425 0.7388 -0.2717 -0.3932 -0.2874 150 ARG B NH1 
2952 N  NH2 . ARG B 150 ? 0.6420 0.8016 0.9341 0.0746  0.2420  0.0043  150 ARG B NH2 
2953 N  N   . GLY B 151 ? 0.1554 0.2203 0.1228 -0.0680 0.0034  0.0106  151 GLY B N   
2954 C  CA  . GLY B 151 ? 0.1452 0.2045 0.1212 -0.0377 0.0165  0.0028  151 GLY B CA  
2955 C  C   . GLY B 151 ? 0.1450 0.2637 0.1239 -0.0755 0.0154  0.0162  151 GLY B C   
2956 O  O   . GLY B 151 ? 0.2119 0.2594 0.1468 -0.1047 0.0343  0.0038  151 GLY B O   
2957 N  N   . GLN B 152 ? 0.2051 0.2771 0.1009 -0.0864 0.0257  0.0121  152 GLN B N   
2958 C  CA  . GLN B 152 ? 0.2116 0.2925 0.1163 -0.0841 0.0606  0.0268  152 GLN B CA  
2959 C  C   . GLN B 152 ? 0.3165 0.2963 0.1908 -0.0541 0.0899  0.0560  152 GLN B C   
2960 O  O   . GLN B 152 ? 0.3156 0.3800 0.3600 0.0394  0.1451  0.2077  152 GLN B O   
2961 C  CB  . GLN B 152 ? 0.2926 0.3592 0.1161 -0.0472 -0.0074 0.0184  152 GLN B CB  
2962 C  CG  . GLN B 152 ? 0.3564 0.3494 0.1812 -0.0626 0.1175  -0.0188 152 GLN B CG  
2963 C  CD  . GLN B 152 ? 0.2994 0.4189 0.1979 -0.0683 0.1086  -0.0273 152 GLN B CD  
2964 O  OE1 . GLN B 152 ? 0.2906 0.3673 0.5316 -0.1399 -0.0696 -0.1005 152 GLN B OE1 
2965 N  NE2 . GLN B 152 ? 0.8015 0.2795 0.2857 0.1450  0.0106  -0.0388 152 GLN B NE2 
2966 N  N   . GLU B 153 ? 0.2112 0.2614 0.1748 -0.0522 0.0134  0.0703  153 GLU B N   
2967 C  CA  . GLU B 153 ? 0.2958 0.2667 0.1852 -0.0171 0.0408  0.1164  153 GLU B CA  
2968 C  C   . GLU B 153 ? 0.2913 0.2580 0.2211 -0.0345 0.0766  0.0489  153 GLU B C   
2969 O  O   . GLU B 153 ? 0.3063 0.2535 0.1970 -0.0600 0.0706  0.0248  153 GLU B O   
2970 C  CB  . GLU B 153 ? 0.3085 0.2559 0.1390 -0.0014 0.0381  0.0682  153 GLU B CB  
2971 C  CG  . GLU B 153 ? 0.3197 0.2250 0.1831 -0.0050 0.0071  0.0603  153 GLU B CG  
2972 C  CD  . GLU B 153 ? 0.4427 0.1788 0.1345 -0.0433 -0.0246 0.0101  153 GLU B CD  
2973 O  OE1 . GLU B 153 ? 0.4606 0.1774 0.1631 -0.0344 -0.0214 0.0043  153 GLU B OE1 
2974 O  OE2 . GLU B 153 ? 0.6123 0.2137 0.1544 -0.0128 0.0202  -0.0039 153 GLU B OE2 
2975 N  N   . GLU B 154 ? 0.3359 0.2742 0.2555 -0.0474 0.0819  0.0843  154 GLU B N   
2976 C  CA  . GLU B 154 ? 0.3323 0.2624 0.3593 -0.0690 0.0764  0.0383  154 GLU B CA  
2977 C  C   . GLU B 154 ? 0.2586 0.2739 0.2842 -0.1190 0.0552  0.0558  154 GLU B C   
2978 O  O   . GLU B 154 ? 0.3920 0.2293 0.3126 -0.1062 -0.0117 0.0286  154 GLU B O   
2979 C  CB  . GLU B 154 ? 0.2801 0.4559 0.4991 -0.0987 0.1657  0.0396  154 GLU B CB  
2980 C  CG  . GLU B 154 ? 0.3446 0.5811 0.6821 -0.2204 0.0862  0.0955  154 GLU B CG  
2981 C  CD  . GLU B 154 ? 0.3704 0.7600 0.9358 -0.3193 0.1315  0.2403  154 GLU B CD  
2982 O  OE1 . GLU B 154 ? 0.4271 0.6573 1.2565 -0.2513 0.0795  0.3141  154 GLU B OE1 
2983 O  OE2 . GLU B 154 ? 0.8060 0.9512 1.0384 -0.0666 0.5216  0.3571  154 GLU B OE2 
2984 N  N   . THR B 155 ? 0.3223 0.1919 0.3035 -0.0842 0.0315  0.0307  155 THR B N   
2985 C  CA  . THR B 155 ? 0.3064 0.1995 0.2669 -0.0854 0.0056  0.0226  155 THR B CA  
2986 C  C   . THR B 155 ? 0.3010 0.1860 0.2503 -0.0716 -0.0085 0.0589  155 THR B C   
2987 O  O   . THR B 155 ? 0.2838 0.2374 0.2334 -0.0328 0.0136  0.0723  155 THR B O   
2988 C  CB  . THR B 155 ? 0.3363 0.1922 0.3148 -0.0868 0.0057  0.0016  155 THR B CB  
2989 O  OG1 . THR B 155 ? 0.3955 0.2611 0.5714 -0.1700 0.0224  -0.0076 155 THR B OG1 
2990 C  CG2 . THR B 155 ? 0.5028 0.1997 0.2761 -0.0948 0.0108  -0.0219 155 THR B CG2 
2991 N  N   . PRO B 156 ? 0.2819 0.1686 0.2152 -0.0503 0.0067  0.0408  156 PRO B N   
2992 C  CA  . PRO B 156 ? 0.2700 0.1625 0.2255 -0.0456 0.0070  0.0408  156 PRO B CA  
2993 C  C   . PRO B 156 ? 0.2781 0.1395 0.1533 -0.0520 0.0180  0.0344  156 PRO B C   
2994 O  O   . PRO B 156 ? 0.2759 0.1530 0.2274 -0.0713 -0.0048 0.0068  156 PRO B O   
2995 C  CB  . PRO B 156 ? 0.2753 0.1345 0.2368 -0.0214 0.0338  0.0317  156 PRO B CB  
2996 C  CG  . PRO B 156 ? 0.2716 0.1981 0.2345 -0.0325 0.0175  0.0642  156 PRO B CG  
2997 C  CD  . PRO B 156 ? 0.2760 0.1867 0.2172 -0.0414 -0.0017 0.0233  156 PRO B CD  
2998 N  N   . SER B 157 ? 0.2681 0.1129 0.1421 -0.0436 0.0388  -0.0036 157 SER B N   
2999 C  CA  . SER B 157 ? 0.2919 0.1244 0.1144 -0.0199 -0.0135 0.0012  157 SER B CA  
3000 C  C   . SER B 157 ? 0.2307 0.1311 0.1334 -0.0137 0.0151  0.0253  157 SER B C   
3001 O  O   . SER B 157 ? 0.3190 0.1330 0.1643 0.0180  0.0387  0.0273  157 SER B O   
3002 C  CB  . SER B 157 ? 0.3057 0.1857 0.1499 -0.0712 -0.0312 0.0351  157 SER B CB  
3003 O  OG  . SER B 157 ? 0.3326 0.1747 0.1332 -0.0584 -0.0217 -0.0080 157 SER B OG  
3004 N  N   . TRP B 158 ? 0.2060 0.1248 0.1176 -0.0136 -0.0129 0.0038  158 TRP B N   
3005 C  CA  . TRP B 158 ? 0.1826 0.1185 0.1173 -0.0099 -0.0178 0.0186  158 TRP B CA  
3006 C  C   . TRP B 158 ? 0.2006 0.0983 0.1224 -0.0163 -0.0063 0.0000  158 TRP B C   
3007 O  O   . TRP B 158 ? 0.1988 0.1735 0.1287 -0.0402 -0.0090 0.0011  158 TRP B O   
3008 C  CB  . TRP B 158 ? 0.1730 0.1186 0.1205 -0.0143 0.0123  -0.0105 158 TRP B CB  
3009 C  CG  . TRP B 158 ? 0.1825 0.1129 0.0857 -0.0081 -0.0048 -0.0058 158 TRP B CG  
3010 C  CD1 . TRP B 158 ? 0.1791 0.1115 0.0925 -0.0063 -0.0073 -0.0033 158 TRP B CD1 
3011 C  CD2 . TRP B 158 ? 0.1829 0.1066 0.0941 -0.0100 -0.0101 0.0034  158 TRP B CD2 
3012 N  NE1 . TRP B 158 ? 0.1914 0.1131 0.0864 -0.0057 0.0056  -0.0099 158 TRP B NE1 
3013 C  CE2 . TRP B 158 ? 0.1809 0.1227 0.0873 -0.0038 -0.0010 0.0097  158 TRP B CE2 
3014 C  CE3 . TRP B 158 ? 0.1717 0.1428 0.0926 0.0055  -0.0023 -0.0041 158 TRP B CE3 
3015 C  CZ2 . TRP B 158 ? 0.1841 0.1078 0.0959 -0.0089 0.0116  0.0005  158 TRP B CZ2 
3016 C  CZ3 . TRP B 158 ? 0.1849 0.1261 0.1050 0.0055  -0.0128 -0.0073 158 TRP B CZ3 
3017 C  CH2 . TRP B 158 ? 0.1670 0.1283 0.0983 -0.0034 0.0109  -0.0008 158 TRP B CH2 
3018 N  N   . GLU B 159 ? 0.1887 0.1230 0.1241 0.0254  -0.0182 0.0066  159 GLU B N   
3019 C  CA  . GLU B 159 ? 0.2063 0.1094 0.1317 -0.0052 -0.0227 0.0001  159 GLU B CA  
3020 C  C   . GLU B 159 ? 0.1936 0.1065 0.1221 -0.0115 -0.0296 -0.0026 159 GLU B C   
3021 O  O   . GLU B 159 ? 0.1773 0.1137 0.1142 -0.0006 -0.0166 -0.0039 159 GLU B O   
3022 C  CB  . GLU B 159 ? 0.2363 0.1041 0.1392 0.0033  -0.0234 0.0018  159 GLU B CB  
3023 C  CG  . GLU B 159 ? 0.2423 0.1103 0.1778 0.0113  -0.0483 -0.0340 159 GLU B CG  
3024 C  CD  . GLU B 159 ? 0.3138 0.1594 0.1596 0.0420  -0.0270 -0.0328 159 GLU B CD  
3025 O  OE1 . GLU B 159 ? 0.3015 0.1577 0.1683 0.0468  -0.0107 -0.0406 159 GLU B OE1 
3026 O  OE2 . GLU B 159 ? 0.3442 0.1567 0.1781 0.0093  -0.0482 -0.0441 159 GLU B OE2 
3027 N  N   . HIS B 160 ? 0.1810 0.1081 0.1065 -0.0148 -0.0199 -0.0058 160 HIS B N   
3028 C  CA  . HIS B 160 ? 0.1827 0.1119 0.0977 -0.0073 -0.0096 -0.0026 160 HIS B CA  
3029 C  C   . HIS B 160 ? 0.1705 0.0988 0.1057 -0.0056 -0.0105 -0.0069 160 HIS B C   
3030 O  O   . HIS B 160 ? 0.2289 0.1180 0.1002 -0.0353 -0.0182 -0.0097 160 HIS B O   
3031 C  CB  . HIS B 160 ? 0.1877 0.0998 0.1103 -0.0059 0.0021  -0.0193 160 HIS B CB  
3032 C  CG  . HIS B 160 ? 0.1810 0.1084 0.1005 -0.0032 0.0039  -0.0127 160 HIS B CG  
3033 N  ND1 . HIS B 160 ? 0.1758 0.1489 0.1442 -0.0148 0.0130  0.0194  160 HIS B ND1 
3034 C  CD2 . HIS B 160 ? 0.1732 0.0972 0.1190 -0.0063 -0.0162 -0.0115 160 HIS B CD2 
3035 C  CE1 . HIS B 160 ? 0.1645 0.1463 0.1673 -0.0047 0.0118  0.0311  160 HIS B CE1 
3036 N  NE2 . HIS B 160 ? 0.1696 0.1164 0.1136 -0.0021 -0.0030 0.0029  160 HIS B NE2 
3037 N  N   . ILE B 161 ? 0.1596 0.1078 0.0941 -0.0026 -0.0080 -0.0108 161 ILE B N   
3038 C  CA  . ILE B 161 ? 0.1826 0.1212 0.0878 0.0157  -0.0091 -0.0239 161 ILE B CA  
3039 C  C   . ILE B 161 ? 0.1516 0.1145 0.1068 -0.0118 0.0007  0.0018  161 ILE B C   
3040 O  O   . ILE B 161 ? 0.1720 0.1133 0.0913 0.0007  -0.0080 -0.0015 161 ILE B O   
3041 C  CB  . ILE B 161 ? 0.1838 0.1114 0.0958 0.0133  -0.0030 -0.0355 161 ILE B CB  
3042 C  CG1 . ILE B 161 ? 0.1705 0.1163 0.1352 0.0083  -0.0054 -0.0227 161 ILE B CG1 
3043 C  CG2 . ILE B 161 ? 0.1847 0.1428 0.1165 0.0228  0.0136  -0.0135 161 ILE B CG2 
3044 C  CD1 . ILE B 161 ? 0.1852 0.1151 0.1493 -0.0035 -0.0039 -0.0024 161 ILE B CD1 
3045 N  N   . LEU B 162 ? 0.1689 0.1210 0.0959 0.0003  -0.0077 -0.0118 162 LEU B N   
3046 C  CA  . LEU B 162 ? 0.1503 0.1308 0.1073 -0.0110 -0.0023 0.0012  162 LEU B CA  
3047 C  C   . LEU B 162 ? 0.1470 0.1192 0.1135 -0.0005 0.0068  -0.0111 162 LEU B C   
3048 O  O   . LEU B 162 ? 0.1736 0.1255 0.1345 -0.0118 0.0334  -0.0205 162 LEU B O   
3049 C  CB  . LEU B 162 ? 0.1458 0.1291 0.1295 -0.0070 -0.0023 -0.0117 162 LEU B CB  
3050 C  CG  . LEU B 162 ? 0.1686 0.1468 0.1377 0.0062  -0.0148 -0.0063 162 LEU B CG  
3051 C  CD1 . LEU B 162 ? 0.1774 0.1346 0.1329 0.0096  -0.0030 -0.0013 162 LEU B CD1 
3052 C  CD2 . LEU B 162 ? 0.2319 0.1782 0.2193 0.0007  -0.1029 -0.0191 162 LEU B CD2 
3053 N  N   . PHE B 163 ? 0.1405 0.1168 0.1016 0.0010  -0.0029 -0.0053 163 PHE B N   
3054 C  CA  . PHE B 163 ? 0.1205 0.1284 0.1035 0.0087  0.0131  -0.0095 163 PHE B CA  
3055 C  C   . PHE B 163 ? 0.1397 0.1085 0.1093 0.0014  -0.0007 -0.0066 163 PHE B C   
3056 O  O   . PHE B 163 ? 0.1566 0.1417 0.1030 0.0246  0.0049  0.0035  163 PHE B O   
3057 C  CB  . PHE B 163 ? 0.1305 0.1221 0.1079 0.0007  -0.0006 0.0012  163 PHE B CB  
3058 C  CG  . PHE B 163 ? 0.1459 0.1344 0.0998 -0.0118 0.0094  -0.0150 163 PHE B CG  
3059 C  CD1 . PHE B 163 ? 0.1477 0.1725 0.1180 -0.0035 0.0179  -0.0075 163 PHE B CD1 
3060 C  CD2 . PHE B 163 ? 0.1483 0.1348 0.0957 -0.0253 -0.0058 -0.0086 163 PHE B CD2 
3061 C  CE1 . PHE B 163 ? 0.1355 0.1805 0.1465 -0.0242 0.0065  0.0011  163 PHE B CE1 
3062 C  CE2 . PHE B 163 ? 0.1683 0.1542 0.1114 -0.0196 0.0060  0.0036  163 PHE B CE2 
3063 C  CZ  . PHE B 163 ? 0.1632 0.1655 0.1155 -0.0245 0.0099  -0.0131 163 PHE B CZ  
3064 N  N   . THR B 164 ? 0.1464 0.1525 0.1079 0.0192  0.0081  0.0017  164 THR B N   
3065 C  CA  . THR B 164 ? 0.1787 0.1966 0.1061 0.0623  0.0117  0.0071  164 THR B CA  
3066 C  C   . THR B 164 ? 0.1386 0.2006 0.1005 0.0300  0.0055  0.0269  164 THR B C   
3067 O  O   . THR B 164 ? 0.1521 0.2635 0.1546 0.0116  0.0125  0.0392  164 THR B O   
3068 C  CB  . THR B 164 ? 0.1828 0.2369 0.1142 0.0134  -0.0135 -0.0209 164 THR B CB  
3069 O  OG1 . THR B 164 ? 0.1554 0.2237 0.1555 0.0357  -0.0204 -0.0410 164 THR B OG1 
3070 C  CG2 . THR B 164 ? 0.1569 0.2475 0.1408 0.0088  -0.0277 -0.0215 164 THR B CG2 
3071 N  N   . CYS B 165 ? 0.1589 0.1892 0.1666 0.0536  0.0218  0.0311  165 CYS B N   
3072 C  CA  . CYS B 165 ? 0.1712 0.1850 0.1948 0.0283  -0.0064 0.0459  165 CYS B CA  
3073 C  C   . CYS B 165 ? 0.1617 0.2131 0.2341 0.0196  -0.0217 0.0697  165 CYS B C   
3074 O  O   . CYS B 165 ? 0.2021 0.1732 0.2285 0.0281  -0.0385 0.0405  165 CYS B O   
3075 C  CB  . CYS B 165 ? 0.1565 0.2064 0.2504 0.0658  -0.0048 -0.0085 165 CYS B CB  
3076 S  SG  . CYS B 165 ? 0.2689 0.2204 0.2224 -0.0085 -0.0192 0.0049  165 CYS B SG  
3077 N  N   . CYS B 166 ? 0.1515 0.2385 0.2796 -0.0246 -0.0450 0.1080  166 CYS B N   
3078 C  CA  . CYS B 166 ? 0.1636 0.2018 0.2418 0.0098  -0.0375 0.0673  166 CYS B CA  
3079 C  C   . CYS B 166 ? 0.1390 0.2190 0.2316 0.0272  -0.0334 0.0371  166 CYS B C   
3080 O  O   . CYS B 166 ? 0.1824 0.2179 0.2520 -0.0131 -0.0063 -0.0129 166 CYS B O   
3081 C  CB  . CYS B 166 ? 0.2503 0.2133 0.2912 0.0204  -0.0526 0.0805  166 CYS B CB  
3082 S  SG  . CYS B 166 ? 0.2619 0.1939 0.3795 0.0084  -0.0337 0.0422  166 CYS B SG  
3083 N  N   . HIS B 167 ? 0.1415 0.1856 0.2340 0.0186  -0.0492 0.0366  167 HIS B N   
3084 C  CA  . HIS B 167 ? 0.1572 0.1771 0.2081 0.0188  -0.0355 -0.0079 167 HIS B CA  
3085 C  C   . HIS B 167 ? 0.1453 0.1811 0.1881 0.0114  -0.0136 -0.0129 167 HIS B C   
3086 O  O   . HIS B 167 ? 0.1492 0.2139 0.2033 0.0054  -0.0090 -0.0208 167 HIS B O   
3087 C  CB  . HIS B 167 ? 0.1737 0.1786 0.2450 0.0464  -0.0758 -0.0338 167 HIS B CB  
3088 C  CG  . HIS B 167 ? 0.1870 0.1500 0.2423 0.0292  -0.0757 -0.0195 167 HIS B CG  
3089 N  ND1 . HIS B 167 ? 0.1906 0.1622 0.1795 0.0225  -0.0426 -0.0410 167 HIS B ND1 
3090 C  CD2 . HIS B 167 ? 0.1605 0.2260 0.2304 0.0049  -0.0663 0.0370  167 HIS B CD2 
3091 C  CE1 . HIS B 167 ? 0.2097 0.1749 0.1933 0.0148  -0.0571 -0.0177 167 HIS B CE1 
3092 N  NE2 . HIS B 167 ? 0.2253 0.1901 0.1895 -0.0071 -0.0792 0.0066  167 HIS B NE2 
3093 N  N   . ASN B 168 ? 0.1312 0.1680 0.1732 -0.0050 -0.0249 0.0097  168 ASN B N   
3094 C  CA  . ASN B 168 ? 0.1533 0.1687 0.1721 -0.0141 -0.0270 -0.0067 168 ASN B CA  
3095 C  C   . ASN B 168 ? 0.1741 0.1845 0.1749 0.0033  -0.0138 -0.0124 168 ASN B C   
3096 O  O   . ASN B 168 ? 0.2196 0.1820 0.1736 -0.0455 -0.0466 -0.0219 168 ASN B O   
3097 C  CB  . ASN B 168 ? 0.1474 0.1956 0.1403 -0.0057 0.0166  0.0324  168 ASN B CB  
3098 C  CG  . ASN B 168 ? 0.1407 0.1532 0.1175 -0.0005 0.0088  0.0030  168 ASN B CG  
3099 O  OD1 . ASN B 168 ? 0.1475 0.1720 0.1212 -0.0026 -0.0027 -0.0144 168 ASN B OD1 
3100 N  ND2 . ASN B 168 ? 0.1550 0.1637 0.1019 -0.0041 0.0106  0.0062  168 ASN B ND2 
3101 N  N   . ARG B 169 ? 0.1753 0.2215 0.1769 0.0181  -0.0094 0.0076  169 ARG B N   
3102 C  CA  . ARG B 169 ? 0.2648 0.2837 0.1996 0.0114  0.0238  -0.0315 169 ARG B CA  
3103 C  C   . ARG B 169 ? 0.2686 0.2648 0.1594 0.0243  0.0204  -0.0377 169 ARG B C   
3104 O  O   . ARG B 169 ? 0.4317 0.2778 0.2620 0.0182  0.0755  -0.0876 169 ARG B O   
3105 C  CB  . ARG B 169 ? 0.2817 0.3014 0.1767 -0.0095 0.0049  -0.0379 169 ARG B CB  
3106 C  CG  . ARG B 169 ? 0.5735 0.5340 0.2628 0.2922  0.1712  0.1492  169 ARG B CG  
3107 C  CD  . ARG B 169 ? 0.7959 0.5453 0.3086 0.3764  0.2570  0.1862  169 ARG B CD  
3108 N  NE  . ARG B 169 ? 0.8732 0.5783 0.3848 0.2623  0.1716  0.2259  169 ARG B NE  
3109 C  CZ  . ARG B 169 ? 0.9075 0.7281 0.4012 0.2684  0.1007  0.1998  169 ARG B CZ  
3110 N  NH1 . ARG B 169 ? 1.0754 1.0878 0.4048 0.4570  -0.0515 0.4112  169 ARG B NH1 
3111 N  NH2 . ARG B 169 ? 1.0244 0.8527 0.4025 0.0583  0.3532  0.0179  169 ARG B NH2 
3122 C  CG  A HIS B 170 ? 0.2669 0.4650 0.2978 0.1292  0.0390  0.1774  170 HIS B CG  
3123 C  CG  B HIS B 170 ? 0.3684 0.1585 0.2749 0.0115  -0.0782 -0.0713 170 HIS B CG  
3124 N  ND1 A HIS B 170 ? 0.2347 0.4528 0.3160 0.0583  -0.0220 0.2804  170 HIS B ND1 
