data_4L6V
# 
_entry.id   4L6V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.312 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4L6V         
RCSB  RCSB080255   
WWPDB D_1000080255 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1JB0 'Photosynthetic Reaction Center and Core Antenna System from Cyanobacteria' unspecified 
PDB 3LW5 'Improved model of plant photosystem I'                                     unspecified 
PDB 4KT0 .                                                                           unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4L6V 
_pdbx_database_status.recvd_initial_deposition_date   2013-06-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mazor, Y.'   1 
'Nataf, D.'   2 
'Toporik, H.' 3 
'Nelson, N.'  4 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structures of virus-like photosystem I complexes from the mesophilic cyanobacterium Synechocystis PCC 6803.' 
_citation.journal_abbrev            Elife 
_citation.journal_volume            3 
_citation.page_first                e01496 
_citation.page_last                 e01496 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24473073 
_citation.pdbx_database_id_DOI      10.7554/eLife.01496 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Mazor, Y.'   1 ? 
primary 'Nataf, D.'   2 ? 
primary 'Toporik, H.' 3 ? 
primary 'Nelson, N.'  4 ? 
# 
_cell.entry_id           4L6V 
_cell.length_a           214.619 
_cell.length_b           133.680 
_cell.length_c           219.846 
_cell.angle_alpha        90.00 
_cell.angle_beta         111.14 
_cell.angle_gamma        90.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4L6V 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Photosystem I P700 chlorophyll a apoprotein A1'             83036.398 3   1.97.1.12 ? ? ? 
2  polymer     man 'Photosystem I P700 chlorophyll a apoprotein A2'             81369.531 3   1.97.1.12 ? ? ? 
3  polymer     man 'Photosystem I iron-sulfur center'                           8837.261  3   1.97.1.12 ? ? ? 
4  polymer     man 'Photosystem I subunit II'                                   15663.749 3   1.97.1.12 ? ? ? 
5  polymer     man 'Photosystem I reaction center subunit IV'                   8154.086  3   1.97.1.12 ? ? ? 
6  polymer     man 'Fusion protein of Photosystem I subunit III and subunit IX' 13855.387 3   1.97.1.12 ? ? ? 
7  polymer     man 'Photosystem I reaction center subunit XI'                   16631.795 3   1.97.1.12 ? ? ? 
8  polymer     man 'Photosystem I reaction center subunit XII'                  3382.063  3   1.97.1.12 ? ? ? 
9  polymer     man 'Photosystem I subunit III'                                  4414.148  3   1.97.1.12 ? ? ? 
10 polymer     man 'Photosystem I reaction center subunit VIII'                 13732.274 3   1.97.1.12 ? ? ? 
11 non-polymer syn 'CHLOROPHYLL A'                                              893.489   273 ?         ? ? ? 
12 non-polymer syn PHYLLOQUINONE                                                450.696   6   ?         ? ? ? 
13 non-polymer syn 'IRON/SULFUR CLUSTER'                                        351.640   9   ?         ? ? ? 
14 non-polymer syn BETA-CAROTENE                                                536.873   57  ?         ? ? ? 
15 non-polymer syn 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE                       722.970   9   ?         ? ? ? 
16 non-polymer syn 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE                    787.158   3   ?         ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  PsaA                                                        
2  PsaB                                                        
3  '9 kDa polypeptide, PSI-C, Photosystem I subunit VII, PsaC' 
6  'PSI subunit V, PSI-L'                                      
7  PSI-M                                                       
11 'Photosystem I subunit X'                                   
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MTISPPEREAKAKVSVDNNPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHANAHDFDSQTSDLEDVSRKIFSAHFGHL
AVVFVWLSGMYFHGAKFSNYEGWLADPTHIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFYLWRASGFTDSYQLYC
TAIGGLVMAALMLFAGWFHYHVKAPKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMPINKLLDAGVAPKDIPLPH
EFILEPSKMAELYPSFAQGLTPFFTLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNWGIGHS
MKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQAIDYATQLSLFTHHMWIGGFL
IVGAGAHGAIFMVRDYDPAKNVNNLLDRMLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQP
IFAQWVQHLHTLAPGATAPNALATASYAFGGETIAVAGKVAMMPITLGTADFMVHHIHAFTIHVTALILLKGVLYARSSR
LVPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVSPDGSVTHVTLGNFAQSAI
TINGWLRDFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQELIESIVWAHNKLNVAPAIQPRALSI
IQGRAVGVAHYLLGGIVTTWAFFLARSLSIG
;
;MTISPPEREAKAKVSVDNNPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHANAHDFDSQTSDLEDVSRKIFSAHFGHL
AVVFVWLSGMYFHGAKFSNYEGWLADPTHIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFYLWRASGFTDSYQLYC
TAIGGLVMAALMLFAGWFHYHVKAPKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMPINKLLDAGVAPKDIPLPH
EFILEPSKMAELYPSFAQGLTPFFTLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNWGIGHS
MKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQAIDYATQLSLFTHHMWIGGFL
IVGAGAHGAIFMVRDYDPAKNVNNLLDRMLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQP
IFAQWVQHLHTLAPGATAPNALATASYAFGGETIAVAGKVAMMPITLGTADFMVHHIHAFTIHVTALILLKGVLYARSSR
LVPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVSPDGSVTHVTLGNFAQSAI
TINGWLRDFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQELIESIVWAHNKLNVAPAIQPRALSI
IQGRAVGVAHYLLGGIVTTWAFFLARSLSIG
;
A,a,1 ? 
2  'polypeptide(L)' no no 
;MATKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKD
PLNIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGVYHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPK
FRPSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIPEARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTA
GHIFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAIAVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNL
YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVA
NKDNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPD
SIASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPG
RGGTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWSGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNL
SVWAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAA
FLIASTAGKFG
;
;MATKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKD
PLNIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGVYHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPK
FRPSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIPEARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTA
GHIFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAIAVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNL
YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVA
NKDNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPD
SIASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPG
RGGTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWSGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNL
SVWAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAA
FLIASTAGKFG
;
B,b,2 ? 
3  'polypeptide(L)' no no 
;MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLA
Y
;
;MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLA
Y
;
C,c,3 ? 
4  'polypeptide(L)' no no 
;MTELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKI
QDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV
;
;MTELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKI
QDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV
;
D,d,4 ? 
5  'polypeptide(L)' no no MALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELVQAAAK 
MALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELVQAAAK E,e,5 ? 
6  'polypeptide(L)' no no 
;MDGLKSFLSTAPVMIMALLTFTAGILIEFNAFYPDLLFHPCSCAGDFLIPSIIFLYIAGWIGWVGRSYLIEIRESKNPEM
QEVVINVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTSPR
;
;MDGLKSFLSTAPVMIMALLTFTAGILIEFNAFYPDLLFHPCSCAGDFLIPSIIFLYIAGWIGWVGRSYLIEIRESKNPEM
QEVVINVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTSPR
;
F,f,6 ? 
7  'polypeptide(L)' no no 
;MAESNQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPWTLLGPLRDSEYQYIG
GLIGALALILVATAALSSYGLVTFQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRGLFN
;
;MAESNQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPWTLLGPLRDSEYQYIG
GLIGALALILVATAALSSYGLVTFQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRGLFN
;
L,l,8 ? 
8  'polypeptide(L)' no no MALSDTQILAALVVALLPAFLAFRLSTELYK MALSDTQILAALVVALLPAFLAFRLSTELYK M,m,7 ? 
9  'polypeptide(L)' no no MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESEGEG MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESEGEG i,9,I ? 
10 'polypeptide(L)' no no 
;MTAIARERGRSKRGIALHRLEYLKENQVFEIIFGEPLSMFNTALLLAQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQ
KTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLASSGIL
;
;MTAIARERGRSKRGIALHRLEYLKENQVFEIIFGEPLSMFNTALLLAQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQ
KTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLASSGIL
;
K,k,0 ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   MET n 
1  2   THR n 
1  3   ILE n 
1  4   SER n 
1  5   PRO n 
1  6   PRO n 
1  7   GLU n 
1  8   ARG n 
1  9   GLU n 
1  10  ALA n 
1  11  LYS n 
1  12  ALA n 
1  13  LYS n 
1  14  VAL n 
1  15  SER n 
1  16  VAL n 
1  17  ASP n 
1  18  ASN n 
1  19  ASN n 
1  20  PRO n 
1  21  VAL n 
1  22  PRO n 
1  23  THR n 
1  24  SER n 
1  25  PHE n 
1  26  GLU n 
1  27  LYS n 
1  28  TRP n 
1  29  GLY n 
1  30  LYS n 
1  31  PRO n 
1  32  GLY n 
1  33  HIS n 
1  34  PHE n 
1  35  ASP n 
1  36  ARG n 
1  37  THR n 
1  38  LEU n 
1  39  ALA n 
1  40  ARG n 
1  41  GLY n 
1  42  PRO n 
1  43  LYS n 
1  44  THR n 
1  45  THR n 
1  46  THR n 
1  47  TRP n 
1  48  ILE n 
1  49  TRP n 
1  50  ASN n 
1  51  LEU n 
1  52  HIS n 
1  53  ALA n 
1  54  ASN n 
1  55  ALA n 
1  56  HIS n 
1  57  ASP n 
1  58  PHE n 
1  59  ASP n 
1  60  SER n 
1  61  GLN n 
1  62  THR n 
1  63  SER n 
1  64  ASP n 
1  65  LEU n 
1  66  GLU n 
1  67  ASP n 
1  68  VAL n 
1  69  SER n 
1  70  ARG n 
1  71  LYS n 
1  72  ILE n 
1  73  PHE n 
1  74  SER n 
1  75  ALA n 
1  76  HIS n 
1  77  PHE n 
1  78  GLY n 
1  79  HIS n 
1  80  LEU n 
1  81  ALA n 
1  82  VAL n 
1  83  VAL n 
1  84  PHE n 
1  85  VAL n 
1  86  TRP n 
1  87  LEU n 
1  88  SER n 
1  89  GLY n 
1  90  MET n 
1  91  TYR n 
1  92  PHE n 
1  93  HIS n 
1  94  GLY n 
1  95  ALA n 
1  96  LYS n 
1  97  PHE n 
1  98  SER n 
1  99  ASN n 
1  100 TYR n 
1  101 GLU n 
1  102 GLY n 
1  103 TRP n 
1  104 LEU n 
1  105 ALA n 
1  106 ASP n 
1  107 PRO n 
1  108 THR n 
1  109 HIS n 
1  110 ILE n 
1  111 LYS n 
1  112 PRO n 
1  113 SER n 
1  114 ALA n 
1  115 GLN n 
1  116 VAL n 
1  117 VAL n 
1  118 TRP n 
1  119 PRO n 
1  120 ILE n 
1  121 VAL n 
1  122 GLY n 
1  123 GLN n 
1  124 GLY n 
1  125 ILE n 
1  126 LEU n 
1  127 ASN n 
1  128 GLY n 
1  129 ASP n 
1  130 VAL n 
1  131 GLY n 
1  132 GLY n 
1  133 GLY n 
1  134 PHE n 
1  135 HIS n 
1  136 GLY n 
1  137 ILE n 
1  138 GLN n 
1  139 ILE n 
1  140 THR n 
1  141 SER n 
1  142 GLY n 
1  143 LEU n 
1  144 PHE n 
1  145 TYR n 
1  146 LEU n 
1  147 TRP n 
1  148 ARG n 
1  149 ALA n 
1  150 SER n 
1  151 GLY n 
1  152 PHE n 
1  153 THR n 
1  154 ASP n 
1  155 SER n 
1  156 TYR n 
1  157 GLN n 
1  158 LEU n 
1  159 TYR n 
1  160 CYS n 
1  161 THR n 
1  162 ALA n 
1  163 ILE n 
1  164 GLY n 
1  165 GLY n 
1  166 LEU n 
1  167 VAL n 
1  168 MET n 
1  169 ALA n 
1  170 ALA n 
1  171 LEU n 
1  172 MET n 
1  173 LEU n 
1  174 PHE n 
1  175 ALA n 
1  176 GLY n 
1  177 TRP n 
1  178 PHE n 
1  179 HIS n 
1  180 TYR n 
1  181 HIS n 
1  182 VAL n 
1  183 LYS n 
1  184 ALA n 
1  185 PRO n 
1  186 LYS n 
1  187 LEU n 
1  188 GLU n 
1  189 TRP n 
1  190 PHE n 
1  191 GLN n 
1  192 ASN n 
1  193 VAL n 
1  194 GLU n 
1  195 SER n 
1  196 MET n 
1  197 MET n 
1  198 ASN n 
1  199 HIS n 
1  200 HIS n 
1  201 LEU n 
1  202 ALA n 
1  203 GLY n 
1  204 LEU n 
1  205 LEU n 
1  206 GLY n 
1  207 LEU n 
1  208 GLY n 
1  209 SER n 
1  210 LEU n 
1  211 GLY n 
1  212 TRP n 
1  213 ALA n 
1  214 GLY n 
1  215 HIS n 
1  216 GLN n 
1  217 ILE n 
1  218 HIS n 
1  219 VAL n 
1  220 SER n 
1  221 MET n 
1  222 PRO n 
1  223 ILE n 
1  224 ASN n 
1  225 LYS n 
1  226 LEU n 
1  227 LEU n 
1  228 ASP n 
1  229 ALA n 
1  230 GLY n 
1  231 VAL n 
1  232 ALA n 
1  233 PRO n 
1  234 LYS n 
1  235 ASP n 
1  236 ILE n 
1  237 PRO n 
1  238 LEU n 
1  239 PRO n 
1  240 HIS n 
1  241 GLU n 
1  242 PHE n 
1  243 ILE n 
1  244 LEU n 
1  245 GLU n 
1  246 PRO n 
1  247 SER n 
1  248 LYS n 
1  249 MET n 
1  250 ALA n 
1  251 GLU n 
1  252 LEU n 
1  253 TYR n 
1  254 PRO n 
1  255 SER n 
1  256 PHE n 
1  257 ALA n 
1  258 GLN n 
1  259 GLY n 
1  260 LEU n 
1  261 THR n 
1  262 PRO n 
1  263 PHE n 
1  264 PHE n 
1  265 THR n 
1  266 LEU n 
1  267 ASN n 
1  268 TRP n 
1  269 GLY n 
1  270 VAL n 
1  271 TYR n 
1  272 SER n 
1  273 ASP n 
1  274 PHE n 
1  275 LEU n 
1  276 THR n 
1  277 PHE n 
1  278 LYS n 
1  279 GLY n 
1  280 GLY n 
1  281 LEU n 
1  282 ASN n 
1  283 PRO n 
1  284 VAL n 
1  285 THR n 
1  286 GLY n 
1  287 GLY n 
1  288 LEU n 
1  289 TRP n 
1  290 LEU n 
1  291 SER n 
1  292 ASP n 
1  293 THR n 
1  294 ALA n 
1  295 HIS n 
1  296 HIS n 
1  297 HIS n 
1  298 LEU n 
1  299 ALA n 
1  300 ILE n 
1  301 ALA n 
1  302 VAL n 
1  303 LEU n 
1  304 PHE n 
1  305 ILE n 
1  306 ILE n 
1  307 ALA n 
1  308 GLY n 
1  309 HIS n 
1  310 MET n 
1  311 TYR n 
1  312 ARG n 
1  313 THR n 
1  314 ASN n 
1  315 TRP n 
1  316 GLY n 
1  317 ILE n 
1  318 GLY n 
1  319 HIS n 
1  320 SER n 
1  321 MET n 
1  322 LYS n 
1  323 GLU n 
1  324 ILE n 
1  325 LEU n 
1  326 GLU n 
1  327 ALA n 
1  328 HIS n 
1  329 LYS n 
1  330 GLY n 
1  331 PRO n 
1  332 PHE n 
1  333 THR n 
1  334 GLY n 
1  335 GLU n 
1  336 GLY n 
1  337 HIS n 
1  338 LYS n 
1  339 GLY n 
1  340 LEU n 
1  341 TYR n 
1  342 GLU n 
1  343 ILE n 
1  344 LEU n 
1  345 THR n 
1  346 THR n 
1  347 SER n 
1  348 TRP n 
1  349 HIS n 
1  350 ALA n 
1  351 GLN n 
1  352 LEU n 
1  353 ALA n 
1  354 ILE n 
1  355 ASN n 
1  356 LEU n 
1  357 ALA n 
1  358 LEU n 
1  359 LEU n 
1  360 GLY n 
1  361 SER n 
1  362 LEU n 
1  363 THR n 
1  364 ILE n 
1  365 ILE n 
1  366 VAL n 
1  367 ALA n 
1  368 GLN n 
1  369 HIS n 
1  370 MET n 
1  371 TYR n 
1  372 ALA n 
1  373 MET n 
1  374 PRO n 
1  375 PRO n 
1  376 TYR n 
1  377 PRO n 
1  378 TYR n 
1  379 GLN n 
1  380 ALA n 
1  381 ILE n 
1  382 ASP n 
1  383 TYR n 
1  384 ALA n 
1  385 THR n 
1  386 GLN n 
1  387 LEU n 
1  388 SER n 
1  389 LEU n 
1  390 PHE n 
1  391 THR n 
1  392 HIS n 
1  393 HIS n 
1  394 MET n 
1  395 TRP n 
1  396 ILE n 
1  397 GLY n 
1  398 GLY n 
1  399 PHE n 
1  400 LEU n 
1  401 ILE n 
1  402 VAL n 
1  403 GLY n 
1  404 ALA n 
1  405 GLY n 
1  406 ALA n 
1  407 HIS n 
1  408 GLY n 
1  409 ALA n 
1  410 ILE n 
1  411 PHE n 
1  412 MET n 
1  413 VAL n 
1  414 ARG n 
1  415 ASP n 
1  416 TYR n 
1  417 ASP n 
1  418 PRO n 
1  419 ALA n 
1  420 LYS n 
1  421 ASN n 
1  422 VAL n 
1  423 ASN n 
1  424 ASN n 
1  425 LEU n 
1  426 LEU n 
1  427 ASP n 
1  428 ARG n 
1  429 MET n 
1  430 LEU n 
1  431 ARG n 
1  432 HIS n 
1  433 ARG n 
1  434 ASP n 
1  435 ALA n 
1  436 ILE n 
1  437 ILE n 
1  438 SER n 
1  439 HIS n 
1  440 LEU n 
1  441 ASN n 
1  442 TRP n 
1  443 VAL n 
1  444 CYS n 
1  445 ILE n 
1  446 PHE n 
1  447 LEU n 
1  448 GLY n 
1  449 PHE n 
1  450 HIS n 
1  451 SER n 
1  452 PHE n 
1  453 GLY n 
1  454 LEU n 
1  455 TYR n 
1  456 ILE n 
1  457 HIS n 
1  458 ASN n 
1  459 ASP n 
1  460 THR n 
1  461 MET n 
1  462 ARG n 
1  463 ALA n 
1  464 LEU n 
1  465 GLY n 
1  466 ARG n 
1  467 PRO n 
1  468 GLN n 
1  469 ASP n 
1  470 MET n 
1  471 PHE n 
1  472 SER n 
1  473 ASP n 
1  474 THR n 
1  475 ALA n 
1  476 ILE n 
1  477 GLN n 
1  478 LEU n 
1  479 GLN n 
1  480 PRO n 
1  481 ILE n 
1  482 PHE n 
1  483 ALA n 
1  484 GLN n 
1  485 TRP n 
1  486 VAL n 
1  487 GLN n 
1  488 HIS n 
1  489 LEU n 
1  490 HIS n 
1  491 THR n 
1  492 LEU n 
1  493 ALA n 
1  494 PRO n 
1  495 GLY n 
1  496 ALA n 
1  497 THR n 
1  498 ALA n 
1  499 PRO n 
1  500 ASN n 
1  501 ALA n 
1  502 LEU n 
1  503 ALA n 
1  504 THR n 
1  505 ALA n 
1  506 SER n 
1  507 TYR n 
1  508 ALA n 
1  509 PHE n 
1  510 GLY n 
1  511 GLY n 
1  512 GLU n 
1  513 THR n 
1  514 ILE n 
1  515 ALA n 
1  516 VAL n 
1  517 ALA n 
1  518 GLY n 
1  519 LYS n 
1  520 VAL n 
1  521 ALA n 
1  522 MET n 
1  523 MET n 
1  524 PRO n 
1  525 ILE n 
1  526 THR n 
1  527 LEU n 
1  528 GLY n 
1  529 THR n 
1  530 ALA n 
1  531 ASP n 
1  532 PHE n 
1  533 MET n 
1  534 VAL n 
1  535 HIS n 
1  536 HIS n 
1  537 ILE n 
1  538 HIS n 
1  539 ALA n 
1  540 PHE n 
1  541 THR n 
1  542 ILE n 
1  543 HIS n 
1  544 VAL n 
1  545 THR n 
1  546 ALA n 
1  547 LEU n 
1  548 ILE n 
1  549 LEU n 
1  550 LEU n 
1  551 LYS n 
1  552 GLY n 
1  553 VAL n 
1  554 LEU n 
1  555 TYR n 
1  556 ALA n 
1  557 ARG n 
1  558 SER n 
1  559 SER n 
1  560 ARG n 
1  561 LEU n 
1  562 VAL n 
1  563 PRO n 
1  564 ASP n 
1  565 LYS n 
1  566 ALA n 
1  567 ASN n 
1  568 LEU n 
1  569 GLY n 
1  570 PHE n 
1  571 ARG n 
1  572 PHE n 
1  573 PRO n 
1  574 CYS n 
1  575 ASP n 
1  576 GLY n 
1  577 PRO n 
1  578 GLY n 
1  579 ARG n 
1  580 GLY n 
1  581 GLY n 
1  582 THR n 
1  583 CYS n 
1  584 GLN n 
1  585 VAL n 
1  586 SER n 
1  587 GLY n 
1  588 TRP n 
1  589 ASP n 
1  590 HIS n 
1  591 VAL n 
1  592 PHE n 
1  593 LEU n 
1  594 GLY n 
1  595 LEU n 
1  596 PHE n 
1  597 TRP n 
1  598 MET n 
1  599 TYR n 
1  600 ASN n 
1  601 SER n 
1  602 LEU n 
1  603 SER n 
1  604 ILE n 
1  605 VAL n 
1  606 ILE n 
1  607 PHE n 
1  608 HIS n 
1  609 PHE n 
1  610 SER n 
1  611 TRP n 
1  612 LYS n 
1  613 MET n 
1  614 GLN n 
1  615 SER n 
1  616 ASP n 
1  617 VAL n 
1  618 TRP n 
1  619 GLY n 
1  620 THR n 
1  621 VAL n 
1  622 SER n 
1  623 PRO n 
1  624 ASP n 
1  625 GLY n 
1  626 SER n 
1  627 VAL n 
1  628 THR n 
1  629 HIS n 
1  630 VAL n 
1  631 THR n 
1  632 LEU n 
1  633 GLY n 
1  634 ASN n 
1  635 PHE n 
1  636 ALA n 
1  637 GLN n 
1  638 SER n 
1  639 ALA n 
1  640 ILE n 
1  641 THR n 
1  642 ILE n 
1  643 ASN n 
1  644 GLY n 
1  645 TRP n 
1  646 LEU n 
1  647 ARG n 
1  648 ASP n 
1  649 PHE n 
1  650 LEU n 
1  651 TRP n 
1  652 ALA n 
1  653 GLN n 
1  654 ALA n 
1  655 ALA n 
1  656 ASN n 
1  657 VAL n 
1  658 ILE n 
1  659 ASN n 
1  660 SER n 
1  661 TYR n 
1  662 GLY n 
1  663 SER n 
1  664 ALA n 
1  665 LEU n 
1  666 SER n 
1  667 ALA n 
1  668 TYR n 
1  669 GLY n 
1  670 ILE n 
1  671 MET n 
1  672 PHE n 
1  673 LEU n 
1  674 ALA n 
1  675 GLY n 
1  676 HIS n 
1  677 PHE n 
1  678 VAL n 
1  679 PHE n 
1  680 ALA n 
1  681 PHE n 
1  682 SER n 
1  683 LEU n 
1  684 MET n 
1  685 PHE n 
1  686 LEU n 
1  687 PHE n 
1  688 SER n 
1  689 GLY n 
1  690 ARG n 
1  691 GLY n 
1  692 TYR n 
1  693 TRP n 
1  694 GLN n 
1  695 GLU n 
1  696 LEU n 
1  697 ILE n 
1  698 GLU n 
1  699 SER n 
1  700 ILE n 
1  701 VAL n 
1  702 TRP n 
1  703 ALA n 
1  704 HIS n 
1  705 ASN n 
1  706 LYS n 
1  707 LEU n 
1  708 ASN n 
1  709 VAL n 
1  710 ALA n 
1  711 PRO n 
1  712 ALA n 
1  713 ILE n 
1  714 GLN n 
1  715 PRO n 
1  716 ARG n 
1  717 ALA n 
1  718 LEU n 
1  719 SER n 
1  720 ILE n 
1  721 ILE n 
1  722 GLN n 
1  723 GLY n 
1  724 ARG n 
1  725 ALA n 
1  726 VAL n 
1  727 GLY n 
1  728 VAL n 
1  729 ALA n 
1  730 HIS n 
1  731 TYR n 
1  732 LEU n 
1  733 LEU n 
1  734 GLY n 
1  735 GLY n 
1  736 ILE n 
1  737 VAL n 
1  738 THR n 
1  739 THR n 
1  740 TRP n 
1  741 ALA n 
1  742 PHE n 
1  743 PHE n 
1  744 LEU n 
1  745 ALA n 
1  746 ARG n 
1  747 SER n 
1  748 LEU n 
1  749 SER n 
1  750 ILE n 
1  751 GLY n 
2  1   MET n 
2  2   ALA n 
2  3   THR n 
2  4   LYS n 
2  5   PHE n 
2  6   PRO n 
2  7   LYS n 
2  8   PHE n 
2  9   SER n 
2  10  GLN n 
2  11  ASP n 
2  12  LEU n 
2  13  ALA n 
2  14  GLN n 
2  15  ASP n 
2  16  PRO n 
2  17  THR n 
2  18  THR n 
2  19  ARG n 
2  20  ARG n 
2  21  ILE n 
2  22  TRP n 
2  23  TYR n 
2  24  GLY n 
2  25  ILE n 
2  26  ALA n 
2  27  THR n 
2  28  ALA n 
2  29  HIS n 
2  30  ASP n 
2  31  PHE n 
2  32  GLU n 
2  33  THR n 
2  34  HIS n 
2  35  ASP n 
2  36  GLY n 
2  37  MET n 
2  38  THR n 
2  39  GLU n 
2  40  GLU n 
2  41  ASN n 
2  42  LEU n 
2  43  TYR n 
2  44  GLN n 
2  45  LYS n 
2  46  ILE n 
2  47  PHE n 
2  48  ALA n 
2  49  SER n 
2  50  HIS n 
2  51  PHE n 
2  52  GLY n 
2  53  HIS n 
2  54  ILE n 
2  55  ALA n 
2  56  ILE n 
2  57  ILE n 
2  58  PHE n 
2  59  LEU n 
2  60  TRP n 
2  61  THR n 
2  62  SER n 
2  63  GLY n 
2  64  THR n 
2  65  LEU n 
2  66  PHE n 
2  67  HIS n 
2  68  VAL n 
2  69  ALA n 
2  70  TRP n 
2  71  GLN n 
2  72  GLY n 
2  73  ASN n 
2  74  PHE n 
2  75  GLU n 
2  76  GLN n 
2  77  TRP n 
2  78  ILE n 
2  79  LYS n 
2  80  ASP n 
2  81  PRO n 
2  82  LEU n 
2  83  ASN n 
2  84  ILE n 
2  85  ARG n 
2  86  PRO n 
2  87  ILE n 
2  88  ALA n 
2  89  HIS n 
2  90  ALA n 
2  91  ILE n 
2  92  TRP n 
2  93  ASP n 
2  94  PRO n 
2  95  HIS n 
2  96  PHE n 
2  97  GLY n 
2  98  GLU n 
2  99  GLY n 
2  100 ALA n 
2  101 VAL n 
2  102 ASN n 
2  103 ALA n 
2  104 PHE n 
2  105 THR n 
2  106 GLN n 
2  107 ALA n 
2  108 GLY n 
2  109 ALA n 
2  110 SER n 
2  111 ASN n 
2  112 PRO n 
2  113 VAL n 
2  114 ASN n 
2  115 ILE n 
2  116 ALA n 
2  117 TYR n 
2  118 SER n 
2  119 GLY n 
2  120 VAL n 
2  121 TYR n 
2  122 HIS n 
2  123 TRP n 
2  124 PHE n 
2  125 TYR n 
2  126 THR n 
2  127 ILE n 
2  128 GLY n 
2  129 MET n 
2  130 THR n 
2  131 THR n 
2  132 ASN n 
2  133 GLN n 
2  134 GLU n 
2  135 LEU n 
2  136 TYR n 
2  137 SER n 
2  138 GLY n 
2  139 ALA n 
2  140 VAL n 
2  141 PHE n 
2  142 LEU n 
2  143 LEU n 
2  144 VAL n 
2  145 LEU n 
2  146 ALA n 
2  147 SER n 
2  148 LEU n 
2  149 PHE n 
2  150 LEU n 
2  151 PHE n 
2  152 ALA n 
2  153 GLY n 
2  154 TRP n 
2  155 LEU n 
2  156 HIS n 
2  157 LEU n 
2  158 GLN n 
2  159 PRO n 
2  160 LYS n 
2  161 PHE n 
2  162 ARG n 
2  163 PRO n 
2  164 SER n 
2  165 LEU n 
2  166 ALA n 
2  167 TRP n 
2  168 PHE n 
2  169 LYS n 
2  170 ASN n 
2  171 ALA n 
2  172 GLU n 
2  173 SER n 
2  174 ARG n 
2  175 LEU n 
2  176 ASN n 
2  177 HIS n 
2  178 HIS n 
2  179 LEU n 
2  180 ALA n 
2  181 GLY n 
2  182 LEU n 
2  183 PHE n 
2  184 GLY n 
2  185 VAL n 
2  186 SER n 
2  187 SER n 
2  188 LEU n 
2  189 ALA n 
2  190 TRP n 
2  191 ALA n 
2  192 GLY n 
2  193 HIS n 
2  194 LEU n 
2  195 VAL n 
2  196 HIS n 
2  197 VAL n 
2  198 ALA n 
2  199 ILE n 
2  200 PRO n 
2  201 GLU n 
2  202 ALA n 
2  203 ARG n 
2  204 GLY n 
2  205 GLN n 
2  206 HIS n 
2  207 VAL n 
2  208 GLY n 
2  209 TRP n 
2  210 ASP n 
2  211 ASN n 
2  212 PHE n 
2  213 LEU n 
2  214 SER n 
2  215 THR n 
2  216 PRO n 
2  217 PRO n 
2  218 HIS n 
2  219 PRO n 
2  220 ALA n 
2  221 GLY n 
2  222 LEU n 
2  223 MET n 
2  224 PRO n 
2  225 PHE n 
2  226 PHE n 
2  227 THR n 
2  228 GLY n 
2  229 ASN n 
2  230 TRP n 
2  231 GLY n 
2  232 VAL n 
2  233 TYR n 
2  234 ALA n 
2  235 ALA n 
2  236 ASP n 
2  237 PRO n 
2  238 ASP n 
2  239 THR n 
2  240 ALA n 
2  241 GLY n 
2  242 HIS n 
2  243 ILE n 
2  244 PHE n 
2  245 GLY n 
2  246 THR n 
2  247 SER n 
2  248 GLU n 
2  249 GLY n 
2  250 ALA n 
2  251 GLY n 
2  252 THR n 
2  253 ALA n 
2  254 ILE n 
2  255 LEU n 
2  256 THR n 
2  257 PHE n 
2  258 LEU n 
2  259 GLY n 
2  260 GLY n 
2  261 PHE n 
2  262 HIS n 
2  263 PRO n 
2  264 GLN n 
2  265 THR n 
2  266 GLU n 
2  267 SER n 
2  268 LEU n 
2  269 TRP n 
2  270 LEU n 
2  271 THR n 
2  272 ASP n 
2  273 ILE n 
2  274 ALA n 
2  275 HIS n 
2  276 HIS n 
2  277 HIS n 
2  278 LEU n 
2  279 ALA n 
2  280 ILE n 
2  281 ALA n 
2  282 VAL n 
2  283 ILE n 
2  284 PHE n 
2  285 ILE n 
2  286 ILE n 
2  287 ALA n 
2  288 GLY n 
2  289 HIS n 
2  290 MET n 
2  291 TYR n 
2  292 ARG n 
2  293 THR n 
2  294 ASN n 
2  295 TRP n 
2  296 GLY n 
2  297 ILE n 
2  298 GLY n 
2  299 HIS n 
2  300 SER n 
2  301 ILE n 
2  302 LYS n 
2  303 GLU n 
2  304 ILE n 
2  305 LEU n 
2  306 ASN n 
2  307 ALA n 
2  308 HIS n 
2  309 LYS n 
2  310 GLY n 
2  311 PRO n 
2  312 LEU n 
2  313 THR n 
2  314 GLY n 
2  315 ALA n 
2  316 GLY n 
2  317 HIS n 
2  318 THR n 
2  319 ASN n 
2  320 LEU n 
2  321 TYR n 
2  322 ASP n 
2  323 THR n 
2  324 ILE n 
2  325 ASN n 
2  326 ASN n 
2  327 SER n 
2  328 LEU n 
2  329 HIS n 
2  330 PHE n 
2  331 GLN n 
2  332 LEU n 
2  333 GLY n 
2  334 LEU n 
2  335 ALA n 
2  336 LEU n 
2  337 ALA n 
2  338 SER n 
2  339 LEU n 
2  340 GLY n 
2  341 VAL n 
2  342 ILE n 
2  343 THR n 
2  344 SER n 
2  345 LEU n 
2  346 VAL n 
2  347 ALA n 
2  348 GLN n 
2  349 HIS n 
2  350 MET n 
2  351 TYR n 
2  352 SER n 
2  353 LEU n 
2  354 PRO n 
2  355 SER n 
2  356 TYR n 
2  357 ALA n 
2  358 PHE n 
2  359 ILE n 
2  360 ALA n 
2  361 GLN n 
2  362 ASP n 
2  363 HIS n 
2  364 THR n 
2  365 THR n 
2  366 GLN n 
2  367 ALA n 
2  368 ALA n 
2  369 LEU n 
2  370 TYR n 
2  371 THR n 
2  372 HIS n 
2  373 HIS n 
2  374 GLN n 
2  375 TYR n 
2  376 ILE n 
2  377 ALA n 
2  378 GLY n 
2  379 PHE n 
2  380 LEU n 
2  381 MET n 
2  382 VAL n 
2  383 GLY n 
2  384 ALA n 
2  385 PHE n 
2  386 ALA n 
2  387 HIS n 
2  388 GLY n 
2  389 ALA n 
2  390 ILE n 
2  391 PHE n 
2  392 PHE n 
2  393 VAL n 
2  394 ARG n 
2  395 ASP n 
2  396 TYR n 
2  397 ASP n 
2  398 PRO n 
2  399 VAL n 
2  400 ALA n 
2  401 ASN n 
2  402 LYS n 
2  403 ASP n 
2  404 ASN n 
2  405 VAL n 
2  406 LEU n 
2  407 ALA n 
2  408 ARG n 
2  409 MET n 
2  410 LEU n 
2  411 GLU n 
2  412 HIS n 
2  413 LYS n 
2  414 GLU n 
2  415 ALA n 
2  416 LEU n 
2  417 ILE n 
2  418 SER n 
2  419 HIS n 
2  420 LEU n 
2  421 SER n 
2  422 TRP n 
2  423 VAL n 
2  424 SER n 
2  425 LEU n 
2  426 PHE n 
2  427 LEU n 
2  428 GLY n 
2  429 PHE n 
2  430 HIS n 
2  431 THR n 
2  432 LEU n 
2  433 GLY n 
2  434 LEU n 
2  435 TYR n 
2  436 VAL n 
2  437 HIS n 
2  438 ASN n 
2  439 ASP n 
2  440 VAL n 
2  441 VAL n 
2  442 VAL n 
2  443 ALA n 
2  444 PHE n 
2  445 GLY n 
2  446 THR n 
2  447 PRO n 
2  448 GLU n 
2  449 LYS n 
2  450 GLN n 
2  451 ILE n 
2  452 LEU n 
2  453 ILE n 
2  454 GLU n 
2  455 PRO n 
2  456 VAL n 
2  457 PHE n 
2  458 ALA n 
2  459 GLN n 
2  460 TRP n 
2  461 ILE n 
2  462 GLN n 
2  463 ALA n 
2  464 THR n 
2  465 SER n 
2  466 GLY n 
2  467 LYS n 
2  468 ALA n 
2  469 LEU n 
2  470 TYR n 
2  471 GLY n 
2  472 PHE n 
2  473 ASP n 
2  474 VAL n 
2  475 LEU n 
2  476 LEU n 
2  477 SER n 
2  478 ASN n 
2  479 PRO n 
2  480 ASP n 
2  481 SER n 
2  482 ILE n 
2  483 ALA n 
2  484 SER n 
2  485 THR n 
2  486 THR n 
2  487 GLY n 
2  488 ALA n 
2  489 ALA n 
2  490 TRP n 
2  491 LEU n 
2  492 PRO n 
2  493 GLY n 
2  494 TRP n 
2  495 LEU n 
2  496 ASP n 
2  497 ALA n 
2  498 ILE n 
2  499 ASN n 
2  500 SER n 
2  501 GLY n 
2  502 THR n 
2  503 ASN n 
2  504 SER n 
2  505 LEU n 
2  506 PHE n 
2  507 LEU n 
2  508 THR n 
2  509 ILE n 
2  510 GLY n 
2  511 PRO n 
2  512 GLY n 
2  513 ASP n 
2  514 PHE n 
2  515 LEU n 
2  516 VAL n 
2  517 HIS n 
2  518 HIS n 
2  519 ALA n 
2  520 ILE n 
2  521 ALA n 
2  522 LEU n 
2  523 GLY n 
2  524 LEU n 
2  525 HIS n 
2  526 THR n 
2  527 THR n 
2  528 ALA n 
2  529 LEU n 
2  530 ILE n 
2  531 LEU n 
2  532 ILE n 
2  533 LYS n 
2  534 GLY n 
2  535 ALA n 
2  536 LEU n 
2  537 ASP n 
2  538 ALA n 
2  539 ARG n 
2  540 GLY n 
2  541 SER n 
2  542 LYS n 
2  543 LEU n 
2  544 MET n 
2  545 PRO n 
2  546 ASP n 
2  547 LYS n 
2  548 LYS n 
2  549 ASP n 
2  550 PHE n 
2  551 GLY n 
2  552 TYR n 
2  553 SER n 
2  554 PHE n 
2  555 PRO n 
2  556 CYS n 
2  557 ASP n 
2  558 GLY n 
2  559 PRO n 
2  560 GLY n 
2  561 ARG n 
2  562 GLY n 
2  563 GLY n 
2  564 THR n 
2  565 CYS n 
2  566 ASP n 
2  567 ILE n 
2  568 SER n 
2  569 ALA n 
2  570 TRP n 
2  571 ASP n 
2  572 ALA n 
2  573 PHE n 
2  574 TYR n 
2  575 LEU n 
2  576 ALA n 
2  577 MET n 
2  578 PHE n 
2  579 TRP n 
2  580 MET n 
2  581 LEU n 
2  582 ASN n 
2  583 THR n 
2  584 LEU n 
2  585 GLY n 
2  586 TRP n 
2  587 LEU n 
2  588 THR n 
2  589 PHE n 
2  590 TYR n 
2  591 TRP n 
2  592 HIS n 
2  593 TRP n 
2  594 LYS n 
2  595 HIS n 
2  596 LEU n 
2  597 GLY n 
2  598 VAL n 
2  599 TRP n 
2  600 SER n 
2  601 GLY n 
2  602 ASN n 
2  603 VAL n 
2  604 ALA n 
2  605 GLN n 
2  606 PHE n 
2  607 ASN n 
2  608 GLU n 
2  609 ASN n 
2  610 SER n 
2  611 THR n 
2  612 TYR n 
2  613 LEU n 
2  614 MET n 
2  615 GLY n 
2  616 TRP n 
2  617 PHE n 
2  618 ARG n 
2  619 ASP n 
2  620 TYR n 
2  621 LEU n 
2  622 TRP n 
2  623 ALA n 
2  624 ASN n 
2  625 SER n 
2  626 ALA n 
2  627 GLN n 
2  628 LEU n 
2  629 ILE n 
2  630 ASN n 
2  631 GLY n 
2  632 TYR n 
2  633 ASN n 
2  634 PRO n 
2  635 TYR n 
2  636 GLY n 
2  637 VAL n 
2  638 ASN n 
2  639 ASN n 
2  640 LEU n 
2  641 SER n 
2  642 VAL n 
2  643 TRP n 
2  644 ALA n 
2  645 TRP n 
2  646 MET n 
2  647 PHE n 
2  648 LEU n 
2  649 PHE n 
2  650 GLY n 
2  651 HIS n 
2  652 LEU n 
2  653 VAL n 
2  654 TRP n 
2  655 ALA n 
2  656 THR n 
2  657 GLY n 
2  658 PHE n 
2  659 MET n 
2  660 PHE n 
2  661 LEU n 
2  662 ILE n 
2  663 SER n 
2  664 TRP n 
2  665 ARG n 
2  666 GLY n 
2  667 TYR n 
2  668 TRP n 
2  669 GLN n 
2  670 GLU n 
2  671 LEU n 
2  672 ILE n 
2  673 GLU n 
2  674 THR n 
2  675 ILE n 
2  676 VAL n 
2  677 TRP n 
2  678 ALA n 
2  679 HIS n 
2  680 GLU n 
2  681 ARG n 
2  682 THR n 
2  683 PRO n 
2  684 LEU n 
2  685 ALA n 
2  686 ASN n 
2  687 LEU n 
2  688 VAL n 
2  689 ARG n 
2  690 TRP n 
2  691 LYS n 
2  692 ASP n 
2  693 LYS n 
2  694 PRO n 
2  695 VAL n 
2  696 ALA n 
2  697 LEU n 
2  698 SER n 
2  699 ILE n 
2  700 VAL n 
2  701 GLN n 
2  702 ALA n 
2  703 ARG n 
2  704 LEU n 
2  705 VAL n 
2  706 GLY n 
2  707 LEU n 
2  708 ALA n 
2  709 HIS n 
2  710 PHE n 
2  711 THR n 
2  712 VAL n 
2  713 GLY n 
2  714 TYR n 
2  715 VAL n 
2  716 LEU n 
2  717 THR n 
2  718 TYR n 
2  719 ALA n 
2  720 ALA n 
2  721 PHE n 
2  722 LEU n 
2  723 ILE n 
2  724 ALA n 
2  725 SER n 
2  726 THR n 
2  727 ALA n 
2  728 GLY n 
2  729 LYS n 
2  730 PHE n 
2  731 GLY n 
3  1   MET n 
3  2   SER n 
3  3   HIS n 
3  4   SER n 
3  5   VAL n 
3  6   LYS n 
3  7   ILE n 
3  8   TYR n 
3  9   ASP n 
3  10  THR n 
3  11  CYS n 
3  12  ILE n 
3  13  GLY n 
3  14  CYS n 
3  15  THR n 
3  16  GLN n 
3  17  CYS n 
3  18  VAL n 
3  19  ARG n 
3  20  ALA n 
3  21  CYS n 
3  22  PRO n 
3  23  LEU n 
3  24  ASP n 
3  25  VAL n 
3  26  LEU n 
3  27  GLU n 
3  28  MET n 
3  29  VAL n 
3  30  PRO n 
3  31  TRP n 
3  32  ASP n 
3  33  GLY n 
3  34  CYS n 
3  35  LYS n 
3  36  ALA n 
3  37  ALA n 
3  38  GLN n 
3  39  ILE n 
3  40  ALA n 
3  41  SER n 
3  42  SER n 
3  43  PRO n 
3  44  ARG n 
3  45  THR n 
3  46  GLU n 
3  47  ASP n 
3  48  CYS n 
3  49  VAL n 
3  50  GLY n 
3  51  CYS n 
3  52  LYS n 
3  53  ARG n 
3  54  CYS n 
3  55  GLU n 
3  56  THR n 
3  57  ALA n 
3  58  CYS n 
3  59  PRO n 
3  60  THR n 
3  61  ASP n 
3  62  PHE n 
3  63  LEU n 
3  64  SER n 
3  65  ILE n 
3  66  ARG n 
3  67  VAL n 
3  68  TYR n 
3  69  LEU n 
3  70  GLY n 
3  71  ALA n 
3  72  GLU n 
3  73  THR n 
3  74  THR n 
3  75  ARG n 
3  76  SER n 
3  77  MET n 
3  78  GLY n 
3  79  LEU n 
3  80  ALA n 
3  81  TYR n 
4  1   MET n 
4  2   THR n 
4  3   GLU n 
4  4   LEU n 
4  5   SER n 
4  6   GLY n 
4  7   GLN n 
4  8   PRO n 
4  9   PRO n 
4  10  LYS n 
4  11  PHE n 
4  12  GLY n 
4  13  GLY n 
4  14  SER n 
4  15  THR n 
4  16  GLY n 
4  17  GLY n 
4  18  LEU n 
4  19  LEU n 
4  20  SER n 
4  21  LYS n 
4  22  ALA n 
4  23  ASN n 
4  24  ARG n 
4  25  GLU n 
4  26  GLU n 
4  27  LYS n 
4  28  TYR n 
4  29  ALA n 
4  30  ILE n 
4  31  THR n 
4  32  TRP n 
4  33  THR n 
4  34  SER n 
4  35  ALA n 
4  36  SER n 
4  37  GLU n 
4  38  GLN n 
4  39  VAL n 
4  40  PHE n 
4  41  GLU n 
4  42  MET n 
4  43  PRO n 
4  44  THR n 
4  45  GLY n 
4  46  GLY n 
4  47  ALA n 
4  48  ALA n 
4  49  ILE n 
4  50  MET n 
4  51  ASN n 
4  52  GLU n 
4  53  GLY n 
4  54  GLU n 
4  55  ASN n 
4  56  LEU n 
4  57  LEU n 
4  58  TYR n 
4  59  LEU n 
4  60  ALA n 
4  61  ARG n 
4  62  LYS n 
4  63  GLU n 
4  64  GLN n 
4  65  CYS n 
4  66  LEU n 
4  67  ALA n 
4  68  LEU n 
4  69  GLY n 
4  70  THR n 
4  71  GLN n 
4  72  LEU n 
4  73  ARG n 
4  74  THR n 
4  75  LYS n 
4  76  PHE n 
4  77  LYS n 
4  78  PRO n 
4  79  LYS n 
4  80  ILE n 
4  81  GLN n 
4  82  ASP n 
4  83  TYR n 
4  84  LYS n 
4  85  ILE n 
4  86  TYR n 
4  87  ARG n 
4  88  VAL n 
4  89  TYR n 
4  90  PRO n 
4  91  SER n 
4  92  GLY n 
4  93  GLU n 
4  94  VAL n 
4  95  GLN n 
4  96  TYR n 
4  97  LEU n 
4  98  HIS n 
4  99  PRO n 
4  100 ALA n 
4  101 ASP n 
4  102 GLY n 
4  103 VAL n 
4  104 PHE n 
4  105 PRO n 
4  106 GLU n 
4  107 LYS n 
4  108 VAL n 
4  109 ASN n 
4  110 GLU n 
4  111 GLY n 
4  112 ARG n 
4  113 GLU n 
4  114 ALA n 
4  115 GLN n 
4  116 GLY n 
4  117 THR n 
4  118 LYS n 
4  119 THR n 
4  120 ARG n 
4  121 ARG n 
4  122 ILE n 
4  123 GLY n 
4  124 GLN n 
4  125 ASN n 
4  126 PRO n 
4  127 GLU n 
4  128 PRO n 
4  129 VAL n 
4  130 THR n 
4  131 ILE n 
4  132 LYS n 
4  133 PHE n 
4  134 SER n 
4  135 GLY n 
4  136 LYS n 
4  137 ALA n 
4  138 PRO n 
4  139 TYR n 
4  140 GLU n 
4  141 VAL n 
5  1   MET n 
5  2   ALA n 
5  3   LEU n 
5  4   ASN n 
5  5   ARG n 
5  6   GLY n 
5  7   ASP n 
5  8   LYS n 
5  9   VAL n 
5  10  ARG n 
5  11  ILE n 
5  12  LYS n 
5  13  ARG n 
5  14  THR n 
5  15  GLU n 
5  16  SER n 
5  17  TYR n 
5  18  TRP n 
5  19  TYR n 
5  20  GLY n 
5  21  ASP n 
5  22  VAL n 
5  23  GLY n 
5  24  THR n 
5  25  VAL n 
5  26  ALA n 
5  27  SER n 
5  28  VAL n 
5  29  GLU n 
5  30  LYS n 
5  31  SER n 
5  32  GLY n 
5  33  ILE n 
5  34  LEU n 
5  35  TYR n 
5  36  PRO n 
5  37  VAL n 
5  38  ILE n 
5  39  VAL n 
5  40  ARG n 
5  41  PHE n 
5  42  ASP n 
5  43  ARG n 
5  44  VAL n 
5  45  ASN n 
5  46  TYR n 
5  47  ASN n 
5  48  GLY n 
5  49  PHE n 
5  50  SER n 
5  51  GLY n 
5  52  SER n 
5  53  ALA n 
5  54  SER n 
5  55  GLY n 
5  56  VAL n 
5  57  ASN n 
5  58  THR n 
5  59  ASN n 
5  60  ASN n 
5  61  PHE n 
5  62  ALA n 
5  63  GLU n 
5  64  ASN n 
5  65  GLU n 
5  66  LEU n 
5  67  GLU n 
5  68  LEU n 
5  69  VAL n 
5  70  GLN n 
5  71  ALA n 
5  72  ALA n 
5  73  ALA n 
5  74  LYS n 
6  1   MET n 
6  2   ASP n 
6  3   GLY n 
6  4   LEU n 
6  5   LYS n 
6  6   SER n 
6  7   PHE n 
6  8   LEU n 
6  9   SER n 
6  10  THR n 
6  11  ALA n 
6  12  PRO n 
6  13  VAL n 
6  14  MET n 
6  15  ILE n 
6  16  MET n 
6  17  ALA n 
6  18  LEU n 
6  19  LEU n 
6  20  THR n 
6  21  PHE n 
6  22  THR n 
6  23  ALA n 
6  24  GLY n 
6  25  ILE n 
6  26  LEU n 
6  27  ILE n 
6  28  GLU n 
6  29  PHE n 
6  30  ASN n 
6  31  ALA n 
6  32  PHE n 
6  33  TYR n 
6  34  PRO n 
6  35  ASP n 
6  36  LEU n 
6  37  LEU n 
6  38  PHE n 
6  39  HIS n 
6  40  PRO n 
6  41  CYS n 
6  42  SER n 
6  43  CYS n 
6  44  ALA n 
6  45  GLY n 
6  46  ASP n 
6  47  PHE n 
6  48  LEU n 
6  49  ILE n 
6  50  PRO n 
6  51  SER n 
6  52  ILE n 
6  53  ILE n 
6  54  PHE n 
6  55  LEU n 
6  56  TYR n 
6  57  ILE n 
6  58  ALA n 
6  59  GLY n 
6  60  TRP n 
6  61  ILE n 
6  62  GLY n 
6  63  TRP n 
6  64  VAL n 
6  65  GLY n 
6  66  ARG n 
6  67  SER n 
6  68  TYR n 
6  69  LEU n 
6  70  ILE n 
6  71  GLU n 
6  72  ILE n 
6  73  ARG n 
6  74  GLU n 
6  75  SER n 
6  76  LYS n 
6  77  ASN n 
6  78  PRO n 
6  79  GLU n 
6  80  MET n 
6  81  GLN n 
6  82  GLU n 
6  83  VAL n 
6  84  VAL n 
6  85  ILE n 
6  86  ASN n 
6  87  VAL n 
6  88  PRO n 
6  89  LEU n 
6  90  ALA n 
6  91  ILE n 
6  92  LYS n 
6  93  LYS n 
6  94  MET n 
6  95  LEU n 
6  96  GLY n 
6  97  GLY n 
6  98  PHE n 
6  99  LEU n 
6  100 TRP n 
6  101 PRO n 
6  102 LEU n 
6  103 ALA n 
6  104 ALA n 
6  105 VAL n 
6  106 GLY n 
6  107 GLU n 
6  108 TYR n 
6  109 THR n 
6  110 SER n 
6  111 GLY n 
6  112 LYS n 
6  113 LEU n 
6  114 VAL n 
6  115 MET n 
6  116 LYS n 
6  117 ASP n 
6  118 SER n 
6  119 GLU n 
6  120 ILE n 
6  121 PRO n 
6  122 THR n 
6  123 SER n 
6  124 PRO n 
6  125 ARG n 
7  1   MET n 
7  2   ALA n 
7  3   GLU n 
7  4   SER n 
7  5   ASN n 
7  6   GLN n 
7  7   VAL n 
7  8   VAL n 
7  9   GLN n 
7  10  ALA n 
7  11  TYR n 
7  12  ASN n 
7  13  GLY n 
7  14  ASP n 
7  15  PRO n 
7  16  PHE n 
7  17  VAL n 
7  18  GLY n 
7  19  HIS n 
7  20  LEU n 
7  21  SER n 
7  22  THR n 
7  23  PRO n 
7  24  ILE n 
7  25  SER n 
7  26  ASP n 
7  27  SER n 
7  28  ALA n 
7  29  PHE n 
7  30  THR n 
7  31  ARG n 
7  32  THR n 
7  33  PHE n 
7  34  ILE n 
7  35  GLY n 
7  36  ASN n 
7  37  LEU n 
7  38  PRO n 
7  39  ALA n 
7  40  TYR n 
7  41  ARG n 
7  42  LYS n 
7  43  GLY n 
7  44  LEU n 
7  45  SER n 
7  46  PRO n 
7  47  ILE n 
7  48  LEU n 
7  49  ARG n 
7  50  GLY n 
7  51  LEU n 
7  52  GLU n 
7  53  VAL n 
7  54  GLY n 
7  55  MET n 
7  56  ALA n 
7  57  HIS n 
7  58  GLY n 
7  59  TYR n 
7  60  PHE n 
7  61  LEU n 
7  62  ILE n 
7  63  GLY n 
7  64  PRO n 
7  65  TRP n 
7  66  THR n 
7  67  LEU n 
7  68  LEU n 
7  69  GLY n 
7  70  PRO n 
7  71  LEU n 
7  72  ARG n 
7  73  ASP n 
7  74  SER n 
7  75  GLU n 
7  76  TYR n 
7  77  GLN n 
7  78  TYR n 
7  79  ILE n 
7  80  GLY n 
7  81  GLY n 
7  82  LEU n 
7  83  ILE n 
7  84  GLY n 
7  85  ALA n 
7  86  LEU n 
7  87  ALA n 
7  88  LEU n 
7  89  ILE n 
7  90  LEU n 
7  91  VAL n 
7  92  ALA n 
7  93  THR n 
7  94  ALA n 
7  95  ALA n 
7  96  LEU n 
7  97  SER n 
7  98  SER n 
7  99  TYR n 
7  100 GLY n 
7  101 LEU n 
7  102 VAL n 
7  103 THR n 
7  104 PHE n 
7  105 GLN n 
7  106 GLY n 
7  107 GLU n 
7  108 GLN n 
7  109 GLY n 
7  110 SER n 
7  111 GLY n 
7  112 ASP n 
7  113 THR n 
7  114 LEU n 
7  115 GLN n 
7  116 THR n 
7  117 ALA n 
7  118 ASP n 
7  119 GLY n 
7  120 TRP n 
7  121 SER n 
7  122 GLN n 
7  123 PHE n 
7  124 ALA n 
7  125 ALA n 
7  126 GLY n 
7  127 PHE n 
7  128 PHE n 
7  129 VAL n 
7  130 GLY n 
7  131 GLY n 
7  132 MET n 
7  133 GLY n 
7  134 GLY n 
7  135 ALA n 
7  136 PHE n 
7  137 VAL n 
7  138 ALA n 
7  139 TYR n 
7  140 PHE n 
7  141 LEU n 
7  142 LEU n 
7  143 GLU n 
7  144 ASN n 
7  145 LEU n 
7  146 SER n 
7  147 VAL n 
7  148 VAL n 
7  149 ASP n 
7  150 GLY n 
7  151 ILE n 
7  152 PHE n 
7  153 ARG n 
7  154 GLY n 
7  155 LEU n 
7  156 PHE n 
7  157 ASN n 
8  1   MET n 
8  2   ALA n 
8  3   LEU n 
8  4   SER n 
8  5   ASP n 
8  6   THR n 
8  7   GLN n 
8  8   ILE n 
8  9   LEU n 
8  10  ALA n 
8  11  ALA n 
8  12  LEU n 
8  13  VAL n 
8  14  VAL n 
8  15  ALA n 
8  16  LEU n 
8  17  LEU n 
8  18  PRO n 
8  19  ALA n 
8  20  PHE n 
8  21  LEU n 
8  22  ALA n 
8  23  PHE n 
8  24  ARG n 
8  25  LEU n 
8  26  SER n 
8  27  THR n 
8  28  GLU n 
8  29  LEU n 
8  30  TYR n 
8  31  LYS n 
9  1   MET n 
9  2   ASP n 
9  3   GLY n 
9  4   SER n 
9  5   TYR n 
9  6   ALA n 
9  7   ALA n 
9  8   SER n 
9  9   TYR n 
9  10  LEU n 
9  11  PRO n 
9  12  TRP n 
9  13  ILE n 
9  14  LEU n 
9  15  ILE n 
9  16  PRO n 
9  17  MET n 
9  18  VAL n 
9  19  GLY n 
9  20  TRP n 
9  21  LEU n 
9  22  PHE n 
9  23  PRO n 
9  24  ALA n 
9  25  VAL n 
9  26  THR n 
9  27  MET n 
9  28  GLY n 
9  29  LEU n 
9  30  LEU n 
9  31  PHE n 
9  32  ILE n 
9  33  HIS n 
9  34  ILE n 
9  35  GLU n 
9  36  SER n 
9  37  GLU n 
9  38  GLY n 
9  39  GLU n 
9  40  GLY n 
10 1   MET n 
10 2   THR n 
10 3   ALA n 
10 4   ILE n 
10 5   ALA n 
10 6   ARG n 
10 7   GLU n 
10 8   ARG n 
10 9   GLY n 
10 10  ARG n 
10 11  SER n 
10 12  LYS n 
10 13  ARG n 
10 14  GLY n 
10 15  ILE n 
10 16  ALA n 
10 17  LEU n 
10 18  HIS n 
10 19  ARG n 
10 20  LEU n 
10 21  GLU n 
10 22  TYR n 
10 23  LEU n 
10 24  LYS n 
10 25  GLU n 
10 26  ASN n 
10 27  GLN n 
10 28  VAL n 
10 29  PHE n 
10 30  GLU n 
10 31  ILE n 
10 32  ILE n 
10 33  PHE n 
10 34  GLY n 
10 35  GLU n 
10 36  PRO n 
10 37  LEU n 
10 38  SER n 
10 39  MET n 
10 40  PHE n 
10 41  ASN n 
10 42  THR n 
10 43  ALA n 
10 44  LEU n 
10 45  LEU n 
10 46  LEU n 
10 47  ALA n 
10 48  GLN n 
10 49  ALA n 
10 50  SER n 
10 51  PRO n 
10 52  THR n 
10 53  THR n 
10 54  ALA n 
10 55  GLY n 
10 56  TRP n 
10 57  SER n 
10 58  LEU n 
10 59  SER n 
10 60  VAL n 
10 61  GLY n 
10 62  ILE n 
10 63  ILE n 
10 64  MET n 
10 65  CYS n 
10 66  LEU n 
10 67  CYS n 
10 68  ASN n 
10 69  VAL n 
10 70  PHE n 
10 71  ALA n 
10 72  PHE n 
10 73  VAL n 
10 74  ILE n 
10 75  GLY n 
10 76  TYR n 
10 77  PHE n 
10 78  ALA n 
10 79  ILE n 
10 80  GLN n 
10 81  LYS n 
10 82  THR n 
10 83  GLY n 
10 84  LYS n 
10 85  GLY n 
10 86  LYS n 
10 87  ASP n 
10 88  LEU n 
10 89  ALA n 
10 90  LEU n 
10 91  PRO n 
10 92  GLN n 
10 93  LEU n 
10 94  ALA n 
10 95  SER n 
10 96  LYS n 
10 97  LYS n 
10 98  THR n 
10 99  PHE n 
10 100 GLY n 
10 101 LEU n 
10 102 PRO n 
10 103 GLU n 
10 104 LEU n 
10 105 LEU n 
10 106 ALA n 
10 107 THR n 
10 108 MET n 
10 109 SER n 
10 110 PHE n 
10 111 GLY n 
10 112 HIS n 
10 113 ILE n 
10 114 LEU n 
10 115 GLY n 
10 116 ALA n 
10 117 GLY n 
10 118 MET n 
10 119 VAL n 
10 120 LEU n 
10 121 GLY n 
10 122 LEU n 
10 123 ALA n 
10 124 SER n 
10 125 SER n 
10 126 GLY n 
10 127 ILE n 
10 128 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1  1 sample ? ?  ?   ? ? 'psaA, BEST7613_2234, MYO_18690'       ? ? ? ? ? ? 'Synechocystis sp. PCC 6803' 1148    ? ? ? ? ? ? ? ? 
'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ?  ?   ? ? 'psaB, BEST7613_2235, MYO_18700'       ? ? ? ? ? ? 'Synechocystis sp. PCC 6803' 1148    ? ? ? ? ? ? ? ? 
'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ?  ?   ? ? 'psaC, BEST7613_5694, MYO_120930'      ? ? ? ? ? ? 'Synechocystis sp. PCC 6803' 1148    ? ? ? ? ? ? ? ? 
'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ?  ?   ? ? 'psaE, BEST7613_5968, MYO_118260'      ? ? ? ? ? ? 'Synechocystis sp. PCC 6803' 1148    ? ? ? ? ? ? ? ? 
'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ?  ?   ? ? 'psaF, BEST7613_2928'                  ? ? ? ? ? ? 'Synechocystis sp. PCC 6803' 1148    ? ? ? ? ? ? ? ? 
'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? 1  40  ? ? 'psaL, BEST7613_4425, MYO_131030'      ? ? ? ? ? ? 'Synechocystis sp. PCC 6803' 1148    ? ? ? ? ? ? ? ? 
'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  2 sample ? 44 125 ? ? psaF,BEST7613_2928                     ? ? ? ? ? ? 'Bacillus subtilis BEST7613' 1204343 ? ? ? ? ? ? ? ? 
'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ?  ?   ? ? 'psbM, psaM, BEST7613_1787, MYO_14340' ? ? ? ? ? ? 'Synechocystis sp. PCC 6803' 1148    ? ? ? ? ? ? ? ? 
'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ?  ?   ? ? 'psaF, BEST7613_2928'                  ? ? ? ? ? ? 'Synechocystis sp. PCC 6803' 1148    ? ? ? ? ? ? ? ? 
'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ?  ?   ? ? 'psaI, BEST7613_4424, MYO_131040'      ? ? ? ? ? ? 'Synechocystis sp. PCC 6803' 1148    ? ? ? ? ? ? ? ? 
'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ?  ?   ? ? 'psaD, BEST7613_1459, MYO_11100'       ? ? ? ? ? ? 'Synechocystis sp. PCC 6803' 1148    ? ? ? ? ? ? ? ? 
'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ?  ?   ? ? 'psaK, BEST7613_4536, MYO_129960'      ? ? ? ? ? ? 'Synechocystis sp. PCC 6803' 1148    ? ? ? ? ? ? ? ? 
'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  UNP L8AHT3_9SYNC L8AHT3 1  
;MTISPPEREAKAKVSVDNNPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHANAHDFDSQTSDLEDVSRKIFSAHFGHL
AVVFVWLSGMYFHGAKFSNYEGWLADPTHIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFYLWRASGFTDSYQLYC
TAIGGLVMAALMLFAGWFHYHVKAPKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMPINKLLDAGVAPKDIPLPH
EFILEPSKMAELYPSFAQGLTPFFTLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNWGIGHS
MKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQAIDYATQLSLFTHHMWIGGFL
IVGAGAHGAIFMVRDYDPAKNVNNLLDRMLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQP
IFAQWVQHLHTLAPGATAPNALATASYAFGGETIAVAGKVAMMPITLGTADFMVHHIHAFTIHVTALILLKGVLYARSSR
LVPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVSPDGSVTHVTLGNFAQSAI
TINGWLRDFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQELIESIVWAHNKLNVAPAIQPRALSI
IQGRAVGVAHYLLGGIVTTWAFFLARSLSIG
;
1   ? 
2  UNP L8AIC0_9SYNC L8AIC0 2  
;MATKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKD
PLNIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGVYHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPK
FRPSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIPEARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTA
GHIFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAIAVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNL
YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVA
NKDNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPD
SIASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPG
RGGTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWSGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNL
SVWAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAA
FLIASTAGKFG
;
1   ? 
3  UNP L8AST2_9SYNC L8AST2 3  
;MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLA
Y
;
1   ? 
4  UNP L8AFM8_9SYNC L8AFM8 4  
;MTELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKI
QDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV
;
1   ? 
5  UNP L8ASH8_9SYNC L8ASH8 5  MALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELVQAAAK 1   ? 
6  UNP L8AII8_9SYNC L8AII8 6  
;AGDFLIPSILFLYIAGWIGWVGRSYLIEIRESKNPEMQEVVINVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTS
PR
;
103 ? 
7  UNP L8APN7_9SYNC L8APN7 7  
;MAESNQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPWTLLGPLRDSEYQYIG
GLIGALALILVATAALSSYGLVTFQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRGLFN
;
1   ? 
8  UNP L8ADF9_9SYNC L8ADF9 8  MALSDTQILAALVVALLPAFLAFRLSTELYK 1   ? 
9  UNP L8AP84_9SYNC L8AP84 9  MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESEGEG 1   ? 
10 UNP L8APJ0_9SYNC L8APJ0 10 
;MTAIARERGRSKRGIALHRLEYLKENQVFEIIFGEPLSMFNTALLLAQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQ
KTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLASSGIL
;
1   ? 
11 UNP PSAJ_SYNY3   Q55329 6  MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFHP 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  4L6V A 1  ? 751 ? L8AHT3 1   ? 751 ? 1  751 
2  2  4L6V B 1  ? 731 ? L8AIC0 1   ? 731 ? 1  731 
3  3  4L6V C 1  ? 81  ? L8AST2 1   ? 81  ? 1  81  
4  4  4L6V D 1  ? 141 ? L8AFM8 1   ? 141 ? 1  141 
5  5  4L6V E 1  ? 74  ? L8ASH8 1   ? 74  ? 1  74  
6  6  4L6V F 44 ? 125 ? L8AII8 103 ? 184 ? 44 125 
7  7  4L6V L 1  ? 157 ? L8APN7 1   ? 157 ? 1  157 
8  8  4L6V M 1  ? 31  ? L8ADF9 1   ? 31  ? 1  31  
9  1  4L6V a 1  ? 751 ? L8AHT3 1   ? 751 ? 1  751 
10 2  4L6V b 1  ? 731 ? L8AIC0 1   ? 731 ? 1  731 
11 3  4L6V c 1  ? 81  ? L8AST2 1   ? 81  ? 1  81  
12 4  4L6V d 1  ? 141 ? L8AFM8 1   ? 141 ? 1  141 
13 5  4L6V e 1  ? 74  ? L8ASH8 1   ? 74  ? 1  74  
14 6  4L6V f 44 ? 125 ? L8AII8 103 ? 184 ? 44 125 
15 9  4L6V i 1  ? 40  ? L8AP84 1   ? 40  ? 1  40  
16 7  4L6V l 1  ? 157 ? L8APN7 1   ? 157 ? 1  157 
17 8  4L6V m 1  ? 31  ? L8ADF9 1   ? 31  ? 1  31  
18 1  4L6V 1 1  ? 751 ? L8AHT3 1   ? 751 ? 1  751 
19 2  4L6V 2 1  ? 731 ? L8AIC0 1   ? 731 ? 1  731 
20 3  4L6V 3 1  ? 81  ? L8AST2 1   ? 81  ? 1  81  
21 4  4L6V 4 1  ? 141 ? L8AFM8 1   ? 141 ? 1  141 
22 5  4L6V 5 1  ? 74  ? L8ASH8 1   ? 74  ? 1  74  
23 6  4L6V 6 44 ? 125 ? L8AII8 103 ? 184 ? 44 125 
24 9  4L6V 9 1  ? 40  ? L8AP84 1   ? 40  ? 1  40  
25 7  4L6V 8 1  ? 157 ? L8APN7 1   ? 157 ? 1  157 
26 8  4L6V 7 1  ? 31  ? L8ADF9 1   ? 31  ? 1  31  
27 10 4L6V K 1  ? 128 ? L8APJ0 1   ? 128 ? 1  128 
28 9  4L6V I 1  ? 40  ? L8AP84 1   ? 40  ? 1  40  
29 10 4L6V k 1  ? 128 ? L8APJ0 1   ? 128 ? 1  128 
30 10 4L6V 0 1  ? 128 ? L8APJ0 1   ? 128 ? 1  128 
31 11 4L6V F 1  ? 40  ? Q55329 1   ? 40  ? 1  40  
32 11 4L6V f 1  ? 40  ? Q55329 1   ? 40  ? 1  40  
33 11 4L6V 6 1  ? 40  ? Q55329 1   ? 40  ? 1  40  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
6  4L6V CYS F 41 ? UNP L8AII8 ?   ?   LINKER                41 1  
6  4L6V SER F 42 ? UNP L8AII8 ?   ?   LINKER                42 2  
6  4L6V CYS F 43 ? UNP L8AII8 ?   ?   LINKER                43 3  
6  4L6V ILE F 53 ? UNP L8AII8 LEU 112 'engineered mutation' 53 4  
14 4L6V CYS f 41 ? UNP L8AII8 ?   ?   LINKER                41 5  
14 4L6V SER f 42 ? UNP L8AII8 ?   ?   LINKER                42 6  
14 4L6V CYS f 43 ? UNP L8AII8 ?   ?   LINKER                43 7  
14 4L6V ILE f 53 ? UNP L8AII8 LEU 112 'engineered mutation' 53 8  
23 4L6V CYS 6 41 ? UNP L8AII8 ?   ?   LINKER                41 9  
23 4L6V SER 6 42 ? UNP L8AII8 ?   ?   LINKER                42 10 
23 4L6V CYS 6 43 ? UNP L8AII8 ?   ?   LINKER                43 11 
23 4L6V ILE 6 53 ? UNP L8AII8 LEU 112 'engineered mutation' 53 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                   ?                                                  
'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE                                  ?                                                  
'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ?                                                  
'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ?                                                  
'C4 H7 N O4'         133.103 
BCR non-polymer         . BETA-CAROTENE                             ?                                                  'C40 H56' 
536.873 
CLA non-polymer         . 'CHLOROPHYLL A'                           ?                                                  
'C55 H72 Mg N4 O5 2' 893.489 
CYS 'L-peptide linking' y CYSTEINE                                  ?                                                  
'C3 H7 N O2 S'       121.158 
GLN 'L-peptide linking' y GLUTAMINE                                 ?                                                  
'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ?                                                  
'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE                                   ?                                                  
'C2 H5 N O2'         75.067  
HIS 'L-peptide linking' y HISTIDINE                                 ?                                                  
'C6 H10 N3 O2 1'     156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                ?                                                  
'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE                                   ?                                                  
'C6 H13 N O2'        131.173 
LHG non-polymer         . 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE    ?                                                  
'C38 H75 O10 P'      722.970 
LMG non-polymer         . 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE ?                                                  
'C45 H86 O10'        787.158 
LYS 'L-peptide linking' y LYSINE                                    ?                                                  
'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE                                ?                                                  
'C5 H11 N O2 S'      149.211 
PHE 'L-peptide linking' y PHENYLALANINE                             ?                                                  
'C9 H11 N O2'        165.189 
PQN non-polymer         . PHYLLOQUINONE                             'VITAMIN K1; 2-METHYL-3-PHYTYL-1,4-NAPHTHOQUINONE' 
'C31 H46 O2'         450.696 
PRO 'L-peptide linking' y PROLINE                                   ?                                                  
'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE                                    ?                                                  
'C3 H7 N O3'         105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER'                     ?                                                  'Fe4 S4' 
351.640 
THR 'L-peptide linking' y THREONINE                                 ?                                                  
'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ?                                                  
'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE                                  ?                                                  
'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE                                    ?                                                  
'C5 H11 N O2'        117.146 
# 
_exptl.entry_id          4L6V 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.94 
_exptl_crystal.density_percent_sol   68.76 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;30mM Tricine-NaOH, 90mM NaCl, 90mM MgCl2, 100mM Glycine, 0.005% nonyl beta maltoside., pH 8, VAPOR DIFFUSION, SITTING DROP, temperature 277K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'PSI PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2011-11-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97625 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97625 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4L6V 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            3.8 
_reflns.number_obs                   113221 
_reflns.number_all                   114480 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            0.116 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        202 
_reflns.pdbx_redundancy              3.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.8 
_reflns_shell.d_res_low              4 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           1.238 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.2 
_reflns_shell.pdbx_redundancy        3.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4L6V 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     109176 
_refine.ls_number_reflns_all                     109175 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.996 
_refine.ls_d_res_high                            3.800 
_refine.ls_percent_reflns_obs                    95.44 
_refine.ls_R_factor_obs                          0.2550 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2528 
_refine.ls_R_factor_R_free                       0.2972 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_number_reflns_R_free                  5477 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               127.77 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4KT0' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.67 
_refine.pdbx_overall_phase_error                 35.96 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        49764 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         18606 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               68370 
_refine_hist.d_res_high                       3.800 
_refine_hist.d_res_low                        29.996 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.004  ? ? 72200  'X-RAY DIFFRACTION' ? 
f_angle_d          1.771  ? ? 102458 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 28.623 ? ? 27473  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.199  ? ? 9065   'X-RAY DIFFRACTION' ? 
f_plane_restr      0.012  ? ? 12278  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.8000  3.8431  3341 0.4158 93.00 0.4549 . . 185 . . . . 
'X-RAY DIFFRACTION' . 3.8431  3.8882  3430 0.4048 94.00 0.4173 . . 160 . . . . 
'X-RAY DIFFRACTION' . 3.8882  3.9355  3369 0.3903 94.00 0.4424 . . 163 . . . . 
'X-RAY DIFFRACTION' . 3.9355  3.9852  3408 0.3851 95.00 0.4212 . . 182 . . . . 
'X-RAY DIFFRACTION' . 3.9852  4.0376  3408 0.3707 95.00 0.3689 . . 173 . . . . 
'X-RAY DIFFRACTION' . 4.0376  4.0927  3430 0.3632 95.00 0.4159 . . 181 . . . . 
'X-RAY DIFFRACTION' . 4.0927  4.1511  3473 0.3452 95.00 0.3823 . . 190 . . . . 
'X-RAY DIFFRACTION' . 4.1511  4.2129  3429 0.3330 95.00 0.3956 . . 185 . . . . 
'X-RAY DIFFRACTION' . 4.2129  4.2785  3406 0.3312 95.00 0.3872 . . 185 . . . . 
'X-RAY DIFFRACTION' . 4.2785  4.3485  3374 0.3280 94.00 0.3770 . . 193 . . . . 
'X-RAY DIFFRACTION' . 4.3485  4.4232  3355 0.3151 93.00 0.3367 . . 175 . . . . 
'X-RAY DIFFRACTION' . 4.4232  4.5034  3275 0.2959 90.00 0.3368 . . 165 . . . . 
'X-RAY DIFFRACTION' . 4.5034  4.5897  3280 0.2836 91.00 0.2753 . . 203 . . . . 
'X-RAY DIFFRACTION' . 4.5897  4.6830  3447 0.2741 96.00 0.3556 . . 167 . . . . 
'X-RAY DIFFRACTION' . 4.6830  4.7845  3482 0.2565 96.00 0.3034 . . 188 . . . . 
'X-RAY DIFFRACTION' . 4.7845  4.8953  3457 0.2497 97.00 0.2969 . . 203 . . . . 
'X-RAY DIFFRACTION' . 4.8953  5.0172  3491 0.2431 97.00 0.3257 . . 174 . . . . 
'X-RAY DIFFRACTION' . 5.0172  5.1522  3478 0.2448 96.00 0.2867 . . 181 . . . . 
'X-RAY DIFFRACTION' . 5.1522  5.3030  3509 0.2490 97.00 0.3212 . . 200 . . . . 