3125 N  ND1 B HIS B 170 ? 0.3285 0.1780 0.2913 0.0046  -0.0498 -0.0611 170 HIS B ND1 
3126 C  CD2 A HIS B 170 ? 0.2862 0.5064 0.2725 0.0186  0.0032  0.1641  170 HIS B CD2 
3127 C  CD2 B HIS B 170 ? 0.5370 0.2523 0.2813 -0.0606 -0.0432 -0.1013 170 HIS B CD2 
3128 C  CE1 A HIS B 170 ? 0.2770 0.5078 0.2908 0.0713  -0.0320 0.1551  170 HIS B CE1 
3129 C  CE1 B HIS B 170 ? 0.4661 0.1992 0.3064 0.0110  -0.0069 -0.0538 170 HIS B CE1 
3130 N  NE2 A HIS B 170 ? 0.2809 0.4991 0.2883 0.0130  0.0438  0.1483  170 HIS B NE2 
3131 N  NE2 B HIS B 170 ? 0.6302 0.2334 0.2900 -0.0066 0.0281  -0.0952 170 HIS B NE2 
3132 N  N   . LEU B 171 ? 0.3369 0.3750 0.1836 0.0172  0.0375  0.0281  171 LEU B N   
3133 C  CA  . LEU B 171 ? 0.3301 0.4640 0.2065 -0.1163 -0.0230 0.0542  171 LEU B CA  
3134 C  C   . LEU B 171 ? 0.4911 0.4035 0.3868 -0.1014 -0.1574 0.1008  171 LEU B C   
3135 O  O   . LEU B 171 ? 0.5125 0.2778 0.4025 -0.1094 -0.1594 -0.0173 171 LEU B O   
3136 C  CB  . LEU B 171 ? 0.3432 0.6398 0.1967 -0.0419 -0.0465 0.0258  171 LEU B CB  
3137 C  CG  . LEU B 171 ? 0.3427 0.5930 0.2080 -0.1361 -0.0075 -0.0649 171 LEU B CG  
3138 C  CD1 . LEU B 171 ? 0.3043 0.5198 0.4615 -0.2356 0.0323  -0.1377 171 LEU B CD1 
3139 C  CD2 . LEU B 171 ? 0.3132 0.7038 0.2087 -0.1116 0.0310  -0.1634 171 LEU B CD2 
3140 N  N   . VAL B 172 ? 0.5399 0.4543 0.4801 -0.1497 -0.1248 0.1083  172 VAL B N   
3141 C  CA  . VAL B 172 ? 0.6991 0.4357 0.5488 -0.1748 -0.0851 0.0592  172 VAL B CA  
3142 C  C   . VAL B 172 ? 0.7533 0.3555 0.5964 -0.1927 -0.0413 0.0851  172 VAL B C   
3143 O  O   . VAL B 172 ? 1.0926 0.5647 0.6509 0.2289  0.2143  0.1320  172 VAL B O   
3147 N  N   . LEU B 173 ? 0.7894 0.3233 0.5491 -0.1965 -0.0922 0.0453  173 LEU B N   
3148 C  CA  . LEU B 173 ? 0.8111 0.3529 0.4991 -0.2230 -0.1028 0.0144  173 LEU B CA  
3149 C  C   . LEU B 173 ? 0.5924 0.3401 0.5103 -0.2442 -0.1542 0.0468  173 LEU B C   
3150 O  O   . LEU B 173 ? 0.6628 0.3181 0.4819 -0.1441 -0.2741 0.0421  173 LEU B O   
3151 C  CB  . LEU B 173 ? 0.8091 0.2612 0.3941 -0.2402 -0.0380 -0.0125 173 LEU B CB  
3152 C  CG  . LEU B 173 ? 0.8172 0.3399 0.4806 -0.1417 0.0081  -0.0496 173 LEU B CG  
3153 C  CD1 . LEU B 173 ? 1.1890 0.4217 0.4965 0.0375  -0.0349 -0.1908 173 LEU B CD1 
3154 C  CD2 . LEU B 173 ? 0.9815 0.3458 0.5462 -0.3162 0.0915  0.1491  173 LEU B CD2 
3155 N  N   . PRO B 174 ? 0.5432 0.4259 0.5565 -0.1194 -0.1041 0.1146  174 PRO B N   
3156 C  CA  . PRO B 174 ? 0.4747 0.3964 0.6514 -0.1957 -0.1549 0.1281  174 PRO B CA  
3157 C  C   . PRO B 174 ? 0.4845 0.3739 0.5963 -0.1766 -0.1693 -0.0727 174 PRO B C   
3158 O  O   . PRO B 174 ? 0.4537 0.3132 0.4382 -0.1285 -0.1662 -0.0241 174 PRO B O   
3159 C  CB  . PRO B 174 ? 0.5186 0.5414 0.6934 -0.1244 -0.1520 0.2545  174 PRO B CB  
3160 C  CG  . PRO B 174 ? 0.5271 0.6394 0.5950 -0.0586 -0.1463 0.2253  174 PRO B CG  
3161 C  CD  . PRO B 174 ? 0.6112 0.5527 0.5653 -0.0217 -0.0316 0.1527  174 PRO B CD  
3162 N  N   . PRO B 175 ? 0.5723 0.3590 0.5684 -0.1426 -0.2822 -0.0740 175 PRO B N   
3163 C  CA  . PRO B 175 ? 0.6019 0.3571 0.5636 -0.0956 -0.2252 -0.0862 175 PRO B CA  
3164 C  C   . PRO B 175 ? 0.4769 0.4633 0.5321 -0.0268 -0.1622 -0.1295 175 PRO B C   
3165 O  O   . PRO B 175 ? 0.4403 1.1494 0.6831 -0.2162 -0.1594 -0.0674 175 PRO B O   
3166 C  CB  . PRO B 175 ? 0.7243 0.3341 0.6097 -0.0842 -0.2958 -0.0705 175 PRO B CB  
3167 C  CG  . PRO B 175 ? 0.7289 0.3465 0.7261 -0.1323 -0.3416 -0.0294 175 PRO B CG  
3168 C  CD  . PRO B 175 ? 0.6687 0.3462 0.6583 -0.1573 -0.3433 -0.0492 175 PRO B CD  
3169 N  N   . THR B 176 ? 0.5743 0.3211 0.5627 -0.0731 -0.1042 -0.1300 176 THR B N   
3170 C  CA  . THR B 176 ? 0.4721 0.2577 0.5166 -0.1081 -0.0561 -0.0053 176 THR B CA  
3171 C  C   . THR B 176 ? 0.4082 0.3061 0.3497 -0.1575 0.0278  0.0010  176 THR B C   
3172 O  O   . THR B 176 ? 0.4775 0.2897 0.6270 -0.0271 -0.1237 -0.1587 176 THR B O   
3173 C  CB  . THR B 176 ? 0.5989 0.3410 0.6232 -0.2481 -0.0149 0.1727  176 THR B CB  
3174 O  OG1 . THR B 176 ? 0.9018 0.3142 0.9284 -0.2346 0.0942  0.1204  176 THR B OG1 
3175 C  CG2 . THR B 176 ? 0.7095 0.5478 0.5269 -0.2764 0.0461  0.2102  176 THR B CG2 
3176 N  N   . ARG B 177 ? 0.3927 0.2474 0.2971 -0.1703 0.0452  -0.0478 177 ARG B N   
3177 C  CA  . ARG B 177 ? 0.4427 0.2813 0.2502 -0.2132 0.0267  -0.0586 177 ARG B CA  
3178 C  C   . ARG B 177 ? 0.4077 0.3069 0.1869 -0.2173 -0.0473 0.0033  177 ARG B C   
3179 O  O   . ARG B 177 ? 0.3039 0.6078 0.2091 -0.1098 -0.0400 -0.1030 177 ARG B O   
3180 C  CB  . ARG B 177 ? 0.5288 0.2264 0.4360 -0.1924 0.0825  -0.0478 177 ARG B CB  
3181 C  CG  . ARG B 177 ? 0.5211 0.3141 0.5086 -0.1430 0.1424  -0.0403 177 ARG B CG  
3182 C  CD  . ARG B 177 ? 0.4425 0.2304 0.5240 -0.0330 0.1389  0.0120  177 ARG B CD  
3183 N  NE  . ARG B 177 ? 0.2771 0.2200 0.5391 0.0165  0.0939  0.0347  177 ARG B NE  
3184 C  CZ  . ARG B 177 ? 0.2716 0.2952 0.6058 0.0328  0.0408  0.1629  177 ARG B CZ  
3185 N  NH1 . ARG B 177 ? 0.3231 0.2058 0.3959 -0.0108 -0.0621 -0.0180 177 ARG B NH1 
3186 N  NH2 . ARG B 177 ? 0.2601 0.3092 0.4919 0.0250  -0.0682 -0.0721 177 ARG B NH2 
3187 N  N   . ARG B 178 ? 0.3205 0.1479 0.1302 -0.0322 -0.0433 -0.0030 178 ARG B N   
3188 C  CA  . ARG B 178 ? 0.2910 0.1088 0.1668 -0.0046 -0.0362 -0.0083 178 ARG B CA  
3189 C  C   . ARG B 178 ? 0.2614 0.1093 0.1331 -0.0142 -0.0459 -0.0179 178 ARG B C   
3190 O  O   . ARG B 178 ? 0.2413 0.1200 0.1431 -0.0207 -0.0218 -0.0181 178 ARG B O   
3191 C  CB  . ARG B 178 ? 0.3160 0.1331 0.1903 0.0158  -0.0454 0.0158  178 ARG B CB  
3192 C  CG  . ARG B 178 ? 0.3712 0.1249 0.2800 0.0417  -0.1234 -0.0457 178 ARG B CG  
3193 C  CD  . ARG B 178 ? 0.3974 0.1914 0.2139 0.0932  -0.0917 -0.0836 178 ARG B CD  
3194 N  NE  . ARG B 178 ? 0.2900 0.1822 0.1739 0.0377  -0.0268 -0.0367 178 ARG B NE  
3195 C  CZ  . ARG B 178 ? 0.2991 0.2051 0.1900 0.0718  -0.0271 -0.0802 178 ARG B CZ  
3196 N  NH1 . ARG B 178 ? 0.3447 0.2224 0.2217 0.0719  0.0326  -0.0396 178 ARG B NH1 
3197 N  NH2 . ARG B 178 ? 0.3001 0.2145 0.2131 0.0766  -0.0512 -0.0864 178 ARG B NH2 
3198 N  N   . ARG B 179 ? 0.2532 0.1325 0.1555 -0.0167 0.0008  -0.0148 179 ARG B N   
3199 C  CA  . ARG B 179 ? 0.2316 0.1374 0.1231 -0.0068 0.0175  -0.0242 179 ARG B CA  
3200 C  C   . ARG B 179 ? 0.2374 0.1350 0.1968 0.0258  0.0515  -0.0034 179 ARG B C   
3201 O  O   . ARG B 179 ? 0.3010 0.1466 0.3923 -0.0060 0.1611  -0.0471 179 ARG B O   
3202 C  CB  . ARG B 179 ? 0.2851 0.2020 0.1494 0.0170  -0.0240 -0.0210 179 ARG B CB  
3203 C  CG  . ARG B 179 ? 0.2844 0.1931 0.1700 0.0056  -0.0453 -0.0206 179 ARG B CG  
3204 C  CD  . ARG B 179 ? 0.3045 0.2309 0.2133 0.0408  -0.0846 -0.0483 179 ARG B CD  
3205 N  NE  . ARG B 179 ? 0.3032 0.2407 0.2386 0.0068  -0.0845 -0.0998 179 ARG B NE  
3206 C  CZ  . ARG B 179 ? 0.2782 0.2180 0.1587 -0.0186 -0.0358 -0.0521 179 ARG B CZ  
3207 N  NH1 . ARG B 179 ? 0.2856 0.2432 0.1583 -0.0229 -0.0310 -0.0113 179 ARG B NH1 
3208 N  NH2 . ARG B 179 ? 0.2897 0.2226 0.1811 -0.0226 -0.0720 -0.0639 179 ARG B NH2 
3209 N  N   . LEU B 180 ? 0.2043 0.1634 0.1033 0.0089  0.0308  -0.0170 180 LEU B N   
3210 C  CA  . LEU B 180 ? 0.1631 0.1621 0.1486 0.0395  0.0340  -0.0186 180 LEU B CA  
3211 C  C   . LEU B 180 ? 0.2055 0.1270 0.1390 0.0123  0.0432  -0.0198 180 LEU B C   
3212 O  O   . LEU B 180 ? 0.2211 0.1453 0.1270 0.0372  0.0459  0.0060  180 LEU B O   
3213 C  CB  . LEU B 180 ? 0.1870 0.1788 0.1875 0.0350  0.0144  -0.0276 180 LEU B CB  
3214 C  CG  . LEU B 180 ? 0.2181 0.2295 0.2430 -0.0269 0.0154  -0.0414 180 LEU B CG  
3215 C  CD1 . LEU B 180 ? 0.2383 0.5015 0.1378 0.1696  0.0007  -0.0698 180 LEU B CD1 
3216 C  CD2 . LEU B 180 ? 0.2342 0.3651 0.3426 0.0673  -0.1181 -0.0995 180 LEU B CD2 
3217 N  N   . LEU B 181 ? 0.1829 0.1331 0.1434 -0.0026 0.0457  -0.0222 181 LEU B N   
3218 C  CA  . LEU B 181 ? 0.1619 0.1504 0.1314 -0.0121 0.0432  -0.0265 181 LEU B CA  
3219 C  C   . LEU B 181 ? 0.1811 0.1450 0.1143 -0.0090 0.0019  -0.0080 181 LEU B C   
3220 O  O   . LEU B 181 ? 0.1795 0.1648 0.1345 0.0148  0.0212  -0.0023 181 LEU B O   
3221 C  CB  . LEU B 181 ? 0.1651 0.1850 0.1480 -0.0192 0.0315  -0.0534 181 LEU B CB  
3222 C  CG  . LEU B 181 ? 0.1979 0.2133 0.2676 -0.0441 0.0853  -0.1281 181 LEU B CG  
3223 C  CD1 . LEU B 181 ? 0.3621 0.2294 0.1823 -0.0341 0.0713  -0.1016 181 LEU B CD1 
3224 C  CD2 . LEU B 181 ? 0.2129 0.2239 0.2425 -0.0790 0.0096  -0.0626 181 LEU B CD2 
3225 N  N   . SER B 182 ? 0.1773 0.1363 0.0961 -0.0075 0.0109  -0.0115 182 SER B N   
3226 C  CA  . SER B 182 ? 0.1567 0.1370 0.0990 0.0068  0.0079  -0.0102 182 SER B CA  
3227 C  C   . SER B 182 ? 0.1491 0.1519 0.1018 0.0213  0.0174  -0.0112 182 SER B C   
3228 O  O   . SER B 182 ? 0.1744 0.1641 0.0970 0.0250  0.0118  -0.0029 182 SER B O   
3229 C  CB  . SER B 182 ? 0.1718 0.1500 0.1200 0.0220  0.0241  0.0159  182 SER B CB  
3230 O  OG  . SER B 182 ? 0.1579 0.2159 0.1074 0.0461  0.0120  0.0041  182 SER B OG  
3231 N  N   . TRP B 183 ? 0.1446 0.1618 0.0895 0.0286  0.0112  -0.0127 183 TRP B N   
3232 C  CA  . TRP B 183 ? 0.1398 0.1471 0.1077 0.0146  0.0203  -0.0002 183 TRP B CA  
3233 C  C   . TRP B 183 ? 0.1486 0.1641 0.0923 0.0269  -0.0016 -0.0216 183 TRP B C   
3234 O  O   . TRP B 183 ? 0.1634 0.2089 0.1067 0.0536  -0.0077 -0.0419 183 TRP B O   
3235 C  CB  . TRP B 183 ? 0.1684 0.1680 0.0916 0.0199  -0.0015 -0.0278 183 TRP B CB  
3236 C  CG  . TRP B 183 ? 0.1119 0.1630 0.0982 0.0042  0.0088  -0.0078 183 TRP B CG  
3237 C  CD1 . TRP B 183 ? 0.1468 0.1589 0.0965 0.0142  0.0005  -0.0122 183 TRP B CD1 
3238 C  CD2 . TRP B 183 ? 0.1348 0.1341 0.1082 0.0019  0.0091  -0.0099 183 TRP B CD2 
3239 N  NE1 . TRP B 183 ? 0.1279 0.1492 0.1048 0.0123  0.0100  -0.0035 183 TRP B NE1 
3240 C  CE2 . TRP B 183 ? 0.1410 0.1503 0.0941 0.0167  -0.0008 -0.0131 183 TRP B CE2 
3241 C  CE3 . TRP B 183 ? 0.1482 0.1681 0.1173 0.0344  -0.0126 -0.0209 183 TRP B CE3 
3242 C  CZ2 . TRP B 183 ? 0.1486 0.1821 0.1019 0.0313  0.0085  0.0111  183 TRP B CZ2 
3243 C  CZ3 . TRP B 183 ? 0.1483 0.1762 0.1356 0.0380  -0.0074 0.0100  183 TRP B CZ3 
3244 C  CH2 . TRP B 183 ? 0.1502 0.1811 0.1212 0.0293  0.0011  0.0089  183 TRP B CH2 
3245 N  N   . SER B 184 ? 0.1841 0.1914 0.0885 0.0494  0.0187  0.0117  184 SER B N   
3248 C  C   . SER B 184 ? 0.1606 0.1928 0.1142 0.0418  0.0305  0.0037  184 SER B C   
3249 O  O   . SER B 184 ? 0.1733 0.1993 0.1304 0.0139  0.0257  -0.0472 184 SER B O   
3252 O  OG  A SER B 184 ? 0.5735 0.4903 0.1618 0.3056  0.1000  0.0397  184 SER B OG  
3253 O  OG  B SER B 184 ? 0.2536 0.2074 0.0665 -0.0772 0.0109  -0.0026 184 SER B OG  
3254 N  N   . ASP B 185 ? 0.1602 0.1615 0.1130 0.0101  0.0073  -0.0174 185 ASP B N   
3255 C  CA  . ASP B 185 ? 0.1737 0.1571 0.1108 0.0276  0.0189  -0.0081 185 ASP B CA  
3256 C  C   . ASP B 185 ? 0.1711 0.1585 0.1246 0.0180  0.0078  -0.0084 185 ASP B C   
3257 O  O   . ASP B 185 ? 0.2036 0.1618 0.1293 0.0089  -0.0089 -0.0073 185 ASP B O   
3258 C  CB  . ASP B 185 ? 0.1669 0.1586 0.1094 0.0123  0.0116  -0.0166 185 ASP B CB  
3259 C  CG  . ASP B 185 ? 0.1774 0.1432 0.1481 0.0290  0.0229  -0.0002 185 ASP B CG  
3260 O  OD1 . ASP B 185 ? 0.1710 0.1652 0.1715 0.0264  0.0094  -0.0344 185 ASP B OD1 
3261 O  OD2 . ASP B 185 ? 0.2161 0.1392 0.2154 -0.0048 0.0882  -0.0439 185 ASP B OD2 
3262 N  N   . ASN B 186 ? 0.1688 0.1542 0.1531 0.0185  -0.0320 -0.0178 186 ASN B N   
3263 C  CA  . ASN B 186 ? 0.2644 0.1688 0.1163 0.0417  -0.0552 -0.0146 186 ASN B CA  
3264 C  C   . ASN B 186 ? 0.2251 0.1756 0.1301 0.0508  0.0030  -0.0214 186 ASN B C   
3265 O  O   . ASN B 186 ? 0.3145 0.1937 0.1677 0.0288  0.0519  -0.0154 186 ASN B O   
3266 C  CB  . ASN B 186 ? 0.4959 0.2144 0.1952 0.1651  -0.1393 -0.0965 186 ASN B CB  
3267 C  CG  . ASN B 186 ? 0.7097 0.3340 0.2392 0.1652  -0.0189 -0.1310 186 ASN B CG  
3268 O  OD1 . ASN B 186 ? 1.0272 0.4614 0.3192 0.2231  0.0967  0.1222  186 ASN B OD1 
3269 N  ND2 . ASN B 186 ? 1.0378 0.4525 0.7803 0.2504  0.2969  -0.2717 186 ASN B ND2 
3270 N  N   . TRP B 187 ? 0.2162 0.1902 0.1012 0.0378  -0.0199 -0.0070 187 TRP B N   
3271 C  CA  . TRP B 187 ? 0.1980 0.1991 0.1063 0.0894  0.0106  -0.0184 187 TRP B CA  
3272 C  C   . TRP B 187 ? 0.1686 0.2157 0.1020 0.0599  -0.0066 -0.0182 187 TRP B C   
3273 O  O   . TRP B 187 ? 0.2088 0.2191 0.1095 0.0730  0.0077  -0.0065 187 TRP B O   
3274 C  CB  . TRP B 187 ? 0.1905 0.2094 0.1214 0.0615  -0.0074 -0.0264 187 TRP B CB  
3275 C  CG  . TRP B 187 ? 0.1778 0.2284 0.1266 0.0763  0.0054  -0.0128 187 TRP B CG  
3276 C  CD1 . TRP B 187 ? 0.1930 0.2101 0.1329 0.0811  0.0090  -0.0158 187 TRP B CD1 
3277 C  CD2 . TRP B 187 ? 0.2206 0.2136 0.1105 0.0229  -0.0162 -0.0458 187 TRP B CD2 
3278 N  NE1 . TRP B 187 ? 0.2281 0.1984 0.1460 0.0498  -0.0041 -0.0223 187 TRP B NE1 
3279 C  CE2 . TRP B 187 ? 0.2197 0.1768 0.1278 0.0467  -0.0055 -0.0401 187 TRP B CE2 
3280 C  CE3 . TRP B 187 ? 0.1844 0.2676 0.1095 0.0109  -0.0070 -0.0298 187 TRP B CE3 
3281 C  CZ2 . TRP B 187 ? 0.2469 0.2524 0.1294 -0.0091 -0.0118 -0.0357 187 TRP B CZ2 
3282 C  CZ3 . TRP B 187 ? 0.1673 0.3395 0.1526 0.0147  -0.0045 0.0116  187 TRP B CZ3 
3283 C  CH2 . TRP B 187 ? 0.1885 0.2484 0.1918 0.0067  -0.0233 0.0007  187 TRP B CH2 
3284 N  N   . ARG B 188 ? 0.1604 0.2096 0.1219 0.0560  -0.0059 -0.0179 188 ARG B N   
3285 C  CA  . ARG B 188 ? 0.2089 0.2306 0.1434 0.1073  0.0107  0.0091  188 ARG B CA  
3286 C  C   . ARG B 188 ? 0.2233 0.2152 0.1455 0.1048  0.0063  -0.0263 188 ARG B C   
3287 O  O   . ARG B 188 ? 0.2565 0.2034 0.1458 0.0817  -0.0096 -0.0146 188 ARG B O   
3288 C  CB  . ARG B 188 ? 0.1698 0.3085 0.1625 0.0905  -0.0149 -0.0087 188 ARG B CB  
3289 C  CG  . ARG B 188 ? 0.1849 0.3530 0.1334 0.0504  -0.0170 -0.0618 188 ARG B CG  
3290 C  CD  . ARG B 188 ? 0.2305 0.3614 0.1634 0.0094  0.0212  -0.0983 188 ARG B CD  
3291 N  NE  . ARG B 188 ? 0.2873 0.3775 0.2575 -0.0306 0.0252  -0.0511 188 ARG B NE  
3292 C  CZ  . ARG B 188 ? 0.3060 0.4049 0.2670 0.0012  0.1053  -0.0057 188 ARG B CZ  
3293 N  NH1 . ARG B 188 ? 0.2195 0.6271 0.8707 -0.0129 0.0502  0.3161  188 ARG B NH1 
3294 N  NH2 . ARG B 188 ? 0.3704 0.3992 0.3281 -0.0277 0.1545  0.0063  188 ARG B NH2 
3295 N  N   . GLU B 189 ? 0.2855 0.2370 0.1424 0.1266  -0.0114 -0.0437 189 GLU B N   
3296 C  CA  . GLU B 189 ? 0.2293 0.2493 0.1605 0.1085  -0.0403 -0.0642 189 GLU B CA  
3297 C  C   . GLU B 189 ? 0.2769 0.2240 0.1352 0.1085  -0.0344 -0.0504 189 GLU B C   
3298 O  O   . GLU B 189 ? 0.3181 0.2027 0.1573 0.0853  -0.0513 -0.0558 189 GLU B O   
3299 C  CB  . GLU B 189 ? 0.3795 0.3397 0.1496 0.1146  -0.0541 -0.1207 189 GLU B CB  
3300 C  CG  . GLU B 189 ? 0.5591 0.4025 0.4251 -0.1136 -0.2099 -0.0882 189 GLU B CG  
3301 C  CD  . GLU B 189 ? 0.6017 0.7574 0.7855 -0.2538 -0.3196 0.2448  189 GLU B CD  
3302 O  OE1 . GLU B 189 ? 0.7741 1.0847 1.0454 -0.2270 -0.5797 0.2862  189 GLU B OE1 
3303 O  OE2 . GLU B 189 ? 0.8422 1.1490 1.1412 -0.4518 -0.1850 0.5008  189 GLU B OE2 
3304 N  N   . ILE B 190 ? 0.2459 0.1978 0.1317 0.0739  -0.0189 -0.0444 190 ILE B N   
3305 C  CA  . ILE B 190 ? 0.2122 0.2190 0.1602 0.0695  -0.0201 -0.0355 190 ILE B CA  
3306 C  C   . ILE B 190 ? 0.2046 0.1958 0.1418 0.0385  -0.0007 -0.0218 190 ILE B C   
3307 O  O   . ILE B 190 ? 0.2338 0.1740 0.1529 0.0278  0.0012  -0.0266 190 ILE B O   
3308 C  CB  . ILE B 190 ? 0.2220 0.1806 0.1710 0.0532  -0.0121 -0.0232 190 ILE B CB  
3309 C  CG1 . ILE B 190 ? 0.2858 0.2064 0.1618 0.0509  -0.0411 0.0239  190 ILE B CG1 
3310 C  CG2 . ILE B 190 ? 0.2277 0.2123 0.1753 0.0704  -0.0056 -0.0229 190 ILE B CG2 
3311 C  CD1 . ILE B 190 ? 0.2326 0.2969 0.2497 0.0729  -0.0017 0.0817  190 ILE B CD1 
3312 N  N   . LEU B 191 ? 0.2278 0.1628 0.1345 0.0409  -0.0061 -0.0174 191 LEU B N   
3313 C  CA  . LEU B 191 ? 0.1982 0.1641 0.1523 0.0518  -0.0064 -0.0183 191 LEU B CA  
3314 C  C   . LEU B 191 ? 0.2472 0.1799 0.1646 0.0814  0.0065  -0.0103 191 LEU B C   
3315 O  O   . LEU B 191 ? 0.2773 0.1811 0.1576 0.0753  -0.0189 -0.0179 191 LEU B O   
3316 C  CB  . LEU B 191 ? 0.1667 0.1879 0.1697 0.0590  0.0126  -0.0326 191 LEU B CB  
3317 C  CG  . LEU B 191 ? 0.1823 0.1724 0.1359 0.0349  0.0066  -0.0187 191 LEU B CG  
3318 C  CD1 . LEU B 191 ? 0.2191 0.1730 0.1290 0.0605  -0.0039 -0.0251 191 LEU B CD1 
3319 C  CD2 . LEU B 191 ? 0.1833 0.1912 0.1812 0.0279  0.0363  -0.0030 191 LEU B CD2 
3320 N  N   . ASP B 192 ? 0.2267 0.1893 0.1592 0.0841  -0.0166 -0.0219 192 ASP B N   
3321 C  CA  . ASP B 192 ? 0.2363 0.2070 0.1350 0.0977  -0.0263 -0.0312 192 ASP B CA  
3322 C  C   . ASP B 192 ? 0.2692 0.1848 0.1753 0.0972  -0.0051 -0.0224 192 ASP B C   
3323 O  O   . ASP B 192 ? 0.3786 0.1908 0.1622 0.1214  -0.0239 -0.0295 192 ASP B O   
3324 C  CB  . ASP B 192 ? 0.2947 0.2235 0.1635 0.0905  0.0109  -0.0403 192 ASP B CB  
3325 C  CG  . ASP B 192 ? 0.2051 0.2771 0.1992 0.1272  0.0010  -0.0519 192 ASP B CG  
3326 O  OD1 . ASP B 192 ? 0.3038 0.2252 0.2660 0.1009  -0.0280 -0.0649 192 ASP B OD1 
3327 O  OD2 . ASP B 192 ? 0.2757 0.3176 0.2012 0.1009  0.0155  -0.0023 192 ASP B OD2 
3328 N  N   . SER B 193 ? 0.2671 0.2127 0.1831 0.0673  -0.0056 -0.0244 193 SER B N   
3329 C  CA  . SER B 193 ? 0.2818 0.1730 0.2246 0.0761  0.0009  -0.0340 193 SER B CA  
3330 C  C   . SER B 193 ? 0.2969 0.1615 0.2344 0.0414  0.0249  -0.0349 193 SER B C   
3331 O  O   . SER B 193 ? 0.4525 0.1922 0.2438 -0.0316 -0.0217 -0.0026 193 SER B O   
3332 C  CB  . SER B 193 ? 0.2744 0.2283 0.2966 0.0690  -0.0260 -0.0580 193 SER B CB  
3333 O  OG  . SER B 193 ? 0.3041 0.2397 0.4482 0.1145  -0.0157 -0.0594 193 SER B OG  
3334 N  N   . LYS B 194 ? 0.3069 0.1531 0.1998 0.0387  0.0203  -0.0110 194 LYS B N   
3335 C  CA  . LYS B 194 ? 0.3889 0.1742 0.1950 0.0675  0.0354  -0.0090 194 LYS B CA  
3336 C  C   . LYS B 194 ? 0.4445 0.1970 0.1639 0.1090  0.0129  -0.0058 194 LYS B C   
3337 O  O   . LYS B 194 ? 0.5523 0.2928 0.1581 0.1573  0.0190  0.0270  194 LYS B O   
3338 C  CB  . LYS B 194 ? 0.3651 0.1676 0.1916 0.0612  0.0794  0.0116  194 LYS B CB  
3339 C  CG  . LYS B 194 ? 0.3488 0.1496 0.2797 0.0425  0.0478  -0.0511 194 LYS B CG  
3340 C  CD  . LYS B 194 ? 0.3786 0.2208 0.2474 -0.0048 -0.0324 0.0176  194 LYS B CD  
3341 C  CE  . LYS B 194 ? 0.3568 0.1800 0.3306 0.0108  -0.0536 -0.0866 194 LYS B CE  
3342 N  NZ  . LYS B 194 ? 0.3699 0.1697 0.2401 0.0433  -0.0509 -0.0166 194 LYS B NZ  
3343 N  N   . ARG B 195 ? 0.3672 0.2610 0.1689 0.0478  -0.0303 -0.0658 195 ARG B N   
3344 C  CA  . ARG B 195 ? 0.4182 0.2970 0.2344 0.0804  -0.0656 0.0344  195 ARG B CA  
3345 C  C   . ARG B 195 ? 0.6768 0.3913 0.4719 0.2173  0.1077  0.1998  195 ARG B C   
3346 O  O   . ARG B 195 ? 1.0651 0.2234 0.6005 0.1390  0.0395  0.1133  195 ARG B O   
3347 C  CB  . ARG B 195 ? 0.3480 0.2428 0.2703 0.0329  -0.0882 -0.0451 195 ARG B CB  
3348 C  CG  . ARG B 195 ? 0.3040 0.2356 0.2031 0.0721  -0.0191 -0.0639 195 ARG B CG  
3349 C  CD  . ARG B 195 ? 0.2810 0.2701 0.2237 0.1252  -0.0107 -0.0226 195 ARG B CD  
3350 N  NE  . ARG B 195 ? 0.2618 0.2481 0.2372 0.1067  0.0001  -0.0367 195 ARG B NE  
3351 C  CZ  . ARG B 195 ? 0.3570 0.2684 0.1756 0.1429  0.0213  -0.0560 195 ARG B CZ  
3352 N  NH1 . ARG B 195 ? 0.2914 0.3663 0.1998 0.0499  -0.0071 -0.0258 195 ARG B NH1 
3353 N  NH2 . ARG B 195 ? 0.2280 0.2578 0.2029 0.0637  0.0308  -0.0407 195 ARG B NH2 
3354 MG MG  . MG  C .   ? 0.0861 0.0773 0.0922 -0.0019 0.0005  0.0048  201 MG  A MG  
3355 P  P   . PO4 D .   ? 0.1041 0.1037 0.0910 0.0022  0.0015  0.0036  202 PO4 A P   
3356 O  O1  . PO4 D .   ? 0.1221 0.1002 0.1326 -0.0133 0.0173  0.0204  202 PO4 A O1  
3357 O  O2  . PO4 D .   ? 0.1109 0.1064 0.0874 0.0005  0.0003  0.0114  202 PO4 A O2  
3358 O  O3  . PO4 D .   ? 0.0962 0.1409 0.1141 0.0141  -0.0044 0.0063  202 PO4 A O3  
3359 O  O4  . PO4 D .   ? 0.1145 0.1131 0.1001 -0.0107 -0.0064 -0.0039 202 PO4 A O4  
3360 C  C1  . GOL E .   ? 0.2846 0.5920 0.1670 -0.1569 -0.0801 0.0577  203 GOL A C1  
3361 O  O1  . GOL E .   ? 0.4647 0.5056 0.2958 -0.0669 -0.0436 0.2062  203 GOL A O1  
3362 C  C2  . GOL E .   ? 0.4179 0.5726 0.2377 -0.1241 -0.0460 0.0664  203 GOL A C2  
3363 O  O2  . GOL E .   ? 0.4338 0.3123 0.8139 -0.1081 0.0138  0.2332  203 GOL A O2  
3364 C  C3  . GOL E .   ? 0.4268 0.4405 0.3032 0.0494  0.0690  0.1566  203 GOL A C3  
3365 O  O3  . GOL E .   ? 0.3626 0.3504 0.3912 0.0679  0.2402  0.1887  203 GOL A O3  
3366 C  C1  . GOL F .   ? 0.2868 0.2900 0.3265 -0.0976 0.1069  -0.1213 204 GOL A C1  
3367 O  O1  . GOL F .   ? 0.1876 0.2996 0.2130 -0.0459 0.0063  -0.0046 204 GOL A O1  
3368 C  C2  . GOL F .   ? 0.2052 0.2027 0.2756 0.0034  0.0564  -0.0455 204 GOL A C2  
3369 O  O2  . GOL F .   ? 0.1465 0.1798 0.2432 0.0170  -0.0035 -0.0226 204 GOL A O2  
3370 C  C3  . GOL F .   ? 0.1574 0.2479 0.5091 0.0431  0.0130  -0.0289 204 GOL A C3  
3371 O  O3  . GOL F .   ? 0.2041 0.2720 0.3103 -0.0112 -0.0004 0.0739  204 GOL A O3  
3390 NA NA  . NA  J .   ? 0.8913 0.4647 0.2779 0.1781  -0.0730 -0.0728 208 NA  A NA  
3391 MG MG  . MG  K .   ? 0.1138 0.1155 0.0981 -0.0069 -0.0027 0.0079  201 MG  B MG  
3392 P  P   . PO4 L .   ? 0.1207 0.1287 0.0921 0.0016  0.0009  -0.0030 202 PO4 B P   
3393 O  O1  . PO4 L .   ? 0.1356 0.1333 0.1326 0.0102  -0.0009 0.0074  202 PO4 B O1  
3394 O  O2  . PO4 L .   ? 0.1413 0.1326 0.0920 -0.0045 0.0017  0.0000  202 PO4 B O2  
3395 O  O3  . PO4 L .   ? 0.1236 0.1684 0.1087 -0.0157 0.0016  0.0118  202 PO4 B O3  
3396 O  O4  . PO4 L .   ? 0.1202 0.1324 0.0842 0.0070  -0.0013 0.0030  202 PO4 B O4  
3403 O  O   . HOH N .   ? 0.1226 0.1112 0.1188 0.0103  0.0223  0.0033  301 HOH A O   
3404 O  O   . HOH N .   ? 0.1713 0.1405 0.1824 -0.0399 0.0048  0.0007  302 HOH A O   
3405 O  O   . HOH N .   ? 0.1417 0.1383 0.1719 -0.0186 -0.0145 0.0017  303 HOH A O   
3406 O  O   . HOH N .   ? 0.1623 0.1366 0.1317 -0.0161 0.0256  0.0030  304 HOH A O   
3407 O  O   . HOH N .   ? 0.1655 0.1292 0.1065 -0.0146 -0.0130 0.0064  305 HOH A O   
3408 O  O   . HOH N .   ? 0.1019 0.1101 0.1890 -0.0090 -0.0048 0.0224  306 HOH A O   
3409 O  O   . HOH N .   ? 0.1178 0.1091 0.1310 -0.0259 0.0055  0.0050  307 HOH A O   
3410 O  O   . HOH N .   ? 0.1254 0.1076 0.1107 0.0068  0.0308  -0.0099 308 HOH A O   
3411 O  O   . HOH N .   ? 0.1307 0.0845 0.2104 -0.0275 -0.0547 0.0370  309 HOH A O   
3412 O  O   . HOH N .   ? 0.1780 0.0831 0.1203 -0.0068 -0.0011 0.0144  310 HOH A O   
3413 O  O   . HOH N .   ? 0.0834 0.0853 0.0976 -0.0007 -0.0043 0.0061  311 HOH A O   
3414 O  O   . HOH N .   ? 0.1133 0.1573 0.1324 -0.0203 0.0119  -0.0213 312 HOH A O   
3415 O  O   . HOH N .   ? 0.1673 0.0984 0.1579 0.0000  0.0147  0.0246  313 HOH A O   
3416 O  O   . HOH N .   ? 0.1130 0.1013 0.1441 -0.0078 0.0005  0.0040  314 HOH A O   
3417 O  O   . HOH N .   ? 0.1832 0.1070 0.1982 -0.0245 -0.0206 0.0160  315 HOH A O   
3418 O  O   . HOH N .   ? 0.1132 0.1089 0.1856 0.0017  -0.0285 -0.0258 316 HOH A O   
3419 O  O   . HOH N .   ? 0.1178 0.0961 0.2477 -0.0176 -0.0321 -0.0235 317 HOH A O   
3420 O  O   . HOH N .   ? 0.1218 0.1635 0.1628 0.0246  0.0069  0.0188  318 HOH A O   
3421 O  O   . HOH N .   ? 0.1194 0.1454 0.1112 -0.0008 -0.0039 -0.0060 319 HOH A O   
3422 O  O   . HOH N .   ? 0.0957 0.0883 0.1577 -0.0046 -0.0082 -0.0031 320 HOH A O   
3423 O  O   . HOH N .   ? 0.1372 0.1622 0.1657 0.0308  0.0043  -0.0105 321 HOH A O   
3424 O  O   . HOH N .   ? 0.1524 0.1054 0.2548 0.0095  -0.0022 -0.0060 322 HOH A O   
3425 O  O   . HOH N .   ? 0.1411 0.1704 0.1195 0.0051  -0.0079 0.0271  323 HOH A O   
3426 O  O   . HOH N .   ? 0.1412 0.1138 0.1434 -0.0116 0.0073  0.0065  324 HOH A O   
3427 O  O   . HOH N .   ? 0.1461 0.1213 0.1320 0.0021  0.0145  0.0089  325 HOH A O   
3428 O  O   . HOH N .   ? 0.1637 0.1347 0.2226 -0.0144 -0.0176 0.0345  326 HOH A O   
3429 O  O   . HOH N .   ? 0.1759 0.1861 0.2187 -0.0099 -0.0014 0.0086  327 HOH A O   
3430 O  O   . HOH N .   ? 0.2329 0.2113 0.1617 -0.0753 0.0359  -0.0500 328 HOH A O   
3431 O  O   . HOH N .   ? 0.1321 0.1542 0.1432 0.0187  -0.0075 0.0275  329 HOH A O   
3432 O  O   . HOH N .   ? 0.1838 0.1497 0.1414 0.0067  0.0308  -0.0024 330 HOH A O   
3433 O  O   . HOH N .   ? 0.1755 0.1453 0.1914 0.0059  -0.0043 -0.0195 331 HOH A O   
3434 O  O   . HOH N .   ? 0.1123 0.1946 0.1746 0.0076  0.0099  0.0202  332 HOH A O   
3435 O  O   . HOH N .   ? 0.1524 0.1508 0.1710 -0.0119 0.0044  -0.0328 333 HOH A O   
3436 O  O   . HOH N .   ? 0.1392 0.1583 0.1273 0.0085  -0.0127 -0.0079 334 HOH A O   
3437 O  O   . HOH N .   ? 0.1342 0.1780 0.1450 -0.0344 0.0020  0.0044  335 HOH A O   
3438 O  O   . HOH N .   ? 0.2152 0.1348 0.2288 -0.0177 0.0643  -0.0240 336 HOH A O   
3439 O  O   . HOH N .   ? 0.1835 0.1981 0.1912 0.0073  0.0335  0.0207  337 HOH A O   
3440 O  O   . HOH N .   ? 0.2085 0.1135 0.1540 -0.0305 -0.0642 0.0208  338 HOH A O   
3441 O  O   . HOH N .   ? 0.2377 0.2070 0.1238 -0.0663 0.0519  -0.0037 339 HOH A O   
3442 O  O   . HOH N .   ? 0.1407 0.1365 0.2178 -0.0090 0.0117  -0.0076 340 HOH A O   
3443 O  O   . HOH N .   ? 0.1860 0.3492 0.2459 0.0688  0.0129  0.1076  341 HOH A O   
3444 O  O   . HOH N .   ? 0.2859 0.1784 0.2802 -0.0345 0.0743  -0.0201 342 HOH A O   
3445 O  O   . HOH N .   ? 0.1416 0.1584 0.1947 0.0238  0.0389  0.0419  343 HOH A O   
3446 O  O   . HOH N .   ? 0.2129 0.1858 0.2265 -0.0072 -0.0158 0.0302  344 HOH A O   
3447 O  O   . HOH N .   ? 0.2259 0.2114 0.2009 -0.0509 -0.0160 0.0491  345 HOH A O   
3448 O  O   . HOH N .   ? 0.1579 0.2153 0.1349 0.0267  -0.0019 0.0250  346 HOH A O   
3449 O  O   . HOH N .   ? 0.2079 0.2176 0.1515 0.0181  0.0230  -0.0193 347 HOH A O   
3450 O  O   . HOH N .   ? 0.3383 0.2248 0.1847 -0.1314 -0.0285 0.0732  348 HOH A O   
3451 O  O   . HOH N .   ? 0.2133 0.1047 0.2453 -0.0292 -0.0316 0.0043  349 HOH A O   
3452 O  O   . HOH N .   ? 0.1240 0.2383 0.2207 0.0483  -0.0160 -0.0649 350 HOH A O   
3453 O  O   . HOH N .   ? 0.1490 0.2009 0.1700 0.0322  0.0059  0.0535  351 HOH A O   
3454 O  O   . HOH N .   ? 0.1257 0.2462 0.2108 -0.0146 -0.0101 0.0550  352 HOH A O   
3455 O  O   . HOH N .   ? 0.2059 0.2209 0.2584 0.0345  0.0556  0.0541  353 HOH A O   
3456 O  O   . HOH N .   ? 0.2135 0.1643 0.2231 0.0268  -0.0622 -0.0148 354 HOH A O   
3457 O  O   . HOH N .   ? 0.1733 0.1626 0.1978 -0.0046 -0.0006 -0.0035 355 HOH A O   
3458 O  O   . HOH N .   ? 0.2033 0.4225 0.1835 -0.0635 -0.0033 0.1827  356 HOH A O   
3459 O  O   . HOH N .   ? 0.1479 0.3317 0.3133 -0.0486 0.0497  -0.0762 357 HOH A O   
3460 O  O   . HOH N .   ? 0.2980 0.2165 0.1273 0.0678  0.0345  0.0102  358 HOH A O   
3461 O  O   . HOH N .   ? 0.2473 0.1455 0.3194 -0.0042 0.0328  -0.0061 359 HOH A O   
3462 O  O   . HOH N .   ? 0.4122 0.2047 0.1846 -0.1046 0.0353  -0.0235 360 HOH A O   
3463 O  O   . HOH N .   ? 0.2325 0.3045 0.3016 -0.1137 0.0295  -0.0023 361 HOH A O   
3464 O  O   . HOH N .   ? 0.2529 0.1901 0.1591 -0.0118 0.0275  0.0399  362 HOH A O   
3465 O  O   . HOH N .   ? 0.2309 0.1592 0.2632 0.0412  0.0147  0.0047  363 HOH A O   
3466 O  O   . HOH N .   ? 0.2594 0.2827 0.2030 0.0854  0.0549  0.0565  364 HOH A O   
3467 O  O   . HOH N .   ? 0.2753 0.4110 0.2029 0.0298  -0.0501 -0.0374 365 HOH A O   
3468 O  O   . HOH N .   ? 0.1652 0.2446 0.2654 0.0224  0.0209  0.0837  366 HOH A O   
3469 O  O   . HOH N .   ? 0.1587 0.1664 0.2929 0.0423  0.0447  0.0585  367 HOH A O   
3470 O  O   . HOH N .   ? 0.1654 0.1821 0.2263 -0.0185 -0.0440 0.0042  368 HOH A O   
3471 O  O   . HOH N .   ? 0.2505 0.1849 0.1676 0.0429  -0.0327 0.0141  369 HOH A O   
3472 O  O   . HOH N .   ? 0.1440 0.1158 0.1847 0.0292  0.0104  0.0410  370 HOH A O   
3473 O  O   . HOH N .   ? 0.2069 0.3017 0.2060 -0.0604 0.0092  0.0328  371 HOH A O   
3474 O  O   . HOH N .   ? 0.2608 0.3482 0.2639 -0.0359 0.1257  -0.0441 372 HOH A O   
3475 O  O   . HOH N .   ? 0.3447 0.2178 0.5057 -0.0870 -0.0768 0.0277  373 HOH A O   
3476 O  O   . HOH N .   ? 0.3270 0.2032 0.3304 0.0346  -0.0092 -0.0294 374 HOH A O   
3477 O  O   . HOH N .   ? 0.1511 0.4059 0.2370 0.0439  -0.0277 0.0039  375 HOH A O   
3478 O  O   . HOH N .   ? 0.2288 0.2503 0.3802 0.0089  0.1450  0.0272  376 HOH A O   
3479 O  O   . HOH N .   ? 0.2475 0.2999 0.1699 -0.0237 0.0064  0.0261  377 HOH A O   
3480 O  O   . HOH N .   ? 0.2072 0.2023 0.2440 -0.0493 0.0261  -0.0130 378 HOH A O   
3481 O  O   . HOH N .   ? 0.2530 0.2485 0.2246 0.0096  -0.0724 0.0618  379 HOH A O   
3482 O  O   . HOH N .   ? 0.4236 0.1851 0.1530 -0.0909 -0.0499 0.0185  380 HOH A O   