'X-RAY DIFFRACTION' . 5.3030  5.4732  3523 0.2579 97.00 0.2986 . . 191 . . . . 
'X-RAY DIFFRACTION' . 5.4732  5.6675  3499 0.2620 97.00 0.3359 . . 200 . . . . 
'X-RAY DIFFRACTION' . 5.6675  5.8928  3531 0.2503 97.00 0.3116 . . 179 . . . . 
'X-RAY DIFFRACTION' . 5.8928  6.1588  3560 0.2574 97.00 0.3121 . . 172 . . . . 
'X-RAY DIFFRACTION' . 6.1588  6.4804  3495 0.2513 96.00 0.3518 . . 178 . . . . 
'X-RAY DIFFRACTION' . 6.4804  6.8818  3335 0.2436 93.00 0.3275 . . 166 . . . . 
'X-RAY DIFFRACTION' . 6.8818  7.4058  3576 0.2137 97.00 0.2764 . . 185 . . . . 
'X-RAY DIFFRACTION' . 7.4058  8.1375  3557 0.1936 98.00 0.2336 . . 177 . . . . 
'X-RAY DIFFRACTION' . 8.1375  9.2844  3561 0.1648 98.00 0.1988 . . 208 . . . . 
'X-RAY DIFFRACTION' . 9.2844  11.5842 3588 0.1578 97.00 0.1798 . . 185 . . . . 
'X-RAY DIFFRACTION' . 11.5842 29.9972 3632 0.2385 96.00 0.2719 . . 183 . . . . 
# 
_struct.entry_id                  4L6V 
_struct.title                     'Crystal structure of a virus like photosystem I from the cyanobacterium Synechocystis PCC 6803' 
_struct.pdbx_descriptor           
;Photosystem I P700 chlorophyll a apoprotein A1 (E.C.1.97.1.12), Photosystem I P700 chlorophyll a apoprotein A2 (E.C.1.97.1.12), Photosystem I iron-sulfur center (E.C.1.97.1.12), Photosystem I subunit II (E.C.1.97.1.12), Photosystem I reaction center subunit IV (E.C.1.97.1.12), Photosystem I subunit III (E.C.1.97.1.12), Photosystem I reaction center subunit XI (E.C.1.97.1.12), Photosystem I reaction center subunit XII (E.C.1.97.1.12), Photosystem I reaction center subunit VIII (E.C.1.97.1.12)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4L6V 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSPORT' 
_struct_keywords.text            
'photosynthetic reaction center, membrane complex, plastocyanin, cytochrome C6, Ferredoxin, ELECTRON TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 1  ? 
J  N N 2  ? 
K  N N 3  ? 
L  N N 4  ? 
M  N N 5  ? 
N  N N 6  ? 
O  N N 9  ? 
P  N N 7  ? 
Q  N N 8  ? 
R  N N 1  ? 
S  N N 2  ? 
T  N N 3  ? 
U  N N 4  ? 
V  N N 5  ? 
W  N N 6  ? 
X  N N 9  ? 
Y  N N 7  ? 
Z  N N 8  ? 
AA N N 10 ? 
BA N N 9  ? 
CA N N 10 ? 
DA N N 10 ? 
EA N N 11 ? 
FA N N 12 ? 
GA N N 13 ? 
HA N N 14 ? 
IA N N 14 ? 
JA N N 14 ? 
KA N N 14 ? 
LA N N 14 ? 
MA N N 15 ? 
NA N N 15 ? 
OA N N 11 ? 
PA N N 11 ? 
QA N N 11 ? 
RA N N 11 ? 
SA N N 11 ? 
TA N N 11 ? 
UA N N 11 ? 
VA N N 11 ? 
WA N N 11 ? 
XA N N 11 ? 
YA N N 11 ? 
ZA N N 11 ? 
AB N N 11 ? 
BB N N 11 ? 
CB N N 11 ? 
DB N N 11 ? 
EB N N 11 ? 
FB N N 11 ? 
GB N N 11 ? 
HB N N 11 ? 
IB N N 11 ? 
JB N N 11 ? 
KB N N 11 ? 
LB N N 11 ? 
MB N N 11 ? 
NB N N 11 ? 
OB N N 11 ? 
PB N N 11 ? 
QB N N 11 ? 
RB N N 11 ? 
SB N N 11 ? 
TB N N 11 ? 
UB N N 11 ? 
VB N N 11 ? 
WB N N 11 ? 
XB N N 11 ? 
YB N N 11 ? 
ZB N N 11 ? 
AC N N 11 ? 
BC N N 11 ? 
CC N N 11 ? 
DC N N 11 ? 
EC N N 11 ? 
FC N N 11 ? 
GC N N 12 ? 
HC N N 14 ? 
IC N N 14 ? 
JC N N 14 ? 
KC N N 14 ? 
LC N N 14 ? 
MC N N 14 ? 
NC N N 14 ? 
OC N N 14 ? 
PC N N 16 ? 
QC N N 15 ? 
RC N N 11 ? 
SC N N 11 ? 
TC N N 11 ? 
UC N N 11 ? 
VC N N 11 ? 
WC N N 11 ? 
XC N N 11 ? 
YC N N 11 ? 
ZC N N 11 ? 
AD N N 11 ? 
BD N N 11 ? 
CD N N 11 ? 
DD N N 11 ? 
ED N N 11 ? 
FD N N 11 ? 
GD N N 11 ? 
HD N N 11 ? 
ID N N 11 ? 
JD N N 11 ? 
KD N N 11 ? 
LD N N 11 ? 
MD N N 11 ? 
ND N N 11 ? 
OD N N 11 ? 
PD N N 11 ? 
QD N N 11 ? 
RD N N 11 ? 
SD N N 11 ? 
TD N N 11 ? 
UD N N 11 ? 
VD N N 11 ? 
WD N N 11 ? 
XD N N 11 ? 
YD N N 11 ? 
ZD N N 11 ? 
AE N N 11 ? 
BE N N 11 ? 
CE N N 11 ? 
DE N N 11 ? 
EE N N 11 ? 
FE N N 11 ? 
GE N N 13 ? 
HE N N 13 ? 
IE N N 14 ? 
JE N N 14 ? 
KE N N 14 ? 
LE N N 11 ? 
ME N N 11 ? 
NE N N 11 ? 
OE N N 14 ? 
PE N N 14 ? 
QE N N 14 ? 
RE N N 11 ? 
SE N N 12 ? 
TE N N 13 ? 
UE N N 14 ? 
VE N N 14 ? 
WE N N 14 ? 
XE N N 14 ? 
YE N N 14 ? 
ZE N N 15 ? 
AF N N 15 ? 
BF N N 11 ? 
CF N N 11 ? 
DF N N 11 ? 
EF N N 11 ? 
FF N N 11 ? 
GF N N 11 ? 
HF N N 11 ? 
IF N N 11 ? 
JF N N 11 ? 
KF N N 11 ? 
LF N N 11 ? 
MF N N 11 ? 
NF N N 11 ? 
OF N N 11 ? 
PF N N 11 ? 
QF N N 11 ? 
RF N N 11 ? 
SF N N 11 ? 
TF N N 11 ? 
UF N N 11 ? 
VF N N 11 ? 
WF N N 11 ? 
XF N N 11 ? 
YF N N 11 ? 
ZF N N 11 ? 
AG N N 11 ? 
BG N N 11 ? 
CG N N 11 ? 
DG N N 11 ? 
EG N N 11 ? 
FG N N 11 ? 
GG N N 11 ? 
HG N N 11 ? 
IG N N 11 ? 
JG N N 11 ? 
KG N N 11 ? 
LG N N 11 ? 
MG N N 11 ? 
NG N N 11 ? 
OG N N 11 ? 
PG N N 11 ? 
QG N N 11 ? 
RG N N 11 ? 
SG N N 11 ? 
TG N N 12 ? 
UG N N 14 ? 
VG N N 14 ? 
WG N N 14 ? 
XG N N 14 ? 
YG N N 14 ? 
ZG N N 14 ? 
AH N N 14 ? 
BH N N 14 ? 
CH N N 16 ? 
DH N N 15 ? 
EH N N 11 ? 
FH N N 11 ? 
GH N N 11 ? 
HH N N 11 ? 
IH N N 11 ? 
JH N N 11 ? 
KH N N 11 ? 
LH N N 11 ? 
MH N N 11 ? 
NH N N 11 ? 
OH N N 11 ? 
PH N N 11 ? 
QH N N 11 ? 
RH N N 11 ? 
SH N N 11 ? 
TH N N 11 ? 
UH N N 11 ? 
VH N N 11 ? 
WH N N 11 ? 
XH N N 11 ? 
YH N N 11 ? 
ZH N N 11 ? 
AI N N 11 ? 
BI N N 11 ? 
CI N N 11 ? 
DI N N 11 ? 
EI N N 11 ? 
FI N N 11 ? 
GI N N 11 ? 
HI N N 11 ? 
II N N 11 ? 
JI N N 11 ? 
KI N N 11 ? 
LI N N 11 ? 
MI N N 11 ? 
NI N N 11 ? 
OI N N 11 ? 
PI N N 11 ? 
QI N N 11 ? 
RI N N 11 ? 
SI N N 11 ? 
TI N N 13 ? 
UI N N 13 ? 
VI N N 14 ? 
WI N N 14 ? 
XI N N 14 ? 
YI N N 11 ? 
ZI N N 11 ? 
AJ N N 11 ? 
BJ N N 14 ? 
CJ N N 14 ? 
DJ N N 14 ? 
EJ N N 11 ? 
FJ N N 12 ? 
GJ N N 13 ? 
HJ N N 14 ? 
IJ N N 14 ? 
JJ N N 14 ? 
KJ N N 14 ? 
LJ N N 14 ? 
MJ N N 15 ? 
NJ N N 15 ? 
OJ N N 11 ? 
PJ N N 11 ? 
QJ N N 11 ? 
RJ N N 11 ? 
SJ N N 11 ? 
TJ N N 11 ? 
UJ N N 11 ? 
VJ N N 11 ? 
WJ N N 11 ? 
XJ N N 11 ? 
YJ N N 11 ? 
ZJ N N 11 ? 
AK N N 11 ? 
BK N N 11 ? 
CK N N 11 ? 
DK N N 11 ? 
EK N N 11 ? 
FK N N 11 ? 
GK N N 11 ? 
HK N N 11 ? 
IK N N 11 ? 
JK N N 11 ? 
KK N N 11 ? 
LK N N 11 ? 
MK N N 11 ? 
NK N N 11 ? 
OK N N 11 ? 
PK N N 11 ? 
QK N N 11 ? 
RK N N 11 ? 
SK N N 11 ? 
TK N N 11 ? 
UK N N 11 ? 
VK N N 11 ? 
WK N N 11 ? 
XK N N 11 ? 
YK N N 11 ? 
ZK N N 11 ? 
AL N N 11 ? 
BL N N 11 ? 
CL N N 11 ? 
DL N N 11 ? 
EL N N 11 ? 
FL N N 11 ? 
GL N N 12 ? 
HL N N 14 ? 
IL N N 14 ? 
JL N N 14 ? 
KL N N 14 ? 
LL N N 14 ? 
ML N N 14 ? 
NL N N 14 ? 
OL N N 14 ? 
PL N N 16 ? 
QL N N 15 ? 
RL N N 11 ? 
SL N N 11 ? 
TL N N 11 ? 
UL N N 11 ? 
VL N N 11 ? 
WL N N 11 ? 
XL N N 11 ? 
YL N N 11 ? 
ZL N N 11 ? 
AM N N 11 ? 
BM N N 11 ? 
CM N N 11 ? 
DM N N 11 ? 
EM N N 11 ? 
FM N N 11 ? 
GM N N 11 ? 
HM N N 11 ? 
IM N N 11 ? 
JM N N 11 ? 
KM N N 11 ? 
LM N N 11 ? 
MM N N 11 ? 
NM N N 11 ? 
OM N N 11 ? 
PM N N 11 ? 
QM N N 11 ? 
RM N N 11 ? 
SM N N 11 ? 
TM N N 11 ? 
UM N N 11 ? 
VM N N 11 ? 
WM N N 11 ? 
XM N N 11 ? 
YM N N 11 ? 
ZM N N 11 ? 
AN N N 11 ? 
BN N N 11 ? 
CN N N 11 ? 
DN N N 11 ? 
EN N N 11 ? 
FN N N 11 ? 
GN N N 13 ? 
HN N N 13 ? 
IN N N 14 ? 
JN N N 14 ? 
KN N N 14 ? 
LN N N 11 ? 
MN N N 11 ? 
NN N N 11 ? 
ON N N 14 ? 
PN N N 14 ? 
QN N N 14 ? 
RN N N 11 ? 
SN N N 11 ? 
TN N N 11 ? 
UN N N 11 ? 
VN N N 11 ? 
WN N N 11 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLU A  26  ? LYS A  30  ? GLU A 26  LYS A 30  5 ? 5  
HELX_P HELX_P2   2   THR A  45  ? ASN A  54  ? THR A 45  ASN A 54  1 ? 10 
HELX_P HELX_P3   3   ASP A  57  ? THR A  62  ? ASP A 57  THR A 62  1 ? 6  
HELX_P HELX_P4   4   ASP A  64  ? PHE A  97  ? ASP A 64  PHE A 97  1 ? 34 
HELX_P HELX_P5   5   ASN A  99  ? ASP A  106 ? ASN A 99  ASP A 106 1 ? 8  
HELX_P HELX_P6   6   GLY A  122 ? ASN A  127 ? GLY A 122 ASN A 127 5 ? 6  
HELX_P HELX_P7   7   GLY A  142 ? GLY A  151 ? GLY A 142 GLY A 151 1 ? 10 
HELX_P HELX_P8   8   ASP A  154 ? VAL A  182 ? ASP A 154 VAL A 182 1 ? 29 
HELX_P HELX_P9   9   LYS A  186 ? GLN A  191 ? LYS A 186 GLN A 191 1 ? 6  
HELX_P HELX_P10  10  ASN A  192 ? GLY A  203 ? ASN A 192 GLY A 203 1 ? 12 
HELX_P HELX_P11  11  LEU A  204 ? VAL A  219 ? LEU A 204 VAL A 219 1 ? 16 
HELX_P HELX_P12  12  VAL A  219 ? GLY A  230 ? VAL A 219 GLY A 230 1 ? 12 
HELX_P HELX_P13  13  HIS A  240 ? GLU A  245 ? HIS A 240 GLU A 245 1 ? 6  
HELX_P HELX_P14  14  GLU A  245 ? LEU A  252 ? GLU A 245 LEU A 252 1 ? 8  
HELX_P HELX_P15  15  TRP A  268 ? PHE A  274 ? TRP A 268 PHE A 274 5 ? 7  
HELX_P HELX_P16  16  TRP A  289 ? GLY A  308 ? TRP A 289 GLY A 308 1 ? 20 
HELX_P HELX_P17  17  SER A  320 ? ALA A  327 ? SER A 320 ALA A 327 1 ? 8  
HELX_P HELX_P18  18  GLY A  330 ? GLY A  334 ? GLY A 330 GLY A 334 5 ? 5  
HELX_P HELX_P19  19  GLY A  339 ? LEU A  344 ? GLY A 339 LEU A 344 1 ? 6  
HELX_P HELX_P20  20  SER A  347 ? TYR A  371 ? SER A 347 TYR A 371 1 ? 25 
HELX_P HELX_P21  21  ASP A  382 ? ASP A  415 ? ASP A 382 ASP A 415 1 ? 34 
HELX_P HELX_P22  22  ASP A  417 ? ASN A  421 ? ASP A 417 ASN A 421 5 ? 5  
HELX_P HELX_P23  23  ASN A  424 ? ARG A  431 ? ASN A 424 ARG A 431 1 ? 8  
HELX_P HELX_P24  24  HIS A  432 ? LEU A  464 ? HIS A 432 LEU A 464 1 ? 33 
HELX_P HELX_P25  25  PRO A  480 ? LEU A  492 ? PRO A 480 LEU A 492 1 ? 13 
HELX_P HELX_P26  26  GLY A  528 ? TYR A  555 ? GLY A 528 TYR A 555 1 ? 28 
HELX_P HELX_P27  27  ASP A  564 ? GLY A  569 ? ASP A 564 GLY A 569 1 ? 6  
HELX_P HELX_P28  28  GLY A  587 ? VAL A  617 ? GLY A 587 VAL A 617 1 ? 31 
HELX_P HELX_P29  29  ASN A  634 ? ALA A  639 ? ASN A 634 ALA A 639 1 ? 6  
HELX_P HELX_P30  30  THR A  641 ? PHE A  649 ? THR A 641 PHE A 649 1 ? 9  
HELX_P HELX_P31  31  PHE A  649 ? ALA A  654 ? PHE A 649 ALA A 654 1 ? 6  
HELX_P HELX_P32  32  ALA A  654 ? ASN A  659 ? ALA A 654 ASN A 659 1 ? 6  
HELX_P HELX_P33  33  LEU A  665 ? SER A  688 ? LEU A 665 SER A 688 1 ? 24 
HELX_P HELX_P34  34  GLY A  689 ? ASN A  708 ? GLY A 689 ASN A 708 1 ? 20 
HELX_P HELX_P35  35  SER A  719 ? GLY A  751 ? SER A 719 GLY A 751 1 ? 33 
HELX_P HELX_P36  36  SER B  9   ? GLN B  14  ? SER B 9   GLN B 14  1 ? 6  
HELX_P HELX_P37  37  THR B  18  ? THR B  27  ? THR B 18  THR B 27  1 ? 10 
HELX_P HELX_P38  38  ASP B  30  ? HIS B  34  ? ASP B 30  HIS B 34  5 ? 5  
HELX_P HELX_P39  39  GLU B  39  ? GLY B  72  ? GLU B 39  GLY B 72  1 ? 34 
HELX_P HELX_P40  40  ASN B  73  ? ILE B  78  ? ASN B 73  ILE B 78  1 ? 6  
HELX_P HELX_P41  41  GLY B  97  ? THR B  105 ? GLY B 97  THR B 105 1 ? 9  
HELX_P HELX_P42  42  GLY B  119 ? GLY B  128 ? GLY B 119 GLY B 128 1 ? 10 
HELX_P HELX_P43  43  THR B  131 ? HIS B  156 ? THR B 131 HIS B 156 1 ? 26 
HELX_P HELX_P44  44  SER B  164 ? ASN B  170 ? SER B 164 ASN B 170 1 ? 7  
HELX_P HELX_P45  45  ASN B  170 ? GLY B  181 ? ASN B 170 GLY B 181 1 ? 12 
HELX_P HELX_P46  46  PHE B  183 ? VAL B  197 ? PHE B 183 VAL B 197 1 ? 15 
HELX_P HELX_P47  47  VAL B  197 ? ALA B  202 ? VAL B 197 ALA B 202 1 ? 6  
HELX_P HELX_P48  48  LEU B  222 ? GLY B  228 ? LEU B 222 GLY B 228 1 ? 7  
HELX_P HELX_P49  49  TRP B  230 ? ALA B  235 ? TRP B 230 ALA B 235 5 ? 6  
HELX_P HELX_P50  50  TRP B  269 ? GLY B  288 ? TRP B 269 GLY B 288 1 ? 20 
HELX_P HELX_P51  51  SER B  300 ? HIS B  308 ? SER B 300 HIS B 308 1 ? 9  
HELX_P HELX_P52  52  ASN B  319 ? SER B  327 ? ASN B 319 SER B 327 1 ? 9  
HELX_P HELX_P53  53  SER B  327 ? TYR B  351 ? SER B 327 TYR B 351 1 ? 25 
HELX_P HELX_P54  54  ASP B  362 ? ASP B  395 ? ASP B 362 ASP B 395 1 ? 34 
HELX_P HELX_P55  55  ASN B  404 ? HIS B  412 ? ASN B 404 HIS B 412 1 ? 9  
HELX_P HELX_P56  56  HIS B  412 ? PHE B  444 ? HIS B 412 PHE B 444 1 ? 33 
HELX_P HELX_P57  57  THR B  446 ? GLN B  450 ? THR B 446 GLN B 450 5 ? 5  
HELX_P HELX_P58  58  PRO B  455 ? SER B  465 ? PRO B 455 SER B 465 1 ? 11 
HELX_P HELX_P59  59  VAL B  474 ? ASN B  478 ? VAL B 474 ASN B 478 5 ? 5  
HELX_P HELX_P60  60  TRP B  490 ? ASN B  499 ? TRP B 490 ASN B 499 1 ? 10 
HELX_P HELX_P61  61  GLY B  510 ? ASP B  537 ? GLY B 510 ASP B 537 1 ? 28 
HELX_P HELX_P62  62  ASP B  546 ? GLY B  551 ? ASP B 546 GLY B 551 1 ? 6  
HELX_P HELX_P63  63  SER B  568 ? TRP B  599 ? SER B 568 TRP B 599 1 ? 32 
HELX_P HELX_P64  64  VAL B  603 ? SER B  610 ? VAL B 603 SER B 610 1 ? 8  
HELX_P HELX_P65  65  TYR B  612 ? TYR B  620 ? TYR B 612 TYR B 620 1 ? 9  
HELX_P HELX_P66  66  LEU B  640 ? SER B  663 ? LEU B 640 SER B 663 1 ? 24 
HELX_P HELX_P67  67  TRP B  664 ? THR B  682 ? TRP B 664 THR B 682 1 ? 19 
HELX_P HELX_P68  68  SER B  698 ? PHE B  730 ? SER B 698 PHE B 730 1 ? 33 
HELX_P HELX_P69  69  ARG C  44  ? CYS C  48  ? ARG C 44  CYS C 48  5 ? 5  
HELX_P HELX_P70  70  LYS C  52  ? CYS C  58  ? LYS C 52  CYS C 58  1 ? 7  
HELX_P HELX_P71  279 LEU D  19  ? GLU D  25  ? LEU D 19  GLU D 25  1 ? 7  
HELX_P HELX_P72  280 ARG D  61  ? ARG D  73  ? ARG D 61  ARG D 73  1 ? 13 
HELX_P HELX_P73  281 ARG D  121 ? ASN D  125 ? ARG D 121 ASN D 125 5 ? 5  
HELX_P HELX_P74  71  ALA E  62  ? ASN E  64  ? ALA E 62  ASN E 64  5 ? 3  
HELX_P HELX_P75  72  ASP F  2   ? SER F  9   ? ASP F 2   SER F 9   1 ? 8  
HELX_P HELX_P76  73  PRO F  12  ? THR F  20  ? PRO F 12  THR F 20  1 ? 9  
HELX_P HELX_P77  74  PHE F  21  ? PHE F  29  ? PHE F 21  PHE F 29  1 ? 9  
HELX_P HELX_P78  75  ILE F  52  ? LYS F  76  ? ILE F 52  LYS F 76  1 ? 25 
HELX_P HELX_P79  76  ASN F  77  ? VAL F  84  ? ASN F 77  VAL F 84  1 ? 8  
HELX_P HELX_P80  77  ASN F  86  ? GLY F  96  ? ASN F 86  GLY F 96  1 ? 11 
HELX_P HELX_P81  78  LEU F  99  ? SER F  110 ? LEU F 99  SER F 110 1 ? 12 
HELX_P HELX_P82  79  SER G  27  ? LEU G  37  ? SER L 27  LEU L 37  1 ? 11 
HELX_P HELX_P83  80  SER G  45  ? ILE G  62  ? SER L 45  ILE L 62  1 ? 18 
HELX_P HELX_P84  81  ILE G  62  ? GLY G  69  ? ILE L 62  GLY L 69  1 ? 8  
HELX_P HELX_P85  82  PRO G  70  ? SER G  74  ? PRO L 70  SER L 74  5 ? 5  
HELX_P HELX_P86  83  TYR G  76  ? PHE G  104 ? TYR L 76  PHE L 104 1 ? 29 
HELX_P HELX_P87  84  ASP G  112 ? GLN G  115 ? ASP L 112 GLN L 115 5 ? 4  
HELX_P HELX_P88  85  THR G  116 ? ASN G  144 ? THR L 116 ASN L 144 1 ? 29 
HELX_P HELX_P89  86  ASN G  144 ? ARG G  153 ? ASN L 144 ARG L 153 1 ? 10 
HELX_P HELX_P90  87  SER H  4   ? LYS H  31  ? SER M 4   LYS M 31  1 ? 28 
HELX_P HELX_P91  88  PHE I  25  ? LYS I  30  ? PHE a 25  LYS a 30  5 ? 6  
HELX_P HELX_P92  89  THR I  45  ? ASN I  54  ? THR a 45  ASN a 54  1 ? 10 
HELX_P HELX_P93  90  ASP I  57  ? THR I  62  ? ASP a 57  THR a 62  1 ? 6  
HELX_P HELX_P94  91  ASP I  64  ? PHE I  97  ? ASP a 64  PHE a 97  1 ? 34 
HELX_P HELX_P95  92  ASN I  99  ? ASP I  106 ? ASN a 99  ASP a 106 1 ? 8  
HELX_P HELX_P96  93  GLY I  122 ? ASN I  127 ? GLY a 122 ASN a 127 5 ? 6  
HELX_P HELX_P97  94  GLY I  142 ? GLY I  151 ? GLY a 142 GLY a 151 1 ? 10 
HELX_P HELX_P98  95  ASP I  154 ? VAL I  182 ? ASP a 154 VAL a 182 1 ? 29 
HELX_P HELX_P99  96  LYS I  186 ? GLN I  191 ? LYS a 186 GLN a 191 1 ? 6  
HELX_P HELX_P100 97  ASN I  192 ? GLY I  203 ? ASN a 192 GLY a 203 1 ? 12 
HELX_P HELX_P101 98  LEU I  204 ? VAL I  219 ? LEU a 204 VAL a 219 1 ? 16 
HELX_P HELX_P102 99  VAL I  219 ? GLY I  230 ? VAL a 219 GLY a 230 1 ? 12 
HELX_P HELX_P103 100 HIS I  240 ? GLU I  245 ? HIS a 240 GLU a 245 1 ? 6  
HELX_P HELX_P104 101 GLU I  245 ? LEU I  252 ? GLU a 245 LEU a 252 1 ? 8  
HELX_P HELX_P105 102 TRP I  268 ? PHE I  274 ? TRP a 268 PHE a 274 5 ? 7  
HELX_P HELX_P106 103 TRP I  289 ? GLY I  308 ? TRP a 289 GLY a 308 1 ? 20 
HELX_P HELX_P107 104 SER I  320 ? ALA I  327 ? SER a 320 ALA a 327 1 ? 8  
HELX_P HELX_P108 105 GLY I  330 ? GLY I  334 ? GLY a 330 GLY a 334 5 ? 5  
HELX_P HELX_P109 106 GLY I  339 ? LEU I  344 ? GLY a 339 LEU a 344 1 ? 6  
HELX_P HELX_P110 107 SER I  347 ? TYR I  371 ? SER a 347 TYR a 371 1 ? 25 
HELX_P HELX_P111 108 ASP I  382 ? ASP I  415 ? ASP a 382 ASP a 415 1 ? 34 
HELX_P HELX_P112 109 ASP I  417 ? ASN I  421 ? ASP a 417 ASN a 421 5 ? 5  
HELX_P HELX_P113 110 ASN I  424 ? ARG I  431 ? ASN a 424 ARG a 431 1 ? 8  
HELX_P HELX_P114 111 HIS I  432 ? LEU I  464 ? HIS a 432 LEU a 464 1 ? 33 
HELX_P HELX_P115 112 PRO I  480 ? LEU I  492 ? PRO a 480 LEU a 492 1 ? 13 
HELX_P HELX_P116 113 GLY I  528 ? TYR I  555 ? GLY a 528 TYR a 555 1 ? 28 
HELX_P HELX_P117 114 ASP I  564 ? GLY I  569 ? ASP a 564 GLY a 569 1 ? 6  
HELX_P HELX_P118 115 PRO I  577 ? GLY I  581 ? PRO a 577 GLY a 581 5 ? 5  
HELX_P HELX_P119 116 GLY I  587 ? VAL I  617 ? GLY a 587 VAL a 617 1 ? 31 
HELX_P HELX_P120 117 ASN I  634 ? ALA I  639 ? ASN a 634 ALA a 639 1 ? 6  
HELX_P HELX_P121 118 THR I  641 ? PHE I  649 ? THR a 641 PHE a 649 1 ? 9  
HELX_P HELX_P122 119 PHE I  649 ? ALA I  654 ? PHE a 649 ALA a 654 1 ? 6  
HELX_P HELX_P123 120 ALA I  654 ? ASN I  659 ? ALA a 654 ASN a 659 1 ? 6  
HELX_P HELX_P124 121 LEU I  665 ? SER I  688 ? LEU a 665 SER a 688 1 ? 24 
HELX_P HELX_P125 122 GLY I  689 ? LEU I  707 ? GLY a 689 LEU a 707 1 ? 19 
HELX_P HELX_P126 123 SER I  719 ? GLY I  751 ? SER a 719 GLY a 751 1 ? 33 
HELX_P HELX_P127 124 SER J  9   ? GLN J  14  ? SER b 9   GLN b 14  1 ? 6  
HELX_P HELX_P128 125 THR J  18  ? THR J  27  ? THR b 18  THR b 27  1 ? 10 
HELX_P HELX_P129 126 ASP J  30  ? HIS J  34  ? ASP b 30  HIS b 34  5 ? 5  
HELX_P HELX_P130 127 GLU J  39  ? GLY J  72  ? GLU b 39  GLY b 72  1 ? 34 
HELX_P HELX_P131 128 ASN J  73  ? ILE J  78  ? ASN b 73  ILE b 78  1 ? 6  
HELX_P HELX_P132 129 GLY J  97  ? THR J  105 ? GLY b 97  THR b 105 1 ? 9  
HELX_P HELX_P133 130 GLY J  119 ? GLY J  128 ? GLY b 119 GLY b 128 1 ? 10 
HELX_P HELX_P134 131 THR J  131 ? HIS J  156 ? THR b 131 HIS b 156 1 ? 26 
HELX_P HELX_P135 132 SER J  164 ? ASN J  170 ? SER b 164 ASN b 170 1 ? 7  
HELX_P HELX_P136 133 ASN J  170 ? GLY J  181 ? ASN b 170 GLY b 181 1 ? 12 
HELX_P HELX_P137 134 PHE J  183 ? VAL J  197 ? PHE b 183 VAL b 197 1 ? 15 
HELX_P HELX_P138 135 VAL J  197 ? ALA J  202 ? VAL b 197 ALA b 202 1 ? 6  
HELX_P HELX_P139 136 LEU J  222 ? GLY J  228 ? LEU b 222 GLY b 228 1 ? 7  
HELX_P HELX_P140 137 TRP J  230 ? ALA J  235 ? TRP b 230 ALA b 235 5 ? 6  
HELX_P HELX_P141 138 TRP J  269 ? GLY J  288 ? TRP b 269 GLY b 288 1 ? 20 
HELX_P HELX_P142 139 SER J  300 ? ALA J  307 ? SER b 300 ALA b 307 1 ? 8  
HELX_P HELX_P143 140 ASN J  319 ? SER J  327 ? ASN b 319 SER b 327 1 ? 9  
HELX_P HELX_P144 141 SER J  327 ? TYR J  351 ? SER b 327 TYR b 351 1 ? 25 
HELX_P HELX_P145 142 ASP J  362 ? ASP J  395 ? ASP b 362 ASP b 395 1 ? 34 
HELX_P HELX_P146 143 ASN J  404 ? HIS J  412 ? ASN b 404 HIS b 412 1 ? 9  
HELX_P HELX_P147 144 HIS J  412 ? PHE J  444 ? HIS b 412 PHE b 444 1 ? 33 
HELX_P HELX_P148 145 THR J  446 ? GLN J  450 ? THR b 446 GLN b 450 5 ? 5  
HELX_P HELX_P149 146 PRO J  455 ? GLY J  466 ? PRO b 455 GLY b 466 1 ? 12 
HELX_P HELX_P150 147 VAL J  474 ? ASN J  478 ? VAL b 474 ASN b 478 5 ? 5  
HELX_P HELX_P151 148 TRP J  490 ? ASN J  499 ? TRP b 490 ASN b 499 1 ? 10 
HELX_P HELX_P152 149 GLY J  510 ? ASP J  537 ? GLY b 510 ASP b 537 1 ? 28 
HELX_P HELX_P153 150 ASP J  546 ? GLY J  551 ? ASP b 546 GLY b 551 5 ? 6  
HELX_P HELX_P154 151 SER J  568 ? TRP J  599 ? SER b 568 TRP b 599 1 ? 32 
HELX_P HELX_P155 152 VAL J  603 ? SER J  610 ? VAL b 603 SER b 610 1 ? 8  
HELX_P HELX_P156 153 TYR J  612 ? TYR J  620 ? TYR b 612 TYR b 620 1 ? 9  
HELX_P HELX_P157 154 LEU J  640 ? SER J  663 ? LEU b 640 SER b 663 1 ? 24 
HELX_P HELX_P158 155 TRP J  664 ? THR J  682 ? TRP b 664 THR b 682 1 ? 19 
HELX_P HELX_P159 156 SER J  698 ? PHE J  730 ? SER b 698 PHE b 730 1 ? 33 
HELX_P HELX_P160 157 ARG K  44  ? CYS K  48  ? ARG c 44  CYS c 48  5 ? 5  
HELX_P HELX_P161 158 LYS K  52  ? CYS K  58  ? LYS c 52  CYS c 58  1 ? 7  
HELX_P HELX_P162 282 LEU L  19  ? GLU L  25  ? LEU d 19  GLU d 25  1 ? 7  
HELX_P HELX_P163 283 ARG L  61  ? ARG L  73  ? ARG d 61  ARG d 73  1 ? 13 
HELX_P HELX_P164 284 ARG L  121 ? ASN L  125 ? ARG d 121 ASN d 125 5 ? 5  
HELX_P HELX_P165 159 ALA M  62  ? ASN M  64  ? ALA e 62  ASN e 64  5 ? 3  
HELX_P HELX_P166 160 ASP N  2   ? THR N  10  ? ASP f 2   THR f 10  1 ? 9  
HELX_P HELX_P167 161 THR N  10  ? THR N  20  ? THR f 10  THR f 20  1 ? 11 
HELX_P HELX_P168 162 THR N  20  ? PHE N  29  ? THR f 20  PHE f 29  1 ? 10 
HELX_P HELX_P169 163 LEU N  48  ? LYS N  76  ? LEU f 48  LYS f 76  1 ? 29 
HELX_P HELX_P170 164 ASN N  77  ? VAL N  84  ? ASN f 77  VAL f 84  1 ? 8  
HELX_P HELX_P171 165 ASN N  86  ? GLY N  96  ? ASN f 86  GLY f 96  1 ? 11 
HELX_P HELX_P172 166 LEU N  99  ? SER N  110 ? LEU f 99  SER f 110 1 ? 12 
HELX_P HELX_P173 167 TYR O  9   ? TRP O  20  ? TYR i 9   TRP i 20  1 ? 12 
HELX_P HELX_P174 168 TRP O  20  ? GLU O  35  ? TRP i 20  GLU i 35  1 ? 16 
HELX_P HELX_P175 169 SER P  27  ? LEU P  37  ? SER l 27  LEU l 37  1 ? 11 
HELX_P HELX_P176 170 SER P  45  ? ILE P  62  ? SER l 45  ILE l 62  1 ? 18 
HELX_P HELX_P177 171 ILE P  62  ? GLY P  69  ? ILE l 62  GLY l 69  1 ? 8  
HELX_P HELX_P178 172 PRO P  70  ? SER P  74  ? PRO l 70  SER l 74  5 ? 5  
HELX_P HELX_P179 173 TYR P  76  ? PHE P  104 ? TYR l 76  PHE l 104 1 ? 29 
HELX_P HELX_P180 174 ASP P  112 ? GLN P  115 ? ASP l 112 GLN l 115 5 ? 4  
HELX_P HELX_P181 175 THR P  116 ? ASN P  144 ? THR l 116 ASN l 144 1 ? 29 
HELX_P HELX_P182 176 ASN P  144 ? ARG P  153 ? ASN l 144 ARG l 153 1 ? 10 
HELX_P HELX_P183 177 SER Q  4   ? ALA Q  15  ? SER m 4   ALA m 15  1 ? 12 
HELX_P HELX_P184 178 ALA Q  15  ? LYS Q  31  ? ALA m 15  LYS m 31  1 ? 17 
HELX_P HELX_P185 179 PHE R  25  ? LYS R  30  ? PHE 1 25  LYS 1 30  5 ? 6  
HELX_P HELX_P186 180 THR R  45  ? ASN R  54  ? THR 1 45  ASN 1 54  1 ? 10 
HELX_P HELX_P187 181 ASP R  57  ? THR R  62  ? ASP 1 57  THR 1 62  1 ? 6  
HELX_P HELX_P188 182 ASP R  64  ? PHE R  97  ? ASP 1 64  PHE 1 97  1 ? 34 
HELX_P HELX_P189 183 ASN R  99  ? ASP R  106 ? ASN 1 99  ASP 1 106 1 ? 8  
HELX_P HELX_P190 184 GLY R  122 ? ASN R  127 ? GLY 1 122 ASN 1 127 5 ? 6  
HELX_P HELX_P191 185 GLY R  142 ? GLY R  151 ? GLY 1 142 GLY 1 151 1 ? 10 
HELX_P HELX_P192 186 ASP R  154 ? VAL R  182 ? ASP 1 154 VAL 1 182 1 ? 29 
HELX_P HELX_P193 187 LYS R  186 ? GLN R  191 ? LYS 1 186 GLN 1 191 1 ? 6  
HELX_P HELX_P194 188 ASN R  192 ? GLY R  203 ? ASN 1 192 GLY 1 203 1 ? 12 
HELX_P HELX_P195 189 LEU R  204 ? VAL R  219 ? LEU 1 204 VAL 1 219 1 ? 16 
HELX_P HELX_P196 190 VAL R  219 ? GLY R  230 ? VAL 1 219 GLY 1 230 1 ? 12 
HELX_P HELX_P197 191 HIS R  240 ? GLU R  245 ? HIS 1 240 GLU 1 245 1 ? 6  
HELX_P HELX_P198 192 GLU R  245 ? LEU R  252 ? GLU 1 245 LEU 1 252 1 ? 8  
HELX_P HELX_P199 193 TRP R  268 ? PHE R  274 ? TRP 1 268 PHE 1 274 5 ? 7  
HELX_P HELX_P200 194 TRP R  289 ? GLY R  308 ? TRP 1 289 GLY 1 308 1 ? 20 
HELX_P HELX_P201 195 SER R  320 ? ALA R  327 ? SER 1 320 ALA 1 327 1 ? 8  
HELX_P HELX_P202 196 GLY R  330 ? GLY R  334 ? GLY 1 330 GLY 1 334 5 ? 5  
HELX_P HELX_P203 197 GLY R  339 ? LEU R  344 ? GLY 1 339 LEU 1 344 1 ? 6  
HELX_P HELX_P204 198 SER R  347 ? TYR R  371 ? SER 1 347 TYR 1 371 1 ? 25 
HELX_P HELX_P205 199 ASP R  382 ? ASP R  415 ? ASP 1 382 ASP 1 415 1 ? 34 
HELX_P HELX_P206 200 ASP R  417 ? ASN R  421 ? ASP 1 417 ASN 1 421 5 ? 5  
HELX_P HELX_P207 201 ASN R  424 ? ARG R  431 ? ASN 1 424 ARG 1 431 1 ? 8  
HELX_P HELX_P208 202 HIS R  432 ? LEU R  464 ? HIS 1 432 LEU 1 464 1 ? 33 
HELX_P HELX_P209 203 PRO R  480 ? LEU R  492 ? PRO 1 480 LEU 1 492 1 ? 13 
HELX_P HELX_P210 204 GLY R  528 ? TYR R  555 ? GLY 1 528 TYR 1 555 1 ? 28 
HELX_P HELX_P211 205 ASP R  564 ? GLY R  569 ? ASP 1 564 GLY 1 569 1 ? 6  
HELX_P HELX_P212 206 GLY R  587 ? VAL R  617 ? GLY 1 587 VAL 1 617 1 ? 31 
HELX_P HELX_P213 207 ASN R  634 ? ALA R  639 ? ASN 1 634 ALA 1 639 1 ? 6  
HELX_P HELX_P214 208 THR R  641 ? PHE R  649 ? THR 1 641 PHE 1 649 1 ? 9  
HELX_P HELX_P215 209 PHE R  649 ? ALA R  654 ? PHE 1 649 ALA 1 654 1 ? 6  
HELX_P HELX_P216 210 ALA R  654 ? ASN R  659 ? ALA 1 654 ASN 1 659 1 ? 6  
HELX_P HELX_P217 211 LEU R  665 ? PHE R  687 ? LEU 1 665 PHE 1 687 1 ? 23 
HELX_P HELX_P218 212 GLY R  689 ? LEU R  707 ? GLY 1 689 LEU 1 707 1 ? 19 
HELX_P HELX_P219 213 SER R  719 ? GLY R  751 ? SER 1 719 GLY 1 751 1 ? 33 
HELX_P HELX_P220 214 SER S  9   ? GLN S  14  ? SER 2 9   GLN 2 14  1 ? 6  
HELX_P HELX_P221 215 THR S  18  ? THR S  27  ? THR 2 18  THR 2 27  1 ? 10 
HELX_P HELX_P222 216 ASP S  30  ? HIS S  34  ? ASP 2 30  HIS 2 34  5 ? 5  
HELX_P HELX_P223 217 THR S  38  ? GLY S  72  ? THR 2 38  GLY 2 72  1 ? 35 
HELX_P HELX_P224 218 ASN S  73  ? ILE S  78  ? ASN 2 73  ILE 2 78  1 ? 6  
HELX_P HELX_P225 219 GLY S  97  ? THR S  105 ? GLY 2 97  THR 2 105 1 ? 9  
HELX_P HELX_P226 220 GLY S  119 ? GLY S  128 ? GLY 2 119 GLY 2 128 1 ? 10 
HELX_P HELX_P227 221 THR S  131 ? HIS S  156 ? THR 2 131 HIS 2 156 1 ? 26 
HELX_P HELX_P228 222 SER S  164 ? ASN S  170 ? SER 2 164 ASN 2 170 1 ? 7  
HELX_P HELX_P229 223 ASN S  170 ? GLY S  181 ? ASN 2 170 GLY 2 181 1 ? 12 
HELX_P HELX_P230 224 PHE S  183 ? VAL S  197 ? PHE 2 183 VAL 2 197 1 ? 15 
HELX_P HELX_P231 225 VAL S  197 ? ALA S  202 ? VAL 2 197 ALA 2 202 1 ? 6  
HELX_P HELX_P232 226 LEU S  222 ? GLY S  228 ? LEU 2 222 GLY 2 228 1 ? 7  
HELX_P HELX_P233 227 TRP S  230 ? ALA S  235 ? TRP 2 230 ALA 2 235 5 ? 6  
HELX_P HELX_P234 228 TRP S  269 ? GLY S  288 ? TRP 2 269 GLY 2 288 1 ? 20 
HELX_P HELX_P235 229 SER S  300 ? ALA S  307 ? SER 2 300 ALA 2 307 1 ? 8  
HELX_P HELX_P236 230 ASN S  319 ? SER S  327 ? ASN 2 319 SER 2 327 1 ? 9  
HELX_P HELX_P237 231 SER S  327 ? TYR S  351 ? SER 2 327 TYR 2 351 1 ? 25 
HELX_P HELX_P238 232 ASP S  362 ? ASP S  395 ? ASP 2 362 ASP 2 395 1 ? 34 
HELX_P HELX_P239 233 ASN S  404 ? HIS S  412 ? ASN 2 404 HIS 2 412 1 ? 9  
HELX_P HELX_P240 234 HIS S  412 ? PHE S  444 ? HIS 2 412 PHE 2 444 1 ? 33 
HELX_P HELX_P241 235 THR S  446 ? GLN S  450 ? THR 2 446 GLN 2 450 5 ? 5  
HELX_P HELX_P242 236 PRO S  455 ? GLY S  466 ? PRO 2 455 GLY 2 466 1 ? 12 
HELX_P HELX_P243 237 VAL S  474 ? ASN S  478 ? VAL 2 474 ASN 2 478 5 ? 5  
HELX_P HELX_P244 238 TRP S  490 ? ASN S  499 ? TRP 2 490 ASN 2 499 1 ? 10 
HELX_P HELX_P245 239 GLY S  510 ? ASP S  537 ? GLY 2 510 ASP 2 537 1 ? 28 
HELX_P HELX_P246 240 ASP S  546 ? GLY S  551 ? ASP 2 546 GLY 2 551 1 ? 6  
HELX_P HELX_P247 241 SER S  568 ? TRP S  599 ? SER 2 568 TRP 2 599 1 ? 32 
HELX_P HELX_P248 242 VAL S  603 ? SER S  610 ? VAL 2 603 SER 2 610 1 ? 8  
HELX_P HELX_P249 243 TYR S  612 ? TYR S  620 ? TYR 2 612 TYR 2 620 1 ? 9  
HELX_P HELX_P250 244 LEU S  640 ? SER S  663 ? LEU 2 640 SER 2 663 1 ? 24 
HELX_P HELX_P251 245 TRP S  664 ? THR S  682 ? TRP 2 664 THR 2 682 1 ? 19 
HELX_P HELX_P252 246 SER S  698 ? PHE S  730 ? SER 2 698 PHE 2 730 1 ? 33 
HELX_P HELX_P253 247 ARG T  44  ? CYS T  48  ? ARG 3 44  CYS 3 48  5 ? 5  
HELX_P HELX_P254 248 LYS T  52  ? CYS T  58  ? LYS 3 52  CYS 3 58  1 ? 7  
HELX_P HELX_P255 285 LEU U  19  ? GLU U  25  ? LEU 4 19  GLU 4 25  1 ? 7  
HELX_P HELX_P256 286 ARG U  61  ? ARG U  73  ? ARG 4 61  ARG 4 73  1 ? 13 
HELX_P HELX_P257 287 ARG U  121 ? ASN U  125 ? ARG 4 121 ASN 4 125 5 ? 5  
HELX_P HELX_P258 249 ALA V  62  ? ASN V  64  ? ALA 5 62  ASN 5 64  5 ? 3  
HELX_P HELX_P259 250 ASP W  2   ? SER W  9   ? ASP 6 2   SER 6 9   1 ? 8  
HELX_P HELX_P260 251 THR W  10  ? THR W  20  ? THR 6 10  THR 6 20  1 ? 11 
HELX_P HELX_P261 252 THR W  20  ? PHE W  29  ? THR 6 20  PHE 6 29  1 ? 10 
HELX_P HELX_P262 253 LEU W  48  ? LYS W  76  ? LEU 6 48  LYS 6 76  1 ? 29 
HELX_P HELX_P263 254 ASN W  77  ? VAL W  84  ? ASN 6 77  VAL 6 84  1 ? 8  
HELX_P HELX_P264 255 ASN W  86  ? GLY W  96  ? ASN 6 86  GLY 6 96  1 ? 11 
HELX_P HELX_P265 256 LEU W  99  ? SER W  110 ? LEU 6 99  SER 6 110 1 ? 12 
HELX_P HELX_P266 257 TYR X  9   ? TRP X  20  ? TYR 9 9   TRP 9 20  1 ? 12 
HELX_P HELX_P267 258 TRP X  20  ? GLU X  35  ? TRP 9 20  GLU 9 35  1 ? 16 
HELX_P HELX_P268 259 SER Y  27  ? LEU Y  37  ? SER 8 27  LEU 8 37  1 ? 11 
HELX_P HELX_P269 260 SER Y  45  ? LEU Y  61  ? SER 8 45  LEU 8 61  1 ? 17 
HELX_P HELX_P270 261 ILE Y  62  ? GLY Y  69  ? ILE 8 62  GLY 8 69  1 ? 8  
HELX_P HELX_P271 262 PRO Y  70  ? SER Y  74  ? PRO 8 70  SER 8 74  5 ? 5  
HELX_P HELX_P272 263 TYR Y  76  ? PHE Y  104 ? TYR 8 76  PHE 8 104 1 ? 29 
HELX_P HELX_P273 264 ASP Y  112 ? GLN Y  115 ? ASP 8 112 GLN 8 115 5 ? 4  
HELX_P HELX_P274 265 THR Y  116 ? ASN Y  144 ? THR 8 116 ASN 8 144 1 ? 29 
HELX_P HELX_P275 266 ASN Y  144 ? ARG Y  153 ? ASN 8 144 ARG 8 153 1 ? 10 
HELX_P HELX_P276 267 SER Z  4   ? ALA Z  15  ? SER 7 4   ALA 7 15  1 ? 12 
HELX_P HELX_P277 268 ALA Z  15  ? LYS Z  31  ? ALA 7 15  LYS 7 31  1 ? 17 
HELX_P HELX_P278 269 SER AA 57  ? TYR AA 76  ? SER K 57  TYR K 76  1 ? 20 
HELX_P HELX_P279 270 LEU AA 93  ? THR AA 98  ? LEU K 93  THR K 98  1 ? 6  
HELX_P HELX_P280 271 GLY AA 100 ? SER AA 125 ? GLY K 100 SER K 125 1 ? 26 
HELX_P HELX_P281 272 TYR BA 9   ? GLU BA 35  ? TYR I 9   GLU I 35  1 ? 27 
HELX_P HELX_P282 273 SER CA 57  ? TYR CA 76  ? SER k 57  TYR k 76  1 ? 20 
HELX_P HELX_P283 274 LEU CA 93  ? THR CA 98  ? LEU k 93  THR k 98  1 ? 6  
HELX_P HELX_P284 275 GLY CA 100 ? SER CA 124 ? GLY k 100 SER k 124 1 ? 25 
HELX_P HELX_P285 276 SER DA 57  ? TYR DA 76  ? SER 0 57  TYR 0 76  1 ? 20 
HELX_P HELX_P286 277 LEU DA 93  ? THR DA 98  ? LEU 0 93  THR 0 98  1 ? 6  
HELX_P HELX_P287 278 GLY DA 100 ? SER DA 124 ? GLY 0 100 SER 0 124 1 ? 25 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? R  CYS 574 SG  ? ? ? 1_555 GJ SF4 . FE4 ? ? 1 CYS 574  1 SF4 3001 1_555 ? ? ? ? ? ? ? 1.922 ? 
metalc2  metalc ? ? C  CYS 17  SG  ? ? ? 1_555 HE SF4 . FE4 ? ? C CYS 17   C SF4 3003 1_555 ? ? ? ? ? ? ? 1.925 ? 
metalc3  metalc ? ? J  CYS 565 SG  ? ? ? 1_555 TE SF4 . FE3 ? ? b CYS 565  a SF4 3001 1_555 ? ? ? ? ? ? ? 1.941 ? 
metalc4  metalc ? ? B  CYS 556 SG  ? ? ? 1_555 GA SF4 . FE1 ? ? B CYS 556  A SF4 3001 1_555 ? ? ? ? ? ? ? 1.958 ? 
metalc5  metalc ? ? S  CYS 556 SG  ? ? ? 1_555 GJ SF4 . FE1 ? ? 2 CYS 556  1 SF4 3001 1_555 ? ? ? ? ? ? ? 1.961 ? 
metalc6  metalc ? ? C  CYS 51  SG  ? ? ? 1_555 GE SF4 . FE1 ? ? C CYS 51   C SF4 3002 1_555 ? ? ? ? ? ? ? 2.018 ? 
metalc7  metalc ? ? T  CYS 54  SG  ? ? ? 1_555 GN SF4 . FE3 ? ? 3 CYS 54   3 SF4 3002 1_555 ? ? ? ? ? ? ? 2.042 ? 
metalc8  metalc ? ? A  CYS 574 SG  ? ? ? 1_555 GA SF4 . FE4 ? ? A CYS 574  A SF4 3001 1_555 ? ? ? ? ? ? ? 2.047 ? 
metalc9  metalc ? ? K  CYS 17  SG  ? ? ? 1_555 UI SF4 . FE4 ? ? c CYS 17   c SF4 3003 1_555 ? ? ? ? ? ? ? 2.086 ? 
metalc10 metalc ? ? I  CYS 583 SG  ? ? ? 1_555 TE SF4 . FE2 ? ? a CYS 583  a SF4 3001 1_555 ? ? ? ? ? ? ? 2.125 ? 
metalc11 metalc ? ? R  CYS 583 SG  ? ? ? 1_555 GJ SF4 . FE2 ? ? 1 CYS 583  1 SF4 3001 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc12 metalc ? ? J  CYS 556 SG  ? ? ? 1_555 TE SF4 . FE1 ? ? b CYS 556  a SF4 3001 1_555 ? ? ? ? ? ? ? 2.334 ? 
metalc13 metalc ? ? K  CYS 54  SG  ? ? ? 1_555 TI SF4 . FE3 ? ? c CYS 54   c SF4 3002 1_555 ? ? ? ? ? ? ? 2.367 ? 
metalc14 metalc ? ? I  GLN 115 OE1 ? ? ? 1_555 IF CLA . MG  ? ? a GLN 115  a CLA 1106 1_555 ? ? ? ? ? ? ? 2.815 ? 
metalc15 metalc ? ? A  GLN 115 OE1 ? ? ? 1_555 VA CLA . MG  ? ? A GLN 115  A CLA 1106 1_555 ? ? ? ? ? ? ? 2.834 ? 
metalc16 metalc ? ? R  GLN 115 OE1 ? ? ? 1_555 VJ CLA . MG  ? ? 1 GLN 115  1 CLA 1106 1_555 ? ? ? ? ? ? ? 2.856 ? 
metalc17 metalc ? ? P  GLU 52  OE2 ? ? ? 1_555 YI CLA . MG  ? ? l GLU 52   l CLA 1501 1_555 ? ? ? ? ? ? ? 2.869 ? 
metalc18 metalc ? ? QC LHG .   O5  ? ? ? 1_555 BE CLA . MG  ? ? B LHG 5004 B CLA 1240 1_555 ? ? ? ? ? ? ? 2.880 ? 
metalc19 metalc ? ? B  ASP 93  OD2 ? ? ? 1_555 CE CLA . MG  ? ? B ASP 93   B CLA 1206 1_555 ? ? ? ? ? ? ? 2.904 ? 
metalc20 metalc ? ? S  ASP 93  OD2 ? ? ? 1_555 ZL CLA . MG  ? ? 2 ASP 93   2 CLA 1206 1_555 ? ? ? ? ? ? ? 2.905 ? 
metalc21 metalc ? ? EF CLA .   O1A ? ? ? 1_555 LF CLA . MG  ? ? a CLA 1102 a CLA 1109 1_555 ? ? ? ? ? ? ? 2.909 ? 
metalc22 metalc ? ? A  GLN 123 OE1 ? ? ? 1_555 WA CLA . MG  ? ? A GLN 123  A CLA 1107 1_555 ? ? ? ? ? ? ? 2.910 ? 
metalc23 metalc ? ? EA CLA .   MG  ? ? ? 1_555 NA LHG . O5  ? ? A CLA 1801 A LHG 5003 1_555 ? ? ? ? ? ? ? 2.931 ? 
metalc24 metalc ? ? RE CLA .   MG  ? ? ? 1_555 AF LHG . O5  ? ? a CLA 1801 a LHG 5003 1_555 ? ? ? ? ? ? ? 2.935 ? 
metalc25 metalc ? ? EJ CLA .   MG  ? ? ? 1_555 NJ LHG . O5  ? ? 1 CLA 1801 1 LHG 5003 1_555 ? ? ? ? ? ? ? 2.947 ? 
metalc26 metalc ? ? G  GLU 52  OE2 ? ? ? 1_555 LE CLA . MG  ? ? L GLU 52   L CLA 1501 1_555 ? ? ? ? ? ? ? 2.964 ? 
metalc27 metalc ? ? J  ASP 93  OD2 ? ? ? 1_555 PI CLA . MG  ? ? b ASP 93   b CLA 1206 1_555 ? ? ? ? ? ? ? 2.970 ? 
metalc28 metalc ? ? I  GLN 123 OE1 ? ? ? 1_555 JF CLA . MG  ? ? a GLN 123  a CLA 1107 1_555 ? ? ? ? ? ? ? 2.974 ? 
metalc29 metalc ? ? RA CLA .   O1A ? ? ? 1_555 YA CLA . MG  ? ? A CLA 1102 A CLA 1109 1_555 ? ? ? ? ? ? ? 2.977 ? 
metalc30 metalc ? ? A  THR 497 O   ? ? ? 1_555 DC CLA . MG  ? ? A THR 497  A CLA 1134 1_555 ? ? ? ? ? ? ? 2.980 ? 
metalc31 metalc ? ? QL LHG .   O5  ? ? ? 1_555 CN CLA . MG  ? ? 2 LHG 5004 2 CLA 1240 1_555 ? ? ? ? ? ? ? 2.988 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          PRO 
_struct_mon_prot_cis.label_seq_id           40 
_struct_mon_prot_cis.label_asym_id          W 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           PRO 
_struct_mon_prot_cis.auth_seq_id            40 
_struct_mon_prot_cis.auth_asym_id           6 
_struct_mon_prot_cis.pdbx_label_comp_id_2   CYS 
_struct_mon_prot_cis.pdbx_label_seq_id_2    41 
_struct_mon_prot_cis.pdbx_label_asym_id_2   W 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    CYS 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     41 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    6 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -4.07 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 2 ? 
B  ? 3 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 2 ? 
G  ? 2 ? 
H  ? 5 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 3 ? 
L  ? 2 ? 
M  ? 2 ? 
N  ? 2 ? 
O  ? 2 ? 
P  ? 2 ? 
Q  ? 2 ? 
R  ? 5 ? 
S  ? 2 ? 
T  ? 2 ? 
U  ? 3 ? 
V  ? 2 ? 
W  ? 2 ? 
X  ? 2 ? 
Y  ? 2 ? 
Z  ? 3 ? 
AA ? 2 ? 
AB ? 5 ? 
AC ? 2 ? 
AD ? 4 ? 
AE ? 2 ? 
AF ? 4 ? 
AG ? 2 ? 
AH ? 4 ? 
AI ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
H  4 5 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
L  1 2 ? anti-parallel 
M  1 2 ? anti-parallel 
N  1 2 ? anti-parallel 
O  1 2 ? anti-parallel 
P  1 2 ? anti-parallel 
Q  1 2 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
R  4 5 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
Y  1 2 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? parallel      
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AI 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 VAL A 16  ? ASN A 18  ? VAL A 16  ASN A 18  
A  2 LYS A 183 ? PRO A 185 ? LYS A 183 PRO A 185 
B  1 SER A 113 ? ALA A 114 ? SER A 113 ALA A 114 
B  2 HIS A 135 ? GLN A 138 ? HIS A 135 GLN A 138 
B  3 GLY A 128 ? ASP A 129 ? GLY A 128 ASP A 129 
C  1 ILE A 514 ? VAL A 516 ? ILE A 514 VAL A 516 
C  2 LYS A 519 ? MET A 522 ? LYS A 519 MET A 522 
D  1 THR A 620 ? VAL A 621 ? THR A 620 VAL A 621 
D  2 VAL A 627 ? THR A 628 ? VAL A 627 THR A 628 
E  1 TYR B 632 ? ASN B 633 ? TYR B 632 ASN B 633 
E  2 GLY B 636 ? VAL B 637 ? GLY B 636 VAL B 637 
F  1 SER C 4   ? ILE C 7   ? SER C 4   ILE C 7   
F  2 ILE C 65  ? TYR C 68  ? ILE C 65  TYR C 68  
G  1 GLU C 27  ? PRO C 30  ? GLU C 27  PRO C 30  
G  2 GLN C 38  ? SER C 41  ? GLN C 38  SER C 41  
H  1 THR E 58  ? PHE E 61  ? THR E 58  PHE E 61  
H  2 VAL E 37  ? ARG E 40  ? VAL E 37  ARG E 40  
H  3 VAL E 22  ? VAL E 28  ? VAL E 22  VAL E 28  
H  4 LYS E 8   ? ILE E 11  ? LYS E 8   ILE E 11  
H  5 LEU E 66  ? LEU E 68  ? LEU E 66  LEU E 68  
I  1 GLN G 9   ? ALA G 10  ? GLN L 9   ALA L 10  
I  2 LEU G 20  ? SER G 21  ? LEU L 20  SER L 21  
J  1 VAL I 16  ? ASN I 18  ? VAL a 16  ASN a 18  
J  2 LYS I 183 ? PRO I 185 ? LYS a 183 PRO a 185 
K  1 SER I 113 ? ALA I 114 ? SER a 113 ALA a 114 
K  2 HIS I 135 ? GLN I 138 ? HIS a 135 GLN a 138 
K  3 GLY I 128 ? ASP I 129 ? GLY a 128 ASP a 129 
L  1 ILE I 514 ? VAL I 516 ? ILE a 514 VAL a 516 
L  2 LYS I 519 ? MET I 522 ? LYS a 519 MET a 522 
M  1 THR I 620 ? VAL I 621 ? THR a 620 VAL a 621 
M  2 VAL I 627 ? THR I 628 ? VAL a 627 THR a 628 
N  1 ILE J 87  ? ALA J 90  ? ILE b 87  ALA b 90  
N  2 VAL J 113 ? ILE J 115 ? VAL b 113 ILE b 115 
O  1 TYR J 632 ? ASN J 633 ? TYR b 632 ASN b 633 
O  2 GLY J 636 ? VAL J 637 ? GLY b 636 VAL b 637 
P  1 SER K 4   ? ILE K 7   ? SER c 4   ILE c 7   
P  2 ILE K 65  ? TYR K 68  ? ILE c 65  TYR c 68  
Q  1 GLU K 27  ? PRO K 30  ? GLU c 27  PRO c 30  
Q  2 GLN K 38  ? SER K 41  ? GLN c 38  SER c 41  
R  1 THR M 58  ? PHE M 61  ? THR e 58  PHE e 61  
R  2 VAL M 37  ? ARG M 40  ? VAL e 37  ARG e 40  
R  3 VAL M 22  ? VAL M 28  ? VAL e 22  VAL e 28  
R  4 LYS M 8   ? ILE M 11  ? LYS e 8   ILE e 11  
R  5 LEU M 66  ? LEU M 68  ? LEU e 66  LEU e 68  
S  1 GLN P 9   ? ALA P 10  ? GLN l 9   ALA l 10  
S  2 LEU P 20  ? SER P 21  ? LEU l 20  SER l 21  
T  1 VAL R 16  ? ASN R 18  ? VAL 1 16  ASN 1 18  
T  2 LYS R 183 ? PRO R 185 ? LYS 1 183 PRO 1 185 
U  1 SER R 113 ? ALA R 114 ? SER 1 113 ALA 1 114 
U  2 HIS R 135 ? GLN R 138 ? HIS 1 135 GLN 1 138 
U  3 GLY R 128 ? ASP R 129 ? GLY 1 128 ASP 1 129 
V  1 ILE R 514 ? VAL R 516 ? ILE 1 514 VAL 1 516 
V  2 LYS R 519 ? MET R 522 ? LYS 1 519 MET 1 522 
W  1 THR R 620 ? VAL R 621 ? THR 1 620 VAL 1 621 
W  2 VAL R 627 ? THR R 628 ? VAL 1 627 THR 1 628 
X  1 ILE S 87  ? ALA S 90  ? ILE 2 87  ALA 2 90  
X  2 VAL S 113 ? ILE S 115 ? VAL 2 113 ILE 2 115 
Y  1 TYR S 632 ? ASN S 633 ? TYR 2 632 ASN 2 633 
Y  2 GLY S 636 ? VAL S 637 ? GLY 2 636 VAL 2 637 
Z  1 ILE T 65  ? TYR T 68  ? ILE 3 65  TYR 3 68  
Z  2 SER T 4   ? TYR T 8   ? SER 3 4   TYR 3 8   
Z  3 THR U 117 ? LYS U 118 ? THR 4 117 LYS 4 118 
AA 1 GLU T 27  ? PRO T 30  ? GLU 3 27  PRO 3 30  
AA 2 GLN T 38  ? SER T 41  ? GLN 3 38  SER 3 41  
AB 1 THR V 58  ? PHE V 61  ? THR 5 58  PHE 5 61  
AB 2 VAL V 37  ? PHE V 41  ? VAL 5 37  PHE 5 41  
AB 3 VAL V 22  ? VAL V 28  ? VAL 5 22  VAL 5 28  
AB 4 LYS V 8   ? ILE V 11  ? LYS 5 8   ILE 5 11  
AB 5 LEU V 66  ? LEU V 68  ? LEU 5 66  LEU 5 68  
AC 1 GLN Y 9   ? ALA Y 10  ? GLN 8 9   ALA 8 10  
AC 2 LEU Y 20  ? SER Y 21  ? LEU 8 20  SER 8 21  
AD 1 GLY D 53  ? LEU D 59  ? GLY D 53  LEU D 59  
AD 2 LYS D 27  ? SER D 34  ? LYS D 27  SER D 34  
AD 3 LYS D 84  ? VAL D 88  ? LYS D 84  VAL D 88  
AD 4 VAL D 94  ? TYR D 96  ? VAL D 94  TYR D 96  
AE 1 VAL D 39  ? GLU D 41  ? VAL D 39  GLU D 41  
AE 2 ALA D 47  ? ILE D 49  ? ALA D 47  ILE D 49  
AF 1 GLY L 53  ? LEU L 59  ? GLY d 53  LEU d 59  
AF 2 LYS L 27  ? SER L 34  ? LYS d 27  SER d 34  
AF 3 LYS L 84  ? VAL L 88  ? LYS d 84  VAL d 88  
AF 4 VAL L 94  ? TYR L 96  ? VAL d 94  TYR d 96  
AG 1 VAL L 39  ? GLU L 41  ? VAL d 39  GLU d 41  
AG 2 ALA L 47  ? ILE L 49  ? ALA d 47  ILE d 49  
AH 1 GLY U 53  ? LEU U 59  ? GLY 4 53  LEU 4 59  
AH 2 LYS U 27  ? SER U 34  ? LYS 4 27  SER 4 34  
AH 3 LYS U 84  ? VAL U 88  ? LYS 4 84  VAL 4 88  
AH 4 VAL U 94  ? TYR U 96  ? VAL 4 94  TYR 4 96  
AI 1 VAL U 39  ? GLU U 41  ? VAL 4 39  GLU 4 41  
AI 2 ALA U 47  ? ILE U 49  ? ALA 4 47  ILE 4 49  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N ASP A 17  ? N ASP A 17  O ALA A 184 ? O ALA A 184 
B  1 2 N ALA A 114 ? N ALA A 114 O ILE A 137 ? O ILE A 137 
B  2 3 O GLY A 136 ? O GLY A 136 N GLY A 128 ? N GLY A 128 
C  1 2 N VAL A 516 ? N VAL A 516 O LYS A 519 ? O LYS A 519 
D  1 2 N THR A 620 ? N THR A 620 O THR A 628 ? O THR A 628 
E  1 2 N ASN B 633 ? N ASN B 633 O GLY B 636 ? O GLY B 636 
F  1 2 N SER C 4   ? N SER C 4   O TYR C 68  ? O TYR C 68  
G  1 2 N VAL C 29  ? N VAL C 29  O ILE C 39  ? O ILE C 39  
H  1 2 O PHE E 61  ? O PHE E 61  N VAL E 37  ? N VAL E 37  
H  2 3 O ARG E 40  ? O ARG E 40  N THR E 24  ? N THR E 24  
H  3 4 O GLY E 23  ? O GLY E 23  N VAL E 9   ? N VAL E 9   
H  4 5 N ARG E 10  ? N ARG E 10  O GLU E 67  ? O GLU E 67  
I  1 2 N GLN G 9   ? N GLN L 9   O SER G 21  ? O SER L 21  
J  1 2 N ASP I 17  ? N ASP a 17  O ALA I 184 ? O ALA a 184 
K  1 2 N ALA I 114 ? N ALA a 114 O ILE I 137 ? O ILE a 137 
K  2 3 O GLY I 136 ? O GLY a 136 N GLY I 128 ? N GLY a 128 
L  1 2 N VAL I 516 ? N VAL a 516 O LYS I 519 ? O LYS a 519 
M  1 2 N THR I 620 ? N THR a 620 O THR I 628 ? O THR a 628 
N  1 2 N ALA J 88  ? N ALA b 88  O ASN J 114 ? O ASN b 114 
O  1 2 N ASN J 633 ? N ASN b 633 O GLY J 636 ? O GLY b 636 
P  1 2 N SER K 4   ? N SER c 4   O TYR K 68  ? O TYR c 68  
Q  1 2 N VAL K 29  ? N VAL c 29  O ILE K 39  ? O ILE c 39  
R  1 2 O PHE M 61  ? O PHE e 61  N VAL M 37  ? N VAL e 37  
R  2 3 O ILE M 38  ? O ILE e 38  N ALA M 26  ? N ALA e 26  
R  3 4 O GLY M 23  ? O GLY e 23  N VAL M 9   ? N VAL e 9   
R  4 5 N ARG M 10  ? N ARG e 10  O GLU M 67  ? O GLU e 67  
S  1 2 N GLN P 9   ? N GLN l 9   O SER P 21  ? O SER l 21  
T  1 2 N ASP R 17  ? N ASP 1 17  O ALA R 184 ? O ALA 1 184 
U  1 2 N ALA R 114 ? N ALA 1 114 O ILE R 137 ? O ILE 1 137 
U  2 3 O GLY R 136 ? O GLY 1 136 N GLY R 128 ? N GLY 1 128 
V  1 2 N VAL R 516 ? N VAL 1 516 O LYS R 519 ? O LYS 1 519 
W  1 2 N THR R 620 ? N THR 1 620 O THR R 628 ? O THR 1 628 
X  1 2 N ALA S 88  ? N ALA 2 88  O ASN S 114 ? O ASN 2 114 
Y  1 2 N ASN S 633 ? N ASN 2 633 O GLY S 636 ? O GLY 2 636 
Z  1 2 O TYR T 68  ? O TYR 3 68  N SER T 4   ? N SER 3 4   
Z  2 3 N ILE T 7   ? N ILE 3 7   O LYS U 118 ? O LYS 4 118 
AA 1 2 N VAL T 29  ? N VAL 3 29  O ILE T 39  ? O ILE 3 39  
AB 1 2 O PHE V 61  ? O PHE 5 61  N VAL V 37  ? N VAL 5 37  
AB 2 3 O ILE V 38  ? O ILE 5 38  N ALA V 26  ? N ALA 5 26  
AB 3 4 O GLY V 23  ? O GLY 5 23  N VAL V 9   ? N VAL 5 9   
AB 4 5 N ARG V 10  ? N ARG 5 10  O GLU V 67  ? O GLU 5 67  
AC 1 2 N GLN Y 9   ? N GLN 8 9   O SER Y 21  ? O SER 8 21  
AD 1 2 O LEU D 59  ? O LEU D 59  N TYR D 28  ? N TYR D 28  
AD 2 3 N ALA D 29  ? N ALA D 29  O TYR D 86  ? O TYR D 86  
AD 3 4 N ARG D 87  ? N ARG D 87  O GLN D 95  ? O GLN D 95  
AE 1 2 N PHE D 40  ? N PHE D 40  O ALA D 48  ? O ALA D 48  
AF 1 2 O LEU L 59  ? O LEU d 59  N TYR L 28  ? N TYR d 28  
AF 2 3 N ALA L 29  ? N ALA d 29  O TYR L 86  ? O TYR d 86  
AF 3 4 N ARG L 87  ? N ARG d 87  O GLN L 95  ? O GLN d 95  
AG 1 2 N PHE L 40  ? N PHE d 40  O ALA L 48  ? O ALA d 48  
AH 1 2 O LEU U 59  ? O LEU 4 59  N TYR U 28  ? N TYR 4 28  
AH 2 3 N ALA U 29  ? N ALA 4 29  O TYR U 86  ? O TYR 4 86  
AH 3 4 N ARG U 87  ? N ARG 4 87  O GLN U 95  ? O GLN 4 95  
AI 1 2 N PHE U 40  ? N PHE 4 40  O ALA U 48  ? O ALA 4 48  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA A 1801' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE PQN A 2001' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SF4 A 3001' 
AC4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE BCR A 4001' 
AC5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE BCR A 4002' 
AC6 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE BCR A 4003' 
AC7 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE BCR A 4007' 
AC8 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE BCR A 4008' 
AC9 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE LHG A 5001' 
BC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE LHG A 5003' 
BC2 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA A 1237' 
BC3 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA A 1022' 
BC4 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA A 1101' 
BC5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA A 1102' 
BC6 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE CLA A 1103' 
BC7 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA A 1104' 
BC8 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA A 1105' 
BC9 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA A 1106' 
CC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA A 1107' 
CC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA A 1108' 
CC3 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA A 1109' 
CC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA A 1110' 
CC5 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA A 1111' 
CC6 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA A 1112' 
CC7 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA A 1113' 
CC8 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA A 1115' 
CC9 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA A 1116' 
DC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA A 1117' 
DC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA A 1118' 
DC3 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA A 1119' 
DC4 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA A 1122' 
DC5 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA A 1123' 
DC6 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA A 1124' 
DC7 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA A 1125' 
DC8 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA A 1126' 
DC9 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA A 1127' 
EC1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA A 1128' 
EC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA A 1130' 
EC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA A 1131' 
EC4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA A 1137' 
EC5 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA A 1138' 
EC6 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA A 1139' 
EC7 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA A 1140' 
EC8 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE CLA A 1011' 
EC9 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA A 1012' 
FC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CLA A 1114' 
FC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA A 1120' 
FC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CLA A 1121' 
FC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA A 1129' 
FC5 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE CLA A 1132' 
FC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CLA A 1133' 
FC7 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CLA A 1134' 
FC8 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA A 1135' 
FC9 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA A 1136' 
GC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE PQN B 2002' 
GC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE BCR B 4004' 
GC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE BCR B 4005' 
GC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE BCR B 4006' 
GC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE BCR B 4009' 
GC6 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE BCR B 4010' 
GC7 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE BCR B 4011' 
GC8 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE BCR B 4014' 
GC9 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE BCR B 4017' 
HC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE LMG B 5002' 
HC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE LHG B 5004' 
HC3 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE CLA B 1013' 
HC4 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE CLA B 1021' 
HC5 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE CLA B 1023' 
HC6 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA B 1201' 
HC7 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA B 1202' 
HC8 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA B 1203' 
HC9 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE CLA B 1204' 
IC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA B 1205' 
IC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA B 1207' 
IC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA B 1208' 
IC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA B 1209' 
IC5 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA B 1210' 
IC6 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA B 1212' 
IC7 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA B 1213' 
IC8 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA B 1214' 
IC9 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA B 1215' 
JC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA B 1216' 
JC2 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA B 1217' 
JC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CLA B 1218' 
JC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA B 1219' 
JC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA B 1220' 
JC6 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA B 1221' 
JC7 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA B 1222' 
JC8 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA B 1223' 
JC9 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA B 1224' 
KC1 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE CLA B 1225' 
KC2 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA B 1226' 
KC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA B 1227' 
KC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CLA B 1228' 
KC5 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA B 1229' 
KC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA B 1230' 
KC7 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA B 1231' 
KC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CLA B 1232' 
KC9 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA B 1234' 
LC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA B 1235' 
LC2 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA B 1236' 
LC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CLA B 1240' 
LC4 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE CLA B 1206' 
LC5 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA B 1211' 
LC6 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE CLA B 1238' 
LC7 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA B 1239' 
LC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SF4 C 3002' 
LC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SF4 C 3003' 
MC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE BCR F 4018' 
MC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE BCR F 4020' 
MC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE BCR F 4013' 
MC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA L 1501' 
MC5 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA L 1502' 
MC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA L 1503' 
MC7 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE BCR L 4019' 
MC8 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE BCR L 4022' 
MC9 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE BCR M 4021' 
NC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CLA a 1801' 
NC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE PQN a 2001' 
NC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SF4 a 3001' 
NC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE BCR a 4001' 
NC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE BCR a 4002' 
NC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE BCR a 4003' 
NC7 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE BCR a 4007' 
NC8 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE BCR a 4008' 
NC9 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE LHG a 5001' 
OC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE LHG a 5003' 
OC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA a 1237' 
OC3 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA a 1022' 
OC4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA a 1101' 
OC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA a 1102' 
OC6 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE CLA a 1103' 
OC7 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA a 1104' 
OC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CLA a 1105' 
OC9 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE CLA a 1106' 
PC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA a 1107' 
PC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA a 1108' 
PC3 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA a 1109' 
PC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA a 1110' 
PC5 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA a 1111' 
PC6 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA a 1112' 
PC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA a 1113' 
PC8 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA a 1115' 
PC9 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA a 1116' 
QC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA a 1117' 
QC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA a 1118' 
QC3 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA a 1119' 
QC4 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA a 1122' 
QC5 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA a 1123' 
QC6 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA a 1124' 
QC7 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA a 1125' 
QC8 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA a 1126' 
QC9 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA a 1127' 
RC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA a 1128' 
RC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA a 1130' 
RC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA a 1131' 
RC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA a 1137' 
RC5 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA a 1138' 
RC6 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA a 1139' 
RC7 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA a 1140' 
RC8 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA a 1011' 
RC9 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA a 1012' 
SC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CLA a 1114' 
SC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA a 1120' 
SC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CLA a 1121' 
SC4 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA a 1129' 
SC5 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA a 1132' 
SC6 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA a 1133' 
SC7 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CLA a 1134' 
SC8 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA a 1135' 
SC9 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA a 1136' 
TC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE PQN b 2002' 
TC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE BCR b 4004' 
TC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE BCR b 4005' 
TC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE BCR b 4006' 
TC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE BCR b 4009' 
TC6 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE BCR b 4010' 
TC7 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE BCR b 4011' 
TC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE BCR b 4014' 
TC9 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE BCR b 4017' 
UC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE LMG b 5002' 
UC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE LHG b 5004' 
UC3 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE CLA b 1013' 
UC4 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE CLA b 1021' 
UC5 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE CLA b 1023' 
UC6 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA b 1201' 
UC7 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA b 1202' 
UC8 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA b 1203' 
UC9 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE CLA b 1204' 
VC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA b 1205' 
VC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA b 1207' 
VC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CLA b 1208' 
VC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA b 1209' 
VC5 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA b 1210' 
VC6 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA b 1212' 
VC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CLA b 1213' 
VC8 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA b 1214' 
VC9 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE CLA b 1215' 
WC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA b 1216' 
WC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CLA b 1217' 
WC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CLA b 1218' 
WC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA b 1219' 
WC5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA b 1220' 
WC6 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA b 1221' 
WC7 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA b 1222' 
WC8 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA b 1223' 
WC9 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA b 1224' 
XC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA b 1225' 
XC2 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA b 1226' 
XC3 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA b 1227' 
XC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CLA b 1228' 
XC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA b 1229' 
XC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA b 1230' 
XC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA b 1231' 
XC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CLA b 1232' 
XC9 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA b 1234' 
YC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA b 1235' 
YC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA b 1236' 
YC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CLA b 1240' 
YC4 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE CLA b 1206' 
YC5 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA b 1211' 
YC6 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA b 1238' 
YC7 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA b 1239' 
YC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SF4 c 3002' 
YC9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SF4 c 3003' 
ZC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE BCR f 4018' 
ZC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE BCR f 4020' 
ZC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE BCR f 4013' 
ZC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA l 1501' 
ZC5 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA l 1502' 
ZC6 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA l 1503' 
ZC7 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE BCR l 4019' 
ZC8 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE BCR l 4022' 
ZC9 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE BCR m 4021' 
AD1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA 1 1801' 
AD2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE PQN 1 2001' 
AD3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SF4 1 3001' 
AD4 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE BCR 1 4001' 
AD5 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE BCR 1 4002' 
AD6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE BCR 1 4003' 
AD7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE BCR 1 4007' 
AD8 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE BCR 1 4008' 
AD9 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE LHG 1 5001' 
BD1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE LHG 1 5003' 
BD2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA 1 1237' 
BD3 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE CLA 1 1022' 
BD4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA 1 1101' 
BD5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA 1 1102' 
BD6 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA 1 1103' 
BD7 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA 1 1104' 
BD8 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA 1 1105' 
BD9 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA 1 1106' 
CD1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA 1 1107' 
CD2 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA 1 1108' 
CD3 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA 1 1109' 
CD4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CLA 1 1110' 
CD5 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA 1 1111' 
CD6 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA 1 1112' 
CD7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA 1 1113' 
CD8 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA 1 1115' 
CD9 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA 1 1116' 
DD1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA 1 1117' 
DD2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA 1 1118' 
DD3 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA 1 1119' 
DD4 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA 1 1122' 
DD5 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE CLA 1 1123' 
DD6 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA 1 1124' 
DD7 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA 1 1125' 
DD8 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA 1 1126' 
DD9 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA 1 1127' 
ED1 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA 1 1128' 
ED2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA 1 1130' 
ED3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA 1 1131' 
ED4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA 1 1137' 
ED5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA 1 1138' 
ED6 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA 1 1139' 
ED7 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA 1 1140' 
ED8 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE CLA 1 1011' 
ED9 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA 1 1012' 
FD1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CLA 1 1114' 
FD2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CLA 1 1120' 
FD3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CLA 1 1121' 
FD4 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA 1 1129' 
FD5 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA 1 1132' 
FD6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA 1 1133' 
FD7 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CLA 1 1134' 
FD8 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA 1 1135' 
FD9 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA 1 1136' 
GD1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE PQN 2 2002' 
GD2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE BCR 2 4004' 
GD3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE BCR 2 4005' 
GD4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE BCR 2 4006' 
GD5 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE BCR 2 4009' 
GD6 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE BCR 2 4010' 
GD7 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE BCR 2 4011' 
GD8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE BCR 2 4014' 
GD9 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE BCR 2 4017' 
HD1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE LMG 2 5002' 
HD2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE LHG 2 5004' 
HD3 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE CLA 2 1013' 
HD4 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE CLA 2 1021' 
HD5 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE CLA 2 1023' 
HD6 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA 2 1201' 
HD7 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA 2 1202' 
HD8 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA 2 1203' 
HD9 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE CLA 2 1204' 
ID1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA 2 1205' 
ID2 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE CLA 2 1206' 
ID3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA 2 1207' 
ID4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA 2 1208' 
ID5 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CLA 2 1209' 
ID6 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA 2 1210' 
ID7 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA 2 1212' 
ID8 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA 2 1213' 
ID9 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CLA 2 1214' 
JD1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CLA 2 1215' 
JD2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA 2 1216' 
JD3 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA 2 1217' 
JD4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CLA 2 1218' 
JD5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CLA 2 1219' 
JD6 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA 2 1220' 
JD7 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CLA 2 1221' 
JD8 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA 2 1222' 
JD9 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA 2 1223' 
KD1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA 2 1224' 
KD2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA 2 1225' 
KD3 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA 2 1226' 
KD4 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA 2 1227' 
KD5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA 2 1228' 
KD6 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA 2 1229' 
KD7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CLA 2 1230' 
KD8 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA 2 1231' 
KD9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CLA 2 1232' 
LD1 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE CLA 2 1234' 
LD2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA 2 1235' 
LD3 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CLA 2 1236' 
LD4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CLA 2 1240' 
LD5 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CLA 2 1211' 
LD6 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE CLA 2 1238' 
LD7 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CLA 2 1239' 
LD8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SF4 3 3002' 
LD9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SF4 3 3003' 
MD1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE BCR 6 4018' 
MD2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE BCR 6 4020' 
MD3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE BCR 6 4013' 
MD4 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CLA 8 1501' 
MD5 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CLA 8 1502' 
MD6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CLA 8 1503' 
MD7 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE BCR 8 4019' 
MD8 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE BCR 8 4022' 
MD9 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE BCR 7 4021' 
ND1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CLA K 1401' 
ND2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CLA K 1402' 
ND3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CLA k 1401' 
ND4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CLA k 1402' 
ND5 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CLA 0 1401' 
ND6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CLA 0 1402' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1    AC1 9  ALA A  327 ? ALA A 327  . ? 1_555 ? 