3483 O  O   . HOH N .   ? 0.3278 0.2110 0.2622 -0.0084 -0.0017 0.0060  381 HOH A O   
3484 O  O   . HOH N .   ? 0.1676 0.2305 0.3237 -0.0147 -0.0110 -0.0603 382 HOH A O   
3485 O  O   . HOH N .   ? 0.2687 0.2013 0.3047 0.0735  0.0855  0.0978  383 HOH A O   
3486 O  O   . HOH N .   ? 0.2654 0.2628 0.2485 -0.0334 0.0043  0.1196  384 HOH A O   
3487 O  O   . HOH N .   ? 0.2051 0.1942 0.3037 0.0965  -0.0424 -0.0514 385 HOH A O   
3488 O  O   . HOH N .   ? 0.1961 0.3392 0.3782 0.0421  0.0594  0.1291  386 HOH A O   
3489 O  O   . HOH N .   ? 0.3196 0.3585 0.2764 -0.0059 0.0991  -0.0193 387 HOH A O   
3490 O  O   . HOH N .   ? 0.2411 0.2667 0.4229 -0.0301 -0.1472 -0.0835 388 HOH A O   
3491 O  O   . HOH N .   ? 0.1211 0.1218 0.1108 0.0078  0.0109  -0.0051 389 HOH A O   
3492 O  O   . HOH N .   ? 0.3925 0.2241 0.2043 -0.1079 0.0320  -0.0255 390 HOH A O   
3493 O  O   . HOH N .   ? 0.2616 0.3020 0.2628 0.0350  0.0762  0.1212  391 HOH A O   
3494 O  O   . HOH N .   ? 0.3740 0.3324 0.3582 -0.0747 0.0783  -0.0243 392 HOH A O   
3495 O  O   . HOH N .   ? 0.2589 0.3714 0.1702 -0.0886 -0.0267 0.0371  393 HOH A O   
3496 O  O   . HOH N .   ? 0.2456 0.2386 0.2962 0.0324  0.0102  0.0209  394 HOH A O   
3497 O  O   . HOH N .   ? 0.1836 0.4005 0.2319 -0.0301 -0.0282 0.1469  395 HOH A O   
3498 O  O   . HOH N .   ? 0.3584 0.2793 0.3737 0.0013  -0.1258 -0.0250 396 HOH A O   
3499 O  O   . HOH N .   ? 0.3177 0.3561 0.2043 -0.0746 0.0477  -0.0467 397 HOH A O   
3500 O  O   . HOH N .   ? 0.4126 0.2827 0.1680 -0.0147 -0.0349 0.0061  398 HOH A O   
3501 O  O   . HOH N .   ? 0.2369 0.3353 0.2281 -0.1092 -0.0532 -0.0286 399 HOH A O   
3502 O  O   . HOH N .   ? 0.3302 0.3745 0.2274 0.0009  -0.0273 0.0495  400 HOH A O   
3503 O  O   . HOH N .   ? 0.3251 0.3822 0.2056 0.0664  -0.0192 0.0582  401 HOH A O   
3504 O  O   . HOH N .   ? 0.2584 0.2468 0.4040 -0.0861 -0.0116 0.0016  402 HOH A O   
3505 O  O   . HOH N .   ? 0.2482 0.2171 0.3645 0.0879  -0.0160 -0.0889 403 HOH A O   
3506 O  O   . HOH N .   ? 0.3219 0.2800 0.3291 -0.1605 0.0536  -0.0786 404 HOH A O   
3507 O  O   . HOH N .   ? 0.4193 0.1676 0.2611 0.0050  0.1404  -0.0234 405 HOH A O   
3508 O  O   . HOH N .   ? 0.4794 0.1615 0.3625 -0.0640 -0.0127 -0.0149 406 HOH A O   
3509 O  O   . HOH N .   ? 0.1834 0.2556 0.3115 0.0452  -0.0148 0.0265  407 HOH A O   
3510 O  O   . HOH N .   ? 0.3005 0.2243 0.3142 0.0354  -0.0727 -0.0498 408 HOH A O   
3511 O  O   . HOH N .   ? 0.3956 0.2481 0.4171 -0.0909 0.1952  -0.0177 409 HOH A O   
3512 O  O   . HOH N .   ? 0.3586 0.2308 0.3450 -0.0443 0.0523  0.0190  410 HOH A O   
3513 O  O   . HOH N .   ? 0.2966 0.3803 0.2767 -0.1170 -0.0060 -0.0234 411 HOH A O   
3514 O  O   . HOH N .   ? 0.3456 0.1297 0.1856 -0.0608 0.0655  -0.0386 412 HOH A O   
3515 O  O   . HOH N .   ? 0.2830 0.3506 0.2041 0.0544  -0.0009 0.0105  413 HOH A O   
3516 O  O   . HOH N .   ? 0.4794 0.2660 0.2780 -0.0252 0.0886  0.0149  414 HOH A O   
3517 O  O   . HOH N .   ? 0.2394 0.2899 0.4207 -0.0815 0.1695  -0.0686 415 HOH A O   
3518 O  O   . HOH N .   ? 0.2517 0.3511 0.2869 -0.0378 0.0776  -0.0379 416 HOH A O   
3519 O  O   . HOH N .   ? 0.3010 0.2246 0.2878 -0.0182 0.0039  -0.0654 417 HOH A O   
3520 O  O   . HOH N .   ? 0.3682 0.2475 0.1926 0.0354  -0.0318 -0.0056 418 HOH A O   
3521 O  O   . HOH N .   ? 0.3179 0.3996 0.2720 -0.0509 -0.0188 -0.0047 419 HOH A O   
3522 O  O   . HOH N .   ? 0.3388 0.3127 0.3080 0.0402  -0.0146 0.0390  420 HOH A O   
3523 O  O   . HOH N .   ? 1.0587 0.1679 0.2916 -0.0334 -0.2470 -0.0264 421 HOH A O   
3524 O  O   . HOH N .   ? 0.3490 0.3691 0.4162 -0.1004 -0.1887 0.1135  422 HOH A O   
3525 O  O   . HOH N .   ? 0.3362 0.2961 0.5573 -0.0282 0.0300  -0.1136 423 HOH A O   
3526 O  O   . HOH N .   ? 0.3284 0.2528 0.4686 -0.0233 0.0113  0.0265  424 HOH A O   
3527 O  O   . HOH N .   ? 0.2119 0.4302 0.2235 -0.0289 0.0569  -0.0820 425 HOH A O   
3528 O  O   . HOH N .   ? 0.3536 0.2022 0.4660 -0.0745 -0.0623 -0.0526 426 HOH A O   
3529 O  O   . HOH N .   ? 0.5445 0.2807 0.2832 0.1084  0.1130  0.0424  427 HOH A O   
3530 O  O   . HOH N .   ? 0.3756 0.4508 0.3056 0.0272  -0.0739 -0.1877 428 HOH A O   
3531 O  O   . HOH N .   ? 0.2937 0.4677 0.4463 -0.0509 -0.0108 0.0361  429 HOH A O   
3532 O  O   . HOH N .   ? 0.3480 0.4066 0.5184 -0.0576 0.1270  0.1363  430 HOH A O   
3533 O  O   . HOH N .   ? 0.1483 0.3879 0.6716 0.0297  -0.0980 0.1624  431 HOH A O   
3534 O  O   . HOH N .   ? 0.3280 0.2972 0.3788 0.0280  0.1996  0.0657  432 HOH A O   
3535 O  O   . HOH N .   ? 0.3079 0.3255 0.5605 -0.0512 0.1113  0.1373  433 HOH A O   
3536 O  O   . HOH N .   ? 0.2725 0.3043 0.3951 0.0069  -0.0170 -0.0678 434 HOH A O   
3537 O  O   . HOH N .   ? 0.2621 0.2906 0.2941 0.0364  -0.0402 -0.0352 435 HOH A O   
3538 O  O   . HOH N .   ? 0.3014 0.1561 0.2760 0.0509  0.0252  0.0091  436 HOH A O   
3539 O  O   . HOH N .   ? 0.3150 0.2011 0.3888 -0.0514 0.0029  0.0405  437 HOH A O   
3540 O  O   . HOH N .   ? 0.3968 0.3005 0.2782 0.0045  -0.0016 -0.0452 438 HOH A O   
3541 O  O   . HOH N .   ? 0.3264 0.4530 0.2255 0.0080  -0.0504 -0.0081 439 HOH A O   
3542 O  O   . HOH N .   ? 0.2213 0.2879 0.3779 0.0024  -0.0877 0.0487  440 HOH A O   
3543 O  O   . HOH N .   ? 0.3837 0.3934 0.4873 0.1240  0.1054  0.1305  441 HOH A O   
3544 O  O   . HOH N .   ? 0.1781 0.4089 0.5470 0.0193  0.0627  0.2170  442 HOH A O   
3545 O  O   . HOH N .   ? 0.2641 0.3858 0.2401 0.0698  -0.0065 0.0547  443 HOH A O   
3546 O  O   . HOH N .   ? 0.4088 0.3829 0.3663 -0.0130 0.0023  0.0868  444 HOH A O   
3547 O  O   . HOH N .   ? 0.3287 0.2447 0.3947 -0.0779 -0.0594 -0.0242 445 HOH A O   
3548 O  O   . HOH N .   ? 0.3365 0.2161 0.5614 -0.0450 0.0802  0.0999  446 HOH A O   
3549 O  O   . HOH N .   ? 0.1753 0.2549 0.3463 0.0196  -0.0440 -0.0606 447 HOH A O   
3550 O  O   . HOH N .   ? 0.4304 0.2728 0.3002 -0.0994 -0.0620 0.1053  448 HOH A O   
3551 O  O   . HOH N .   ? 0.2100 0.3776 0.5561 0.0530  0.0554  0.1300  449 HOH A O   
3552 O  O   . HOH N .   ? 0.2352 0.4356 0.4573 -0.1207 0.1509  -0.1128 450 HOH A O   
3553 O  O   . HOH N .   ? 0.3387 0.2781 0.3892 -0.0856 -0.0552 0.0750  451 HOH A O   
3554 O  O   . HOH N .   ? 0.3226 0.4026 0.4462 -0.0808 0.0239  -0.1528 452 HOH A O   
3555 O  O   . HOH N .   ? 0.4053 0.4094 0.3559 -0.1618 -0.0179 -0.0768 453 HOH A O   
3556 O  O   . HOH N .   ? 0.5607 0.2527 0.2432 -0.0884 -0.1975 0.0002  454 HOH A O   
3557 O  O   . HOH N .   ? 0.3972 0.3402 0.4227 0.0000  -0.0605 -0.0631 455 HOH A O   
3558 O  O   . HOH N .   ? 0.2038 0.4354 0.5656 0.1314  0.1006  0.1482  456 HOH A O   
3559 O  O   . HOH N .   ? 0.3614 0.2753 0.4520 -0.0433 0.0111  -0.0400 457 HOH A O   
3560 O  O   . HOH N .   ? 0.3319 0.3467 0.1783 0.0069  0.1100  0.0602  458 HOH A O   
3561 O  O   . HOH N .   ? 0.2293 0.5898 0.4519 0.1805  -0.0835 -0.2505 459 HOH A O   
3562 O  O   . HOH N .   ? 0.4912 0.3900 0.5631 -0.0655 -0.2399 -0.0460 460 HOH A O   
3563 O  O   . HOH N .   ? 0.2963 0.3529 0.5267 0.1158  -0.0976 0.0650  461 HOH A O   
3564 O  O   . HOH N .   ? 0.7066 0.2969 0.2395 -0.2014 -0.0619 0.0743  462 HOH A O   
3565 O  O   . HOH N .   ? 0.4845 0.4559 0.4928 -0.1553 -0.1090 0.0208  463 HOH A O   
3566 O  O   . HOH N .   ? 0.2108 0.5012 0.2587 -0.0643 -0.0085 0.1125  464 HOH A O   
3567 O  O   . HOH N .   ? 0.3471 0.2957 0.6456 0.0133  0.1248  0.0484  465 HOH A O   
3568 O  O   . HOH N .   ? 0.2468 0.4417 0.3583 0.1624  0.0346  0.0883  466 HOH A O   
3569 O  O   . HOH N .   ? 0.5447 0.4219 0.4325 0.0651  0.1201  0.1385  467 HOH A O   
3570 O  O   . HOH N .   ? 0.4145 0.4179 0.4822 0.2365  -0.0913 0.0788  468 HOH A O   
3571 O  O   . HOH N .   ? 0.3423 0.3919 0.6368 -0.1219 -0.0919 0.0788  469 HOH A O   
3572 O  O   . HOH N .   ? 0.3337 0.4701 0.4276 0.1069  0.1161  -0.0137 470 HOH A O   
3573 O  O   . HOH N .   ? 0.4161 0.3147 0.4894 0.1006  0.0149  0.1163  471 HOH A O   
3574 O  O   . HOH N .   ? 0.2653 0.2742 0.5613 -0.0198 0.0327  0.0924  472 HOH A O   
3575 O  O   . HOH N .   ? 0.5329 0.5443 0.3127 0.0213  0.0731  0.1226  473 HOH A O   
3576 O  O   . HOH N .   ? 0.6884 0.6785 0.4400 0.0976  0.0038  0.2448  474 HOH A O   
3577 O  O   . HOH N .   ? 0.3262 0.2992 0.6234 -0.0574 0.0994  -0.0578 475 HOH A O   
3578 O  O   . HOH N .   ? 0.4273 0.8365 0.4387 -0.0138 -0.1642 0.0351  476 HOH A O   
3579 O  O   . HOH N .   ? 0.3324 0.5815 0.5429 0.0621  -0.2489 -0.0016 477 HOH A O   
3580 O  O   . HOH N .   ? 0.4490 0.3166 0.4461 -0.0961 -0.0271 -0.0896 478 HOH A O   
3581 O  O   . HOH N .   ? 0.2913 0.3122 0.4629 0.0090  -0.0848 -0.0772 479 HOH A O   
3582 O  O   . HOH N .   ? 0.2852 0.3654 0.3190 -0.1527 -0.0858 0.1507  480 HOH A O   
3583 O  O   . HOH N .   ? 0.3392 0.1809 0.3877 -0.0067 -0.0313 -0.0439 481 HOH A O   
3584 O  O   . HOH N .   ? 0.3589 0.4461 0.5109 0.0558  -0.0772 0.1070  482 HOH A O   
3585 O  O   . HOH N .   ? 0.4114 0.3708 0.4481 0.1423  0.0533  0.1383  483 HOH A O   
3586 O  O   . HOH N .   ? 0.5818 0.3082 0.3256 -0.1841 -0.0591 0.0358  484 HOH A O   
3587 O  O   . HOH N .   ? 0.3541 0.3287 0.3820 -0.0226 0.1416  0.0347  485 HOH A O   
3588 O  O   . HOH N .   ? 0.3018 0.3307 0.3247 -0.0393 0.1581  0.0464  486 HOH A O   
3589 O  O   . HOH N .   ? 0.4565 0.5510 0.2598 0.3319  -0.1069 -0.0733 487 HOH A O   
3590 O  O   . HOH N .   ? 0.5268 0.3561 0.4196 0.1264  0.0634  -0.0058 488 HOH A O   
3591 O  O   . HOH N .   ? 0.3650 0.2769 0.3768 -0.0665 0.0845  -0.0629 489 HOH A O   
3592 O  O   . HOH N .   ? 0.4156 0.1916 0.5573 0.0861  0.2052  0.0512  490 HOH A O   
3593 O  O   . HOH N .   ? 0.3893 0.3325 0.4347 -0.0404 0.0296  -0.0281 491 HOH A O   
3594 O  O   . HOH N .   ? 0.4586 0.3033 0.5806 -0.0389 0.0039  -0.1783 492 HOH A O   
3595 O  O   . HOH N .   ? 0.5350 0.4067 0.3775 0.0667  0.0843  -0.1905 493 HOH A O   
3596 O  O   . HOH N .   ? 0.4640 0.4076 0.4163 0.2204  0.1035  0.0007  494 HOH A O   
3597 O  O   . HOH N .   ? 0.3715 0.4921 0.4260 -0.0607 0.0200  0.1909  495 HOH A O   
3598 O  O   . HOH N .   ? 0.5320 0.2117 0.2381 -0.0103 0.0126  -0.0194 496 HOH A O   
3599 O  O   . HOH N .   ? 0.5597 0.2776 0.4507 -0.1886 0.0171  -0.0535 497 HOH A O   
3600 O  O   . HOH N .   ? 0.4960 0.7651 0.3350 -0.0682 -0.1650 -0.0207 498 HOH A O   
3601 O  O   . HOH N .   ? 0.3339 0.6040 0.3799 -0.0583 0.0784  0.0468  499 HOH A O   
3602 O  O   . HOH N .   ? 0.3380 0.2765 0.3869 -0.0792 0.0910  -0.0907 500 HOH A O   
3603 O  O   . HOH N .   ? 0.4193 0.2576 0.2106 0.0938  0.1410  0.1030  501 HOH A O   
3604 O  O   . HOH N .   ? 0.5988 0.6096 0.3131 0.0331  -0.0239 -0.2431 502 HOH A O   
3605 O  O   . HOH N .   ? 0.6278 0.3580 0.3833 0.1313  0.0203  -0.1282 503 HOH A O   
3606 O  O   . HOH N .   ? 0.4116 0.7857 0.5166 0.0302  0.2568  0.1065  504 HOH A O   
3607 O  O   . HOH N .   ? 0.6205 0.4930 0.6530 -0.2662 -0.1359 0.0441  505 HOH A O   
3608 O  O   . HOH N .   ? 0.4006 0.8738 0.6760 -0.1662 -0.0258 0.1082  506 HOH A O   
3609 O  O   . HOH N .   ? 0.3574 0.4792 0.4993 0.1159  0.0737  -0.0678 507 HOH A O   
3610 O  O   . HOH N .   ? 0.3972 0.5770 0.3652 0.0284  -0.0834 -0.2314 508 HOH A O   
3611 O  O   . HOH N .   ? 0.2591 0.4530 0.4691 0.1135  -0.0264 -0.0656 509 HOH A O   
3612 O  O   . HOH N .   ? 0.4623 0.2766 0.3735 -0.1087 -0.0269 -0.0316 510 HOH A O   
3613 O  O   . HOH N .   ? 0.3002 0.4793 0.3521 0.0451  -0.1137 0.0310  511 HOH A O   
3614 O  O   . HOH N .   ? 0.2866 0.6855 0.4370 -0.0194 -0.0476 -0.1844 512 HOH A O   
3615 O  O   . HOH N .   ? 0.2885 0.3367 0.5427 0.0241  0.1295  -0.0394 513 HOH A O   
3616 O  O   . HOH N .   ? 0.9289 0.4323 0.4704 0.2919  0.0535  -0.0901 514 HOH A O   
3617 O  O   . HOH N .   ? 0.4178 0.4384 0.6089 -0.0884 -0.0269 -0.2108 515 HOH A O   
3618 O  O   . HOH N .   ? 0.4558 0.4446 0.5255 -0.2213 0.0744  0.0842  516 HOH A O   
3619 O  O   . HOH N .   ? 0.6063 0.4294 0.3627 0.0453  0.1435  -0.0761 517 HOH A O   
3620 O  O   . HOH N .   ? 0.3467 0.1240 0.1083 0.0831  -0.1067 -0.0479 518 HOH A O   
3621 O  O   . HOH N .   ? 0.3309 0.6232 0.4087 -0.0345 0.1765  0.0938  519 HOH A O   
3622 O  O   . HOH N .   ? 0.4958 0.7317 0.2985 0.3460  -0.0069 0.1677  520 HOH A O   
3623 O  O   . HOH N .   ? 0.4439 0.4842 0.4011 0.0922  0.2544  0.1121  521 HOH A O   
3624 O  O   . HOH N .   ? 0.2551 0.3935 0.6762 0.0118  0.2473  0.0180  522 HOH A O   
3625 O  O   . HOH N .   ? 0.7949 0.2020 0.5502 0.0532  0.0167  -0.0647 523 HOH A O   
3626 O  O   . HOH N .   ? 0.4125 0.5394 0.3330 0.0432  -0.0962 -0.0630 524 HOH A O   
3627 O  O   . HOH N .   ? 0.5052 0.2779 0.5548 -0.0592 0.1249  -0.0872 525 HOH A O   
3628 O  O   . HOH N .   ? 0.2943 0.4424 0.6453 -0.0211 -0.1981 -0.0528 526 HOH A O   
3629 O  O   . HOH N .   ? 0.4175 0.4551 0.2549 -0.0424 0.0371  -0.0100 527 HOH A O   
3630 O  O   . HOH N .   ? 0.3086 0.5671 0.4657 -0.0831 0.1046  0.0467  528 HOH A O   
3631 O  O   . HOH N .   ? 0.4156 0.3757 0.6745 -0.2444 0.0533  -0.0092 529 HOH A O   
3632 O  O   . HOH N .   ? 0.4035 0.4419 0.3148 0.0696  -0.0515 -0.1489 530 HOH A O   
3633 O  O   . HOH N .   ? 0.5566 0.2692 0.3432 -0.0106 -0.1336 -0.0652 531 HOH A O   
3634 O  O   . HOH N .   ? 0.4054 0.5564 0.2682 0.0051  -0.0537 -0.1016 532 HOH A O   
3635 O  O   . HOH N .   ? 0.4398 0.3776 0.6062 0.0583  0.0914  -0.1743 533 HOH A O   
3636 O  O   . HOH N .   ? 0.3429 0.4491 0.3767 0.1134  -0.0018 0.0896  534 HOH A O   
3637 O  O   . HOH N .   ? 0.4977 0.2827 0.2647 -0.0038 -0.1523 -0.0821 535 HOH A O   
3638 O  O   . HOH N .   ? 0.3840 0.3962 0.3619 -0.0461 -0.0561 0.1139  536 HOH A O   
3639 O  O   . HOH N .   ? 0.3087 0.4766 0.5317 -0.0539 -0.0071 -0.0142 537 HOH A O   
3650 O  O   . HOH O .   ? 0.1459 0.1420 0.1073 -0.0031 0.0087  -0.0065 301 HOH B O   
3651 O  O   . HOH O .   ? 0.1364 0.1457 0.1725 -0.0090 -0.0108 0.0423  302 HOH B O   
3652 O  O   . HOH O .   ? 0.1665 0.1242 0.1017 -0.0096 -0.0127 0.0150  303 HOH B O   
3653 O  O   . HOH O .   ? 0.1881 0.1362 0.1333 0.0151  -0.0028 0.0167  304 HOH B O   
3654 O  O   . HOH O .   ? 0.1434 0.1464 0.1115 -0.0095 -0.0056 0.0162  305 HOH B O   
3655 O  O   . HOH O .   ? 0.1382 0.1571 0.1069 -0.0138 -0.0055 -0.0030 306 HOH B O   
3656 O  O   . HOH O .   ? 0.1291 0.1736 0.1043 0.0010  0.0076  0.0263  307 HOH B O   
3657 O  O   . HOH O .   ? 0.1407 0.1673 0.1074 -0.0086 0.0019  0.0016  308 HOH B O   
3658 O  O   . HOH O .   ? 0.1775 0.1560 0.1123 -0.0177 -0.0101 0.0137  309 HOH B O   
3659 O  O   . HOH O .   ? 0.1800 0.2195 0.1819 0.0329  -0.0167 0.0096  310 HOH B O   
3660 O  O   . HOH O .   ? 0.1387 0.1913 0.1438 -0.0059 -0.0214 0.0632  311 HOH B O   
3661 O  O   . HOH O .   ? 0.2035 0.1244 0.3022 0.0104  -0.1063 0.0068  312 HOH B O   
3662 O  O   . HOH O .   ? 0.1642 0.1854 0.1492 0.0129  0.0276  0.0046  313 HOH B O   
3663 O  O   . HOH O .   ? 0.1114 0.1321 0.0978 0.0063  0.0014  0.0047  314 HOH B O   
3664 O  O   . HOH O .   ? 0.1163 0.1296 0.1334 0.0020  -0.0047 0.0150  315 HOH B O   
3665 O  O   . HOH O .   ? 0.1513 0.1925 0.1143 0.0186  -0.0131 0.0123  316 HOH B O   
3666 O  O   . HOH O .   ? 0.1640 0.1715 0.1823 0.0095  -0.0126 0.0447  317 HOH B O   
3667 O  O   . HOH O .   ? 0.1346 0.1418 0.1559 0.0043  -0.0003 -0.0058 318 HOH B O   
3668 O  O   . HOH O .   ? 0.1470 0.1612 0.1156 -0.0168 -0.0033 0.0121  319 HOH B O   
3669 O  O   . HOH O .   ? 0.2243 0.1933 0.1882 -0.0141 -0.0098 -0.0140 320 HOH B O   
3670 O  O   . HOH O .   ? 0.1724 0.1796 0.1374 -0.0383 -0.0047 0.0097  321 HOH B O   
3671 O  O   . HOH O .   ? 0.1357 0.1593 0.1150 -0.0049 -0.0083 0.0125  322 HOH B O   
3672 O  O   . HOH O .   ? 0.1428 0.1859 0.1509 -0.0096 -0.0210 0.0262  323 HOH B O   
3673 O  O   . HOH O .   ? 0.1884 0.2450 0.1468 -0.0106 0.0379  0.0036  324 HOH B O   
3674 O  O   . HOH O .   ? 0.1789 0.2482 0.1795 0.0182  0.0105  0.0422  325 HOH B O   
3675 O  O   . HOH O .   ? 0.2137 0.1559 0.2957 -0.0281 -0.0131 -0.0060 326 HOH B O   
3676 O  O   . HOH O .   ? 0.2294 0.1718 0.2067 -0.0622 -0.0535 0.0571  327 HOH B O   
3677 O  O   . HOH O .   ? 0.2444 0.2422 0.2150 -0.0501 -0.0155 -0.0054 328 HOH B O   
3678 O  O   . HOH O .   ? 0.2494 0.2948 0.1470 0.0573  0.0005  0.0557  329 HOH B O   
3679 O  O   . HOH O .   ? 0.1661 0.3647 0.2301 -0.0816 -0.0137 0.0960  330 HOH B O   
3680 O  O   . HOH O .   ? 0.3247 0.1521 0.1589 -0.0172 -0.0107 -0.0330 331 HOH B O   
3681 O  O   . HOH O .   ? 0.1816 0.2154 0.2640 -0.0120 -0.0270 0.0091  332 HOH B O   
3682 O  O   . HOH O .   ? 0.1680 0.3961 0.1969 -0.0384 0.0222  0.0306  333 HOH B O   
3683 O  O   . HOH O .   ? 0.1997 0.2069 0.2687 0.0070  -0.0369 0.0250  334 HOH B O   
3684 O  O   . HOH O .   ? 0.2169 0.1701 0.1966 0.0173  -0.0321 -0.0110 335 HOH B O   
3685 O  O   . HOH O .   ? 0.2472 0.2301 0.1669 0.0099  0.0572  0.0544  336 HOH B O   
3686 O  O   . HOH O .   ? 0.2254 0.2124 0.1974 0.0136  -0.0557 0.0320  337 HOH B O   
3687 O  O   . HOH O .   ? 0.2893 0.2422 0.1404 0.0858  0.0293  -0.0138 338 HOH B O   
3688 O  O   . HOH O .   ? 0.1910 0.2434 0.1482 -0.0575 -0.0069 0.0373  339 HOH B O   
3689 O  O   . HOH O .   ? 0.2182 0.2897 0.2068 -0.0266 -0.0463 0.1143  340 HOH B O   
3690 O  O   . HOH O .   ? 0.1954 0.1914 0.1847 -0.0057 0.0130  0.0237  341 HOH B O   
3691 O  O   . HOH O .   ? 0.2651 0.2194 0.2010 -0.0741 -0.0253 0.0328  342 HOH B O   
3692 O  O   . HOH O .   ? 0.3427 0.2627 0.2286 -0.0113 0.0884  -0.1013 343 HOH B O   
3693 O  O   . HOH O .   ? 0.2509 0.2084 0.2326 -0.0273 -0.0977 -0.0054 344 HOH B O   
3694 O  O   . HOH O .   ? 0.2253 0.1970 0.2149 -0.0023 -0.0159 0.0043  345 HOH B O   
3695 O  O   . HOH O .   ? 0.2327 0.3531 0.3467 0.0650  0.0481  0.0966  346 HOH B O   
3696 O  O   . HOH O .   ? 0.2568 0.2401 0.3140 0.0396  -0.1072 -0.0541 347 HOH B O   
3697 O  O   . HOH O .   ? 0.2395 0.1907 0.2322 -0.0342 -0.0009 0.0255  348 HOH B O   
3698 O  O   . HOH O .   ? 0.1815 0.3085 0.2227 -0.0159 -0.0124 0.0464  349 HOH B O   
3699 O  O   . HOH O .   ? 0.3020 0.2385 0.1301 -0.0323 0.0274  -0.0271 350 HOH B O   
3700 O  O   . HOH O .   ? 0.2164 0.3074 0.2840 0.0951  -0.0488 -0.0005 351 HOH B O   
3701 O  O   . HOH O .   ? 0.1863 0.2495 0.3319 -0.0471 -0.0588 0.0321  352 HOH B O   
3702 O  O   . HOH O .   ? 0.3525 0.2447 0.2288 -0.0077 0.0880  0.0689  353 HOH B O   
3703 O  O   . HOH O .   ? 0.2134 0.2254 0.2927 0.0025  0.0231  0.0046  354 HOH B O   
3704 O  O   . HOH O .   ? 0.2468 0.4502 0.2630 -0.1138 -0.0078 -0.1100 355 HOH B O   
3705 O  O   . HOH O .   ? 0.1939 0.2258 0.3381 -0.0329 -0.0074 -0.0345 356 HOH B O   
3706 O  O   . HOH O .   ? 0.4006 0.3458 0.2138 0.0921  0.1248  -0.0222 357 HOH B O   
3707 O  O   . HOH O .   ? 0.1978 0.2414 0.3379 -0.0408 -0.0085 0.0582  358 HOH B O   
3708 O  O   . HOH O .   ? 0.3738 0.3070 0.1927 0.0881  0.0455  0.0013  359 HOH B O   
3709 O  O   . HOH O .   ? 0.2260 0.3845 0.2185 -0.0209 0.0348  -0.0854 360 HOH B O   
3710 O  O   . HOH O .   ? 0.3461 0.2287 0.1658 0.0483  -0.0095 -0.0100 361 HOH B O   
3711 O  O   . HOH O .   ? 0.1792 0.3935 0.1870 -0.0448 -0.0113 -0.0466 362 HOH B O   
3712 O  O   . HOH O .   ? 0.2401 0.3204 0.2399 0.0428  0.0327  0.0884  363 HOH B O   
3713 O  O   . HOH O .   ? 0.3147 0.3329 0.2397 0.0094  0.0884  0.0597  364 HOH B O   
3714 O  O   . HOH O .   ? 0.2735 0.3231 0.2039 0.0225  0.0389  -0.0407 365 HOH B O   
3715 O  O   . HOH O .   ? 0.3488 0.2507 0.3032 -0.0023 -0.0330 -0.0165 366 HOH B O   
3716 O  O   . HOH O .   ? 0.2445 0.2778 0.2618 -0.1051 0.0457  -0.0018 367 HOH B O   
3717 O  O   . HOH O .   ? 0.1565 0.1389 0.1101 -0.0101 -0.0020 0.0151  368 HOH B O   
3718 O  O   . HOH O .   ? 0.2176 0.2898 0.2226 0.0118  0.0397  0.0283  369 HOH B O   
3719 O  O   . HOH O .   ? 0.2520 0.3132 0.3598 0.0791  -0.0644 -0.1703 370 HOH B O   
3720 O  O   . HOH O .   ? 0.2485 0.4043 0.2709 -0.0326 0.0157  -0.1525 371 HOH B O   
3721 O  O   . HOH O .   ? 0.4739 0.3372 0.2501 0.2900  0.0484  0.0080  372 HOH B O   
3722 O  O   . HOH O .   ? 0.2820 0.2554 0.1815 0.0121  -0.0007 0.0433  373 HOH B O   
3723 O  O   . HOH O .   ? 0.2201 0.2249 0.3349 0.0344  -0.0723 -0.0511 374 HOH B O   
3724 O  O   . HOH O .   ? 0.2626 0.3320 0.2250 0.1132  0.0688  -0.0244 375 HOH B O   
3725 O  O   . HOH O .   ? 0.3327 0.3743 0.2687 0.0196  0.0181  0.0354  376 HOH B O   
3726 O  O   . HOH O .   ? 0.2564 0.2078 0.2477 -0.0449 0.0319  0.0140  377 HOH B O   
3727 O  O   . HOH O .   ? 0.2538 0.2714 0.2597 -0.0047 -0.0320 0.0311  378 HOH B O   
3728 O  O   . HOH O .   ? 0.3731 0.3291 0.2074 0.1001  -0.0526 0.0184  379 HOH B O   
3729 O  O   . HOH O .   ? 0.1940 0.3390 0.1993 -0.0054 -0.0033 -0.0084 380 HOH B O   
3730 O  O   . HOH O .   ? 0.2749 0.2927 0.1679 0.0771  0.0071  -0.0508 381 HOH B O   
3731 O  O   . HOH O .   ? 0.2402 0.2369 0.3510 0.0119  -0.0297 0.1116  382 HOH B O   
3732 O  O   . HOH O .   ? 0.2445 0.2462 0.2800 0.0618  -0.0444 -0.0446 383 HOH B O   
3733 O  O   . HOH O .   ? 0.4029 0.3520 0.2680 -0.0864 0.0086  0.1155  384 HOH B O   
3734 O  O   . HOH O .   ? 0.2034 0.3614 0.2708 -0.0310 -0.0313 0.0680  385 HOH B O   
3735 O  O   . HOH O .   ? 0.2462 0.3857 0.2741 0.0481  -0.0359 -0.0247 386 HOH B O   
3736 O  O   . HOH O .   ? 0.2697 0.3419 0.2954 -0.0189 -0.0345 -0.0955 387 HOH B O   
3737 O  O   . HOH O .   ? 0.3793 0.3672 0.1492 0.0282  -0.0056 -0.0267 388 HOH B O   
3738 O  O   . HOH O .   ? 0.4189 0.3374 0.3165 -0.1380 0.0776  0.1237  389 HOH B O   
3739 O  O   . HOH O .   ? 0.2294 0.2193 0.2980 0.0088  -0.0219 0.0531  390 HOH B O   
3740 O  O   . HOH O .   ? 0.2882 0.2828 0.2661 0.1010  0.0229  0.0257  391 HOH B O   
3741 O  O   . HOH O .   ? 0.3095 0.3418 0.2873 0.0417  -0.0757 0.0761  392 HOH B O   
3742 O  O   . HOH O .   ? 0.2418 0.3727 0.2460 0.0532  -0.0161 0.0154  393 HOH B O   
3743 O  O   . HOH O .   ? 0.3348 0.3013 0.3324 0.0020  0.0514  -0.1019 394 HOH B O   
3744 O  O   . HOH O .   ? 0.4945 0.2311 0.3725 -0.0621 -0.0598 0.0835  395 HOH B O   
3745 O  O   . HOH O .   ? 0.4128 0.3484 0.2414 0.1297  0.0226  -0.0616 396 HOH B O   
3746 O  O   . HOH O .   ? 0.4022 0.6068 0.3920 0.2248  0.2121  0.1212  397 HOH B O   
3747 O  O   . HOH O .   ? 0.2078 0.5284 0.2853 -0.0121 0.0042  -0.1044 398 HOH B O   
3748 O  O   . HOH O .   ? 0.2320 0.4184 0.2946 -0.1385 0.0346  -0.0703 399 HOH B O   
3749 O  O   . HOH O .   ? 0.3436 0.4306 0.3989 0.0487  -0.1034 -0.0446 400 HOH B O   
3750 O  O   . HOH O .   ? 0.2261 0.2905 0.2945 -0.0225 -0.0702 0.0940  401 HOH B O   
3751 O  O   . HOH O .   ? 0.1975 0.2570 0.4152 -0.0086 -0.0547 0.0071  402 HOH B O   
3752 O  O   . HOH O .   ? 0.3902 0.3927 0.3627 -0.0788 0.1376  -0.0308 403 HOH B O   
3753 O  O   . HOH O .   ? 0.2432 0.3160 0.2779 0.0524  -0.0464 0.0051  404 HOH B O   
3754 O  O   . HOH O .   ? 0.3488 0.2135 0.5281 0.0109  0.0581  0.1387  405 HOH B O   
3755 O  O   . HOH O .   ? 0.4094 0.2508 0.3804 0.0694  -0.0848 0.0458  406 HOH B O   
3756 O  O   . HOH O .   ? 0.3393 0.2296 0.3883 -0.0292 -0.1519 0.0231  407 HOH B O   
3757 O  O   . HOH O .   ? 0.1518 0.4123 0.3454 -0.0383 -0.0132 0.0276  408 HOH B O   
3758 O  O   . HOH O .   ? 0.2937 0.2488 0.3745 -0.0310 -0.0485 0.0323  409 HOH B O   
3759 O  O   . HOH O .   ? 0.3107 0.4079 0.2175 0.0458  -0.0315 -0.0174 410 HOH B O   
3760 O  O   . HOH O .   ? 0.2761 0.2926 0.2920 0.0459  0.0285  0.0161  411 HOH B O   
3761 O  O   . HOH O .   ? 0.4350 0.3763 0.2575 -0.0238 -0.1020 0.0376  412 HOH B O   
3762 O  O   . HOH O .   ? 0.3493 0.2702 0.3315 -0.0785 0.0815  0.0172  413 HOH B O   
3763 O  O   . HOH O .   ? 0.2934 0.4845 0.4573 0.0102  -0.0805 0.0807  414 HOH B O   
3764 O  O   . HOH O .   ? 0.4005 0.4742 0.2404 -0.0516 0.0186  -0.0859 415 HOH B O   
3765 O  O   . HOH O .   ? 0.5054 0.3020 0.3014 -0.0348 -0.0859 -0.0118 416 HOH B O   
3766 O  O   . HOH O .   ? 0.5629 0.3773 0.2210 0.0967  0.0966  0.0479  417 HOH B O   
3767 O  O   . HOH O .   ? 0.2966 0.4135 0.4206 0.0291  0.0002  0.0980  418 HOH B O   
3768 O  O   . HOH O .   ? 0.4494 0.2795 0.3196 -0.0661 -0.0271 -0.0388 419 HOH B O   
3769 O  O   . HOH O .   ? 0.4826 0.3168 0.4551 -0.1344 0.0293  -0.0267 420 HOH B O   
3770 O  O   . HOH O .   ? 0.6160 0.2266 0.3166 -0.0358 0.0275  -0.0402 421 HOH B O   
3771 O  O   . HOH O .   ? 0.2596 0.2534 0.1807 0.0276  0.0240  0.0229  422 HOH B O   
3772 O  O   . HOH O .   ? 0.4646 0.2819 0.2254 0.0371  0.0395  0.0216  423 HOH B O   
3773 O  O   . HOH O .   ? 0.2108 0.4768 0.2834 -0.0104 -0.0339 0.0335  424 HOH B O   
3774 O  O   . HOH O .   ? 0.3614 0.3834 0.4011 -0.0879 0.1639  -0.0379 425 HOH B O   
3775 O  O   . HOH O .   ? 0.3477 0.3365 0.4229 0.1244  0.0937  0.0576  426 HOH B O   
3776 O  O   . HOH O .   ? 0.3968 0.4088 0.3764 -0.0780 -0.0590 0.0300  427 HOH B O   
3777 O  O   . HOH O .   ? 0.3114 0.4736 0.2603 -0.0864 0.0386  0.0994  428 HOH B O   
3778 O  O   . HOH O .   ? 0.2587 0.5597 0.5601 -0.1414 0.0883  0.0423  429 HOH B O   
3779 O  O   . HOH O .   ? 0.4284 0.3210 0.2786 -0.0808 -0.0675 -0.0056 430 HOH B O   
3780 O  O   . HOH O .   ? 0.3599 0.5863 0.4333 -0.0202 -0.0771 -0.0452 431 HOH B O   
3781 O  O   . HOH O .   ? 0.4476 0.3317 0.4402 -0.1395 -0.0629 0.0530  432 HOH B O   
3782 O  O   . HOH O .   ? 0.6024 0.2216 0.5780 -0.1363 -0.0937 -0.1432 433 HOH B O   
3783 O  O   . HOH O .   ? 0.4582 0.3686 0.4777 -0.0076 -0.1897 -0.0731 434 HOH B O   
3784 O  O   . HOH O .   ? 0.4023 0.4370 0.3762 0.0146  -0.1285 0.0731  435 HOH B O   
3785 O  O   . HOH O .   ? 0.4820 0.5037 0.3306 0.0919  -0.0769 -0.1113 436 HOH B O   
3786 O  O   . HOH O .   ? 0.2507 0.4802 0.4487 0.0633  0.1042  -0.0598 437 HOH B O   
3787 O  O   . HOH O .   ? 0.4437 0.6597 0.3162 -0.0547 0.1211  0.0791  438 HOH B O   
3788 O  O   . HOH O .   ? 0.6392 0.2632 0.4270 -0.0155 -0.1120 0.0029  439 HOH B O   
3789 O  O   . HOH O .   ? 0.4508 0.3418 0.3427 -0.0989 0.0528  0.0661  440 HOH B O   
3790 O  O   . HOH O .   ? 0.5438 0.2410 0.3448 -0.0239 0.1220  -0.1253 441 HOH B O   
3791 O  O   . HOH O .   ? 0.4588 0.4923 0.4634 0.0575  0.0047  -0.0979 442 HOH B O   
3792 O  O   . HOH O .   ? 0.4733 0.4120 0.4151 0.0448  0.0153  0.0942  443 HOH B O   
3793 O  O   . HOH O .   ? 0.4844 0.4023 0.3827 0.2179  -0.1496 -0.1425 444 HOH B O   
3794 O  O   . HOH O .   ? 0.3435 0.4662 0.3521 0.1338  0.0604  0.1108  445 HOH B O   
3795 O  O   . HOH O .   ? 0.4359 0.2526 0.4024 0.1200  0.0853  0.0777  446 HOH B O   
3796 O  O   . HOH O .   ? 0.4731 0.3197 0.4231 -0.2015 -0.0310 -0.0015 447 HOH B O   
3797 O  O   . HOH O .   ? 0.5061 0.5963 0.5246 -0.2414 0.0140  0.1935  448 HOH B O   
3798 O  O   . HOH O .   ? 0.3609 0.4200 0.5075 0.1524  -0.1137 -0.0631 449 HOH B O   
3799 O  O   . HOH O .   ? 0.4228 0.4001 0.2988 0.0704  -0.0879 -0.0755 450 HOH B O   
3800 O  O   . HOH O .   ? 0.3306 0.3973 0.5373 -0.0433 -0.0436 0.0416  451 HOH B O   
3801 O  O   . HOH O .   ? 0.2930 0.4404 0.7215 -0.0005 0.2378  -0.0144 452 HOH B O   
3802 O  O   . HOH O .   ? 0.4696 0.6247 0.3274 -0.1781 0.0573  -0.0278 453 HOH B O   
3803 O  O   . HOH O .   ? 0.3769 0.4399 0.3403 0.1012  0.1555  0.1088  454 HOH B O   
3804 O  O   . HOH O .   ? 0.3387 0.3853 0.2922 0.0045  -0.0217 0.0898  455 HOH B O   
3805 O  O   . HOH O .   ? 0.4829 0.6026 0.5622 0.0393  0.0781  0.1703  456 HOH B O   
3806 O  O   . HOH O .   ? 0.3561 0.6148 0.5929 0.2154  0.1414  0.1867  457 HOH B O   
3807 O  O   . HOH O .   ? 0.5249 0.3426 0.4014 -0.0212 -0.0354 -0.1038 458 HOH B O   
3808 O  O   . HOH O .   ? 0.2311 0.2448 0.2315 -0.0742 0.0622  0.0112  459 HOH B O   
3809 O  O   . HOH O .   ? 0.3362 0.3133 0.3504 -0.1031 -0.0240 -0.0260 460 HOH B O   
3810 O  O   . HOH O .   ? 0.2971 0.2973 0.4091 0.0834  0.0445  0.0244  461 HOH B O   
3811 O  O   . HOH O .   ? 0.2844 0.6561 0.3152 -0.0056 -0.1053 0.0079  462 HOH B O   
3812 O  O   . HOH O .   ? 0.3673 0.3842 0.2638 0.0826  -0.0163 -0.0248 463 HOH B O   
3813 O  O   . HOH O .   ? 0.2055 0.4365 0.3451 0.0121  0.0423  0.0976  464 HOH B O   
3814 O  O   . HOH O .   ? 0.3849 0.2910 0.4548 0.0344  0.0192  -0.1106 465 HOH B O   
3815 O  O   . HOH O .   ? 0.3137 0.3817 0.4933 -0.0582 -0.0097 0.0153  466 HOH B O   
3816 O  O   . HOH O .   ? 0.3183 0.2344 0.4895 -0.0045 0.0135  -0.0678 467 HOH B O   
3817 O  O   . HOH O .   ? 0.2283 0.5328 0.3215 0.0987  0.0081  0.0355  468 HOH B O   
3818 O  O   . HOH O .   ? 0.3793 0.3550 0.3102 0.0106  0.1008  0.1059  469 HOH B O   
3819 O  O   . HOH O .   ? 0.6682 0.4147 0.4781 0.0037  0.1545  -0.1353 470 HOH B O   