2    AC1 9  HIS A  328 ? HIS A 328  . ? 1_555 ? 
3    AC1 9  LYS A  329 ? LYS A 329  . ? 1_555 ? 
4    AC1 9  PRO A  331 ? PRO A 331  . ? 1_555 ? 
5    AC1 9  PHE A  332 ? PHE A 332  . ? 1_555 ? 
6    AC1 9  CLA ZB .   ? CLA A 1121 . ? 1_555 ? 
7    AC1 9  CLA IB .   ? CLA A 1122 . ? 1_555 ? 
8    AC1 9  BCR KA .   ? BCR A 4007 . ? 1_555 ? 
9    AC1 9  LHG NA .   ? LHG A 5003 . ? 1_555 ? 
10   AC2 11 MET A  684 ? MET A 684  . ? 1_555 ? 
11   AC2 11 PHE A  685 ? PHE A 685  . ? 1_555 ? 
12   AC2 11 SER A  688 ? SER A 688  . ? 1_555 ? 
13   AC2 11 ARG A  690 ? ARG A 690  . ? 1_555 ? 
14   AC2 11 TRP A  693 ? TRP A 693  . ? 1_555 ? 
15   AC2 11 ALA A  717 ? ALA A 717  . ? 1_555 ? 
16   AC2 11 LEU A  718 ? LEU A 718  . ? 1_555 ? 
17   AC2 11 CLA QA .   ? CLA A 1101 . ? 1_555 ? 
18   AC2 11 CLA SB .   ? CLA A 1138 . ? 1_555 ? 
19   AC2 11 CLA UB .   ? CLA A 1140 . ? 1_555 ? 
20   AC2 11 CLA RC .   ? CLA B 1013 . ? 1_555 ? 
21   AC3 5  CYS A  574 ? CYS A 574  . ? 1_555 ? 
22   AC3 5  PRO A  577 ? PRO A 577  . ? 1_555 ? 
23   AC3 5  CYS A  583 ? CYS A 583  . ? 1_555 ? 
24   AC3 5  CYS B  556 ? CYS B 556  . ? 1_555 ? 
25   AC3 5  CYS B  565 ? CYS B 565  . ? 1_555 ? 
26   AC4 13 PHE A  263 ? PHE A 263  . ? 1_555 ? 
27   AC4 13 ILE A  305 ? ILE A 305  . ? 1_555 ? 
28   AC4 13 HIS A  309 ? HIS A 309  . ? 1_555 ? 
29   AC4 13 CLA CB .   ? CLA A 1113 . ? 1_555 ? 
30   AC4 13 CLA GB .   ? CLA A 1118 . ? 1_555 ? 
31   AC4 13 CLA YB .   ? CLA A 1120 . ? 1_555 ? 
32   AC4 13 BCR IA .   ? BCR A 4002 . ? 1_555 ? 
33   AC4 13 PHE AA 72  ? PHE K 72   . ? 1_555 ? 
34   AC4 13 PHE AA 77  ? PHE K 77   . ? 1_555 ? 
35   AC4 13 ALA AA 106 ? ALA K 106  . ? 1_555 ? 
36   AC4 13 SER AA 109 ? SER K 109  . ? 1_555 ? 
37   AC4 13 PHE AA 110 ? PHE K 110  . ? 1_555 ? 
38   AC4 13 CLA RN .   ? CLA K 1401 . ? 1_555 ? 
39   AC5 13 PHE A  84  ? PHE A 84   . ? 1_555 ? 
40   AC5 13 THR A  161 ? THR A 161  . ? 1_555 ? 
41   AC5 13 GLY A  164 ? GLY A 164  . ? 1_555 ? 
42   AC5 13 GLY A  165 ? GLY A 165  . ? 1_555 ? 
43   AC5 13 MET A  168 ? MET A 168  . ? 1_555 ? 
44   AC5 13 LEU A  207 ? LEU A 207  . ? 1_555 ? 
45   AC5 13 GLY A  211 ? GLY A 211  . ? 1_555 ? 
46   AC5 13 CLA SA .   ? CLA A 1103 . ? 1_555 ? 
47   AC5 13 CLA BB .   ? CLA A 1112 . ? 1_555 ? 
48   AC5 13 CLA CB .   ? CLA A 1113 . ? 1_555 ? 
49   AC5 13 CLA XB .   ? CLA A 1114 . ? 1_555 ? 
50   AC5 13 BCR HA .   ? BCR A 4001 . ? 1_555 ? 
51   AC5 13 BCR JA .   ? BCR A 4003 . ? 1_555 ? 
52   AC6 9  GLY A  203 ? GLY A 203  . ? 1_555 ? 
53   AC6 9  LEU A  207 ? LEU A 207  . ? 1_555 ? 
54   AC6 9  GLY A  208 ? GLY A 208  . ? 1_555 ? 
55   AC6 9  CLA SA .   ? CLA A 1103 . ? 1_555 ? 
56   AC6 9  CLA AB .   ? CLA A 1111 . ? 1_555 ? 
57   AC6 9  CLA FB .   ? CLA A 1117 . ? 1_555 ? 
58   AC6 9  CLA GB .   ? CLA A 1118 . ? 1_555 ? 
59   AC6 9  CLA NB .   ? CLA A 1127 . ? 1_555 ? 
60   AC6 9  BCR IA .   ? BCR A 4002 . ? 1_555 ? 
61   AC7 10 ALA A  350 ? ALA A 350  . ? 1_555 ? 
62   AC7 10 ILE A  354 ? ILE A 354  . ? 1_555 ? 
63   AC7 10 PHE A  411 ? PHE A 411  . ? 1_555 ? 
64   AC7 10 CLA HB .   ? CLA A 1119 . ? 1_555 ? 
65   AC7 10 CLA IB .   ? CLA A 1122 . ? 1_555 ? 
66   AC7 10 CLA JB .   ? CLA A 1123 . ? 1_555 ? 
67   AC7 10 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
68   AC7 10 CLA EA .   ? CLA A 1801 . ? 1_555 ? 
69   AC7 10 BCR LA .   ? BCR A 4008 . ? 1_555 ? 
70   AC7 10 LHG NA .   ? LHG A 5003 . ? 1_555 ? 
71   AC8 10 LEU A  358 ? LEU A 358  . ? 1_555 ? 
72   AC8 10 ILE A  401 ? ILE A 401  . ? 1_555 ? 
73   AC8 10 ALA A  404 ? ALA A 404  . ? 1_555 ? 
74   AC8 10 LEU A  550 ? LEU A 550  . ? 1_555 ? 
75   AC8 10 CLA HB .   ? CLA A 1119 . ? 1_555 ? 
76   AC8 10 CLA KB .   ? CLA A 1124 . ? 1_555 ? 
77   AC8 10 CLA LB .   ? CLA A 1125 . ? 1_555 ? 
78   AC8 10 CLA CC .   ? CLA A 1133 . ? 1_555 ? 
79   AC8 10 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
80   AC8 10 BCR KA .   ? BCR A 4007 . ? 1_555 ? 
81   AC9 14 ASN A  50  ? ASN A 50   . ? 1_555 ? 
82   AC9 14 ALA A  53  ? ALA A 53   . ? 1_555 ? 
83   AC9 14 ASN A  54  ? ASN A 54   . ? 1_555 ? 
84   AC9 14 ARG A  571 ? ARG A 571  . ? 1_555 ? 
85   AC9 14 TRP A  588 ? TRP A 588  . ? 1_555 ? 
86   AC9 14 SER A  719 ? SER A 719  . ? 1_555 ? 
87   AC9 14 ILE A  721 ? ILE A 721  . ? 1_555 ? 
88   AC9 14 GLN A  722 ? GLN A 722  . ? 1_555 ? 
89   AC9 14 ALA A  725 ? ALA A 725  . ? 1_555 ? 
90   AC9 14 CLA QA .   ? CLA A 1101 . ? 1_555 ? 
91   AC9 14 CLA TA .   ? CLA A 1104 . ? 1_555 ? 
92   AC9 14 CLA VA .   ? CLA A 1106 . ? 1_555 ? 
93   AC9 14 CLA OB .   ? CLA A 1128 . ? 1_555 ? 
94   AC9 14 CLA UB .   ? CLA A 1140 . ? 1_555 ? 
95   BC1 12 HIS A  328 ? HIS A 328  . ? 1_555 ? 
96   BC1 12 GLY A  330 ? GLY A 330  . ? 1_555 ? 
97   BC1 12 PRO A  331 ? PRO A 331  . ? 1_555 ? 
98   BC1 12 PHE A  332 ? PHE A 332  . ? 1_555 ? 
99   BC1 12 THR A  333 ? THR A 333  . ? 1_555 ? 
100  BC1 12 HIS A  337 ? HIS A 337  . ? 1_555 ? 
101  BC1 12 CLA IB .   ? CLA A 1122 . ? 1_555 ? 
102  BC1 12 CLA AC .   ? CLA A 1129 . ? 1_555 ? 
103  BC1 12 CLA FC .   ? CLA A 1136 . ? 1_555 ? 
104  BC1 12 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
105  BC1 12 CLA EA .   ? CLA A 1801 . ? 1_555 ? 
106  BC1 12 BCR KA .   ? BCR A 4007 . ? 1_555 ? 
107  BC2 13 SER A  438 ? SER A 438  . ? 1_555 ? 
108  BC2 13 ASN A  441 ? ASN A 441  . ? 1_555 ? 
109  BC2 13 ILE A  445 ? ILE A 445  . ? 1_555 ? 
110  BC2 13 CLA QB .   ? CLA A 1131 . ? 1_555 ? 
111  BC2 13 ILE B  675 ? ILE B 675  . ? 1_555 ? 
112  BC2 13 ALA B  678 ? ALA B 678  . ? 1_555 ? 
113  BC2 13 HIS B  679 ? HIS B 679  . ? 1_555 ? 
114  BC2 13 THR B  682 ? THR B 682  . ? 1_555 ? 
115  BC2 13 CLA EE .   ? CLA B 1238 . ? 1_555 ? 
116  BC2 13 BCR OC .   ? BCR B 4017 . ? 1_555 ? 
117  BC2 13 BCR JE .   ? BCR F 4020 . ? 1_555 ? 
118  BC2 13 CLA ME .   ? CLA L 1502 . ? 1_555 ? 
119  BC2 13 BCR OE .   ? BCR L 4019 . ? 1_555 ? 
120  BC3 19 PHE A  452 ? PHE A 452  . ? 1_555 ? 
121  BC3 19 ILE A  456 ? ILE A 456  . ? 1_555 ? 
122  BC3 19 PHE A  540 ? PHE A 540  . ? 1_555 ? 
123  BC3 19 TRP A  597 ? TRP A 597  . ? 1_555 ? 
124  BC3 19 ASN A  600 ? ASN A 600  . ? 1_555 ? 
125  BC3 19 ILE A  642 ? ILE A 642  . ? 1_555 ? 
126  BC3 19 TYR A  731 ? TYR A 731  . ? 1_555 ? 
127  BC3 19 CLA VB .   ? CLA A 1011 . ? 1_555 ? 
128  BC3 19 TRP B  645 ? TRP B 645  . ? 1_555 ? 
129  BC3 19 LEU B  648 ? LEU B 648  . ? 1_555 ? 
130  BC3 19 HIS B  651 ? HIS B 651  . ? 1_555 ? 
131  BC3 19 LEU B  652 ? LEU B 652  . ? 1_555 ? 
132  BC3 19 TRP B  654 ? TRP B 654  . ? 1_555 ? 
133  BC3 19 ALA B  655 ? ALA B 655  . ? 1_555 ? 
134  BC3 19 CLA SC .   ? CLA B 1021 . ? 1_555 ? 
135  BC3 19 CLA TC .   ? CLA B 1023 . ? 1_555 ? 
136  BC3 19 CLA CE .   ? CLA B 1206 . ? 1_555 ? 
137  BC3 19 CLA ZC .   ? CLA B 1207 . ? 1_555 ? 
138  BC3 19 BCR OC .   ? BCR B 4017 . ? 1_555 ? 
139  BC4 15 TRP A  49  ? TRP A 49   . ? 1_555 ? 
140  BC4 15 HIS A  52  ? HIS A 52   . ? 1_555 ? 
141  BC4 15 CLA WB .   ? CLA A 1012 . ? 1_555 ? 
142  BC4 15 CLA RA .   ? CLA A 1102 . ? 1_555 ? 
143  BC4 15 CLA MB .   ? CLA A 1126 . ? 1_555 ? 
144  BC4 15 CLA SB .   ? CLA A 1138 . ? 1_555 ? 
145  BC4 15 CLA TB .   ? CLA A 1139 . ? 1_555 ? 
146  BC4 15 CLA UB .   ? CLA A 1140 . ? 1_555 ? 
147  BC4 15 PQN FA .   ? PQN A 2001 . ? 1_555 ? 
148  BC4 15 LHG MA .   ? LHG A 5001 . ? 1_555 ? 
149  BC4 15 CLA RC .   ? CLA B 1013 . ? 1_555 ? 
150  BC4 15 BCR NC .   ? BCR B 4014 . ? 1_555 ? 
151  BC4 15 ALA F  11  ? ALA F 11   . ? 1_555 ? 
152  BC4 15 VAL F  83  ? VAL F 83   . ? 1_555 ? 
153  BC4 15 BCR KE .   ? BCR F 4013 . ? 1_555 ? 
154  BC5 13 TRP A  28  ? TRP A 28   . ? 1_555 ? 
155  BC5 13 PHE A  34  ? PHE A 34   . ? 1_555 ? 
156  BC5 13 LEU A  51  ? LEU A 51   . ? 1_555 ? 
157  BC5 13 ALA A  55  ? ALA A 55   . ? 1_555 ? 
158  BC5 13 HIS A  56  ? HIS A 56   . ? 1_555 ? 
159  BC5 13 GLY A  78  ? GLY A 78   . ? 1_555 ? 
160  BC5 13 HIS A  79  ? HIS A 79   . ? 1_555 ? 
161  BC5 13 CLA QA .   ? CLA A 1101 . ? 1_555 ? 
162  BC5 13 CLA SA .   ? CLA A 1103 . ? 1_555 ? 
163  BC5 13 CLA TA .   ? CLA A 1104 . ? 1_555 ? 
164  BC5 13 CLA VA .   ? CLA A 1106 . ? 1_555 ? 
165  BC5 13 CLA WA .   ? CLA A 1107 . ? 1_555 ? 
166  BC5 13 CLA YA .   ? CLA A 1109 . ? 1_555 ? 
167  BC6 20 HIS A  56  ? HIS A 56   . ? 1_555 ? 
168  BC6 20 PHE A  58  ? PHE A 58   . ? 1_555 ? 
169  BC6 20 ILE A  72  ? ILE A 72   . ? 1_555 ? 
170  BC6 20 ALA A  75  ? ALA A 75   . ? 1_555 ? 
171  BC6 20 HIS A  76  ? HIS A 76   . ? 1_555 ? 
172  BC6 20 HIS A  79  ? HIS A 79   . ? 1_555 ? 
173  BC6 20 LEU A  80  ? LEU A 80   . ? 1_555 ? 
174  BC6 20 PHE A  84  ? PHE A 84   . ? 1_555 ? 
175  BC6 20 TRP A  348 ? TRP A 348  . ? 1_555 ? 
176  BC6 20 HIS A  349 ? HIS A 349  . ? 1_555 ? 
177  BC6 20 LEU A  352 ? LEU A 352  . ? 1_555 ? 
178  BC6 20 ASN A  355 ? ASN A 355  . ? 1_555 ? 
179  BC6 20 LEU A  356 ? LEU A 356  . ? 1_555 ? 
180  BC6 20 CLA RA .   ? CLA A 1102 . ? 1_555 ? 
181  BC6 20 CLA TA .   ? CLA A 1104 . ? 1_555 ? 
182  BC6 20 CLA AB .   ? CLA A 1111 . ? 1_555 ? 
183  BC6 20 CLA JB .   ? CLA A 1123 . ? 1_555 ? 
184  BC6 20 CLA OB .   ? CLA A 1128 . ? 1_555 ? 
185  BC6 20 BCR IA .   ? BCR A 4002 . ? 1_555 ? 
186  BC6 20 BCR JA .   ? BCR A 4003 . ? 1_555 ? 
187  BC7 10 HIS A  56  ? HIS A 56   . ? 1_555 ? 
188  BC7 10 HIS A  79  ? HIS A 79   . ? 1_555 ? 
189  BC7 10 TRP A  86  ? TRP A 86   . ? 1_555 ? 
190  BC7 10 LEU A  400 ? LEU A 400  . ? 1_555 ? 
191  BC7 10 CLA RA .   ? CLA A 1102 . ? 1_555 ? 
192  BC7 10 CLA SA .   ? CLA A 1103 . ? 1_555 ? 
193  BC7 10 CLA VA .   ? CLA A 1106 . ? 1_555 ? 
194  BC7 10 CLA NB .   ? CLA A 1127 . ? 1_555 ? 
195  BC7 10 CLA OB .   ? CLA A 1128 . ? 1_555 ? 
196  BC7 10 LHG MA .   ? LHG A 5001 . ? 1_555 ? 
197  BC8 10 VAL A  85  ? VAL A 85   . ? 1_555 ? 
198  BC8 10 SER A  88  ? SER A 88   . ? 1_555 ? 
199  BC8 10 GLY A  89  ? GLY A 89   . ? 1_555 ? 
200  BC8 10 PHE A  92  ? PHE A 92   . ? 1_555 ? 
201  BC8 10 HIS A  93  ? HIS A 93   . ? 1_555 ? 
202  BC8 10 PHE A  97  ? PHE A 97   . ? 1_555 ? 
203  BC8 10 TRP A  118 ? TRP A 118  . ? 1_555 ? 
204  BC8 10 CLA VA .   ? CLA A 1106 . ? 1_555 ? 
205  BC8 10 CLA WA .   ? CLA A 1107 . ? 1_555 ? 
206  BC8 10 BCR KE .   ? BCR F 4013 . ? 1_555 ? 
207  BC9 18 GLN A  115 ? GLN A 115  . ? 1_555 ? 
208  BC9 18 GLN A  138 ? GLN A 138  . ? 1_555 ? 
209  BC9 18 ILE A  139 ? ILE A 139  . ? 1_555 ? 
210  BC9 18 THR A  140 ? THR A 140  . ? 1_555 ? 
211  BC9 18 SER A  141 ? SER A 141  . ? 1_555 ? 
212  BC9 18 LEU A  143 ? LEU A 143  . ? 1_555 ? 
213  BC9 18 ALA A  667 ? ALA A 667  . ? 1_555 ? 
214  BC9 18 TYR A  668 ? TYR A 668  . ? 1_555 ? 
215  BC9 18 CLA RA .   ? CLA A 1102 . ? 1_555 ? 
216  BC9 18 CLA TA .   ? CLA A 1104 . ? 1_555 ? 
217  BC9 18 CLA UA .   ? CLA A 1105 . ? 1_555 ? 
218  BC9 18 CLA WA .   ? CLA A 1107 . ? 1_555 ? 
219  BC9 18 CLA YA .   ? CLA A 1109 . ? 1_555 ? 
220  BC9 18 CLA MB .   ? CLA A 1126 . ? 1_555 ? 
221  BC9 18 CLA UB .   ? CLA A 1140 . ? 1_555 ? 
222  BC9 18 LHG MA .   ? LHG A 5001 . ? 1_555 ? 
223  BC9 18 BCR MC .   ? BCR B 4011 . ? 1_555 ? 
224  BC9 18 BCR KE .   ? BCR F 4013 . ? 1_555 ? 
225  CC1 14 GLN A  115 ? GLN A 115  . ? 1_555 ? 
226  CC1 14 VAL A  116 ? VAL A 116  . ? 1_555 ? 
227  CC1 14 VAL A  117 ? VAL A 117  . ? 1_555 ? 
228  CC1 14 TRP A  118 ? TRP A 118  . ? 1_555 ? 
229  CC1 14 GLN A  123 ? GLN A 123  . ? 1_555 ? 
230  CC1 14 LEU A  126 ? LEU A 126  . ? 1_555 ? 
231  CC1 14 ILE A  670 ? ILE A 670  . ? 1_555 ? 
232  CC1 14 CLA RA .   ? CLA A 1102 . ? 1_555 ? 
233  CC1 14 CLA UA .   ? CLA A 1105 . ? 1_555 ? 
234  CC1 14 CLA VA .   ? CLA A 1106 . ? 1_555 ? 
235  CC1 14 CLA MB .   ? CLA A 1126 . ? 1_555 ? 
236  CC1 14 VAL B  440 ? VAL B 440  . ? 1_555 ? 
237  CC1 14 PHE B  444 ? PHE B 444  . ? 1_555 ? 
238  CC1 14 BCR KE .   ? BCR F 4013 . ? 1_555 ? 
239  CC2 11 VAL A  14  ? VAL A 14   . ? 1_555 ? 
240  CC2 11 PHE A  77  ? PHE A 77   . ? 1_555 ? 
241  CC2 11 MET A  172 ? MET A 172  . ? 1_555 ? 
242  CC2 11 PHE A  174 ? PHE A 174  . ? 1_555 ? 
243  CC2 11 ALA A  175 ? ALA A 175  . ? 1_555 ? 
244  CC2 11 PHE A  178 ? PHE A 178  . ? 1_555 ? 
245  CC2 11 HIS A  179 ? HIS A 179  . ? 1_555 ? 
246  CC2 11 LYS A  183 ? LYS A 183  . ? 1_555 ? 
247  CC2 11 TRP A  189 ? TRP A 189  . ? 1_555 ? 
248  CC2 11 CLA ZA .   ? CLA A 1110 . ? 1_555 ? 
249  CC2 11 CLA AB .   ? CLA A 1111 . ? 1_555 ? 
250  CC3 15 THR A  23  ? THR A 23   . ? 1_555 ? 
251  CC3 15 SER A  24  ? SER A 24   . ? 1_555 ? 
252  CC3 15 PHE A  25  ? PHE A 25   . ? 1_555 ? 
253  CC3 15 LYS A  27  ? LYS A 27   . ? 1_555 ? 
254  CC3 15 TRP A  28  ? TRP A 28   . ? 1_555 ? 
255  CC3 15 HIS A  33  ? HIS A 33   . ? 1_555 ? 
256  CC3 15 LYS A  71  ? LYS A 71   . ? 1_555 ? 
257  CC3 15 VAL A  85  ? VAL A 85   . ? 1_555 ? 
258  CC3 15 LEU A  173 ? LEU A 173  . ? 1_555 ? 
259  CC3 15 GLY A  176 ? GLY A 176  . ? 1_555 ? 
260  CC3 15 TRP A  177 ? TRP A 177  . ? 1_555 ? 
261  CC3 15 TYR A  180 ? TYR A 180  . ? 1_555 ? 
262  CC3 15 HIS A  181 ? HIS A 181  . ? 1_555 ? 
263  CC3 15 CLA RA .   ? CLA A 1102 . ? 1_555 ? 
264  CC3 15 CLA VA .   ? CLA A 1106 . ? 1_555 ? 
265  CC4 10 LYS A  13  ? LYS A 13   . ? 1_555 ? 
266  CC4 10 TRP A  189 ? TRP A 189  . ? 1_555 ? 
267  CC4 10 ASN A  192 ? ASN A 192  . ? 1_555 ? 
268  CC4 10 SER A  195 ? SER A 195  . ? 1_555 ? 
269  CC4 10 HIS A  199 ? HIS A 199  . ? 1_555 ? 
270  CC4 10 ASN A  314 ? ASN A 314  . ? 1_555 ? 
271  CC4 10 CLA XA .   ? CLA A 1108 . ? 1_555 ? 
272  CC4 10 CLA AB .   ? CLA A 1111 . ? 1_555 ? 
273  CC4 10 CLA GB .   ? CLA A 1118 . ? 1_555 ? 
274  CC4 10 GLY AA 83  ? GLY K 83   . ? 1_555 ? 
275  CC5 16 PHE A  73  ? PHE A 73   . ? 1_555 ? 
276  CC5 16 HIS A  76  ? HIS A 76   . ? 1_555 ? 
277  CC5 16 PHE A  77  ? PHE A 77   . ? 1_555 ? 
278  CC5 16 LEU A  80  ? LEU A 80   . ? 1_555 ? 
279  CC5 16 MET A  172 ? MET A 172  . ? 1_555 ? 
280  CC5 16 TRP A  189 ? TRP A 189  . ? 1_555 ? 
281  CC5 16 ASN A  192 ? ASN A 192  . ? 1_555 ? 
282  CC5 16 MET A  196 ? MET A 196  . ? 1_555 ? 
283  CC5 16 HIS A  199 ? HIS A 199  . ? 1_555 ? 
284  CC5 16 HIS A  200 ? HIS A 200  . ? 1_555 ? 
285  CC5 16 LEU A  204 ? LEU A 204  . ? 1_555 ? 
286  CC5 16 CLA SA .   ? CLA A 1103 . ? 1_555 ? 
287  CC5 16 CLA XA .   ? CLA A 1108 . ? 1_555 ? 
288  CC5 16 CLA ZA .   ? CLA A 1110 . ? 1_555 ? 
289  CC5 16 CLA JB .   ? CLA A 1123 . ? 1_555 ? 
290  CC5 16 BCR JA .   ? BCR A 4003 . ? 1_555 ? 
291  CC6 13 GLY A  151 ? GLY A 151  . ? 1_555 ? 
292  CC6 13 PHE A  152 ? PHE A 152  . ? 1_555 ? 
293  CC6 13 GLN A  157 ? GLN A 157  . ? 1_555 ? 
294  CC6 13 CYS A  160 ? CYS A 160  . ? 1_555 ? 
295  CC6 13 THR A  161 ? THR A 161  . ? 1_555 ? 
296  CC6 13 GLY A  211 ? GLY A 211  . ? 1_555 ? 
297  CC6 13 TRP A  212 ? TRP A 212  . ? 1_555 ? 
298  CC6 13 HIS A  215 ? HIS A 215  . ? 1_555 ? 
299  CC6 13 VAL A  219 ? VAL A 219  . ? 1_555 ? 
300  CC6 13 HIS A  240 ? HIS A 240  . ? 1_555 ? 
301  CC6 13 CLA CB .   ? CLA A 1113 . ? 1_555 ? 
302  CC6 13 CLA XB .   ? CLA A 1114 . ? 1_555 ? 
303  CC6 13 BCR IA .   ? BCR A 4002 . ? 1_555 ? 
304  CC7 11 LEU A  210 ? LEU A 210  . ? 1_555 ? 
305  CC7 11 GLY A  214 ? GLY A 214  . ? 1_555 ? 
306  CC7 11 ILE A  217 ? ILE A 217  . ? 1_555 ? 
307  CC7 11 HIS A  218 ? HIS A 218  . ? 1_555 ? 
308  CC7 11 PRO A  246 ? PRO A 246  . ? 1_555 ? 
309  CC7 11 PHE A  256 ? PHE A 256  . ? 1_555 ? 
310  CC7 11 GLY A  259 ? GLY A 259  . ? 1_555 ? 
311  CC7 11 LEU A  260 ? LEU A 260  . ? 1_555 ? 
312  CC7 11 CLA BB .   ? CLA A 1112 . ? 1_555 ? 
313  CC7 11 BCR HA .   ? BCR A 4001 . ? 1_555 ? 
314  CC7 11 BCR IA .   ? BCR A 4002 . ? 1_555 ? 
315  CC8 13 TRP A  268 ? TRP A 268  . ? 1_555 ? 
316  CC8 13 SER A  272 ? SER A 272  . ? 1_555 ? 
317  CC8 13 LEU A  275 ? LEU A 275  . ? 1_555 ? 
318  CC8 13 PHE A  277 ? PHE A 277  . ? 1_555 ? 
319  CC8 13 HIS A  295 ? HIS A 295  . ? 1_555 ? 
320  CC8 13 LEU A  298 ? LEU A 298  . ? 1_555 ? 
321  CC8 13 ALA A  299 ? ALA A 299  . ? 1_555 ? 
322  CC8 13 VAL A  302 ? VAL A 302  . ? 1_555 ? 
323  CC8 13 ASN A  500 ? ASN A 500  . ? 1_555 ? 
324  CC8 13 CLA EB .   ? CLA A 1116 . ? 1_555 ? 
325  CC8 13 CLA DC .   ? CLA A 1134 . ? 1_555 ? 
326  CC8 13 ALA AA 49  ? ALA K 49   . ? 1_555 ? 
327  CC8 13 CLA RN .   ? CLA K 1401 . ? 1_555 ? 
328  CC9 16 THR A  276 ? THR A 276  . ? 1_555 ? 
329  CC9 16 PHE A  277 ? PHE A 277  . ? 1_555 ? 
330  CC9 16 ASP A  292 ? ASP A 292  . ? 1_555 ? 
331  CC9 16 THR A  293 ? THR A 293  . ? 1_555 ? 
332  CC9 16 HIS A  295 ? HIS A 295  . ? 1_555 ? 
333  CC9 16 HIS A  296 ? HIS A 296  . ? 1_555 ? 
334  CC9 16 ALA A  299 ? ALA A 299  . ? 1_555 ? 
335  CC9 16 ILE A  300 ? ILE A 300  . ? 1_555 ? 
336  CC9 16 HIS A  369 ? HIS A 369  . ? 1_555 ? 
337  CC9 16 MET A  373 ? MET A 373  . ? 1_555 ? 
338  CC9 16 ALA A  505 ? ALA A 505  . ? 1_555 ? 
339  CC9 16 CLA DB .   ? CLA A 1115 . ? 1_555 ? 
340  CC9 16 CLA FB .   ? CLA A 1117 . ? 1_555 ? 
341  CC9 16 CLA LB .   ? CLA A 1125 . ? 1_555 ? 
342  CC9 16 CLA CC .   ? CLA A 1133 . ? 1_555 ? 
343  CC9 16 CLA DC .   ? CLA A 1134 . ? 1_555 ? 
344  DC1 17 ALA A  149 ? ALA A 149  . ? 1_555 ? 
345  DC1 17 LEU A  205 ? LEU A 205  . ? 1_555 ? 
346  DC1 17 GLY A  208 ? GLY A 208  . ? 1_555 ? 
347  DC1 17 SER A  209 ? SER A 209  . ? 1_555 ? 
348  DC1 17 TRP A  212 ? TRP A 212  . ? 1_555 ? 
349  DC1 17 GLN A  216 ? GLN A 216  . ? 1_555 ? 
350  DC1 17 HIS A  296 ? HIS A 296  . ? 1_555 ? 
351  DC1 17 HIS A  297 ? HIS A 297  . ? 1_555 ? 
352  DC1 17 PHE A  304 ? PHE A 304  . ? 1_555 ? 
353  DC1 17 LEU A  362 ? LEU A 362  . ? 1_555 ? 
354  DC1 17 ILE A  365 ? ILE A 365  . ? 1_555 ? 
355  DC1 17 VAL A  366 ? VAL A 366  . ? 1_555 ? 
356  DC1 17 PRO A  375 ? PRO A 375  . ? 1_555 ? 
357  DC1 17 TYR A  376 ? TYR A 376  . ? 1_555 ? 
358  DC1 17 CLA EB .   ? CLA A 1116 . ? 1_555 ? 
359  DC1 17 CLA NB .   ? CLA A 1127 . ? 1_555 ? 
360  DC1 17 BCR JA .   ? BCR A 4003 . ? 1_555 ? 
361  DC2 15 ASN A  198 ? ASN A 198  . ? 1_555 ? 
362  DC2 15 HIS A  199 ? HIS A 199  . ? 1_555 ? 
363  DC2 15 ALA A  202 ? ALA A 202  . ? 1_555 ? 
364  DC2 15 GLY A  203 ? GLY A 203  . ? 1_555 ? 
365  DC2 15 HIS A  309 ? HIS A 309  . ? 1_555 ? 
366  DC2 15 TYR A  311 ? TYR A 311  . ? 1_555 ? 
367  DC2 15 THR A  313 ? THR A 313  . ? 1_555 ? 
368  DC2 15 TRP A  315 ? TRP A 315  . ? 1_555 ? 
369  DC2 15 ILE A  317 ? ILE A 317  . ? 1_555 ? 
370  DC2 15 CLA ZA .   ? CLA A 1110 . ? 1_555 ? 
371  DC2 15 BCR HA .   ? BCR A 4001 . ? 1_555 ? 
372  DC2 15 BCR JA .   ? BCR A 4003 . ? 1_555 ? 
373  DC2 15 LEU AA 105 ? LEU K 105  . ? 1_555 ? 
374  DC2 15 ALA AA 106 ? ALA K 106  . ? 1_555 ? 
375  DC2 15 SER AA 109 ? SER K 109  . ? 1_555 ? 
376  DC3 15 MET A  197 ? MET A 197  . ? 1_555 ? 
377  DC3 15 LEU A  201 ? LEU A 201  . ? 1_555 ? 
378  DC3 15 LEU A  205 ? LEU A 205  . ? 1_555 ? 
379  DC3 15 PHE A  304 ? PHE A 304  . ? 1_555 ? 
380  DC3 15 ALA A  307 ? ALA A 307  . ? 1_555 ? 
381  DC3 15 MET A  310 ? MET A 310  . ? 1_555 ? 
382  DC3 15 TYR A  311 ? TYR A 311  . ? 1_555 ? 
383  DC3 15 MET A  321 ? MET A 321  . ? 1_555 ? 
384  DC3 15 CLA YB .   ? CLA A 1120 . ? 1_555 ? 
385  DC3 15 CLA ZB .   ? CLA A 1121 . ? 1_555 ? 
386  DC3 15 CLA IB .   ? CLA A 1122 . ? 1_555 ? 
387  DC3 15 CLA JB .   ? CLA A 1123 . ? 1_555 ? 
388  DC3 15 CLA KB .   ? CLA A 1124 . ? 1_555 ? 
389  DC3 15 BCR KA .   ? BCR A 4007 . ? 1_555 ? 
390  DC3 15 BCR LA .   ? BCR A 4008 . ? 1_555 ? 
391  DC4 15 ILE A  324 ? ILE A 324  . ? 1_555 ? 
392  DC4 15 LEU A  325 ? LEU A 325  . ? 1_555 ? 
393  DC4 15 HIS A  328 ? HIS A 328  . ? 1_555 ? 
394  DC4 15 THR A  333 ? THR A 333  . ? 1_555 ? 
395  DC4 15 HIS A  337 ? HIS A 337  . ? 1_555 ? 
396  DC4 15 LEU A  340 ? LEU A 340  . ? 1_555 ? 
397  DC4 15 MET A  429 ? MET A 429  . ? 1_555 ? 
398  DC4 15 CLA HB .   ? CLA A 1119 . ? 1_555 ? 
399  DC4 15 CLA ZB .   ? CLA A 1121 . ? 1_555 ? 
400  DC4 15 CLA JB .   ? CLA A 1123 . ? 1_555 ? 
401  DC4 15 CLA AC .   ? CLA A 1129 . ? 1_555 ? 
402  DC4 15 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
403  DC4 15 CLA EA .   ? CLA A 1801 . ? 1_555 ? 
404  DC4 15 BCR KA .   ? BCR A 4007 . ? 1_555 ? 
405  DC4 15 LHG NA .   ? LHG A 5003 . ? 1_555 ? 
406  DC5 19 PHE A  190 ? PHE A 190  . ? 1_555 ? 
407  DC5 19 VAL A  193 ? VAL A 193  . ? 1_555 ? 
408  DC5 19 MET A  196 ? MET A 196  . ? 1_555 ? 
409  DC5 19 MET A  197 ? MET A 197  . ? 1_555 ? 
410  DC5 19 HIS A  200 ? HIS A 200  . ? 1_555 ? 
411  DC5 19 MET A  321 ? MET A 321  . ? 1_555 ? 
412  DC5 19 LEU A  344 ? LEU A 344  . ? 1_555 ? 
413  DC5 19 THR A  345 ? THR A 345  . ? 1_555 ? 
414  DC5 19 THR A  346 ? THR A 346  . ? 1_555 ? 
415  DC5 19 TRP A  348 ? TRP A 348  . ? 1_555 ? 
416  DC5 19 ILE A  354 ? ILE A 354  . ? 1_555 ? 
417  DC5 19 ASN A  355 ? ASN A 355  . ? 1_555 ? 
418  DC5 19 LEU A  358 ? LEU A 358  . ? 1_555 ? 
419  DC5 19 CLA SA .   ? CLA A 1103 . ? 1_555 ? 
420  DC5 19 CLA AB .   ? CLA A 1111 . ? 1_555 ? 
421  DC5 19 CLA HB .   ? CLA A 1119 . ? 1_555 ? 
422  DC5 19 CLA IB .   ? CLA A 1122 . ? 1_555 ? 
423  DC5 19 CLA NB .   ? CLA A 1127 . ? 1_555 ? 
424  DC5 19 BCR KA .   ? BCR A 4007 . ? 1_555 ? 
425  DC6 11 ILE A  364 ? ILE A 364  . ? 1_555 ? 
426  DC6 11 ILE A  365 ? ILE A 365  . ? 1_555 ? 
427  DC6 11 GLN A  368 ? GLN A 368  . ? 1_555 ? 
428  DC6 11 ILE A  401 ? ILE A 401  . ? 1_555 ? 
429  DC6 11 ILE A  542 ? ILE A 542  . ? 1_555 ? 
430  DC6 11 SER A  601 ? SER A 601  . ? 1_555 ? 
431  DC6 11 CLA HB .   ? CLA A 1119 . ? 1_555 ? 
432  DC6 11 CLA LB .   ? CLA A 1125 . ? 1_555 ? 
433  DC6 11 CLA EC .   ? CLA A 1135 . ? 1_555 ? 
434  DC6 11 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
435  DC6 11 BCR LA .   ? BCR A 4008 . ? 1_555 ? 
436  DC7 13 LEU A  358 ? LEU A 358  . ? 1_555 ? 
437  DC7 13 ILE A  365 ? ILE A 365  . ? 1_555 ? 
438  DC7 13 HIS A  369 ? HIS A 369  . ? 1_555 ? 
439  DC7 13 TYR A  371 ? TYR A 371  . ? 1_555 ? 
440  DC7 13 ALA A  372 ? ALA A 372  . ? 1_555 ? 
441  DC7 13 MET A  373 ? MET A 373  . ? 1_555 ? 
442  DC7 13 SER A  506 ? SER A 506  . ? 1_555 ? 
443  DC7 13 PHE A  509 ? PHE A 509  . ? 1_555 ? 
444  DC7 13 CLA EB .   ? CLA A 1116 . ? 1_555 ? 
445  DC7 13 CLA KB .   ? CLA A 1124 . ? 1_555 ? 
446  DC7 13 CLA CC .   ? CLA A 1133 . ? 1_555 ? 
447  DC7 13 CLA EC .   ? CLA A 1135 . ? 1_555 ? 
448  DC7 13 BCR LA .   ? BCR A 4008 . ? 1_555 ? 
449  DC8 14 TRP A  86  ? TRP A 86   . ? 1_555 ? 
450  DC8 14 MET A  90  ? MET A 90   . ? 1_555 ? 
451  DC8 14 SER A  141 ? SER A 141  . ? 1_555 ? 
452  DC8 14 SER A  388 ? SER A 388  . ? 1_555 ? 
453  DC8 14 THR A  391 ? THR A 391  . ? 1_555 ? 
454  DC8 14 HIS A  392 ? HIS A 392  . ? 1_555 ? 
455  DC8 14 TRP A  395 ? TRP A 395  . ? 1_555 ? 
456  DC8 14 ILE A  736 ? ILE A 736  . ? 1_555 ? 
457  DC8 14 CLA WB .   ? CLA A 1012 . ? 1_555 ? 
458  DC8 14 CLA QA .   ? CLA A 1101 . ? 1_555 ? 
459  DC8 14 CLA VA .   ? CLA A 1106 . ? 1_555 ? 
460  DC8 14 CLA WA .   ? CLA A 1107 . ? 1_555 ? 
461  DC8 14 CLA NB .   ? CLA A 1127 . ? 1_555 ? 
462  DC8 14 BCR MC .   ? BCR B 4011 . ? 1_555 ? 
463  DC9 16 LEU A  87  ? LEU A 87   . ? 1_555 ? 
464  DC9 16 SER A  141 ? SER A 141  . ? 1_555 ? 
465  DC9 16 GLY A  142 ? GLY A 142  . ? 1_555 ? 
466  DC9 16 LEU A  146 ? LEU A 146  . ? 1_555 ? 
467  DC9 16 THR A  363 ? THR A 363  . ? 1_555 ? 
468  DC9 16 MET A  370 ? MET A 370  . ? 1_555 ? 
469  DC9 16 TYR A  376 ? TYR A 376  . ? 1_555 ? 
470  DC9 16 LEU A  389 ? LEU A 389  . ? 1_555 ? 
471  DC9 16 HIS A  392 ? HIS A 392  . ? 1_555 ? 
472  DC9 16 HIS A  393 ? HIS A 393  . ? 1_555 ? 
473  DC9 16 ILE A  396 ? ILE A 396  . ? 1_555 ? 
474  DC9 16 CLA TA .   ? CLA A 1104 . ? 1_555 ? 
475  DC9 16 CLA FB .   ? CLA A 1117 . ? 1_555 ? 
476  DC9 16 CLA JB .   ? CLA A 1123 . ? 1_555 ? 
477  DC9 16 CLA MB .   ? CLA A 1126 . ? 1_555 ? 
478  DC9 16 BCR JA .   ? BCR A 4003 . ? 1_555 ? 
479  EC1 16 HIS A  52  ? HIS A 52   . ? 1_555 ? 
480  EC1 16 ALA A  53  ? ALA A 53   . ? 1_555 ? 
481  EC1 16 ASP A  57  ? ASP A 57   . ? 1_555 ? 
482  EC1 16 LEU A  356 ? LEU A 356  . ? 1_555 ? 
483  EC1 16 PHE A  399 ? PHE A 399  . ? 1_555 ? 
484  EC1 16 LEU A  400 ? LEU A 400  . ? 1_555 ? 
485  EC1 16 GLY A  403 ? GLY A 403  . ? 1_555 ? 
486  EC1 16 HIS A  407 ? HIS A 407  . ? 1_555 ? 
487  EC1 16 ILE A  410 ? ILE A 410  . ? 1_555 ? 
488  EC1 16 PHE A  570 ? PHE A 570  . ? 1_555 ? 
489  EC1 16 ARG A  571 ? ARG A 571  . ? 1_555 ? 
490  EC1 16 TRP A  588 ? TRP A 588  . ? 1_555 ? 
491  EC1 16 CLA SA .   ? CLA A 1103 . ? 1_555 ? 
492  EC1 16 CLA TA .   ? CLA A 1104 . ? 1_555 ? 
493  EC1 16 CLA UB .   ? CLA A 1140 . ? 1_555 ? 
494  EC1 16 LHG MA .   ? LHG A 5001 . ? 1_555 ? 
495  EC2 10 HIS A  439 ? HIS A 439  . ? 1_555 ? 
496  EC2 10 TRP A  442 ? TRP A 442  . ? 1_555 ? 
497  EC2 10 CLA AC .   ? CLA A 1129 . ? 1_555 ? 
498  EC2 10 ALA B  678 ? ALA B 678  . ? 1_555 ? 
499  EC2 10 THR B  682 ? THR B 682  . ? 1_555 ? 
500  EC2 10 PRO B  683 ? PRO B 683  . ? 1_555 ? 
501  EC2 10 HIS G  19  ? HIS L 19   . ? 1_555 ? 
502  EC2 10 LEU G  20  ? LEU L 20   . ? 1_555 ? 
503  EC2 10 THR G  22  ? THR L 22   . ? 1_555 ? 
504  EC2 10 ILE G  24  ? ILE L 24   . ? 1_555 ? 
505  EC3 13 TRP A  442 ? TRP A 442  . ? 1_555 ? 
506  EC3 13 ILE A  445 ? ILE A 445  . ? 1_555 ? 
507  EC3 13 PHE A  446 ? PHE A 446  . ? 1_555 ? 
508  EC3 13 PHE A  449 ? PHE A 449  . ? 1_555 ? 
509  EC3 13 HIS A  450 ? HIS A 450  . ? 1_555 ? 
510  EC3 13 CLA BC .   ? CLA A 1132 . ? 1_555 ? 
511  EC3 13 CLA FC .   ? CLA A 1136 . ? 1_555 ? 
512  EC3 13 CLA OA .   ? CLA A 1237 . ? 1_555 ? 
513  EC3 13 CLA TC .   ? CLA B 1023 . ? 1_555 ? 
514  EC3 13 CLA EE .   ? CLA B 1238 . ? 1_555 ? 
515  EC3 13 PQN GC .   ? PQN B 2002 . ? 1_555 ? 
516  EC3 13 BCR IE .   ? BCR F 4018 . ? 1_555 ? 
517  EC3 13 BCR JE .   ? BCR F 4020 . ? 1_555 ? 
518  EC4 13 ILE A  436 ? ILE A 436  . ? 1_555 ? 
519  EC4 13 LEU A  440 ? LEU A 440  . ? 1_555 ? 
520  EC4 13 VAL A  443 ? VAL A 443  . ? 1_555 ? 
521  EC4 13 ALA A  539 ? ALA A 539  . ? 1_555 ? 
522  EC4 13 HIS A  543 ? HIS A 543  . ? 1_555 ? 
523  EC4 13 CLA IB .   ? CLA A 1122 . ? 1_555 ? 
524  EC4 13 CLA KB .   ? CLA A 1124 . ? 1_555 ? 
525  EC4 13 CLA AC .   ? CLA A 1129 . ? 1_555 ? 
526  EC4 13 CLA EC .   ? CLA A 1135 . ? 1_555 ? 
527  EC4 13 CLA FC .   ? CLA A 1136 . ? 1_555 ? 
528  EC4 13 BCR KA .   ? BCR A 4007 . ? 1_555 ? 
529  EC4 13 BCR LA .   ? BCR A 4008 . ? 1_555 ? 
530  EC4 13 LHG NA .   ? LHG A 5003 . ? 1_555 ? 
531  EC5 12 ILE A  700 ? ILE A 700  . ? 1_555 ? 
532  EC5 12 HIS A  704 ? HIS A 704  . ? 1_555 ? 
533  EC5 12 LEU A  707 ? LEU A 707  . ? 1_555 ? 
534  EC5 12 CLA QA .   ? CLA A 1101 . ? 1_555 ? 
535  EC5 12 CLA TB .   ? CLA A 1139 . ? 1_555 ? 
536  EC5 12 PQN FA .   ? PQN A 2001 . ? 1_555 ? 
537  EC5 12 SER B  418 ? SER B 418  . ? 1_555 ? 
538  EC5 12 SER B  421 ? SER B 421  . ? 1_555 ? 
539  EC5 12 TRP B  422 ? TRP B 422  . ? 1_555 ? 
540  EC5 12 CLA UD .   ? CLA B 1229 . ? 1_555 ? 
541  EC5 12 BCR NC .   ? BCR B 4014 . ? 1_555 ? 
542  EC5 12 GLY F  62  ? GLY F 62   . ? 1_555 ? 
543  EC6 11 THR A  45  ? THR A 45   . ? 1_555 ? 
544  EC6 11 ILE A  48  ? ILE A 48   . ? 1_555 ? 
545  EC6 11 TRP A  49  ? TRP A 49   . ? 1_555 ? 
546  EC6 11 HIS A  704 ? HIS A 704  . ? 1_555 ? 
547  EC6 11 VAL A  709 ? VAL A 709  . ? 1_555 ? 
548  EC6 11 PRO A  711 ? PRO A 711  . ? 1_555 ? 
549  EC6 11 PRO A  715 ? PRO A 715  . ? 1_555 ? 
550  EC6 11 ARG A  716 ? ARG A 716  . ? 1_555 ? 
551  EC6 11 CLA QA .   ? CLA A 1101 . ? 1_555 ? 
552  EC6 11 CLA SB .   ? CLA A 1138 . ? 1_555 ? 
553  EC6 11 ILE F  85  ? ILE F 85   . ? 1_555 ? 
554  EC7 18 TRP A  49  ? TRP A 49   . ? 1_555 ? 
555  EC7 18 VAL A  678 ? VAL A 678  . ? 1_555 ? 
556  EC7 18 PHE A  681 ? PHE A 681  . ? 1_555 ? 
557  EC7 18 GLN A  722 ? GLN A 722  . ? 1_555 ? 
558  EC7 18 ALA A  725 ? ALA A 725  . ? 1_555 ? 
559  EC7 18 VAL A  726 ? VAL A 726  . ? 1_555 ? 
560  EC7 18 ALA A  729 ? ALA A 729  . ? 1_555 ? 
561  EC7 18 HIS A  730 ? HIS A 730  . ? 1_555 ? 
562  EC7 18 LEU A  733 ? LEU A 733  . ? 1_555 ? 
563  EC7 18 CLA QA .   ? CLA A 1101 . ? 1_555 ? 
564  EC7 18 CLA VA .   ? CLA A 1106 . ? 1_555 ? 
565  EC7 18 CLA OB .   ? CLA A 1128 . ? 1_555 ? 
566  EC7 18 PQN FA .   ? PQN A 2001 . ? 1_555 ? 
567  EC7 18 LHG MA .   ? LHG A 5001 . ? 1_555 ? 
568  EC7 18 CLA RC .   ? CLA B 1013 . ? 1_555 ? 
569  EC7 18 BCR MC .   ? BCR B 4011 . ? 1_555 ? 
570  EC7 18 ILE F  15  ? ILE F 15   . ? 1_555 ? 
571  EC7 18 BCR KE .   ? BCR F 4013 . ? 1_555 ? 
572  EC8 23 TYR A  455 ? TYR A 455  . ? 1_555 ? 
573  EC8 23 THR A  541 ? THR A 541  . ? 1_555 ? 
574  EC8 23 TYR A  599 ? TYR A 599  . ? 1_555 ? 
575  EC8 23 ASN A  600 ? ASN A 600  . ? 1_555 ? 
576  EC8 23 SER A  603 ? SER A 603  . ? 1_555 ? 
577  EC8 23 PHE A  607 ? PHE A 607  . ? 1_555 ? 
578  EC8 23 ILE A  642 ? ILE A 642  . ? 1_555 ? 
579  EC8 23 LEU A  650 ? LEU A 650  . ? 1_555 ? 
580  EC8 23 ALA A  654 ? ALA A 654  . ? 1_555 ? 
581  EC8 23 ILE A  658 ? ILE A 658  . ? 1_555 ? 
582  EC8 23 PHE A  672 ? PHE A 672  . ? 1_555 ? 
583  EC8 23 HIS A  676 ? HIS A 676  . ? 1_555 ? 
584  EC8 23 PHE A  679 ? PHE A 679  . ? 1_555 ? 
585  EC8 23 TYR A  731 ? TYR A 731  . ? 1_555 ? 
586  EC8 23 GLY A  735 ? GLY A 735  . ? 1_555 ? 
587  EC8 23 THR A  738 ? THR A 738  . ? 1_555 ? 
588  EC8 23 THR A  739 ? THR A 739  . ? 1_555 ? 
589  EC8 23 PHE A  742 ? PHE A 742  . ? 1_555 ? 
590  EC8 23 CLA WB .   ? CLA A 1012 . ? 1_555 ? 
591  EC8 23 CLA PA .   ? CLA A 1022 . ? 1_555 ? 
592  EC8 23 PHE B  617 ? PHE B 617  . ? 1_555 ? 
593  EC8 23 TRP B  622 ? TRP B 622  . ? 1_555 ? 
594  EC8 23 CLA SC .   ? CLA B 1021 . ? 1_555 ? 
595  EC9 18 ILE A  670 ? ILE A 670  . ? 1_555 ? 
596  EC9 18 MET A  671 ? MET A 671  . ? 1_555 ? 
597  EC9 18 LEU A  673 ? LEU A 673  . ? 1_555 ? 
598  EC9 18 HIS A  676 ? HIS A 676  . ? 1_555 ? 
599  EC9 18 PHE A  677 ? PHE A 677  . ? 1_555 ? 
600  EC9 18 ALA A  680 ? ALA A 680  . ? 1_555 ? 
601  EC9 18 CLA VB .   ? CLA A 1011 . ? 1_555 ? 
602  EC9 18 CLA QA .   ? CLA A 1101 . ? 1_555 ? 
603  EC9 18 CLA MB .   ? CLA A 1126 . ? 1_555 ? 
604  EC9 18 PHE B  578 ? PHE B 578  . ? 1_555 ? 
605  EC9 18 TRP B  579 ? TRP B 579  . ? 1_555 ? 
606  EC9 18 ASN B  582 ? ASN B 582  . ? 1_555 ? 
607  EC9 18 LEU B  613 ? LEU B 613  . ? 1_555 ? 
608  EC9 18 PHE B  617 ? PHE B 617  . ? 1_555 ? 
609  EC9 18 PHE B  710 ? PHE B 710  . ? 1_555 ? 
610  EC9 18 CLA RC .   ? CLA B 1013 . ? 1_555 ? 
611  EC9 18 CLA SC .   ? CLA B 1021 . ? 1_555 ? 
612  EC9 18 BCR MC .   ? BCR B 4011 . ? 1_555 ? 
613  FC1 4  HIS A  240 ? HIS A 240  . ? 1_555 ? 
614  FC1 4  LEU A  244 ? LEU A 244  . ? 1_555 ? 
615  FC1 4  CLA BB .   ? CLA A 1112 . ? 1_555 ? 
616  FC1 4  BCR IA .   ? BCR A 4002 . ? 1_555 ? 
617  FC2 11 ILE A  306 ? ILE A 306  . ? 1_555 ? 
618  FC2 11 HIS A  309 ? HIS A 309  . ? 1_555 ? 
619  FC2 11 MET A  310 ? MET A 310  . ? 1_555 ? 
620  FC2 11 GLY A  318 ? GLY A 318  . ? 1_555 ? 
621  FC2 11 HIS A  319 ? HIS A 319  . ? 1_555 ? 
622  FC2 11 CLA HB .   ? CLA A 1119 . ? 1_555 ? 
623  FC2 11 CLA ZB .   ? CLA A 1121 . ? 1_555 ? 
624  FC2 11 BCR HA .   ? BCR A 4001 . ? 1_555 ? 
625  FC2 11 PHE AA 72  ? PHE K 72   . ? 1_555 ? 
626  FC2 11 PHE AA 77  ? PHE K 77   . ? 1_555 ? 
627  FC2 11 ALA AA 78  ? ALA K 78   . ? 1_555 ? 
628  FC3 8  HIS A  319 ? HIS A 319  . ? 1_555 ? 
629  FC3 8  ILE A  324 ? ILE A 324  . ? 1_555 ? 
630  FC3 8  ALA A  327 ? ALA A 327  . ? 1_555 ? 
631  FC3 8  HIS A  328 ? HIS A 328  . ? 1_555 ? 
632  FC3 8  CLA HB .   ? CLA A 1119 . ? 1_555 ? 
633  FC3 8  CLA YB .   ? CLA A 1120 . ? 1_555 ? 
634  FC3 8  CLA IB .   ? CLA A 1122 . ? 1_555 ? 
635  FC3 8  CLA EA .   ? CLA A 1801 . ? 1_555 ? 
636  FC4 12 PHE A  332 ? PHE A 332  . ? 1_555 ? 
637  FC4 12 THR A  333 ? THR A 333  . ? 1_555 ? 
638  FC4 12 LEU A  425 ? LEU A 425  . ? 1_555 ? 
639  FC4 12 ARG A  428 ? ARG A 428  . ? 1_555 ? 
640  FC4 12 HIS A  432 ? HIS A 432  . ? 1_555 ? 
641  FC4 12 HIS A  439 ? HIS A 439  . ? 1_555 ? 
642  FC4 12 CLA IB .   ? CLA A 1122 . ? 1_555 ? 
643  FC4 12 CLA PB .   ? CLA A 1130 . ? 1_555 ? 
644  FC4 12 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
645  FC4 12 LHG NA .   ? LHG A 5003 . ? 1_555 ? 
646  FC4 12 VAL G  8   ? VAL L 8    . ? 1_555 ? 
647  FC4 12 PRO G  23  ? PRO L 23   . ? 1_555 ? 
648  FC5 20 PHE A  449 ? PHE A 449  . ? 1_555 ? 
649  FC5 20 GLY A  453 ? GLY A 453  . ? 1_555 ? 
650  FC5 20 LEU A  454 ? LEU A 454  . ? 1_555 ? 
651  FC5 20 ILE A  456 ? ILE A 456  . ? 1_555 ? 
652  FC5 20 HIS A  457 ? HIS A 457  . ? 1_555 ? 
653  FC5 20 THR A  460 ? THR A 460  . ? 1_555 ? 
654  FC5 20 MET A  461 ? MET A 461  . ? 1_555 ? 
655  FC5 20 ARG A  466 ? ARG A 466  . ? 1_555 ? 
656  FC5 20 ASP A  469 ? ASP A 469  . ? 1_555 ? 
657  FC5 20 CLA QB .   ? CLA A 1131 . ? 1_555 ? 
658  FC5 20 HIS B  95  ? HIS B 95   . ? 1_555 ? 
659  FC5 20 CLA CE .   ? CLA B 1206 . ? 1_555 ? 
660  FC5 20 CLA ZC .   ? CLA B 1207 . ? 1_555 ? 
661  FC5 20 BCR JE .   ? BCR F 4020 . ? 1_555 ? 
662  FC5 20 PRO G  64  ? PRO L 64   . ? 1_555 ? 
663  FC5 20 TRP G  65  ? TRP L 65   . ? 1_555 ? 
664  FC5 20 LEU G  68  ? LEU L 68   . ? 1_555 ? 
665  FC5 20 PRO G  70  ? PRO L 70   . ? 1_555 ? 
666  FC5 20 CLA NE .   ? CLA L 1503 . ? 1_555 ? 
667  FC5 20 BCR PE .   ? BCR L 4022 . ? 1_555 ? 
668  FC6 8  HIS A  490 ? HIS A 490  . ? 1_555 ? 
669  FC6 8  ALA A  493 ? ALA A 493  . ? 1_555 ? 
670  FC6 8  THR A  497 ? THR A 497  . ? 1_555 ? 
671  FC6 8  CLA EB .   ? CLA A 1116 . ? 1_555 ? 
672  FC6 8  CLA LB .   ? CLA A 1125 . ? 1_555 ? 
673  FC6 8  CLA DC .   ? CLA A 1134 . ? 1_555 ? 
674  FC6 8  CLA EC .   ? CLA A 1135 . ? 1_555 ? 
675  FC6 8  BCR LA .   ? BCR A 4008 . ? 1_555 ? 
676  FC7 8  PHE A  277 ? PHE A 277  . ? 1_555 ? 
677  FC7 8  THR A  497 ? THR A 497  . ? 1_555 ? 
678  FC7 8  PRO A  499 ? PRO A 499  . ? 1_555 ? 
679  FC7 8  ASN A  500 ? ASN A 500  . ? 1_555 ? 
680  FC7 8  CLA DB .   ? CLA A 1115 . ? 1_555 ? 
681  FC7 8  CLA EB .   ? CLA A 1116 . ? 1_555 ? 
682  FC7 8  CLA CC .   ? CLA A 1133 . ? 1_555 ? 
683  FC7 8  CLA RN .   ? CLA K 1401 . ? 1_555 ? 
684  FC8 16 GLN A  368 ? GLN A 368  . ? 1_555 ? 
685  FC8 16 TYR A  371 ? TYR A 371  . ? 1_555 ? 
686  FC8 16 VAL A  486 ? VAL A 486  . ? 1_555 ? 
687  FC8 16 GLN A  487 ? GLN A 487  . ? 1_555 ? 
688  FC8 16 PHE A  509 ? PHE A 509  . ? 1_555 ? 
689  FC8 16 ILE A  525 ? ILE A 525  . ? 1_555 ? 
690  FC8 16 HIS A  535 ? HIS A 535  . ? 1_555 ? 
691  FC8 16 HIS A  538 ? HIS A 538  . ? 1_555 ? 
692  FC8 16 VAL A  605 ? VAL A 605  . ? 1_555 ? 
693  FC8 16 HIS A  608 ? HIS A 608  . ? 1_555 ? 
694  FC8 16 PHE A  609 ? PHE A 609  . ? 1_555 ? 
695  FC8 16 CLA KB .   ? CLA A 1124 . ? 1_555 ? 
696  FC8 16 CLA LB .   ? CLA A 1125 . ? 1_555 ? 
697  FC8 16 CLA CC .   ? CLA A 1133 . ? 1_555 ? 
698  FC8 16 CLA FC .   ? CLA A 1136 . ? 1_555 ? 
699  FC8 16 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
700  FC9 13 PHE A  446 ? PHE A 446  . ? 1_555 ? 
701  FC9 13 LEU A  447 ? LEU A 447  . ? 1_555 ? 
702  FC9 13 GLN A  479 ? GLN A 479  . ? 1_555 ? 
703  FC9 13 PRO A  480 ? PRO A 480  . ? 1_555 ? 
704  FC9 13 ILE A  481 ? ILE A 481  . ? 1_555 ? 
705  FC9 13 PHE A  482 ? PHE A 482  . ? 1_555 ? 
706  FC9 13 ALA A  483 ? ALA A 483  . ? 1_555 ? 
707  FC9 13 HIS A  535 ? HIS A 535  . ? 1_555 ? 
708  FC9 13 HIS A  536 ? HIS A 536  . ? 1_555 ? 
709  FC9 13 CLA QB .   ? CLA A 1131 . ? 1_555 ? 
710  FC9 13 CLA EC .   ? CLA A 1135 . ? 1_555 ? 
711  FC9 13 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
712  FC9 13 LHG NA .   ? LHG A 5003 . ? 1_555 ? 
713  GC1 13 CLA QB .   ? CLA A 1131 . ? 1_555 ? 
714  GC1 13 MET B  659 ? MET B 659  . ? 1_555 ? 
715  GC1 13 PHE B  660 ? PHE B 660  . ? 1_555 ? 
716  GC1 13 SER B  663 ? SER B 663  . ? 1_555 ? 
717  GC1 13 TRP B  664 ? TRP B 664  . ? 1_555 ? 
718  GC1 13 ARG B  665 ? ARG B 665  . ? 1_555 ? 
719  GC1 13 TRP B  668 ? TRP B 668  . ? 1_555 ? 
720  GC1 13 ALA B  696 ? ALA B 696  . ? 1_555 ? 
721  GC1 13 LEU B  697 ? LEU B 697  . ? 1_555 ? 
722  GC1 13 ALA B  702 ? ALA B 702  . ? 1_555 ? 
723  GC1 13 CLA FE .   ? CLA B 1239 . ? 1_555 ? 
724  GC1 13 LMG PC .   ? LMG B 5002 . ? 1_555 ? 
725  GC1 13 BCR OE .   ? BCR L 4019 . ? 1_555 ? 
726  GC2 8  LEU B  188 ? LEU B 188  . ? 1_555 ? 
727  GC2 8  PHE B  225 ? PHE B 225  . ? 1_555 ? 
728  GC2 8  ILE B  285 ? ILE B 285  . ? 1_555 ? 
729  GC2 8  HIS B  289 ? HIS B 289  . ? 1_555 ? 
730  GC2 8  ILE B  297 ? ILE B 297  . ? 1_555 ? 
731  GC2 8  CLA DD .   ? CLA B 1212 . ? 1_555 ? 
732  GC2 8  CLA ID .   ? CLA B 1217 . ? 1_555 ? 
733  GC2 8  CLA JD .   ? CLA B 1218 . ? 1_555 ? 
734  GC3 7  PHE B  58  ? PHE B 58   . ? 1_555 ? 
735  GC3 7  PHE B  149 ? PHE B 149  . ? 1_555 ? 
736  GC3 7  SER B  186 ? SER B 186  . ? 1_555 ? 
737  GC3 7  CLA VC .   ? CLA B 1202 . ? 1_555 ? 
738  GC3 7  CLA BD .   ? CLA B 1209 . ? 1_555 ? 
739  GC3 7  CLA CD .   ? CLA B 1210 . ? 1_555 ? 
740  GC3 7  CLA QD .   ? CLA B 1225 . ? 1_555 ? 
741  GC4 6  TRP B  123 ? TRP B 123  . ? 1_555 ? 
742  GC4 6  MET B  129 ? MET B 129  . ? 1_555 ? 
743  GC4 6  PHE B  141 ? PHE B 141  . ? 1_555 ? 
744  GC4 6  CLA DE .   ? CLA B 1211 . ? 1_555 ? 
745  GC4 6  CLA DD .   ? CLA B 1212 . ? 1_555 ? 
746  GC4 6  CLA QD .   ? CLA B 1225 . ? 1_555 ? 
747  GC5 7  MET B  409 ? MET B 409  . ? 1_555 ? 
748  GC5 7  LEU B  416 ? LEU B 416  . ? 1_555 ? 
749  GC5 7  CLA LD .   ? CLA B 1220 . ? 1_555 ? 
750  GC5 7  CLA OD .   ? CLA B 1223 . ? 1_555 ? 
751  GC5 7  CLA SD .   ? CLA B 1227 . ? 1_555 ? 
752  GC5 7  BCR LC .   ? BCR B 4010 . ? 1_555 ? 
753  GC5 7  LHG QC .   ? LHG B 5004 . ? 1_555 ? 
754  GC6 12 ALA B  337 ? ALA B 337  . ? 1_555 ? 
755  GC6 12 MET B  381 ? MET B 381  . ? 1_555 ? 
756  GC6 12 ALA B  384 ? ALA B 384  . ? 1_555 ? 
757  GC6 12 PHE B  385 ? PHE B 385  . ? 1_555 ? 
758  GC6 12 GLY B  388 ? GLY B 388  . ? 1_555 ? 
759  GC6 12 PHE B  392 ? PHE B 392  . ? 1_555 ? 
760  GC6 12 CLA ND .   ? CLA B 1222 . ? 1_555 ? 
761  GC6 12 CLA OD .   ? CLA B 1223 . ? 1_555 ? 
762  GC6 12 CLA XD .   ? CLA B 1232 . ? 1_555 ? 
763  GC6 12 CLA YD .   ? CLA B 1234 . ? 1_555 ? 
764  GC6 12 CLA AE .   ? CLA B 1236 . ? 1_555 ? 
765  GC6 12 BCR KC .   ? BCR B 4009 . ? 1_555 ? 
766  GC7 11 ALA A  674 ? ALA A 674  . ? 1_555 ? 
767  GC7 11 PHE A  677 ? PHE A 677  . ? 1_555 ? 
768  GC7 11 VAL A  737 ? VAL A 737  . ? 1_555 ? 
769  GC7 11 TRP A  740 ? TRP A 740  . ? 1_555 ? 
770  GC7 11 CLA WB .   ? CLA A 1012 . ? 1_555 ? 
771  GC7 11 CLA VA .   ? CLA A 1106 . ? 1_555 ? 
772  GC7 11 CLA MB .   ? CLA A 1126 . ? 1_555 ? 
773  GC7 11 CLA UB .   ? CLA A 1140 . ? 1_555 ? 
774  GC7 11 CLA RC .   ? CLA B 1013 . ? 1_555 ? 
775  GC7 11 CLA UD .   ? CLA B 1229 . ? 1_555 ? 
776  GC7 11 CLA VD .   ? CLA B 1230 . ? 1_555 ? 
777  GC8 7  CLA QA .   ? CLA A 1101 . ? 1_555 ? 
778  GC8 7  CLA SB .   ? CLA A 1138 . ? 1_555 ? 
779  GC8 7  CLA RC .   ? CLA B 1013 . ? 1_555 ? 
780  GC8 7  CLA UD .   ? CLA B 1229 . ? 1_555 ? 
781  GC8 7  CLA VD .   ? CLA B 1230 . ? 1_555 ? 
782  GC8 7  ILE F  53  ? ILE F 53   . ? 1_555 ? 
783  GC8 7  PHE F  54  ? PHE F 54   . ? 1_555 ? 
784  GC9 11 CLA PA .   ? CLA A 1022 . ? 1_555 ? 
785  GC9 11 CLA OA .   ? CLA A 1237 . ? 1_555 ? 
786  GC9 11 TRP B  645 ? TRP B 645  . ? 1_555 ? 
787  GC9 11 MET B  646 ? MET B 646  . ? 1_555 ? 
788  GC9 11 PHE B  649 ? PHE B 649  . ? 1_555 ? 
789  GC9 11 ILE B  672 ? ILE B 672  . ? 1_555 ? 
790  GC9 11 ILE B  675 ? ILE B 675  . ? 1_555 ? 
791  GC9 11 CLA TC .   ? CLA B 1023 . ? 1_555 ? 
792  GC9 11 CLA YC .   ? CLA B 1205 . ? 1_555 ? 
793  GC9 11 CLA CE .   ? CLA B 1206 . ? 1_555 ? 
794  GC9 11 CLA FE .   ? CLA B 1239 . ? 1_555 ? 
795  HC1 15 TYR B  23  ? TYR B 23   . ? 1_555 ? 
796  HC1 15 ALA B  26  ? ALA B 26   . ? 1_555 ? 
797  HC1 15 SER B  553 ? SER B 553  . ? 1_555 ? 
798  HC1 15 TRP B  570 ? TRP B 570  . ? 1_555 ? 
799  HC1 15 GLN B  701 ? GLN B 701  . ? 1_555 ? 
800  HC1 15 LEU B  704 ? LEU B 704  . ? 1_555 ? 
801  HC1 15 ALA B  708 ? ALA B 708  . ? 1_555 ? 
802  HC1 15 THR B  711 ? THR B 711  . ? 1_555 ? 
803  HC1 15 CLA UC .   ? CLA B 1201 . ? 1_555 ? 
804  HC1 15 CLA WC .   ? CLA B 1203 . ? 1_555 ? 
805  HC1 15 CLA XC .   ? CLA B 1204 . ? 1_555 ? 
806  HC1 15 CLA PD .   ? CLA B 1224 . ? 1_555 ? 
807  HC1 15 CLA RD .   ? CLA B 1226 . ? 1_555 ? 
808  HC1 15 CLA FE .   ? CLA B 1239 . ? 1_555 ? 
809  HC1 15 PQN GC .   ? PQN B 2002 . ? 1_555 ? 
810  HC2 15 HIS B  308 ? HIS B 308  . ? 1_555 ? 
811  HC2 15 LYS B  309 ? LYS B 309  . ? 1_555 ? 
812  HC2 15 GLY B  310 ? GLY B 310  . ? 1_555 ? 
813  HC2 15 PRO B  311 ? PRO B 311  . ? 1_555 ? 
814  HC2 15 LEU B  312 ? LEU B 312  . ? 1_555 ? 
815  HC2 15 THR B  313 ? THR B 313  . ? 1_555 ? 
816  HC2 15 HIS B  317 ? HIS B 317  . ? 1_555 ? 
817  HC2 15 VAL B  405 ? VAL B 405  . ? 1_555 ? 
818  HC2 15 CLA LD .   ? CLA B 1220 . ? 1_555 ? 
819  HC2 15 CLA ND .   ? CLA B 1222 . ? 1_555 ? 
820  HC2 15 CLA OD .   ? CLA B 1223 . ? 1_555 ? 
821  HC2 15 CLA SD .   ? CLA B 1227 . ? 1_555 ? 
822  HC2 15 CLA AE .   ? CLA B 1236 . ? 1_555 ? 
823  HC2 15 CLA BE .   ? CLA B 1240 . ? 1_555 ? 
824  HC2 15 BCR KC .   ? BCR B 4009 . ? 1_555 ? 
825  HC3 25 PHE A  677 ? PHE A 677  . ? 1_555 ? 
826  HC3 25 ALA A  680 ? ALA A 680  . ? 1_555 ? 
827  HC3 25 PHE A  681 ? PHE A 681  . ? 1_555 ? 
828  HC3 25 LEU A  683 ? LEU A 683  . ? 1_555 ? 
829  HC3 25 MET A  684 ? MET A 684  . ? 1_555 ? 
830  HC3 25 PHE A  687 ? PHE A 687  . ? 1_555 ? 
831  HC3 25 TYR A  692 ? TYR A 692  . ? 1_555 ? 
832  HC3 25 TRP A  693 ? TRP A 693  . ? 1_555 ? 
833  HC3 25 LEU A  696 ? LEU A 696  . ? 1_555 ? 
834  HC3 25 CLA WB .   ? CLA A 1012 . ? 1_555 ? 
835  HC3 25 CLA QA .   ? CLA A 1101 . ? 1_555 ? 
836  HC3 25 CLA UB .   ? CLA A 1140 . ? 1_555 ? 
837  HC3 25 PQN FA .   ? PQN A 2001 . ? 1_555 ? 
838  HC3 25 SER B  421 ? SER B 421  . ? 1_555 ? 
839  HC3 25 SER B  424 ? SER B 424  . ? 1_555 ? 
840  HC3 25 LEU B  425 ? LEU B 425  . ? 1_555 ? 
841  HC3 25 GLY B  428 ? GLY B 428  . ? 1_555 ? 
842  HC3 25 PHE B  429 ? PHE B 429  . ? 1_555 ? 
843  HC3 25 LEU B  522 ? LEU B 522  . ? 1_555 ? 
844  HC3 25 LEU B  529 ? LEU B 529  . ? 1_555 ? 
845  HC3 25 ILE B  530 ? ILE B 530  . ? 1_555 ? 
846  HC3 25 LEU B  575 ? LEU B 575  . ? 1_555 ? 
847  HC3 25 TRP B  579 ? TRP B 579  . ? 1_555 ? 
848  HC3 25 BCR MC .   ? BCR B 4011 . ? 1_555 ? 
849  HC3 25 BCR NC .   ? BCR B 4014 . ? 1_555 ? 
850  HC4 21 TRP A  651 ? TRP A 651  . ? 1_555 ? 
851  HC4 21 CLA VB .   ? CLA A 1011 . ? 1_555 ? 
852  HC4 21 CLA WB .   ? CLA A 1012 . ? 1_555 ? 
853  HC4 21 CLA PA .   ? CLA A 1022 . ? 1_555 ? 
854  HC4 21 TYR B  435 ? TYR B 435  . ? 1_555 ? 
855  HC4 21 ALA B  519 ? ALA B 519  . ? 1_555 ? 
856  HC4 21 ASN B  582 ? ASN B 582  . ? 1_555 ? 
857  HC4 21 TRP B  586 ? TRP B 586  . ? 1_555 ? 
858  HC4 21 PHE B  589 ? PHE B 589  . ? 1_555 ? 
859  HC4 21 LEU B  613 ? LEU B 613  . ? 1_555 ? 
860  HC4 21 TRP B  616 ? TRP B 616  . ? 1_555 ? 
861  HC4 21 LEU B  621 ? LEU B 621  . ? 1_555 ? 
862  HC4 21 SER B  625 ? SER B 625  . ? 1_555 ? 
863  HC4 21 ILE B  629 ? ILE B 629  . ? 1_555 ? 
864  HC4 21 PHE B  647 ? PHE B 647  . ? 1_555 ? 
865  HC4 21 HIS B  651 ? HIS B 651  . ? 1_555 ? 
866  HC4 21 TRP B  654 ? TRP B 654  . ? 1_555 ? 
867  HC4 21 TYR B  714 ? TYR B 714  . ? 1_555 ? 
868  HC4 21 THR B  717 ? THR B 717  . ? 1_555 ? 
869  HC4 21 TYR B  718 ? TYR B 718  . ? 1_555 ? 
870  HC4 21 PHE B  721 ? PHE B 721  . ? 1_555 ? 
871  HC5 22 ASN A  441 ? ASN A 441  . ? 1_555 ? 
872  HC5 22 ILE A  445 ? ILE A 445  . ? 1_555 ? 
873  HC5 22 GLY A  448 ? GLY A 448  . ? 1_555 ? 
874  HC5 22 PHE A  449 ? PHE A 449  . ? 1_555 ? 
875  HC5 22 PHE A  540 ? PHE A 540  . ? 1_555 ? 
876  HC5 22 LEU A  547 ? LEU A 547  . ? 1_555 ? 
877  HC5 22 ILE A  548 ? ILE A 548  . ? 1_555 ? 
878  HC5 22 PHE A  596 ? PHE A 596  . ? 1_555 ? 
879  HC5 22 TRP A  597 ? TRP A 597  . ? 1_555 ? 
880  HC5 22 CLA PA .   ? CLA A 1022 . ? 1_555 ? 
881  HC5 22 CLA QB .   ? CLA A 1131 . ? 1_555 ? 
882  HC5 22 ALA B  655 ? ALA B 655  . ? 1_555 ? 
883  HC5 22 THR B  656 ? THR B 656  . ? 1_555 ? 
884  HC5 22 PHE B  658 ? PHE B 658  . ? 1_555 ? 
885  HC5 22 MET B  659 ? MET B 659  . ? 1_555 ? 
886  HC5 22 TYR B  667 ? TYR B 667  . ? 1_555 ? 
887  HC5 22 TRP B  668 ? TRP B 668  . ? 1_555 ? 
888  HC5 22 LEU B  671 ? LEU B 671  . ? 1_555 ? 
889  HC5 22 CLA ZC .   ? CLA B 1207 . ? 1_555 ? 
890  HC5 22 CLA FE .   ? CLA B 1239 . ? 1_555 ? 
891  HC5 22 BCR OC .   ? BCR B 4017 . ? 1_555 ? 
892  HC5 22 BCR IE .   ? BCR F 4018 . ? 1_555 ? 
893  HC6 15 PHE B  5   ? PHE B 5    . ? 1_555 ? 
894  HC6 15 PHE B  8   ? PHE B 8    . ? 1_555 ? 
895  HC6 15 ALA B  28  ? ALA B 28   . ? 1_555 ? 
896  HC6 15 HIS B  29  ? HIS B 29   . ? 1_555 ? 
897  HC6 15 HIS B  34  ? HIS B 34   . ? 1_555 ? 
898  HC6 15 LYS B  45  ? LYS B 45   . ? 1_555 ? 
899  HC6 15 CLA WC .   ? CLA B 1203 . ? 1_555 ? 
900  HC6 15 CLA RD .   ? CLA B 1226 . ? 1_555 ? 
901  HC6 15 LMG PC .   ? LMG B 5002 . ? 1_555 ? 
902  HC6 15 BCR OE .   ? BCR L 4019 . ? 1_555 ? 
903  HC6 15 PHE H  23  ? PHE M 23   . ? 1_555 ? 
904  HC6 15 SER H  26  ? SER M 26   . ? 1_555 ? 
905  HC6 15 LEU H  29  ? LEU M 29   . ? 1_555 ? 
906  HC6 15 TYR H  30  ? TYR M 30   . ? 1_555 ? 
907  HC6 15 BCR QE .   ? BCR M 4021 . ? 1_555 ? 
908  HC7 18 HIS B  29  ? HIS B 29   . ? 1_555 ? 
909  HC7 18 PHE B  31  ? PHE B 31   . ? 1_555 ? 
910  HC7 18 ILE B  46  ? ILE B 46   . ? 1_555 ? 
911  HC7 18 SER B  49  ? SER B 49   . ? 1_555 ? 
912  HC7 18 HIS B  50  ? HIS B 50   . ? 1_555 ? 
913  HC7 18 HIS B  53  ? HIS B 53   . ? 1_555 ? 
914  HC7 18 ILE B  54  ? ILE B 54   . ? 1_555 ? 
915  HC7 18 ARG B  174 ? ARG B 174  . ? 1_555 ? 
916  HC7 18 LEU B  328 ? LEU B 328  . ? 1_555 ? 
917  HC7 18 GLN B  331 ? GLN B 331  . ? 1_555 ? 
918  HC7 18 LEU B  332 ? LEU B 332  . ? 1_555 ? 
919  HC7 18 ALA B  335 ? ALA B 335  . ? 1_555 ? 
920  HC7 18 LEU B  336 ? LEU B 336  . ? 1_555 ? 
921  HC7 18 CLA WC .   ? CLA B 1203 . ? 1_555 ? 
922  HC7 18 CLA CD .   ? CLA B 1210 . ? 1_555 ? 
923  HC7 18 CLA MD .   ? CLA B 1221 . ? 1_555 ? 
924  HC7 18 CLA RD .   ? CLA B 1226 . ? 1_555 ? 
925  HC7 18 BCR IC .   ? BCR B 4005 . ? 1_555 ? 
926  HC8 11 HIS B  29  ? HIS B 29   . ? 1_555 ? 
927  HC8 11 HIS B  53  ? HIS B 53   . ? 1_555 ? 
928  HC8 11 TRP B  60  ? TRP B 60   . ? 1_555 ? 
929  HC8 11 LEU B  339 ? LEU B 339  . ? 1_555 ? 
930  HC8 11 PHE B  379 ? PHE B 379  . ? 1_555 ? 
931  HC8 11 CLA UC .   ? CLA B 1201 . ? 1_555 ? 
932  HC8 11 CLA VC .   ? CLA B 1202 . ? 1_555 ? 
933  HC8 11 CLA PD .   ? CLA B 1224 . ? 1_555 ? 
934  HC8 11 CLA QD .   ? CLA B 1225 . ? 1_555 ? 
935  HC8 11 CLA RD .   ? CLA B 1226 . ? 1_555 ? 
936  HC8 11 LMG PC .   ? LMG B 5002 . ? 1_555 ? 
937  HC9 22 LEU B  59  ? LEU B 59   . ? 1_555 ? 
938  HC9 22 SER B  62  ? SER B 62   . ? 1_555 ? 
939  HC9 22 GLY B  63  ? GLY B 63   . ? 1_555 ? 
940  HC9 22 PHE B  66  ? PHE B 66   . ? 1_555 ? 
941  HC9 22 HIS B  67  ? HIS B 67   . ? 1_555 ? 
942  HC9 22 TRP B  70  ? TRP B 70   . ? 1_555 ? 
943  HC9 22 GLN B  71  ? GLN B 71   . ? 1_555 ? 
944  HC9 22 HIS B  89  ? HIS B 89   . ? 1_555 ? 
945  HC9 22 LEU B  143 ? LEU B 143  . ? 1_555 ? 
946  HC9 22 CLA YC .   ? CLA B 1205 . ? 1_555 ? 
947  HC9 22 CLA CE .   ? CLA B 1206 . ? 1_555 ? 
948  HC9 22 LMG PC .   ? LMG B 5002 . ? 1_555 ? 
949  HC9 22 BCR IE .   ? BCR F 4018 . ? 1_555 ? 
950  HC9 22 LEU BA 10  ? LEU I 10   . ? 1_555 ? 
951  HC9 22 PRO BA 11  ? PRO I 11   . ? 1_555 ? 
952  HC9 22 LEU BA 14  ? LEU I 14   . ? 1_555 ? 
953  HC9 22 ILE BA 15  ? ILE I 15   . ? 1_555 ? 
954  HC9 22 VAL BA 18  ? VAL I 18   . ? 1_555 ? 
955  HC9 22 ALA H  11  ? ALA M 11   . ? 1_555 ? 
956  HC9 22 LEU H  12  ? LEU M 12   . ? 1_555 ? 
957  HC9 22 ALA H  15  ? ALA M 15   . ? 1_555 ? 
958  HC9 22 BCR QE .   ? BCR M 4021 . ? 1_555 ? 
959  IC1 15 TRP B  60  ? TRP B 60   . ? 1_555 ? 
960  IC1 15 THR B  64  ? THR B 64   . ? 1_555 ? 
961  IC1 15 VAL B  68  ? VAL B 68   . ? 1_555 ? 
962  IC1 15 ALA B  88  ? ALA B 88   . ? 1_555 ? 
963  IC1 15 HIS B  89  ? HIS B 89   . ? 1_555 ? 
964  IC1 15 ILE B  115 ? ILE B 115  . ? 1_555 ? 
965  IC1 15 ALA B  116 ? ALA B 116  . ? 1_555 ? 
966  IC1 15 TYR B  117 ? TYR B 117  . ? 1_555 ? 
967  IC1 15 SER B  118 ? SER B 118  . ? 1_555 ? 
968  IC1 15 VAL B  642 ? VAL B 642  . ? 1_555 ? 
969  IC1 15 TRP B  643 ? TRP B 643  . ? 1_555 ? 
970  IC1 15 CLA XC .   ? CLA B 1204 . ? 1_555 ? 
971  IC1 15 CLA CE .   ? CLA B 1206 . ? 1_555 ? 
972  IC1 15 CLA PD .   ? CLA B 1224 . ? 1_555 ? 
973  IC1 15 BCR OC .   ? BCR B 4017 . ? 1_555 ? 
974  IC2 14 CLA PA .   ? CLA A 1022 . ? 1_555 ? 
975  IC2 14 CLA BC .   ? CLA A 1132 . ? 1_555 ? 
976  IC2 14 HIS B  95  ? HIS B 95   . ? 1_555 ? 
977  IC2 14 CLA TC .   ? CLA B 1023 . ? 1_555 ? 
978  IC2 14 CLA CE .   ? CLA B 1206 . ? 1_555 ? 
979  IC2 14 BCR IE .   ? BCR F 4018 . ? 1_555 ? 
980  IC2 14 BCR JE .   ? BCR F 4020 . ? 1_555 ? 
981  IC2 14 GLY BA 19  ? GLY I 19   . ? 1_555 ? 
982  IC2 14 TRP BA 20  ? TRP I 20   . ? 1_555 ? 
983  IC2 14 TRP G  65  ? TRP L 65   . ? 1_555 ? 
984  IC2 14 PRO G  70  ? PRO L 70   . ? 1_555 ? 
985  IC2 14 ILE G  83  ? ILE L 83   . ? 1_555 ? 
986  IC2 14 GLY G  84  ? GLY L 84   . ? 1_555 ? 
987  IC2 14 ALA G  87  ? ALA L 87   . ? 1_555 ? 
988  IC3 10 PHE B  51  ? PHE B 51   . ? 1_555 ? 
989  IC3 10 LEU B  148 ? LEU B 148  . ? 1_555 ? 
990  IC3 10 PHE B  151 ? PHE B 151  . ? 1_555 ? 
991  IC3 10 ALA B  152 ? ALA B 152  . ? 1_555 ? 
992  IC3 10 LEU B  155 ? LEU B 155  . ? 1_555 ? 
993  IC3 10 HIS B  156 ? HIS B 156  . ? 1_555 ? 
994  IC3 10 PHE B  161 ? PHE B 161  . ? 1_555 ? 
995  IC3 10 TRP B  167 ? TRP B 167  . ? 1_555 ? 
996  IC3 10 CLA BD .   ? CLA B 1209 . ? 1_555 ? 
997  IC3 10 CLA CD .   ? CLA B 1210 . ? 1_555 ? 
998  IC4 9  TRP B  167 ? TRP B 167  . ? 1_555 ? 
999  IC4 9  ASN B  170 ? ASN B 170  . ? 1_555 ? 
1000 IC4 9  SER B  173 ? SER B 173  . ? 1_555 ? 
1001 IC4 9  HIS B  177 ? HIS B 177  . ? 1_555 ? 
1002 IC4 9  TRP B  295 ? TRP B 295  . ? 1_555 ? 
1003 IC4 9  CLA AD .   ? CLA B 1208 . ? 1_555 ? 
1004 IC4 9  CLA CD .   ? CLA B 1210 . ? 1_555 ? 
1005 IC4 9  CLA ID .   ? CLA B 1217 . ? 1_555 ? 
1006 IC4 9  BCR IC .   ? BCR B 4005 . ? 1_555 ? 
1007 IC5 16 PHE B  47  ? PHE B 47   . ? 1_555 ? 
1008 IC5 16 HIS B  50  ? HIS B 50   . ? 1_555 ? 
1009 IC5 16 PHE B  51  ? PHE B 51   . ? 1_555 ? 
1010 IC5 16 ILE B  54  ? ILE B 54   . ? 1_555 ? 
1011 IC5 16 TRP B  167 ? TRP B 167  . ? 1_555 ? 
1012 IC5 16 ARG B  174 ? ARG B 174  . ? 1_555 ? 
1013 IC5 16 HIS B  177 ? HIS B 177  . ? 1_555 ? 
1014 IC5 16 HIS B  178 ? HIS B 178  . ? 1_555 ? 
1015 IC5 16 LEU B  182 ? LEU B 182  . ? 1_555 ? 
1016 IC5 16 PHE B  183 ? PHE B 183  . ? 1_555 ? 
1017 IC5 16 CLA VC .   ? CLA B 1202 . ? 1_555 ? 
1018 IC5 16 CLA AD .   ? CLA B 1208 . ? 1_555 ? 
1019 IC5 16 CLA BD .   ? CLA B 1209 . ? 1_555 ? 
1020 IC5 16 CLA GD .   ? CLA B 1215 . ? 1_555 ? 
1021 IC5 16 CLA QD .   ? CLA B 1225 . ? 1_555 ? 
1022 IC5 16 BCR IC .   ? BCR B 4005 . ? 1_555 ? 
1023 IC6 17 LEU B  188 ? LEU B 188  . ? 1_555 ? 
1024 IC6 17 ALA B  189 ? ALA B 189  . ? 1_555 ? 
1025 IC6 17 ALA B  191 ? ALA B 191  . ? 1_555 ? 
1026 IC6 17 GLY B  192 ? GLY B 192  . ? 1_555 ? 
1027 IC6 17 HIS B  196 ? HIS B 196  . ? 1_555 ? 
1028 IC6 17 PHE B  212 ? PHE B 212  . ? 1_555 ? 
1029 IC6 17 LEU B  213 ? LEU B 213  . ? 1_555 ? 
1030 IC6 17 THR B  215 ? THR B 215  . ? 1_555 ? 
1031 IC6 17 PRO B  216 ? PRO B 216  . ? 1_555 ? 
1032 IC6 17 PRO B  217 ? PRO B 217  . ? 1_555 ? 
1033 IC6 17 GLY B  221 ? GLY B 221  . ? 1_555 ? 
1034 IC6 17 LEU B  222 ? LEU B 222  . ? 1_555 ? 
1035 IC6 17 LEU B  255 ? LEU B 255  . ? 1_555 ? 
1036 IC6 17 LEU B  278 ? LEU B 278  . ? 1_555 ? 
1037 IC6 17 CLA DE .   ? CLA B 1211 . ? 1_555 ? 
1038 IC6 17 BCR HC .   ? BCR B 4004 . ? 1_555 ? 
1039 IC6 17 BCR JC .   ? BCR B 4006 . ? 1_555 ? 
1040 IC7 11 TRP B  230 ? TRP B 230  . ? 1_555 ? 
1041 IC7 11 PRO B  237 ? PRO B 237  . ? 1_555 ? 
1042 IC7 11 ASP B  238 ? ASP B 238  . ? 1_555 ? 
1043 IC7 11 LEU B  255 ? LEU B 255  . ? 1_555 ? 
1044 IC7 11 PHE B  257 ? PHE B 257  . ? 1_555 ? 
1045 IC7 11 LEU B  258 ? LEU B 258  . ? 1_555 ? 
1046 IC7 11 HIS B  275 ? HIS B 275  . ? 1_555 ? 
1047 IC7 11 GLY B  487 ? GLY B 487  . ? 1_555 ? 
1048 IC7 11 ALA B  489 ? ALA B 489  . ? 1_555 ? 
1049 IC7 11 TRP B  490 ? TRP B 490  . ? 1_555 ? 
1050 IC7 11 CLA FD .   ? CLA B 1214 . ? 1_555 ? 
1051 IC8 15 PHE B  257 ? PHE B 257  . ? 1_555 ? 
1052 IC8 15 LEU B  268 ? LEU B 268  . ? 1_555 ? 
1053 IC8 15 ASP B  272 ? ASP B 272  . ? 1_555 ? 
1054 IC8 15 HIS B  275 ? HIS B 275  . ? 1_555 ? 
1055 IC8 15 HIS B  276 ? HIS B 276  . ? 1_555 ? 
1056 IC8 15 ILE B  280 ? ILE B 280  . ? 1_555 ? 
1057 IC8 15 ILE B  283 ? ILE B 283  . ? 1_555 ? 
1058 IC8 15 HIS B  349 ? HIS B 349  . ? 1_555 ? 
1059 IC8 15 LEU B  353 ? LEU B 353  . ? 1_555 ? 
1060 IC8 15 TRP B  494 ? TRP B 494  . ? 1_555 ? 
1061 IC8 15 CLA ED .   ? CLA B 1213 . ? 1_555 ? 
1062 IC8 15 CLA GD .   ? CLA B 1215 . ? 1_555 ? 
1063 IC8 15 CLA OD .   ? CLA B 1223 . ? 1_555 ? 
1064 IC8 15 CLA WD .   ? CLA B 1231 . ? 1_555 ? 
1065 IC8 15 CLA XD .   ? CLA B 1232 . ? 1_555 ? 
1066 IC9 19 TRP B  123 ? TRP B 123  . ? 1_555 ? 
1067 IC9 19 THR B  126 ? THR B 126  . ? 1_555 ? 
1068 IC9 19 ILE B  127 ? ILE B 127  . ? 1_555 ? 
1069 IC9 19 PHE B  183 ? PHE B 183  . ? 1_555 ? 
1070 IC9 19 SER B  186 ? SER B 186  . ? 1_555 ? 
1071 IC9 19 SER B  187 ? SER B 187  . ? 1_555 ? 
1072 IC9 19 TRP B  190 ? TRP B 190  . ? 1_555 ? 
1073 IC9 19 ILE B  273 ? ILE B 273  . ? 1_555 ? 
1074 IC9 19 HIS B  276 ? HIS B 276  . ? 1_555 ? 
1075 IC9 19 HIS B  277 ? HIS B 277  . ? 1_555 ? 
1076 IC9 19 ILE B  280 ? ILE B 280  . ? 1_555 ? 
1077 IC9 19 VAL B  346 ? VAL B 346  . ? 1_555 ? 
1078 IC9 19 MET B  350 ? MET B 350  . ? 1_555 ? 
1079 IC9 19 SER B  355 ? SER B 355  . ? 1_555 ? 
1080 IC9 19 CLA CD .   ? CLA B 1210 . ? 1_555 ? 
1081 IC9 19 CLA FD .   ? CLA B 1214 . ? 1_555 ? 
1082 IC9 19 CLA OD .   ? CLA B 1223 . ? 1_555 ? 
1083 IC9 19 CLA QD .   ? CLA B 1225 . ? 1_555 ? 
1084 IC9 19 CLA WD .   ? CLA B 1231 . ? 1_555 ? 
1085 JC1 11 LEU B  179 ? LEU B 179  . ? 1_555 ? 
1086 JC1 11 ILE B  283 ? ILE B 283  . ? 1_555 ? 
1087 JC1 11 PHE B  284 ? PHE B 284  . ? 1_555 ? 
1088 JC1 11 ALA B  287 ? ALA B 287  . ? 1_555 ? 
1089 JC1 11 MET B  290 ? MET B 290  . ? 1_555 ? 
1090 JC1 11 TYR B  291 ? TYR B 291  . ? 1_555 ? 
1091 JC1 11 CLA JD .   ? CLA B 1218 . ? 1_555 ? 
1092 JC1 11 CLA KD .   ? CLA B 1219 . ? 1_555 ? 
1093 JC1 11 CLA LD .   ? CLA B 1220 . ? 1_555 ? 
1094 JC1 11 CLA MD .   ? CLA B 1221 . ? 1_555 ? 
1095 JC1 11 CLA OD .   ? CLA B 1223 . ? 1_555 ? 
1096 JC2 9  ASN B  176 ? ASN B 176  . ? 1_555 ? 
1097 JC2 9  HIS B  177 ? HIS B 177  . ? 1_555 ? 
1098 JC2 9  VAL B  185 ? VAL B 185  . ? 1_555 ? 
1099 JC2 9  HIS B  289 ? HIS B 289  . ? 1_555 ? 
1100 JC2 9  TYR B  291 ? TYR B 291  . ? 1_555 ? 
1101 JC2 9  THR B  293 ? THR B 293  . ? 1_555 ? 
1102 JC2 9  ILE B  297 ? ILE B 297  . ? 1_555 ? 
1103 JC2 9  CLA BD .   ? CLA B 1209 . ? 1_555 ? 
1104 JC2 9  BCR HC .   ? BCR B 4004 . ? 1_555 ? 
1105 JC3 7  ILE B  286 ? ILE B 286  . ? 1_555 ? 
1106 JC3 7  MET B  290 ? MET B 290  . ? 1_555 ? 
1107 JC3 7  GLY B  298 ? GLY B 298  . ? 1_555 ? 
1108 JC3 7  HIS B  299 ? HIS B 299  . ? 1_555 ? 
1109 JC3 7  CLA HD .   ? CLA B 1216 . ? 1_555 ? 
1110 JC3 7  CLA KD .   ? CLA B 1219 . ? 1_555 ? 
1111 JC3 7  BCR HC .   ? BCR B 4004 . ? 1_555 ? 
1112 JC4 9  MET B  290 ? MET B 290  . ? 1_555 ? 
1113 JC4 9  HIS B  299 ? HIS B 299  . ? 1_555 ? 
1114 JC4 9  ILE B  304 ? ILE B 304  . ? 1_555 ? 
1115 JC4 9  ALA B  307 ? ALA B 307  . ? 1_555 ? 
1116 JC4 9  HIS B  308 ? HIS B 308  . ? 1_555 ? 
1117 JC4 9  CLA HD .   ? CLA B 1216 . ? 1_555 ? 
1118 JC4 9  CLA JD .   ? CLA B 1218 . ? 1_555 ? 
1119 JC4 9  CLA LD .   ? CLA B 1220 . ? 1_555 ? 
1120 JC4 9  CLA BE .   ? CLA B 1240 . ? 1_555 ? 
1121 JC5 10 LEU B  305 ? LEU B 305  . ? 1_555 ? 
1122 JC5 10 HIS B  317 ? HIS B 317  . ? 1_555 ? 
1123 JC5 10 PHE B  330 ? PHE B 330  . ? 1_555 ? 
1124 JC5 10 VAL B  405 ? VAL B 405  . ? 1_555 ? 
1125 JC5 10 CLA HD .   ? CLA B 1216 . ? 1_555 ? 
1126 JC5 10 CLA KD .   ? CLA B 1219 . ? 1_555 ? 
1127 JC5 10 CLA MD .   ? CLA B 1221 . ? 1_555 ? 
1128 JC5 10 CLA SD .   ? CLA B 1227 . ? 1_555 ? 
1129 JC5 10 BCR KC .   ? BCR B 4009 . ? 1_555 ? 
1130 JC5 10 LHG QC .   ? LHG B 5004 . ? 1_555 ? 
1131 JC6 13 ALA B  171 ? ALA B 171  . ? 1_555 ? 
1132 JC6 13 ARG B  174 ? ARG B 174  . ? 1_555 ? 
1133 JC6 13 HIS B  178 ? HIS B 178  . ? 1_555 ? 
1134 JC6 13 PHE B  183 ? PHE B 183  . ? 1_555 ? 
1135 JC6 13 ILE B  301 ? ILE B 301  . ? 1_555 ? 
1136 JC6 13 ILE B  324 ? ILE B 324  . ? 1_555 ? 
1137 JC6 13 LEU B  334 ? LEU B 334  . ? 1_555 ? 
1138 JC6 13 SER B  338 ? SER B 338  . ? 1_555 ? 
1139 JC6 13 ILE B  342 ? ILE B 342  . ? 1_555 ? 
1140 JC6 13 CLA VC .   ? CLA B 1202 . ? 1_555 ? 
1141 JC6 13 CLA HD .   ? CLA B 1216 . ? 1_555 ? 
1142 JC6 13 CLA LD .   ? CLA B 1220 . ? 1_555 ? 
1143 JC6 13 CLA OD .   ? CLA B 1223 . ? 1_555 ? 
1144 JC7 16 VAL B  341 ? VAL B 341  . ? 1_555 ? 
1145 JC7 16 SER B  344 ? SER B 344  . ? 1_555 ? 
1146 JC7 16 LEU B  345 ? LEU B 345  . ? 1_555 ? 
1147 JC7 16 GLN B  348 ? GLN B 348  . ? 1_555 ? 
1148 JC7 16 GLN B  374 ? GLN B 374  . ? 1_555 ? 
1149 JC7 16 MET B  381 ? MET B 381  . ? 1_555 ? 
1150 JC7 16 PHE B  385 ? PHE B 385  . ? 1_555 ? 
1151 JC7 16 LEU B  524 ? LEU B 524  . ? 1_555 ? 
1152 JC7 16 THR B  527 ? THR B 527  . ? 1_555 ? 
1153 JC7 16 LEU B  531 ? LEU B 531  . ? 1_555 ? 
1154 JC7 16 MET B  580 ? MET B 580  . ? 1_555 ? 
1155 JC7 16 CLA OD .   ? CLA B 1223 . ? 1_555 ? 
1156 JC7 16 CLA YD .   ? CLA B 1234 . ? 1_555 ? 
1157 JC7 16 CLA AE .   ? CLA B 1236 . ? 1_555 ? 
1158 JC7 16 BCR LC .   ? BCR B 4010 . ? 1_555 ? 
1159 JC7 16 LHG QC .   ? LHG B 5004 . ? 1_555 ? 
1160 JC8 16 SER B  338 ? SER B 338  . ? 1_555 ? 
1161 JC8 16 VAL B  341 ? VAL B 341  . ? 1_555 ? 
1162 JC8 16 LEU B  345 ? LEU B 345  . ? 1_555 ? 
1163 JC8 16 HIS B  349 ? HIS B 349  . ? 1_555 ? 
1164 JC8 16 SER B  352 ? SER B 352  . ? 1_555 ? 
1165 JC8 16 CLA FD .   ? CLA B 1214 . ? 1_555 ? 
1166 JC8 16 CLA GD .   ? CLA B 1215 . ? 1_555 ? 
1167 JC8 16 CLA HD .   ? CLA B 1216 . ? 1_555 ? 
1168 JC8 16 CLA MD .   ? CLA B 1221 . ? 1_555 ? 
1169 JC8 16 CLA ND .   ? CLA B 1222 . ? 1_555 ? 
1170 JC8 16 CLA WD .   ? CLA B 1231 . ? 1_555 ? 
1171 JC8 16 CLA YD .   ? CLA B 1234 . ? 1_555 ? 
1172 JC8 16 CLA AE .   ? CLA B 1236 . ? 1_555 ? 
1173 JC8 16 BCR KC .   ? BCR B 4009 . ? 1_555 ? 
1174 JC8 16 BCR LC .   ? BCR B 4010 . ? 1_555 ? 
1175 JC8 16 LHG QC .   ? LHG B 5004 . ? 1_555 ? 
1176 JC9 12 TRP B  60  ? TRP B 60   . ? 1_555 ? 
1177 JC9 12 SER B  118 ? SER B 118  . ? 1_555 ? 
1178 JC9 12 ALA B  368 ? ALA B 368  . ? 1_555 ? 
1179 JC9 12 THR B  371 ? THR B 371  . ? 1_555 ? 
1180 JC9 12 HIS B  372 ? HIS B 372  . ? 1_555 ? 
1181 JC9 12 TYR B  375 ? TYR B 375  . ? 1_555 ? 
1182 JC9 12 LEU B  716 ? LEU B 716  . ? 1_555 ? 
1183 JC9 12 ALA B  719 ? ALA B 719  . ? 1_555 ? 
1184 JC9 12 CLA WC .   ? CLA B 1203 . ? 1_555 ? 
1185 JC9 12 CLA YC .   ? CLA B 1205 . ? 1_555 ? 
1186 JC9 12 CLA QD .   ? CLA B 1225 . ? 1_555 ? 
1187 JC9 12 LMG PC .   ? LMG B 5002 . ? 1_555 ? 
1188 KC1 20 TRP B  60  ? TRP B 60   . ? 1_555 ? 
1189 KC1 20 THR B  61  ? THR B 61   . ? 1_555 ? 
1190 KC1 20 SER B  118 ? SER B 118  . ? 1_555 ? 
1191 KC1 20 GLY B  119 ? GLY B 119  . ? 1_555 ? 
1192 KC1 20 TRP B  123 ? TRP B 123  . ? 1_555 ? 
1193 KC1 20 ILE B  342 ? ILE B 342  . ? 1_555 ? 
1194 KC1 20 THR B  343 ? THR B 343  . ? 1_555 ? 
1195 KC1 20 VAL B  346 ? VAL B 346  . ? 1_555 ? 
1196 KC1 20 MET B  350 ? MET B 350  . ? 1_555 ? 
1197 KC1 20 TYR B  356 ? TYR B 356  . ? 1_555 ? 
1198 KC1 20 LEU B  369 ? LEU B 369  . ? 1_555 ? 
1199 KC1 20 HIS B  372 ? HIS B 372  . ? 1_555 ? 
1200 KC1 20 HIS B  373 ? HIS B 373  . ? 1_555 ? 
1201 KC1 20 CLA WC .   ? CLA B 1203 . ? 1_555 ? 
1202 KC1 20 CLA CD .   ? CLA B 1210 . ? 1_555 ? 
1203 KC1 20 CLA DE .   ? CLA B 1211 . ? 1_555 ? 
1204 KC1 20 CLA GD .   ? CLA B 1215 . ? 1_555 ? 
1205 KC1 20 CLA PD .   ? CLA B 1224 . ? 1_555 ? 
1206 KC1 20 BCR IC .   ? BCR B 4005 . ? 1_555 ? 
1207 KC1 20 BCR JC .   ? BCR B 4006 . ? 1_555 ? 
1208 KC2 18 ALA B  26  ? ALA B 26   . ? 1_555 ? 
1209 KC2 18 HIS B  29  ? HIS B 29   . ? 1_555 ? 
1210 KC2 18 ASP B  30  ? ASP B 30   . ? 1_555 ? 
1211 KC2 18 HIS B  329 ? HIS B 329  . ? 1_555 ? 
1212 KC2 18 LEU B  336 ? LEU B 336  . ? 1_555 ? 
1213 KC2 18 PHE B  379 ? PHE B 379  . ? 1_555 ? 
1214 KC2 18 GLY B  383 ? GLY B 383  . ? 1_555 ? 
1215 KC2 18 HIS B  387 ? HIS B 387  . ? 1_555 ? 
1216 KC2 18 ILE B  390 ? ILE B 390  . ? 1_555 ? 
1217 KC2 18 ARG B  394 ? ARG B 394  . ? 1_555 ? 
1218 KC2 18 TYR B  552 ? TYR B 552  . ? 1_555 ? 
1219 KC2 18 TRP B  570 ? TRP B 570  . ? 1_555 ? 
1220 KC2 18 PHE B  573 ? PHE B 573  . ? 1_555 ? 
1221 KC2 18 CLA UC .   ? CLA B 1201 . ? 1_555 ? 
1222 KC2 18 CLA VC .   ? CLA B 1202 . ? 1_555 ? 
1223 KC2 18 CLA WC .   ? CLA B 1203 . ? 1_555 ? 
1224 KC2 18 CLA FE .   ? CLA B 1239 . ? 1_555 ? 
1225 KC2 18 LMG PC .   ? LMG B 5002 . ? 1_555 ? 
1226 KC3 13 LEU B  312 ? LEU B 312  . ? 1_555 ? 
1227 KC3 13 THR B  313 ? THR B 313  . ? 1_555 ? 
1228 KC3 13 VAL B  405 ? VAL B 405  . ? 1_555 ? 
1229 KC3 13 ARG B  408 ? ARG B 408  . ? 1_555 ? 
1230 KC3 13 MET B  409 ? MET B 409  . ? 1_555 ? 
1231 KC3 13 GLU B  411 ? GLU B 411  . ? 1_555 ? 
1232 KC3 13 HIS B  412 ? HIS B 412  . ? 1_555 ? 
1233 KC3 13 HIS B  419 ? HIS B 419  . ? 1_555 ? 
1234 KC3 13 CLA LD .   ? CLA B 1220 . ? 1_555 ? 
1235 KC3 13 CLA TD .   ? CLA B 1228 . ? 1_555 ? 
1236 KC3 13 CLA AE .   ? CLA B 1236 . ? 1_555 ? 
1237 KC3 13 BCR KC .   ? BCR B 4009 . ? 1_555 ? 
1238 KC3 13 LHG QC .   ? LHG B 5004 . ? 1_555 ? 
1239 KC4 8  TRP A  702 ? TRP A 702  . ? 1_555 ? 
1240 KC4 8  LYS A  706 ? LYS A 706  . ? 1_555 ? 
1241 KC4 8  ALA B  415 ? ALA B 415  . ? 1_555 ? 
1242 KC4 8  HIS B  419 ? HIS B 419  . ? 1_555 ? 
1243 KC4 8  TRP B  422 ? TRP B 422  . ? 1_555 ? 
1244 KC4 8  CLA SD .   ? CLA B 1227 . ? 1_555 ? 
1245 KC4 8  CLA UD .   ? CLA B 1229 . ? 1_555 ? 
1246 KC4 8  CLA AE .   ? CLA B 1236 . ? 1_555 ? 
1247 KC5 12 CLA SB .   ? CLA A 1138 . ? 1_555 ? 
1248 KC5 12 TRP B  422 ? TRP B 422  . ? 1_555 ? 
1249 KC5 12 LEU B  425 ? LEU B 425  . ? 1_555 ? 
1250 KC5 12 PHE B  426 ? PHE B 426  . ? 1_555 ? 
1251 KC5 12 HIS B  430 ? HIS B 430  . ? 1_555 ? 
1252 KC5 12 CLA TD .   ? CLA B 1228 . ? 1_555 ? 
1253 KC5 12 CLA VD .   ? CLA B 1230 . ? 1_555 ? 
1254 KC5 12 CLA ZD .   ? CLA B 1235 . ? 1_555 ? 
1255 KC5 12 BCR MC .   ? BCR B 4011 . ? 1_555 ? 
1256 KC5 12 BCR NC .   ? BCR B 4014 . ? 1_555 ? 
1257 KC5 12 SER F  51  ? SER F 51   . ? 1_555 ? 
1258 KC5 12 ALA F  58  ? ALA F 58   . ? 1_555 ? 
1259 KC6 10 VAL A  121 ? VAL A 121  . ? 1_555 ? 
1260 KC6 10 HIS B  430 ? HIS B 430  . ? 1_555 ? 
1261 KC6 10 GLY B  433 ? GLY B 433  . ? 1_555 ? 
1262 KC6 10 LEU B  434 ? LEU B 434  . ? 1_555 ? 
1263 KC6 10 VAL B  436 ? VAL B 436  . ? 1_555 ? 
1264 KC6 10 HIS B  437 ? HIS B 437  . ? 1_555 ? 
1265 KC6 10 LYS B  449 ? LYS B 449  . ? 1_555 ? 
1266 KC6 10 CLA UD .   ? CLA B 1229 . ? 1_555 ? 
1267 KC6 10 BCR MC .   ? BCR B 4011 . ? 1_555 ? 
1268 KC6 10 BCR NC .   ? BCR B 4014 . ? 1_555 ? 
1269 KC7 12 TRP B  460 ? TRP B 460  . ? 1_555 ? 
1270 KC7 12 ILE B  461 ? ILE B 461  . ? 1_555 ? 
1271 KC7 12 THR B  464 ? THR B 464  . ? 1_555 ? 
1272 KC7 12 SER B  465 ? SER B 465  . ? 1_555 ? 
1273 KC7 12 LEU B  475 ? LEU B 475  . ? 1_555 ? 
1274 KC7 12 LEU B  476 ? LEU B 476  . ? 1_555 ? 
1275 KC7 12 TRP B  494 ? TRP B 494  . ? 1_555 ? 
1276 KC7 12 CLA FD .   ? CLA B 1214 . ? 1_555 ? 
1277 KC7 12 CLA GD .   ? CLA B 1215 . ? 1_555 ? 
1278 KC7 12 CLA OD .   ? CLA B 1223 . ? 1_555 ? 
1279 KC7 12 CLA XD .   ? CLA B 1232 . ? 1_555 ? 
1280 KC7 12 CLA YD .   ? CLA B 1234 . ? 1_555 ? 
1281 KC8 6  ILE B  482 ? ILE B 482  . ? 1_555 ? 
1282 KC8 6  THR B  486 ? THR B 486  . ? 1_555 ? 
1283 KC8 6  TRP B  490 ? TRP B 490  . ? 1_555 ? 
1284 KC8 6  CLA FD .   ? CLA B 1214 . ? 1_555 ? 
1285 KC8 6  CLA WD .   ? CLA B 1231 . ? 1_555 ? 
1286 KC8 6  BCR LC .   ? BCR B 4010 . ? 1_555 ? 
1287 KC9 19 GLN B  348 ? GLN B 348  . ? 1_555 ? 
1288 KC9 19 TYR B  351 ? TYR B 351  . ? 1_555 ? 
1289 KC9 19 TYR B  370 ? TYR B 370  . ? 1_555 ? 
1290 KC9 19 PHE B  457 ? PHE B 457  . ? 1_555 ? 
1291 KC9 19 ALA B  458 ? ALA B 458  . ? 1_555 ? 
1292 KC9 19 ILE B  461 ? ILE B 461  . ? 1_555 ? 
1293 KC9 19 GLN B  462 ? GLN B 462  . ? 1_555 ? 
1294 KC9 19 PHE B  506 ? PHE B 506  . ? 1_555 ? 
1295 KC9 19 LEU B  507 ? LEU B 507  . ? 1_555 ? 
1296 KC9 19 HIS B  517 ? HIS B 517  . ? 1_555 ? 
1297 KC9 19 ILE B  520 ? ILE B 520  . ? 1_555 ? 
1298 KC9 19 LEU B  587 ? LEU B 587  . ? 1_555 ? 
1299 KC9 19 TYR B  590 ? TYR B 590  . ? 1_555 ? 
1300 KC9 19 TRP B  591 ? TRP B 591  . ? 1_555 ? 
1301 KC9 19 CLA ND .   ? CLA B 1222 . ? 1_555 ? 
1302 KC9 19 CLA OD .   ? CLA B 1223 . ? 1_555 ? 
1303 KC9 19 CLA WD .   ? CLA B 1231 . ? 1_555 ? 
1304 KC9 19 CLA ZD .   ? CLA B 1235 . ? 1_555 ? 
1305 KC9 19 BCR LC .   ? BCR B 4010 . ? 1_555 ? 
1306 LC1 14 TRP B  422 ? TRP B 422  . ? 1_555 ? 
1307 LC1 14 PHE B  426 ? PHE B 426  . ? 1_555 ? 
1308 LC1 14 LEU B  427 ? LEU B 427  . ? 1_555 ? 
1309 LC1 14 GLU B  454 ? GLU B 454  . ? 1_555 ? 
1310 LC1 14 PRO B  455 ? PRO B 455  . ? 1_555 ? 
1311 LC1 14 VAL B  456 ? VAL B 456  . ? 1_555 ? 
1312 LC1 14 PHE B  457 ? PHE B 457  . ? 1_555 ? 
1313 LC1 14 ALA B  458 ? ALA B 458  . ? 1_555 ? 
1314 LC1 14 PHE B  514 ? PHE B 514  . ? 1_555 ? 
1315 LC1 14 HIS B  517 ? HIS B 517  . ? 1_555 ? 
1316 LC1 14 HIS B  518 ? HIS B 518  . ? 1_555 ? 
1317 LC1 14 CLA UD .   ? CLA B 1229 . ? 1_555 ? 
1318 LC1 14 CLA YD .   ? CLA B 1234 . ? 1_555 ? 
1319 LC1 14 CLA AE .   ? CLA B 1236 . ? 1_555 ? 
1320 LC2 13 LEU B  420 ? LEU B 420  . ? 1_555 ? 
1321 LC2 13 TRP B  422 ? TRP B 422  . ? 1_555 ? 
1322 LC2 13 VAL B  423 ? VAL B 423  . ? 1_555 ? 
1323 LC2 13 ALA B  521 ? ALA B 521  . ? 1_555 ? 
1324 LC2 13 HIS B  525 ? HIS B 525  . ? 1_555 ? 
1325 LC2 13 ILE B  532 ? ILE B 532  . ? 1_555 ? 
1326 LC2 13 CLA ND .   ? CLA B 1222 . ? 1_555 ? 
1327 LC2 13 CLA OD .   ? CLA B 1223 . ? 1_555 ? 
1328 LC2 13 CLA SD .   ? CLA B 1227 . ? 1_555 ? 
1329 LC2 13 CLA TD .   ? CLA B 1228 . ? 1_555 ? 
1330 LC2 13 CLA ZD .   ? CLA B 1235 . ? 1_555 ? 
1331 LC2 13 BCR LC .   ? BCR B 4010 . ? 1_555 ? 
1332 LC2 13 LHG QC .   ? LHG B 5004 . ? 1_555 ? 
1333 LC3 5  LYS B  309 ? LYS B 309  . ? 1_555 ? 
1334 LC3 5  PRO B  311 ? PRO B 311  . ? 1_555 ? 
1335 LC3 5  LEU B  312 ? LEU B 312  . ? 1_555 ? 
1336 LC3 5  CLA KD .   ? CLA B 1219 . ? 1_555 ? 
1337 LC3 5  LHG QC .   ? LHG B 5004 . ? 1_555 ? 
1338 LC4 21 THR A  460 ? THR A 460  . ? 1_555 ? 
1339 LC4 21 ALA A  463 ? ALA A 463  . ? 1_555 ? 
1340 LC4 21 CLA PA .   ? CLA A 1022 . ? 1_555 ? 
1341 LC4 21 CLA BC .   ? CLA A 1132 . ? 1_555 ? 
1342 LC4 21 ILE B  91  ? ILE B 91   . ? 1_555 ? 
1343 LC4 21 TRP B  92  ? TRP B 92   . ? 1_555 ? 
1344 LC4 21 ASP B  93  ? ASP B 93   . ? 1_555 ? 
1345 LC4 21 HIS B  95  ? HIS B 95   . ? 1_555 ? 
1346 LC4 21 ASN B  114 ? ASN B 114  . ? 1_555 ? 
1347 LC4 21 SER B  641 ? SER B 641  . ? 1_555 ? 
1348 LC4 21 VAL B  642 ? VAL B 642  . ? 1_555 ? 
1349 LC4 21 TRP B  645 ? TRP B 645  . ? 1_555 ? 
1350 LC4 21 CLA XC .   ? CLA B 1204 . ? 1_555 ? 
1351 LC4 21 CLA YC .   ? CLA B 1205 . ? 1_555 ? 
1352 LC4 21 CLA ZC .   ? CLA B 1207 . ? 1_555 ? 
1353 LC4 21 CLA FE .   ? CLA B 1239 . ? 1_555 ? 
1354 LC4 21 BCR OC .   ? BCR B 4017 . ? 1_555 ? 
1355 LC4 21 BCR IE .   ? BCR F 4018 . ? 1_555 ? 
1356 LC4 21 ILE BA 15  ? ILE I 15   . ? 1_555 ? 
1357 LC4 21 PRO BA 23  ? PRO I 23   . ? 1_555 ? 
1358 LC4 21 THR BA 26  ? THR I 26   . ? 1_555 ? 
1359 LC5 16 ILE B  127 ? ILE B 127  . ? 1_555 ? 
1360 LC5 16 GLY B  128 ? GLY B 128  . ? 1_555 ? 
1361 LC5 16 GLU B  134 ? GLU B 134  . ? 1_555 ? 
1362 LC5 16 GLY B  138 ? GLY B 138  . ? 1_555 ? 
1363 LC5 16 PHE B  141 ? PHE B 141  . ? 1_555 ? 
1364 LC5 16 SER B  186 ? SER B 186  . ? 1_555 ? 
1365 LC5 16 ALA B  189 ? ALA B 189  . ? 1_555 ? 
1366 LC5 16 TRP B  190 ? TRP B 190  . ? 1_555 ? 
1367 LC5 16 HIS B  193 ? HIS B 193  . ? 1_555 ? 
1368 LC5 16 VAL B  197 ? VAL B 197  . ? 1_555 ? 
1369 LC5 16 GLY B  208 ? GLY B 208  . ? 1_555 ? 
1370 LC5 16 TRP B  209 ? TRP B 209  . ? 1_555 ? 
1371 LC5 16 PHE B  212 ? PHE B 212  . ? 1_555 ? 
1372 LC5 16 CLA DD .   ? CLA B 1212 . ? 1_555 ? 
1373 LC5 16 CLA QD .   ? CLA B 1225 . ? 1_555 ? 
1374 LC5 16 BCR JC .   ? BCR B 4006 . ? 1_555 ? 
1375 LC6 21 CLA QB .   ? CLA A 1131 . ? 1_555 ? 
1376 LC6 21 CLA OA .   ? CLA A 1237 . ? 1_555 ? 
1377 LC6 21 THR B  18  ? THR B 18   . ? 1_555 ? 
1378 LC6 21 ILE B  21  ? ILE B 21   . ? 1_555 ? 
1379 LC6 21 TRP B  22  ? TRP B 22   . ? 1_555 ? 
1380 LC6 21 ILE B  675 ? ILE B 675  . ? 1_555 ? 
1381 LC6 21 VAL B  676 ? VAL B 676  . ? 1_555 ? 
1382 LC6 21 HIS B  679 ? HIS B 679  . ? 1_555 ? 
1383 LC6 21 VAL B  688 ? VAL B 688  . ? 1_555 ? 
1384 LC6 21 TRP B  690 ? TRP B 690  . ? 1_555 ? 
1385 LC6 21 LYS B  691 ? LYS B 691  . ? 1_555 ? 
1386 LC6 21 PRO B  694 ? PRO B 694  . ? 1_555 ? 
1387 LC6 21 VAL B  695 ? VAL B 695  . ? 1_555 ? 
1388 LC6 21 BCR IE .   ? BCR F 4018 . ? 1_555 ? 
1389 LC6 21 BCR JE .   ? BCR F 4020 . ? 1_555 ? 
1390 LC6 21 TRP BA 20  ? TRP I 20   . ? 1_555 ? 
1391 LC6 21 PHE BA 31  ? PHE I 31   . ? 1_555 ? 
1392 LC6 21 LEU G  88  ? LEU L 88   . ? 1_555 ? 
1393 LC6 21 VAL G  91  ? VAL L 91   . ? 1_555 ? 
1394 LC6 21 TYR G  99  ? TYR L 99   . ? 1_555 ? 
1395 LC6 21 BCR OE .   ? BCR L 4019 . ? 1_555 ? 
1396 LC7 13 PHE B  649 ? PHE B 649  . ? 1_555 ? 
1397 LC7 13 LEU B  652 ? LEU B 652  . ? 1_555 ? 
1398 LC7 13 VAL B  653 ? VAL B 653  . ? 1_555 ? 
1399 LC7 13 MET B  659 ? MET B 659  . ? 1_555 ? 
1400 LC7 13 PHE B  660 ? PHE B 660  . ? 1_555 ? 
1401 LC7 13 VAL B  705 ? VAL B 705  . ? 1_555 ? 
1402 LC7 13 HIS B  709 ? HIS B 709  . ? 1_555 ? 
1403 LC7 13 CLA TC .   ? CLA B 1023 . ? 1_555 ? 
1404 LC7 13 CLA CE .   ? CLA B 1206 . ? 1_555 ? 
1405 LC7 13 CLA RD .   ? CLA B 1226 . ? 1_555 ? 
1406 LC7 13 PQN GC .   ? PQN B 2002 . ? 1_555 ? 
1407 LC7 13 BCR OC .   ? BCR B 4017 . ? 1_555 ? 
1408 LC7 13 LMG PC .   ? LMG B 5002 . ? 1_555 ? 
1409 LC8 5  CYS C  21  ? CYS C 21   . ? 1_555 ? 
1410 LC8 5  CYS C  48  ? CYS C 48   . ? 1_555 ? 
1411 LC8 5  CYS C  51  ? CYS C 51   . ? 1_555 ? 
1412 LC8 5  LYS C  52  ? LYS C 52   . ? 1_555 ? 
1413 LC8 5  CYS C  54  ? CYS C 54   . ? 1_555 ? 
1414 LC9 6  CYS C  11  ? CYS C 11   . ? 1_555 ? 
1415 LC9 6  ILE C  12  ? ILE C 12   . ? 1_555 ? 
1416 LC9 6  CYS C  14  ? CYS C 14   . ? 1_555 ? 
1417 LC9 6  THR C  15  ? THR C 15   . ? 1_555 ? 
1418 LC9 6  CYS C  17  ? CYS C 17   . ? 1_555 ? 
1419 LC9 6  CYS C  58  ? CYS C 58   . ? 1_555 ? 
1420 MC1 9  CLA QB .   ? CLA A 1131 . ? 1_555 ? 
1421 MC1 9  CLA TC .   ? CLA B 1023 . ? 1_555 ? 
1422 MC1 9  CLA XC .   ? CLA B 1204 . ? 1_555 ? 
1423 MC1 9  CLA CE .   ? CLA B 1206 . ? 1_555 ? 
1424 MC1 9  CLA ZC .   ? CLA B 1207 . ? 1_555 ? 
1425 MC1 9  CLA EE .   ? CLA B 1238 . ? 1_555 ? 
1426 MC1 9  BCR JE .   ? BCR F 4020 . ? 1_555 ? 
1427 MC1 9  PHE BA 22  ? PHE I 22   . ? 1_555 ? 
1428 MC1 9  PRO BA 23  ? PRO I 23   . ? 1_555 ? 
1429 MC2 10 CLA QB .   ? CLA A 1131 . ? 1_555 ? 
1430 MC2 10 CLA BC .   ? CLA A 1132 . ? 1_555 ? 
1431 MC2 10 CLA OA .   ? CLA A 1237 . ? 1_555 ? 
1432 MC2 10 CLA ZC .   ? CLA B 1207 . ? 1_555 ? 
1433 MC2 10 CLA EE .   ? CLA B 1238 . ? 1_555 ? 
1434 MC2 10 BCR IE .   ? BCR F 4018 . ? 1_555 ? 
1435 MC2 10 TRP G  65  ? TRP L 65   . ? 1_555 ? 
1436 MC2 10 GLY G  84  ? GLY L 84   . ? 1_555 ? 
1437 MC2 10 ALA G  87  ? ALA L 87   . ? 1_555 ? 
1438 MC2 10 CLA ME .   ? CLA L 1502 . ? 1_555 ? 
1439 MC3 7  TRP A  118 ? TRP A 118  . ? 1_555 ? 
1440 MC3 7  CLA QA .   ? CLA A 1101 . ? 1_555 ? 
1441 MC3 7  CLA UA .   ? CLA A 1105 . ? 1_555 ? 
1442 MC3 7  CLA VA .   ? CLA A 1106 . ? 1_555 ? 
1443 MC3 7  CLA WA .   ? CLA A 1107 . ? 1_555 ? 
1444 MC3 7  CLA UB .   ? CLA A 1140 . ? 1_555 ? 
1445 MC3 7  PRO F  12  ? PRO F 12   . ? 1_555 ? 
1446 MC4 10 ASN G  36  ? ASN L 36   . ? 1_555 ? 
1447 MC4 10 LEU G  37  ? LEU L 37   . ? 1_555 ? 
1448 MC4 10 ARG G  41  ? ARG L 41   . ? 1_555 ? 
1449 MC4 10 LEU G  48  ? LEU L 48   . ? 1_555 ? 
1450 MC4 10 GLU G  52  ? GLU L 52   . ? 1_555 ? 
1451 MC4 10 MET G  55  ? MET L 55   . ? 1_555 ? 
1452 MC4 10 ALA G  56  ? ALA L 56   . ? 1_555 ? 
1453 MC4 10 CLA ME .   ? CLA L 1502 . ? 1_555 ? 
1454 MC4 10 CLA NE .   ? CLA L 1503 . ? 1_555 ? 
1455 MC4 10 BCR PE .   ? BCR L 4022 . ? 1_555 ? 
1456 MC5 11 CLA OA .   ? CLA A 1237 . ? 1_555 ? 
1457 MC5 11 LEU B  684 ? LEU B 684  . ? 1_555 ? 
1458 MC5 11 BCR JE .   ? BCR F 4020 . ? 1_555 ? 
1459 MC5 11 PHE G  33  ? PHE L 33   . ? 1_555 ? 
1460 MC5 11 PRO G  38  ? PRO L 38   . ? 1_555 ? 
1461 MC5 11 GLU G  52  ? GLU L 52   . ? 1_555 ? 
1462 MC5 11 VAL G  53  ? VAL L 53   . ? 1_555 ? 
1463 MC5 11 ALA G  56  ? ALA L 56   . ? 1_555 ? 
1464 MC5 11 HIS G  57  ? HIS L 57   . ? 1_555 ? 
1465 MC5 11 CLA LE .   ? CLA L 1501 . ? 1_555 ? 
1466 MC5 11 BCR OE .   ? BCR L 4019 . ? 1_555 ? 
1467 MC6 10 CLA BC .   ? CLA A 1132 . ? 1_555 ? 
1468 MC6 10 TYR G  59  ? TYR L 59   . ? 1_555 ? 
1469 MC6 10 PHE G  60  ? PHE L 60   . ? 1_555 ? 
1470 MC6 10 GLY G  63  ? GLY L 63   . ? 1_555 ? 
1471 MC6 10 PRO G  64  ? PRO L 64   . ? 1_555 ? 
1472 MC6 10 THR G  66  ? THR L 66   . ? 1_555 ? 
1473 MC6 10 LEU G  142 ? LEU L 142  . ? 1_555 ? 
1474 MC6 10 LEU G  145 ? LEU L 145  . ? 1_555 ? 
1475 MC6 10 CLA LE .   ? CLA L 1501 . ? 1_555 ? 
1476 MC6 10 BCR PE .   ? BCR L 4022 . ? 1_555 ? 
1477 MC7 11 CLA OA .   ? CLA A 1237 . ? 1_555 ? 
1478 MC7 11 CLA UC .   ? CLA B 1201 . ? 1_555 ? 
1479 MC7 11 CLA EE .   ? CLA B 1238 . ? 1_555 ? 
1480 MC7 11 PQN GC .   ? PQN B 2002 . ? 1_555 ? 
1481 MC7 11 MET BA 27  ? MET I 27   . ? 1_555 ? 
1482 MC7 11 LEU BA 30  ? LEU I 30   . ? 1_555 ? 
1483 MC7 11 ALA G  92  ? ALA L 92   . ? 1_555 ? 
1484 MC7 11 ALA G  95  ? ALA L 95   . ? 1_555 ? 
1485 MC7 11 LEU G  96  ? LEU L 96   . ? 1_555 ? 
1486 MC7 11 PHE G  127 ? PHE L 127  . ? 1_555 ? 
1487 MC7 11 CLA ME .   ? CLA L 1502 . ? 1_555 ? 
1488 MC8 7  CLA BC .   ? CLA A 1132 . ? 1_555 ? 
1489 MC8 7  MET G  55  ? MET L 55   . ? 1_555 ? 
1490 MC8 7  ALA G  56  ? ALA L 56   . ? 1_555 ? 
1491 MC8 7  GLY G  133 ? GLY L 133  . ? 1_555 ? 
1492 MC8 7  VAL G  137 ? VAL L 137  . ? 1_555 ? 
1493 MC8 7  CLA LE .   ? CLA L 1501 . ? 1_555 ? 
1494 MC8 7  CLA NE .   ? CLA L 1503 . ? 1_555 ? 
1495 MC9 10 LEU B  150 ? LEU B 150  . ? 1_555 ? 
1496 MC9 10 CLA UC .   ? CLA B 1201 . ? 1_555 ? 
1497 MC9 10 CLA XC .   ? CLA B 1204 . ? 1_555 ? 
1498 MC9 10 LEU H  9   ? LEU M 9    . ? 1_555 ? 
1499 MC9 10 LEU H  12  ? LEU M 12   . ? 1_555 ? 
1500 MC9 10 ALA H  15  ? ALA M 15   . ? 1_555 ? 
1501 MC9 10 LEU H  16  ? LEU M 16   . ? 1_555 ? 
1502 MC9 10 ALA H  19  ? ALA M 19   . ? 1_555 ? 
1503 MC9 10 ALA H  22  ? ALA M 22   . ? 1_555 ? 
1504 MC9 10 SER H  26  ? SER M 26   . ? 1_555 ? 
1505 NC1 8  ALA I  327 ? ALA a 327  . ? 1_555 ? 
1506 NC1 8  HIS I  328 ? HIS a 328  . ? 1_555 ? 
1507 NC1 8  LYS I  329 ? LYS a 329  . ? 1_555 ? 
1508 NC1 8  PRO I  331 ? PRO a 331  . ? 1_555 ? 
1509 NC1 8  PHE I  332 ? PHE a 332  . ? 1_555 ? 
1510 NC1 8  CLA MG .   ? CLA a 1121 . ? 1_555 ? 
1511 NC1 8  CLA VF .   ? CLA a 1122 . ? 1_555 ? 
1512 NC1 8  LHG AF .   ? LHG a 5003 . ? 1_555 ? 
1513 NC2 12 MET I  684 ? MET a 684  . ? 1_555 ? 
1514 NC2 12 PHE I  685 ? PHE a 685  . ? 1_555 ? 
1515 NC2 12 SER I  688 ? SER a 688  . ? 1_555 ? 
1516 NC2 12 TRP I  693 ? TRP a 693  . ? 1_555 ? 
1517 NC2 12 ALA I  717 ? ALA a 717  . ? 1_555 ? 
1518 NC2 12 LEU I  718 ? LEU a 718  . ? 1_555 ? 
1519 NC2 12 CLA DF .   ? CLA a 1101 . ? 1_555 ? 
1520 NC2 12 CLA GG .   ? CLA a 1139 . ? 1_555 ? 
1521 NC2 12 CLA HG .   ? CLA a 1140 . ? 1_555 ? 
1522 NC2 12 CLA EH .   ? CLA b 1013 . ? 1_555 ? 
1523 NC2 12 BCR AH .   ? BCR b 4014 . ? 1_555 ? 
1524 NC2 12 ALA N  11  ? ALA f 11   . ? 1_555 ? 
1525 NC3 4  CYS I  574 ? CYS a 574  . ? 1_555 ? 
1526 NC3 4  CYS I  583 ? CYS a 583  . ? 1_555 ? 
1527 NC3 4  CYS J  556 ? CYS b 556  . ? 1_555 ? 
1528 NC3 4  CYS J  565 ? CYS b 565  . ? 1_555 ? 
1529 NC4 12 PHE I  263 ? PHE a 263  . ? 1_555 ? 
1530 NC4 12 ILE I  305 ? ILE a 305  . ? 1_555 ? 
1531 NC4 12 HIS I  309 ? HIS a 309  . ? 1_555 ? 
1532 NC4 12 CLA PF .   ? CLA a 1113 . ? 1_555 ? 
1533 NC4 12 CLA TF .   ? CLA a 1118 . ? 1_555 ? 
1534 NC4 12 CLA LG .   ? CLA a 1120 . ? 1_555 ? 
1535 NC4 12 BCR VE .   ? BCR a 4002 . ? 1_555 ? 
1536 NC4 12 PHE CA 77  ? PHE k 77   . ? 1_555 ? 
1537 NC4 12 ALA CA 106 ? ALA k 106  . ? 1_555 ? 
1538 NC4 12 SER CA 109 ? SER k 109  . ? 1_555 ? 
1539 NC4 12 PHE CA 110 ? PHE k 110  . ? 1_555 ? 
1540 NC4 12 CLA TN .   ? CLA k 1401 . ? 1_555 ? 
1541 NC5 9  THR I  161 ? THR a 161  . ? 1_555 ? 
1542 NC5 9  LEU I  207 ? LEU a 207  . ? 1_555 ? 
1543 NC5 9  GLY I  211 ? GLY a 211  . ? 1_555 ? 
1544 NC5 9  CLA FF .   ? CLA a 1103 . ? 1_555 ? 
1545 NC5 9  CLA OF .   ? CLA a 1112 . ? 1_555 ? 
1546 NC5 9  CLA PF .   ? CLA a 1113 . ? 1_555 ? 
1547 NC5 9  CLA TF .   ? CLA a 1118 . ? 1_555 ? 
1548 NC5 9  BCR UE .   ? BCR a 4001 . ? 1_555 ? 
1549 NC5 9  BCR WE .   ? BCR a 4003 . ? 1_555 ? 
1550 NC6 8  GLY I  208 ? GLY a 208  . ? 1_555 ? 
1551 NC6 8  CLA FF .   ? CLA a 1103 . ? 1_555 ? 
1552 NC6 8  CLA GF .   ? CLA a 1104 . ? 1_555 ? 
1553 NC6 8  CLA NF .   ? CLA a 1111 . ? 1_555 ? 
1554 NC6 8  CLA SF .   ? CLA a 1117 . ? 1_555 ? 
1555 NC6 8  CLA TF .   ? CLA a 1118 . ? 1_555 ? 
1556 NC6 8  CLA AG .   ? CLA a 1127 . ? 1_555 ? 
1557 NC6 8  BCR VE .   ? BCR a 4002 . ? 1_555 ? 
1558 NC7 8  ALA I  350 ? ALA a 350  . ? 1_555 ? 
1559 NC7 8  ILE I  354 ? ILE a 354  . ? 1_555 ? 
1560 NC7 8  PHE I  411 ? PHE a 411  . ? 1_555 ? 
1561 NC7 8  CLA UF .   ? CLA a 1119 . ? 1_555 ? 
1562 NC7 8  CLA VF .   ? CLA a 1122 . ? 1_555 ? 
1563 NC7 8  CLA WF .   ? CLA a 1123 . ? 1_555 ? 
1564 NC7 8  BCR YE .   ? BCR a 4008 . ? 1_555 ? 
1565 NC7 8  LHG AF .   ? LHG a 5003 . ? 1_555 ? 
1566 NC8 9  ALA I  357 ? ALA a 357  . ? 1_555 ? 
1567 NC8 9  LEU I  358 ? LEU a 358  . ? 1_555 ? 
1568 NC8 9  SER I  361 ? SER a 361  . ? 1_555 ? 
1569 NC8 9  ILE I  401 ? ILE a 401  . ? 1_555 ? 
1570 NC8 9  CLA UF .   ? CLA a 1119 . ? 1_555 ? 
1571 NC8 9  CLA XF .   ? CLA a 1124 . ? 1_555 ? 
1572 NC8 9  CLA YF .   ? CLA a 1125 . ? 1_555 ? 
1573 NC8 9  CLA EG .   ? CLA a 1137 . ? 1_555 ? 
1574 NC8 9  BCR XE .   ? BCR a 4007 . ? 1_555 ? 
1575 NC9 16 TRP I  49  ? TRP a 49   . ? 1_555 ? 
1576 NC9 16 ASN I  50  ? ASN a 50   . ? 1_555 ? 
1577 NC9 16 ALA I  53  ? ALA a 53   . ? 1_555 ? 
1578 NC9 16 ASN I  54  ? ASN a 54   . ? 1_555 ? 
1579 NC9 16 ARG I  571 ? ARG a 571  . ? 1_555 ? 
1580 NC9 16 SER I  719 ? SER a 719  . ? 1_555 ? 
1581 NC9 16 ILE I  721 ? ILE a 721  . ? 1_555 ? 
1582 NC9 16 ALA I  725 ? ALA a 725  . ? 1_555 ? 
1583 NC9 16 VAL I  728 ? VAL a 728  . ? 1_555 ? 
1584 NC9 16 CLA DF .   ? CLA a 1101 . ? 1_555 ? 
1585 NC9 16 CLA EF .   ? CLA a 1102 . ? 1_555 ? 
1586 NC9 16 CLA GF .   ? CLA a 1104 . ? 1_555 ? 
1587 NC9 16 CLA IF .   ? CLA a 1106 . ? 1_555 ? 
1588 NC9 16 CLA BG .   ? CLA a 1128 . ? 1_555 ? 
1589 NC9 16 CLA HG .   ? CLA a 1140 . ? 1_555 ? 
1590 NC9 16 GLY M  51  ? GLY e 51   . ? 1_555 ? 
1591 OC1 12 HIS I  328 ? HIS a 328  . ? 1_555 ? 
1592 OC1 12 LYS I  329 ? LYS a 329  . ? 1_555 ? 
1593 OC1 12 GLY I  330 ? GLY a 330  . ? 1_555 ? 
1594 OC1 12 PHE I  332 ? PHE a 332  . ? 1_555 ? 
1595 OC1 12 THR I  333 ? THR a 333  . ? 1_555 ? 
1596 OC1 12 HIS I  337 ? HIS a 337  . ? 1_555 ? 
1597 OC1 12 CLA VF .   ? CLA a 1122 . ? 1_555 ? 
1598 OC1 12 CLA NG .   ? CLA a 1129 . ? 1_555 ? 
1599 OC1 12 CLA SG .   ? CLA a 1136 . ? 1_555 ? 
1600 OC1 12 CLA EG .   ? CLA a 1137 . ? 1_555 ? 
1601 OC1 12 CLA RE .   ? CLA a 1801 . ? 1_555 ? 
1602 OC1 12 BCR XE .   ? BCR a 4007 . ? 1_555 ? 
1603 OC2 12 SER I  438 ? SER a 438  . ? 1_555 ? 
1604 OC2 12 ASN I  441 ? ASN a 441  . ? 1_555 ? 
1605 OC2 12 TRP I  442 ? TRP a 442  . ? 1_555 ? 
1606 OC2 12 ILE I  445 ? ILE a 445  . ? 1_555 ? 
1607 OC2 12 ILE J  675 ? ILE b 675  . ? 1_555 ? 
1608 OC2 12 ALA J  678 ? ALA b 678  . ? 1_555 ? 
1609 OC2 12 HIS J  679 ? HIS b 679  . ? 1_555 ? 
1610 OC2 12 ALA J  685 ? ALA b 685  . ? 1_555 ? 
1611 OC2 12 CLA RI .   ? CLA b 1238 . ? 1_555 ? 
1612 OC2 12 BCR BH .   ? BCR b 4017 . ? 1_555 ? 
1613 OC2 12 BCR WI .   ? BCR f 4020 . ? 1_555 ? 
1614 OC2 12 CLA ZI .   ? CLA l 1502 . ? 1_555 ? 
1615 OC3 18 PHE I  452 ? PHE a 452  . ? 1_555 ? 
1616 OC3 18 ILE I  456 ? ILE a 456  . ? 1_555 ? 
1617 OC3 18 PHE I  540 ? PHE a 540  . ? 1_555 ? 
1618 OC3 18 PHE I  596 ? PHE a 596  . ? 1_555 ? 
1619 OC3 18 TRP I  597 ? TRP a 597  . ? 1_555 ? 
1620 OC3 18 ASN I  600 ? ASN a 600  . ? 1_555 ? 
1621 OC3 18 ILE I  642 ? ILE a 642  . ? 1_555 ? 
1622 OC3 18 CLA IG .   ? CLA a 1011 . ? 1_555 ? 
1623 OC3 18 TRP J  645 ? TRP b 645  . ? 1_555 ? 
1624 OC3 18 LEU J  648 ? LEU b 648  . ? 1_555 ? 
1625 OC3 18 HIS J  651 ? HIS b 651  . ? 1_555 ? 
1626 OC3 18 LEU J  652 ? LEU b 652  . ? 1_555 ? 
1627 OC3 18 TRP J  654 ? TRP b 654  . ? 1_555 ? 
1628 OC3 18 ALA J  655 ? ALA b 655  . ? 1_555 ? 
1629 OC3 18 CLA FH .   ? CLA b 1021 . ? 1_555 ? 
1630 OC3 18 CLA GH .   ? CLA b 1023 . ? 1_555 ? 
1631 OC3 18 CLA PI .   ? CLA b 1206 . ? 1_555 ? 
1632 OC3 18 BCR BH .   ? BCR b 4017 . ? 1_555 ? 
1633 OC4 13 ILE I  48  ? ILE a 48   . ? 1_555 ? 
1634 OC4 13 TRP I  49  ? TRP a 49   . ? 1_555 ? 
1635 OC4 13 HIS I  52  ? HIS a 52   . ? 1_555 ? 
1636 OC4 13 CLA EF .   ? CLA a 1102 . ? 1_555 ? 
1637 OC4 13 CLA LF .   ? CLA a 1109 . ? 1_555 ? 
1638 OC4 13 CLA ZF .   ? CLA a 1126 . ? 1_555 ? 
1639 OC4 13 CLA FG .   ? CLA a 1138 . ? 1_555 ? 
1640 OC4 13 CLA GG .   ? CLA a 1139 . ? 1_555 ? 
1641 OC4 13 CLA HG .   ? CLA a 1140 . ? 1_555 ? 
1642 OC4 13 PQN SE .   ? PQN a 2001 . ? 1_555 ? 
1643 OC4 13 LHG ZE .   ? LHG a 5001 . ? 1_555 ? 
1644 OC4 13 VAL N  83  ? VAL f 83   . ? 1_555 ? 
1645 OC4 13 BCR XI .   ? BCR f 4013 . ? 1_555 ? 
1646 OC5 9  HIS I  33  ? HIS a 33   . ? 1_555 ? 
1647 OC5 9  HIS I  56  ? HIS a 56   . ? 1_555 ? 
1648 OC5 9  GLY I  78  ? GLY a 78   . ? 1_555 ? 
1649 OC5 9  HIS I  79  ? HIS a 79   . ? 1_555 ? 
1650 OC5 9  CLA DF .   ? CLA a 1101 . ? 1_555 ? 
1651 OC5 9  CLA GF .   ? CLA a 1104 . ? 1_555 ? 
1652 OC5 9  CLA IF .   ? CLA a 1106 . ? 1_555 ? 
1653 OC5 9  CLA LF .   ? CLA a 1109 . ? 1_555 ? 
1654 OC5 9  LHG ZE .   ? LHG a 5001 . ? 1_555 ? 
1655 OC6 21 HIS I  56  ? HIS a 56   . ? 1_555 ? 
1656 OC6 21 PHE I  58  ? PHE a 58   . ? 1_555 ? 
1657 OC6 21 ILE I  72  ? ILE a 72   . ? 1_555 ? 
1658 OC6 21 HIS I  76  ? HIS a 76   . ? 1_555 ? 
1659 OC6 21 HIS I  79  ? HIS a 79   . ? 1_555 ? 
1660 OC6 21 LEU I  80  ? LEU a 80   . ? 1_555 ? 
1661 OC6 21 VAL I  83  ? VAL a 83   . ? 1_555 ? 
1662 OC6 21 PHE I  84  ? PHE a 84   . ? 1_555 ? 
1663 OC6 21 LEU I  87  ? LEU a 87   . ? 1_555 ? 
1664 OC6 21 MET I  168 ? MET a 168  . ? 1_555 ? 
1665 OC6 21 TRP I  348 ? TRP a 348  . ? 1_555 ? 
1666 OC6 21 HIS I  349 ? HIS a 349  . ? 1_555 ? 
1667 OC6 21 LEU I  352 ? LEU a 352  . ? 1_555 ? 
1668 OC6 21 ASN I  355 ? ASN a 355  . ? 1_555 ? 
1669 OC6 21 LEU I  356 ? LEU a 356  . ? 1_555 ? 
1670 OC6 21 LEU I  359 ? LEU a 359  . ? 1_555 ? 
1671 OC6 21 CLA GF .   ? CLA a 1104 . ? 1_555 ? 
1672 OC6 21 CLA NF .   ? CLA a 1111 . ? 1_555 ? 
1673 OC6 21 CLA BG .   ? CLA a 1128 . ? 1_555 ? 
1674 OC6 21 BCR VE .   ? BCR a 4002 . ? 1_555 ? 
1675 OC6 21 BCR WE .   ? BCR a 4003 . ? 1_555 ? 
1676 OC7 11 HIS I  56  ? HIS a 56   . ? 1_555 ? 
1677 OC7 11 HIS I  79  ? HIS a 79   . ? 1_555 ? 
1678 OC7 11 TRP I  86  ? TRP a 86   . ? 1_555 ? 
1679 OC7 11 CLA EF .   ? CLA a 1102 . ? 1_555 ? 
1680 OC7 11 CLA FF .   ? CLA a 1103 . ? 1_555 ? 
1681 OC7 11 CLA IF .   ? CLA a 1106 . ? 1_555 ? 
1682 OC7 11 CLA ZF .   ? CLA a 1126 . ? 1_555 ? 
1683 OC7 11 CLA AG .   ? CLA a 1127 . ? 1_555 ? 
1684 OC7 11 CLA BG .   ? CLA a 1128 . ? 1_555 ? 
1685 OC7 11 BCR WE .   ? BCR a 4003 . ? 1_555 ? 
1686 OC7 11 LHG ZE .   ? LHG a 5001 . ? 1_555 ? 
1687 OC8 6  VAL I  85  ? VAL a 85   . ? 1_555 ? 
1688 OC8 6  PHE I  92  ? PHE a 92   . ? 1_555 ? 
1689 OC8 6  HIS I  93  ? HIS a 93   . ? 1_555 ? 
1690 OC8 6  TRP I  118 ? TRP a 118  . ? 1_555 ? 
1691 OC8 6  CLA IF .   ? CLA a 1106 . ? 1_555 ? 
1692 OC8 6  CLA JF .   ? CLA a 1107 . ? 1_555 ? 
1693 OC9 20 TRP I  86  ? TRP a 86   . ? 1_555 ? 
1694 OC9 20 MET I  90  ? MET a 90   . ? 1_555 ? 
1695 OC9 20 GLN I  115 ? GLN a 115  . ? 1_555 ? 
1696 OC9 20 GLN I  138 ? GLN a 138  . ? 1_555 ? 
1697 OC9 20 ILE I  139 ? ILE a 139  . ? 1_555 ? 
1698 OC9 20 THR I  140 ? THR a 140  . ? 1_555 ? 
1699 OC9 20 SER I  141 ? SER a 141  . ? 1_555 ? 
1700 OC9 20 LEU I  143 ? LEU a 143  . ? 1_555 ? 
1701 OC9 20 ALA I  667 ? ALA a 667  . ? 1_555 ? 
1702 OC9 20 TYR I  668 ? TYR a 668  . ? 1_555 ? 
1703 OC9 20 CLA JG .   ? CLA a 1012 . ? 1_555 ? 
1704 OC9 20 CLA EF .   ? CLA a 1102 . ? 1_555 ? 
1705 OC9 20 CLA GF .   ? CLA a 1104 . ? 1_555 ? 
1706 OC9 20 CLA HF .   ? CLA a 1105 . ? 1_555 ? 
1707 OC9 20 CLA JF .   ? CLA a 1107 . ? 1_555 ? 
1708 OC9 20 CLA LF .   ? CLA a 1109 . ? 1_555 ? 
1709 OC9 20 CLA ZF .   ? CLA a 1126 . ? 1_555 ? 
1710 OC9 20 LHG ZE .   ? LHG a 5001 . ? 1_555 ? 
1711 OC9 20 BCR ZG .   ? BCR b 4011 . ? 1_555 ? 
1712 OC9 20 BCR XI .   ? BCR f 4013 . ? 1_555 ? 
1713 PC1 14 VAL I  85  ? VAL a 85   . ? 1_555 ? 
1714 PC1 14 GLN I  115 ? GLN a 115  . ? 1_555 ? 
1715 PC1 14 VAL I  116 ? VAL a 116  . ? 1_555 ? 
1716 PC1 14 TRP I  118 ? TRP a 118  . ? 1_555 ? 
1717 PC1 14 GLN I  123 ? GLN a 123  . ? 1_555 ? 
1718 PC1 14 LEU I  126 ? LEU a 126  . ? 1_555 ? 
1719 PC1 14 ILE I  137 ? ILE a 137  . ? 1_555 ? 
1720 PC1 14 ILE I  670 ? ILE a 670  . ? 1_555 ? 