3820 O  O   . HOH O .   ? 0.5468 0.4294 0.3856 0.1009  0.1211  -0.0599 471 HOH B O   
3821 O  O   . HOH O .   ? 0.6187 0.4234 0.2290 0.1481  0.1307  -0.0223 472 HOH B O   
3822 O  O   . HOH O .   ? 0.4711 0.4317 0.5469 -0.1235 0.0948  0.0971  473 HOH B O   
3823 O  O   . HOH O .   ? 0.3966 0.7210 0.3296 -0.2571 -0.0378 0.0677  474 HOH B O   
3824 O  O   . HOH O .   ? 0.4283 0.6913 0.3767 -0.1572 0.0786  0.2311  475 HOH B O   
3825 O  O   . HOH O .   ? 0.7422 0.6519 0.4554 0.1168  0.2949  0.0985  476 HOH B O   
3826 O  O   . HOH O .   ? 0.6618 0.2484 0.4411 -0.0381 0.1311  0.0175  477 HOH B O   
3827 O  O   . HOH O .   ? 0.4774 0.2607 0.4331 0.1063  -0.0223 0.0683  478 HOH B O   
3828 O  O   . HOH O .   ? 0.4108 0.5020 0.3832 -0.0825 -0.1125 -0.0726 479 HOH B O   
3829 O  O   . HOH O .   ? 0.5233 0.2855 0.6755 -0.0543 -0.0974 -0.0958 480 HOH B O   
3830 O  O   . HOH O .   ? 0.7107 0.3330 0.5606 0.1586  -0.1314 -0.0606 481 HOH B O   
3831 O  O   . HOH O .   ? 0.6315 0.5707 0.2398 0.1152  0.0762  -0.0166 482 HOH B O   
3832 O  O   . HOH O .   ? 0.2803 0.6112 0.2960 -0.0005 -0.0074 0.0936  483 HOH B O   
3833 O  O   . HOH O .   ? 0.4772 0.7198 0.4101 0.2568  -0.1489 0.0424  484 HOH B O   
3834 O  O   . HOH O .   ? 0.4712 0.3891 0.4582 0.2226  -0.1287 -0.2295 485 HOH B O   
3835 O  O   . HOH O .   ? 0.5725 0.5241 0.4243 -0.0051 0.1592  -0.0168 486 HOH B O   
3836 O  O   . HOH O .   ? 0.4933 0.4032 0.5172 0.2206  -0.0888 -0.0203 487 HOH B O   
3837 O  O   . HOH O .   ? 0.3533 0.2880 0.4894 -0.0244 0.0544  0.1022  488 HOH B O   
3838 O  O   . HOH O .   ? 0.3166 0.1639 0.3055 0.0192  0.1890  0.0224  489 HOH B O   
3839 O  O   . HOH O .   ? 0.5282 0.4495 0.5295 -0.1439 -0.1657 -0.0741 490 HOH B O   
3840 O  O   . HOH O .   ? 0.5377 0.5966 0.3400 -0.0901 -0.1528 0.0911  491 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   ARG 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   ARG 6   6   6   ARG ARG A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  MET 11  11  11  MET MET A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  PHE 18  18  18  PHE PHE A . n 
A 1 19  GLU 19  19  19  GLU GLU A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  ARG 24  24  24  ARG ARG A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  ARG 28  28  28  ARG ARG A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  PRO 31  31  31  PRO PRO A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  HIS 35  35  35  HIS HIS A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  GLN 40  40  40  GLN GLN A . n 
A 1 41  ARG 41  41  41  ARG ARG A . n 
A 1 42  ARG 42  42  42  ARG ARG A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  PHE 44  44  44  PHE PHE A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  GLN 49  49  49  GLN GLN A . n 
A 1 50  TYR 50  50  50  TYR TYR A . n 
A 1 51  ARG 51  51  51  ARG ARG A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  ASP 56  56  56  ASP ASP A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  TYR 65  65  65  TYR TYR A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  PRO 68  68  68  PRO PRO A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  PHE 70  70  70  PHE PHE A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  ASP 73  73  73  ASP ASP A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  GLU 75  75  75  GLU GLU A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  ILE 77  77  77  ILE ILE A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  MET 87  87  87  MET MET A . n 
A 1 88  ASN 88  88  88  ASN ASN A . n 
A 1 89  ASP 89  89  89  ASP ASP A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  PRO 91  91  91  PRO PRO A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  GLN 94  94  94  GLN GLN A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  CYS 98  98  98  CYS CYS A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 HIS 106 106 106 HIS HIS A . n 
A 1 107 HIS 107 107 107 HIS HIS A . n 
A 1 108 CYS 108 108 108 CYS CYS A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 TYR 113 113 113 TYR TYR A . n 
A 1 114 ARG 114 114 114 ARG ARG A . n 
A 1 115 TRP 115 115 115 TRP TRP A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 GLN 118 118 118 GLN GLN A . n 
A 1 119 HIS 119 119 119 HIS HIS A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 PRO 122 122 122 PRO PRO A . n 
A 1 123 GLN 123 123 123 GLN GLN A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 ARG 127 127 127 ARG ARG A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 ARG 132 132 132 ARG ARG A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 THR 135 135 135 THR THR A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 VAL 137 137 137 VAL VAL A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 ASP 140 140 140 ASP ASP A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 ASP 144 144 144 ASP ASP A . n 
A 1 145 ASP 145 145 145 ASP ASP A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 THR 148 148 148 THR THR A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 ARG 150 150 150 ARG ARG A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 GLN 152 152 152 GLN GLN A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 PRO 156 156 156 PRO PRO A . n 
A 1 157 SER 157 157 157 SER SER A . n 
A 1 158 TRP 158 158 158 TRP TRP A . n 
A 1 159 GLU 159 159 159 GLU GLU A . n 
A 1 160 HIS 160 160 160 HIS HIS A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 PHE 163 163 163 PHE PHE A . n 
A 1 164 THR 164 164 164 THR THR A . n 
A 1 165 CYS 165 165 165 CYS CYS A . n 
A 1 166 CYS 166 166 166 CYS CYS A . n 
A 1 167 HIS 167 167 167 HIS HIS A . n 
A 1 168 ASN 168 168 168 ASN ASN A . n 
A 1 169 ARG 169 169 169 ARG ARG A . n 
A 1 170 HIS 170 170 170 HIS HIS A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 PRO 174 174 174 PRO PRO A . n 
A 1 175 PRO 175 175 175 PRO PRO A . n 
A 1 176 THR 176 176 176 THR THR A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 ARG 178 178 178 ARG ARG A . n 
A 1 179 ARG 179 179 179 ARG ARG A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 SER 182 182 182 SER SER A . n 
A 1 183 TRP 183 183 183 TRP TRP A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 TRP 187 187 187 TRP TRP A . n 
A 1 188 ARG 188 188 188 ARG ARG A . n 
A 1 189 GLU 189 189 189 GLU GLU A . n 
A 1 190 ILE 190 190 190 ILE ILE A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 SER 193 193 193 SER SER A . n 
A 1 194 LYS 194 194 194 LYS LYS A . n 
A 1 195 ARG 195 195 195 ARG ARG A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   ALA 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   SER 4   4   4   SER SER B . n 
B 1 5   VAL 5   5   5   VAL VAL B . n 
B 1 6   ARG 6   6   6   ARG ARG B . n 
B 1 7   VAL 7   7   7   VAL VAL B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   VAL 9   9   9   VAL VAL B . n 
B 1 10  ASP 10  10  10  ASP ASP B . n 
B 1 11  MET 11  11  11  MET MET B . n 
B 1 12  ASP 12  12  12  ASP ASP B . n 
B 1 13  GLY 13  13  13  GLY GLY B . n 
B 1 14  VAL 14  14  14  VAL VAL B . n 
B 1 15  LEU 15  15  15  LEU LEU B . n 
B 1 16  ALA 16  16  16  ALA ALA B . n 
B 1 17  ASP 17  17  17  ASP ASP B . n 
B 1 18  PHE 18  18  18  PHE PHE B . n 
B 1 19  GLU 19  19  19  GLU GLU B . n 
B 1 20  ALA 20  20  20  ALA ALA B . n 
B 1 21  GLY 21  21  21  GLY GLY B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  LEU 23  23  23  LEU LEU B . n 
B 1 24  ARG 24  24  24  ARG ARG B . n 
B 1 25  GLY 25  25  25  GLY GLY B . n 
B 1 26  PHE 26  26  26  PHE PHE B . n 
B 1 27  ARG 27  27  27  ARG ARG B . n 
B 1 28  ARG 28  28  28  ARG ARG B . n 
B 1 29  ARG 29  29  29  ARG ARG B . n 
B 1 30  PHE 30  30  30  PHE PHE B . n 
B 1 31  PRO 31  31  31  PRO PRO B . n 
B 1 32  GLU 32  32  32  GLU GLU B . n 
B 1 33  GLU 33  33  33  GLU GLU B . n 
B 1 34  PRO 34  34  34  PRO PRO B . n 
B 1 35  HIS 35  35  35  HIS HIS B . n 
B 1 36  VAL 36  36  36  VAL VAL B . n 
B 1 37  PRO 37  37  37  PRO PRO B . n 
B 1 38  LEU 38  38  38  LEU LEU B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  GLN 40  40  40  GLN GLN B . n 
B 1 41  ARG 41  41  41  ARG ARG B . n 
B 1 42  ARG 42  42  42  ARG ARG B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  PHE 44  44  44  PHE PHE B . n 
B 1 45  LEU 45  45  45  LEU LEU B . n 
B 1 46  ALA 46  46  46  ALA ALA B . n 
B 1 47  ARG 47  47  47  ARG ARG B . n 
B 1 48  GLU 48  48  48  GLU GLU B . n 
B 1 49  GLN 49  49  49  GLN GLN B . n 
B 1 50  TYR 50  50  50  TYR TYR B . n 
B 1 51  ARG 51  51  51  ARG ARG B . n 
B 1 52  ALA 52  52  52  ALA ALA B . n 
B 1 53  LEU 53  53  53  LEU LEU B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  ASP 56  56  56  ASP ASP B . n 
B 1 57  LEU 57  57  57  LEU LEU B . n 
B 1 58  ALA 58  58  58  ALA ALA B . n 
B 1 59  ASP 59  59  59  ASP ASP B . n 
B 1 60  LYS 60  60  60  LYS LYS B . n 
B 1 61  VAL 61  61  61  VAL VAL B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  SER 63  63  63  SER SER B . n 
B 1 64  VAL 64  64  64  VAL VAL B . n 
B 1 65  TYR 65  65  65  TYR TYR B . n 
B 1 66  GLU 66  66  66  GLU GLU B . n 
B 1 67  ALA 67  67  67  ALA ALA B . n 
B 1 68  PRO 68  68  68  PRO PRO B . n 
B 1 69  GLY 69  69  69  GLY GLY B . n 
B 1 70  PHE 70  70  70  PHE PHE B . n 
B 1 71  PHE 71  71  71  PHE PHE B . n 
B 1 72  LEU 72  72  72  LEU LEU B . n 
B 1 73  ASP 73  73  73  ASP ASP B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  GLU 75  75  75  GLU GLU B . n 
B 1 76  PRO 76  76  76  PRO PRO B . n 
B 1 77  ILE 77  77  77  ILE ILE B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  ALA 80  80  80  ALA ALA B . n 
B 1 81  LEU 81  81  81  LEU LEU B . n 
B 1 82  ASP 82  82  82  ASP ASP B . n 
B 1 83  ALA 83  83  83  ALA ALA B . n 
B 1 84  VAL 84  84  84  VAL VAL B . n 
B 1 85  ARG 85  85  85  ARG ARG B . n 
B 1 86  GLU 86  86  86  GLU GLU B . n 
B 1 87  MET 87  87  87  MET MET B . n 
B 1 88  ASN 88  88  88  ASN ASN B . n 
B 1 89  ASP 89  89  89  ASP ASP B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  PRO 91  91  91  PRO PRO B . n 
B 1 92  ASP 92  92  92  ASP ASP B . n 
B 1 93  THR 93  93  93  THR THR B . n 
B 1 94  GLN 94  94  94  GLN GLN B . n 
B 1 95  VAL 95  95  95  VAL VAL B . n 
B 1 96  PHE 96  96  96  PHE PHE B . n 
B 1 97  ILE 97  97  97  ILE ILE B . n 
B 1 98  CYS 98  98  98  CYS CYS B . n 
B 1 99  THR 99  99  99  THR THR B . n 
B 1 100 SER 100 100 100 SER SER B . n 
B 1 101 PRO 101 101 101 PRO PRO B . n 
B 1 102 LEU 102 102 102 LEU LEU B . n 
B 1 103 LEU 103 103 103 LEU LEU B . n 
B 1 104 LYS 104 104 104 LYS LYS B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 HIS 106 106 106 HIS HIS B . n 
B 1 107 HIS 107 107 107 HIS HIS B . n 
B 1 108 CYS 108 108 108 CYS CYS B . n 
B 1 109 VAL 109 109 109 VAL VAL B . n 
B 1 110 GLY 110 110 110 GLY GLY B . n 
B 1 111 GLU 111 111 111 GLU GLU B . n 
B 1 112 LYS 112 112 112 LYS LYS B . n 
B 1 113 TYR 113 113 113 TYR TYR B . n 
B 1 114 ARG 114 114 114 ARG ARG B . n 
B 1 115 TRP 115 115 115 TRP TRP B . n 
B 1 116 VAL 116 116 116 VAL VAL B . n 
B 1 117 GLU 117 117 117 GLU GLU B . n 
B 1 118 GLN 118 118 118 GLN GLN B . n 
B 1 119 HIS 119 119 119 HIS HIS B . n 
B 1 120 LEU 120 120 120 LEU LEU B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 PRO 122 122 122 PRO PRO B . n 
B 1 123 GLN 123 123 123 GLN GLN B . n 
B 1 124 PHE 124 124 124 PHE PHE B . n 
B 1 125 VAL 125 125 125 VAL VAL B . n 
B 1 126 GLU 126 126 126 GLU GLU B . n 
B 1 127 ARG 127 127 127 ARG ARG B . n 
B 1 128 ILE 128 128 128 ILE ILE B . n 
B 1 129 ILE 129 129 129 ILE ILE B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 THR 131 131 131 THR THR B . n 
B 1 132 ARG 132 132 132 ARG ARG B . n 
B 1 133 ASP 133 133 133 ASP ASP B . n 
B 1 134 LYS 134 134 134 LYS LYS B . n 
B 1 135 THR 135 135 135 THR THR B . n 
B 1 136 VAL 136 136 136 VAL VAL B . n 
B 1 137 VAL 137 137 137 VAL VAL B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 GLY 139 139 139 GLY GLY B . n 
B 1 140 ASP 140 140 140 ASP ASP B . n 
B 1 141 LEU 141 141 141 LEU LEU B . n 
B 1 142 LEU 142 142 142 LEU LEU B . n 
B 1 143 ILE 143 143 143 ILE ILE B . n 
B 1 144 ASP 144 144 144 ASP ASP B . n 
B 1 145 ASP 145 145 145 ASP ASP B . n 
B 1 146 LYS 146 146 146 LYS LYS B . n 
B 1 147 ASP 147 147 147 ASP ASP B . n 
B 1 148 THR 148 148 148 THR THR B . n 
B 1 149 VAL 149 149 149 VAL VAL B . n 
B 1 150 ARG 150 150 150 ARG ARG B . n 
B 1 151 GLY 151 151 151 GLY GLY B . n 
B 1 152 GLN 152 152 152 GLN GLN B . n 
B 1 153 GLU 153 153 153 GLU GLU B . n 
B 1 154 GLU 154 154 154 GLU GLU B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 PRO 156 156 156 PRO PRO B . n 
B 1 157 SER 157 157 157 SER SER B . n 
B 1 158 TRP 158 158 158 TRP TRP B . n 
B 1 159 GLU 159 159 159 GLU GLU B . n 
B 1 160 HIS 160 160 160 HIS HIS B . n 
B 1 161 ILE 161 161 161 ILE ILE B . n 
B 1 162 LEU 162 162 162 LEU LEU B . n 
B 1 163 PHE 163 163 163 PHE PHE B . n 
B 1 164 THR 164 164 164 THR THR B . n 
B 1 165 CYS 165 165 165 CYS CYS B . n 
B 1 166 CYS 166 166 166 CYS CYS B . n 
B 1 167 HIS 167 167 167 HIS HIS B . n 
B 1 168 ASN 168 168 168 ASN ASN B . n 
B 1 169 ARG 169 169 169 ARG ARG B . n 
B 1 170 HIS 170 170 170 HIS HIS B . n 
B 1 171 LEU 171 171 171 LEU LEU B . n 
B 1 172 VAL 172 172 172 VAL VAL B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 PRO 174 174 174 PRO PRO B . n 
B 1 175 PRO 175 175 175 PRO PRO B . n 
B 1 176 THR 176 176 176 THR THR B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 ARG 178 178 178 ARG ARG B . n 
B 1 179 ARG 179 179 179 ARG ARG B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 LEU 181 181 181 LEU LEU B . n 
B 1 182 SER 182 182 182 SER SER B . n 
B 1 183 TRP 183 183 183 TRP TRP B . n 
B 1 184 SER 184 184 184 SER SER B . n 
B 1 185 ASP 185 185 185 ASP ASP B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 TRP 187 187 187 TRP TRP B . n 
B 1 188 ARG 188 188 188 ARG ARG B . n 
B 1 189 GLU 189 189 189 GLU GLU B . n 
B 1 190 ILE 190 190 190 ILE ILE B . n 
B 1 191 LEU 191 191 191 LEU LEU B . n 
B 1 192 ASP 192 192 192 ASP ASP B . n 
B 1 193 SER 193 193 193 SER SER B . n 
B 1 194 LYS 194 194 194 LYS LYS B . n 
B 1 195 ARG 195 195 195 ARG ARG B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MG  1   201 201 MG  MG  A . 
D 3 PO4 1   202 202 PO4 PO4 A . 
E 4 GOL 1   203 203 GOL GOL A . 
F 4 GOL 1   204 204 GOL GOL A . 
G 4 GOL 1   205 205 GOL GOL A . 
H 4 GOL 1   206 206 GOL GOL A . 
I 4 GOL 1   207 207 GOL GOL A . 
J 5 NA  1   208 208 NA  NA  A . 
K 2 MG  1   201 201 MG  MG  B . 
L 3 PO4 1   202 202 PO4 PO4 B . 
M 4 GOL 1   203 203 GOL GOL B . 
N 6 HOH 1   301 1   HOH HOH A . 
N 6 HOH 2   302 2   HOH HOH A . 
N 6 HOH 3   303 3   HOH HOH A . 
N 6 HOH 4   304 4   HOH HOH A . 
N 6 HOH 5   305 5   HOH HOH A . 
N 6 HOH 6   306 6   HOH HOH A . 
N 6 HOH 7   307 10  HOH HOH A . 
N 6 HOH 8   308 12  HOH HOH A . 
N 6 HOH 9   309 13  HOH HOH A . 
N 6 HOH 10  310 16  HOH HOH A . 
N 6 HOH 11  311 17  HOH HOH A . 
N 6 HOH 12  312 18  HOH HOH A . 
N 6 HOH 13  313 19  HOH HOH A . 
N 6 HOH 14  314 20  HOH HOH A . 
N 6 HOH 15  315 21  HOH HOH A . 
N 6 HOH 16  316 23  HOH HOH A . 
N 6 HOH 17  317 24  HOH HOH A . 
N 6 HOH 18  318 26  HOH HOH A . 
N 6 HOH 19  319 27  HOH HOH A . 
N 6 HOH 20  320 28  HOH HOH A . 
N 6 HOH 21  321 29  HOH HOH A . 
N 6 HOH 22  322 31  HOH HOH A . 
N 6 HOH 23  323 32  HOH HOH A . 
N 6 HOH 24  324 34  HOH HOH A . 
N 6 HOH 25  325 35  HOH HOH A . 
N 6 HOH 26  326 38  HOH HOH A . 
N 6 HOH 27  327 40  HOH HOH A . 
N 6 HOH 28  328 41  HOH HOH A . 
N 6 HOH 29  329 42  HOH HOH A . 
N 6 HOH 30  330 45  HOH HOH A . 
N 6 HOH 31  331 46  HOH HOH A . 
N 6 HOH 32  332 47  HOH HOH A . 
N 6 HOH 33  333 51  HOH HOH A . 
N 6 HOH 34  334 52  HOH HOH A . 
N 6 HOH 35  335 53  HOH HOH A . 
N 6 HOH 36  336 56  HOH HOH A . 
N 6 HOH 37  337 57  HOH HOH A . 
N 6 HOH 38  338 59  HOH HOH A . 
N 6 HOH 39  339 62  HOH HOH A . 
N 6 HOH 40  340 65  HOH HOH A . 
N 6 HOH 41  341 67  HOH HOH A . 
N 6 HOH 42  342 68  HOH HOH A . 
N 6 HOH 43  343 70  HOH HOH A . 
N 6 HOH 44  344 71  HOH HOH A . 
N 6 HOH 45  345 72  HOH HOH A . 
N 6 HOH 46  346 74  HOH HOH A . 
N 6 HOH 47  347 75  HOH HOH A . 
N 6 HOH 48  348 77  HOH HOH A . 
N 6 HOH 49  349 82  HOH HOH A . 
N 6 HOH 50  350 83  HOH HOH A . 
N 6 HOH 51  351 84  HOH HOH A . 
N 6 HOH 52  352 85  HOH HOH A . 
N 6 HOH 53  353 86  HOH HOH A . 
N 6 HOH 54  354 88  HOH HOH A . 
N 6 HOH 55  355 92  HOH HOH A . 
N 6 HOH 56  356 93  HOH HOH A . 
N 6 HOH 57  357 94  HOH HOH A . 
N 6 HOH 58  358 95  HOH HOH A . 
N 6 HOH 59  359 98  HOH HOH A . 
N 6 HOH 60  360 99  HOH HOH A . 
N 6 HOH 61  361 100 HOH HOH A . 
N 6 HOH 62  362 103 HOH HOH A . 
N 6 HOH 63  363 104 HOH HOH A . 
N 6 HOH 64  364 105 HOH HOH A . 
N 6 HOH 65  365 109 HOH HOH A . 
N 6 HOH 66  366 110 HOH HOH A . 
N 6 HOH 67  367 112 HOH HOH A . 
N 6 HOH 68  368 117 HOH HOH A . 
N 6 HOH 69  369 118 HOH HOH A . 
N 6 HOH 70  370 122 HOH HOH A . 
N 6 HOH 71  371 123 HOH HOH A . 
N 6 HOH 72  372 125 HOH HOH A . 
N 6 HOH 73  373 129 HOH HOH A . 
N 6 HOH 74  374 131 HOH HOH A . 
N 6 HOH 75  375 132 HOH HOH A . 
N 6 HOH 76  376 133 HOH HOH A . 
N 6 HOH 77  377 135 HOH HOH A . 
N 6 HOH 78  378 136 HOH HOH A . 
N 6 HOH 79  379 137 HOH HOH A . 
N 6 HOH 80  380 140 HOH HOH A . 
N 6 HOH 81  381 141 HOH HOH A . 
N 6 HOH 82  382 142 HOH HOH A . 
N 6 HOH 83  383 143 HOH HOH A . 
N 6 HOH 84  384 144 HOH HOH A . 
N 6 HOH 85  385 148 HOH HOH A . 
N 6 HOH 86  386 150 HOH HOH A . 
N 6 HOH 87  387 153 HOH HOH A . 
N 6 HOH 88  388 154 HOH HOH A . 
N 6 HOH 89  389 156 HOH HOH A . 
N 6 HOH 90  390 160 HOH HOH A . 
N 6 HOH 91  391 163 HOH HOH A . 
N 6 HOH 92  392 164 HOH HOH A . 
N 6 HOH 93  393 166 HOH HOH A . 
N 6 HOH 94  394 167 HOH HOH A . 
N 6 HOH 95  395 170 HOH HOH A . 
N 6 HOH 96  396 177 HOH HOH A . 
N 6 HOH 97  397 178 HOH HOH A . 
N 6 HOH 98  398 179 HOH HOH A . 
N 6 HOH 99  399 180 HOH HOH A . 
N 6 HOH 100 400 181 HOH HOH A . 
N 6 HOH 101 401 185 HOH HOH A . 
N 6 HOH 102 402 186 HOH HOH A . 
N 6 HOH 103 403 187 HOH HOH A . 
N 6 HOH 104 404 189 HOH HOH A . 
N 6 HOH 105 405 190 HOH HOH A . 
N 6 HOH 106 406 191 HOH HOH A . 
N 6 HOH 107 407 192 HOH HOH A . 
N 6 HOH 108 408 193 HOH HOH A . 
N 6 HOH 109 409 196 HOH HOH A . 
N 6 HOH 110 410 205 HOH HOH A . 
N 6 HOH 111 411 206 HOH HOH A . 
N 6 HOH 112 412 209 HOH HOH A . 
N 6 HOH 113 413 210 HOH HOH A . 
N 6 HOH 114 414 211 HOH HOH A . 
N 6 HOH 115 415 212 HOH HOH A . 
N 6 HOH 116 416 213 HOH HOH A . 
N 6 HOH 117 417 216 HOH HOH A . 
N 6 HOH 118 418 218 HOH HOH A . 
N 6 HOH 119 419 219 HOH HOH A . 
N 6 HOH 120 420 221 HOH HOH A . 
N 6 HOH 121 421 223 HOH HOH A . 
N 6 HOH 122 422 225 HOH HOH A . 
N 6 HOH 123 423 226 HOH HOH A . 
N 6 HOH 124 424 228 HOH HOH A . 
N 6 HOH 125 425 230 HOH HOH A . 
N 6 HOH 126 426 233 HOH HOH A . 
N 6 HOH 127 427 235 HOH HOH A . 
N 6 HOH 128 428 236 HOH HOH A . 
N 6 HOH 129 429 237 HOH HOH A . 
N 6 HOH 130 430 238 HOH HOH A . 
N 6 HOH 131 431 241 HOH HOH A . 
N 6 HOH 132 432 242 HOH HOH A . 
N 6 HOH 133 433 244 HOH HOH A . 
N 6 HOH 134 434 246 HOH HOH A . 
N 6 HOH 135 435 247 HOH HOH A . 
N 6 HOH 136 436 248 HOH HOH A . 
N 6 HOH 137 437 251 HOH HOH A . 
N 6 HOH 138 438 253 HOH HOH A . 
N 6 HOH 139 439 255 HOH HOH A . 
N 6 HOH 140 440 256 HOH HOH A . 
N 6 HOH 141 441 259 HOH HOH A . 
N 6 HOH 142 442 260 HOH HOH A . 
N 6 HOH 143 443 262 HOH HOH A . 
N 6 HOH 144 444 265 HOH HOH A . 
N 6 HOH 145 445 266 HOH HOH A . 
N 6 HOH 146 446 268 HOH HOH A . 
N 6 HOH 147 447 269 HOH HOH A . 
N 6 HOH 148 448 272 HOH HOH A . 
N 6 HOH 149 449 273 HOH HOH A . 
N 6 HOH 150 450 275 HOH HOH A . 
N 6 HOH 151 451 279 HOH HOH A . 
N 6 HOH 152 452 280 HOH HOH A . 
N 6 HOH 153 453 281 HOH HOH A . 
N 6 HOH 154 454 282 HOH HOH A . 
N 6 HOH 155 455 283 HOH HOH A . 
N 6 HOH 156 456 285 HOH HOH A . 
N 6 HOH 157 457 288 HOH HOH A . 
N 6 HOH 158 458 290 HOH HOH A . 
N 6 HOH 159 459 291 HOH HOH A . 
N 6 HOH 160 460 292 HOH HOH A . 
N 6 HOH 161 461 296 HOH HOH A . 
N 6 HOH 162 462 297 HOH HOH A . 
N 6 HOH 163 463 299 HOH HOH A . 
N 6 HOH 164 464 301 HOH HOH A . 
N 6 HOH 165 465 304 HOH HOH A . 
N 6 HOH 166 466 310 HOH HOH A . 
N 6 HOH 167 467 311 HOH HOH A . 
N 6 HOH 168 468 312 HOH HOH A . 
N 6 HOH 169 469 313 HOH HOH A . 
N 6 HOH 170 470 321 HOH HOH A . 
N 6 HOH 171 471 322 HOH HOH A . 
N 6 HOH 172 472 323 HOH HOH A . 
N 6 HOH 173 473 324 HOH HOH A . 
N 6 HOH 174 474 325 HOH HOH A . 
N 6 HOH 175 475 326 HOH HOH A . 
N 6 HOH 176 476 328 HOH HOH A . 
N 6 HOH 177 477 329 HOH HOH A . 
N 6 HOH 178 478 330 HOH HOH A . 
N 6 HOH 179 479 333 HOH HOH A . 
N 6 HOH 180 480 335 HOH HOH A . 
N 6 HOH 181 481 336 HOH HOH A . 
N 6 HOH 182 482 339 HOH HOH A . 
N 6 HOH 183 483 350 HOH HOH A . 
N 6 HOH 184 484 351 HOH HOH A . 
N 6 HOH 185 485 352 HOH HOH A . 
N 6 HOH 186 486 353 HOH HOH A . 
N 6 HOH 187 487 354 HOH HOH A . 
N 6 HOH 188 488 355 HOH HOH A . 
N 6 HOH 189 489 356 HOH HOH A . 
N 6 HOH 190 490 357 HOH HOH A . 
N 6 HOH 191 491 358 HOH HOH A . 
N 6 HOH 192 492 361 HOH HOH A . 
N 6 HOH 193 493 363 HOH HOH A . 
N 6 HOH 194 494 364 HOH HOH A . 
N 6 HOH 195 495 365 HOH HOH A . 
N 6 HOH 196 496 366 HOH HOH A . 
N 6 HOH 197 497 368 HOH HOH A . 
N 6 HOH 198 498 369 HOH HOH A . 
N 6 HOH 199 499 370 HOH HOH A . 
N 6 HOH 200 500 372 HOH HOH A . 
N 6 HOH 201 501 374 HOH HOH A . 
N 6 HOH 202 502 376 HOH HOH A . 
N 6 HOH 203 503 377 HOH HOH A . 
N 6 HOH 204 504 379 HOH HOH A . 
N 6 HOH 205 505 380 HOH HOH A . 
N 6 HOH 206 506 381 HOH HOH A . 
N 6 HOH 207 507 382 HOH HOH A . 
N 6 HOH 208 508 383 HOH HOH A . 
N 6 HOH 209 509 384 HOH HOH A . 
N 6 HOH 210 510 386 HOH HOH A . 
N 6 HOH 211 511 389 HOH HOH A . 
N 6 HOH 212 512 395 HOH HOH A . 
N 6 HOH 213 513 399 HOH HOH A . 
N 6 HOH 214 514 400 HOH HOH A . 
N 6 HOH 215 515 403 HOH HOH A . 
N 6 HOH 216 516 406 HOH HOH A . 
N 6 HOH 217 517 408 HOH HOH A . 
N 6 HOH 218 518 409 HOH HOH A . 
N 6 HOH 219 519 410 HOH HOH A . 
N 6 HOH 220 520 411 HOH HOH A . 
N 6 HOH 221 521 413 HOH HOH A . 
N 6 HOH 222 522 414 HOH HOH A . 
N 6 HOH 223 523 416 HOH HOH A . 
N 6 HOH 224 524 418 HOH HOH A . 
N 6 HOH 225 525 421 HOH HOH A . 
N 6 HOH 226 526 422 HOH HOH A . 
N 6 HOH 227 527 423 HOH HOH A . 
N 6 HOH 228 528 424 HOH HOH A . 
N 6 HOH 229 529 427 HOH HOH A . 
N 6 HOH 230 530 428 HOH HOH A . 
N 6 HOH 231 531 429 HOH HOH A . 
N 6 HOH 232 532 430 HOH HOH A . 
N 6 HOH 233 533 431 HOH HOH A . 
N 6 HOH 234 534 432 HOH HOH A . 
N 6 HOH 235 535 433 HOH HOH A . 
N 6 HOH 236 536 434 HOH HOH A . 
N 6 HOH 237 537 435 HOH HOH A . 
N 6 HOH 238 538 442 HOH HOH A . 
N 6 HOH 239 539 449 HOH HOH A . 
N 6 HOH 240 540 453 HOH HOH A . 
N 6 HOH 241 541 456 HOH HOH A . 
N 6 HOH 242 542 457 HOH HOH A . 
N 6 HOH 243 543 462 HOH HOH A . 
N 6 HOH 244 544 464 HOH HOH A . 
N 6 HOH 245 545 466 HOH HOH A . 
N 6 HOH 246 546 467 HOH HOH A . 
N 6 HOH 247 547 468 HOH HOH A . 
O 6 HOH 1   301 7   HOH HOH B . 
O 6 HOH 2   302 8   HOH HOH B . 
O 6 HOH 3   303 9   HOH HOH B . 
O 6 HOH 4   304 11  HOH HOH B . 
O 6 HOH 5   305 14  HOH HOH B . 
O 6 HOH 6   306 15  HOH HOH B . 
O 6 HOH 7   307 22  HOH HOH B . 
O 6 HOH 8   308 25  HOH HOH B . 
O 6 HOH 9   309 30  HOH HOH B . 
O 6 HOH 10  310 33  HOH HOH B . 
O 6 HOH 11  311 36  HOH HOH B . 
O 6 HOH 12  312 37  HOH HOH B . 
O 6 HOH 13  313 39  HOH HOH B . 
O 6 HOH 14  314 43  HOH HOH B . 
O 6 HOH 15  315 44  HOH HOH B . 
O 6 HOH 16  316 48  HOH HOH B . 
O 6 HOH 17  317 49  HOH HOH B . 
O 6 HOH 18  318 50  HOH HOH B . 
O 6 HOH 19  319 54  HOH HOH B . 
O 6 HOH 20  320 55  HOH HOH B . 
O 6 HOH 21  321 58  HOH HOH B . 
O 6 HOH 22  322 60  HOH HOH B . 
O 6 HOH 23  323 61  HOH HOH B . 
O 6 HOH 24  324 63  HOH HOH B . 
O 6 HOH 25  325 64  HOH HOH B . 
O 6 HOH 26  326 66  HOH HOH B . 
O 6 HOH 27  327 69  HOH HOH B . 
O 6 HOH 28  328 73  HOH HOH B . 
O 6 HOH 29  329 76  HOH HOH B . 
O 6 HOH 30  330 78  HOH HOH B . 
O 6 HOH 31  331 79  HOH HOH B . 
O 6 HOH 32  332 80  HOH HOH B . 
O 6 HOH 33  333 81  HOH HOH B . 
O 6 HOH 34  334 87  HOH HOH B . 
O 6 HOH 35  335 89  HOH HOH B . 
O 6 HOH 36  336 90  HOH HOH B . 
O 6 HOH 37  337 91  HOH HOH B . 
O 6 HOH 38  338 96  HOH HOH B . 
O 6 HOH 39  339 97  HOH HOH B . 
O 6 HOH 40  340 101 HOH HOH B . 
O 6 HOH 41  341 102 HOH HOH B . 
O 6 HOH 42  342 106 HOH HOH B . 
O 6 HOH 43  343 107 HOH HOH B . 
O 6 HOH 44  344 108 HOH HOH B . 
O 6 HOH 45  345 111 HOH HOH B . 
O 6 HOH 46  346 113 HOH HOH B . 
O 6 HOH 47  347 114 HOH HOH B . 
O 6 HOH 48  348 115 HOH HOH B . 
O 6 HOH 49  349 116 HOH HOH B . 
O 6 HOH 50  350 119 HOH HOH B . 
O 6 HOH 51  351 120 HOH HOH B . 
O 6 HOH 52  352 121 HOH HOH B . 
O 6 HOH 53  353 124 HOH HOH B . 
O 6 HOH 54  354 126 HOH HOH B . 
O 6 HOH 55  355 127 HOH HOH B . 
O 6 HOH 56  356 128 HOH HOH B . 
O 6 HOH 57  357 130 HOH HOH B . 
O 6 HOH 58  358 134 HOH HOH B . 
O 6 HOH 59  359 138 HOH HOH B . 
O 6 HOH 60  360 139 HOH HOH B . 
O 6 HOH 61  361 145 HOH HOH B . 
O 6 HOH 62  362 146 HOH HOH B . 
O 6 HOH 63  363 147 HOH HOH B . 
O 6 HOH 64  364 149 HOH HOH B . 
O 6 HOH 65  365 151 HOH HOH B . 
O 6 HOH 66  366 152 HOH HOH B . 
O 6 HOH 67  367 155 HOH HOH B . 
O 6 HOH 68  368 157 HOH HOH B . 
O 6 HOH 69  369 158 HOH HOH B . 
O 6 HOH 70  370 159 HOH HOH B . 
O 6 HOH 71  371 161 HOH HOH B . 
O 6 HOH 72  372 162 HOH HOH B . 
O 6 HOH 73  373 165 HOH HOH B . 
O 6 HOH 74  374 168 HOH HOH B . 
O 6 HOH 75  375 169 HOH HOH B . 
O 6 HOH 76  376 171 HOH HOH B . 
O 6 HOH 77  377 172 HOH HOH B . 
O 6 HOH 78  378 173 HOH HOH B . 
O 6 HOH 79  379 174 HOH HOH B . 
O 6 HOH 80  380 175 HOH HOH B . 
O 6 HOH 81  381 176 HOH HOH B . 
O 6 HOH 82  382 182 HOH HOH B . 
O 6 HOH 83  383 183 HOH HOH B . 
O 6 HOH 84  384 184 HOH HOH B . 
O 6 HOH 85  385 188 HOH HOH B . 
O 6 HOH 86  386 194 HOH HOH B . 
O 6 HOH 87  387 195 HOH HOH B . 
O 6 HOH 88  388 197 HOH HOH B . 
O 6 HOH 89  389 198 HOH HOH B . 
O 6 HOH 90  390 199 HOH HOH B . 
O 6 HOH 91  391 200 HOH HOH B . 
O 6 HOH 92  392 201 HOH HOH B . 
O 6 HOH 93  393 202 HOH HOH B . 
O 6 HOH 94  394 203 HOH HOH B . 
O 6 HOH 95  395 204 HOH HOH B . 
O 6 HOH 96  396 207 HOH HOH B . 
O 6 HOH 97  397 208 HOH HOH B . 
O 6 HOH 98  398 214 HOH HOH B . 
O 6 HOH 99  399 215 HOH HOH B . 
O 6 HOH 100 400 217 HOH HOH B . 
O 6 HOH 101 401 220 HOH HOH B . 
O 6 HOH 102 402 222 HOH HOH B . 
O 6 HOH 103 403 224 HOH HOH B . 
O 6 HOH 104 404 227 HOH HOH B . 
O 6 HOH 105 405 229 HOH HOH B . 
O 6 HOH 106 406 231 HOH HOH B . 
O 6 HOH 107 407 232 HOH HOH B . 
O 6 HOH 108 408 234 HOH HOH B . 
O 6 HOH 109 409 239 HOH HOH B . 
O 6 HOH 110 410 240 HOH HOH B . 
O 6 HOH 111 411 243 HOH HOH B . 
O 6 HOH 112 412 245 HOH HOH B . 
O 6 HOH 113 413 249 HOH HOH B . 
O 6 HOH 114 414 250 HOH HOH B . 
O 6 HOH 115 415 252 HOH HOH B . 
O 6 HOH 116 416 254 HOH HOH B . 
O 6 HOH 117 417 257 HOH HOH B . 
O 6 HOH 118 418 258 HOH HOH B . 
O 6 HOH 119 419 261 HOH HOH B . 
O 6 HOH 120 420 263 HOH HOH B . 
O 6 HOH 121 421 264 HOH HOH B . 
O 6 HOH 122 422 267 HOH HOH B . 
O 6 HOH 123 423 270 HOH HOH B . 
O 6 HOH 124 424 271 HOH HOH B . 
O 6 HOH 125 425 274 HOH HOH B . 
O 6 HOH 126 426 276 HOH HOH B . 
O 6 HOH 127 427 277 HOH HOH B . 
O 6 HOH 128 428 278 HOH HOH B . 