1721 PC1 14 CLA HF .   ? CLA a 1105 . ? 1_555 ? 
1722 PC1 14 CLA IF .   ? CLA a 1106 . ? 1_555 ? 
1723 PC1 14 CLA ZF .   ? CLA a 1126 . ? 1_555 ? 
1724 PC1 14 VAL J  440 ? VAL b 440  . ? 1_555 ? 
1725 PC1 14 PHE J  444 ? PHE b 444  . ? 1_555 ? 
1726 PC1 14 CLA II .   ? CLA b 1230 . ? 1_555 ? 
1727 PC2 10 PHE I  77  ? PHE a 77   . ? 1_555 ? 
1728 PC2 10 LEU I  171 ? LEU a 171  . ? 1_555 ? 
1729 PC2 10 MET I  172 ? MET a 172  . ? 1_555 ? 
1730 PC2 10 PHE I  174 ? PHE a 174  . ? 1_555 ? 
1731 PC2 10 PHE I  178 ? PHE a 178  . ? 1_555 ? 
1732 PC2 10 HIS I  179 ? HIS a 179  . ? 1_555 ? 
1733 PC2 10 LYS I  183 ? LYS a 183  . ? 1_555 ? 
1734 PC2 10 TRP I  189 ? TRP a 189  . ? 1_555 ? 
1735 PC2 10 CLA MF .   ? CLA a 1110 . ? 1_555 ? 
1736 PC2 10 CLA NF .   ? CLA a 1111 . ? 1_555 ? 
1737 PC3 17 THR I  23  ? THR a 23   . ? 1_555 ? 
1738 PC3 17 SER I  24  ? SER a 24   . ? 1_555 ? 
1739 PC3 17 LYS I  27  ? LYS a 27   . ? 1_555 ? 
1740 PC3 17 TRP I  28  ? TRP a 28   . ? 1_555 ? 
1741 PC3 17 HIS I  33  ? HIS a 33   . ? 1_555 ? 
1742 PC3 17 LYS I  71  ? LYS a 71   . ? 1_555 ? 
1743 PC3 17 SER I  74  ? SER a 74   . ? 1_555 ? 
1744 PC3 17 GLY I  78  ? GLY a 78   . ? 1_555 ? 
1745 PC3 17 VAL I  82  ? VAL a 82   . ? 1_555 ? 
1746 PC3 17 LEU I  173 ? LEU a 173  . ? 1_555 ? 
1747 PC3 17 GLY I  176 ? GLY a 176  . ? 1_555 ? 
1748 PC3 17 TRP I  177 ? TRP a 177  . ? 1_555 ? 
1749 PC3 17 TYR I  180 ? TYR a 180  . ? 1_555 ? 
1750 PC3 17 HIS I  181 ? HIS a 181  . ? 1_555 ? 
1751 PC3 17 CLA DF .   ? CLA a 1101 . ? 1_555 ? 
1752 PC3 17 CLA EF .   ? CLA a 1102 . ? 1_555 ? 
1753 PC3 17 CLA IF .   ? CLA a 1106 . ? 1_555 ? 
1754 PC4 9  LYS I  13  ? LYS a 13   . ? 1_555 ? 
1755 PC4 9  TRP I  189 ? TRP a 189  . ? 1_555 ? 
1756 PC4 9  SER I  195 ? SER a 195  . ? 1_555 ? 
1757 PC4 9  HIS I  199 ? HIS a 199  . ? 1_555 ? 
1758 PC4 9  ASN I  314 ? ASN a 314  . ? 1_555 ? 
1759 PC4 9  TRP I  315 ? TRP a 315  . ? 1_555 ? 
1760 PC4 9  CLA KF .   ? CLA a 1108 . ? 1_555 ? 
1761 PC4 9  CLA NF .   ? CLA a 1111 . ? 1_555 ? 
1762 PC4 9  CLA TF .   ? CLA a 1118 . ? 1_555 ? 
1763 PC5 15 PHE I  73  ? PHE a 73   . ? 1_555 ? 
1764 PC5 15 HIS I  76  ? HIS a 76   . ? 1_555 ? 
1765 PC5 15 PHE I  77  ? PHE a 77   . ? 1_555 ? 
1766 PC5 15 LEU I  80  ? LEU a 80   . ? 1_555 ? 
1767 PC5 15 MET I  172 ? MET a 172  . ? 1_555 ? 
1768 PC5 15 TRP I  189 ? TRP a 189  . ? 1_555 ? 
1769 PC5 15 MET I  196 ? MET a 196  . ? 1_555 ? 
1770 PC5 15 HIS I  199 ? HIS a 199  . ? 1_555 ? 
1771 PC5 15 HIS I  200 ? HIS a 200  . ? 1_555 ? 
1772 PC5 15 LEU I  204 ? LEU a 204  . ? 1_555 ? 
1773 PC5 15 CLA FF .   ? CLA a 1103 . ? 1_555 ? 
1774 PC5 15 CLA KF .   ? CLA a 1108 . ? 1_555 ? 
1775 PC5 15 CLA MF .   ? CLA a 1110 . ? 1_555 ? 
1776 PC5 15 CLA WF .   ? CLA a 1123 . ? 1_555 ? 
1777 PC5 15 BCR WE .   ? BCR a 4003 . ? 1_555 ? 
1778 PC6 13 GLY I  151 ? GLY a 151  . ? 1_555 ? 
1779 PC6 13 PHE I  152 ? PHE a 152  . ? 1_555 ? 
1780 PC6 13 GLN I  157 ? GLN a 157  . ? 1_555 ? 
1781 PC6 13 CYS I  160 ? CYS a 160  . ? 1_555 ? 
1782 PC6 13 THR I  161 ? THR a 161  . ? 1_555 ? 
1783 PC6 13 GLY I  211 ? GLY a 211  . ? 1_555 ? 
1784 PC6 13 TRP I  212 ? TRP a 212  . ? 1_555 ? 
1785 PC6 13 HIS I  215 ? HIS a 215  . ? 1_555 ? 
1786 PC6 13 VAL I  219 ? VAL a 219  . ? 1_555 ? 
1787 PC6 13 PRO I  239 ? PRO a 239  . ? 1_555 ? 
1788 PC6 13 CLA PF .   ? CLA a 1113 . ? 1_555 ? 
1789 PC6 13 CLA KG .   ? CLA a 1114 . ? 1_555 ? 
1790 PC6 13 BCR VE .   ? BCR a 4002 . ? 1_555 ? 
1791 PC7 9  LEU I  210 ? LEU a 210  . ? 1_555 ? 
1792 PC7 9  ILE I  217 ? ILE a 217  . ? 1_555 ? 
1793 PC7 9  HIS I  218 ? HIS a 218  . ? 1_555 ? 
1794 PC7 9  PHE I  256 ? PHE a 256  . ? 1_555 ? 
1795 PC7 9  GLY I  259 ? GLY a 259  . ? 1_555 ? 
1796 PC7 9  LEU I  260 ? LEU a 260  . ? 1_555 ? 
1797 PC7 9  CLA OF .   ? CLA a 1112 . ? 1_555 ? 
1798 PC7 9  BCR UE .   ? BCR a 4001 . ? 1_555 ? 
1799 PC7 9  BCR VE .   ? BCR a 4002 . ? 1_555 ? 
1800 PC8 13 TRP I  268 ? TRP a 268  . ? 1_555 ? 
1801 PC8 13 SER I  272 ? SER a 272  . ? 1_555 ? 
1802 PC8 13 LEU I  275 ? LEU a 275  . ? 1_555 ? 
1803 PC8 13 PHE I  277 ? PHE a 277  . ? 1_555 ? 
1804 PC8 13 HIS I  295 ? HIS a 295  . ? 1_555 ? 
1805 PC8 13 LEU I  298 ? LEU a 298  . ? 1_555 ? 
1806 PC8 13 ALA I  299 ? ALA a 299  . ? 1_555 ? 
1807 PC8 13 VAL I  302 ? VAL a 302  . ? 1_555 ? 
1808 PC8 13 ASN I  500 ? ASN a 500  . ? 1_555 ? 
1809 PC8 13 CLA RF .   ? CLA a 1116 . ? 1_555 ? 
1810 PC8 13 CLA QG .   ? CLA a 1134 . ? 1_555 ? 
1811 PC8 13 ALA CA 49  ? ALA k 49   . ? 1_555 ? 
1812 PC8 13 CLA TN .   ? CLA k 1401 . ? 1_555 ? 
1813 PC9 16 PHE I  277 ? PHE a 277  . ? 1_555 ? 
1814 PC9 16 GLY I  279 ? GLY a 279  . ? 1_555 ? 
1815 PC9 16 ASP I  292 ? ASP a 292  . ? 1_555 ? 
1816 PC9 16 HIS I  295 ? HIS a 295  . ? 1_555 ? 
1817 PC9 16 HIS I  296 ? HIS a 296  . ? 1_555 ? 
1818 PC9 16 ALA I  299 ? ALA a 299  . ? 1_555 ? 
1819 PC9 16 ILE I  300 ? ILE a 300  . ? 1_555 ? 
1820 PC9 16 LEU I  303 ? LEU a 303  . ? 1_555 ? 
1821 PC9 16 HIS I  369 ? HIS a 369  . ? 1_555 ? 
1822 PC9 16 MET I  373 ? MET a 373  . ? 1_555 ? 
1823 PC9 16 ALA I  505 ? ALA a 505  . ? 1_555 ? 
1824 PC9 16 CLA QF .   ? CLA a 1115 . ? 1_555 ? 
1825 PC9 16 CLA SF .   ? CLA a 1117 . ? 1_555 ? 
1826 PC9 16 CLA YF .   ? CLA a 1125 . ? 1_555 ? 
1827 PC9 16 CLA PG .   ? CLA a 1133 . ? 1_555 ? 
1828 PC9 16 CLA QG .   ? CLA a 1134 . ? 1_555 ? 
1829 QC1 17 ALA I  149 ? ALA a 149  . ? 1_555 ? 
1830 QC1 17 LEU I  205 ? LEU a 205  . ? 1_555 ? 
1831 QC1 17 GLY I  208 ? GLY a 208  . ? 1_555 ? 
1832 QC1 17 SER I  209 ? SER a 209  . ? 1_555 ? 
1833 QC1 17 TRP I  212 ? TRP a 212  . ? 1_555 ? 
1834 QC1 17 GLN I  216 ? GLN a 216  . ? 1_555 ? 
1835 QC1 17 HIS I  296 ? HIS a 296  . ? 1_555 ? 
1836 QC1 17 HIS I  297 ? HIS a 297  . ? 1_555 ? 
1837 QC1 17 ILE I  300 ? ILE a 300  . ? 1_555 ? 
1838 QC1 17 PHE I  304 ? PHE a 304  . ? 1_555 ? 
1839 QC1 17 LEU I  362 ? LEU a 362  . ? 1_555 ? 
1840 QC1 17 PRO I  375 ? PRO a 375  . ? 1_555 ? 
1841 QC1 17 TYR I  376 ? TYR a 376  . ? 1_555 ? 
1842 QC1 17 CLA RF .   ? CLA a 1116 . ? 1_555 ? 
1843 QC1 17 CLA YF .   ? CLA a 1125 . ? 1_555 ? 
1844 QC1 17 CLA AG .   ? CLA a 1127 . ? 1_555 ? 
1845 QC1 17 BCR WE .   ? BCR a 4003 . ? 1_555 ? 
1846 QC2 15 HIS I  199 ? HIS a 199  . ? 1_555 ? 
1847 QC2 15 ALA I  202 ? ALA a 202  . ? 1_555 ? 
1848 QC2 15 GLY I  203 ? GLY a 203  . ? 1_555 ? 
1849 QC2 15 LEU I  207 ? LEU a 207  . ? 1_555 ? 
1850 QC2 15 ILE I  305 ? ILE a 305  . ? 1_555 ? 
1851 QC2 15 HIS I  309 ? HIS a 309  . ? 1_555 ? 
1852 QC2 15 THR I  313 ? THR a 313  . ? 1_555 ? 
1853 QC2 15 TRP I  315 ? TRP a 315  . ? 1_555 ? 
1854 QC2 15 ILE I  317 ? ILE a 317  . ? 1_555 ? 
1855 QC2 15 CLA MF .   ? CLA a 1110 . ? 1_555 ? 
1856 QC2 15 BCR UE .   ? BCR a 4001 . ? 1_555 ? 
1857 QC2 15 BCR VE .   ? BCR a 4002 . ? 1_555 ? 
1858 QC2 15 BCR WE .   ? BCR a 4003 . ? 1_555 ? 
1859 QC2 15 LEU CA 105 ? LEU k 105  . ? 1_555 ? 
1860 QC2 15 SER CA 109 ? SER k 109  . ? 1_555 ? 
1861 QC3 17 MET I  197 ? MET a 197  . ? 1_555 ? 
1862 QC3 17 LEU I  201 ? LEU a 201  . ? 1_555 ? 
1863 QC3 17 LEU I  205 ? LEU a 205  . ? 1_555 ? 
1864 QC3 17 PHE I  304 ? PHE a 304  . ? 1_555 ? 
1865 QC3 17 ALA I  307 ? ALA a 307  . ? 1_555 ? 
1866 QC3 17 MET I  310 ? MET a 310  . ? 1_555 ? 
1867 QC3 17 TYR I  311 ? TYR a 311  . ? 1_555 ? 
1868 QC3 17 MET I  429 ? MET a 429  . ? 1_555 ? 
1869 QC3 17 LEU I  550 ? LEU a 550  . ? 1_555 ? 
1870 QC3 17 LEU I  554 ? LEU a 554  . ? 1_555 ? 
1871 QC3 17 CLA LG .   ? CLA a 1120 . ? 1_555 ? 
1872 QC3 17 CLA MG .   ? CLA a 1121 . ? 1_555 ? 
1873 QC3 17 CLA VF .   ? CLA a 1122 . ? 1_555 ? 
1874 QC3 17 CLA WF .   ? CLA a 1123 . ? 1_555 ? 
1875 QC3 17 CLA YF .   ? CLA a 1125 . ? 1_555 ? 
1876 QC3 17 BCR XE .   ? BCR a 4007 . ? 1_555 ? 
1877 QC3 17 BCR YE .   ? BCR a 4008 . ? 1_555 ? 
1878 QC4 15 ILE I  324 ? ILE a 324  . ? 1_555 ? 
1879 QC4 15 LEU I  325 ? LEU a 325  . ? 1_555 ? 
1880 QC4 15 HIS I  328 ? HIS a 328  . ? 1_555 ? 
1881 QC4 15 THR I  333 ? THR a 333  . ? 1_555 ? 
1882 QC4 15 HIS I  337 ? HIS a 337  . ? 1_555 ? 
1883 QC4 15 LEU I  340 ? LEU a 340  . ? 1_555 ? 
1884 QC4 15 LEU I  426 ? LEU a 426  . ? 1_555 ? 
1885 QC4 15 MET I  429 ? MET a 429  . ? 1_555 ? 
1886 QC4 15 CLA UF .   ? CLA a 1119 . ? 1_555 ? 
1887 QC4 15 CLA MG .   ? CLA a 1121 . ? 1_555 ? 
1888 QC4 15 CLA WF .   ? CLA a 1123 . ? 1_555 ? 
1889 QC4 15 CLA NG .   ? CLA a 1129 . ? 1_555 ? 
1890 QC4 15 CLA RE .   ? CLA a 1801 . ? 1_555 ? 
1891 QC4 15 BCR XE .   ? BCR a 4007 . ? 1_555 ? 
1892 QC4 15 LHG AF .   ? LHG a 5003 . ? 1_555 ? 
1893 QC5 18 PHE I  190 ? PHE a 190  . ? 1_555 ? 
1894 QC5 18 VAL I  193 ? VAL a 193  . ? 1_555 ? 
1895 QC5 18 MET I  196 ? MET a 196  . ? 1_555 ? 
1896 QC5 18 MET I  197 ? MET a 197  . ? 1_555 ? 
1897 QC5 18 HIS I  200 ? HIS a 200  . ? 1_555 ? 
1898 QC5 18 MET I  321 ? MET a 321  . ? 1_555 ? 
1899 QC5 18 LEU I  344 ? LEU a 344  . ? 1_555 ? 
1900 QC5 18 THR I  345 ? THR a 345  . ? 1_555 ? 
1901 QC5 18 THR I  346 ? THR a 346  . ? 1_555 ? 
1902 QC5 18 TRP I  348 ? TRP a 348  . ? 1_555 ? 
1903 QC5 18 ILE I  354 ? ILE a 354  . ? 1_555 ? 
1904 QC5 18 ASN I  355 ? ASN a 355  . ? 1_555 ? 
1905 QC5 18 LEU I  358 ? LEU a 358  . ? 1_555 ? 
1906 QC5 18 CLA NF .   ? CLA a 1111 . ? 1_555 ? 
1907 QC5 18 CLA UF .   ? CLA a 1119 . ? 1_555 ? 
1908 QC5 18 CLA VF .   ? CLA a 1122 . ? 1_555 ? 
1909 QC5 18 CLA AG .   ? CLA a 1127 . ? 1_555 ? 
1910 QC5 18 BCR XE .   ? BCR a 4007 . ? 1_555 ? 
1911 QC6 9  ILE I  364 ? ILE a 364  . ? 1_555 ? 
1912 QC6 9  GLN I  368 ? GLN a 368  . ? 1_555 ? 
1913 QC6 9  ILE I  401 ? ILE a 401  . ? 1_555 ? 
1914 QC6 9  THR I  545 ? THR a 545  . ? 1_555 ? 
1915 QC6 9  SER I  601 ? SER a 601  . ? 1_555 ? 
1916 QC6 9  CLA YF .   ? CLA a 1125 . ? 1_555 ? 
1917 QC6 9  CLA RG .   ? CLA a 1135 . ? 1_555 ? 
1918 QC6 9  CLA EG .   ? CLA a 1137 . ? 1_555 ? 
1919 QC6 9  BCR YE .   ? BCR a 4008 . ? 1_555 ? 
1920 QC7 14 LEU I  358 ? LEU a 358  . ? 1_555 ? 
1921 QC7 14 GLN I  368 ? GLN a 368  . ? 1_555 ? 
1922 QC7 14 HIS I  369 ? HIS a 369  . ? 1_555 ? 
1923 QC7 14 TYR I  371 ? TYR a 371  . ? 1_555 ? 
1924 QC7 14 ALA I  372 ? ALA a 372  . ? 1_555 ? 
1925 QC7 14 MET I  373 ? MET a 373  . ? 1_555 ? 
1926 QC7 14 SER I  506 ? SER a 506  . ? 1_555 ? 
1927 QC7 14 PHE I  509 ? PHE a 509  . ? 1_555 ? 
1928 QC7 14 CLA RF .   ? CLA a 1116 . ? 1_555 ? 
1929 QC7 14 CLA SF .   ? CLA a 1117 . ? 1_555 ? 
1930 QC7 14 CLA UF .   ? CLA a 1119 . ? 1_555 ? 
1931 QC7 14 CLA XF .   ? CLA a 1124 . ? 1_555 ? 
1932 QC7 14 CLA PG .   ? CLA a 1133 . ? 1_555 ? 
1933 QC7 14 BCR YE .   ? BCR a 4008 . ? 1_555 ? 
1934 QC8 15 TRP I  86  ? TRP a 86   . ? 1_555 ? 
1935 QC8 15 SER I  141 ? SER a 141  . ? 1_555 ? 
1936 QC8 15 SER I  388 ? SER a 388  . ? 1_555 ? 
1937 QC8 15 THR I  391 ? THR a 391  . ? 1_555 ? 
1938 QC8 15 HIS I  392 ? HIS a 392  . ? 1_555 ? 
1939 QC8 15 TRP I  395 ? TRP a 395  . ? 1_555 ? 
1940 QC8 15 PHE I  399 ? PHE a 399  . ? 1_555 ? 
1941 QC8 15 ILE I  736 ? ILE a 736  . ? 1_555 ? 
1942 QC8 15 TRP I  740 ? TRP a 740  . ? 1_555 ? 
1943 QC8 15 CLA DF .   ? CLA a 1101 . ? 1_555 ? 
1944 QC8 15 CLA GF .   ? CLA a 1104 . ? 1_555 ? 
1945 QC8 15 CLA IF .   ? CLA a 1106 . ? 1_555 ? 
1946 QC8 15 CLA JF .   ? CLA a 1107 . ? 1_555 ? 
1947 QC8 15 CLA AG .   ? CLA a 1127 . ? 1_555 ? 
1948 QC8 15 BCR ZG .   ? BCR b 4011 . ? 1_555 ? 
1949 QC9 16 SER I  141 ? SER a 141  . ? 1_555 ? 
1950 QC9 16 GLY I  142 ? GLY a 142  . ? 1_555 ? 
1951 QC9 16 LEU I  146 ? LEU a 146  . ? 1_555 ? 
1952 QC9 16 LEU I  359 ? LEU a 359  . ? 1_555 ? 
1953 QC9 16 THR I  363 ? THR a 363  . ? 1_555 ? 
1954 QC9 16 VAL I  366 ? VAL a 366  . ? 1_555 ? 
1955 QC9 16 MET I  370 ? MET a 370  . ? 1_555 ? 
1956 QC9 16 TYR I  376 ? TYR a 376  . ? 1_555 ? 
1957 QC9 16 LEU I  389 ? LEU a 389  . ? 1_555 ? 
1958 QC9 16 HIS I  392 ? HIS a 392  . ? 1_555 ? 
1959 QC9 16 HIS I  393 ? HIS a 393  . ? 1_555 ? 
1960 QC9 16 CLA GF .   ? CLA a 1104 . ? 1_555 ? 
1961 QC9 16 CLA SF .   ? CLA a 1117 . ? 1_555 ? 
1962 QC9 16 CLA WF .   ? CLA a 1123 . ? 1_555 ? 
1963 QC9 16 CLA ZF .   ? CLA a 1126 . ? 1_555 ? 
1964 QC9 16 BCR WE .   ? BCR a 4003 . ? 1_555 ? 
1965 RC1 18 HIS I  52  ? HIS a 52   . ? 1_555 ? 
1966 RC1 18 ALA I  53  ? ALA a 53   . ? 1_555 ? 
1967 RC1 18 HIS I  56  ? HIS a 56   . ? 1_555 ? 
1968 RC1 18 LEU I  352 ? LEU a 352  . ? 1_555 ? 
1969 RC1 18 LEU I  356 ? LEU a 356  . ? 1_555 ? 
1970 RC1 18 PHE I  399 ? PHE a 399  . ? 1_555 ? 
1971 RC1 18 GLY I  403 ? GLY a 403  . ? 1_555 ? 
1972 RC1 18 HIS I  407 ? HIS a 407  . ? 1_555 ? 
1973 RC1 18 ILE I  410 ? ILE a 410  . ? 1_555 ? 
1974 RC1 18 ARG I  414 ? ARG a 414  . ? 1_555 ? 
1975 RC1 18 PHE I  570 ? PHE a 570  . ? 1_555 ? 
1976 RC1 18 ARG I  571 ? ARG a 571  . ? 1_555 ? 
1977 RC1 18 TRP I  588 ? TRP a 588  . ? 1_555 ? 
1978 RC1 18 CLA FF .   ? CLA a 1103 . ? 1_555 ? 
1979 RC1 18 CLA GF .   ? CLA a 1104 . ? 1_555 ? 
1980 RC1 18 CLA HG .   ? CLA a 1140 . ? 1_555 ? 
1981 RC1 18 LHG ZE .   ? LHG a 5001 . ? 1_555 ? 
1982 RC1 18 BCR ZG .   ? BCR b 4011 . ? 1_555 ? 
1983 RC2 11 HIS I  439 ? HIS a 439  . ? 1_555 ? 
1984 RC2 11 CLA NG .   ? CLA a 1129 . ? 1_555 ? 
1985 RC2 11 CLA EG .   ? CLA a 1137 . ? 1_555 ? 
1986 RC2 11 ALA J  678 ? ALA b 678  . ? 1_555 ? 
1987 RC2 11 THR J  682 ? THR b 682  . ? 1_555 ? 
1988 RC2 11 PRO J  683 ? PRO b 683  . ? 1_555 ? 
1989 RC2 11 HIS P  19  ? HIS l 19   . ? 1_555 ? 
1990 RC2 11 LEU P  20  ? LEU l 20   . ? 1_555 ? 
1991 RC2 11 THR P  22  ? THR l 22   . ? 1_555 ? 
1992 RC2 11 ILE P  24  ? ILE l 24   . ? 1_555 ? 
1993 RC2 11 SER P  25  ? SER l 25   . ? 1_555 ? 
1994 RC3 12 TRP I  442 ? TRP a 442  . ? 1_555 ? 
1995 RC3 12 PHE I  446 ? PHE a 446  . ? 1_555 ? 
1996 RC3 12 PHE I  449 ? PHE a 449  . ? 1_555 ? 
1997 RC3 12 HIS I  450 ? HIS a 450  . ? 1_555 ? 
1998 RC3 12 CLA OG .   ? CLA a 1132 . ? 1_555 ? 
1999 RC3 12 CLA GH .   ? CLA b 1023 . ? 1_555 ? 
2000 RC3 12 CLA RI .   ? CLA b 1238 . ? 1_555 ? 
2001 RC3 12 CLA SI .   ? CLA b 1239 . ? 1_555 ? 
2002 RC3 12 PQN TG .   ? PQN b 2002 . ? 1_555 ? 
2003 RC3 12 BCR BH .   ? BCR b 4017 . ? 1_555 ? 
2004 RC3 12 BCR VI .   ? BCR f 4018 . ? 1_555 ? 
2005 RC3 12 BCR WI .   ? BCR f 4020 . ? 1_555 ? 
2006 RC4 12 LEU I  440 ? LEU a 440  . ? 1_555 ? 
2007 RC4 12 TRP I  442 ? TRP a 442  . ? 1_555 ? 
2008 RC4 12 VAL I  443 ? VAL a 443  . ? 1_555 ? 
2009 RC4 12 ALA I  539 ? ALA a 539  . ? 1_555 ? 
2010 RC4 12 HIS I  543 ? HIS a 543  . ? 1_555 ? 
2011 RC4 12 CLA XF .   ? CLA a 1124 . ? 1_555 ? 
2012 RC4 12 CLA NG .   ? CLA a 1129 . ? 1_555 ? 
2013 RC4 12 CLA CG .   ? CLA a 1130 . ? 1_555 ? 
2014 RC4 12 CLA RG .   ? CLA a 1135 . ? 1_555 ? 
2015 RC4 12 CLA SG .   ? CLA a 1136 . ? 1_555 ? 
2016 RC4 12 BCR YE .   ? BCR a 4008 . ? 1_555 ? 
2017 RC4 12 LHG AF .   ? LHG a 5003 . ? 1_555 ? 
2018 RC5 14 ILE I  700 ? ILE a 700  . ? 1_555 ? 
2019 RC5 14 ALA I  703 ? ALA a 703  . ? 1_555 ? 
2020 RC5 14 HIS I  704 ? HIS a 704  . ? 1_555 ? 
2021 RC5 14 LEU I  707 ? LEU a 707  . ? 1_555 ? 
2022 RC5 14 CLA DF .   ? CLA a 1101 . ? 1_555 ? 
2023 RC5 14 CLA GG .   ? CLA a 1139 . ? 1_555 ? 
2024 RC5 14 SER J  418 ? SER b 418  . ? 1_555 ? 
2025 RC5 14 SER J  421 ? SER b 421  . ? 1_555 ? 
2026 RC5 14 TRP J  422 ? TRP b 422  . ? 1_555 ? 
2027 RC5 14 LEU J  425 ? LEU b 425  . ? 1_555 ? 
2028 RC5 14 CLA GI .   ? CLA b 1228 . ? 1_555 ? 
2029 RC5 14 CLA HI .   ? CLA b 1229 . ? 1_555 ? 
2030 RC5 14 BCR AH .   ? BCR b 4014 . ? 1_555 ? 
2031 RC5 14 GLY N  62  ? GLY f 62   . ? 1_555 ? 
2032 RC6 12 THR I  45  ? THR a 45   . ? 1_555 ? 
2033 RC6 12 VAL I  701 ? VAL a 701  . ? 1_555 ? 
2034 RC6 12 HIS I  704 ? HIS a 704  . ? 1_555 ? 
2035 RC6 12 VAL I  709 ? VAL a 709  . ? 1_555 ? 
2036 RC6 12 PRO I  711 ? PRO a 711  . ? 1_555 ? 
2037 RC6 12 PRO I  715 ? PRO a 715  . ? 1_555 ? 
2038 RC6 12 ARG I  716 ? ARG a 716  . ? 1_555 ? 
2039 RC6 12 CLA DF .   ? CLA a 1101 . ? 1_555 ? 
2040 RC6 12 CLA FG .   ? CLA a 1138 . ? 1_555 ? 
2041 RC6 12 PQN SE .   ? PQN a 2001 . ? 1_555 ? 
2042 RC6 12 SER N  9   ? SER f 9    . ? 1_555 ? 
2043 RC6 12 ALA N  90  ? ALA f 90   . ? 1_555 ? 
2044 RC7 14 TRP I  49  ? TRP a 49   . ? 1_555 ? 
2045 RC7 14 PHE I  681 ? PHE a 681  . ? 1_555 ? 
2046 RC7 14 GLN I  722 ? GLN a 722  . ? 1_555 ? 
2047 RC7 14 VAL I  726 ? VAL a 726  . ? 1_555 ? 
2048 RC7 14 ALA I  729 ? ALA a 729  . ? 1_555 ? 
2049 RC7 14 HIS I  730 ? HIS a 730  . ? 1_555 ? 
2050 RC7 14 CLA DF .   ? CLA a 1101 . ? 1_555 ? 
2051 RC7 14 CLA BG .   ? CLA a 1128 . ? 1_555 ? 
2052 RC7 14 PQN SE .   ? PQN a 2001 . ? 1_555 ? 
2053 RC7 14 LHG ZE .   ? LHG a 5001 . ? 1_555 ? 
2054 RC7 14 CLA EH .   ? CLA b 1013 . ? 1_555 ? 
2055 RC7 14 BCR ZG .   ? BCR b 4011 . ? 1_555 ? 
2056 RC7 14 ILE N  15  ? ILE f 15   . ? 1_555 ? 
2057 RC7 14 BCR XI .   ? BCR f 4013 . ? 1_555 ? 
2058 RC8 18 TYR I  599 ? TYR a 599  . ? 1_555 ? 
2059 RC8 18 ILE I  604 ? ILE a 604  . ? 1_555 ? 
2060 RC8 18 PHE I  607 ? PHE a 607  . ? 1_555 ? 
2061 RC8 18 TRP I  645 ? TRP a 645  . ? 1_555 ? 
2062 RC8 18 LEU I  650 ? LEU a 650  . ? 1_555 ? 
2063 RC8 18 ALA I  654 ? ALA a 654  . ? 1_555 ? 
2064 RC8 18 HIS I  676 ? HIS a 676  . ? 1_555 ? 
2065 RC8 18 PHE I  679 ? PHE a 679  . ? 1_555 ? 
2066 RC8 18 TYR I  731 ? TYR a 731  . ? 1_555 ? 
2067 RC8 18 GLY I  735 ? GLY a 735  . ? 1_555 ? 
2068 RC8 18 THR I  738 ? THR a 738  . ? 1_555 ? 
2069 RC8 18 THR I  739 ? THR a 739  . ? 1_555 ? 
2070 RC8 18 PHE I  742 ? PHE a 742  . ? 1_555 ? 
2071 RC8 18 CLA JG .   ? CLA a 1012 . ? 1_555 ? 
2072 RC8 18 CLA CF .   ? CLA a 1022 . ? 1_555 ? 
2073 RC8 18 PHE J  617 ? PHE b 617  . ? 1_555 ? 
2074 RC8 18 TRP J  622 ? TRP b 622  . ? 1_555 ? 
2075 RC8 18 CLA FH .   ? CLA b 1021 . ? 1_555 ? 
2076 RC9 18 ILE I  670 ? ILE a 670  . ? 1_555 ? 
2077 RC9 18 MET I  671 ? MET a 671  . ? 1_555 ? 
2078 RC9 18 LEU I  673 ? LEU a 673  . ? 1_555 ? 
2079 RC9 18 ALA I  674 ? ALA a 674  . ? 1_555 ? 
2080 RC9 18 HIS I  676 ? HIS a 676  . ? 1_555 ? 
2081 RC9 18 PHE I  677 ? PHE a 677  . ? 1_555 ? 
2082 RC9 18 ALA I  680 ? ALA a 680  . ? 1_555 ? 
2083 RC9 18 CLA IG .   ? CLA a 1011 . ? 1_555 ? 
2084 RC9 18 CLA IF .   ? CLA a 1106 . ? 1_555 ? 
2085 RC9 18 PHE J  578 ? PHE b 578  . ? 1_555 ? 
2086 RC9 18 TRP J  579 ? TRP b 579  . ? 1_555 ? 
2087 RC9 18 ASN J  582 ? ASN b 582  . ? 1_555 ? 
2088 RC9 18 TRP J  586 ? TRP b 586  . ? 1_555 ? 
2089 RC9 18 LEU J  613 ? LEU b 613  . ? 1_555 ? 
2090 RC9 18 PHE J  710 ? PHE b 710  . ? 1_555 ? 
2091 RC9 18 CLA EH .   ? CLA b 1013 . ? 1_555 ? 
2092 RC9 18 CLA FH .   ? CLA b 1021 . ? 1_555 ? 
2093 RC9 18 BCR ZG .   ? BCR b 4011 . ? 1_555 ? 
2094 SC1 4  LEU I  238 ? LEU a 238  . ? 1_555 ? 
2095 SC1 4  HIS I  240 ? HIS a 240  . ? 1_555 ? 
2096 SC1 4  LEU I  244 ? LEU a 244  . ? 1_555 ? 
2097 SC1 4  CLA OF .   ? CLA a 1112 . ? 1_555 ? 
2098 SC2 10 ILE I  306 ? ILE a 306  . ? 1_555 ? 
2099 SC2 10 HIS I  309 ? HIS a 309  . ? 1_555 ? 
2100 SC2 10 MET I  310 ? MET a 310  . ? 1_555 ? 
2101 SC2 10 GLY I  318 ? GLY a 318  . ? 1_555 ? 
2102 SC2 10 HIS I  319 ? HIS a 319  . ? 1_555 ? 
2103 SC2 10 CLA UF .   ? CLA a 1119 . ? 1_555 ? 
2104 SC2 10 CLA MG .   ? CLA a 1121 . ? 1_555 ? 
2105 SC2 10 BCR UE .   ? BCR a 4001 . ? 1_555 ? 
2106 SC2 10 PHE CA 72  ? PHE k 72   . ? 1_555 ? 
2107 SC2 10 PHE CA 77  ? PHE k 77   . ? 1_555 ? 
2108 SC3 7  HIS I  319 ? HIS a 319  . ? 1_555 ? 
2109 SC3 7  ILE I  324 ? ILE a 324  . ? 1_555 ? 
2110 SC3 7  HIS I  328 ? HIS a 328  . ? 1_555 ? 
2111 SC3 7  CLA UF .   ? CLA a 1119 . ? 1_555 ? 
2112 SC3 7  CLA LG .   ? CLA a 1120 . ? 1_555 ? 
2113 SC3 7  CLA VF .   ? CLA a 1122 . ? 1_555 ? 
2114 SC3 7  CLA RE .   ? CLA a 1801 . ? 1_555 ? 
2115 SC4 14 PHE I  332 ? PHE a 332  . ? 1_555 ? 
2116 SC4 14 THR I  333 ? THR a 333  . ? 1_555 ? 
2117 SC4 14 LEU I  425 ? LEU a 425  . ? 1_555 ? 
2118 SC4 14 ARG I  428 ? ARG a 428  . ? 1_555 ? 
2119 SC4 14 HIS I  432 ? HIS a 432  . ? 1_555 ? 
2120 SC4 14 ILE I  436 ? ILE a 436  . ? 1_555 ? 
2121 SC4 14 HIS I  439 ? HIS a 439  . ? 1_555 ? 
2122 SC4 14 CLA VF .   ? CLA a 1122 . ? 1_555 ? 
2123 SC4 14 CLA CG .   ? CLA a 1130 . ? 1_555 ? 
2124 SC4 14 CLA EG .   ? CLA a 1137 . ? 1_555 ? 
2125 SC4 14 LHG AF .   ? LHG a 5003 . ? 1_555 ? 
2126 SC4 14 VAL P  8   ? VAL l 8    . ? 1_555 ? 
2127 SC4 14 LEU P  20  ? LEU l 20   . ? 1_555 ? 
2128 SC4 14 PRO P  23  ? PRO l 23   . ? 1_555 ? 
2129 SC5 19 PHE I  449 ? PHE a 449  . ? 1_555 ? 
2130 SC5 19 GLY I  453 ? GLY a 453  . ? 1_555 ? 
2131 SC5 19 LEU I  454 ? LEU a 454  . ? 1_555 ? 
2132 SC5 19 ILE I  456 ? ILE a 456  . ? 1_555 ? 
2133 SC5 19 HIS I  457 ? HIS a 457  . ? 1_555 ? 
2134 SC5 19 THR I  460 ? THR a 460  . ? 1_555 ? 
2135 SC5 19 MET I  461 ? MET a 461  . ? 1_555 ? 
2136 SC5 19 ARG I  466 ? ARG a 466  . ? 1_555 ? 
2137 SC5 19 CLA DG .   ? CLA a 1131 . ? 1_555 ? 
2138 SC5 19 HIS J  95  ? HIS b 95   . ? 1_555 ? 
2139 SC5 19 CLA MH .   ? CLA b 1207 . ? 1_555 ? 
2140 SC5 19 BCR WI .   ? BCR f 4020 . ? 1_555 ? 
2141 SC5 19 PRO P  64  ? PRO l 64   . ? 1_555 ? 
2142 SC5 19 TRP P  65  ? TRP l 65   . ? 1_555 ? 
2143 SC5 19 LEU P  68  ? LEU l 68   . ? 1_555 ? 
2144 SC5 19 GLY P  69  ? GLY l 69   . ? 1_555 ? 
2145 SC5 19 PRO P  70  ? PRO l 70   . ? 1_555 ? 
2146 SC5 19 CLA AJ .   ? CLA l 1503 . ? 1_555 ? 
2147 SC5 19 BCR CJ .   ? BCR l 4022 . ? 1_555 ? 
2148 SC6 9  LEU I  489 ? LEU a 489  . ? 1_555 ? 
2149 SC6 9  HIS I  490 ? HIS a 490  . ? 1_555 ? 
2150 SC6 9  ALA I  493 ? ALA a 493  . ? 1_555 ? 
2151 SC6 9  THR I  497 ? THR a 497  . ? 1_555 ? 
2152 SC6 9  ALA I  498 ? ALA a 498  . ? 1_555 ? 
2153 SC6 9  CLA RF .   ? CLA a 1116 . ? 1_555 ? 
2154 SC6 9  CLA YF .   ? CLA a 1125 . ? 1_555 ? 
2155 SC6 9  CLA QG .   ? CLA a 1134 . ? 1_555 ? 
2156 SC6 9  CLA RG .   ? CLA a 1135 . ? 1_555 ? 
2157 SC7 8  PHE I  277 ? PHE a 277  . ? 1_555 ? 
2158 SC7 8  THR I  497 ? THR a 497  . ? 1_555 ? 
2159 SC7 8  ALA I  498 ? ALA a 498  . ? 1_555 ? 
2160 SC7 8  PRO I  499 ? PRO a 499  . ? 1_555 ? 
2161 SC7 8  ASN I  500 ? ASN a 500  . ? 1_555 ? 
2162 SC7 8  CLA QF .   ? CLA a 1115 . ? 1_555 ? 
2163 SC7 8  CLA RF .   ? CLA a 1116 . ? 1_555 ? 
2164 SC7 8  CLA PG .   ? CLA a 1133 . ? 1_555 ? 
2165 SC8 16 GLN I  368 ? GLN a 368  . ? 1_555 ? 
2166 SC8 16 TYR I  371 ? TYR a 371  . ? 1_555 ? 
2167 SC8 16 PHE I  482 ? PHE a 482  . ? 1_555 ? 
2168 SC8 16 ALA I  483 ? ALA a 483  . ? 1_555 ? 
2169 SC8 16 VAL I  486 ? VAL a 486  . ? 1_555 ? 
2170 SC8 16 GLN I  487 ? GLN a 487  . ? 1_555 ? 
2171 SC8 16 PHE I  509 ? PHE a 509  . ? 1_555 ? 
2172 SC8 16 ILE I  525 ? ILE a 525  . ? 1_555 ? 
2173 SC8 16 HIS I  535 ? HIS a 535  . ? 1_555 ? 
2174 SC8 16 HIS I  538 ? HIS a 538  . ? 1_555 ? 
2175 SC8 16 VAL I  605 ? VAL a 605  . ? 1_555 ? 
2176 SC8 16 HIS I  608 ? HIS a 608  . ? 1_555 ? 
2177 SC8 16 CLA XF .   ? CLA a 1124 . ? 1_555 ? 
2178 SC8 16 CLA PG .   ? CLA a 1133 . ? 1_555 ? 
2179 SC8 16 CLA SG .   ? CLA a 1136 . ? 1_555 ? 
2180 SC8 16 CLA EG .   ? CLA a 1137 . ? 1_555 ? 
2181 SC9 13 PHE I  446 ? PHE a 446  . ? 1_555 ? 
2182 SC9 13 LEU I  447 ? LEU a 447  . ? 1_555 ? 
2183 SC9 13 GLN I  479 ? GLN a 479  . ? 1_555 ? 
2184 SC9 13 PRO I  480 ? PRO a 480  . ? 1_555 ? 
2185 SC9 13 ILE I  481 ? ILE a 481  . ? 1_555 ? 
2186 SC9 13 PHE I  482 ? PHE a 482  . ? 1_555 ? 
2187 SC9 13 ALA I  483 ? ALA a 483  . ? 1_555 ? 
2188 SC9 13 PHE I  532 ? PHE a 532  . ? 1_555 ? 
2189 SC9 13 HIS I  535 ? HIS a 535  . ? 1_555 ? 
2190 SC9 13 HIS I  536 ? HIS a 536  . ? 1_555 ? 
2191 SC9 13 CLA RG .   ? CLA a 1135 . ? 1_555 ? 
2192 SC9 13 CLA EG .   ? CLA a 1137 . ? 1_555 ? 
2193 SC9 13 LHG AF .   ? LHG a 5003 . ? 1_555 ? 
2194 TC1 13 CLA DG .   ? CLA a 1131 . ? 1_555 ? 
2195 TC1 13 MET J  659 ? MET b 659  . ? 1_555 ? 
2196 TC1 13 SER J  663 ? SER b 663  . ? 1_555 ? 
2197 TC1 13 TRP J  664 ? TRP b 664  . ? 1_555 ? 
2198 TC1 13 ARG J  665 ? ARG b 665  . ? 1_555 ? 
2199 TC1 13 TRP J  668 ? TRP b 668  . ? 1_555 ? 
2200 TC1 13 ALA J  696 ? ALA b 696  . ? 1_555 ? 
2201 TC1 13 LEU J  697 ? LEU b 697  . ? 1_555 ? 
2202 TC1 13 ALA J  702 ? ALA b 702  . ? 1_555 ? 
2203 TC1 13 CLA RI .   ? CLA b 1238 . ? 1_555 ? 
2204 TC1 13 CLA SI .   ? CLA b 1239 . ? 1_555 ? 
2205 TC1 13 BCR BH .   ? BCR b 4017 . ? 1_555 ? 
2206 TC1 13 BCR BJ .   ? BCR l 4019 . ? 1_555 ? 
2207 TC2 8  LEU J  188 ? LEU b 188  . ? 1_555 ? 
2208 TC2 8  PHE J  225 ? PHE b 225  . ? 1_555 ? 
2209 TC2 8  ILE J  285 ? ILE b 285  . ? 1_555 ? 
2210 TC2 8  HIS J  289 ? HIS b 289  . ? 1_555 ? 
2211 TC2 8  ILE J  297 ? ILE b 297  . ? 1_555 ? 
2212 TC2 8  CLA QH .   ? CLA b 1212 . ? 1_555 ? 
2213 TC2 8  CLA VH .   ? CLA b 1217 . ? 1_555 ? 
2214 TC2 8  CLA WH .   ? CLA b 1218 . ? 1_555 ? 
2215 TC3 8  PHE J  58  ? PHE b 58   . ? 1_555 ? 
2216 TC3 8  PHE J  149 ? PHE b 149  . ? 1_555 ? 
2217 TC3 8  GLY J  181 ? GLY b 181  . ? 1_555 ? 
2218 TC3 8  SER J  186 ? SER b 186  . ? 1_555 ? 
2219 TC3 8  CLA JH .   ? CLA b 1203 . ? 1_555 ? 
2220 TC3 8  CLA OH .   ? CLA b 1209 . ? 1_555 ? 
2221 TC3 8  CLA PH .   ? CLA b 1210 . ? 1_555 ? 
2222 TC3 8  CLA DI .   ? CLA b 1225 . ? 1_555 ? 
2223 TC4 4  MET J  129 ? MET b 129  . ? 1_555 ? 
2224 TC4 4  TRP J  209 ? TRP b 209  . ? 1_555 ? 
2225 TC4 4  CLA QI .   ? CLA b 1211 . ? 1_555 ? 
2226 TC4 4  CLA QH .   ? CLA b 1212 . ? 1_555 ? 
2227 TC5 5  CLA YH .   ? CLA b 1220 . ? 1_555 ? 
2228 TC5 5  CLA BI .   ? CLA b 1223 . ? 1_555 ? 
2229 TC5 5  CLA FI .   ? CLA b 1227 . ? 1_555 ? 
2230 TC5 5  CLA OI .   ? CLA b 1240 . ? 1_555 ? 
2231 TC5 5  BCR YG .   ? BCR b 4010 . ? 1_555 ? 
2232 TC6 14 PHE J  330 ? PHE b 330  . ? 1_555 ? 
2233 TC6 14 GLY J  333 ? GLY b 333  . ? 1_555 ? 
2234 TC6 14 LEU J  334 ? LEU b 334  . ? 1_555 ? 
2235 TC6 14 ALA J  337 ? ALA b 337  . ? 1_555 ? 
2236 TC6 14 MET J  381 ? MET b 381  . ? 1_555 ? 
2237 TC6 14 ALA J  384 ? ALA b 384  . ? 1_555 ? 
2238 TC6 14 PHE J  385 ? PHE b 385  . ? 1_555 ? 
2239 TC6 14 PHE J  392 ? PHE b 392  . ? 1_555 ? 
2240 TC6 14 CLA UH .   ? CLA b 1216 . ? 1_555 ? 
2241 TC6 14 CLA AI .   ? CLA b 1222 . ? 1_555 ? 
2242 TC6 14 CLA BI .   ? CLA b 1223 . ? 1_555 ? 
2243 TC6 14 CLA KI .   ? CLA b 1232 . ? 1_555 ? 
2244 TC6 14 BCR XG .   ? BCR b 4009 . ? 1_555 ? 
2245 TC6 14 LHG DH .   ? LHG b 5004 . ? 1_555 ? 
2246 TC7 10 PHE I  677 ? PHE a 677  . ? 1_555 ? 
2247 TC7 10 LEU I  733 ? LEU a 733  . ? 1_555 ? 
2248 TC7 10 VAL I  737 ? VAL a 737  . ? 1_555 ? 
2249 TC7 10 CLA JG .   ? CLA a 1012 . ? 1_555 ? 
2250 TC7 10 CLA IF .   ? CLA a 1106 . ? 1_555 ? 
2251 TC7 10 CLA ZF .   ? CLA a 1126 . ? 1_555 ? 
2252 TC7 10 CLA BG .   ? CLA a 1128 . ? 1_555 ? 
2253 TC7 10 CLA HG .   ? CLA a 1140 . ? 1_555 ? 
2254 TC7 10 CLA EH .   ? CLA b 1013 . ? 1_555 ? 
2255 TC7 10 CLA II .   ? CLA b 1230 . ? 1_555 ? 
2256 TC8 8  CLA FG .   ? CLA a 1138 . ? 1_555 ? 
2257 TC8 8  PQN SE .   ? PQN a 2001 . ? 1_555 ? 
2258 TC8 8  PHE J  429 ? PHE b 429  . ? 1_555 ? 
2259 TC8 8  CLA EH .   ? CLA b 1013 . ? 1_555 ? 
2260 TC8 8  CLA HI .   ? CLA b 1229 . ? 1_555 ? 
2261 TC8 8  CLA II .   ? CLA b 1230 . ? 1_555 ? 
2262 TC8 8  ILE N  53  ? ILE f 53   . ? 1_555 ? 
2263 TC8 8  PHE N  54  ? PHE f 54   . ? 1_555 ? 
2264 TC9 13 ILE I  445 ? ILE a 445  . ? 1_555 ? 
2265 TC9 13 PHE I  449 ? PHE a 449  . ? 1_555 ? 
2266 TC9 13 CLA CF .   ? CLA a 1022 . ? 1_555 ? 
2267 TC9 13 CLA DG .   ? CLA a 1131 . ? 1_555 ? 
2268 TC9 13 CLA BF .   ? CLA a 1237 . ? 1_555 ? 
2269 TC9 13 TRP J  645 ? TRP b 645  . ? 1_555 ? 
2270 TC9 13 MET J  646 ? MET b 646  . ? 1_555 ? 
2271 TC9 13 PHE J  649 ? PHE b 649  . ? 1_555 ? 
2272 TC9 13 CLA GH .   ? CLA b 1023 . ? 1_555 ? 
2273 TC9 13 CLA LH .   ? CLA b 1205 . ? 1_555 ? 
2274 TC9 13 CLA PI .   ? CLA b 1206 . ? 1_555 ? 
2275 TC9 13 CLA SI .   ? CLA b 1239 . ? 1_555 ? 
2276 TC9 13 PQN TG .   ? PQN b 2002 . ? 1_555 ? 
2277 UC1 12 LEU J  12  ? LEU b 12   . ? 1_555 ? 
2278 UC1 12 TYR J  23  ? TYR b 23   . ? 1_555 ? 
2279 UC1 12 ALA J  26  ? ALA b 26   . ? 1_555 ? 
2280 UC1 12 SER J  553 ? SER b 553  . ? 1_555 ? 
2281 UC1 12 TRP J  570 ? TRP b 570  . ? 1_555 ? 
2282 UC1 12 SER J  698 ? SER b 698  . ? 1_555 ? 
2283 UC1 12 GLN J  701 ? GLN b 701  . ? 1_555 ? 
2284 UC1 12 CLA HH .   ? CLA b 1201 . ? 1_555 ? 
2285 UC1 12 CLA JH .   ? CLA b 1203 . ? 1_555 ? 
2286 UC1 12 CLA CI .   ? CLA b 1224 . ? 1_555 ? 
2287 UC1 12 CLA EI .   ? CLA b 1226 . ? 1_555 ? 
2288 UC1 12 CLA SI .   ? CLA b 1239 . ? 1_555 ? 
2289 UC2 14 HIS J  308 ? HIS b 308  . ? 1_555 ? 
2290 UC2 14 LYS J  309 ? LYS b 309  . ? 1_555 ? 
2291 UC2 14 GLY J  310 ? GLY b 310  . ? 1_555 ? 
2292 UC2 14 PRO J  311 ? PRO b 311  . ? 1_555 ? 
2293 UC2 14 LEU J  312 ? LEU b 312  . ? 1_555 ? 
2294 UC2 14 THR J  313 ? THR b 313  . ? 1_555 ? 
2295 UC2 14 HIS J  317 ? HIS b 317  . ? 1_555 ? 
2296 UC2 14 VAL J  405 ? VAL b 405  . ? 1_555 ? 
2297 UC2 14 CLA YH .   ? CLA b 1220 . ? 1_555 ? 
2298 UC2 14 CLA BI .   ? CLA b 1223 . ? 1_555 ? 
2299 UC2 14 CLA FI .   ? CLA b 1227 . ? 1_555 ? 
2300 UC2 14 CLA NI .   ? CLA b 1236 . ? 1_555 ? 
2301 UC2 14 CLA OI .   ? CLA b 1240 . ? 1_555 ? 
2302 UC2 14 BCR YG .   ? BCR b 4010 . ? 1_555 ? 
2303 UC3 23 PHE I  677 ? PHE a 677  . ? 1_555 ? 
2304 UC3 23 ALA I  680 ? ALA a 680  . ? 1_555 ? 
2305 UC3 23 PHE I  681 ? PHE a 681  . ? 1_555 ? 
2306 UC3 23 LEU I  683 ? LEU a 683  . ? 1_555 ? 
2307 UC3 23 MET I  684 ? MET a 684  . ? 1_555 ? 
2308 UC3 23 PHE I  687 ? PHE a 687  . ? 1_555 ? 
2309 UC3 23 TYR I  692 ? TYR a 692  . ? 1_555 ? 
2310 UC3 23 TRP I  693 ? TRP a 693  . ? 1_555 ? 
2311 UC3 23 CLA JG .   ? CLA a 1012 . ? 1_555 ? 
2312 UC3 23 CLA HG .   ? CLA a 1140 . ? 1_555 ? 
2313 UC3 23 PQN SE .   ? PQN a 2001 . ? 1_555 ? 
2314 UC3 23 SER J  421 ? SER b 421  . ? 1_555 ? 
2315 UC3 23 SER J  424 ? SER b 424  . ? 1_555 ? 
2316 UC3 23 LEU J  425 ? LEU b 425  . ? 1_555 ? 
2317 UC3 23 GLY J  428 ? GLY b 428  . ? 1_555 ? 
2318 UC3 23 PHE J  429 ? PHE b 429  . ? 1_555 ? 
2319 UC3 23 LEU J  522 ? LEU b 522  . ? 1_555 ? 
2320 UC3 23 LEU J  529 ? LEU b 529  . ? 1_555 ? 
2321 UC3 23 ILE J  530 ? ILE b 530  . ? 1_555 ? 
2322 UC3 23 LEU J  575 ? LEU b 575  . ? 1_555 ? 
2323 UC3 23 TRP J  579 ? TRP b 579  . ? 1_555 ? 
2324 UC3 23 BCR ZG .   ? BCR b 4011 . ? 1_555 ? 
2325 UC3 23 BCR AH .   ? BCR b 4014 . ? 1_555 ? 
2326 UC4 21 LEU I  650 ? LEU a 650  . ? 1_555 ? 
2327 UC4 21 TRP I  651 ? TRP a 651  . ? 1_555 ? 
2328 UC4 21 CLA IG .   ? CLA a 1011 . ? 1_555 ? 
2329 UC4 21 CLA JG .   ? CLA a 1012 . ? 1_555 ? 
2330 UC4 21 CLA CF .   ? CLA a 1022 . ? 1_555 ? 
2331 UC4 21 TYR J  435 ? TYR b 435  . ? 1_555 ? 
2332 UC4 21 ALA J  519 ? ALA b 519  . ? 1_555 ? 
2333 UC4 21 ASN J  582 ? ASN b 582  . ? 1_555 ? 
2334 UC4 21 TRP J  586 ? TRP b 586  . ? 1_555 ? 
2335 UC4 21 PHE J  589 ? PHE b 589  . ? 1_555 ? 
2336 UC4 21 LEU J  613 ? LEU b 613  . ? 1_555 ? 
2337 UC4 21 TRP J  616 ? TRP b 616  . ? 1_555 ? 
2338 UC4 21 LEU J  621 ? LEU b 621  . ? 1_555 ? 
2339 UC4 21 SER J  625 ? SER b 625  . ? 1_555 ? 
2340 UC4 21 PHE J  647 ? PHE b 647  . ? 1_555 ? 
2341 UC4 21 HIS J  651 ? HIS b 651  . ? 1_555 ? 
2342 UC4 21 TRP J  654 ? TRP b 654  . ? 1_555 ? 
2343 UC4 21 TYR J  714 ? TYR b 714  . ? 1_555 ? 
2344 UC4 21 THR J  717 ? THR b 717  . ? 1_555 ? 
2345 UC4 21 TYR J  718 ? TYR b 718  . ? 1_555 ? 
2346 UC4 21 PHE J  721 ? PHE b 721  . ? 1_555 ? 
2347 UC5 20 ASN I  441 ? ASN a 441  . ? 1_555 ? 
2348 UC5 20 CYS I  444 ? CYS a 444  . ? 1_555 ? 
2349 UC5 20 ILE I  445 ? ILE a 445  . ? 1_555 ? 
2350 UC5 20 GLY I  448 ? GLY a 448  . ? 1_555 ? 
2351 UC5 20 PHE I  449 ? PHE a 449  . ? 1_555 ? 
2352 UC5 20 PHE I  452 ? PHE a 452  . ? 1_555 ? 
2353 UC5 20 PHE I  540 ? PHE a 540  . ? 1_555 ? 
2354 UC5 20 LEU I  547 ? LEU a 547  . ? 1_555 ? 
2355 UC5 20 ILE I  548 ? ILE a 548  . ? 1_555 ? 
2356 UC5 20 PHE I  596 ? PHE a 596  . ? 1_555 ? 
2357 UC5 20 TRP I  597 ? TRP a 597  . ? 1_555 ? 
2358 UC5 20 CLA CF .   ? CLA a 1022 . ? 1_555 ? 
2359 UC5 20 CLA DG .   ? CLA a 1131 . ? 1_555 ? 
2360 UC5 20 ALA J  655 ? ALA b 655  . ? 1_555 ? 
2361 UC5 20 THR J  656 ? THR b 656  . ? 1_555 ? 
2362 UC5 20 PHE J  658 ? PHE b 658  . ? 1_555 ? 
2363 UC5 20 MET J  659 ? MET b 659  . ? 1_555 ? 
2364 UC5 20 TYR J  667 ? TYR b 667  . ? 1_555 ? 
2365 UC5 20 TRP J  668 ? TRP b 668  . ? 1_555 ? 
2366 UC5 20 BCR BH .   ? BCR b 4017 . ? 1_555 ? 
2367 UC6 17 PHE J  5   ? PHE b 5    . ? 1_555 ? 
2368 UC6 17 PHE J  8   ? PHE b 8    . ? 1_555 ? 
2369 UC6 17 ILE J  25  ? ILE b 25   . ? 1_555 ? 
2370 UC6 17 ALA J  28  ? ALA b 28   . ? 1_555 ? 
2371 UC6 17 HIS J  29  ? HIS b 29   . ? 1_555 ? 
2372 UC6 17 PHE J  31  ? PHE b 31   . ? 1_555 ? 
2373 UC6 17 HIS J  34  ? HIS b 34   . ? 1_555 ? 
2374 UC6 17 ILE J  56  ? ILE b 56   . ? 1_555 ? 
2375 UC6 17 CLA IH .   ? CLA b 1202 . ? 1_555 ? 
2376 UC6 17 CLA JH .   ? CLA b 1203 . ? 1_555 ? 
2377 UC6 17 CLA EI .   ? CLA b 1226 . ? 1_555 ? 
2378 UC6 17 LMG CH .   ? LMG b 5002 . ? 1_555 ? 
2379 UC6 17 PHE Q  23  ? PHE m 23   . ? 1_555 ? 
2380 UC6 17 SER Q  26  ? SER m 26   . ? 1_555 ? 
2381 UC6 17 LEU Q  29  ? LEU m 29   . ? 1_555 ? 
2382 UC6 17 TYR Q  30  ? TYR m 30   . ? 1_555 ? 
2383 UC6 17 BCR DJ .   ? BCR m 4021 . ? 1_555 ? 
2384 UC7 16 HIS J  29  ? HIS b 29   . ? 1_555 ? 
2385 UC7 16 PHE J  31  ? PHE b 31   . ? 1_555 ? 
2386 UC7 16 ILE J  46  ? ILE b 46   . ? 1_555 ? 
2387 UC7 16 SER J  49  ? SER b 49   . ? 1_555 ? 
2388 UC7 16 HIS J  50  ? HIS b 50   . ? 1_555 ? 
2389 UC7 16 HIS J  53  ? HIS b 53   . ? 1_555 ? 
2390 UC7 16 ILE J  54  ? ILE b 54   . ? 1_555 ? 
2391 UC7 16 LEU J  328 ? LEU b 328  . ? 1_555 ? 
2392 UC7 16 LEU J  332 ? LEU b 332  . ? 1_555 ? 
2393 UC7 16 ALA J  335 ? ALA b 335  . ? 1_555 ? 
2394 UC7 16 LEU J  339 ? LEU b 339  . ? 1_555 ? 
2395 UC7 16 CLA HH .   ? CLA b 1201 . ? 1_555 ? 
2396 UC7 16 CLA JH .   ? CLA b 1203 . ? 1_555 ? 
2397 UC7 16 CLA PH .   ? CLA b 1210 . ? 1_555 ? 
2398 UC7 16 CLA ZH .   ? CLA b 1221 . ? 1_555 ? 
2399 UC7 16 CLA EI .   ? CLA b 1226 . ? 1_555 ? 
2400 UC8 11 HIS J  29  ? HIS b 29   . ? 1_555 ? 
2401 UC8 11 HIS J  53  ? HIS b 53   . ? 1_555 ? 
2402 UC8 11 TRP J  60  ? TRP b 60   . ? 1_555 ? 
2403 UC8 11 PHE J  379 ? PHE b 379  . ? 1_555 ? 
2404 UC8 11 CLA HH .   ? CLA b 1201 . ? 1_555 ? 
2405 UC8 11 CLA IH .   ? CLA b 1202 . ? 1_555 ? 
2406 UC8 11 CLA CI .   ? CLA b 1224 . ? 1_555 ? 
2407 UC8 11 CLA DI .   ? CLA b 1225 . ? 1_555 ? 
2408 UC8 11 CLA EI .   ? CLA b 1226 . ? 1_555 ? 
2409 UC8 11 BCR VG .   ? BCR b 4005 . ? 1_555 ? 
2410 UC8 11 LMG CH .   ? LMG b 5002 . ? 1_555 ? 
2411 UC9 20 LEU J  59  ? LEU b 59   . ? 1_555 ? 
2412 UC9 20 TRP J  60  ? TRP b 60   . ? 1_555 ? 
2413 UC9 20 SER J  62  ? SER b 62   . ? 1_555 ? 
2414 UC9 20 GLY J  63  ? GLY b 63   . ? 1_555 ? 
2415 UC9 20 PHE J  66  ? PHE b 66   . ? 1_555 ? 
2416 UC9 20 HIS J  67  ? HIS b 67   . ? 1_555 ? 
2417 UC9 20 TRP J  70  ? TRP b 70   . ? 1_555 ? 
2418 UC9 20 GLN J  71  ? GLN b 71   . ? 1_555 ? 
2419 UC9 20 HIS J  89  ? HIS b 89   . ? 1_555 ? 
2420 UC9 20 LEU J  143 ? LEU b 143  . ? 1_555 ? 
2421 UC9 20 CLA LH .   ? CLA b 1205 . ? 1_555 ? 
2422 UC9 20 CLA PI .   ? CLA b 1206 . ? 1_555 ? 
2423 UC9 20 LEU O  10  ? LEU i 10   . ? 1_555 ? 
2424 UC9 20 PRO O  11  ? PRO i 11   . ? 1_555 ? 
2425 UC9 20 LEU O  14  ? LEU i 14   . ? 1_555 ? 
2426 UC9 20 ILE O  15  ? ILE i 15   . ? 1_555 ? 
2427 UC9 20 VAL O  18  ? VAL i 18   . ? 1_555 ? 
2428 UC9 20 ALA Q  11  ? ALA m 11   . ? 1_555 ? 
2429 UC9 20 ALA Q  15  ? ALA m 15   . ? 1_555 ? 
2430 UC9 20 BCR DJ .   ? BCR m 4021 . ? 1_555 ? 
2431 VC1 13 THR J  64  ? THR b 64   . ? 1_555 ? 
2432 VC1 13 ALA J  88  ? ALA b 88   . ? 1_555 ? 
2433 VC1 13 HIS J  89  ? HIS b 89   . ? 1_555 ? 
2434 VC1 13 ILE J  115 ? ILE b 115  . ? 1_555 ? 
2435 VC1 13 ALA J  116 ? ALA b 116  . ? 1_555 ? 
2436 VC1 13 TYR J  117 ? TYR b 117  . ? 1_555 ? 
2437 VC1 13 SER J  118 ? SER b 118  . ? 1_555 ? 
2438 VC1 13 VAL J  642 ? VAL b 642  . ? 1_555 ? 
2439 VC1 13 TRP J  643 ? TRP b 643  . ? 1_555 ? 
2440 VC1 13 CLA KH .   ? CLA b 1204 . ? 1_555 ? 
2441 VC1 13 CLA PI .   ? CLA b 1206 . ? 1_555 ? 
2442 VC1 13 CLA CI .   ? CLA b 1224 . ? 1_555 ? 
2443 VC1 13 BCR BH .   ? BCR b 4017 . ? 1_555 ? 
2444 VC2 16 TYR Y  59  ? TYR 8 59   . ? 1_455 ? 
2445 VC2 16 VAL Y  137 ? VAL 8 137  . ? 1_455 ? 
2446 VC2 16 ILE Y  151 ? ILE 8 151  . ? 1_455 ? 
2447 VC2 16 CLA LN .   ? CLA 8 1501 . ? 1_455 ? 
2448 VC2 16 CLA NN .   ? CLA 8 1503 . ? 1_455 ? 
2449 VC2 16 BCR PN .   ? BCR 8 4022 . ? 1_455 ? 
2450 VC2 16 CLA OG .   ? CLA a 1132 . ? 1_555 ? 
2451 VC2 16 HIS J  95  ? HIS b 95   . ? 1_555 ? 
2452 VC2 16 CLA PI .   ? CLA b 1206 . ? 1_555 ? 
2453 VC2 16 BCR VI .   ? BCR f 4018 . ? 1_555 ? 
2454 VC2 16 BCR WI .   ? BCR f 4020 . ? 1_555 ? 
2455 VC2 16 TRP O  20  ? TRP i 20   . ? 1_555 ? 
2456 VC2 16 TRP P  65  ? TRP l 65   . ? 1_555 ? 
2457 VC2 16 PRO P  70  ? PRO l 70   . ? 1_555 ? 
2458 VC2 16 LEU P  71  ? LEU l 71   . ? 1_555 ? 
2459 VC2 16 ILE P  83  ? ILE l 83   . ? 1_555 ? 
2460 VC3 8  LEU J  148 ? LEU b 148  . ? 1_555 ? 
2461 VC3 8  PHE J  151 ? PHE b 151  . ? 1_555 ? 
2462 VC3 8  HIS J  156 ? HIS b 156  . ? 1_555 ? 
2463 VC3 8  LYS J  160 ? LYS b 160  . ? 1_555 ? 
2464 VC3 8  PHE J  161 ? PHE b 161  . ? 1_555 ? 
2465 VC3 8  TRP J  167 ? TRP b 167  . ? 1_555 ? 
2466 VC3 8  CLA OH .   ? CLA b 1209 . ? 1_555 ? 
2467 VC3 8  CLA PH .   ? CLA b 1210 . ? 1_555 ? 
2468 VC4 10 TRP J  167 ? TRP b 167  . ? 1_555 ? 
2469 VC4 10 ASN J  170 ? ASN b 170  . ? 1_555 ? 
2470 VC4 10 SER J  173 ? SER b 173  . ? 1_555 ? 
2471 VC4 10 HIS J  177 ? HIS b 177  . ? 1_555 ? 
2472 VC4 10 ASN J  294 ? ASN b 294  . ? 1_555 ? 
2473 VC4 10 TRP J  295 ? TRP b 295  . ? 1_555 ? 
2474 VC4 10 CLA NH .   ? CLA b 1208 . ? 1_555 ? 
2475 VC4 10 CLA PH .   ? CLA b 1210 . ? 1_555 ? 
2476 VC4 10 CLA VH .   ? CLA b 1217 . ? 1_555 ? 
2477 VC4 10 BCR VG .   ? BCR b 4005 . ? 1_555 ? 
2478 VC5 17 PHE J  47  ? PHE b 47   . ? 1_555 ? 
2479 VC5 17 HIS J  50  ? HIS b 50   . ? 1_555 ? 
2480 VC5 17 PHE J  51  ? PHE b 51   . ? 1_555 ? 
2481 VC5 17 TRP J  167 ? TRP b 167  . ? 1_555 ? 
2482 VC5 17 PHE J  168 ? PHE b 168  . ? 1_555 ? 
2483 VC5 17 ARG J  174 ? ARG b 174  . ? 1_555 ? 
2484 VC5 17 HIS J  177 ? HIS b 177  . ? 1_555 ? 
2485 VC5 17 HIS J  178 ? HIS b 178  . ? 1_555 ? 
2486 VC5 17 LEU J  182 ? LEU b 182  . ? 1_555 ? 
2487 VC5 17 PHE J  183 ? PHE b 183  . ? 1_555 ? 
2488 VC5 17 TYR J  356 ? TYR b 356  . ? 1_555 ? 
2489 VC5 17 CLA IH .   ? CLA b 1202 . ? 1_555 ? 
2490 VC5 17 CLA NH .   ? CLA b 1208 . ? 1_555 ? 
2491 VC5 17 CLA OH .   ? CLA b 1209 . ? 1_555 ? 
2492 VC5 17 CLA TH .   ? CLA b 1215 . ? 1_555 ? 
2493 VC5 17 CLA DI .   ? CLA b 1225 . ? 1_555 ? 
2494 VC5 17 BCR VG .   ? BCR b 4005 . ? 1_555 ? 
2495 VC6 14 LEU J  188 ? LEU b 188  . ? 1_555 ? 
2496 VC6 14 ALA J  189 ? ALA b 189  . ? 1_555 ? 
2497 VC6 14 ALA J  191 ? ALA b 191  . ? 1_555 ? 
2498 VC6 14 GLY J  192 ? GLY b 192  . ? 1_555 ? 
2499 VC6 14 HIS J  196 ? HIS b 196  . ? 1_555 ? 
2500 VC6 14 PHE J  212 ? PHE b 212  . ? 1_555 ? 
2501 VC6 14 LEU J  213 ? LEU b 213  . ? 1_555 ? 
2502 VC6 14 THR J  215 ? THR b 215  . ? 1_555 ? 
2503 VC6 14 PRO J  216 ? PRO b 216  . ? 1_555 ? 
2504 VC6 14 PRO J  217 ? PRO b 217  . ? 1_555 ? 
2505 VC6 14 LEU J  222 ? LEU b 222  . ? 1_555 ? 
2506 VC6 14 CLA QI .   ? CLA b 1211 . ? 1_555 ? 
2507 VC6 14 BCR UG .   ? BCR b 4004 . ? 1_555 ? 
2508 VC6 14 BCR WG .   ? BCR b 4006 . ? 1_555 ? 
2509 VC7 6  TRP J  230 ? TRP b 230  . ? 1_555 ? 
2510 VC7 6  LEU J  255 ? LEU b 255  . ? 1_555 ? 
2511 VC7 6  PHE J  257 ? PHE b 257  . ? 1_555 ? 
2512 VC7 6  HIS J  275 ? HIS b 275  . ? 1_555 ? 
2513 VC7 6  ALA J  489 ? ALA b 489  . ? 1_555 ? 
2514 VC7 6  CLA SH .   ? CLA b 1214 . ? 1_555 ? 
2515 VC8 19 PHE J  257 ? PHE b 257  . ? 1_555 ? 
2516 VC8 19 GLY J  259 ? GLY b 259  . ? 1_555 ? 
2517 VC8 19 GLY J  260 ? GLY b 260  . ? 1_555 ? 
2518 VC8 19 LEU J  268 ? LEU b 268  . ? 1_555 ? 
2519 VC8 19 ASP J  272 ? ASP b 272  . ? 1_555 ? 
2520 VC8 19 HIS J  275 ? HIS b 275  . ? 1_555 ? 
2521 VC8 19 HIS J  276 ? HIS b 276  . ? 1_555 ? 
2522 VC8 19 ALA J  279 ? ALA b 279  . ? 1_555 ? 
2523 VC8 19 ILE J  280 ? ILE b 280  . ? 1_555 ? 
2524 VC8 19 ILE J  283 ? ILE b 283  . ? 1_555 ? 
2525 VC8 19 HIS J  349 ? HIS b 349  . ? 1_555 ? 
2526 VC8 19 LEU J  353 ? LEU b 353  . ? 1_555 ? 
2527 VC8 19 TRP J  490 ? TRP b 490  . ? 1_555 ? 
2528 VC8 19 TRP J  494 ? TRP b 494  . ? 1_555 ? 
2529 VC8 19 CLA RH .   ? CLA b 1213 . ? 1_555 ? 
2530 VC8 19 CLA TH .   ? CLA b 1215 . ? 1_555 ? 
2531 VC8 19 CLA BI .   ? CLA b 1223 . ? 1_555 ? 
2532 VC8 19 CLA JI .   ? CLA b 1231 . ? 1_555 ? 
2533 VC8 19 CLA KI .   ? CLA b 1232 . ? 1_555 ? 
2534 VC9 21 TRP J  123 ? TRP b 123  . ? 1_555 ? 
2535 VC9 21 LEU J  182 ? LEU b 182  . ? 1_555 ? 
2536 VC9 21 PHE J  183 ? PHE b 183  . ? 1_555 ? 
2537 VC9 21 SER J  186 ? SER b 186  . ? 1_555 ? 
2538 VC9 21 SER J  187 ? SER b 187  . ? 1_555 ? 
2539 VC9 21 TRP J  190 ? TRP b 190  . ? 1_555 ? 
2540 VC9 21 HIS J  276 ? HIS b 276  . ? 1_555 ? 
2541 VC9 21 HIS J  277 ? HIS b 277  . ? 1_555 ? 
2542 VC9 21 ILE J  280 ? ILE b 280  . ? 1_555 ? 
2543 VC9 21 ILE J  342 ? ILE b 342  . ? 1_555 ? 
2544 VC9 21 VAL J  346 ? VAL b 346  . ? 1_555 ? 
2545 VC9 21 HIS J  349 ? HIS b 349  . ? 1_555 ? 
2546 VC9 21 MET J  350 ? MET b 350  . ? 1_555 ? 
2547 VC9 21 SER J  355 ? SER b 355  . ? 1_555 ? 
2548 VC9 21 TYR J  356 ? TYR b 356  . ? 1_555 ? 
2549 VC9 21 CLA PH .   ? CLA b 1210 . ? 1_555 ? 
2550 VC9 21 CLA SH .   ? CLA b 1214 . ? 1_555 ? 
2551 VC9 21 CLA UH .   ? CLA b 1216 . ? 1_555 ? 
2552 VC9 21 CLA BI .   ? CLA b 1223 . ? 1_555 ? 
2553 VC9 21 CLA DI .   ? CLA b 1225 . ? 1_555 ? 
2554 VC9 21 CLA JI .   ? CLA b 1231 . ? 1_555 ? 
2555 WC1 14 LEU J  179 ? LEU b 179  . ? 1_555 ? 
2556 WC1 14 ILE J  283 ? ILE b 283  . ? 1_555 ? 
2557 WC1 14 PHE J  284 ? PHE b 284  . ? 1_555 ? 
2558 WC1 14 ALA J  287 ? ALA b 287  . ? 1_555 ? 
2559 WC1 14 MET J  290 ? MET b 290  . ? 1_555 ? 
2560 WC1 14 TYR J  291 ? TYR b 291  . ? 1_555 ? 
2561 WC1 14 CLA TH .   ? CLA b 1215 . ? 1_555 ? 
2562 WC1 14 CLA WH .   ? CLA b 1218 . ? 1_555 ? 
2563 WC1 14 CLA XH .   ? CLA b 1219 . ? 1_555 ? 
2564 WC1 14 CLA YH .   ? CLA b 1220 . ? 1_555 ? 
2565 WC1 14 CLA ZH .   ? CLA b 1221 . ? 1_555 ? 
2566 WC1 14 CLA BI .   ? CLA b 1223 . ? 1_555 ? 
2567 WC1 14 CLA LI .   ? CLA b 1234 . ? 1_555 ? 
2568 WC1 14 BCR YG .   ? BCR b 4010 . ? 1_555 ? 
2569 WC2 6  HIS J  177 ? HIS b 177  . ? 1_555 ? 
2570 WC2 6  HIS J  289 ? HIS b 289  . ? 1_555 ? 
2571 WC2 6  THR J  293 ? THR b 293  . ? 1_555 ? 
2572 WC2 6  ILE J  297 ? ILE b 297  . ? 1_555 ? 
2573 WC2 6  CLA OH .   ? CLA b 1209 . ? 1_555 ? 
2574 WC2 6  BCR UG .   ? BCR b 4004 . ? 1_555 ? 
2575 WC3 6  ILE J  286 ? ILE b 286  . ? 1_555 ? 
2576 WC3 6  GLY J  298 ? GLY b 298  . ? 1_555 ? 
2577 WC3 6  HIS J  299 ? HIS b 299  . ? 1_555 ? 
2578 WC3 6  CLA UH .   ? CLA b 1216 . ? 1_555 ? 
2579 WC3 6  CLA XH .   ? CLA b 1219 . ? 1_555 ? 
2580 WC3 6  BCR UG .   ? BCR b 4004 . ? 1_555 ? 
2581 WC4 9  MET J  290 ? MET b 290  . ? 1_555 ? 