O 6 HOH 129 429 284 HOH HOH B . 
O 6 HOH 130 430 286 HOH HOH B . 
O 6 HOH 131 431 287 HOH HOH B . 
O 6 HOH 132 432 289 HOH HOH B . 
O 6 HOH 133 433 293 HOH HOH B . 
O 6 HOH 134 434 294 HOH HOH B . 
O 6 HOH 135 435 298 HOH HOH B . 
O 6 HOH 136 436 300 HOH HOH B . 
O 6 HOH 137 437 302 HOH HOH B . 
O 6 HOH 138 438 303 HOH HOH B . 
O 6 HOH 139 439 305 HOH HOH B . 
O 6 HOH 140 440 306 HOH HOH B . 
O 6 HOH 141 441 308 HOH HOH B . 
O 6 HOH 142 442 309 HOH HOH B . 
O 6 HOH 143 443 314 HOH HOH B . 
O 6 HOH 144 444 315 HOH HOH B . 
O 6 HOH 145 445 316 HOH HOH B . 
O 6 HOH 146 446 317 HOH HOH B . 
O 6 HOH 147 447 318 HOH HOH B . 
O 6 HOH 148 448 319 HOH HOH B . 
O 6 HOH 149 449 320 HOH HOH B . 
O 6 HOH 150 450 327 HOH HOH B . 
O 6 HOH 151 451 331 HOH HOH B . 
O 6 HOH 152 452 332 HOH HOH B . 
O 6 HOH 153 453 334 HOH HOH B . 
O 6 HOH 154 454 337 HOH HOH B . 
O 6 HOH 155 455 338 HOH HOH B . 
O 6 HOH 156 456 340 HOH HOH B . 
O 6 HOH 157 457 341 HOH HOH B . 
O 6 HOH 158 458 342 HOH HOH B . 
O 6 HOH 159 459 343 HOH HOH B . 
O 6 HOH 160 460 344 HOH HOH B . 
O 6 HOH 161 461 345 HOH HOH B . 
O 6 HOH 162 462 346 HOH HOH B . 
O 6 HOH 163 463 347 HOH HOH B . 
O 6 HOH 164 464 348 HOH HOH B . 
O 6 HOH 165 465 349 HOH HOH B . 
O 6 HOH 166 466 359 HOH HOH B . 
O 6 HOH 167 467 360 HOH HOH B . 
O 6 HOH 168 468 362 HOH HOH B . 
O 6 HOH 169 469 367 HOH HOH B . 
O 6 HOH 170 470 371 HOH HOH B . 
O 6 HOH 171 471 373 HOH HOH B . 
O 6 HOH 172 472 385 HOH HOH B . 
O 6 HOH 173 473 387 HOH HOH B . 
O 6 HOH 174 474 388 HOH HOH B . 
O 6 HOH 175 475 390 HOH HOH B . 
O 6 HOH 176 476 391 HOH HOH B . 
O 6 HOH 177 477 392 HOH HOH B . 
O 6 HOH 178 478 393 HOH HOH B . 
O 6 HOH 179 479 394 HOH HOH B . 
O 6 HOH 180 480 396 HOH HOH B . 
O 6 HOH 181 481 397 HOH HOH B . 
O 6 HOH 182 482 398 HOH HOH B . 
O 6 HOH 183 483 401 HOH HOH B . 
O 6 HOH 184 484 402 HOH HOH B . 
O 6 HOH 185 485 404 HOH HOH B . 
O 6 HOH 186 486 405 HOH HOH B . 
O 6 HOH 187 487 407 HOH HOH B . 
O 6 HOH 188 488 412 HOH HOH B . 
O 6 HOH 189 489 415 HOH HOH B . 
O 6 HOH 190 490 419 HOH HOH B . 
O 6 HOH 191 491 426 HOH HOH B . 
O 6 HOH 192 492 437 HOH HOH B . 
O 6 HOH 193 493 438 HOH HOH B . 
O 6 HOH 194 494 439 HOH HOH B . 
O 6 HOH 195 495 447 HOH HOH B . 
O 6 HOH 196 496 448 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,G,H,I,J,N 
1 2 B,K,L,M,O           
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4700  ? 
1 MORE         -62   ? 
1 'SSA (A^2)'  17750 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000  
2 'crystal symmetry operation' 1_556 x,y,z+1 1.0000000000 0.0000000000 0.0000000000 9.1086273792 0.0000000000 1.0000000000 
0.0000000000 21.2273665826 0.0000000000 0.0000000000 1.0000000000 56.8990078669 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? B ASP 145 ? B ASP 145 ? 1_555 MG ? K MG . ? B MG 201 ? 1_555 O   ? B ASP 12 ? B ASP 12  ? 1_555 89.4  ? 
2  OD1 ? B ASP 145 ? B ASP 145 ? 1_555 MG ? K MG . ? B MG 201 ? 1_555 O2  ? L PO4 .  ? B PO4 202 ? 1_555 170.3 ? 
3  O   ? B ASP 12  ? B ASP 12  ? 1_555 MG ? K MG . ? B MG 201 ? 1_555 O2  ? L PO4 .  ? B PO4 202 ? 1_555 94.5  ? 
4  OD1 ? B ASP 145 ? B ASP 145 ? 1_555 MG ? K MG . ? B MG 201 ? 1_555 OD2 ? B ASP 10 ? B ASP 10  ? 1_555 84.6  ? 
5  O   ? B ASP 12  ? B ASP 12  ? 1_555 MG ? K MG . ? B MG 201 ? 1_555 OD2 ? B ASP 10 ? B ASP 10  ? 1_555 85.9  ? 
6  O2  ? L PO4 .   ? B PO4 202 ? 1_555 MG ? K MG . ? B MG 201 ? 1_555 OD2 ? B ASP 10 ? B ASP 10  ? 1_555 86.8  ? 
7  OD1 ? B ASP 145 ? B ASP 145 ? 1_555 MG ? K MG . ? B MG 201 ? 1_555 O   ? O HOH .  ? B HOH 315 ? 1_555 96.8  ? 
8  O   ? B ASP 12  ? B ASP 12  ? 1_555 MG ? K MG . ? B MG 201 ? 1_555 O   ? O HOH .  ? B HOH 315 ? 1_555 88.7  ? 
9  O2  ? L PO4 .   ? B PO4 202 ? 1_555 MG ? K MG . ? B MG 201 ? 1_555 O   ? O HOH .  ? B HOH 315 ? 1_555 92.1  ? 
10 OD2 ? B ASP 10  ? B ASP 10  ? 1_555 MG ? K MG . ? B MG 201 ? 1_555 O   ? O HOH .  ? B HOH 315 ? 1_555 174.4 ? 
11 OD1 ? B ASP 145 ? B ASP 145 ? 1_555 MG ? K MG . ? B MG 201 ? 1_555 O   ? O HOH .  ? B HOH 314 ? 1_555 90.5  ? 
12 O   ? B ASP 12  ? B ASP 12  ? 1_555 MG ? K MG . ? B MG 201 ? 1_555 O   ? O HOH .  ? B HOH 314 ? 1_555 176.6 ? 
13 O2  ? L PO4 .   ? B PO4 202 ? 1_555 MG ? K MG . ? B MG 201 ? 1_555 O   ? O HOH .  ? B HOH 314 ? 1_555 85.1  ? 
14 OD2 ? B ASP 10  ? B ASP 10  ? 1_555 MG ? K MG . ? B MG 201 ? 1_555 O   ? O HOH .  ? B HOH 314 ? 1_555 90.7  ? 
15 O   ? O HOH .   ? B HOH 315 ? 1_555 MG ? K MG . ? B MG 201 ? 1_555 O   ? O HOH .  ? B HOH 314 ? 1_555 94.7  ? 
16 OD1 ? A ASP 145 ? A ASP 145 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O   ? A ASP 12 ? A ASP 12  ? 1_555 89.7  ? 
17 OD1 ? A ASP 145 ? A ASP 145 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O2  ? D PO4 .  ? A PO4 202 ? 1_555 169.2 ? 
18 O   ? A ASP 12  ? A ASP 12  ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O2  ? D PO4 .  ? A PO4 202 ? 1_555 95.0  ? 
19 OD1 ? A ASP 145 ? A ASP 145 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 OD2 ? A ASP 10 ? A ASP 10  ? 1_555 83.3  ? 
20 O   ? A ASP 12  ? A ASP 12  ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 OD2 ? A ASP 10 ? A ASP 10  ? 1_555 86.1  ? 
21 O2  ? D PO4 .   ? A PO4 202 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 OD2 ? A ASP 10 ? A ASP 10  ? 1_555 87.3  ? 
22 OD1 ? A ASP 145 ? A ASP 145 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O   ? N HOH .  ? A HOH 320 ? 1_555 95.5  ? 
23 O   ? A ASP 12  ? A ASP 12  ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O   ? N HOH .  ? A HOH 320 ? 1_555 88.5  ? 
24 O2  ? D PO4 .   ? A PO4 202 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O   ? N HOH .  ? A HOH 320 ? 1_555 94.4  ? 
25 OD2 ? A ASP 10  ? A ASP 10  ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O   ? N HOH .  ? A HOH 320 ? 1_555 174.5 ? 
26 OD1 ? A ASP 145 ? A ASP 145 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O   ? N HOH .  ? A HOH 311 ? 1_555 89.4  ? 
27 O   ? A ASP 12  ? A ASP 12  ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O   ? N HOH .  ? A HOH 311 ? 1_555 177.3 ? 
28 O2  ? D PO4 .   ? A PO4 202 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O   ? N HOH .  ? A HOH 311 ? 1_555 85.5  ? 
29 OD2 ? A ASP 10  ? A ASP 10  ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O   ? N HOH .  ? A HOH 311 ? 1_555 91.2  ? 
30 O   ? N HOH .   ? A HOH 320 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O   ? N HOH .  ? A HOH 311 ? 1_555 94.1  ? 
31 O   ? A LEU 90  ? A LEU 90  ? 1_555 NA ? J NA . ? A NA 208 ? 1_555 O   ? A ASN 88 ? A ASN 88  ? 1_555 107.5 ? 
32 O   ? A LEU 90  ? A LEU 90  ? 1_555 NA ? J NA . ? A NA 208 ? 1_555 O   ? A THR 93 ? A THR 93  ? 1_555 90.8  ? 
33 O   ? A ASN 88  ? A ASN 88  ? 1_555 NA ? J NA . ? A NA 208 ? 1_555 O   ? A THR 93 ? A THR 93  ? 1_555 102.0 ? 
34 O   ? A LEU 90  ? A LEU 90  ? 1_555 NA ? J NA . ? A NA 208 ? 1_555 O   ? N HOH .  ? A HOH 423 ? 1_555 143.9 ? 
35 O   ? A ASN 88  ? A ASN 88  ? 1_555 NA ? J NA . ? A NA 208 ? 1_555 O   ? N HOH .  ? A HOH 423 ? 1_555 61.9  ? 
36 O   ? A THR 93  ? A THR 93  ? 1_555 NA ? J NA . ? A NA 208 ? 1_555 O   ? N HOH .  ? A HOH 423 ? 1_555 61.1  ? 
37 O   ? A LEU 90  ? A LEU 90  ? 1_555 NA ? J NA . ? A NA 208 ? 1_555 O   ? N HOH .  ? A HOH 429 ? 1_555 87.0  ? 
38 O   ? A ASN 88  ? A ASN 88  ? 1_555 NA ? J NA . ? A NA 208 ? 1_555 O   ? N HOH .  ? A HOH 429 ? 1_555 160.4 ? 
39 O   ? A THR 93  ? A THR 93  ? 1_555 NA ? J NA . ? A NA 208 ? 1_555 O   ? N HOH .  ? A HOH 429 ? 1_555 63.8  ? 
40 O   ? N HOH .   ? A HOH 423 ? 1_555 NA ? J NA . ? A NA 208 ? 1_555 O   ? N HOH .  ? A HOH 429 ? 1_555 98.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-02-12 
2 'Structure model' 1 1 2014-03-19 
3 'Structure model' 1 2 2018-04-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Refinement description' 
2 3 'Structure model' 'Data collection'        
3 3 'Structure model' 'Database references'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_citation.country'                 
2 3 'Structure model' '_citation.journal_abbrev'          
3 3 'Structure model' '_citation.journal_id_CSD'          
4 3 'Structure model' '_citation.journal_id_ISSN'         
5 3 'Structure model' '_citation.pdbx_database_id_DOI'    
6 3 'Structure model' '_citation.pdbx_database_id_PubMed' 
7 3 'Structure model' '_citation.title'                   
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SHELX       .    ?                package 'George M. Sheldrick' gsheldr@shelx.uni-ac.gwdg.de refinement        
http://shelx.uni-ac.gwdg.de/SHELX/        Fortran_77 ? 
2 PDB_EXTRACT 3.11 'April 22, 2011' package PDB                   deposit@deposit.rcsb.org     'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++        ? 
3 SHELXL      .    ?                ?       ?                     ?                            refinement        ? ?          ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 B GLU 39 ? ? O B HOH 417 ? ? 1.26 
2 1 CD  B GLU 39 ? ? O B HOH 417 ? ? 1.98 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE  A ARG 24  ? B CZ A ARG 24  ? B NH1 A ARG 24  ? B 123.77 120.30 3.47   0.50 N 
2  1 NE  A ARG 24  ? B CZ A ARG 24  ? B NH2 A ARG 24  ? B 116.75 120.30 -3.55  0.50 N 
3  1 NE  A ARG 27  ? B CZ A ARG 27  ? B NH1 A ARG 27  ? B 116.63 120.30 -3.67  0.50 N 
4  1 NE  A ARG 27  ? B CZ A ARG 27  ? B NH2 A ARG 27  ? B 123.36 120.30 3.06   0.50 N 
5  1 NE  A ARG 28  ? ? CZ A ARG 28  ? ? NH1 A ARG 28  ? ? 124.09 120.30 3.79   0.50 N 
6  1 NE  A ARG 28  ? ? CZ A ARG 28  ? ? NH2 A ARG 28  ? ? 116.69 120.30 -3.61  0.50 N 
7  1 NE  A ARG 29  ? B CZ A ARG 29  ? B NH2 A ARG 29  ? B 113.07 120.30 -7.23  0.50 N 
8  1 OE1 A GLU 32  ? ? CD A GLU 32  ? ? OE2 A GLU 32  ? ? 131.36 123.30 8.06   1.20 N 
9  1 NE  A ARG 47  ? B CZ A ARG 47  ? B NH2 A ARG 47  ? B 117.02 120.30 -3.28  0.50 N 
10 1 CD  A ARG 85  ? A NE A ARG 85  ? A CZ  A ARG 85  ? A 151.84 123.60 28.24  1.40 N 
11 1 CD  A ARG 85  ? B NE A ARG 85  ? B CZ  A ARG 85  ? B 133.34 123.60 9.74   1.40 N 
12 1 NE  A ARG 85  ? B CZ A ARG 85  ? B NH2 A ARG 85  ? B 123.49 120.30 3.19   0.50 N 
13 1 CB  A TYR 105 ? ? CG A TYR 105 ? ? CD1 A TYR 105 ? ? 124.80 121.00 3.80   0.60 N 
14 1 NE  A ARG 114 ? ? CZ A ARG 114 ? ? NH2 A ARG 114 ? ? 115.77 120.30 -4.53  0.50 N 
15 1 NE  A ARG 127 ? B CZ A ARG 127 ? B NH2 A ARG 127 ? B 114.11 120.30 -6.19  0.50 N 
16 1 NE  A ARG 132 ? ? CZ A ARG 132 ? ? NH1 A ARG 132 ? ? 115.15 120.30 -5.15  0.50 N 
17 1 CA  A CYS 165 ? B CB A CYS 165 ? B SG  A CYS 165 ? B 103.09 114.00 -10.91 1.80 N 
18 1 NE  A ARG 178 ? B CZ A ARG 178 ? B NH1 A ARG 178 ? B 124.17 120.30 3.87   0.50 N 
19 1 NE  A ARG 178 ? B CZ A ARG 178 ? B NH2 A ARG 178 ? B 116.71 120.30 -3.59  0.50 N 
20 1 NH1 A ARG 179 ? ? CZ A ARG 179 ? ? NH2 A ARG 179 ? ? 111.85 119.40 -7.55  1.10 N 
21 1 NE  A ARG 179 ? ? CZ A ARG 179 ? ? NH1 A ARG 179 ? ? 123.39 120.30 3.09   0.50 N 
22 1 NE  A ARG 179 ? ? CZ A ARG 179 ? ? NH2 A ARG 179 ? ? 124.76 120.30 4.46   0.50 N 
23 1 CB  A ASN 186 ? B CA A ASN 186 ? B C   A ASN 186 ? B 122.61 110.40 12.21  2.00 N 
24 1 NE  B ARG 24  ? ? CZ B ARG 24  ? ? NH1 B ARG 24  ? ? 127.53 120.30 7.23   0.50 N 
25 1 NE  B ARG 24  ? ? CZ B ARG 24  ? ? NH2 B ARG 24  ? ? 115.51 120.30 -4.79  0.50 N 
26 1 NE  B ARG 27  ? ? CZ B ARG 27  ? ? NH1 B ARG 27  ? ? 124.60 120.30 4.30   0.50 N 
27 1 NE  B ARG 27  ? ? CZ B ARG 27  ? ? NH2 B ARG 27  ? ? 114.30 120.30 -6.00  0.50 N 
28 1 NE  B ARG 29  ? ? CZ B ARG 29  ? ? NH1 B ARG 29  ? ? 116.04 120.30 -4.26  0.50 N 
29 1 NE  B ARG 41  ? ? CZ B ARG 41  ? ? NH1 B ARG 41  ? ? 123.63 120.30 3.33   0.50 N 
30 1 NE  B ARG 42  ? ? CZ B ARG 42  ? ? NH2 B ARG 42  ? ? 117.30 120.30 -3.00  0.50 N 
31 1 NE  B ARG 47  ? ? CZ B ARG 47  ? ? NH2 B ARG 47  ? ? 124.00 120.30 3.70   0.50 N 
32 1 NE  B ARG 54  ? ? CZ B ARG 54  ? ? NH2 B ARG 54  ? ? 123.60 120.30 3.30   0.50 N 
33 1 CD  B ARG 85  ? A NE B ARG 85  ? A CZ  B ARG 85  ? A 139.76 123.60 16.16  1.40 N 
34 1 CD  B ARG 85  ? B NE B ARG 85  ? B CZ  B ARG 85  ? B 135.38 123.60 11.78  1.40 N 
35 1 NH1 B ARG 85  ? B CZ B ARG 85  ? B NH2 B ARG 85  ? B 126.88 119.40 7.48   1.10 N 
36 1 NE  B ARG 85  ? B CZ B ARG 85  ? B NH1 B ARG 85  ? B 116.31 120.30 -3.99  0.50 N 
37 1 NE  B ARG 85  ? A CZ B ARG 85  ? A NH2 B ARG 85  ? A 124.65 120.30 4.35   0.50 N 
38 1 NE  B ARG 85  ? B CZ B ARG 85  ? B NH2 B ARG 85  ? B 116.80 120.30 -3.50  0.50 N 
39 1 CB  B VAL 109 ? A CA B VAL 109 ? A C   B VAL 109 ? ? 123.64 111.40 12.24  1.90 N 
40 1 CG1 B VAL 109 ? A CB B VAL 109 ? A CG2 B VAL 109 ? A 93.98  110.90 -16.92 1.60 N 
41 1 CA  B VAL 109 ? A CB B VAL 109 ? A CG1 B VAL 109 ? A 125.70 110.90 14.80  1.50 N 
42 1 NE  B ARG 114 ? ? CZ B ARG 114 ? ? NH2 B ARG 114 ? ? 117.23 120.30 -3.07  0.50 N 
43 1 NH1 B ARG 127 ? ? CZ B ARG 127 ? ? NH2 B ARG 127 ? ? 133.72 119.40 14.32  1.10 N 
44 1 NE  B ARG 127 ? ? CZ B ARG 127 ? ? NH1 B ARG 127 ? ? 113.93 120.30 -6.37  0.50 N 
45 1 NE  B ARG 127 ? ? CZ B ARG 127 ? ? NH2 B ARG 127 ? ? 112.35 120.30 -7.95  0.50 N 
46 1 CA  B ASP 147 ? ? CB B ASP 147 ? ? CG  B ASP 147 ? ? 143.76 113.40 30.36  2.20 N 
47 1 CD  B ARG 150 ? ? NE B ARG 150 ? ? CZ  B ARG 150 ? ? 133.47 123.60 9.87   1.40 N 
48 1 NE  B ARG 150 ? ? CZ B ARG 150 ? ? NH2 B ARG 150 ? ? 124.64 120.30 4.34   0.50 N 
49 1 OE1 B GLN 152 ? ? CD B GLN 152 ? ? NE2 B GLN 152 ? ? 136.47 121.90 14.57  2.30 N 
50 1 CA  B CYS 165 ? ? CB B CYS 165 ? ? SG  B CYS 165 ? ? 121.08 114.20 6.88   1.10 N 
51 1 C   B VAL 172 ? ? N  B LEU 173 ? ? CA  B LEU 173 ? ? 136.82 121.70 15.12  2.50 Y 
52 1 NE  B ARG 177 ? ? CZ B ARG 177 ? ? NH1 B ARG 177 ? ? 114.53 120.30 -5.77  0.50 N 
53 1 NE  B ARG 177 ? ? CZ B ARG 177 ? ? NH2 B ARG 177 ? ? 125.23 120.30 4.93   0.50 N 
54 1 CG  B ARG 179 ? ? CD B ARG 179 ? ? NE  B ARG 179 ? ? 124.82 111.80 13.02  2.10 N 
55 1 NE  B ARG 188 ? ? CZ B ARG 188 ? ? NH1 B ARG 188 ? ? 123.71 120.30 3.41   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 MET A 11  ? ? -100.06 -74.11 
2 1 ASP A 185 ? A -94.29  41.12  
3 1 MET B 11  ? ? -99.97  -72.82 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1 ? A MET 1 
2 1 Y 1 A ALA 2 ? A ALA 2 
3 1 Y 1 A ARG 3 ? A ARG 3 
4 1 Y 1 B MET 1 ? B MET 1 
5 1 Y 1 B ALA 2 ? B ALA 2 
6 1 Y 1 B ARG 3 ? B ARG 3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION' MG  
3 'PHOSPHATE ION' PO4 
4 GLYCEROL        GOL 
5 'SODIUM ION'    NA  
6 water           HOH 
#