2582 WC4 9  HIS J  299 ? HIS b 299  . ? 1_555 ? 
2583 WC4 9  ILE J  304 ? ILE b 304  . ? 1_555 ? 
2584 WC4 9  ALA J  307 ? ALA b 307  . ? 1_555 ? 
2585 WC4 9  HIS J  308 ? HIS b 308  . ? 1_555 ? 
2586 WC4 9  CLA UH .   ? CLA b 1216 . ? 1_555 ? 
2587 WC4 9  CLA WH .   ? CLA b 1218 . ? 1_555 ? 
2588 WC4 9  CLA YH .   ? CLA b 1220 . ? 1_555 ? 
2589 WC4 9  CLA OI .   ? CLA b 1240 . ? 1_555 ? 
2590 WC5 13 ILE J  304 ? ILE b 304  . ? 1_555 ? 
2591 WC5 13 LEU J  305 ? LEU b 305  . ? 1_555 ? 
2592 WC5 13 HIS J  308 ? HIS b 308  . ? 1_555 ? 
2593 WC5 13 HIS J  317 ? HIS b 317  . ? 1_555 ? 
2594 WC5 13 PHE J  330 ? PHE b 330  . ? 1_555 ? 
2595 WC5 13 VAL J  405 ? VAL b 405  . ? 1_555 ? 
2596 WC5 13 CLA UH .   ? CLA b 1216 . ? 1_555 ? 
2597 WC5 13 CLA XH .   ? CLA b 1219 . ? 1_555 ? 
2598 WC5 13 CLA ZH .   ? CLA b 1221 . ? 1_555 ? 
2599 WC5 13 CLA FI .   ? CLA b 1227 . ? 1_555 ? 
2600 WC5 13 CLA OI .   ? CLA b 1240 . ? 1_555 ? 
2601 WC5 13 BCR XG .   ? BCR b 4009 . ? 1_555 ? 
2602 WC5 13 LHG DH .   ? LHG b 5004 . ? 1_555 ? 
2603 WC6 13 ARG J  174 ? ARG b 174  . ? 1_555 ? 
2604 WC6 13 HIS J  178 ? HIS b 178  . ? 1_555 ? 
2605 WC6 13 LEU J  179 ? LEU b 179  . ? 1_555 ? 
2606 WC6 13 LEU J  305 ? LEU b 305  . ? 1_555 ? 
2607 WC6 13 ILE J  324 ? ILE b 324  . ? 1_555 ? 
2608 WC6 13 LEU J  334 ? LEU b 334  . ? 1_555 ? 
2609 WC6 13 ALA J  335 ? ALA b 335  . ? 1_555 ? 
2610 WC6 13 SER J  338 ? SER b 338  . ? 1_555 ? 
2611 WC6 13 ILE J  342 ? ILE b 342  . ? 1_555 ? 
2612 WC6 13 CLA IH .   ? CLA b 1202 . ? 1_555 ? 
2613 WC6 13 CLA UH .   ? CLA b 1216 . ? 1_555 ? 
2614 WC6 13 CLA YH .   ? CLA b 1220 . ? 1_555 ? 
2615 WC6 13 CLA BI .   ? CLA b 1223 . ? 1_555 ? 
2616 WC7 13 VAL J  341 ? VAL b 341  . ? 1_555 ? 
2617 WC7 13 SER J  344 ? SER b 344  . ? 1_555 ? 
2618 WC7 13 GLN J  348 ? GLN b 348  . ? 1_555 ? 
2619 WC7 13 GLN J  374 ? GLN b 374  . ? 1_555 ? 
2620 WC7 13 MET J  381 ? MET b 381  . ? 1_555 ? 
2621 WC7 13 PHE J  385 ? PHE b 385  . ? 1_555 ? 
2622 WC7 13 LEU J  524 ? LEU b 524  . ? 1_555 ? 
2623 WC7 13 LEU J  531 ? LEU b 531  . ? 1_555 ? 
2624 WC7 13 MET J  580 ? MET b 580  . ? 1_555 ? 
2625 WC7 13 CLA BI .   ? CLA b 1223 . ? 1_555 ? 
2626 WC7 13 CLA LI .   ? CLA b 1234 . ? 1_555 ? 
2627 WC7 13 CLA NI .   ? CLA b 1236 . ? 1_555 ? 
2628 WC7 13 BCR YG .   ? BCR b 4010 . ? 1_555 ? 
2629 WC8 17 ALA J  337 ? ALA b 337  . ? 1_555 ? 
2630 WC8 17 SER J  338 ? SER b 338  . ? 1_555 ? 
2631 WC8 17 VAL J  341 ? VAL b 341  . ? 1_555 ? 
2632 WC8 17 LEU J  345 ? LEU b 345  . ? 1_555 ? 
2633 WC8 17 HIS J  349 ? HIS b 349  . ? 1_555 ? 
2634 WC8 17 SER J  352 ? SER b 352  . ? 1_555 ? 
2635 WC8 17 CLA SH .   ? CLA b 1214 . ? 1_555 ? 
2636 WC8 17 CLA TH .   ? CLA b 1215 . ? 1_555 ? 
2637 WC8 17 CLA UH .   ? CLA b 1216 . ? 1_555 ? 
2638 WC8 17 CLA ZH .   ? CLA b 1221 . ? 1_555 ? 
2639 WC8 17 CLA AI .   ? CLA b 1222 . ? 1_555 ? 
2640 WC8 17 CLA JI .   ? CLA b 1231 . ? 1_555 ? 
2641 WC8 17 CLA LI .   ? CLA b 1234 . ? 1_555 ? 
2642 WC8 17 CLA NI .   ? CLA b 1236 . ? 1_555 ? 
2643 WC8 17 BCR XG .   ? BCR b 4009 . ? 1_555 ? 
2644 WC8 17 BCR YG .   ? BCR b 4010 . ? 1_555 ? 
2645 WC8 17 LHG DH .   ? LHG b 5004 . ? 1_555 ? 
2646 WC9 10 TRP J  60  ? TRP b 60   . ? 1_555 ? 
2647 WC9 10 SER J  118 ? SER b 118  . ? 1_555 ? 
2648 WC9 10 ALA J  368 ? ALA b 368  . ? 1_555 ? 
2649 WC9 10 THR J  371 ? THR b 371  . ? 1_555 ? 
2650 WC9 10 HIS J  372 ? HIS b 372  . ? 1_555 ? 
2651 WC9 10 ALA J  719 ? ALA b 719  . ? 1_555 ? 
2652 WC9 10 CLA JH .   ? CLA b 1203 . ? 1_555 ? 
2653 WC9 10 CLA LH .   ? CLA b 1205 . ? 1_555 ? 
2654 WC9 10 CLA DI .   ? CLA b 1225 . ? 1_555 ? 
2655 WC9 10 LMG CH .   ? LMG b 5002 . ? 1_555 ? 
2656 XC1 17 THR J  61  ? THR b 61   . ? 1_555 ? 
2657 XC1 17 SER J  118 ? SER b 118  . ? 1_555 ? 
2658 XC1 17 GLY J  119 ? GLY b 119  . ? 1_555 ? 
2659 XC1 17 TRP J  123 ? TRP b 123  . ? 1_555 ? 
2660 XC1 17 THR J  343 ? THR b 343  . ? 1_555 ? 
2661 XC1 17 MET J  350 ? MET b 350  . ? 1_555 ? 
2662 XC1 17 TYR J  356 ? TYR b 356  . ? 1_555 ? 
2663 XC1 17 LEU J  369 ? LEU b 369  . ? 1_555 ? 
2664 XC1 17 HIS J  372 ? HIS b 372  . ? 1_555 ? 
2665 XC1 17 HIS J  373 ? HIS b 373  . ? 1_555 ? 
2666 XC1 17 ILE J  376 ? ILE b 376  . ? 1_555 ? 
2667 XC1 17 CLA JH .   ? CLA b 1203 . ? 1_555 ? 
2668 XC1 17 CLA PH .   ? CLA b 1210 . ? 1_555 ? 
2669 XC1 17 CLA QI .   ? CLA b 1211 . ? 1_555 ? 
2670 XC1 17 CLA TH .   ? CLA b 1215 . ? 1_555 ? 
2671 XC1 17 CLA CI .   ? CLA b 1224 . ? 1_555 ? 
2672 XC1 17 BCR VG .   ? BCR b 4005 . ? 1_555 ? 
2673 XC2 19 ALA J  26  ? ALA b 26   . ? 1_555 ? 
2674 XC2 19 HIS J  29  ? HIS b 29   . ? 1_555 ? 
2675 XC2 19 ASP J  30  ? ASP b 30   . ? 1_555 ? 
2676 XC2 19 HIS J  329 ? HIS b 329  . ? 1_555 ? 
2677 XC2 19 LEU J  332 ? LEU b 332  . ? 1_555 ? 
2678 XC2 19 LEU J  336 ? LEU b 336  . ? 1_555 ? 
2679 XC2 19 PHE J  379 ? PHE b 379  . ? 1_555 ? 
2680 XC2 19 GLY J  383 ? GLY b 383  . ? 1_555 ? 
2681 XC2 19 HIS J  387 ? HIS b 387  . ? 1_555 ? 
2682 XC2 19 ILE J  390 ? ILE b 390  . ? 1_555 ? 
2683 XC2 19 ARG J  394 ? ARG b 394  . ? 1_555 ? 
2684 XC2 19 TYR J  552 ? TYR b 552  . ? 1_555 ? 
2685 XC2 19 TRP J  570 ? TRP b 570  . ? 1_555 ? 
2686 XC2 19 PHE J  573 ? PHE b 573  . ? 1_555 ? 
2687 XC2 19 CLA HH .   ? CLA b 1201 . ? 1_555 ? 
2688 XC2 19 CLA IH .   ? CLA b 1202 . ? 1_555 ? 
2689 XC2 19 CLA JH .   ? CLA b 1203 . ? 1_555 ? 
2690 XC2 19 CLA SI .   ? CLA b 1239 . ? 1_555 ? 
2691 XC2 19 LMG CH .   ? LMG b 5002 . ? 1_555 ? 
2692 XC3 14 LEU J  312 ? LEU b 312  . ? 1_555 ? 
2693 XC3 14 THR J  313 ? THR b 313  . ? 1_555 ? 
2694 XC3 14 VAL J  405 ? VAL b 405  . ? 1_555 ? 
2695 XC3 14 ARG J  408 ? ARG b 408  . ? 1_555 ? 
2696 XC3 14 MET J  409 ? MET b 409  . ? 1_555 ? 
2697 XC3 14 GLU J  411 ? GLU b 411  . ? 1_555 ? 
2698 XC3 14 HIS J  412 ? HIS b 412  . ? 1_555 ? 
2699 XC3 14 LEU J  416 ? LEU b 416  . ? 1_555 ? 
2700 XC3 14 HIS J  419 ? HIS b 419  . ? 1_555 ? 
2701 XC3 14 CLA YH .   ? CLA b 1220 . ? 1_555 ? 
2702 XC3 14 CLA GI .   ? CLA b 1228 . ? 1_555 ? 
2703 XC3 14 CLA NI .   ? CLA b 1236 . ? 1_555 ? 
2704 XC3 14 BCR XG .   ? BCR b 4009 . ? 1_555 ? 
2705 XC3 14 LHG DH .   ? LHG b 5004 . ? 1_555 ? 
2706 XC4 7  LYS I  706 ? LYS a 706  . ? 1_555 ? 
2707 XC4 7  CLA FG .   ? CLA a 1138 . ? 1_555 ? 
2708 XC4 7  HIS J  419 ? HIS b 419  . ? 1_555 ? 
2709 XC4 7  TRP J  422 ? TRP b 422  . ? 1_555 ? 
2710 XC4 7  CLA FI .   ? CLA b 1227 . ? 1_555 ? 
2711 XC4 7  CLA MI .   ? CLA b 1235 . ? 1_555 ? 
2712 XC4 7  CLA NI .   ? CLA b 1236 . ? 1_555 ? 
2713 XC5 10 CLA FG .   ? CLA a 1138 . ? 1_555 ? 
2714 XC5 10 TRP J  422 ? TRP b 422  . ? 1_555 ? 
2715 XC5 10 LEU J  425 ? LEU b 425  . ? 1_555 ? 
2716 XC5 10 PHE J  426 ? PHE b 426  . ? 1_555 ? 
2717 XC5 10 HIS J  430 ? HIS b 430  . ? 1_555 ? 
2718 XC5 10 CLA II .   ? CLA b 1230 . ? 1_555 ? 
2719 XC5 10 CLA MI .   ? CLA b 1235 . ? 1_555 ? 
2720 XC5 10 BCR AH .   ? BCR b 4014 . ? 1_555 ? 
2721 XC5 10 SER N  51  ? SER f 51   . ? 1_555 ? 
2722 XC5 10 ALA N  58  ? ALA f 58   . ? 1_555 ? 
2723 XC6 10 VAL I  121 ? VAL a 121  . ? 1_555 ? 
2724 XC6 10 CLA JF .   ? CLA a 1107 . ? 1_555 ? 
2725 XC6 10 GLY J  433 ? GLY b 433  . ? 1_555 ? 
2726 XC6 10 VAL J  436 ? VAL b 436  . ? 1_555 ? 
2727 XC6 10 HIS J  437 ? HIS b 437  . ? 1_555 ? 
2728 XC6 10 LYS J  449 ? LYS b 449  . ? 1_555 ? 
2729 XC6 10 CLA HI .   ? CLA b 1229 . ? 1_555 ? 
2730 XC6 10 BCR ZG .   ? BCR b 4011 . ? 1_555 ? 
2731 XC6 10 BCR AH .   ? BCR b 4014 . ? 1_555 ? 
2732 XC6 10 TYR N  33  ? TYR f 33   . ? 1_555 ? 
2733 XC7 9  TRP J  460 ? TRP b 460  . ? 1_555 ? 
2734 XC7 9  ILE J  461 ? ILE b 461  . ? 1_555 ? 
2735 XC7 9  SER J  465 ? SER b 465  . ? 1_555 ? 
2736 XC7 9  LEU J  475 ? LEU b 475  . ? 1_555 ? 
2737 XC7 9  TRP J  494 ? TRP b 494  . ? 1_555 ? 
2738 XC7 9  CLA SH .   ? CLA b 1214 . ? 1_555 ? 
2739 XC7 9  CLA TH .   ? CLA b 1215 . ? 1_555 ? 
2740 XC7 9  CLA BI .   ? CLA b 1223 . ? 1_555 ? 
2741 XC7 9  CLA KI .   ? CLA b 1232 . ? 1_555 ? 
2742 XC8 6  ILE J  482 ? ILE b 482  . ? 1_555 ? 
2743 XC8 6  THR J  486 ? THR b 486  . ? 1_555 ? 
2744 XC8 6  TRP J  490 ? TRP b 490  . ? 1_555 ? 
2745 XC8 6  CLA SH .   ? CLA b 1214 . ? 1_555 ? 
2746 XC8 6  CLA JI .   ? CLA b 1231 . ? 1_555 ? 
2747 XC8 6  BCR YG .   ? BCR b 4010 . ? 1_555 ? 
2748 XC9 19 GLN J  348 ? GLN b 348  . ? 1_555 ? 
2749 XC9 19 TYR J  351 ? TYR b 351  . ? 1_555 ? 
2750 XC9 19 TYR J  370 ? TYR b 370  . ? 1_555 ? 
2751 XC9 19 PHE J  457 ? PHE b 457  . ? 1_555 ? 
2752 XC9 19 ALA J  458 ? ALA b 458  . ? 1_555 ? 
2753 XC9 19 ILE J  461 ? ILE b 461  . ? 1_555 ? 
2754 XC9 19 GLN J  462 ? GLN b 462  . ? 1_555 ? 
2755 XC9 19 PHE J  506 ? PHE b 506  . ? 1_555 ? 
2756 XC9 19 LEU J  507 ? LEU b 507  . ? 1_555 ? 
2757 XC9 19 HIS J  517 ? HIS b 517  . ? 1_555 ? 
2758 XC9 19 ILE J  520 ? ILE b 520  . ? 1_555 ? 
2759 XC9 19 LEU J  524 ? LEU b 524  . ? 1_555 ? 
2760 XC9 19 LEU J  587 ? LEU b 587  . ? 1_555 ? 
2761 XC9 19 TYR J  590 ? TYR b 590  . ? 1_555 ? 
2762 XC9 19 TRP J  591 ? TRP b 591  . ? 1_555 ? 
2763 XC9 19 CLA UH .   ? CLA b 1216 . ? 1_555 ? 
2764 XC9 19 CLA AI .   ? CLA b 1222 . ? 1_555 ? 
2765 XC9 19 CLA BI .   ? CLA b 1223 . ? 1_555 ? 
2766 XC9 19 CLA MI .   ? CLA b 1235 . ? 1_555 ? 
2767 YC1 15 VAL J  423 ? VAL b 423  . ? 1_555 ? 
2768 YC1 15 PHE J  426 ? PHE b 426  . ? 1_555 ? 
2769 YC1 15 LEU J  427 ? LEU b 427  . ? 1_555 ? 
2770 YC1 15 GLU J  454 ? GLU b 454  . ? 1_555 ? 
2771 YC1 15 PRO J  455 ? PRO b 455  . ? 1_555 ? 
2772 YC1 15 VAL J  456 ? VAL b 456  . ? 1_555 ? 
2773 YC1 15 PHE J  457 ? PHE b 457  . ? 1_555 ? 
2774 YC1 15 ALA J  458 ? ALA b 458  . ? 1_555 ? 
2775 YC1 15 PHE J  514 ? PHE b 514  . ? 1_555 ? 
2776 YC1 15 HIS J  517 ? HIS b 517  . ? 1_555 ? 
2777 YC1 15 HIS J  518 ? HIS b 518  . ? 1_555 ? 
2778 YC1 15 CLA GI .   ? CLA b 1228 . ? 1_555 ? 
2779 YC1 15 CLA HI .   ? CLA b 1229 . ? 1_555 ? 
2780 YC1 15 CLA LI .   ? CLA b 1234 . ? 1_555 ? 
2781 YC1 15 CLA NI .   ? CLA b 1236 . ? 1_555 ? 
2782 YC2 12 LEU J  420 ? LEU b 420  . ? 1_555 ? 
2783 YC2 12 TRP J  422 ? TRP b 422  . ? 1_555 ? 
2784 YC2 12 VAL J  423 ? VAL b 423  . ? 1_555 ? 
2785 YC2 12 ALA J  521 ? ALA b 521  . ? 1_555 ? 
2786 YC2 12 HIS J  525 ? HIS b 525  . ? 1_555 ? 
2787 YC2 12 ILE J  532 ? ILE b 532  . ? 1_555 ? 
2788 YC2 12 CLA AI .   ? CLA b 1222 . ? 1_555 ? 
2789 YC2 12 CLA BI .   ? CLA b 1223 . ? 1_555 ? 
2790 YC2 12 CLA FI .   ? CLA b 1227 . ? 1_555 ? 
2791 YC2 12 CLA GI .   ? CLA b 1228 . ? 1_555 ? 
2792 YC2 12 CLA MI .   ? CLA b 1235 . ? 1_555 ? 
2793 YC2 12 LHG DH .   ? LHG b 5004 . ? 1_555 ? 
2794 YC3 8  HIS J  308 ? HIS b 308  . ? 1_555 ? 
2795 YC3 8  LYS J  309 ? LYS b 309  . ? 1_555 ? 
2796 YC3 8  PRO J  311 ? PRO b 311  . ? 1_555 ? 
2797 YC3 8  LEU J  312 ? LEU b 312  . ? 1_555 ? 
2798 YC3 8  CLA XH .   ? CLA b 1219 . ? 1_555 ? 
2799 YC3 8  CLA YH .   ? CLA b 1220 . ? 1_555 ? 
2800 YC3 8  BCR XG .   ? BCR b 4009 . ? 1_555 ? 
2801 YC3 8  LHG DH .   ? LHG b 5004 . ? 1_555 ? 
2802 YC4 22 THR I  460 ? THR a 460  . ? 1_555 ? 
2803 YC4 22 ALA I  463 ? ALA a 463  . ? 1_555 ? 
2804 YC4 22 LEU I  464 ? LEU a 464  . ? 1_555 ? 
2805 YC4 22 CLA CF .   ? CLA a 1022 . ? 1_555 ? 
2806 YC4 22 ILE J  91  ? ILE b 91   . ? 1_555 ? 
2807 YC4 22 TRP J  92  ? TRP b 92   . ? 1_555 ? 
2808 YC4 22 ASP J  93  ? ASP b 93   . ? 1_555 ? 
2809 YC4 22 HIS J  95  ? HIS b 95   . ? 1_555 ? 
2810 YC4 22 ASN J  114 ? ASN b 114  . ? 1_555 ? 
2811 YC4 22 SER J  641 ? SER b 641  . ? 1_555 ? 
2812 YC4 22 VAL J  642 ? VAL b 642  . ? 1_555 ? 
2813 YC4 22 CLA KH .   ? CLA b 1204 . ? 1_555 ? 
2814 YC4 22 CLA LH .   ? CLA b 1205 . ? 1_555 ? 
2815 YC4 22 CLA MH .   ? CLA b 1207 . ? 1_555 ? 
2816 YC4 22 CLA SI .   ? CLA b 1239 . ? 1_555 ? 
2817 YC4 22 BCR BH .   ? BCR b 4017 . ? 1_555 ? 
2818 YC4 22 BCR VI .   ? BCR f 4018 . ? 1_555 ? 
2819 YC4 22 PHE O  22  ? PHE i 22   . ? 1_555 ? 
2820 YC4 22 PRO O  23  ? PRO i 23   . ? 1_555 ? 
2821 YC4 22 THR O  26  ? THR i 26   . ? 1_555 ? 
2822 YC4 22 MET O  27  ? MET i 27   . ? 1_555 ? 
2823 YC4 22 BCR BJ .   ? BCR l 4019 . ? 1_555 ? 
2824 YC5 14 ILE J  127 ? ILE b 127  . ? 1_555 ? 
2825 YC5 14 GLY J  128 ? GLY b 128  . ? 1_555 ? 
2826 YC5 14 GLY J  138 ? GLY b 138  . ? 1_555 ? 
2827 YC5 14 SER J  186 ? SER b 186  . ? 1_555 ? 
2828 YC5 14 ALA J  189 ? ALA b 189  . ? 1_555 ? 
2829 YC5 14 TRP J  190 ? TRP b 190  . ? 1_555 ? 
2830 YC5 14 HIS J  193 ? HIS b 193  . ? 1_555 ? 
2831 YC5 14 VAL J  197 ? VAL b 197  . ? 1_555 ? 
2832 YC5 14 GLY J  208 ? GLY b 208  . ? 1_555 ? 
2833 YC5 14 TRP J  209 ? TRP b 209  . ? 1_555 ? 
2834 YC5 14 PHE J  212 ? PHE b 212  . ? 1_555 ? 
2835 YC5 14 CLA QH .   ? CLA b 1212 . ? 1_555 ? 
2836 YC5 14 CLA DI .   ? CLA b 1225 . ? 1_555 ? 
2837 YC5 14 BCR WG .   ? BCR b 4006 . ? 1_555 ? 
2838 YC6 19 CLA DG .   ? CLA a 1131 . ? 1_555 ? 
2839 YC6 19 CLA BF .   ? CLA a 1237 . ? 1_555 ? 
2840 YC6 19 THR J  18  ? THR b 18   . ? 1_555 ? 
2841 YC6 19 ILE J  21  ? ILE b 21   . ? 1_555 ? 
2842 YC6 19 TRP J  22  ? TRP b 22   . ? 1_555 ? 
2843 YC6 19 ILE J  675 ? ILE b 675  . ? 1_555 ? 
2844 YC6 19 HIS J  679 ? HIS b 679  . ? 1_555 ? 
2845 YC6 19 VAL J  688 ? VAL b 688  . ? 1_555 ? 
2846 YC6 19 TRP J  690 ? TRP b 690  . ? 1_555 ? 
2847 YC6 19 LYS J  691 ? LYS b 691  . ? 1_555 ? 
2848 YC6 19 ASP J  692 ? ASP b 692  . ? 1_555 ? 
2849 YC6 19 PRO J  694 ? PRO b 694  . ? 1_555 ? 
2850 YC6 19 VAL J  695 ? VAL b 695  . ? 1_555 ? 
2851 YC6 19 PQN TG .   ? PQN b 2002 . ? 1_555 ? 
2852 YC6 19 BCR VI .   ? BCR f 4018 . ? 1_555 ? 
2853 YC6 19 PHE O  31  ? PHE i 31   . ? 1_555 ? 
2854 YC6 19 TYR P  99  ? TYR l 99   . ? 1_555 ? 
2855 YC6 19 THR P  103 ? THR l 103  . ? 1_555 ? 
2856 YC6 19 BCR BJ .   ? BCR l 4019 . ? 1_555 ? 
2857 YC7 12 CLA DG .   ? CLA a 1131 . ? 1_555 ? 
2858 YC7 12 TRP J  22  ? TRP b 22   . ? 1_555 ? 
2859 YC7 12 PHE J  649 ? PHE b 649  . ? 1_555 ? 
2860 YC7 12 MET J  659 ? MET b 659  . ? 1_555 ? 
2861 YC7 12 PHE J  660 ? PHE b 660  . ? 1_555 ? 
2862 YC7 12 ALA J  708 ? ALA b 708  . ? 1_555 ? 
2863 YC7 12 HIS J  709 ? HIS b 709  . ? 1_555 ? 
2864 YC7 12 CLA PI .   ? CLA b 1206 . ? 1_555 ? 
2865 YC7 12 CLA EI .   ? CLA b 1226 . ? 1_555 ? 
2866 YC7 12 PQN TG .   ? PQN b 2002 . ? 1_555 ? 
2867 YC7 12 BCR BH .   ? BCR b 4017 . ? 1_555 ? 
2868 YC7 12 LMG CH .   ? LMG b 5002 . ? 1_555 ? 
2869 YC8 5  CYS K  21  ? CYS c 21   . ? 1_555 ? 
2870 YC8 5  CYS K  48  ? CYS c 48   . ? 1_555 ? 
2871 YC8 5  CYS K  51  ? CYS c 51   . ? 1_555 ? 
2872 YC8 5  LYS K  52  ? LYS c 52   . ? 1_555 ? 
2873 YC8 5  CYS K  54  ? CYS c 54   . ? 1_555 ? 
2874 YC9 7  CYS K  11  ? CYS c 11   . ? 1_555 ? 
2875 YC9 7  ILE K  12  ? ILE c 12   . ? 1_555 ? 
2876 YC9 7  GLY K  13  ? GLY c 13   . ? 1_555 ? 
2877 YC9 7  CYS K  14  ? CYS c 14   . ? 1_555 ? 
2878 YC9 7  THR K  15  ? THR c 15   . ? 1_555 ? 
2879 YC9 7  CYS K  17  ? CYS c 17   . ? 1_555 ? 
2880 YC9 7  CYS K  58  ? CYS c 58   . ? 1_555 ? 
2881 ZC1 7  CLA DG .   ? CLA a 1131 . ? 1_555 ? 
2882 ZC1 7  CLA PI .   ? CLA b 1206 . ? 1_555 ? 
2883 ZC1 7  CLA MH .   ? CLA b 1207 . ? 1_555 ? 
2884 ZC1 7  CLA RI .   ? CLA b 1238 . ? 1_555 ? 
2885 ZC1 7  BCR WI .   ? BCR f 4020 . ? 1_555 ? 
2886 ZC1 7  PHE O  22  ? PHE i 22   . ? 1_555 ? 
2887 ZC1 7  PRO O  23  ? PRO i 23   . ? 1_555 ? 
2888 ZC2 10 CLA DG .   ? CLA a 1131 . ? 1_555 ? 
2889 ZC2 10 CLA OG .   ? CLA a 1132 . ? 1_555 ? 
2890 ZC2 10 CLA BF .   ? CLA a 1237 . ? 1_555 ? 
2891 ZC2 10 CLA MH .   ? CLA b 1207 . ? 1_555 ? 
2892 ZC2 10 BCR VI .   ? BCR f 4018 . ? 1_555 ? 
2893 ZC2 10 TRP O  20  ? TRP i 20   . ? 1_555 ? 
2894 ZC2 10 TRP P  65  ? TRP l 65   . ? 1_555 ? 
2895 ZC2 10 ALA P  87  ? ALA l 87   . ? 1_555 ? 
2896 ZC2 10 LEU P  88  ? LEU l 88   . ? 1_555 ? 
2897 ZC2 10 CLA ZI .   ? CLA l 1502 . ? 1_555 ? 
2898 ZC3 6  TRP I  118 ? TRP a 118  . ? 1_555 ? 
2899 ZC3 6  CLA DF .   ? CLA a 1101 . ? 1_555 ? 
2900 ZC3 6  CLA IF .   ? CLA a 1106 . ? 1_555 ? 
2901 ZC3 6  CLA HG .   ? CLA a 1140 . ? 1_555 ? 
2902 ZC3 6  THR N  10  ? THR f 10   . ? 1_555 ? 
2903 ZC3 6  PRO N  12  ? PRO f 12   . ? 1_555 ? 
2904 ZC4 9  PHE P  33  ? PHE l 33   . ? 1_555 ? 
2905 ZC4 9  LEU P  37  ? LEU l 37   . ? 1_555 ? 
2906 ZC4 9  ARG P  41  ? ARG l 41   . ? 1_555 ? 
2907 ZC4 9  GLU P  52  ? GLU l 52   . ? 1_555 ? 
2908 ZC4 9  MET P  55  ? MET l 55   . ? 1_555 ? 
2909 ZC4 9  ALA P  56  ? ALA l 56   . ? 1_555 ? 
2910 ZC4 9  CLA ZI .   ? CLA l 1502 . ? 1_555 ? 
2911 ZC4 9  CLA AJ .   ? CLA l 1503 . ? 1_555 ? 
2912 ZC4 9  BCR CJ .   ? BCR l 4022 . ? 1_555 ? 
2913 ZC5 14 CLA BF .   ? CLA a 1237 . ? 1_555 ? 
2914 ZC5 14 LEU J  684 ? LEU b 684  . ? 1_555 ? 
2915 ZC5 14 BCR WI .   ? BCR f 4020 . ? 1_555 ? 
2916 ZC5 14 PHE P  33  ? PHE l 33   . ? 1_555 ? 
2917 ZC5 14 LEU P  37  ? LEU l 37   . ? 1_555 ? 
2918 ZC5 14 PRO P  38  ? PRO l 38   . ? 1_555 ? 
2919 ZC5 14 GLU P  52  ? GLU l 52   . ? 1_555 ? 
2920 ZC5 14 ALA P  56  ? ALA l 56   . ? 1_555 ? 
2921 ZC5 14 HIS P  57  ? HIS l 57   . ? 1_555 ? 
2922 ZC5 14 PHE P  60  ? PHE l 60   . ? 1_555 ? 
2923 ZC5 14 CLA YI .   ? CLA l 1501 . ? 1_555 ? 
2924 ZC5 14 CLA AJ .   ? CLA l 1503 . ? 1_555 ? 
2925 ZC5 14 BCR BJ .   ? BCR l 4019 . ? 1_555 ? 
2926 ZC5 14 BCR CJ .   ? BCR l 4022 . ? 1_555 ? 
2927 ZC6 11 CLA OG .   ? CLA a 1132 . ? 1_555 ? 
2928 ZC6 11 TYR P  59  ? TYR l 59   . ? 1_555 ? 
2929 ZC6 11 PHE P  60  ? PHE l 60   . ? 1_555 ? 
2930 ZC6 11 GLY P  63  ? GLY l 63   . ? 1_555 ? 
2931 ZC6 11 PRO P  64  ? PRO l 64   . ? 1_555 ? 
2932 ZC6 11 THR P  66  ? THR l 66   . ? 1_555 ? 
2933 ZC6 11 ALA P  138 ? ALA l 138  . ? 1_555 ? 
2934 ZC6 11 LEU P  142 ? LEU l 142  . ? 1_555 ? 
2935 ZC6 11 LEU P  145 ? LEU l 145  . ? 1_555 ? 
2936 ZC6 11 CLA YI .   ? CLA l 1501 . ? 1_555 ? 
2937 ZC6 11 CLA ZI .   ? CLA l 1502 . ? 1_555 ? 
2938 ZC7 11 ILE J  25  ? ILE b 25   . ? 1_555 ? 
2939 ZC7 11 CLA PI .   ? CLA b 1206 . ? 1_555 ? 
2940 ZC7 11 CLA RI .   ? CLA b 1238 . ? 1_555 ? 
2941 ZC7 11 PQN TG .   ? PQN b 2002 . ? 1_555 ? 
2942 ZC7 11 MET O  27  ? MET i 27   . ? 1_555 ? 
2943 ZC7 11 LEU O  30  ? LEU i 30   . ? 1_555 ? 
2944 ZC7 11 ALA P  92  ? ALA l 92   . ? 1_555 ? 
2945 ZC7 11 ALA P  95  ? ALA l 95   . ? 1_555 ? 
2946 ZC7 11 LEU P  96  ? LEU l 96   . ? 1_555 ? 
2947 ZC7 11 TYR P  99  ? TYR l 99   . ? 1_555 ? 
2948 ZC7 11 CLA ZI .   ? CLA l 1502 . ? 1_555 ? 
2949 ZC8 9  BCR PN .   ? BCR 8 4022 . ? 1_455 ? 
2950 ZC8 9  CLA OG .   ? CLA a 1132 . ? 1_555 ? 
2951 ZC8 9  MET P  55  ? MET l 55   . ? 1_555 ? 
2952 ZC8 9  ALA P  56  ? ALA l 56   . ? 1_555 ? 
2953 ZC8 9  TYR P  59  ? TYR l 59   . ? 1_555 ? 
2954 ZC8 9  GLY P  133 ? GLY l 133  . ? 1_555 ? 
2955 ZC8 9  VAL P  137 ? VAL l 137  . ? 1_555 ? 
2956 ZC8 9  CLA YI .   ? CLA l 1501 . ? 1_555 ? 
2957 ZC8 9  CLA ZI .   ? CLA l 1502 . ? 1_555 ? 
2958 ZC9 8  CLA HH .   ? CLA b 1201 . ? 1_555 ? 
2959 ZC9 8  CLA KH .   ? CLA b 1204 . ? 1_555 ? 
2960 ZC9 8  LEU Q  9   ? LEU m 9    . ? 1_555 ? 
2961 ZC9 8  LEU Q  12  ? LEU m 12   . ? 1_555 ? 
2962 ZC9 8  VAL Q  13  ? VAL m 13   . ? 1_555 ? 
2963 ZC9 8  LEU Q  16  ? LEU m 16   . ? 1_555 ? 
2964 ZC9 8  ALA Q  19  ? ALA m 19   . ? 1_555 ? 
2965 ZC9 8  ALA Q  22  ? ALA m 22   . ? 1_555 ? 
2966 AD1 10 ALA R  327 ? ALA 1 327  . ? 1_555 ? 
2967 AD1 10 HIS R  328 ? HIS 1 328  . ? 1_555 ? 
2968 AD1 10 LYS R  329 ? LYS 1 329  . ? 1_555 ? 
2969 AD1 10 PHE R  332 ? PHE 1 332  . ? 1_555 ? 
2970 AD1 10 CLA ZK .   ? CLA 1 1121 . ? 1_555 ? 
2971 AD1 10 CLA IK .   ? CLA 1 1122 . ? 1_555 ? 
2972 AD1 10 BCR KJ .   ? BCR 1 4007 . ? 1_555 ? 
2973 AD1 10 LHG NJ .   ? LHG 1 5003 . ? 1_555 ? 
2974 AD1 10 PHE J  151 ? PHE b 151  . ? 1_655 ? 
2975 AD1 10 ARG Q  24  ? ARG m 24   . ? 1_655 ? 
2976 AD2 14 MET R  684 ? MET 1 684  . ? 1_555 ? 
2977 AD2 14 PHE R  685 ? PHE 1 685  . ? 1_555 ? 
2978 AD2 14 SER R  688 ? SER 1 688  . ? 1_555 ? 
2979 AD2 14 GLY R  689 ? GLY 1 689  . ? 1_555 ? 
2980 AD2 14 ARG R  690 ? ARG 1 690  . ? 1_555 ? 
2981 AD2 14 TRP R  693 ? TRP 1 693  . ? 1_555 ? 
2982 AD2 14 ALA R  717 ? ALA 1 717  . ? 1_555 ? 
2983 AD2 14 LEU R  718 ? LEU 1 718  . ? 1_555 ? 
2984 AD2 14 CLA QJ .   ? CLA 1 1101 . ? 1_555 ? 
2985 AD2 14 CLA SK .   ? CLA 1 1138 . ? 1_555 ? 
2986 AD2 14 CLA TK .   ? CLA 1 1139 . ? 1_555 ? 
2987 AD2 14 CLA UK .   ? CLA 1 1140 . ? 1_555 ? 
2988 AD2 14 BCR NL .   ? BCR 2 4014 . ? 1_555 ? 
2989 AD2 14 ALA W  11  ? ALA 6 11   . ? 1_555 ? 
2990 AD3 4  CYS R  574 ? CYS 1 574  . ? 1_555 ? 
2991 AD3 4  CYS R  583 ? CYS 1 583  . ? 1_555 ? 
2992 AD3 4  CYS S  556 ? CYS 2 556  . ? 1_555 ? 
2993 AD3 4  CYS S  565 ? CYS 2 565  . ? 1_555 ? 
2994 AD4 14 PHE DA 77  ? PHE 0 77   . ? 1_555 ? 
2995 AD4 14 ALA DA 106 ? ALA 0 106  . ? 1_555 ? 
2996 AD4 14 SER DA 109 ? SER 0 109  . ? 1_555 ? 
2997 AD4 14 PHE DA 110 ? PHE 0 110  . ? 1_555 ? 
2998 AD4 14 PHE R  263 ? PHE 1 263  . ? 1_555 ? 
2999 AD4 14 PHE R  264 ? PHE 1 264  . ? 1_555 ? 
3000 AD4 14 LEU R  298 ? LEU 1 298  . ? 1_555 ? 
3001 AD4 14 VAL R  302 ? VAL 1 302  . ? 1_555 ? 
3002 AD4 14 ILE R  305 ? ILE 1 305  . ? 1_555 ? 
3003 AD4 14 HIS R  309 ? HIS 1 309  . ? 1_555 ? 
3004 AD4 14 CLA CK .   ? CLA 1 1113 . ? 1_555 ? 
3005 AD4 14 CLA GK .   ? CLA 1 1118 . ? 1_555 ? 
3006 AD4 14 CLA YK .   ? CLA 1 1120 . ? 1_555 ? 
3007 AD4 14 BCR IJ .   ? BCR 1 4002 . ? 1_555 ? 
3008 AD5 14 CLA WN .   ? CLA 0 1402 . ? 1_555 ? 
3009 AD5 14 PHE R  84  ? PHE 1 84   . ? 1_555 ? 
3010 AD5 14 THR R  161 ? THR 1 161  . ? 1_555 ? 
3011 AD5 14 GLY R  164 ? GLY 1 164  . ? 1_555 ? 
3012 AD5 14 GLY R  165 ? GLY 1 165  . ? 1_555 ? 
3013 AD5 14 MET R  168 ? MET 1 168  . ? 1_555 ? 
3014 AD5 14 LEU R  207 ? LEU 1 207  . ? 1_555 ? 
3015 AD5 14 GLY R  211 ? GLY 1 211  . ? 1_555 ? 
3016 AD5 14 CLA SJ .   ? CLA 1 1103 . ? 1_555 ? 
3017 AD5 14 CLA BK .   ? CLA 1 1112 . ? 1_555 ? 
3018 AD5 14 CLA CK .   ? CLA 1 1113 . ? 1_555 ? 
3019 AD5 14 CLA GK .   ? CLA 1 1118 . ? 1_555 ? 
3020 AD5 14 BCR HJ .   ? BCR 1 4001 . ? 1_555 ? 
3021 AD5 14 BCR JJ .   ? BCR 1 4003 . ? 1_555 ? 
3022 AD6 6  GLY R  208 ? GLY 1 208  . ? 1_555 ? 
3023 AD6 6  CLA SJ .   ? CLA 1 1103 . ? 1_555 ? 
3024 AD6 6  CLA AK .   ? CLA 1 1111 . ? 1_555 ? 
3025 AD6 6  CLA GK .   ? CLA 1 1118 . ? 1_555 ? 
3026 AD6 6  CLA NK .   ? CLA 1 1127 . ? 1_555 ? 
3027 AD6 6  BCR IJ .   ? BCR 1 4002 . ? 1_555 ? 
3028 AD7 9  ALA R  350 ? ALA 1 350  . ? 1_555 ? 
3029 AD7 9  ILE R  354 ? ILE 1 354  . ? 1_555 ? 
3030 AD7 9  PHE R  411 ? PHE 1 411  . ? 1_555 ? 
3031 AD7 9  CLA HK .   ? CLA 1 1119 . ? 1_555 ? 
3032 AD7 9  CLA IK .   ? CLA 1 1122 . ? 1_555 ? 
3033 AD7 9  CLA JK .   ? CLA 1 1123 . ? 1_555 ? 
3034 AD7 9  CLA EJ .   ? CLA 1 1801 . ? 1_555 ? 
3035 AD7 9  BCR LJ .   ? BCR 1 4008 . ? 1_555 ? 
3036 AD7 9  LHG NJ .   ? LHG 1 5003 . ? 1_555 ? 
3037 AD8 10 ALA R  357 ? ALA 1 357  . ? 1_555 ? 
3038 AD8 10 LEU R  358 ? LEU 1 358  . ? 1_555 ? 
3039 AD8 10 SER R  361 ? SER 1 361  . ? 1_555 ? 
3040 AD8 10 ALA R  404 ? ALA 1 404  . ? 1_555 ? 
3041 AD8 10 GLY R  405 ? GLY 1 405  . ? 1_555 ? 
3042 AD8 10 CLA HK .   ? CLA 1 1119 . ? 1_555 ? 
3043 AD8 10 CLA KK .   ? CLA 1 1124 . ? 1_555 ? 
3044 AD8 10 CLA DL .   ? CLA 1 1134 . ? 1_555 ? 
3045 AD8 10 CLA RK .   ? CLA 1 1137 . ? 1_555 ? 
3046 AD8 10 BCR KJ .   ? BCR 1 4007 . ? 1_555 ? 
3047 AD9 16 TRP R  49  ? TRP 1 49   . ? 1_555 ? 
3048 AD9 16 ASN R  50  ? ASN 1 50   . ? 1_555 ? 
3049 AD9 16 HIS R  52  ? HIS 1 52   . ? 1_555 ? 
3050 AD9 16 ALA R  53  ? ALA 1 53   . ? 1_555 ? 
3051 AD9 16 ASN R  54  ? ASN 1 54   . ? 1_555 ? 
3052 AD9 16 ARG R  571 ? ARG 1 571  . ? 1_555 ? 
3053 AD9 16 SER R  719 ? SER 1 719  . ? 1_555 ? 
3054 AD9 16 ILE R  721 ? ILE 1 721  . ? 1_555 ? 
3055 AD9 16 GLN R  722 ? GLN 1 722  . ? 1_555 ? 
3056 AD9 16 ALA R  725 ? ALA 1 725  . ? 1_555 ? 
3057 AD9 16 VAL R  728 ? VAL 1 728  . ? 1_555 ? 
3058 AD9 16 ALA R  729 ? ALA 1 729  . ? 1_555 ? 
3059 AD9 16 CLA RJ .   ? CLA 1 1102 . ? 1_555 ? 
3060 AD9 16 CLA TJ .   ? CLA 1 1104 . ? 1_555 ? 
3061 AD9 16 CLA OK .   ? CLA 1 1128 . ? 1_555 ? 
3062 AD9 16 CLA UK .   ? CLA 1 1140 . ? 1_555 ? 
3063 BD1 10 GLY R  330 ? GLY 1 330  . ? 1_555 ? 
3064 BD1 10 PRO R  331 ? PRO 1 331  . ? 1_555 ? 
3065 BD1 10 PHE R  332 ? PHE 1 332  . ? 1_555 ? 
3066 BD1 10 THR R  333 ? THR 1 333  . ? 1_555 ? 
3067 BD1 10 HIS R  337 ? HIS 1 337  . ? 1_555 ? 
3068 BD1 10 CLA IK .   ? CLA 1 1122 . ? 1_555 ? 
3069 BD1 10 CLA AL .   ? CLA 1 1129 . ? 1_555 ? 
3070 BD1 10 CLA RK .   ? CLA 1 1137 . ? 1_555 ? 
3071 BD1 10 CLA EJ .   ? CLA 1 1801 . ? 1_555 ? 
3072 BD1 10 BCR KJ .   ? BCR 1 4007 . ? 1_555 ? 
3073 BD2 16 SER R  438 ? SER 1 438  . ? 1_555 ? 
3074 BD2 16 ASN R  441 ? ASN 1 441  . ? 1_555 ? 
3075 BD2 16 TRP R  442 ? TRP 1 442  . ? 1_555 ? 
3076 BD2 16 ILE R  445 ? ILE 1 445  . ? 1_555 ? 
3077 BD2 16 CLA PK .   ? CLA 1 1130 . ? 1_555 ? 
3078 BD2 16 CLA QK .   ? CLA 1 1131 . ? 1_555 ? 
3079 BD2 16 ILE S  675 ? ILE 2 675  . ? 1_555 ? 
3080 BD2 16 ALA S  678 ? ALA 2 678  . ? 1_555 ? 
3081 BD2 16 THR S  682 ? THR 2 682  . ? 1_555 ? 
3082 BD2 16 ALA S  685 ? ALA 2 685  . ? 1_555 ? 
3083 BD2 16 CLA EN .   ? CLA 2 1238 . ? 1_555 ? 
3084 BD2 16 PQN GL .   ? PQN 2 2002 . ? 1_555 ? 
3085 BD2 16 BCR OL .   ? BCR 2 4017 . ? 1_555 ? 
3086 BD2 16 BCR JN .   ? BCR 6 4020 . ? 1_555 ? 
3087 BD2 16 CLA MN .   ? CLA 8 1502 . ? 1_555 ? 
3088 BD2 16 BCR ON .   ? BCR 8 4019 . ? 1_555 ? 
3089 BD3 20 PHE R  452 ? PHE 1 452  . ? 1_555 ? 
3090 BD3 20 ILE R  456 ? ILE 1 456  . ? 1_555 ? 
3091 BD3 20 PHE R  540 ? PHE 1 540  . ? 1_555 ? 
3092 BD3 20 PHE R  596 ? PHE 1 596  . ? 1_555 ? 
3093 BD3 20 TRP R  597 ? TRP 1 597  . ? 1_555 ? 
3094 BD3 20 ASN R  600 ? ASN 1 600  . ? 1_555 ? 
3095 BD3 20 ILE R  642 ? ILE 1 642  . ? 1_555 ? 
3096 BD3 20 TYR R  731 ? TYR 1 731  . ? 1_555 ? 
3097 BD3 20 CLA VK .   ? CLA 1 1011 . ? 1_555 ? 
3098 BD3 20 TRP S  645 ? TRP 2 645  . ? 1_555 ? 
3099 BD3 20 LEU S  648 ? LEU 2 648  . ? 1_555 ? 
3100 BD3 20 HIS S  651 ? HIS 2 651  . ? 1_555 ? 
3101 BD3 20 LEU S  652 ? LEU 2 652  . ? 1_555 ? 
3102 BD3 20 TRP S  654 ? TRP 2 654  . ? 1_555 ? 
3103 BD3 20 ALA S  655 ? ALA 2 655  . ? 1_555 ? 
3104 BD3 20 CLA SL .   ? CLA 2 1021 . ? 1_555 ? 
3105 BD3 20 CLA TL .   ? CLA 2 1023 . ? 1_555 ? 
3106 BD3 20 CLA ZL .   ? CLA 2 1206 . ? 1_555 ? 
3107 BD3 20 CLA FN .   ? CLA 2 1239 . ? 1_555 ? 
3108 BD3 20 BCR OL .   ? BCR 2 4017 . ? 1_555 ? 
3109 BD4 13 TRP R  47  ? TRP 1 47   . ? 1_555 ? 
3110 BD4 13 ILE R  48  ? ILE 1 48   . ? 1_555 ? 
3111 BD4 13 TRP R  49  ? TRP 1 49   . ? 1_555 ? 
3112 BD4 13 LEU R  51  ? LEU 1 51   . ? 1_555 ? 
3113 BD4 13 HIS R  52  ? HIS 1 52   . ? 1_555 ? 
3114 BD4 13 CLA RJ .   ? CLA 1 1102 . ? 1_555 ? 
3115 BD4 13 CLA YJ .   ? CLA 1 1109 . ? 1_555 ? 
3116 BD4 13 CLA MK .   ? CLA 1 1126 . ? 1_555 ? 
3117 BD4 13 CLA TK .   ? CLA 1 1139 . ? 1_555 ? 
3118 BD4 13 CLA UK .   ? CLA 1 1140 . ? 1_555 ? 
3119 BD4 13 PQN FJ .   ? PQN 1 2001 . ? 1_555 ? 
3120 BD4 13 CLA RL .   ? CLA 2 1013 . ? 1_555 ? 
3121 BD4 13 BCR NL .   ? BCR 2 4014 . ? 1_555 ? 
3122 BD5 13 HIS R  33  ? HIS 1 33   . ? 1_555 ? 
3123 BD5 13 PHE R  34  ? PHE 1 34   . ? 1_555 ? 
3124 BD5 13 LEU R  51  ? LEU 1 51   . ? 1_555 ? 
3125 BD5 13 ALA R  55  ? ALA 1 55   . ? 1_555 ? 
3126 BD5 13 HIS R  56  ? HIS 1 56   . ? 1_555 ? 
3127 BD5 13 PHE R  58  ? PHE 1 58   . ? 1_555 ? 
3128 BD5 13 GLY R  78  ? GLY 1 78   . ? 1_555 ? 
3129 BD5 13 CLA QJ .   ? CLA 1 1101 . ? 1_555 ? 
3130 BD5 13 CLA TJ .   ? CLA 1 1104 . ? 1_555 ? 
3131 BD5 13 CLA VJ .   ? CLA 1 1106 . ? 1_555 ? 
3132 BD5 13 CLA WJ .   ? CLA 1 1107 . ? 1_555 ? 
3133 BD5 13 CLA YJ .   ? CLA 1 1109 . ? 1_555 ? 
3134 BD5 13 LHG MJ .   ? LHG 1 5001 . ? 1_555 ? 
3135 BD6 18 HIS R  56  ? HIS 1 56   . ? 1_555 ? 
3136 BD6 18 PHE R  58  ? PHE 1 58   . ? 1_555 ? 
3137 BD6 18 ILE R  72  ? ILE 1 72   . ? 1_555 ? 
3138 BD6 18 ALA R  75  ? ALA 1 75   . ? 1_555 ? 
3139 BD6 18 HIS R  76  ? HIS 1 76   . ? 1_555 ? 
3140 BD6 18 HIS R  79  ? HIS 1 79   . ? 1_555 ? 
3141 BD6 18 LEU R  80  ? LEU 1 80   . ? 1_555 ? 
3142 BD6 18 PHE R  84  ? PHE 1 84   . ? 1_555 ? 
3143 BD6 18 TRP R  348 ? TRP 1 348  . ? 1_555 ? 
3144 BD6 18 HIS R  349 ? HIS 1 349  . ? 1_555 ? 
3145 BD6 18 LEU R  352 ? LEU 1 352  . ? 1_555 ? 
3146 BD6 18 ASN R  355 ? ASN 1 355  . ? 1_555 ? 
3147 BD6 18 LEU R  356 ? LEU 1 356  . ? 1_555 ? 
3148 BD6 18 CLA TJ .   ? CLA 1 1104 . ? 1_555 ? 
3149 BD6 18 CLA JK .   ? CLA 1 1123 . ? 1_555 ? 
3150 BD6 18 CLA OK .   ? CLA 1 1128 . ? 1_555 ? 
3151 BD6 18 BCR IJ .   ? BCR 1 4002 . ? 1_555 ? 
3152 BD6 18 BCR JJ .   ? BCR 1 4003 . ? 1_555 ? 
3153 BD7 12 HIS R  56  ? HIS 1 56   . ? 1_555 ? 
3154 BD7 12 HIS R  79  ? HIS 1 79   . ? 1_555 ? 
3155 BD7 12 TRP R  86  ? TRP 1 86   . ? 1_555 ? 
3156 BD7 12 PHE R  399 ? PHE 1 399  . ? 1_555 ? 
3157 BD7 12 LEU R  400 ? LEU 1 400  . ? 1_555 ? 
3158 BD7 12 CLA RJ .   ? CLA 1 1102 . ? 1_555 ? 
3159 BD7 12 CLA SJ .   ? CLA 1 1103 . ? 1_555 ? 
3160 BD7 12 CLA VJ .   ? CLA 1 1106 . ? 1_555 ? 
3161 BD7 12 CLA MK .   ? CLA 1 1126 . ? 1_555 ? 
3162 BD7 12 CLA NK .   ? CLA 1 1127 . ? 1_555 ? 
3163 BD7 12 CLA OK .   ? CLA 1 1128 . ? 1_555 ? 
3164 BD7 12 LHG MJ .   ? LHG 1 5001 . ? 1_555 ? 
3165 BD8 11 VAL R  85  ? VAL 1 85   . ? 1_555 ? 
3166 BD8 11 GLY R  89  ? GLY 1 89   . ? 1_555 ? 
3167 BD8 11 PHE R  92  ? PHE 1 92   . ? 1_555 ? 
3168 BD8 11 HIS R  93  ? HIS 1 93   . ? 1_555 ? 
3169 BD8 11 PHE R  97  ? PHE 1 97   . ? 1_555 ? 
3170 BD8 11 VAL R  116 ? VAL 1 116  . ? 1_555 ? 
3171 BD8 11 TRP R  118 ? TRP 1 118  . ? 1_555 ? 
3172 BD8 11 LEU R  166 ? LEU 1 166  . ? 1_555 ? 
3173 BD8 11 CLA VJ .   ? CLA 1 1106 . ? 1_555 ? 
3174 BD8 11 CLA WJ .   ? CLA 1 1107 . ? 1_555 ? 
3175 BD8 11 BCR KN .   ? BCR 6 4013 . ? 1_555 ? 
3176 BD9 19 TRP R  86  ? TRP 1 86   . ? 1_555 ? 
3177 BD9 19 MET R  90  ? MET 1 90   . ? 1_555 ? 
3178 BD9 19 ALA R  114 ? ALA 1 114  . ? 1_555 ? 
3179 BD9 19 GLN R  115 ? GLN 1 115  . ? 1_555 ? 
3180 BD9 19 GLN R  138 ? GLN 1 138  . ? 1_555 ? 
3181 BD9 19 ILE R  139 ? ILE 1 139  . ? 1_555 ? 
3182 BD9 19 THR R  140 ? THR 1 140  . ? 1_555 ? 
3183 BD9 19 SER R  141 ? SER 1 141  . ? 1_555 ? 
3184 BD9 19 LEU R  143 ? LEU 1 143  . ? 1_555 ? 
3185 BD9 19 ALA R  667 ? ALA 1 667  . ? 1_555 ? 
3186 BD9 19 CLA RJ .   ? CLA 1 1102 . ? 1_555 ? 
3187 BD9 19 CLA TJ .   ? CLA 1 1104 . ? 1_555 ? 
3188 BD9 19 CLA UJ .   ? CLA 1 1105 . ? 1_555 ? 
3189 BD9 19 CLA WJ .   ? CLA 1 1107 . ? 1_555 ? 
3190 BD9 19 CLA YJ .   ? CLA 1 1109 . ? 1_555 ? 
3191 BD9 19 CLA MK .   ? CLA 1 1126 . ? 1_555 ? 
3192 BD9 19 CLA OK .   ? CLA 1 1128 . ? 1_555 ? 
3193 BD9 19 BCR ML .   ? BCR 2 4011 . ? 1_555 ? 
3194 BD9 19 BCR KN .   ? BCR 6 4013 . ? 1_555 ? 
3195 CD1 16 GLN R  115 ? GLN 1 115  . ? 1_555 ? 
3196 CD1 16 VAL R  116 ? VAL 1 116  . ? 1_555 ? 
3197 CD1 16 VAL R  117 ? VAL 1 117  . ? 1_555 ? 
3198 CD1 16 TRP R  118 ? TRP 1 118  . ? 1_555 ? 
3199 CD1 16 GLN R  123 ? GLN 1 123  . ? 1_555 ? 
3200 CD1 16 LEU R  126 ? LEU 1 126  . ? 1_555 ? 
3201 CD1 16 ILE R  137 ? ILE 1 137  . ? 1_555 ? 
3202 CD1 16 ILE R  670 ? ILE 1 670  . ? 1_555 ? 
3203 CD1 16 CLA RJ .   ? CLA 1 1102 . ? 1_555 ? 
3204 CD1 16 CLA UJ .   ? CLA 1 1105 . ? 1_555 ? 
3205 CD1 16 CLA VJ .   ? CLA 1 1106 . ? 1_555 ? 
3206 CD1 16 CLA MK .   ? CLA 1 1126 . ? 1_555 ? 
3207 CD1 16 VAL S  440 ? VAL 2 440  . ? 1_555 ? 
3208 CD1 16 PHE S  444 ? PHE 2 444  . ? 1_555 ? 
3209 CD1 16 CLA WM .   ? CLA 2 1230 . ? 1_555 ? 
3210 CD1 16 BCR KN .   ? BCR 6 4013 . ? 1_555 ? 
3211 CD2 9  PHE R  77  ? PHE 1 77   . ? 1_555 ? 
3212 CD2 9  MET R  172 ? MET 1 172  . ? 1_555 ? 
3213 CD2 9  PHE R  174 ? PHE 1 174  . ? 1_555 ? 
3214 CD2 9  ALA R  175 ? ALA 1 175  . ? 1_555 ? 
3215 CD2 9  HIS R  179 ? HIS 1 179  . ? 1_555 ? 
3216 CD2 9  LYS R  183 ? LYS 1 183  . ? 1_555 ? 
3217 CD2 9  TRP R  189 ? TRP 1 189  . ? 1_555 ? 
3218 CD2 9  CLA ZJ .   ? CLA 1 1110 . ? 1_555 ? 
3219 CD2 9  CLA AK .   ? CLA 1 1111 . ? 1_555 ? 
3220 CD3 18 THR R  23  ? THR 1 23   . ? 1_555 ? 
3221 CD3 18 SER R  24  ? SER 1 24   . ? 1_555 ? 
3222 CD3 18 PHE R  25  ? PHE 1 25   . ? 1_555 ? 
3223 CD3 18 LYS R  27  ? LYS 1 27   . ? 1_555 ? 
3224 CD3 18 TRP R  28  ? TRP 1 28   . ? 1_555 ? 
3225 CD3 18 HIS R  33  ? HIS 1 33   . ? 1_555 ? 
3226 CD3 18 LYS R  71  ? LYS 1 71   . ? 1_555 ? 
3227 CD3 18 SER R  74  ? SER 1 74   . ? 1_555 ? 
3228 CD3 18 GLY R  78  ? GLY 1 78   . ? 1_555 ? 
3229 CD3 18 VAL R  82  ? VAL 1 82   . ? 1_555 ? 
3230 CD3 18 LEU R  173 ? LEU 1 173  . ? 1_555 ? 
3231 CD3 18 GLY R  176 ? GLY 1 176  . ? 1_555 ? 
3232 CD3 18 TRP R  177 ? TRP 1 177  . ? 1_555 ? 
3233 CD3 18 TYR R  180 ? TYR 1 180  . ? 1_555 ? 
3234 CD3 18 HIS R  181 ? HIS 1 181  . ? 1_555 ? 
3235 CD3 18 CLA QJ .   ? CLA 1 1101 . ? 1_555 ? 
3236 CD3 18 CLA RJ .   ? CLA 1 1102 . ? 1_555 ? 
3237 CD3 18 CLA VJ .   ? CLA 1 1106 . ? 1_555 ? 
3238 CD4 6  TRP R  189 ? TRP 1 189  . ? 1_555 ? 
3239 CD4 6  SER R  195 ? SER 1 195  . ? 1_555 ? 
3240 CD4 6  HIS R  199 ? HIS 1 199  . ? 1_555 ? 
3241 CD4 6  CLA XJ .   ? CLA 1 1108 . ? 1_555 ? 
3242 CD4 6  CLA AK .   ? CLA 1 1111 . ? 1_555 ? 
3243 CD4 6  CLA GK .   ? CLA 1 1118 . ? 1_555 ? 
3244 CD5 15 PHE R  73  ? PHE 1 73   . ? 1_555 ? 
3245 CD5 15 HIS R  76  ? HIS 1 76   . ? 1_555 ? 
3246 CD5 15 PHE R  77  ? PHE 1 77   . ? 1_555 ? 
3247 CD5 15 LEU R  80  ? LEU 1 80   . ? 1_555 ? 
3248 CD5 15 TRP R  189 ? TRP 1 189  . ? 1_555 ? 
3249 CD5 15 PHE R  190 ? PHE 1 190  . ? 1_555 ? 
3250 CD5 15 ASN R  192 ? ASN 1 192  . ? 1_555 ? 
3251 CD5 15 MET R  196 ? MET 1 196  . ? 1_555 ? 
3252 CD5 15 HIS R  199 ? HIS 1 199  . ? 1_555 ? 
3253 CD5 15 HIS R  200 ? HIS 1 200  . ? 1_555 ? 
3254 CD5 15 LEU R  204 ? LEU 1 204  . ? 1_555 ? 
3255 CD5 15 CLA XJ .   ? CLA 1 1108 . ? 1_555 ? 
3256 CD5 15 CLA ZJ .   ? CLA 1 1110 . ? 1_555 ? 
3257 CD5 15 CLA JK .   ? CLA 1 1123 . ? 1_555 ? 
3258 CD5 15 BCR JJ .   ? BCR 1 4003 . ? 1_555 ? 
3259 CD6 9  GLY R  151 ? GLY 1 151  . ? 1_555 ? 
3260 CD6 9  PHE R  152 ? PHE 1 152  . ? 1_555 ? 
3261 CD6 9  THR R  161 ? THR 1 161  . ? 1_555 ? 
3262 CD6 9  GLY R  211 ? GLY 1 211  . ? 1_555 ? 
3263 CD6 9  TRP R  212 ? TRP 1 212  . ? 1_555 ? 
3264 CD6 9  HIS R  215 ? HIS 1 215  . ? 1_555 ? 
3265 CD6 9  CLA CK .   ? CLA 1 1113 . ? 1_555 ? 
3266 CD6 9  CLA XK .   ? CLA 1 1114 . ? 1_555 ? 
3267 CD6 9  BCR IJ .   ? BCR 1 4002 . ? 1_555 ? 
3268 CD7 9  LEU R  210 ? LEU 1 210  . ? 1_555 ? 
3269 CD7 9  ILE R  217 ? ILE 1 217  . ? 1_555 ? 
3270 CD7 9  HIS R  218 ? HIS 1 218  . ? 1_555 ? 
3271 CD7 9  PHE R  256 ? PHE 1 256  . ? 1_555 ? 
3272 CD7 9  GLY R  259 ? GLY 1 259  . ? 1_555 ? 
3273 CD7 9  LEU R  260 ? LEU 1 260  . ? 1_555 ? 
3274 CD7 9  CLA BK .   ? CLA 1 1112 . ? 1_555 ? 
3275 CD7 9  BCR HJ .   ? BCR 1 4001 . ? 1_555 ? 
3276 CD7 9  BCR IJ .   ? BCR 1 4002 . ? 1_555 ? 
3277 CD8 11 ALA DA 49  ? ALA 0 49   . ? 1_555 ? 
3278 CD8 11 CLA VN .   ? CLA 0 1401 . ? 1_555 ? 
3279 CD8 11 TRP R  268 ? TRP 1 268  . ? 1_555 ? 
3280 CD8 11 LEU R  275 ? LEU 1 275  . ? 1_555 ? 
3281 CD8 11 PHE R  277 ? PHE 1 277  . ? 1_555 ? 
3282 CD8 11 HIS R  295 ? HIS 1 295  . ? 1_555 ? 
3283 CD8 11 LEU R  298 ? LEU 1 298  . ? 1_555 ? 
3284 CD8 11 VAL R  302 ? VAL 1 302  . ? 1_555 ? 
3285 CD8 11 ASN R  500 ? ASN 1 500  . ? 1_555 ? 
3286 CD8 11 CLA EK .   ? CLA 1 1116 . ? 1_555 ? 
3287 CD8 11 CLA DL .   ? CLA 1 1134 . ? 1_555 ? 
3288 CD9 15 PHE R  277 ? PHE 1 277  . ? 1_555 ? 
3289 CD9 15 GLY R  279 ? GLY 1 279  . ? 1_555 ? 
3290 CD9 15 ASP R  292 ? ASP 1 292  . ? 1_555 ? 
3291 CD9 15 HIS R  295 ? HIS 1 295  . ? 1_555 ? 
3292 CD9 15 HIS R  296 ? HIS 1 296  . ? 1_555 ? 
3293 CD9 15 ALA R  299 ? ALA 1 299  . ? 1_555 ? 
3294 CD9 15 ILE R  300 ? ILE 1 300  . ? 1_555 ? 
3295 CD9 15 LEU R  303 ? LEU 1 303  . ? 1_555 ? 
3296 CD9 15 HIS R  369 ? HIS 1 369  . ? 1_555 ? 
3297 CD9 15 MET R  373 ? MET 1 373  . ? 1_555 ? 
3298 CD9 15 ALA R  505 ? ALA 1 505  . ? 1_555 ? 
3299 CD9 15 CLA DK .   ? CLA 1 1115 . ? 1_555 ? 
3300 CD9 15 CLA FK .   ? CLA 1 1117 . ? 1_555 ? 
3301 CD9 15 CLA LK .   ? CLA 1 1125 . ? 1_555 ? 
3302 CD9 15 CLA CL .   ? CLA 1 1133 . ? 1_555 ? 
3303 DD1 16 ALA R  149 ? ALA 1 149  . ? 1_555 ? 
3304 DD1 16 LEU R  205 ? LEU 1 205  . ? 1_555 ? 
3305 DD1 16 GLY R  208 ? GLY 1 208  . ? 1_555 ? 
3306 DD1 16 SER R  209 ? SER 1 209  . ? 1_555 ? 
3307 DD1 16 TRP R  212 ? TRP 1 212  . ? 1_555 ? 
3308 DD1 16 GLN R  216 ? GLN 1 216  . ? 1_555 ? 
3309 DD1 16 HIS R  296 ? HIS 1 296  . ? 1_555 ? 
3310 DD1 16 HIS R  297 ? HIS 1 297  . ? 1_555 ? 
3311 DD1 16 ILE R  300 ? ILE 1 300  . ? 1_555 ? 
3312 DD1 16 PHE R  304 ? PHE 1 304  . ? 1_555 ? 
3313 DD1 16 LEU R  362 ? LEU 1 362  . ? 1_555 ? 
3314 DD1 16 PRO R  375 ? PRO 1 375  . ? 1_555 ? 
3315 DD1 16 TYR R  376 ? TYR 1 376  . ? 1_555 ? 
3316 DD1 16 CLA EK .   ? CLA 1 1116 . ? 1_555 ? 
3317 DD1 16 CLA HK .   ? CLA 1 1119 . ? 1_555 ? 
3318 DD1 16 CLA NK .   ? CLA 1 1127 . ? 1_555 ? 
3319 DD2 14 LEU DA 105 ? LEU 0 105  . ? 1_555 ? 
3320 DD2 14 SER DA 109 ? SER 0 109  . ? 1_555 ? 
3321 DD2 14 HIS R  199 ? HIS 1 199  . ? 1_555 ? 
3322 DD2 14 ALA R  202 ? ALA 1 202  . ? 1_555 ? 
3323 DD2 14 GLY R  203 ? GLY 1 203  . ? 1_555 ? 
3324 DD2 14 LEU R  207 ? LEU 1 207  . ? 1_555 ? 
3325 DD2 14 ILE R  305 ? ILE 1 305  . ? 1_555 ? 
3326 DD2 14 HIS R  309 ? HIS 1 309  . ? 1_555 ? 
3327 DD2 14 THR R  313 ? THR 1 313  . ? 1_555 ? 
3328 DD2 14 ILE R  317 ? ILE 1 317  . ? 1_555 ? 
3329 DD2 14 CLA ZJ .   ? CLA 1 1110 . ? 1_555 ? 
3330 DD2 14 BCR HJ .   ? BCR 1 4001 . ? 1_555 ? 
3331 DD2 14 BCR IJ .   ? BCR 1 4002 . ? 1_555 ? 
3332 DD2 14 BCR JJ .   ? BCR 1 4003 . ? 1_555 ? 
3333 DD3 18 MET R  197 ? MET 1 197  . ? 1_555 ? 
3334 DD3 18 LEU R  201 ? LEU 1 201  . ? 1_555 ? 
3335 DD3 18 LEU R  205 ? LEU 1 205  . ? 1_555 ? 
3336 DD3 18 PHE R  304 ? PHE 1 304  . ? 1_555 ? 
3337 DD3 18 MET R  310 ? MET 1 310  . ? 1_555 ? 
3338 DD3 18 TYR R  311 ? TYR 1 311  . ? 1_555 ? 
3339 DD3 18 MET R  321 ? MET 1 321  . ? 1_555 ? 
3340 DD3 18 ILE R  324 ? ILE 1 324  . ? 1_555 ? 
3341 DD3 18 MET R  429 ? MET 1 429  . ? 1_555 ? 
3342 DD3 18 VAL R  553 ? VAL 1 553  . ? 1_555 ? 
3343 DD3 18 CLA FK .   ? CLA 1 1117 . ? 1_555 ? 
3344 DD3 18 CLA ZK .   ? CLA 1 1121 . ? 1_555 ? 
3345 DD3 18 CLA IK .   ? CLA 1 1122 . ? 1_555 ? 
3346 DD3 18 CLA JK .   ? CLA 1 1123 . ? 1_555 ? 
3347 DD3 18 CLA LK .   ? CLA 1 1125 . ? 1_555 ? 
3348 DD3 18 CLA AL .   ? CLA 1 1129 . ? 1_555 ? 
3349 DD3 18 BCR KJ .   ? BCR 1 4007 . ? 1_555 ? 
3350 DD3 18 BCR LJ .   ? BCR 1 4008 . ? 1_555 ? 
3351 DD4 14 ILE R  324 ? ILE 1 324  . ? 1_555 ? 
3352 DD4 14 LEU R  325 ? LEU 1 325  . ? 1_555 ? 
3353 DD4 14 HIS R  328 ? HIS 1 328  . ? 1_555 ? 
3354 DD4 14 THR R  333 ? THR 1 333  . ? 1_555 ? 
3355 DD4 14 HIS R  337 ? HIS 1 337  . ? 1_555 ? 
3356 DD4 14 LEU R  340 ? LEU 1 340  . ? 1_555 ? 
3357 DD4 14 MET R  429 ? MET 1 429  . ? 1_555 ? 
3358 DD4 14 CLA HK .   ? CLA 1 1119 . ? 1_555 ? 
3359 DD4 14 CLA JK .   ? CLA 1 1123 . ? 1_555 ? 
3360 DD4 14 CLA AL .   ? CLA 1 1129 . ? 1_555 ? 
3361 DD4 14 CLA RK .   ? CLA 1 1137 . ? 1_555 ? 
3362 DD4 14 CLA EJ .   ? CLA 1 1801 . ? 1_555 ? 
3363 DD4 14 BCR KJ .   ? BCR 1 4007 . ? 1_555 ? 
3364 DD4 14 LHG NJ .   ? LHG 1 5003 . ? 1_555 ? 
3365 DD5 20 HIS R  76  ? HIS 1 76   . ? 1_555 ? 
3366 DD5 20 VAL R  193 ? VAL 1 193  . ? 1_555 ? 
3367 DD5 20 MET R  196 ? MET 1 196  . ? 1_555 ? 
3368 DD5 20 MET R  197 ? MET 1 197  . ? 1_555 ? 
3369 DD5 20 HIS R  200 ? HIS 1 200  . ? 1_555 ? 
3370 DD5 20 MET R  321 ? MET 1 321  . ? 1_555 ? 
3371 DD5 20 LEU R  344 ? LEU 1 344  . ? 1_555 ? 
3372 DD5 20 THR R  346 ? THR 1 346  . ? 1_555 ? 
3373 DD5 20 SER R  347 ? SER 1 347  . ? 1_555 ? 
3374 DD5 20 TRP R  348 ? TRP 1 348  . ? 1_555 ? 
3375 DD5 20 GLN R  351 ? GLN 1 351  . ? 1_555 ? 
3376 DD5 20 ILE R  354 ? ILE 1 354  . ? 1_555 ? 
3377 DD5 20 ASN R  355 ? ASN 1 355  . ? 1_555 ? 
3378 DD5 20 LEU R  358 ? LEU 1 358  . ? 1_555 ? 
3379 DD5 20 CLA SJ .   ? CLA 1 1103 . ? 1_555 ? 
3380 DD5 20 CLA AK .   ? CLA 1 1111 . ? 1_555 ? 
3381 DD5 20 CLA HK .   ? CLA 1 1119 . ? 1_555 ? 
3382 DD5 20 CLA IK .   ? CLA 1 1122 . ? 1_555 ? 
3383 DD5 20 CLA NK .   ? CLA 1 1127 . ? 1_555 ? 
3384 DD5 20 BCR KJ .   ? BCR 1 4007 . ? 1_555 ? 
3385 DD6 11 ILE R  364 ? ILE 1 364  . ? 1_555 ? 
3386 DD6 11 ILE R  365 ? ILE 1 365  . ? 1_555 ? 
3387 DD6 11 GLN R  368 ? GLN 1 368  . ? 1_555 ? 
3388 DD6 11 ILE R  401 ? ILE 1 401  . ? 1_555 ? 
3389 DD6 11 ILE R  542 ? ILE 1 542  . ? 1_555 ? 
3390 DD6 11 THR R  545 ? THR 1 545  . ? 1_555 ? 
3391 DD6 11 SER R  601 ? SER 1 601  . ? 1_555 ? 
3392 DD6 11 CLA LK .   ? CLA 1 1125 . ? 1_555 ? 
3393 DD6 11 CLA EL .   ? CLA 1 1135 . ? 1_555 ? 
3394 DD6 11 CLA RK .   ? CLA 1 1137 . ? 1_555 ? 
3395 DD6 11 BCR LJ .   ? BCR 1 4008 . ? 1_555 ? 
3396 DD7 13 LEU R  358 ? LEU 1 358  . ? 1_555 ? 
3397 DD7 13 GLN R  368 ? GLN 1 368  . ? 1_555 ? 
3398 DD7 13 HIS R  369 ? HIS 1 369  . ? 1_555 ? 
3399 DD7 13 TYR R  371 ? TYR 1 371  . ? 1_555 ? 
3400 DD7 13 ALA R  372 ? ALA 1 372  . ? 1_555 ? 
3401 DD7 13 MET R  373 ? MET 1 373  . ? 1_555 ? 
3402 DD7 13 SER R  506 ? SER 1 506  . ? 1_555 ? 
3403 DD7 13 PHE R  509 ? PHE 1 509  . ? 1_555 ? 
3404 DD7 13 CLA EK .   ? CLA 1 1116 . ? 1_555 ? 
3405 DD7 13 CLA HK .   ? CLA 1 1119 . ? 1_555 ? 
3406 DD7 13 CLA KK .   ? CLA 1 1124 . ? 1_555 ? 
3407 DD7 13 CLA CL .   ? CLA 1 1133 . ? 1_555 ? 
3408 DD7 13 CLA EL .   ? CLA 1 1135 . ? 1_555 ? 
3409 DD8 17 TRP R  86  ? TRP 1 86   . ? 1_555 ? 
3410 DD8 17 SER R  141 ? SER 1 141  . ? 1_555 ? 
3411 DD8 17 THR R  391 ? THR 1 391  . ? 1_555 ? 
3412 DD8 17 HIS R  392 ? HIS 1 392  . ? 1_555 ? 
3413 DD8 17 TRP R  395 ? TRP 1 395  . ? 1_555 ? 
3414 DD8 17 PHE R  399 ? PHE 1 399  . ? 1_555 ? 
3415 DD8 17 MET R  671 ? MET 1 671  . ? 1_555 ? 
3416 DD8 17 ILE R  736 ? ILE 1 736  . ? 1_555 ? 
3417 DD8 17 TRP R  740 ? TRP 1 740  . ? 1_555 ? 
3418 DD8 17 CLA WK .   ? CLA 1 1012 . ? 1_555 ? 
3419 DD8 17 CLA QJ .   ? CLA 1 1101 . ? 1_555 ? 
3420 DD8 17 CLA TJ .   ? CLA 1 1104 . ? 1_555 ? 
3421 DD8 17 CLA VJ .   ? CLA 1 1106 . ? 1_555 ? 
3422 DD8 17 CLA WJ .   ? CLA 1 1107 . ? 1_555 ? 
3423 DD8 17 CLA NK .   ? CLA 1 1127 . ? 1_555 ? 
3424 DD8 17 CLA OK .   ? CLA 1 1128 . ? 1_555 ? 
3425 DD8 17 BCR ML .   ? BCR 2 4011 . ? 1_555 ? 
3426 DD9 15 LEU R  87  ? LEU 1 87   . ? 1_555 ? 
3427 DD9 15 GLY R  142 ? GLY 1 142  . ? 1_555 ? 
3428 DD9 15 LEU R  146 ? LEU 1 146  . ? 1_555 ? 
3429 DD9 15 LEU R  205 ? LEU 1 205  . ? 1_555 ? 
3430 DD9 15 THR R  363 ? THR 1 363  . ? 1_555 ? 
3431 DD9 15 MET R  370 ? MET 1 370  . ? 1_555 ? 
3432 DD9 15 TYR R  376 ? TYR 1 376  . ? 1_555 ? 
3433 DD9 15 LEU R  389 ? LEU 1 389  . ? 1_555 ? 
3434 DD9 15 HIS R  392 ? HIS 1 392  . ? 1_555 ? 
3435 DD9 15 HIS R  393 ? HIS 1 393  . ? 1_555 ? 
3436 DD9 15 CLA TJ .   ? CLA 1 1104 . ? 1_555 ? 
3437 DD9 15 CLA FK .   ? CLA 1 1117 . ? 1_555 ? 
3438 DD9 15 CLA JK .   ? CLA 1 1123 . ? 1_555 ? 
3439 DD9 15 CLA MK .   ? CLA 1 1126 . ? 1_555 ? 
3440 DD9 15 BCR JJ .   ? BCR 1 4003 . ? 1_555 ? 
3441 ED1 19 HIS R  52  ? HIS 1 52   . ? 1_555 ? 
3442 ED1 19 ALA R  53  ? ALA 1 53   . ? 1_555 ? 
3443 ED1 19 HIS R  56  ? HIS 1 56   . ? 1_555 ? 
3444 ED1 19 ASP R  57  ? ASP 1 57   . ? 1_555 ? 
3445 ED1 19 LEU R  356 ? LEU 1 356  . ? 1_555 ? 
3446 ED1 19 PHE R  399 ? PHE 1 399  . ? 1_555 ? 
3447 ED1 19 GLY R  403 ? GLY 1 403  . ? 1_555 ? 
3448 ED1 19 HIS R  407 ? HIS 1 407  . ? 1_555 ? 
3449 ED1 19 ILE R  410 ? ILE 1 410  . ? 1_555 ? 
3450 ED1 19 PHE R  570 ? PHE 1 570  . ? 1_555 ? 
3451 ED1 19 ARG R  571 ? ARG 1 571  . ? 1_555 ? 
3452 ED1 19 TRP R  588 ? TRP 1 588  . ? 1_555 ? 
3453 ED1 19 CLA SJ .   ? CLA 1 1103 . ? 1_555 ? 
3454 ED1 19 CLA TJ .   ? CLA 1 1104 . ? 1_555 ? 
3455 ED1 19 CLA VJ .   ? CLA 1 1106 . ? 1_555 ? 
3456 ED1 19 CLA MK .   ? CLA 1 1126 . ? 1_555 ? 
3457 ED1 19 CLA UK .   ? CLA 1 1140 . ? 1_555 ? 
3458 ED1 19 LHG MJ .   ? LHG 1 5001 . ? 1_555 ? 
3459 ED1 19 BCR ML .   ? BCR 2 4011 . ? 1_555 ? 
3460 ED2 11 HIS R  439 ? HIS 1 439  . ? 1_555 ? 
3461 ED2 11 TRP R  442 ? TRP 1 442  . ? 1_555 ? 
3462 ED2 11 CLA AL .   ? CLA 1 1129 . ? 1_555 ? 
3463 ED2 11 CLA RK .   ? CLA 1 1137 . ? 1_555 ? 
3464 ED2 11 CLA OJ .   ? CLA 1 1237 . ? 1_555 ? 
3465 ED2 11 ALA S  678 ? ALA 2 678  . ? 1_555 ? 
3466 ED2 11 THR S  682 ? THR 2 682  . ? 1_555 ? 
3467 ED2 11 PRO S  683 ? PRO 2 683  . ? 1_555 ? 
3468 ED2 11 THR Y  22  ? THR 8 22   . ? 1_555 ? 
3469 ED2 11 ILE Y  24  ? ILE 8 24   . ? 1_555 ? 
3470 ED2 11 SER Y  25  ? SER 8 25   . ? 1_555 ? 
3471 ED3 12 TRP R  442 ? TRP 1 442  . ? 1_555 ? 
3472 ED3 12 ILE R  445 ? ILE 1 445  . ? 1_555 ? 
3473 ED3 12 PHE R  446 ? PHE 1 446  . ? 1_555 ? 
3474 ED3 12 PHE R  449 ? PHE 1 449  . ? 1_555 ? 
3475 ED3 12 HIS R  450 ? HIS 1 450  . ? 1_555 ? 
3476 ED3 12 CLA BL .   ? CLA 1 1132 . ? 1_555 ? 
3477 ED3 12 CLA FL .   ? CLA 1 1136 . ? 1_555 ? 
3478 ED3 12 CLA OJ .   ? CLA 1 1237 . ? 1_555 ? 
3479 ED3 12 CLA FN .   ? CLA 2 1239 . ? 1_555 ? 
3480 ED3 12 PQN GL .   ? PQN 2 2002 . ? 1_555 ? 
3481 ED3 12 BCR OL .   ? BCR 2 4017 . ? 1_555 ? 
3482 ED3 12 BCR JN .   ? BCR 6 4020 . ? 1_555 ? 
3483 ED4 12 LEU R  440 ? LEU 1 440  . ? 1_555 ? 
3484 ED4 12 TRP R  442 ? TRP 1 442  . ? 1_555 ? 
3485 ED4 12 VAL R  443 ? VAL 1 443  . ? 1_555 ? 
3486 ED4 12 ILE R  542 ? ILE 1 542  . ? 1_555 ? 
3487 ED4 12 HIS R  543 ? HIS 1 543  . ? 1_555 ? 
3488 ED4 12 CLA IK .   ? CLA 1 1122 . ? 1_555 ? 
3489 ED4 12 CLA KK .   ? CLA 1 1124 . ? 1_555 ? 
3490 ED4 12 CLA AL .   ? CLA 1 1129 . ? 1_555 ? 
3491 ED4 12 CLA PK .   ? CLA 1 1130 . ? 1_555 ? 
3492 ED4 12 CLA FL .   ? CLA 1 1136 . ? 1_555 ? 
3493 ED4 12 BCR LJ .   ? BCR 1 4008 . ? 1_555 ? 
3494 ED4 12 LHG NJ .   ? LHG 1 5003 . ? 1_555 ? 
3495 ED5 13 ILE R  700 ? ILE 1 700  . ? 1_555 ? 
3496 ED5 13 ALA R  703 ? ALA 1 703  . ? 1_555 ? 
3497 ED5 13 HIS R  704 ? HIS 1 704  . ? 1_555 ? 
3498 ED5 13 LEU R  707 ? LEU 1 707  . ? 1_555 ? 
3499 ED5 13 CLA TK .   ? CLA 1 1139 . ? 1_555 ? 
3500 ED5 13 PQN FJ .   ? PQN 1 2001 . ? 1_555 ? 
3501 ED5 13 SER S  418 ? SER 2 418  . ? 1_555 ? 
3502 ED5 13 SER S  421 ? SER 2 421  . ? 1_555 ? 
3503 ED5 13 TRP S  422 ? TRP 2 422  . ? 1_555 ? 
3504 ED5 13 CLA UM .   ? CLA 2 1228 . ? 1_555 ? 
3505 ED5 13 CLA VM .   ? CLA 2 1229 . ? 1_555 ? 
3506 ED5 13 BCR NL .   ? BCR 2 4014 . ? 1_555 ? 
3507 ED5 13 GLY W  62  ? GLY 6 62   . ? 1_555 ? 
3508 ED6 14 THR R  45  ? THR 1 45   . ? 1_555 ? 
3509 ED6 14 ILE R  48  ? ILE 1 48   . ? 1_555 ? 
3510 ED6 14 TRP R  49  ? TRP 1 49   . ? 1_555 ? 
3511 ED6 14 VAL R  701 ? VAL 1 701  . ? 1_555 ? 
3512 ED6 14 HIS R  704 ? HIS 1 704  . ? 1_555 ? 
3513 ED6 14 VAL R  709 ? VAL 1 709  . ? 1_555 ? 
3514 ED6 14 PRO R  711 ? PRO 1 711  . ? 1_555 ? 
3515 ED6 14 PRO R  715 ? PRO 1 715  . ? 1_555 ? 
3516 ED6 14 ARG R  716 ? ARG 1 716  . ? 1_555 ? 
3517 ED6 14 CLA QJ .   ? CLA 1 1101 . ? 1_555 ? 
3518 ED6 14 CLA SK .   ? CLA 1 1138 . ? 1_555 ? 
3519 ED6 14 PQN FJ .   ? PQN 1 2001 . ? 1_555 ? 
3520 ED6 14 SER W  9   ? SER 6 9    . ? 1_555 ? 
3521 ED6 14 GLU W  82  ? GLU 6 82   . ? 1_555 ? 
3522 ED7 17 TRP R  49  ? TRP 1 49   . ? 1_555 ? 
3523 ED7 17 VAL R  678 ? VAL 1 678  . ? 1_555 ? 
3524 ED7 17 PHE R  681 ? PHE 1 681  . ? 1_555 ? 
3525 ED7 17 GLN R  722 ? GLN 1 722  . ? 1_555 ? 
3526 ED7 17 VAL R  726 ? VAL 1 726  . ? 1_555 ? 
3527 ED7 17 ALA R  729 ? ALA 1 729  . ? 1_555 ? 
3528 ED7 17 HIS R  730 ? HIS 1 730  . ? 1_555 ? 
3529 ED7 17 LEU R  733 ? LEU 1 733  . ? 1_555 ? 
3530 ED7 17 CLA WK .   ? CLA 1 1012 . ? 1_555 ? 
3531 ED7 17 CLA QJ .   ? CLA 1 1101 . ? 1_555 ? 
3532 ED7 17 CLA OK .   ? CLA 1 1128 . ? 1_555 ? 
3533 ED7 17 PQN FJ .   ? PQN 1 2001 . ? 1_555 ? 
3534 ED7 17 LHG MJ .   ? LHG 1 5001 . ? 1_555 ? 
3535 ED7 17 CLA RL .   ? CLA 2 1013 . ? 1_555 ? 
3536 ED7 17 BCR ML .   ? BCR 2 4011 . ? 1_555 ? 
3537 ED7 17 ILE W  15  ? ILE 6 15   . ? 1_555 ? 
3538 ED7 17 BCR KN .   ? BCR 6 4013 . ? 1_555 ? 
3539 ED8 20 TYR R  455 ? TYR 1 455  . ? 1_555 ? 
3540 ED8 20 THR R  541 ? THR 1 541  . ? 1_555 ? 
3541 ED8 20 TYR R  599 ? TYR 1 599  . ? 1_555 ? 
3542 ED8 20 ASN R  600 ? ASN 1 600  . ? 1_555 ? 
3543 ED8 20 PHE R  607 ? PHE 1 607  . ? 1_555 ? 
3544 ED8 20 ILE R  642 ? ILE 1 642  . ? 1_555 ? 
3545 ED8 20 ALA R  654 ? ALA 1 654  . ? 1_555 ? 
3546 ED8 20 ILE R  658 ? ILE 1 658  . ? 1_555 ? 
3547 ED8 20 HIS R  676 ? HIS 1 676  . ? 1_555 ? 
3548 ED8 20 PHE R  679 ? PHE 1 679  . ? 1_555 ? 
3549 ED8 20 TYR R  731 ? TYR 1 731  . ? 1_555 ? 
3550 ED8 20 GLY R  735 ? GLY 1 735  . ? 1_555 ? 
3551 ED8 20 THR R  738 ? THR 1 738  . ? 1_555 ? 
3552 ED8 20 THR R  739 ? THR 1 739  . ? 1_555 ? 
3553 ED8 20 PHE R  742 ? PHE 1 742  . ? 1_555 ? 
3554 ED8 20 CLA WK .   ? CLA 1 1012 . ? 1_555 ? 
3555 ED8 20 CLA PJ .   ? CLA 1 1022 . ? 1_555 ? 
3556 ED8 20 PHE S  617 ? PHE 2 617  . ? 1_555 ? 
3557 ED8 20 TRP S  622 ? TRP 2 622  . ? 1_555 ? 
3558 ED8 20 CLA SL .   ? CLA 2 1021 . ? 1_555 ? 
3559 ED9 17 LEU R  673 ? LEU 1 673  . ? 1_555 ? 
3560 ED9 17 HIS R  676 ? HIS 1 676  . ? 1_555 ? 
3561 ED9 17 PHE R  677 ? PHE 1 677  . ? 1_555 ? 
3562 ED9 17 ALA R  680 ? ALA 1 680  . ? 1_555 ? 
3563 ED9 17 CLA VK .   ? CLA 1 1011 . ? 1_555 ? 
3564 ED9 17 CLA MK .   ? CLA 1 1126 . ? 1_555 ? 
3565 ED9 17 CLA UK .   ? CLA 1 1140 . ? 1_555 ? 
3566 ED9 17 VAL S  436 ? VAL 2 436  . ? 1_555 ? 
3567 ED9 17 VAL S  440 ? VAL 2 440  . ? 1_555 ? 
3568 ED9 17 PHE S  578 ? PHE 2 578  . ? 1_555 ? 
3569 ED9 17 TRP S  579 ? TRP 2 579  . ? 1_555 ? 
3570 ED9 17 ASN S  582 ? ASN 2 582  . ? 1_555 ? 
3571 ED9 17 LEU S  613 ? LEU 2 613  . ? 1_555 ? 
3572 ED9 17 PHE S  617 ? PHE 2 617  . ? 1_555 ? 
3573 ED9 17 CLA RL .   ? CLA 2 1013 . ? 1_555 ? 
3574 ED9 17 CLA SL .   ? CLA 2 1021 . ? 1_555 ? 
3575 ED9 17 BCR ML .   ? BCR 2 4011 . ? 1_555 ? 
3576 FD1 4  HIS R  240 ? HIS 1 240  . ? 1_555 ? 
3577 FD1 4  ILE R  243 ? ILE 1 243  . ? 1_555 ? 
3578 FD1 4  LEU R  244 ? LEU 1 244  . ? 1_555 ? 
3579 FD1 4  CLA BK .   ? CLA 1 1112 . ? 1_555 ? 
3580 FD2 6  ILE R  306 ? ILE 1 306  . ? 1_555 ? 
3581 FD2 6  HIS R  309 ? HIS 1 309  . ? 1_555 ? 
3582 FD2 6  GLY R  318 ? GLY 1 318  . ? 1_555 ? 
3583 FD2 6  HIS R  319 ? HIS 1 319  . ? 1_555 ? 
3584 FD2 6  CLA ZK .   ? CLA 1 1121 . ? 1_555 ? 
3585 FD2 6  BCR HJ .   ? BCR 1 4001 . ? 1_555 ? 
3586 FD3 7  HIS R  319 ? HIS 1 319  . ? 1_555 ? 
3587 FD3 7  ILE R  324 ? ILE 1 324  . ? 1_555 ? 
3588 FD3 7  ALA R  327 ? ALA 1 327  . ? 1_555 ? 
3589 FD3 7  HIS R  328 ? HIS 1 328  . ? 1_555 ? 
3590 FD3 7  CLA HK .   ? CLA 1 1119 . ? 1_555 ? 
3591 FD3 7  CLA YK .   ? CLA 1 1120 . ? 1_555 ? 
3592 FD3 7  CLA EJ .   ? CLA 1 1801 . ? 1_555 ? 
3593 FD4 15 PHE R  332 ? PHE 1 332  . ? 1_555 ? 
3594 FD4 15 THR R  333 ? THR 1 333  . ? 1_555 ? 
3595 FD4 15 LEU R  425 ? LEU 1 425  . ? 1_555 ? 
3596 FD4 15 ARG R  428 ? ARG 1 428  . ? 1_555 ? 
3597 FD4 15 HIS R  432 ? HIS 1 432  . ? 1_555 ? 
3598 FD4 15 HIS R  439 ? HIS 1 439  . ? 1_555 ? 
3599 FD4 15 CLA HK .   ? CLA 1 1119 . ? 1_555 ? 
3600 FD4 15 CLA IK .   ? CLA 1 1122 . ? 1_555 ? 
3601 FD4 15 CLA PK .   ? CLA 1 1130 . ? 1_555 ? 
3602 FD4 15 CLA RK .   ? CLA 1 1137 . ? 1_555 ? 
3603 FD4 15 LHG NJ .   ? LHG 1 5003 . ? 1_555 ? 
3604 FD4 15 VAL Y  8   ? VAL 8 8    . ? 1_555 ? 
3605 FD4 15 LEU Y  20  ? LEU 8 20   . ? 1_555 ? 
3606 FD4 15 PRO Y  23  ? PRO 8 23   . ? 1_555 ? 
3607 FD4 15 ILE Y  24  ? ILE 8 24   . ? 1_555 ? 
3608 FD5 18 PHE R  449 ? PHE 1 449  . ? 1_555 ? 
3609 FD5 18 GLY R  453 ? GLY 1 453  . ? 1_555 ? 
3610 FD5 18 LEU R  454 ? LEU 1 454  . ? 1_555 ? 
3611 FD5 18 ILE R  456 ? ILE 1 456  . ? 1_555 ? 
3612 FD5 18 HIS R  457 ? HIS 1 457  . ? 1_555 ? 
3613 FD5 18 THR R  460 ? THR 1 460  . ? 1_555 ? 
3614 FD5 18 MET R  461 ? MET 1 461  . ? 1_555 ? 
3615 FD5 18 ARG R  466 ? ARG 1 466  . ? 1_555 ? 
3616 FD5 18 ASP R  469 ? ASP 1 469  . ? 1_555 ? 
3617 FD5 18 CLA QK .   ? CLA 1 1131 . ? 1_555 ? 
3618 FD5 18 HIS S  95  ? HIS 2 95   . ? 1_555 ? 
3619 FD5 18 CLA AM .   ? CLA 2 1207 . ? 1_555 ? 
3620 FD5 18 BCR JN .   ? BCR 6 4020 . ? 1_555 ? 
3621 FD5 18 PRO Y  64  ? PRO 8 64   . ? 1_555 ? 
3622 FD5 18 LEU Y  68  ? LEU 8 68   . ? 1_555 ? 
3623 FD5 18 GLY Y  69  ? GLY 8 69   . ? 1_555 ? 
3624 FD5 18 ARG Y  72  ? ARG 8 72   . ? 1_555 ? 
3625 FD5 18 BCR PN .   ? BCR 8 4022 . ? 1_555 ? 
3626 FD6 10 TRP R  485 ? TRP 1 485  . ? 1_555 ? 
3627 FD6 10 LEU R  489 ? LEU 1 489  . ? 1_555 ? 
3628 FD6 10 HIS R  490 ? HIS 1 490  . ? 1_555 ? 
3629 FD6 10 ALA R  493 ? ALA 1 493  . ? 1_555 ? 
3630 FD6 10 THR R  497 ? THR 1 497  . ? 1_555 ? 
3631 FD6 10 ALA R  498 ? ALA 1 498  . ? 1_555 ? 
3632 FD6 10 CLA EK .   ? CLA 1 1116 . ? 1_555 ? 
3633 FD6 10 CLA LK .   ? CLA 1 1125 . ? 1_555 ? 
3634 FD6 10 CLA DL .   ? CLA 1 1134 . ? 1_555 ? 
3635 FD6 10 CLA EL .   ? CLA 1 1135 . ? 1_555 ? 
3636 FD7 8  CLA VN .   ? CLA 0 1401 . ? 1_555 ? 
3637 FD7 8  THR R  497 ? THR 1 497  . ? 1_555 ? 
3638 FD7 8  ALA R  498 ? ALA 1 498  . ? 1_555 ? 
3639 FD7 8  PRO R  499 ? PRO 1 499  . ? 1_555 ? 
3640 FD7 8  ASN R  500 ? ASN 1 500  . ? 1_555 ? 
3641 FD7 8  CLA DK .   ? CLA 1 1115 . ? 1_555 ? 
3642 FD7 8  CLA CL .   ? CLA 1 1133 . ? 1_555 ? 
3643 FD7 8  BCR LJ .   ? BCR 1 4008 . ? 1_555 ? 
3644 FD8 18 GLN R  368 ? GLN 1 368  . ? 1_555 ? 
3645 FD8 18 TYR R  371 ? TYR 1 371  . ? 1_555 ? 
3646 FD8 18 PHE R  482 ? PHE 1 482  . ? 1_555 ? 
3647 FD8 18 ALA R  483 ? ALA 1 483  . ? 1_555 ? 
3648 FD8 18 VAL R  486 ? VAL 1 486  . ? 1_555 ? 
3649 FD8 18 GLN R  487 ? GLN 1 487  . ? 1_555 ? 
3650 FD8 18 PHE R  509 ? PHE 1 509  . ? 1_555 ? 
3651 FD8 18 ILE R  525 ? ILE 1 525  . ? 1_555 ? 
3652 FD8 18 LEU R  527 ? LEU 1 527  . ? 1_555 ? 
3653 FD8 18 HIS R  535 ? HIS 1 535  . ? 1_555 ? 
3654 FD8 18 HIS R  538 ? HIS 1 538  . ? 1_555 ? 
3655 FD8 18 VAL R  605 ? VAL 1 605  . ? 1_555 ? 
3656 FD8 18 HIS R  608 ? HIS 1 608  . ? 1_555 ? 
3657 FD8 18 PHE R  609 ? PHE 1 609  . ? 1_555 ? 
3658 FD8 18 CLA KK .   ? CLA 1 1124 . ? 1_555 ? 
3659 FD8 18 CLA LK .   ? CLA 1 1125 . ? 1_555 ? 
3660 FD8 18 CLA CL .   ? CLA 1 1133 . ? 1_555 ? 
3661 FD8 18 CLA FL .   ? CLA 1 1136 . ? 1_555 ? 
3662 FD9 14 PHE R  446 ? PHE 1 446  . ? 1_555 ? 
3663 FD9 14 LEU R  447 ? LEU 1 447  . ? 1_555 ? 
3664 FD9 14 GLN R  479 ? GLN 1 479  . ? 1_555 ? 
3665 FD9 14 PRO R  480 ? PRO 1 480  . ? 1_555 ? 
3666 FD9 14 ILE R  481 ? ILE 1 481  . ? 1_555 ? 
3667 FD9 14 PHE R  482 ? PHE 1 482  . ? 1_555 ? 
3668 FD9 14 ALA R  483 ? ALA 1 483  . ? 1_555 ? 
3669 FD9 14 PHE R  532 ? PHE 1 532  . ? 1_555 ? 
3670 FD9 14 HIS R  535 ? HIS 1 535  . ? 1_555 ? 
3671 FD9 14 HIS R  536 ? HIS 1 536  . ? 1_555 ? 
3672 FD9 14 HIS R  543 ? HIS 1 543  . ? 1_555 ? 
3673 FD9 14 CLA QK .   ? CLA 1 1131 . ? 1_555 ? 
3674 FD9 14 CLA EL .   ? CLA 1 1135 . ? 1_555 ? 
3675 FD9 14 CLA RK .   ? CLA 1 1137 . ? 1_555 ? 
3676 GD1 15 CLA QK .   ? CLA 1 1131 . ? 1_555 ? 
3677 GD1 15 CLA OJ .   ? CLA 1 1237 . ? 1_555 ? 
3678 GD1 15 MET S  659 ? MET 2 659  . ? 1_555 ? 
3679 GD1 15 PHE S  660 ? PHE 2 660  . ? 1_555 ? 
3680 GD1 15 SER S  663 ? SER 2 663  . ? 1_555 ? 
3681 GD1 15 TRP S  664 ? TRP 2 664  . ? 1_555 ? 
3682 GD1 15 ARG S  665 ? ARG 2 665  . ? 1_555 ? 
3683 GD1 15 TRP S  668 ? TRP 2 668  . ? 1_555 ? 
3684 GD1 15 ALA S  696 ? ALA 2 696  . ? 1_555 ? 
3685 GD1 15 LEU S  697 ? LEU 2 697  . ? 1_555 ? 
3686 GD1 15 ALA S  702 ? ALA 2 702  . ? 1_555 ? 
3687 GD1 15 CLA EN .   ? CLA 2 1238 . ? 1_555 ? 
3688 GD1 15 CLA FN .   ? CLA 2 1239 . ? 1_555 ? 
3689 GD1 15 BCR OL .   ? BCR 2 4017 . ? 1_555 ? 
3690 GD1 15 BCR ON .   ? BCR 8 4019 . ? 1_555 ? 
3691 GD2 6  PHE S  225 ? PHE 2 225  . ? 1_555 ? 
3692 GD2 6  ILE S  285 ? ILE 2 285  . ? 1_555 ? 
3693 GD2 6  HIS S  289 ? HIS 2 289  . ? 1_555 ? 
3694 GD2 6  CLA EM .   ? CLA 2 1212 . ? 1_555 ? 
3695 GD2 6  CLA JM .   ? CLA 2 1217 . ? 1_555 ? 
3696 GD2 6  CLA KM .   ? CLA 2 1218 . ? 1_555 ? 
3697 GD3 6  PHE S  149 ? PHE 2 149  . ? 1_555 ? 
3698 GD3 6  SER S  186 ? SER 2 186  . ? 1_555 ? 
3699 GD3 6  CLA WL .   ? CLA 2 1203 . ? 1_555 ? 
3700 GD3 6  CLA CM .   ? CLA 2 1209 . ? 1_555 ? 
3701 GD3 6  CLA DM .   ? CLA 2 1210 . ? 1_555 ? 
3702 GD3 6  CLA RM .   ? CLA 2 1225 . ? 1_555 ? 
3703 GD4 7  LEU S  65  ? LEU 2 65   . ? 1_555 ? 
3704 GD4 7  MET S  129 ? MET 2 129  . ? 1_555 ? 
3705 GD4 7  PHE S  141 ? PHE 2 141  . ? 1_555 ? 
3706 GD4 7  LEU S  142 ? LEU 2 142  . ? 1_555 ? 
3707 GD4 7  LEU S  145 ? LEU 2 145  . ? 1_555 ? 
3708 GD4 7  CLA DN .   ? CLA 2 1211 . ? 1_555 ? 
3709 GD4 7  CLA EM .   ? CLA 2 1212 . ? 1_555 ? 
3710 GD5 8  MET S  409 ? MET 2 409  . ? 1_555 ? 
3711 GD5 8  ILE S  532 ? ILE 2 532  . ? 1_555 ? 
3712 GD5 8  CLA LM .   ? CLA 2 1219 . ? 1_555 ? 
3713 GD5 8  CLA MM .   ? CLA 2 1220 . ? 1_555 ? 
3714 GD5 8  CLA PM .   ? CLA 2 1223 . ? 1_555 ? 
3715 GD5 8  CLA TM .   ? CLA 2 1227 . ? 1_555 ? 
3716 GD5 8  BCR LL .   ? BCR 2 4010 . ? 1_555 ? 
3717 GD5 8  LHG QL .   ? LHG 2 5004 . ? 1_555 ? 
3718 GD6 13 PHE S  330 ? PHE 2 330  . ? 1_555 ? 
3719 GD6 13 LEU S  334 ? LEU 2 334  . ? 1_555 ? 
3720 GD6 13 ALA S  337 ? ALA 2 337  . ? 1_555 ? 
3721 GD6 13 MET S  381 ? MET 2 381  . ? 1_555 ? 
3722 GD6 13 ALA S  384 ? ALA 2 384  . ? 1_555 ? 
3723 GD6 13 PHE S  385 ? PHE 2 385  . ? 1_555 ? 
3724 GD6 13 GLY S  388 ? GLY 2 388  . ? 1_555 ? 
3725 GD6 13 CLA HM .   ? CLA 2 1215 . ? 1_555 ? 
3726 GD6 13 CLA OM .   ? CLA 2 1222 . ? 1_555 ? 
3727 GD6 13 CLA PM .   ? CLA 2 1223 . ? 1_555 ? 
3728 GD6 13 CLA ZM .   ? CLA 2 1234 . ? 1_555 ? 
3729 GD6 13 CLA BN .   ? CLA 2 1236 . ? 1_555 ? 
3730 GD6 13 BCR KL .   ? BCR 2 4009 . ? 1_555 ? 
3731 GD7 13 ALA R  674 ? ALA 1 674  . ? 1_555 ? 
3732 GD7 13 PHE R  677 ? PHE 1 677  . ? 1_555 ? 
3733 GD7 13 VAL R  737 ? VAL 1 737  . ? 1_555 ? 
3734 GD7 13 CLA WK .   ? CLA 1 1012 . ? 1_555 ? 
3735 GD7 13 CLA VJ .   ? CLA 1 1106 . ? 1_555 ? 
3736 GD7 13 CLA MK .   ? CLA 1 1126 . ? 1_555 ? 
3737 GD7 13 CLA OK .   ? CLA 1 1128 . ? 1_555 ? 
3738 GD7 13 CLA UK .   ? CLA 1 1140 . ? 1_555 ? 
3739 GD7 13 LEU S  432 ? LEU 2 432  . ? 1_555 ? 
3740 GD7 13 CLA RL .   ? CLA 2 1013 . ? 1_555 ? 
3741 GD7 13 CLA VM .   ? CLA 2 1229 . ? 1_555 ? 
3742 GD7 13 CLA WM .   ? CLA 2 1230 . ? 1_555 ? 
3743 GD7 13 BCR NL .   ? BCR 2 4014 . ? 1_555 ? 
3744 GD8 8  CLA QJ .   ? CLA 1 1101 . ? 1_555 ? 
3745 GD8 8  CLA SK .   ? CLA 1 1138 . ? 1_555 ? 
3746 GD8 8  PQN FJ .   ? PQN 1 2001 . ? 1_555 ? 
3747 GD8 8  CLA RL .   ? CLA 2 1013 . ? 1_555 ? 
3748 GD8 8  CLA VM .   ? CLA 2 1229 . ? 1_555 ? 
3749 GD8 8  BCR ML .   ? BCR 2 4011 . ? 1_555 ? 
3750 GD8 8  ILE W  53  ? ILE 6 53   . ? 1_555 ? 
3751 GD8 8  PHE W  54  ? PHE 6 54   . ? 1_555 ? 
3752 GD9 11 CLA PJ .   ? CLA 1 1022 . ? 1_555 ? 
3753 GD9 11 CLA QK .   ? CLA 1 1131 . ? 1_555 ? 
3754 GD9 11 CLA OJ .   ? CLA 1 1237 . ? 1_555 ? 
3755 GD9 11 TRP S  645 ? TRP 2 645  . ? 1_555 ? 
3756 GD9 11 PHE S  649 ? PHE 2 649  . ? 1_555 ? 
3757 GD9 11 TRP S  668 ? TRP 2 668  . ? 1_555 ? 
3758 GD9 11 CLA TL .   ? CLA 2 1023 . ? 1_555 ? 
3759 GD9 11 CLA YL .   ? CLA 2 1205 . ? 1_555 ? 
3760 GD9 11 CLA ZL .   ? CLA 2 1206 . ? 1_555 ? 
3761 GD9 11 CLA FN .   ? CLA 2 1239 . ? 1_555 ? 
3762 GD9 11 PQN GL .   ? PQN 2 2002 . ? 1_555 ? 
3763 HD1 16 TYR S  23  ? TYR 2 23   . ? 1_555 ? 
3764 HD1 16 ALA S  26  ? ALA 2 26   . ? 1_555 ? 
3765 HD1 16 SER S  553 ? SER 2 553  . ? 1_555 ? 
3766 HD1 16 TRP S  570 ? TRP 2 570  . ? 1_555 ? 
3767 HD1 16 SER S  698 ? SER 2 698  . ? 1_555 ? 
3768 HD1 16 VAL S  700 ? VAL 2 700  . ? 1_555 ? 
3769 HD1 16 GLN S  701 ? GLN 2 701  . ? 1_555 ? 
3770 HD1 16 LEU S  704 ? LEU 2 704  . ? 1_555 ? 
3771 HD1 16 LEU S  707 ? LEU 2 707  . ? 1_555 ? 
3772 HD1 16 THR S  711 ? THR 2 711  . ? 1_555 ? 
3773 HD1 16 VAL S  715 ? VAL 2 715  . ? 1_555 ? 
3774 HD1 16 CLA UL .   ? CLA 2 1201 . ? 1_555 ? 
3775 HD1 16 CLA WL .   ? CLA 2 1203 . ? 1_555 ? 
3776 HD1 16 CLA XL .   ? CLA 2 1204 . ? 1_555 ? 
3777 HD1 16 CLA ZL .   ? CLA 2 1206 . ? 1_555 ? 
3778 HD1 16 CLA SM .   ? CLA 2 1226 . ? 1_555 ? 
3779 HD2 15 HIS S  308 ? HIS 2 308  . ? 1_555 ? 
3780 HD2 15 LYS S  309 ? LYS 2 309  . ? 1_555 ? 
3781 HD2 15 GLY S  310 ? GLY 2 310  . ? 1_555 ? 
3782 HD2 15 LEU S  312 ? LEU 2 312  . ? 1_555 ? 
3783 HD2 15 THR S  313 ? THR 2 313  . ? 1_555 ? 
3784 HD2 15 HIS S  317 ? HIS 2 317  . ? 1_555 ? 
3785 HD2 15 VAL S  405 ? VAL 2 405  . ? 1_555 ? 
3786 HD2 15 CLA MM .   ? CLA 2 1220 . ? 1_555 ? 
3787 HD2 15 CLA OM .   ? CLA 2 1222 . ? 1_555 ? 
3788 HD2 15 CLA PM .   ? CLA 2 1223 . ? 1_555 ? 
3789 HD2 15 CLA TM .   ? CLA 2 1227 . ? 1_555 ? 
3790 HD2 15 CLA UM .   ? CLA 2 1228 . ? 1_555 ? 
3791 HD2 15 CLA BN .   ? CLA 2 1236 . ? 1_555 ? 
3792 HD2 15 CLA CN .   ? CLA 2 1240 . ? 1_555 ? 
3793 HD2 15 BCR KL .   ? BCR 2 4009 . ? 1_555 ? 
3794 HD3 25 PHE R  677 ? PHE 1 677  . ? 1_555 ? 
3795 HD3 25 ALA R  680 ? ALA 1 680  . ? 1_555 ? 
3796 HD3 25 PHE R  681 ? PHE 1 681  . ? 1_555 ? 
3797 HD3 25 LEU R  683 ? LEU 1 683  . ? 1_555 ? 
3798 HD3 25 MET R  684 ? MET 1 684  . ? 1_555 ? 
3799 HD3 25 PHE R  687 ? PHE 1 687  . ? 1_555 ? 
3800 HD3 25 TYR R  692 ? TYR 1 692  . ? 1_555 ? 
3801 HD3 25 TRP R  693 ? TRP 1 693  . ? 1_555 ? 
3802 HD3 25 LEU R  696 ? LEU 1 696  . ? 1_555 ? 
3803 HD3 25 CLA WK .   ? CLA 1 1012 . ? 1_555 ? 
3804 HD3 25 CLA QJ .   ? CLA 1 1101 . ? 1_555 ? 
3805 HD3 25 CLA UK .   ? CLA 1 1140 . ? 1_555 ? 
3806 HD3 25 SER S  421 ? SER 2 421  . ? 1_555 ? 
3807 HD3 25 SER S  424 ? SER 2 424  . ? 1_555 ? 
3808 HD3 25 LEU S  425 ? LEU 2 425  . ? 1_555 ? 
3809 HD3 25 GLY S  428 ? GLY 2 428  . ? 1_555 ? 
3810 HD3 25 PHE S  429 ? PHE 2 429  . ? 1_555 ? 
3811 HD3 25 LEU S  522 ? LEU 2 522  . ? 1_555 ? 
3812 HD3 25 LEU S  529 ? LEU 2 529  . ? 1_555 ? 
3813 HD3 25 ILE S  530 ? ILE 2 530  . ? 1_555 ? 
3814 HD3 25 LEU S  575 ? LEU 2 575  . ? 1_555 ? 
3815 HD3 25 PHE S  578 ? PHE 2 578  . ? 1_555 ? 
3816 HD3 25 TRP S  579 ? TRP 2 579  . ? 1_555 ? 
3817 HD3 25 BCR ML .   ? BCR 2 4011 . ? 1_555 ? 
3818 HD3 25 BCR NL .   ? BCR 2 4014 . ? 1_555 ? 
3819 HD4 21 LEU R  646 ? LEU 1 646  . ? 1_555 ? 
3820 HD4 21 LEU R  650 ? LEU 1 650  . ? 1_555 ? 
3821 HD4 21 TRP R  651 ? TRP 1 651  . ? 1_555 ? 
3822 HD4 21 CLA VK .   ? CLA 1 1011 . ? 1_555 ? 
3823 HD4 21 CLA WK .   ? CLA 1 1012 . ? 1_555 ? 
3824 HD4 21 CLA PJ .   ? CLA 1 1022 . ? 1_555 ? 
3825 HD4 21 TYR S  435 ? TYR 2 435  . ? 1_555 ? 
3826 HD4 21 ALA S  519 ? ALA 2 519  . ? 1_555 ? 
3827 HD4 21 ASN S  582 ? ASN 2 582  . ? 1_555 ? 
3828 HD4 21 TRP S  586 ? TRP 2 586  . ? 1_555 ? 
3829 HD4 21 PHE S  589 ? PHE 2 589  . ? 1_555 ? 
3830 HD4 21 LEU S  613 ? LEU 2 613  . ? 1_555 ? 
3831 HD4 21 SER S  625 ? SER 2 625  . ? 1_555 ? 
3832 HD4 21 ILE S  629 ? ILE 2 629  . ? 1_555 ? 
3833 HD4 21 PHE S  647 ? PHE 2 647  . ? 1_555 ? 
3834 HD4 21 HIS S  651 ? HIS 2 651  . ? 1_555 ? 
3835 HD4 21 TRP S  654 ? TRP 2 654  . ? 1_555 ? 
3836 HD4 21 TYR S  714 ? TYR 2 714  . ? 1_555 ? 
3837 HD4 21 THR S  717 ? THR 2 717  . ? 1_555 ? 
3838 HD4 21 TYR S  718 ? TYR 2 718  . ? 1_555 ? 
3839 HD4 21 PHE S  721 ? PHE 2 721  . ? 1_555 ? 
3840 HD5 20 ASN R  441 ? ASN 1 441  . ? 1_555 ? 
3841 HD5 20 CYS R  444 ? CYS 1 444  . ? 1_555 ? 
3842 HD5 20 ILE R  445 ? ILE 1 445  . ? 1_555 ? 
3843 HD5 20 GLY R  448 ? GLY 1 448  . ? 1_555 ? 
3844 HD5 20 PHE R  449 ? PHE 1 449  . ? 1_555 ? 
3845 HD5 20 PHE R  452 ? PHE 1 452  . ? 1_555 ? 
3846 HD5 20 PHE R  540 ? PHE 1 540  . ? 1_555 ? 
3847 HD5 20 LEU R  547 ? LEU 1 547  . ? 1_555 ? 
3848 HD5 20 ILE R  548 ? ILE 1 548  . ? 1_555 ? 
3849 HD5 20 PHE R  596 ? PHE 1 596  . ? 1_555 ? 
3850 HD5 20 TRP R  597 ? TRP 1 597  . ? 1_555 ? 
3851 HD5 20 CLA PJ .   ? CLA 1 1022 . ? 1_555 ? 
3852 HD5 20 ALA S  655 ? ALA 2 655  . ? 1_555 ? 
3853 HD5 20 THR S  656 ? THR 2 656  . ? 1_555 ? 
3854 HD5 20 PHE S  658 ? PHE 2 658  . ? 1_555 ? 
3855 HD5 20 MET S  659 ? MET 2 659  . ? 1_555 ? 
3856 HD5 20 TYR S  667 ? TYR 2 667  . ? 1_555 ? 
3857 HD5 20 TRP S  668 ? TRP 2 668  . ? 1_555 ? 
3858 HD5 20 LEU S  671 ? LEU 2 671  . ? 1_555 ? 
3859 HD5 20 BCR OL .   ? BCR 2 4017 . ? 1_555 ? 
3860 HD6 15 PHE S  5   ? PHE 2 5    . ? 1_555 ? 
3861 HD6 15 PHE S  8   ? PHE 2 8    . ? 1_555 ? 
3862 HD6 15 ALA S  28  ? ALA 2 28   . ? 1_555 ? 
3863 HD6 15 HIS S  29  ? HIS 2 29   . ? 1_555 ? 
3864 HD6 15 HIS S  34  ? HIS 2 34   . ? 1_555 ? 
3865 HD6 15 HIS S  53  ? HIS 2 53   . ? 1_555 ? 
3866 HD6 15 CLA VL .   ? CLA 2 1202 . ? 1_555 ? 
3867 HD6 15 CLA WL .   ? CLA 2 1203 . ? 1_555 ? 
3868 HD6 15 CLA SM .   ? CLA 2 1226 . ? 1_555 ? 
3869 HD6 15 LMG PL .   ? LMG 2 5002 . ? 1_555 ? 
3870 HD6 15 PHE Z  23  ? PHE 7 23   . ? 1_555 ? 
3871 HD6 15 SER Z  26  ? SER 7 26   . ? 1_555 ? 
3872 HD6 15 LEU Z  29  ? LEU 7 29   . ? 1_555 ? 
3873 HD6 15 TYR Z  30  ? TYR 7 30   . ? 1_555 ? 
3874 HD6 15 BCR QN .   ? BCR 7 4021 . ? 1_555 ? 
3875 HD7 16 HIS S  29  ? HIS 2 29   . ? 1_555 ? 
3876 HD7 16 PHE S  31  ? PHE 2 31   . ? 1_555 ? 
3877 HD7 16 ILE S  46  ? ILE 2 46   . ? 1_555 ? 
3878 HD7 16 SER S  49  ? SER 2 49   . ? 1_555 ? 
3879 HD7 16 HIS S  50  ? HIS 2 50   . ? 1_555 ? 
3880 HD7 16 HIS S  53  ? HIS 2 53   . ? 1_555 ? 
3881 HD7 16 ILE S  54  ? ILE 2 54   . ? 1_555 ? 
3882 HD7 16 LEU S  328 ? LEU 2 328  . ? 1_555 ? 
3883 HD7 16 LEU S  332 ? LEU 2 332  . ? 1_555 ? 
3884 HD7 16 ALA S  335 ? ALA 2 335  . ? 1_555 ? 
3885 HD7 16 LEU S  336 ? LEU 2 336  . ? 1_555 ? 
3886 HD7 16 CLA UL .   ? CLA 2 1201 . ? 1_555 ? 
3887 HD7 16 CLA WL .   ? CLA 2 1203 . ? 1_555 ? 
3888 HD7 16 CLA DM .   ? CLA 2 1210 . ? 1_555 ? 
3889 HD7 16 CLA NM .   ? CLA 2 1221 . ? 1_555 ? 
3890 HD7 16 CLA SM .   ? CLA 2 1226 . ? 1_555 ? 
3891 HD8 11 HIS S  29  ? HIS 2 29   . ? 1_555 ? 
3892 HD8 11 HIS S  53  ? HIS 2 53   . ? 1_555 ? 
3893 HD8 11 ILE S  57  ? ILE 2 57   . ? 1_555 ? 
3894 HD8 11 TRP S  60  ? TRP 2 60   . ? 1_555 ? 
3895 HD8 11 CLA UL .   ? CLA 2 1201 . ? 1_555 ? 
3896 HD8 11 CLA VL .   ? CLA 2 1202 . ? 1_555 ? 
3897 HD8 11 CLA XL .   ? CLA 2 1204 . ? 1_555 ? 
3898 HD8 11 CLA RM .   ? CLA 2 1225 . ? 1_555 ? 
3899 HD8 11 CLA SM .   ? CLA 2 1226 . ? 1_555 ? 
3900 HD8 11 BCR IL .   ? BCR 2 4005 . ? 1_555 ? 
3901 HD8 11 LMG PL .   ? LMG 2 5002 . ? 1_555 ? 
3902 HD9 22 LEU S  59  ? LEU 2 59   . ? 1_555 ? 
3903 HD9 22 SER S  62  ? SER 2 62   . ? 1_555 ? 
3904 HD9 22 GLY S  63  ? GLY 2 63   . ? 1_555 ? 
3905 HD9 22 PHE S  66  ? PHE 2 66   . ? 1_555 ? 
3906 HD9 22 HIS S  67  ? HIS 2 67   . ? 1_555 ? 
3907 HD9 22 TRP S  70  ? TRP 2 70   . ? 1_555 ? 
3908 HD9 22 GLN S  71  ? GLN 2 71   . ? 1_555 ? 
3909 HD9 22 HIS S  89  ? HIS 2 89   . ? 1_555 ? 
3910 HD9 22 LEU S  143 ? LEU 2 143  . ? 1_555 ? 
3911 HD9 22 CLA WL .   ? CLA 2 1203 . ? 1_555 ? 
3912 HD9 22 CLA YL .   ? CLA 2 1205 . ? 1_555 ? 
3913 HD9 22 CLA ZL .   ? CLA 2 1206 . ? 1_555 ? 
3914 HD9 22 LMG PL .   ? LMG 2 5002 . ? 1_555 ? 
3915 HD9 22 BCR IN .   ? BCR 6 4018 . ? 1_555 ? 
3916 HD9 22 ALA Z  11  ? ALA 7 11   . ? 1_555 ? 
3917 HD9 22 LEU Z  12  ? LEU 7 12   . ? 1_555 ? 
3918 HD9 22 ALA Z  15  ? ALA 7 15   . ? 1_555 ? 
3919 HD9 22 BCR QN .   ? BCR 7 4021 . ? 1_555 ? 
3920 HD9 22 LEU X  10  ? LEU 9 10   . ? 1_555 ? 
3921 HD9 22 PRO X  11  ? PRO 9 11   . ? 1_555 ? 
3922 HD9 22 ILE X  15  ? ILE 9 15   . ? 1_555 ? 
3923 HD9 22 VAL X  18  ? VAL 9 18   . ? 1_555 ? 
3924 ID1 15 THR S  64  ? THR 2 64   . ? 1_555 ? 
3925 ID1 15 VAL S  68  ? VAL 2 68   . ? 1_555 ? 
3926 ID1 15 ALA S  88  ? ALA 2 88   . ? 1_555 ? 
3927 ID1 15 HIS S  89  ? HIS 2 89   . ? 1_555 ? 
3928 ID1 15 ILE S  115 ? ILE 2 115  . ? 1_555 ? 
3929 ID1 15 ALA S  116 ? ALA 2 116  . ? 1_555 ? 
3930 ID1 15 TYR S  117 ? TYR 2 117  . ? 1_555 ? 
3931 ID1 15 SER S  118 ? SER 2 118  . ? 1_555 ? 
3932 ID1 15 VAL S  642 ? VAL 2 642  . ? 1_555 ? 
3933 ID1 15 TRP S  643 ? TRP 2 643  . ? 1_555 ? 
3934 ID1 15 MET S  646 ? MET 2 646  . ? 1_555 ? 
3935 ID1 15 CLA XL .   ? CLA 2 1204 . ? 1_555 ? 
3936 ID1 15 CLA ZL .   ? CLA 2 1206 . ? 1_555 ? 
3937 ID1 15 CLA QM .   ? CLA 2 1224 . ? 1_555 ? 
3938 ID1 15 BCR OL .   ? BCR 2 4017 . ? 1_555 ? 
3939 ID2 24 THR R  460 ? THR 1 460  . ? 1_555 ? 
3940 ID2 24 ALA R  463 ? ALA 1 463  . ? 1_555 ? 
3941 ID2 24 CLA PJ .   ? CLA 1 1022 . ? 1_555 ? 
3942 ID2 24 HIS S  89  ? HIS 2 89   . ? 1_555 ? 
3943 ID2 24 ILE S  91  ? ILE 2 91   . ? 1_555 ? 
3944 ID2 24 TRP S  92  ? TRP 2 92   . ? 1_555 ? 
3945 ID2 24 ASP S  93  ? ASP 2 93   . ? 1_555 ? 
3946 ID2 24 HIS S  95  ? HIS 2 95   . ? 1_555 ? 
3947 ID2 24 ASN S  114 ? ASN 2 114  . ? 1_555 ? 
3948 ID2 24 SER S  641 ? SER 2 641  . ? 1_555 ? 
3949 ID2 24 VAL S  642 ? VAL 2 642  . ? 1_555 ? 
3950 ID2 24 TRP S  645 ? TRP 2 645  . ? 1_555 ? 
3951 ID2 24 CLA XL .   ? CLA 2 1204 . ? 1_555 ? 
3952 ID2 24 CLA YL .   ? CLA 2 1205 . ? 1_555 ? 
3953 ID2 24 CLA AM .   ? CLA 2 1207 . ? 1_555 ? 
3954 ID2 24 CLA FN .   ? CLA 2 1239 . ? 1_555 ? 
3955 ID2 24 BCR OL .   ? BCR 2 4017 . ? 1_555 ? 
3956 ID2 24 LMG PL .   ? LMG 2 5002 . ? 1_555 ? 
3957 ID2 24 BCR IN .   ? BCR 6 4018 . ? 1_555 ? 
3958 ID2 24 VAL X  18  ? VAL 9 18   . ? 1_555 ? 
3959 ID2 24 PHE X  22  ? PHE 9 22   . ? 1_555 ? 
3960 ID2 24 PRO X  23  ? PRO 9 23   . ? 1_555 ? 
3961 ID2 24 THR X  26  ? THR 9 26   . ? 1_555 ? 
3962 ID2 24 MET X  27  ? MET 9 27   . ? 1_555 ? 
3963 ID3 10 CLA BL .   ? CLA 1 1132 . ? 1_555 ? 
3964 ID3 10 HIS S  95  ? HIS 2 95   . ? 1_555 ? 
3965 ID3 10 CLA ZL .   ? CLA 2 1206 . ? 1_555 ? 
3966 ID3 10 BCR JN .   ? BCR 6 4020 . ? 1_555 ? 
3967 ID3 10 TRP Y  65  ? TRP 8 65   . ? 1_555 ? 
3968 ID3 10 PRO Y  70  ? PRO 8 70   . ? 1_555 ? 
3969 ID3 10 ILE Y  83  ? ILE 8 83   . ? 1_555 ? 
3970 ID3 10 ALA Y  87  ? ALA 8 87   . ? 1_555 ? 
3971 ID3 10 GLY X  19  ? GLY 9 19   . ? 1_555 ? 
3972 ID3 10 TRP X  20  ? TRP 9 20   . ? 1_555 ? 
3973 ID4 10 PHE S  47  ? PHE 2 47   . ? 1_555 ? 
3974 ID4 10 PHE S  51  ? PHE 2 51   . ? 1_555 ? 
3975 ID4 10 LEU S  148 ? LEU 2 148  . ? 1_555 ? 
3976 ID4 10 PHE S  151 ? PHE 2 151  . ? 1_555 ? 
3977 ID4 10 ALA S  152 ? ALA 2 152  . ? 1_555 ? 
3978 ID4 10 HIS S  156 ? HIS 2 156  . ? 1_555 ? 
3979 ID4 10 PHE S  161 ? PHE 2 161  . ? 1_555 ? 
3980 ID4 10 TRP S  167 ? TRP 2 167  . ? 1_555 ? 
3981 ID4 10 CLA CM .   ? CLA 2 1209 . ? 1_555 ? 
3982 ID4 10 CLA DM .   ? CLA 2 1210 . ? 1_555 ? 
3983 ID5 8  TRP S  167 ? TRP 2 167  . ? 1_555 ? 
3984 ID5 8  SER S  173 ? SER 2 173  . ? 1_555 ? 
3985 ID5 8  HIS S  177 ? HIS 2 177  . ? 1_555 ? 
3986 ID5 8  TRP S  295 ? TRP 2 295  . ? 1_555 ? 
3987 ID5 8  CLA BM .   ? CLA 2 1208 . ? 1_555 ? 
3988 ID5 8  CLA DM .   ? CLA 2 1210 . ? 1_555 ? 
3989 ID5 8  CLA JM .   ? CLA 2 1217 . ? 1_555 ? 
3990 ID5 8  BCR IL .   ? BCR 2 4005 . ? 1_555 ? 
3991 ID6 17 PHE S  47  ? PHE 2 47   . ? 1_555 ? 
3992 ID6 17 HIS S  50  ? HIS 2 50   . ? 1_555 ? 
3993 ID6 17 PHE S  51  ? PHE 2 51   . ? 1_555 ? 
3994 ID6 17 ILE S  54  ? ILE 2 54   . ? 1_555 ? 
3995 ID6 17 TRP S  167 ? TRP 2 167  . ? 1_555 ? 
3996 ID6 17 PHE S  168 ? PHE 2 168  . ? 1_555 ? 
3997 ID6 17 ARG S  174 ? ARG 2 174  . ? 1_555 ? 
3998 ID6 17 HIS S  177 ? HIS 2 177  . ? 1_555 ? 
3999 ID6 17 HIS S  178 ? HIS 2 178  . ? 1_555 ? 
4000 ID6 17 PHE S  183 ? PHE 2 183  . ? 1_555 ? 
4001 ID6 17 TYR S  356 ? TYR 2 356  . ? 1_555 ? 
4002 ID6 17 CLA VL .   ? CLA 2 1202 . ? 1_555 ? 
4003 ID6 17 CLA BM .   ? CLA 2 1208 . ? 1_555 ? 
4004 ID6 17 CLA CM .   ? CLA 2 1209 . ? 1_555 ? 
4005 ID6 17 CLA HM .   ? CLA 2 1215 . ? 1_555 ? 
4006 ID6 17 CLA RM .   ? CLA 2 1225 . ? 1_555 ? 
4007 ID6 17 BCR IL .   ? BCR 2 4005 . ? 1_555 ? 
4008 ID7 13 LEU S  188 ? LEU 2 188  . ? 1_555 ? 
4009 ID7 13 GLY S  192 ? GLY 2 192  . ? 1_555 ? 
4010 ID7 13 HIS S  196 ? HIS 2 196  . ? 1_555 ? 
4011 ID7 13 PHE S  212 ? PHE 2 212  . ? 1_555 ? 
4012 ID7 13 LEU S  213 ? LEU 2 213  . ? 1_555 ? 
4013 ID7 13 THR S  215 ? THR 2 215  . ? 1_555 ? 
4014 ID7 13 PRO S  216 ? PRO 2 216  . ? 1_555 ? 
4015 ID7 13 PRO S  217 ? PRO 2 217  . ? 1_555 ? 
4016 ID7 13 GLY S  221 ? GLY 2 221  . ? 1_555 ? 
4017 ID7 13 LEU S  222 ? LEU 2 222  . ? 1_555 ? 
4018 ID7 13 CLA DN .   ? CLA 2 1211 . ? 1_555 ? 
4019 ID7 13 BCR HL .   ? BCR 2 4004 . ? 1_555 ? 
4020 ID7 13 BCR JL .   ? BCR 2 4006 . ? 1_555 ? 
4021 ID8 11 TRP S  230 ? TRP 2 230  . ? 1_555 ? 
4022 ID8 11 ALA S  234 ? ALA 2 234  . ? 1_555 ? 
4023 ID8 11 ALA S  240 ? ALA 2 240  . ? 1_555 ? 
4024 ID8 11 LEU S  255 ? LEU 2 255  . ? 1_555 ? 
4025 ID8 11 PHE S  257 ? PHE 2 257  . ? 1_555 ? 
4026 ID8 11 LEU S  258 ? LEU 2 258  . ? 1_555 ? 
4027 ID8 11 HIS S  275 ? HIS 2 275  . ? 1_555 ? 
4028 ID8 11 ALA S  279 ? ALA 2 279  . ? 1_555 ? 
4029 ID8 11 GLY S  487 ? GLY 2 487  . ? 1_555 ? 
4030 ID8 11 ALA S  489 ? ALA 2 489  . ? 1_555 ? 
4031 ID8 11 CLA GM .   ? CLA 2 1214 . ? 1_555 ? 
4032 ID9 16 PHE S  257 ? PHE 2 257  . ? 1_555 ? 
4033 ID9 16 LEU S  268 ? LEU 2 268  . ? 1_555 ? 
4034 ID9 16 ASP S  272 ? ASP 2 272  . ? 1_555 ? 
4035 ID9 16 HIS S  275 ? HIS 2 275  . ? 1_555 ? 
4036 ID9 16 HIS S  276 ? HIS 2 276  . ? 1_555 ? 
4037 ID9 16 ALA S  279 ? ALA 2 279  . ? 1_555 ? 
4038 ID9 16 ILE S  280 ? ILE 2 280  . ? 1_555 ? 
4039 ID9 16 ILE S  283 ? ILE 2 283  . ? 1_555 ? 
4040 ID9 16 HIS S  349 ? HIS 2 349  . ? 1_555 ? 
4041 ID9 16 LEU S  353 ? LEU 2 353  . ? 1_555 ? 
4042 ID9 16 TRP S  490 ? TRP 2 490  . ? 1_555 ? 
4043 ID9 16 TRP S  494 ? TRP 2 494  . ? 1_555 ? 
4044 ID9 16 CLA FM .   ? CLA 2 1213 . ? 1_555 ? 
4045 ID9 16 CLA HM .   ? CLA 2 1215 . ? 1_555 ? 
4046 ID9 16 CLA PM .   ? CLA 2 1223 . ? 1_555 ? 
4047 ID9 16 CLA XM .   ? CLA 2 1231 . ? 1_555 ? 
4048 JD1 18 TRP S  123 ? TRP 2 123  . ? 1_555 ? 
4049 JD1 18 SER S  186 ? SER 2 186  . ? 1_555 ? 
4050 JD1 18 SER S  187 ? SER 2 187  . ? 1_555 ? 
4051 JD1 18 TRP S  190 ? TRP 2 190  . ? 1_555 ? 
4052 JD1 18 ILE S  273 ? ILE 2 273  . ? 1_555 ? 
4053 JD1 18 HIS S  276 ? HIS 2 276  . ? 1_555 ? 
4054 JD1 18 HIS S  277 ? HIS 2 277  . ? 1_555 ? 
4055 JD1 18 ILE S  280 ? ILE 2 280  . ? 1_555 ? 
4056 JD1 18 ILE S  342 ? ILE 2 342  . ? 1_555 ? 
4057 JD1 18 MET S  350 ? MET 2 350  . ? 1_555 ? 
4058 JD1 18 SER S  355 ? SER 2 355  . ? 1_555 ? 
4059 JD1 18 TYR S  356 ? TYR 2 356  . ? 1_555 ? 
4060 JD1 18 CLA DM .   ? CLA 2 1210 . ? 1_555 ? 
4061 JD1 18 CLA GM .   ? CLA 2 1214 . ? 1_555 ? 
4062 JD1 18 CLA IM .   ? CLA 2 1216 . ? 1_555 ? 
4063 JD1 18 CLA PM .   ? CLA 2 1223 . ? 1_555 ? 
4064 JD1 18 CLA RM .   ? CLA 2 1225 . ? 1_555 ? 
4065 JD1 18 BCR LL .   ? BCR 2 4010 . ? 1_555 ? 
4066 JD2 12 LEU S  179 ? LEU 2 179  . ? 1_555 ? 
4067 JD2 12 PHE S  183 ? PHE 2 183  . ? 1_555 ? 
4068 JD2 12 ILE S  283 ? ILE 2 283  . ? 1_555 ? 
4069 JD2 12 PHE S  284 ? PHE 2 284  . ? 1_555 ? 
4070 JD2 12 ALA S  287 ? ALA 2 287  . ? 1_555 ? 
4071 JD2 12 MET S  290 ? MET 2 290  . ? 1_555 ? 
4072 JD2 12 TYR S  291 ? TYR 2 291  . ? 1_555 ? 
4073 JD2 12 CLA HM .   ? CLA 2 1215 . ? 1_555 ? 
4074 JD2 12 CLA KM .   ? CLA 2 1218 . ? 1_555 ? 
4075 JD2 12 CLA LM .   ? CLA 2 1219 . ? 1_555 ? 
4076 JD2 12 CLA MM .   ? CLA 2 1220 . ? 1_555 ? 
4077 JD2 12 CLA NM .   ? CLA 2 1221 . ? 1_555 ? 
4078 JD3 11 ASN S  176 ? ASN 2 176  . ? 1_555 ? 
4079 JD3 11 HIS S  177 ? HIS 2 177  . ? 1_555 ? 
4080 JD3 11 ALA S  180 ? ALA 2 180  . ? 1_555 ? 
4081 JD3 11 VAL S  185 ? VAL 2 185  . ? 1_555 ? 
4082 JD3 11 HIS S  289 ? HIS 2 289  . ? 1_555 ? 
4083 JD3 11 TYR S  291 ? TYR 2 291  . ? 1_555 ? 
4084 JD3 11 THR S  293 ? THR 2 293  . ? 1_555 ? 
4085 JD3 11 TRP S  295 ? TRP 2 295  . ? 1_555 ? 
4086 JD3 11 ILE S  297 ? ILE 2 297  . ? 1_555 ? 
4087 JD3 11 CLA CM .   ? CLA 2 1209 . ? 1_555 ? 
4088 JD3 11 BCR HL .   ? BCR 2 4004 . ? 1_555 ? 
4089 JD4 7  ILE S  286 ? ILE 2 286  . ? 1_555 ? 
4090 JD4 7  MET S  290 ? MET 2 290  . ? 1_555 ? 
4091 JD4 7  GLY S  298 ? GLY 2 298  . ? 1_555 ? 
4092 JD4 7  HIS S  299 ? HIS 2 299  . ? 1_555 ? 
4093 JD4 7  CLA IM .   ? CLA 2 1216 . ? 1_555 ? 
4094 JD4 7  CLA LM .   ? CLA 2 1219 . ? 1_555 ? 
4095 JD4 7  BCR HL .   ? BCR 2 4004 . ? 1_555 ? 
4096 JD5 9  MET S  290 ? MET 2 290  . ? 1_555 ? 
4097 JD5 9  HIS S  299 ? HIS 2 299  . ? 1_555 ? 
4098 JD5 9  ILE S  304 ? ILE 2 304  . ? 1_555 ? 
4099 JD5 9  ALA S  307 ? ALA 2 307  . ? 1_555 ? 
4100 JD5 9  HIS S  308 ? HIS 2 308  . ? 1_555 ? 
4101 JD5 9  CLA IM .   ? CLA 2 1216 . ? 1_555 ? 
4102 JD5 9  CLA KM .   ? CLA 2 1218 . ? 1_555 ? 
4103 JD5 9  CLA CN .   ? CLA 2 1240 . ? 1_555 ? 
4104 JD5 9  BCR KL .   ? BCR 2 4009 . ? 1_555 ? 
4105 JD6 12 ILE S  304 ? ILE 2 304  . ? 1_555 ? 
4106 JD6 12 LEU S  305 ? LEU 2 305  . ? 1_555 ? 
4107 JD6 12 HIS S  308 ? HIS 2 308  . ? 1_555 ? 
4108 JD6 12 HIS S  317 ? HIS 2 317  . ? 1_555 ? 
4109 JD6 12 PHE S  330 ? PHE 2 330  . ? 1_555 ? 
4110 JD6 12 VAL S  405 ? VAL 2 405  . ? 1_555 ? 
4111 JD6 12 CLA IM .   ? CLA 2 1216 . ? 1_555 ? 
4112 JD6 12 CLA NM .   ? CLA 2 1221 . ? 1_555 ? 
4113 JD6 12 CLA TM .   ? CLA 2 1227 . ? 1_555 ? 
4114 JD6 12 CLA CN .   ? CLA 2 1240 . ? 1_555 ? 
4115 JD6 12 BCR KL .   ? BCR 2 4009 . ? 1_555 ? 
4116 JD6 12 LHG QL .   ? LHG 2 5004 . ? 1_555 ? 
4117 JD7 13 ARG S  174 ? ARG 2 174  . ? 1_555 ? 
4118 JD7 13 HIS S  178 ? HIS 2 178  . ? 1_555 ? 
4119 JD7 13 LEU S  179 ? LEU 2 179  . ? 1_555 ? 
4120 JD7 13 ILE S  301 ? ILE 2 301  . ? 1_555 ? 
4121 JD7 13 ILE S  324 ? ILE 2 324  . ? 1_555 ? 
4122 JD7 13 LEU S  334 ? LEU 2 334  . ? 1_555 ? 
4123 JD7 13 ALA S  335 ? ALA 2 335  . ? 1_555 ? 
4124 JD7 13 SER S  338 ? SER 2 338  . ? 1_555 ? 
4125 JD7 13 ILE S  342 ? ILE 2 342  . ? 1_555 ? 
4126 JD7 13 CLA VL .   ? CLA 2 1202 . ? 1_555 ? 
4127 JD7 13 CLA IM .   ? CLA 2 1216 . ? 1_555 ? 
4128 JD7 13 CLA MM .   ? CLA 2 1220 . ? 1_555 ? 
4129 JD7 13 CLA PM .   ? CLA 2 1223 . ? 1_555 ? 
4130 JD8 17 VAL S  341 ? VAL 2 341  . ? 1_555 ? 
4131 JD8 17 SER S  344 ? SER 2 344  . ? 1_555 ? 
4132 JD8 17 GLN S  348 ? GLN 2 348  . ? 1_555 ? 
4133 JD8 17 GLN S  374 ? GLN 2 374  . ? 1_555 ? 
4134 JD8 17 MET S  381 ? MET 2 381  . ? 1_555 ? 
4135 JD8 17 PHE S  385 ? PHE 2 385  . ? 1_555 ? 
4136 JD8 17 LEU S  524 ? LEU 2 524  . ? 1_555 ? 
4137 JD8 17 THR S  527 ? THR 2 527  . ? 1_555 ? 
4138 JD8 17 ALA S  528 ? ALA 2 528  . ? 1_555 ? 
4139 JD8 17 LEU S  531 ? LEU 2 531  . ? 1_555 ? 
4140 JD8 17 MET S  580 ? MET 2 580  . ? 1_555 ? 
4141 JD8 17 LEU S  587 ? LEU 2 587  . ? 1_555 ? 
4142 JD8 17 CLA PM .   ? CLA 2 1223 . ? 1_555 ? 
4143 JD8 17 CLA ZM .   ? CLA 2 1234 . ? 1_555 ? 
4144 JD8 17 CLA BN .   ? CLA 2 1236 . ? 1_555 ? 
4145 JD8 17 BCR LL .   ? BCR 2 4010 . ? 1_555 ? 
4146 JD8 17 LHG QL .   ? LHG 2 5004 . ? 1_555 ? 
4147 JD9 14 VAL S  341 ? VAL 2 341  . ? 1_555 ? 
4148 JD9 14 LEU S  345 ? LEU 2 345  . ? 1_555 ? 
4149 JD9 14 HIS S  349 ? HIS 2 349  . ? 1_555 ? 
4150 JD9 14 SER S  352 ? SER 2 352  . ? 1_555 ? 
4151 JD9 14 CLA GM .   ? CLA 2 1214 . ? 1_555 ? 
4152 JD9 14 CLA HM .   ? CLA 2 1215 . ? 1_555 ? 
4153 JD9 14 CLA NM .   ? CLA 2 1221 . ? 1_555 ? 
4154 JD9 14 CLA OM .   ? CLA 2 1222 . ? 1_555 ? 
4155 JD9 14 CLA TM .   ? CLA 2 1227 . ? 1_555 ? 
4156 JD9 14 CLA XM .   ? CLA 2 1231 . ? 1_555 ? 
4157 JD9 14 CLA ZM .   ? CLA 2 1234 . ? 1_555 ? 
4158 JD9 14 BCR KL .   ? BCR 2 4009 . ? 1_555 ? 
4159 JD9 14 BCR LL .   ? BCR 2 4010 . ? 1_555 ? 
4160 JD9 14 LHG QL .   ? LHG 2 5004 . ? 1_555 ? 
4161 KD1 12 TRP S  60  ? TRP 2 60   . ? 1_555 ? 
4162 KD1 12 THR S  64  ? THR 2 64   . ? 1_555 ? 
4163 KD1 12 TYR S  117 ? TYR 2 117  . ? 1_555 ? 
4164 KD1 12 SER S  118 ? SER 2 118  . ? 1_555 ? 
4165 KD1 12 ALA S  368 ? ALA 2 368  . ? 1_555 ? 
4166 KD1 12 THR S  371 ? THR 2 371  . ? 1_555 ? 
4167 KD1 12 HIS S  372 ? HIS 2 372  . ? 1_555 ? 
4168 KD1 12 LEU S  716 ? LEU 2 716  . ? 1_555 ? 
4169 KD1 12 ALA S  719 ? ALA 2 719  . ? 1_555 ? 
4170 KD1 12 LEU S  722 ? LEU 2 722  . ? 1_555 ? 
4171 KD1 12 CLA YL .   ? CLA 2 1205 . ? 1_555 ? 
4172 KD1 12 CLA RM .   ? CLA 2 1225 . ? 1_555 ? 
4173 KD2 17 TRP S  60  ? TRP 2 60   . ? 1_555 ? 
4174 KD2 17 THR S  61  ? THR 2 61   . ? 1_555 ? 
4175 KD2 17 GLY S  119 ? GLY 2 119  . ? 1_555 ? 
4176 KD2 17 TRP S  123 ? TRP 2 123  . ? 1_555 ? 
4177 KD2 17 ALA S  189 ? ALA 2 189  . ? 1_555 ? 
4178 KD2 17 THR S  343 ? THR 2 343  . ? 1_555 ? 
4179 KD2 17 MET S  350 ? MET 2 350  . ? 1_555 ? 
4180 KD2 17 TYR S  356 ? TYR 2 356  . ? 1_555 ? 
4181 KD2 17 LEU S  369 ? LEU 2 369  . ? 1_555 ? 
4182 KD2 17 HIS S  372 ? HIS 2 372  . ? 1_555 ? 
4183 KD2 17 HIS S  373 ? HIS 2 373  . ? 1_555 ? 
4184 KD2 17 ILE S  376 ? ILE 2 376  . ? 1_555 ? 
4185 KD2 17 CLA WL .   ? CLA 2 1203 . ? 1_555 ? 
4186 KD2 17 CLA DM .   ? CLA 2 1210 . ? 1_555 ? 
4187 KD2 17 CLA HM .   ? CLA 2 1215 . ? 1_555 ? 
4188 KD2 17 CLA QM .   ? CLA 2 1224 . ? 1_555 ? 
4189 KD2 17 BCR IL .   ? BCR 2 4005 . ? 1_555 ? 
4190 KD3 17 ILE S  25  ? ILE 2 25   . ? 1_555 ? 
4191 KD3 17 ALA S  26  ? ALA 2 26   . ? 1_555 ? 
4192 KD3 17 HIS S  29  ? HIS 2 29   . ? 1_555 ? 
4193 KD3 17 ASP S  30  ? ASP 2 30   . ? 1_555 ? 
4194 KD3 17 HIS S  329 ? HIS 2 329  . ? 1_555 ? 
4195 KD3 17 LEU S  332 ? LEU 2 332  . ? 1_555 ? 
4196 KD3 17 PHE S  379 ? PHE 2 379  . ? 1_555 ? 
4197 KD3 17 GLY S  383 ? GLY 2 383  . ? 1_555 ? 
4198 KD3 17 HIS S  387 ? HIS 2 387  . ? 1_555 ? 
4199 KD3 17 ILE S  390 ? ILE 2 390  . ? 1_555 ? 
4200 KD3 17 ARG S  394 ? ARG 2 394  . ? 1_555 ? 
4201 KD3 17 TRP S  570 ? TRP 2 570  . ? 1_555 ? 
4202 KD3 17 PHE S  573 ? PHE 2 573  . ? 1_555 ? 
4203 KD3 17 CLA UL .   ? CLA 2 1201 . ? 1_555 ? 
4204 KD3 17 CLA VL .   ? CLA 2 1202 . ? 1_555 ? 
4205 KD3 17 CLA WL .   ? CLA 2 1203 . ? 1_555 ? 
4206 KD3 17 LMG PL .   ? LMG 2 5002 . ? 1_555 ? 
4207 KD4 14 LEU S  312 ? LEU 2 312  . ? 1_555 ? 
4208 KD4 14 THR S  313 ? THR 2 313  . ? 1_555 ? 
4209 KD4 14 ARG S  408 ? ARG 2 408  . ? 1_555 ? 
4210 KD4 14 MET S  409 ? MET 2 409  . ? 1_555 ? 
4211 KD4 14 GLU S  411 ? GLU 2 411  . ? 1_555 ? 
4212 KD4 14 HIS S  412 ? HIS 2 412  . ? 1_555 ? 
4213 KD4 14 LEU S  416 ? LEU 2 416  . ? 1_555 ? 
4214 KD4 14 HIS S  419 ? HIS 2 419  . ? 1_555 ? 
4215 KD4 14 CLA MM .   ? CLA 2 1220 . ? 1_555 ? 
4216 KD4 14 CLA PM .   ? CLA 2 1223 . ? 1_555 ? 
4217 KD4 14 CLA UM .   ? CLA 2 1228 . ? 1_555 ? 
4218 KD4 14 CLA BN .   ? CLA 2 1236 . ? 1_555 ? 
4219 KD4 14 BCR KL .   ? BCR 2 4009 . ? 1_555 ? 
4220 KD4 14 LHG QL .   ? LHG 2 5004 . ? 1_555 ? 
4221 KD5 10 TRP R  702 ? TRP 1 702  . ? 1_555 ? 
4222 KD5 10 LYS R  706 ? LYS 1 706  . ? 1_555 ? 
4223 KD5 10 CLA SK .   ? CLA 1 1138 . ? 1_555 ? 
4224 KD5 10 HIS S  419 ? HIS 2 419  . ? 1_555 ? 
4225 KD5 10 TRP S  422 ? TRP 2 422  . ? 1_555 ? 
4226 KD5 10 CLA TM .   ? CLA 2 1227 . ? 1_555 ? 
4227 KD5 10 CLA VM .   ? CLA 2 1229 . ? 1_555 ? 
4228 KD5 10 CLA AN .   ? CLA 2 1235 . ? 1_555 ? 
4229 KD5 10 CLA BN .   ? CLA 2 1236 . ? 1_555 ? 
4230 KD5 10 LHG QL .   ? LHG 2 5004 . ? 1_555 ? 
4231 KD6 12 CLA SK .   ? CLA 1 1138 . ? 1_555 ? 
4232 KD6 12 TRP S  422 ? TRP 2 422  . ? 1_555 ? 
4233 KD6 12 LEU S  425 ? LEU 2 425  . ? 1_555 ? 
4234 KD6 12 PHE S  426 ? PHE 2 426  . ? 1_555 ? 
4235 KD6 12 HIS S  430 ? HIS 2 430  . ? 1_555 ? 
4236 KD6 12 CLA UM .   ? CLA 2 1228 . ? 1_555 ? 
4237 KD6 12 CLA WM .   ? CLA 2 1230 . ? 1_555 ? 
4238 KD6 12 CLA AN .   ? CLA 2 1235 . ? 1_555 ? 
4239 KD6 12 BCR ML .   ? BCR 2 4011 . ? 1_555 ? 
4240 KD6 12 BCR NL .   ? BCR 2 4014 . ? 1_555 ? 
4241 KD6 12 SER W  51  ? SER 6 51   . ? 1_555 ? 
4242 KD6 12 LEU W  55  ? LEU 6 55   . ? 1_555 ? 
4243 KD7 7  CLA WJ .   ? CLA 1 1107 . ? 1_555 ? 
4244 KD7 7  GLY S  433 ? GLY 2 433  . ? 1_555 ? 
4245 KD7 7  VAL S  436 ? VAL 2 436  . ? 1_555 ? 
4246 KD7 7  HIS S  437 ? HIS 2 437  . ? 1_555 ? 
4247 KD7 7  LYS S  449 ? LYS 2 449  . ? 1_555 ? 
4248 KD7 7  CLA VM .   ? CLA 2 1229 . ? 1_555 ? 
4249 KD7 7  BCR ML .   ? BCR 2 4011 . ? 1_555 ? 
4250 KD8 10 ILE S  461 ? ILE 2 461  . ? 1_555 ? 
4251 KD8 10 THR S  464 ? THR 2 464  . ? 1_555 ? 
4252 KD8 10 SER S  465 ? SER 2 465  . ? 1_555 ? 
4253 KD8 10 LEU S  475 ? LEU 2 475  . ? 1_555 ? 
4254 KD8 10 LEU S  476 ? LEU 2 476  . ? 1_555 ? 
4255 KD8 10 TRP S  494 ? TRP 2 494  . ? 1_555 ? 
4256 KD8 10 CLA GM .   ? CLA 2 1214 . ? 1_555 ? 
4257 KD8 10 CLA PM .   ? CLA 2 1223 . ? 1_555 ? 
4258 KD8 10 CLA YM .   ? CLA 2 1232 . ? 1_555 ? 
4259 KD8 10 CLA ZM .   ? CLA 2 1234 . ? 1_555 ? 
4260 KD9 4  LEU S  475 ? LEU 2 475  . ? 1_555 ? 
4261 KD9 4  ILE S  482 ? ILE 2 482  . ? 1_555 ? 
4262 KD9 4  THR S  486 ? THR 2 486  . ? 1_555 ? 
4263 KD9 4  CLA XM .   ? CLA 2 1231 . ? 1_555 ? 
4264 LD1 19 GLN S  348 ? GLN 2 348  . ? 1_555 ? 
4265 LD1 19 TYR S  351 ? TYR 2 351  . ? 1_555 ? 
4266 LD1 19 TYR S  370 ? TYR 2 370  . ? 1_555 ? 
4267 LD1 19 PHE S  457 ? PHE 2 457  . ? 1_555 ? 
4268 LD1 19 ALA S  458 ? ALA 2 458  . ? 1_555 ? 
4269 LD1 19 ILE S  461 ? ILE 2 461  . ? 1_555 ? 
4270 LD1 19 GLN S  462 ? GLN 2 462  . ? 1_555 ? 
4271 LD1 19 PHE S  506 ? PHE 2 506  . ? 1_555 ? 
4272 LD1 19 LEU S  507 ? LEU 2 507  . ? 1_555 ? 
4273 LD1 19 HIS S  517 ? HIS 2 517  . ? 1_555 ? 
4274 LD1 19 ILE S  520 ? ILE 2 520  . ? 1_555 ? 
4275 LD1 19 LEU S  587 ? LEU 2 587  . ? 1_555 ? 
4276 LD1 19 TYR S  590 ? TYR 2 590  . ? 1_555 ? 
4277 LD1 19 TRP S  591 ? TRP 2 591  . ? 1_555 ? 
4278 LD1 19 CLA OM .   ? CLA 2 1222 . ? 1_555 ? 
4279 LD1 19 CLA PM .   ? CLA 2 1223 . ? 1_555 ? 
4280 LD1 19 CLA XM .   ? CLA 2 1231 . ? 1_555 ? 
4281 LD1 19 CLA AN .   ? CLA 2 1235 . ? 1_555 ? 
4282 LD1 19 BCR LL .   ? BCR 2 4010 . ? 1_555 ? 
4283 LD2 15 VAL S  423 ? VAL 2 423  . ? 1_555 ? 
4284 LD2 15 PHE S  426 ? PHE 2 426  . ? 1_555 ? 
4285 LD2 15 LEU S  427 ? LEU 2 427  . ? 1_555 ? 
4286 LD2 15 GLU S  454 ? GLU 2 454  . ? 1_555 ? 
4287 LD2 15 PRO S  455 ? PRO 2 455  . ? 1_555 ? 
4288 LD2 15 VAL S  456 ? VAL 2 456  . ? 1_555 ? 
4289 LD2 15 PHE S  457 ? PHE 2 457  . ? 1_555 ? 
4290 LD2 15 ALA S  458 ? ALA 2 458  . ? 1_555 ? 
4291 LD2 15 PHE S  514 ? PHE 2 514  . ? 1_555 ? 
4292 LD2 15 HIS S  517 ? HIS 2 517  . ? 1_555 ? 
4293 LD2 15 HIS S  518 ? HIS 2 518  . ? 1_555 ? 
4294 LD2 15 CLA UM .   ? CLA 2 1228 . ? 1_555 ? 
4295 LD2 15 CLA VM .   ? CLA 2 1229 . ? 1_555 ? 
4296 LD2 15 CLA ZM .   ? CLA 2 1234 . ? 1_555 ? 
4297 LD2 15 CLA BN .   ? CLA 2 1236 . ? 1_555 ? 
4298 LD3 11 LEU S  420 ? LEU 2 420  . ? 1_555 ? 
4299 LD3 11 TRP S  422 ? TRP 2 422  . ? 1_555 ? 
4300 LD3 11 VAL S  423 ? VAL 2 423  . ? 1_555 ? 
4301 LD3 11 ALA S  521 ? ALA 2 521  . ? 1_555 ? 
4302 LD3 11 HIS S  525 ? HIS 2 525  . ? 1_555 ? 
4303 LD3 11 CLA OM .   ? CLA 2 1222 . ? 1_555 ? 
4304 LD3 11 CLA TM .   ? CLA 2 1227 . ? 1_555 ? 
4305 LD3 11 CLA UM .   ? CLA 2 1228 . ? 1_555 ? 
4306 LD3 11 CLA AN .   ? CLA 2 1235 . ? 1_555 ? 
4307 LD3 11 BCR LL .   ? BCR 2 4010 . ? 1_555 ? 
4308 LD3 11 LHG QL .   ? LHG 2 5004 . ? 1_555 ? 
4309 LD4 6  LYS S  309 ? LYS 2 309  . ? 1_555 ? 
4310 LD4 6  PRO S  311 ? PRO 2 311  . ? 1_555 ? 
4311 LD4 6  LEU S  312 ? LEU 2 312  . ? 1_555 ? 
4312 LD4 6  CLA LM .   ? CLA 2 1219 . ? 1_555 ? 
4313 LD4 6  CLA MM .   ? CLA 2 1220 . ? 1_555 ? 
4314 LD4 6  LHG QL .   ? LHG 2 5004 . ? 1_555 ? 
4315 LD5 15 ILE S  127 ? ILE 2 127  . ? 1_555 ? 
4316 LD5 15 GLY S  128 ? GLY 2 128  . ? 1_555 ? 
4317 LD5 15 GLU S  134 ? GLU 2 134  . ? 1_555 ? 
4318 LD5 15 GLY S  138 ? GLY 2 138  . ? 1_555 ? 
4319 LD5 15 SER S  186 ? SER 2 186  . ? 1_555 ? 
4320 LD5 15 ALA S  189 ? ALA 2 189  . ? 1_555 ? 
4321 LD5 15 TRP S  190 ? TRP 2 190  . ? 1_555 ? 
4322 LD5 15 HIS S  193 ? HIS 2 193  . ? 1_555 ? 
4323 LD5 15 HIS S  196 ? HIS 2 196  . ? 1_555 ? 
4324 LD5 15 VAL S  197 ? VAL 2 197  . ? 1_555 ? 
4325 LD5 15 GLY S  208 ? GLY 2 208  . ? 1_555 ? 
4326 LD5 15 TRP S  209 ? TRP 2 209  . ? 1_555 ? 
4327 LD5 15 PHE S  212 ? PHE 2 212  . ? 1_555 ? 
4328 LD5 15 CLA EM .   ? CLA 2 1212 . ? 1_555 ? 
4329 LD5 15 BCR JL .   ? BCR 2 4006 . ? 1_555 ? 
4330 LD6 21 CLA OJ .   ? CLA 1 1237 . ? 1_555 ? 
4331 LD6 21 ILE S  21  ? ILE 2 21   . ? 1_555 ? 
4332 LD6 21 TRP S  22  ? TRP 2 22   . ? 1_555 ? 
4333 LD6 21 ILE S  675 ? ILE 2 675  . ? 1_555 ? 
4334 LD6 21 VAL S  676 ? VAL 2 676  . ? 1_555 ? 
4335 LD6 21 HIS S  679 ? HIS 2 679  . ? 1_555 ? 
4336 LD6 21 VAL S  688 ? VAL 2 688  . ? 1_555 ? 
4337 LD6 21 TRP S  690 ? TRP 2 690  . ? 1_555 ? 
4338 LD6 21 LYS S  691 ? LYS 2 691  . ? 1_555 ? 
4339 LD6 21 ASP S  692 ? ASP 2 692  . ? 1_555 ? 
4340 LD6 21 PRO S  694 ? PRO 2 694  . ? 1_555 ? 
4341 LD6 21 VAL S  695 ? VAL 2 695  . ? 1_555 ? 
4342 LD6 21 PQN GL .   ? PQN 2 2002 . ? 1_555 ? 
4343 LD6 21 BCR IN .   ? BCR 6 4018 . ? 1_555 ? 
4344 LD6 21 BCR JN .   ? BCR 6 4020 . ? 1_555 ? 
4345 LD6 21 LEU Y  88  ? LEU 8 88   . ? 1_555 ? 
4346 LD6 21 TYR Y  99  ? TYR 8 99   . ? 1_555 ? 
4347 LD6 21 VAL Y  102 ? VAL 8 102  . ? 1_555 ? 
4348 LD6 21 THR Y  103 ? THR 8 103  . ? 1_555 ? 
4349 LD6 21 BCR ON .   ? BCR 8 4019 . ? 1_555 ? 
4350 LD6 21 PHE X  31  ? PHE 9 31   . ? 1_555 ? 
4351 LD7 12 CLA PJ .   ? CLA 1 1022 . ? 1_555 ? 
4352 LD7 12 CLA QK .   ? CLA 1 1131 . ? 1_555 ? 
4353 LD7 12 PHE S  649 ? PHE 2 649  . ? 1_555 ? 
4354 LD7 12 LEU S  652 ? LEU 2 652  . ? 1_555 ? 
4355 LD7 12 VAL S  653 ? VAL 2 653  . ? 1_555 ? 
4356 LD7 12 MET S  659 ? MET 2 659  . ? 1_555 ? 
4357 LD7 12 PHE S  660 ? PHE 2 660  . ? 1_555 ? 
4358 LD7 12 VAL S  705 ? VAL 2 705  . ? 1_555 ? 
4359 LD7 12 HIS S  709 ? HIS 2 709  . ? 1_555 ? 
4360 LD7 12 CLA ZL .   ? CLA 2 1206 . ? 1_555 ? 
4361 LD7 12 PQN GL .   ? PQN 2 2002 . ? 1_555 ? 
4362 LD7 12 BCR OL .   ? BCR 2 4017 . ? 1_555 ? 
4363 LD8 5  CYS T  21  ? CYS 3 21   . ? 1_555 ? 
4364 LD8 5  CYS T  48  ? CYS 3 48   . ? 1_555 ? 
4365 LD8 5  CYS T  51  ? CYS 3 51   . ? 1_555 ? 
4366 LD8 5  LYS T  52  ? LYS 3 52   . ? 1_555 ? 
4367 LD8 5  CYS T  54  ? CYS 3 54   . ? 1_555 ? 
4368 LD9 7  CYS T  11  ? CYS 3 11   . ? 1_555 ? 
4369 LD9 7  ILE T  12  ? ILE 3 12   . ? 1_555 ? 
4370 LD9 7  GLY T  13  ? GLY 3 13   . ? 1_555 ? 
4371 LD9 7  CYS T  14  ? CYS 3 14   . ? 1_555 ? 
4372 LD9 7  THR T  15  ? THR 3 15   . ? 1_555 ? 
4373 LD9 7  CYS T  17  ? CYS 3 17   . ? 1_555 ? 
4374 LD9 7  CYS T  58  ? CYS 3 58   . ? 1_555 ? 
4375 MD1 6  CLA XL .   ? CLA 2 1204 . ? 1_555 ? 
4376 MD1 6  CLA ZL .   ? CLA 2 1206 . ? 1_555 ? 
4377 MD1 6  CLA EN .   ? CLA 2 1238 . ? 1_555 ? 
4378 MD1 6  BCR JN .   ? BCR 6 4020 . ? 1_555 ? 
4379 MD1 6  PHE X  22  ? PHE 9 22   . ? 1_555 ? 
4380 MD1 6  PRO X  23  ? PRO 9 23   . ? 1_555 ? 
4381 MD2 11 CLA QK .   ? CLA 1 1131 . ? 1_555 ? 
4382 MD2 11 CLA BL .   ? CLA 1 1132 . ? 1_555 ? 
4383 MD2 11 CLA OJ .   ? CLA 1 1237 . ? 1_555 ? 
4384 MD2 11 CLA AM .   ? CLA 2 1207 . ? 1_555 ? 
4385 MD2 11 CLA EN .   ? CLA 2 1238 . ? 1_555 ? 
4386 MD2 11 BCR IN .   ? BCR 6 4018 . ? 1_555 ? 
4387 MD2 11 TRP Y  65  ? TRP 8 65   . ? 1_555 ? 
4388 MD2 11 ALA Y  87  ? ALA 8 87   . ? 1_555 ? 
4389 MD2 11 LEU Y  88  ? LEU 8 88   . ? 1_555 ? 
4390 MD2 11 CLA MN .   ? CLA 8 1502 . ? 1_555 ? 
4391 MD2 11 TRP X  20  ? TRP 9 20   . ? 1_555 ? 
4392 MD3 7  TRP R  118 ? TRP 1 118  . ? 1_555 ? 
4393 MD3 7  CLA UJ .   ? CLA 1 1105 . ? 1_555 ? 
4394 MD3 7  CLA VJ .   ? CLA 1 1106 . ? 1_555 ? 
4395 MD3 7  CLA WJ .   ? CLA 1 1107 . ? 1_555 ? 
4396 MD3 7  CLA UK .   ? CLA 1 1140 . ? 1_555 ? 
4397 MD3 7  THR W  10  ? THR 6 10   . ? 1_555 ? 
4398 MD3 7  PRO W  12  ? PRO 6 12   . ? 1_555 ? 
4399 MD4 17 PHE Y  33  ? PHE 8 33   . ? 1_555 ? 
4400 MD4 17 ARG Y  41  ? ARG 8 41   . ? 1_555 ? 
4401 MD4 17 GLU Y  52  ? GLU 8 52   . ? 1_555 ? 
4402 MD4 17 MET Y  55  ? MET 8 55   . ? 1_555 ? 
4403 MD4 17 ALA Y  56  ? ALA 8 56   . ? 1_555 ? 
4404 MD4 17 CLA MN .   ? CLA 8 1502 . ? 1_555 ? 
4405 MD4 17 CLA NN .   ? CLA 8 1503 . ? 1_555 ? 
4406 MD4 17 BCR PN .   ? BCR 8 4022 . ? 1_555 ? 
4407 MD4 17 CLA MH .   ? CLA b 1207 . ? 1_655 ? 
4408 MD4 17 TYR O  9   ? TYR i 9    . ? 1_655 ? 
4409 MD4 17 ILE O  13  ? ILE i 13   . ? 1_655 ? 
4410 MD4 17 MET O  17  ? MET i 17   . ? 1_655 ? 
4411 MD4 17 LEU O  21  ? LEU i 21   . ? 1_655 ? 
4412 MD4 17 LEU O  29  ? LEU i 29   . ? 1_655 ? 
4413 MD4 17 THR P  93  ? THR l 93   . ? 1_655 ? 
4414 MD4 17 ALA P  94  ? ALA l 94   . ? 1_655 ? 
4415 MD4 17 SER P  97  ? SER l 97   . ? 1_655 ? 
4416 MD5 14 CLA OJ .   ? CLA 1 1237 . ? 1_555 ? 
4417 MD5 14 LEU S  684 ? LEU 2 684  . ? 1_555 ? 
4418 MD5 14 BCR JN .   ? BCR 6 4020 . ? 1_555 ? 
4419 MD5 14 LEU Y  37  ? LEU 8 37   . ? 1_555 ? 
4420 MD5 14 PRO Y  38  ? PRO 8 38   . ? 1_555 ? 
4421 MD5 14 ALA Y  39  ? ALA 8 39   . ? 1_555 ? 
4422 MD5 14 GLU Y  52  ? GLU 8 52   . ? 1_555 ? 
4423 MD5 14 VAL Y  53  ? VAL 8 53   . ? 1_555 ? 
4424 MD5 14 ALA Y  56  ? ALA 8 56   . ? 1_555 ? 
4425 MD5 14 HIS Y  57  ? HIS 8 57   . ? 1_555 ? 
4426 MD5 14 PHE Y  60  ? PHE 8 60   . ? 1_555 ? 
4427 MD5 14 CLA LN .   ? CLA 8 1501 . ? 1_555 ? 
4428 MD5 14 BCR ON .   ? BCR 8 4019 . ? 1_555 ? 
4429 MD5 14 BCR PN .   ? BCR 8 4022 . ? 1_555 ? 
4430 MD6 10 TYR Y  59  ? TYR 8 59   . ? 1_555 ? 
4431 MD6 10 GLY Y  63  ? GLY 8 63   . ? 1_555 ? 
4432 MD6 10 THR Y  66  ? THR 8 66   . ? 1_555 ? 
4433 MD6 10 LEU Y  142 ? LEU 8 142  . ? 1_555 ? 
4434 MD6 10 CLA LN .   ? CLA 8 1501 . ? 1_555 ? 
4435 MD6 10 BCR PN .   ? BCR 8 4022 . ? 1_555 ? 
4436 MD6 10 CLA MH .   ? CLA b 1207 . ? 1_655 ? 
4437 MD6 10 TRP O  12  ? TRP i 12   . ? 1_655 ? 
4438 MD6 10 PRO O  16  ? PRO i 16   . ? 1_655 ? 
4439 MD6 10 TRP O  20  ? TRP i 20   . ? 1_655 ? 
4440 MD7 11 CLA OJ .   ? CLA 1 1237 . ? 1_555 ? 
4441 MD7 11 ILE S  25  ? ILE 2 25   . ? 1_555 ? 
4442 MD7 11 CLA EN .   ? CLA 2 1238 . ? 1_555 ? 
4443 MD7 11 PQN GL .   ? PQN 2 2002 . ? 1_555 ? 
4444 MD7 11 ALA Y  92  ? ALA 8 92   . ? 1_555 ? 
4445 MD7 11 ALA Y  95  ? ALA 8 95   . ? 1_555 ? 
4446 MD7 11 LEU Y  96  ? LEU 8 96   . ? 1_555 ? 
4447 MD7 11 PHE Y  127 ? PHE 8 127  . ? 1_555 ? 
4448 MD7 11 CLA MN .   ? CLA 8 1502 . ? 1_555 ? 
4449 MD7 11 MET X  27  ? MET 9 27   . ? 1_555 ? 
4450 MD7 11 PHE X  31  ? PHE 9 31   . ? 1_555 ? 
4451 MD8 13 CLA BL .   ? CLA 1 1132 . ? 1_555 ? 
4452 MD8 13 PHE Y  33  ? PHE 8 33   . ? 1_555 ? 
4453 MD8 13 MET Y  55  ? MET 8 55   . ? 1_555 ? 
4454 MD8 13 ALA Y  56  ? ALA 8 56   . ? 1_555 ? 
4455 MD8 13 GLY Y  133 ? GLY 8 133  . ? 1_555 ? 
4456 MD8 13 VAL Y  137 ? VAL 8 137  . ? 1_555 ? 
4457 MD8 13 CLA LN .   ? CLA 8 1501 . ? 1_555 ? 
4458 MD8 13 CLA MN .   ? CLA 8 1502 . ? 1_555 ? 
4459 MD8 13 CLA NN .   ? CLA 8 1503 . ? 1_555 ? 
4460 MD8 13 CLA MH .   ? CLA b 1207 . ? 1_655 ? 
4461 MD8 13 PHE P  128 ? PHE l 128  . ? 1_655 ? 
4462 MD8 13 MET P  132 ? MET l 132  . ? 1_655 ? 
4463 MD8 13 BCR CJ .   ? BCR l 4022 . ? 1_655 ? 
4464 MD9 10 LEU S  150 ? LEU 2 150  . ? 1_555 ? 
4465 MD9 10 CLA UL .   ? CLA 2 1201 . ? 1_555 ? 
4466 MD9 10 CLA XL .   ? CLA 2 1204 . ? 1_555 ? 
4467 MD9 10 LEU Z  9   ? LEU 7 9    . ? 1_555 ? 
4468 MD9 10 LEU Z  12  ? LEU 7 12   . ? 1_555 ? 
4469 MD9 10 VAL Z  13  ? VAL 7 13   . ? 1_555 ? 
4470 MD9 10 LEU Z  16  ? LEU 7 16   . ? 1_555 ? 
4471 MD9 10 ALA Z  19  ? ALA 7 19   . ? 1_555 ? 
4472 MD9 10 ALA Z  22  ? ALA 7 22   . ? 1_555 ? 
4473 MD9 10 SER Z  26  ? SER 7 26   . ? 1_555 ? 
4474 ND1 7  CLA DB .   ? CLA A 1115 . ? 1_555 ? 
4475 ND1 7  CLA DC .   ? CLA A 1134 . ? 1_555 ? 
4476 ND1 7  BCR HA .   ? BCR A 4001 . ? 1_555 ? 
4477 ND1 7  ILE AA 113 ? ILE K 113  . ? 1_555 ? 
4478 ND1 7  LEU AA 114 ? LEU K 114  . ? 1_555 ? 
4479 ND1 7  GLY AA 117 ? GLY K 117  . ? 1_555 ? 
4480 ND1 7  MET AA 118 ? MET K 118  . ? 1_555 ? 
4481 ND2 7  PHE A  263 ? PHE A 263  . ? 1_555 ? 
4482 ND2 7  PHE A  264 ? PHE A 264  . ? 1_555 ? 
4483 ND2 7  SER AA 59  ? SER K 59   . ? 1_555 ? 
4484 ND2 7  ILE AA 62  ? ILE K 62   . ? 1_555 ? 
4485 ND2 7  LEU AA 66  ? LEU K 66   . ? 1_555 ? 
4486 ND2 7  MET AA 108 ? MET K 108  . ? 1_555 ? 
4487 ND2 7  HIS AA 112 ? HIS K 112  . ? 1_555 ? 
4488 ND3 8  CLA QF .   ? CLA a 1115 . ? 1_555 ? 
4489 ND3 8  BCR UE .   ? BCR a 4001 . ? 1_555 ? 
4490 ND3 8  PHE CA 110 ? PHE k 110  . ? 1_555 ? 
4491 ND3 8  ILE CA 113 ? ILE k 113  . ? 1_555 ? 
4492 ND3 8  LEU CA 114 ? LEU k 114  . ? 1_555 ? 
4493 ND3 8  GLY CA 117 ? GLY k 117  . ? 1_555 ? 
4494 ND3 8  MET CA 118 ? MET k 118  . ? 1_555 ? 
4495 ND3 8  LEU CA 120 ? LEU k 120  . ? 1_555 ? 
4496 ND4 5  PHE I  264 ? PHE a 264  . ? 1_555 ? 
4497 ND4 5  SER CA 59  ? SER k 59   . ? 1_555 ? 
4498 ND4 5  ILE CA 62  ? ILE k 62   . ? 1_555 ? 
4499 ND4 5  LEU CA 66  ? LEU k 66   . ? 1_555 ? 
4500 ND4 5  HIS CA 112 ? HIS k 112  . ? 1_555 ? 
4501 ND5 8  PHE DA 110 ? PHE 0 110  . ? 1_555 ? 
4502 ND5 8  ILE DA 113 ? ILE 0 113  . ? 1_555 ? 
4503 ND5 8  LEU DA 114 ? LEU 0 114  . ? 1_555 ? 
4504 ND5 8  GLY DA 117 ? GLY 0 117  . ? 1_555 ? 
4505 ND5 8  MET DA 118 ? MET 0 118  . ? 1_555 ? 
4506 ND5 8  LEU DA 120 ? LEU 0 120  . ? 1_555 ? 
4507 ND5 8  CLA DK .   ? CLA 1 1115 . ? 1_555 ? 
4508 ND5 8  CLA DL .   ? CLA 1 1134 . ? 1_555 ? 
4509 ND6 7  SER DA 59  ? SER 0 59   . ? 1_555 ? 
4510 ND6 7  ILE DA 62  ? ILE 0 62   . ? 1_555 ? 
4511 ND6 7  LEU DA 66  ? LEU 0 66   . ? 1_555 ? 
4512 ND6 7  HIS DA 112 ? HIS 0 112  . ? 1_555 ? 
4513 ND6 7  PHE R  263 ? PHE 1 263  . ? 1_555 ? 
4514 ND6 7  PHE R  264 ? PHE 1 264  . ? 1_555 ? 
4515 ND6 7  BCR IJ .   ? BCR 1 4002 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4L6V 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4L6V 
_atom_sites.fract_transf_matrix[1][1]   0.004659 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001802 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007481 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004877 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . LYS A  1  13  ? 37.662   22.406   231.136 1.00 118.06 ? 13   LYS A N   1 
ATOM   2     C  CA  . LYS A  1  13  ? 36.511   23.218   230.762 1.00 117.06 ? 13   LYS A CA  1 
ATOM   3     C  C   . LYS A  1  13  ? 35.483   23.219   231.890 1.00 116.94 ? 13   LYS A C   1 
ATOM   4     O  O   . LYS A  1  13  ? 34.277   23.168   231.650 1.00 115.44 ? 13   LYS A O   1 
ATOM   5     C  CB  . LYS A  1  13  ? 35.878   22.697   229.469 1.00 114.95 ? 13   LYS A CB  1 
ATOM   6     C  CG  . LYS A  1  13  ? 36.873   22.156   228.454 1.00 114.87 ? 13   LYS A CG  1 
ATOM   7     C  CD  . LYS A  1  13  ? 36.489   22.542   227.036 1.00 113.73 ? 13   LYS A CD  1 
ATOM   8     C  CE  . LYS A  1  13  ? 36.897   23.977   226.727 1.00 115.06 ? 13   LYS A CE  1 
ATOM   9     N  NZ  . LYS A  1  13  ? 37.005   24.231   225.264 1.00 114.48 ? 13   LYS A NZ  1 
ATOM   10    N  N   . VAL A  1  14  ? 35.977   23.278   233.122 1.00 118.53 ? 14   VAL A N   1 
ATOM   11    C  CA  . VAL A  1  14  ? 35.137   23.144   234.308 1.00 118.70 ? 14   VAL A CA  1 
ATOM   12    C  C   . VAL A  1  14  ? 34.540   24.479   234.748 1.00 119.54 ? 14   VAL A C   1 
ATOM   13    O  O   . VAL A  1  14  ? 35.266   25.449   234.965 1.00 121.27 ? 14   VAL A O   1 
ATOM   14    C  CB  . VAL A  1  14  ? 35.934   22.555   235.490 1.00 120.34 ? 14   VAL A CB  1 
ATOM   15    C  CG1 . VAL A  1  14  ? 35.001   22.187   236.639 1.00 120.36 ? 14   VAL A CG1 1 
ATOM   16    C  CG2 . VAL A  1  14  ? 36.740   21.342   235.044 1.00 119.92 ? 14   VAL A CG2 1 
ATOM   17    N  N   . SER A  1  15  ? 33.215   24.521   234.870 1.00 118.37 ? 15   SER A N   1 
ATOM   18    C  CA  . SER A  1  15  ? 32.520   25.689   235.410 1.00 119.20 ? 15   SER A CA  1 
ATOM   19    C  C   . SER A  1  15  ? 31.474   25.245   236.431 1.00 118.96 ? 15   SER A C   1 
ATOM   20    O  O   . SER A  1  15  ? 30.720   24.301   236.189 1.00 117.28 ? 15   SER A O   1 
ATOM   21    C  CB  . SER A  1  15  ? 31.870   26.501   234.287 1.00 118.11 ? 15   SER A CB  1 
ATOM   22    O  OG  . SER A  1  15  ? 31.282   25.657   233.313 1.00 115.90 ? 15   SER A OG  1 
ATOM   23    N  N   . VAL A  1  16  ? 31.435   25.933   237.570 1.00 124.03 ? 16   VAL A N   1 
ATOM   24    C  CA  . VAL A  1  16  ? 30.597   25.525   238.696 1.00 124.28 ? 16   VAL A CA  1 
ATOM   25    C  C   . VAL A  1  16  ? 30.089   26.725   239.499 1.00 125.81 ? 16   VAL A C   1 
ATOM   26    O  O   . VAL A  1  16  ? 30.801   27.714   239.676 1.00 127.50 ? 16   VAL A O   1 
ATOM   27    C  CB  . VAL A  1  16  ? 31.378   24.572   239.641 1.00 125.40 ? 16   VAL A CB  1 
ATOM   28    C  CG1 . VAL A  1  16  ? 30.661   24.388   240.980 1.00 126.34 ? 16   VAL A CG1 1 
ATOM   29    C  CG2 . VAL A  1  16  ? 31.608   23.221   238.973 1.00 123.78 ? 16   VAL A CG2 1 
ATOM   30    N  N   . ASP A  1  17  ? 28.850   26.622   239.976 1.00 147.34 ? 17   ASP A N   1 
ATOM   31    C  CA  . ASP A  1  17  ? 28.283   27.579   240.924 1.00 148.92 ? 17   ASP A CA  1 
ATOM   32    C  C   . ASP A  1  17  ? 28.325   26.994   242.334 1.00 150.35 ? 17   ASP A C   1 
ATOM   33    O  O   . ASP A  1  17  ? 27.873   25.872   242.556 1.00 149.37 ? 17   ASP A O   1 
ATOM   34    C  CB  . ASP A  1  17  ? 26.843   27.934   240.540 1.00 159.22 ? 17   ASP A CB  1 
ATOM   35    C  CG  . ASP A  1  17  ? 26.764   29.014   239.474 1.00 176.57 ? 17   ASP A CG  1 
ATOM   36    O  OD1 . ASP A  1  17  ? 27.624   29.920   239.467 1.00 197.76 ? 17   ASP A OD1 1 
ATOM   37    O  OD2 . ASP A  1  17  ? 25.835   28.956   238.640 1.00 171.27 ? 17   ASP A OD2 1 
ATOM   38    N  N   . ASN A  1  18  ? 28.860   27.755   243.284 1.00 149.46 ? 18   ASN A N   1 
ATOM   39    C  CA  . ASN A  1  18  ? 29.048   27.258   244.644 1.00 151.15 ? 18   ASN A CA  1 
ATOM   40    C  C   . ASN A  1  18  ? 27.808   27.438   245.518 1.00 151.63 ? 18   ASN A C   1 
ATOM   41    O  O   . ASN A  1  18  ? 27.319   28.553   245.697 1.00 152.49 ? 18   ASN A O   1 
ATOM   42    C  CB  . ASN A  1  18  ? 30.238   27.962   245.296 1.00 153.73 ? 18   ASN A CB  1 
ATOM   43    C  CG  . ASN A  1  18  ? 31.482   27.918   244.434 1.00 153.50 ? 18   ASN A CG  1 
ATOM   44    O  OD1 . ASN A  1  18  ? 31.605   27.076   243.545 1.00 151.61 ? 18   ASN A OD1 1 
ATOM   45    N  ND2 . ASN A  1  18  ? 32.413   28.828   244.694 1.00 155.54 ? 18   ASN A ND2 1 
ATOM   46    N  N   . ASN A  1  19  ? 27.315   26.329   246.064 1.00 136.68 ? 19   ASN A N   1 
ATOM   47    C  CA  . ASN A  1  19  ? 26.173   26.340   246.976 1.00 137.27 ? 19   ASN A CA  1 
ATOM   48    C  C   . ASN A  1  19  ? 24.946   27.039   246.397 1.00 136.06 ? 19   ASN A C   1 
ATOM   49    O  O   . ASN A  1  19  ? 24.486   28.037   246.948 1.00 137.47 ? 19   ASN A O   1 
ATOM   50    C  CB  . ASN A  1  19  ? 26.561   27.011   248.297 1.00 140.25 ? 19   ASN A CB  1 
ATOM   51    C  CG  . ASN A  1  19  ? 27.860   26.478   248.865 1.00 141.74 ? 19   ASN A CG  1 
ATOM   52    O  OD1 . ASN A  1  19  ? 27.871   25.496   249.608 1.00 142.24 ? 19   ASN A OD1 1 
ATOM   53    N  ND2 . ASN A  1  19  ? 28.965   27.127   248.518 1.00 142.56 ? 19   ASN A ND2 1 
ATOM   54    N  N   . PRO A  1  20  ? 24.401   26.514   245.287 1.00 138.70 ? 20   PRO A N   1 
ATOM   55    C  CA  . PRO A  1  20  ? 23.248   27.179   244.668 1.00 137.57 ? 20   PRO A CA  1 
ATOM   56    C  C   . PRO A  1  20  ? 21.952   27.008   245.459 1.00 137.83 ? 20   PRO A C   1 
ATOM   57    O  O   . PRO A  1  20  ? 21.038   27.818   245.299 1.00 137.74 ? 20   PRO A O   1 
ATOM   58    C  CB  . PRO A  1  20  ? 23.133   26.499   243.295 1.00 134.92 ? 20   PRO A CB  1 
ATOM   59    C  CG  . PRO A  1  20  ? 24.357   25.642   243.150 1.00 134.82 ? 20   PRO A CG  1 
ATOM   60    C  CD  . PRO A  1  20  ? 24.812   25.323   244.529 1.00 136.89 ? 20   PRO A CD  1 
ATOM   61    N  N   . VAL A  1  21  ? 21.878   25.975   246.294 1.00 149.94 ? 21   VAL A N   1 
ATOM   62    C  CA  . VAL A  1  21  ? 20.661   25.679   247.047 1.00 150.22 ? 21   VAL A CA  1 
ATOM   63    C  C   . VAL A  1  21  ? 20.989   25.283   248.488 1.00 152.47 ? 21   VAL A C   1 
ATOM   64    O  O   . VAL A  1  21  ? 21.794   24.380   248.712 1.00 152.63 ? 21   VAL A O   1 
ATOM   65    C  CB  . VAL A  1  21  ? 19.855   24.539   246.392 1.00 147.87 ? 21   VAL A CB  1 
ATOM   66    C  CG1 . VAL A  1  21  ? 18.508   24.368   247.087 1.00 148.18 ? 21   VAL A CG1 1 
ATOM   67    C  CG2 . VAL A  1  21  ? 19.654   24.810   244.909 1.00 145.66 ? 21   VAL A CG2 1 
ATOM   68    N  N   . PRO A  1  22  ? 20.371   25.961   249.474 1.00 129.93 ? 22   PRO A N   1 
ATOM   69    C  CA  . PRO A  1  22  ? 20.564   25.531   250.865 1.00 132.15 ? 22   PRO A CA  1 
ATOM   70    C  C   . PRO A  1  22  ? 20.051   24.116   251.115 1.00 131.28 ? 22   PRO A C   1 
ATOM   71    O  O   . PRO A  1  22  ? 19.223   23.620   250.352 1.00 129.15 ? 22   PRO A O   1 
ATOM   72    C  CB  . PRO A  1  22  ? 19.744   26.546   251.667 1.00 133.96 ? 22   PRO A CB  1 
ATOM   73    C  CG  . PRO A  1  22  ? 19.639   27.738   250.792 1.00 133.31 ? 22   PRO A CG  1 
ATOM   74    C  CD  . PRO A  1  22  ? 19.598   27.213   249.391 1.00 130.39 ? 22   PRO A CD  1 
ATOM   75    N  N   . THR A  1  23  ? 20.539   23.485   252.178 1.00 159.07 ? 23   THR A N   1 
ATOM   76    C  CA  . THR A  1  23  ? 20.106   22.144   252.551 1.00 158.66 ? 23   THR A CA  1 
ATOM   77    C  C   . THR A  1  23  ? 19.231   22.205   253.805 1.00 160.65 ? 23   THR A C   1 
ATOM   78    O  O   . THR A  1  23  ? 19.742   22.216   254.926 1.00 163.12 ? 23   THR A O   1 
ATOM   79    C  CB  . THR A  1  23  ? 21.319   21.223   252.790 1.00 159.20 ? 23   THR A CB  1 
ATOM   80    O  OG1 . THR A  1  23  ? 22.244   21.356   251.703 1.00 157.78 ? 23   THR A OG1 1 
ATOM   81    C  CG2 . THR A  1  23  ? 20.886   19.772   252.908 1.00 158.35 ? 23   THR A CG2 1 
ATOM   82    N  N   . SER A  1  24  ? 17.914   22.247   253.605 1.00 145.27 ? 24   SER A N   1 
ATOM   83    C  CA  . SER A  1  24  ? 16.957   22.386   254.704 1.00 147.10 ? 24   SER A CA  1 
ATOM   84    C  C   . SER A  1  24  ? 15.822   21.373   254.588 1.00 145.80 ? 24   SER A C   1 
ATOM   85    O  O   . SER A  1  24  ? 15.392   21.033   253.488 1.00 143.27 ? 24   SER A O   1 
ATOM   86    C  CB  . SER A  1  24  ? 16.382   23.802   254.740 1.00 147.88 ? 24   SER A CB  1 
ATOM   87    O  OG  . SER A  1  24  ? 15.539   23.972   255.867 1.00 149.94 ? 24   SER A OG  1 
ATOM   88    N  N   . PHE A  1  25  ? 15.321   20.915   255.730 1.00 136.02 ? 25   PHE A N   1 
ATOM   89    C  CA  . PHE A  1  25  ? 14.257   19.915   255.755 1.00 135.14 ? 25   PHE A CA  1 
ATOM   90    C  C   . PHE A  1  25  ? 12.858   20.537   255.711 1.00 134.97 ? 25   PHE A C   1 
ATOM   91    O  O   . PHE A  1  25  ? 11.857   19.829   255.834 1.00 134.56 ? 25   PHE A O   1 
ATOM   92    C  CB  . PHE A  1  25  ? 14.402   19.033   256.999 1.00 137.31 ? 25   PHE A CB  1 
ATOM   93    C  CG  . PHE A  1  25  ? 15.105   17.730   256.737 1.00 136.37 ? 25   PHE A CG  1 
ATOM   94    C  CD1 . PHE A  1  25  ? 14.415   16.646   256.219 1.00 134.58 ? 25   PHE A CD1 1 
ATOM   95    C  CD2 . PHE A  1  25  ? 16.456   17.590   257.006 1.00 137.38 ? 25   PHE A CD2 1 
ATOM   96    C  CE1 . PHE A  1  25  ? 15.059   15.447   255.975 1.00 133.82 ? 25   PHE A CE1 1 
ATOM   97    C  CE2 . PHE A  1  25  ? 17.105   16.393   256.766 1.00 136.63 ? 25   PHE A CE2 1 
ATOM   98    C  CZ  . PHE A  1  25  ? 16.406   15.321   256.248 1.00 134.84 ? 25   PHE A CZ  1 
ATOM   99    N  N   . GLU A  1  26  ? 12.786   21.853   255.532 1.00 169.46 ? 26   GLU A N   1 
ATOM   100   C  CA  . GLU A  1  26  ? 11.501   22.549   255.517 1.00 169.54 ? 26   GLU A CA  1 
ATOM   101   C  C   . GLU A  1  26  ? 10.637   22.127   254.329 1.00 166.69 ? 26   GLU A C   1 
ATOM   102   O  O   . GLU A  1  26  ? 9.415    22.035   254.444 1.00 166.62 ? 26   GLU A O   1 
ATOM   103   C  CB  . GLU A  1  26  ? 11.711   24.069   255.485 1.00 170.54 ? 26   GLU A CB  1 
ATOM   104   C  CG  . GLU A  1  26  ? 12.199   24.622   254.144 1.00 168.38 ? 26   GLU A CG  1 
ATOM   105   C  CD  . GLU A  1  26  ? 12.203   26.136   254.099 1.00 175.52 ? 26   GLU A CD  1 
ATOM   106   O  OE1 . GLU A  1  26  ? 12.504   26.693   253.022 1.00 167.87 ? 26   GLU A OE1 1 
ATOM   107   O  OE2 . GLU A  1  26  ? 11.899   26.768   255.133 1.00 194.23 ? 26   GLU A OE2 1 
ATOM   108   N  N   . LYS A  1  27  ? 11.278   21.872   253.193 1.00 130.99 ? 27   LYS A N   1 
ATOM   109   C  CA  . LYS A  1  27  ? 10.564   21.552   251.961 1.00 128.29 ? 27   LYS A CA  1 
ATOM   110   C  C   . LYS A  1  27  ? 9.963    20.152   251.988 1.00 127.39 ? 27   LYS A C   1 
ATOM   111   O  O   . LYS A  1  27  ? 9.006    19.865   251.267 1.00 125.70 ? 27   LYS A O   1 
ATOM   112   C  CB  . LYS A  1  27  ? 11.504   21.673   250.761 1.00 126.36 ? 27   LYS A CB  1 
ATOM   113   C  CG  . LYS A  1  27  ? 12.099   23.055   250.554 1.00 127.04 ? 27   LYS A CG  1 
ATOM   114   C  CD  . LYS A  1  27  ? 11.042   24.073   250.164 1.00 126.78 ? 27   LYS A CD  1 
ATOM   115   C  CE  . LYS A  1  27  ? 11.677   25.398   249.781 1.00 127.24 ? 27   LYS A CE  1 
ATOM   116   N  NZ  . LYS A  1  27  ? 12.499   25.277   248.543 1.00 125.23 ? 27   LYS A NZ  1 
ATOM   117   N  N   . TRP A  1  28  ? 10.526   19.284   252.824 1.00 127.97 ? 28   TRP A N   1 
ATOM   118   C  CA  . TRP A  1  28  ? 10.047   17.913   252.946 1.00 127.41 ? 28   TRP A CA  1 
ATOM   119   C  C   . TRP A  1  28  ? 8.628    17.894   253.498 1.00 128.23 ? 28   TRP A C   1 
ATOM   120   O  O   . TRP A  1  28  ? 7.828    17.023   253.154 1.00 127.04 ? 28   TRP A O   1 
ATOM   121   C  CB  . TRP A  1  28  ? 10.972   17.096   253.854 1.00 129.01 ? 28   TRP A CB  1 
ATOM   122   C  CG  . TRP A  1  28  ? 12.342   16.862   253.286 1.00 128.14 ? 28   TRP A CG  1 
ATOM   123   C  CD1 . TRP A  1  28  ? 13.178   17.797   252.755 1.00 127.78 ? 28   TRP A CD1 1 
ATOM   124   C  CD2 . TRP A  1  28  ? 13.042   15.612   253.211 1.00 127.67 ? 28   TRP A CD2 1 
ATOM   125   N  NE1 . TRP A  1  28  ? 14.348   17.209   252.341 1.00 127.09 ? 28   TRP A NE1 1 
ATOM   126   C  CE2 . TRP A  1  28  ? 14.291   15.868   252.613 1.00 127.01 ? 28   TRP A CE2 1 
ATOM   127   C  CE3 . TRP A  1  28  ? 12.732   14.302   253.589 1.00 127.84 ? 28   TRP A CE3 1 
ATOM   128   C  CZ2 . TRP A  1  28  ? 15.230   14.865   252.384 1.00 126.52 ? 28   TRP A CZ2 1 
ATOM   129   C  CZ3 . TRP A  1  28  ? 13.666   13.306   253.360 1.00 127.34 ? 28   TRP A CZ3 1 
ATOM   130   C  CH2 . TRP A  1  28  ? 14.900   13.594   252.764 1.00 126.69 ? 28   TRP A CH2 1 
ATOM   131   N  N   . GLY A  1  29  ? 8.323    18.869   254.349 1.00 165.54 ? 29   GLY A N   1 
ATOM   132   C  CA  . GLY A  1  29  ? 7.019    18.966   254.979 1.00 166.70 ? 29   GLY A CA  1 
ATOM   133   C  C   . GLY A  1  29  ? 6.062    19.859   254.211 1.00 166.89 ? 29   GLY A C   1 
ATOM   134   O  O   . GLY A  1  29  ? 4.985    20.192   254.705 1.00 169.95 ? 29   GLY A O   1 
ATOM   135   N  N   . LYS A  1  30  ? 6.460    20.246   253.003 1.00 149.90 ? 30   LYS A N   1 
ATOM   136   C  CA  . LYS A  1  30  ? 5.614    21.037   252.116 1.00 148.60 ? 30   LYS A CA  1 
ATOM   137   C  C   . LYS A  1  30  ? 5.522    20.338   250.765 1.00 145.66 ? 30   LYS A C   1 
ATOM   138   O  O   . LYS A  1  30  ? 6.168    20.751   249.805 1.00 144.21 ? 30   LYS A O   1 
ATOM   139   C  CB  . LYS A  1  30  ? 6.162    22.457   251.953 1.00 149.22 ? 30   LYS A CB  1 
ATOM   140   C  CG  . LYS A  1  30  ? 5.946    23.342   253.171 1.00 152.11 ? 30   LYS A CG  1 
ATOM   141   C  CD  . LYS A  1  30  ? 6.445    24.759   252.931 1.00 152.69 ? 30   LYS A CD  1 
ATOM   142   C  CE  . LYS A  1  30  ? 6.269    25.626   254.168 1.00 155.73 ? 30   LYS A CE  1 
ATOM   143   N  NZ  . LYS A  1  30  ? 7.169    25.206   255.277 1.00 157.71 ? 30   LYS A NZ  1 
ATOM   144   N  N   . PRO A  1  31  ? 4.716    19.265   250.691 1.00 123.22 ? 31   PRO A N   1 
ATOM   145   C  CA  . PRO A  1  31  ? 4.604    18.479   249.458 1.00 120.56 ? 31   PRO A CA  1 
ATOM   146   C  C   . PRO A  1  31  ? 3.999    19.283   248.313 1.00 118.96 ? 31   PRO A C   1 
ATOM   147   O  O   . PRO A  1  31  ? 3.118    20.111   248.542 1.00 119.82 ? 31   PRO A O   1 
ATOM   148   C  CB  . PRO A  1  31  ? 3.675    17.322   249.854 1.00 120.69 ? 31   PRO A CB  1 
ATOM   149   C  CG  . PRO A  1  31  ? 3.613    17.340   251.347 1.00 123.45 ? 31   PRO A CG  1 
ATOM   150   C  CD  . PRO A  1  31  ? 3.829    18.754   251.748 1.00 124.90 ? 31   PRO A CD  1 
ATOM   151   N  N   . GLY A  1  32  ? 4.473    19.042   247.095 1.00 177.27 ? 32   GLY A N   1 
ATOM   152   C  CA  . GLY A  1  32  ? 3.967    19.742   245.930 1.00 176.12 ? 32   GLY A CA  1 
ATOM   153   C  C   . GLY A  1  32  ? 4.517    21.150   245.823 1.00 195.53 ? 32   GLY A C   1 
ATOM   154   O  O   . GLY A  1  32  ? 3.929    22.008   245.165 1.00 218.42 ? 32   GLY A O   1 
ATOM   155   N  N   . HIS A  1  33  ? 5.651    21.388   246.471 1.00 154.34 ? 33   HIS A N   1 
ATOM   156   C  CA  . HIS A  1  33  ? 6.295    22.695   246.442 1.00 151.18 ? 33   HIS A CA  1 
ATOM   157   C  C   . HIS A  1  33  ? 6.934    22.952   245.083 1.00 157.60 ? 33   HIS A C   1 
ATOM   158   O  O   . HIS A  1  33  ? 7.001    24.091   244.621 1.00 178.59 ? 33   HIS A O   1 
ATOM   159   C  CB  . HIS A  1  33  ? 7.355    22.792   247.537 1.00 153.18 ? 33   HIS A CB  1 
ATOM   160   C  CG  . HIS A  1  33  ? 8.456    21.788   247.393 1.00 152.43 ? 33   HIS A CG  1 
ATOM   161   N  ND1 . HIS A  1  33  ? 9.603    22.042   246.673 1.00 151.74 ? 33   HIS A ND1 1 
ATOM   162   C  CD2 . HIS A  1  33  ? 8.583    20.527   247.870 1.00 152.48 ? 33   HIS A CD2 1 
ATOM   163   C  CE1 . HIS A  1  33  ? 10.390   20.982   246.714 1.00 151.18 ? 33   HIS A CE1 1 
ATOM   164   N  NE2 . HIS A  1  33  ? 9.795    20.049   247.435 1.00 151.69 ? 33   HIS A NE2 1 
ATOM   165   N  N   . PHE A  1  34  ? 7.399    21.879   244.451 1.00 114.47 ? 34   PHE A N   1 
ATOM   166   C  CA  . PHE A  1  34  ? 8.116    21.974   243.182 1.00 112.72 ? 34   PHE A CA  1 
ATOM   167   C  C   . PHE A  1  34  ? 7.243    22.488   242.029 1.00 111.26 ? 34   PHE A C   1 
ATOM   168   O  O   . PHE A  1  34  ? 7.758    22.794   240.954 1.00 110.05 ? 34   PHE A O   1 
ATOM   169   C  CB  . PHE A  1  34  ? 8.725    20.612   242.819 1.00 111.42 ? 34   PHE A CB  1 
ATOM   170   C  CG  . PHE A  1  34  ? 7.767    19.459   242.933 1.00 110.75 ? 34   PHE A CG  1 
ATOM   171   C  CD1 . PHE A  1  34  ? 6.815    19.227   241.955 1.00 109.07 ? 34   PHE A CD1 1 
ATOM   172   C  CD2 . PHE A  1  34  ? 7.826    18.600   244.020 1.00 111.92 ? 34   PHE A CD2 1 
ATOM   173   C  CE1 . PHE A  1  34  ? 5.937    18.165   242.062 1.00 108.55 ? 34   PHE A CE1 1 
ATOM   174   C  CE2 . PHE A  1  34  ? 6.951    17.537   244.131 1.00 111.42 ? 34   PHE A CE2 1 
ATOM   175   C  CZ  . PHE A  1  34  ? 6.006    17.319   243.151 1.00 109.73 ? 34   PHE A CZ  1 
ATOM   176   N  N   . ASP A  1  35  ? 5.934    22.580   242.254 1.00 150.10 ? 35   ASP A N   1 
ATOM   177   C  CA  . ASP A  1  35  ? 5.001    23.094   241.247 1.00 159.10 ? 35   ASP A CA  1 
ATOM   178   C  C   . ASP A  1  35  ? 4.106    24.186   241.828 1.00 162.88 ? 35   ASP A C   1 
ATOM   179   O  O   . ASP A  1  35  ? 3.569    24.042   242.926 1.00 171.59 ? 35   ASP A O   1 
ATOM   180   C  CB  . ASP A  1  35  ? 4.139    21.964   240.684 1.00 155.71 ? 35   ASP A CB  1 
ATOM   181   C  CG  . ASP A  1  35  ? 3.569    22.292   239.316 1.00 157.00 ? 35   ASP A CG  1 
ATOM   182   O  OD1 . ASP A  1  35  ? 3.196    23.463   239.088 1.00 150.79 ? 35   ASP A OD1 1 
ATOM   183   O  OD2 . ASP A  1  35  ? 3.492    21.378   238.468 1.00 165.21 ? 35   ASP A OD2 1 
ATOM   184   N  N   . ARG A  1  36  ? 3.948    25.275   241.081 1.00 165.62 ? 36   ARG A N   1 
ATOM   185   C  CA  . ARG A  1  36  ? 3.217    26.442   241.565 1.00 170.40 ? 36   ARG A CA  1 
ATOM   186   C  C   . ARG A  1  36  ? 1.728    26.156   241.729 1.00 173.94 ? 36   ARG A C   1 
ATOM   187   O  O   . ARG A  1  36  ? 1.039    26.835   242.490 1.00 190.14 ? 36   ARG A O   1 
ATOM   188   C  CB  . ARG A  1  36  ? 3.405    27.621   240.607 1.00 182.67 ? 36   ARG A CB  1 
ATOM   189   C  CG  . ARG A  1  36  ? 4.825    28.148   240.545 1.00 193.98 ? 36   ARG A CG  1 
ATOM   190   C  CD  . ARG A  1  36  ? 4.977    29.231   239.490 1.00 200.73 ? 36   ARG A CD  1 
ATOM   191   N  NE  . ARG A  1  36  ? 6.378    29.433   239.138 1.00 205.22 ? 36   ARG A NE  1 
ATOM   192   C  CZ  . ARG A  1  36  ? 7.067    28.642   238.321 1.00 201.41 ? 36   ARG A CZ  1 
ATOM   193   N  NH1 . ARG A  1  36  ? 6.488    27.587   237.762 1.00 192.58 ? 36   ARG A NH1 1 
ATOM   194   N  NH2 . ARG A  1  36  ? 8.341    28.904   238.064 1.00 204.94 ? 36   ARG A NH2 1 
ATOM   195   N  N   . THR A  1  37  ? 1.237    25.146   241.019 1.00 138.38 ? 37   THR A N   1 
ATOM   196   C  CA  . THR A  1  37  ? -0.173   24.777   241.088 1.00 138.30 ? 37   THR A CA  1 
ATOM   197   C  C   . THR A  1  37  ? -0.492   24.008   242.364 1.00 139.57 ? 37   THR A C   1 
ATOM   198   O  O   . THR A  1  37  ? -1.545   24.199   242.971 1.00 140.74 ? 37   THR A O   1 
ATOM   199   C  CB  . THR A  1  37  ? -0.584   23.921   239.878 1.00 136.04 ? 37   THR A CB  1 
ATOM   200   O  OG1 . THR A  1  37  ? 0.299    22.797   239.763 1.00 140.40 ? 37   THR A OG1 1 
ATOM   201   C  CG2 . THR A  1  37  ? -0.524   24.742   238.599 1.00 134.99 ? 37   THR A CG2 1 
ATOM   202   N  N   . LEU A  1  38  ? 0.431    23.141   242.762 1.00 112.61 ? 38   LEU A N   1 
ATOM   203   C  CA  . LEU A  1  38  ? 0.235    22.262   243.908 1.00 113.73 ? 38   LEU A CA  1 
ATOM   204   C  C   . LEU A  1  38  ? 0.728    22.907   245.200 1.00 116.14 ? 38   LEU A C   1 
ATOM   205   O  O   . LEU A  1  38  ? 0.330    22.508   246.295 1.00 117.67 ? 38   LEU A O   1 
ATOM   206   C  CB  . LEU A  1  38  ? 0.966    20.938   243.678 1.00 112.47 ? 38   LEU A CB  1 
ATOM   207   C  CG  . LEU A  1  38  ? 0.784    20.327   242.287 1.00 110.03 ? 38   LEU A CG  1 
ATOM   208   C  CD1 . LEU A  1  38  ? 1.655    19.094   242.135 1.00 109.05 ? 38   LEU A CD1 1 
ATOM   209   C  CD2 . LEU A  1  38  ? -0.677   19.993   242.025 1.00 109.59 ? 38   LEU A CD2 1 
ATOM   210   N  N   . ALA A  1  39  ? 1.593    23.907   245.059 1.00 142.27 ? 39   ALA A N   1 
ATOM   211   C  CA  . ALA A  1  39  ? 2.288    24.503   246.195 1.00 144.49 ? 39   ALA A CA  1 
ATOM   212   C  C   . ALA A  1  39  ? 1.334    25.114   247.216 1.00 146.68 ? 39   ALA A C   1 
ATOM   213   O  O   . ALA A  1  39  ? 1.623    25.121   248.413 1.00 148.70 ? 39   ALA A O   1 
ATOM   214   C  CB  . ALA A  1  39  ? 3.267    25.562   245.705 1.00 144.50 ? 39   ALA A CB  1 
ATOM   215   N  N   . ARG A  1  40  ? 0.199    25.622   246.748 1.00 221.61 ? 40   ARG A N   1 
ATOM   216   C  CA  . ARG A  1  40  ? -0.723   26.336   247.624 1.00 221.42 ? 40   ARG A CA  1 
ATOM   217   C  C   . ARG A  1  40  ? -1.546   25.381   248.491 1.00 216.73 ? 40   ARG A C   1 
ATOM   218   O  O   . ARG A  1  40  ? -1.866   25.708   249.634 1.00 223.53 ? 40   ARG A O   1 
ATOM   219   C  CB  . ARG A  1  40  ? -1.646   27.245   246.804 1.00 216.15 ? 40   ARG A CB  1 
ATOM   220   C  CG  . ARG A  1  40  ? -2.442   26.544   245.715 1.00 211.93 ? 40   ARG A CG  1 
ATOM   221   C  CD  . ARG A  1  40  ? -3.179   27.544   244.835 1.00 222.93 ? 40   ARG A CD  1 
ATOM   222   N  NE  . ARG A  1  40  ? -4.183   28.308   245.575 1.00 235.02 ? 40   ARG A NE  1 
ATOM   223   C  CZ  . ARG A  1  40  ? -3.972   29.490   246.148 1.00 224.08 ? 40   ARG A CZ  1 
ATOM   224   N  NH1 . ARG A  1  40  ? -2.783   30.077   246.082 1.00 226.92 ? 40   ARG A NH1 1 
ATOM   225   N  NH2 . ARG A  1  40  ? -4.960   30.093   246.796 1.00 202.81 ? 40   ARG A NH2 1 
ATOM   226   N  N   . GLY A  1  41  ? -1.882   24.209   247.958 1.00 180.76 ? 41   GLY A N   1 
ATOM   227   C  CA  . GLY A  1  41  ? -2.528   23.177   248.754 1.00 181.52 ? 41   GLY A CA  1 
ATOM   228   C  C   . GLY A  1  41  ? -3.477   22.268   247.990 1.00 191.04 ? 41   GLY A C   1 
ATOM   229   O  O   . GLY A  1  41  ? -3.817   22.547   246.840 1.00 200.02 ? 41   GLY A O   1 
ATOM   230   N  N   . PRO A  1  42  ? -3.914   21.169   248.633 1.00 137.68 ? 42   PRO A N   1 
ATOM   231   C  CA  . PRO A  1  42  ? -4.905   20.247   248.066 1.00 136.38 ? 42   PRO A CA  1 
ATOM   232   C  C   . PRO A  1  42  ? -6.350   20.647   248.351 1.00 137.53 ? 42   PRO A C   1 
ATOM   233   O  O   . PRO A  1  42  ? -6.694   20.928   249.500 1.00 139.85 ? 42   PRO A O   1 
ATOM   234   C  CB  . PRO A  1  42  ? -4.582   18.925   248.762 1.00 136.78 ? 42   PRO A CB  1 
ATOM   235   C  CG  . PRO A  1  42  ? -4.058   19.329   250.089 1.00 139.26 ? 42   PRO A CG  1 
ATOM   236   C  CD  . PRO A  1  42  ? -3.326   20.634   249.875 1.00 139.44 ? 42   PRO A CD  1 
ATOM   237   N  N   . LYS A  1  43  ? -7.176   20.669   247.309 1.00 174.20 ? 43   LYS A N   1 
ATOM   238   C  CA  . LYS A  1  43  ? -8.609   20.904   247.456 1.00 182.01 ? 43   LYS A CA  1 
ATOM   239   C  C   . LYS A  1  43  ? -9.389   19.665   247.027 1.00 182.49 ? 43   LYS A C   1 
ATOM   240   O  O   . LYS A  1  43  ? -10.530  19.465   247.444 1.00 190.84 ? 43   LYS A O   1 
ATOM   241   C  CB  . LYS A  1  43  ? -9.045   22.119   246.634 1.00 194.34 ? 43   LYS A CB  1 
ATOM   242   C  CG  . LYS A  1  43  ? -8.323   23.415   246.995 1.00 193.93 ? 43   LYS A CG  1 
ATOM   243   C  CD  . LYS A  1  43  ? -8.590   23.863   248.431 1.00 190.34 ? 43   LYS A CD  1 
ATOM   244   C  CE  . LYS A  1  43  ? -10.024  24.331   248.630 1.00 191.82 ? 43   LYS A CE  1 
ATOM   245   N  NZ  . LYS A  1  43  ? -10.290  24.698   250.048 1.00 200.30 ? 43   LYS A NZ  1 
ATOM   246   N  N   . THR A  1  44  ? -8.765   18.839   246.191 1.00 147.49 ? 44   THR A N   1 
ATOM   247   C  CA  . THR A  1  44  ? -9.363   17.585   245.745 1.00 146.33 ? 44   THR A CA  1 
ATOM   248   C  C   . THR A  1  44  ? -8.319   16.475   245.756 1.00 145.42 ? 44   THR A C   1 
ATOM   249   O  O   . THR A  1  44  ? -7.126   16.735   245.908 1.00 145.38 ? 44   THR A O   1 
ATOM   250   C  CB  . THR A  1  44  ? -9.961   17.703   244.331 1.00 146.45 ? 44   THR A CB  1 
ATOM   251   O  OG1 . THR A  1  44  ? -8.923   17.998   243.388 1.00 146.06 ? 44   THR A OG1 1 
ATOM   252   C  CG2 . THR A  1  44  ? -11.024  18.795   244.282 1.00 151.22 ? 44   THR A CG2 1 
ATOM   253   N  N   . THR A  1  45  ? -8.774   15.239   245.594 1.00 122.36 ? 45   THR A N   1 
ATOM   254   C  CA  . THR A  1  45  ? -7.885   14.085   245.640 1.00 121.66 ? 45   THR A CA  1 
ATOM   255   C  C   . THR A  1  45  ? -6.960   14.042   244.429 1.00 119.37 ? 45   THR A C   1 
ATOM   256   O  O   . THR A  1  45  ? -5.913   13.395   244.458 1.00 118.87 ? 45   THR A O   1 
ATOM   257   C  CB  . THR A  1  45  ? -8.683   12.774   245.692 1.00 121.59 ? 45   THR A CB  1 
ATOM   258   O  OG1 . THR A  1  45  ? -9.478   12.646   244.506 1.00 119.92 ? 45   THR A OG1 1 
ATOM   259   C  CG2 . THR A  1  45  ? -9.583   12.748   246.919 1.00 124.01 ? 45   THR A CG2 1 
ATOM   260   N  N   . THR A  1  46  ? -7.356   14.732   243.364 1.00 110.47 ? 46   THR A N   1 
ATOM   261   C  CA  . THR A  1  46  ? -6.558   14.800   242.146 1.00 108.40 ? 46   THR A CA  1 
ATOM   262   C  C   . THR A  1  46  ? -5.194   15.428   242.420 1.00 108.68 ? 46   THR A C   1 
ATOM   263   O  O   . THR A  1  46  ? -4.219   15.141   241.726 1.00 107.30 ? 46   THR A O   1 
ATOM   264   C  CB  . THR A  1  46  ? -7.288   15.596   241.050 1.00 107.36 ? 46   THR A CB  1 
ATOM   265   O  OG1 . THR A  1  46  ? -8.648   15.152   240.964 1.00 107.51 ? 46   THR A OG1 1 
ATOM   266   C  CG2 . THR A  1  46  ? -6.608   15.403   239.701 1.00 105.17 ? 46   THR A CG2 1 
ATOM   267   N  N   . TRP A  1  47  ? -5.138   16.291   243.429 1.00 110.58 ? 47   TRP A N   1 
ATOM   268   C  CA  . TRP A  1  47  ? -3.891   16.934   243.833 1.00 111.20 ? 47   TRP A CA  1 
ATOM   269   C  C   . TRP A  1  47  ? -2.840   15.899   244.220 1.00 111.12 ? 47   TRP A C   1 
ATOM   270   O  O   . TRP A  1  47  ? -1.658   16.046   243.903 1.00 110.49 ? 47   TRP A O   1 
ATOM   271   C  CB  . TRP A  1  47  ? -4.146   17.886   245.004 1.00 113.58 ? 47   TRP A CB  1 
ATOM   272   C  CG  . TRP A  1  47  ? -2.916   18.572   245.521 1.00 114.51 ? 47   TRP A CG  1 
ATOM   273   C  CD1 . TRP A  1  47  ? -2.462   19.811   245.177 1.00 114.55 ? 47   TRP A CD1 1 
ATOM   274   C  CD2 . TRP A  1  47  ? -1.988   18.060   246.487 1.00 115.66 ? 47   TRP A CD2 1 
ATOM   275   N  NE1 . TRP A  1  47  ? -1.310   20.102   245.866 1.00 115.65 ? 47   TRP A NE1 1 
ATOM   276   C  CE2 . TRP A  1  47  ? -0.997   19.043   246.676 1.00 116.34 ? 47   TRP A CE2 1 
ATOM   277   C  CE3 . TRP A  1  47  ? -1.900   16.866   247.210 1.00 116.28 ? 47   TRP A CE3 1 
ATOM   278   C  CZ2 . TRP A  1  47  ? 0.069    18.868   247.556 1.00 117.60 ? 47   TRP A CZ2 1 
ATOM   279   C  CZ3 . TRP A  1  47  ? -0.841   16.694   248.082 1.00 117.54 ? 47   TRP A CZ3 1 
ATOM   280   C  CH2 . TRP A  1  47  ? 0.129    17.690   248.248 1.00 118.19 ? 47   TRP A CH2 1 
ATOM   281   N  N   . ILE A  1  48  ? -3.284   14.852   244.907 1.00 111.86 ? 48   ILE A N   1 
ATOM   282   C  CA  . ILE A  1  48  ? -2.395   13.799   245.390 1.00 112.08 ? 48   ILE A CA  1 
ATOM   283   C  C   . ILE A  1  48  ? -1.714   13.064   244.244 1.00 109.87 ? 48   ILE A C   1 
ATOM   284   O  O   . ILE A  1  48  ? -0.498   12.875   244.254 1.00 109.67 ? 48   ILE A O   1 
ATOM   285   C  CB  . ILE A  1  48  ? -3.166   12.780   246.251 1.00 113.30 ? 48   ILE A CB  1 
ATOM   286   C  CG1 . ILE A  1  48  ? -3.738   13.468   247.492 1.00 115.76 ? 48   ILE A CG1 1 
ATOM   287   C  CG2 . ILE A  1  48  ? -2.266   11.611   246.658 1.00 113.47 ? 48   ILE A CG2 1 
ATOM   288   C  CD1 . ILE A  1  48  ? -4.878   12.719   248.124 1.00 116.90 ? 48   ILE A CD1 1 
ATOM   289   N  N   . TRP A  1  49  ? -2.502   12.647   243.260 1.00 108.33 ? 49   TRP A N   1 
ATOM   290   C  CA  . TRP A  1  49  ? -1.969   11.909   242.124 1.00 106.30 ? 49   TRP A CA  1 
ATOM   291   C  C   . TRP A  1  49  ? -1.022   12.799   241.331 1.00 105.29 ? 49   TRP A C   1 
ATOM   292   O  O   . TRP A  1  49  ? 0.027    12.352   240.866 1.00 104.37 ? 49   TRP A O   1 
ATOM   293   C  CB  . TRP A  1  49  ? -3.101   11.407   241.226 1.00 105.03 ? 49   TRP A CB  1 
ATOM   294   C  CG  . TRP A  1  49  ? -4.159   10.653   241.968 1.00 106.14 ? 49   TRP A CG  1 
ATOM   295   C  CD1 . TRP A  1  49  ? -5.461   11.023   242.136 1.00 106.80 ? 49   TRP A CD1 1 
ATOM   296   C  CD2 . TRP A  1  49  ? -4.005   9.404    242.651 1.00 106.85 ? 49   TRP A CD2 1 
ATOM   297   N  NE1 . TRP A  1  49  ? -6.129   10.079   242.877 1.00 107.88 ? 49   TRP A NE1 1 
ATOM   298   C  CE2 . TRP A  1  49  ? -5.258   9.074    243.205 1.00 107.93 ? 49   TRP A CE2 1 
ATOM   299   C  CE3 . TRP A  1  49  ? -2.932   8.530    242.844 1.00 106.76 ? 49   TRP A CE3 1 
ATOM   300   C  CZ2 . TRP A  1  49  ? -5.465   7.909    243.940 1.00 108.94 ? 49   TRP A CZ2 1 
ATOM   301   C  CZ3 . TRP A  1  49  ? -3.140   7.374    243.574 1.00 107.76 ? 49   TRP A CZ3 1 
ATOM   302   C  CH2 . TRP A  1  49  ? -4.396   7.075    244.113 1.00 108.84 ? 49   TRP A CH2 1 
ATOM   303   N  N   . ASN A  1  50  ? -1.404   14.064   241.189 1.00 105.59 ? 50   ASN A N   1 
ATOM   304   C  CA  . ASN A  1  50  ? -0.617   15.033   240.440 1.00 104.82 ? 50   ASN A CA  1 
ATOM   305   C  C   . ASN A  1  50  ? 0.729    15.318   241.095 1.00 105.74 ? 50   ASN A C   1 
ATOM   306   O  O   . ASN A  1  50  ? 1.701    15.638   240.412 1.00 104.87 ? 50   ASN A O   1 
ATOM   307   C  CB  . ASN A  1  50  ? -1.404   16.331   240.272 1.00 105.25 ? 50   ASN A CB  1 
ATOM   308   C  CG  . ASN A  1  50  ? -2.602   16.168   239.357 1.00 104.11 ? 50   ASN A CG  1 
ATOM   309   O  OD1 . ASN A  1  50  ? -2.935   15.057   238.946 1.00 103.13 ? 50   ASN A OD1 1 
ATOM   310   N  ND2 . ASN A  1  50  ? -3.259   17.275   239.037 1.00 104.34 ? 50   ASN A ND2 1 
ATOM   311   N  N   . LEU A  1  51  ? 0.781    15.214   242.419 1.00 107.61 ? 51   LEU A N   1 
ATOM   312   C  CA  . LEU A  1  51  ? 2.034    15.401   243.141 1.00 108.71 ? 51   LEU A CA  1 
ATOM   313   C  C   . LEU A  1  51  ? 3.056    14.343   242.739 1.00 107.67 ? 51   LEU A C   1 
ATOM   314   O  O   . LEU A  1  51  ? 4.255    14.615   242.681 1.00 107.71 ? 51   LEU A O   1 
ATOM   315   C  CB  . LEU A  1  51  ? 1.798    15.350   244.654 1.00 111.04 ? 51   LEU A CB  1 
ATOM   316   C  CG  . LEU A  1  51  ? 3.056    15.429   245.524 1.00 112.43 ? 51   LEU A CG  1 
ATOM   317   C  CD1 . LEU A  1  51  ? 2.794    16.272   246.757 1.00 114.82 ? 51   LEU A CD1 1 
ATOM   318   C  CD2 . LEU A  1  51  ? 3.530    14.038   245.932 1.00 112.56 ? 51   LEU A CD2 1 
ATOM   319   N  N   . HIS A  1  52  ? 2.574    13.135   242.463 1.00 106.82 ? 52   HIS A N   1 
ATOM   320   C  CA  . HIS A  1  52  ? 3.448    12.016   242.131 1.00 105.97 ? 52   HIS A CA  1 
ATOM   321   C  C   . HIS A  1  52  ? 3.853    11.991   240.659 1.00 103.86 ? 52   HIS A C   1 
ATOM   322   O  O   . HIS A  1  52  ? 5.010    11.732   240.333 1.00 103.38 ? 52   HIS A O   1 
ATOM   323   C  CB  . HIS A  1  52  ? 2.768    10.698   242.500 1.00 106.15 ? 52   HIS A CB  1 
ATOM   324   C  CG  . HIS A  1  52  ? 2.549    10.526   243.969 1.00 108.36 ? 52   HIS A CG  1 
ATOM   325   N  ND1 . HIS A  1  52  ? 1.621    11.262   244.675 1.00 109.69 ? 52   HIS A ND1 1 
ATOM   326   C  CD2 . HIS A  1  52  ? 3.146    9.711    244.870 1.00 109.60 ? 52   HIS A CD2 1 
ATOM   327   C  CE1 . HIS A  1  52  ? 1.651    10.902   245.945 1.00 111.66 ? 52   HIS A CE1 1 
ATOM   328   N  NE2 . HIS A  1  52  ? 2.568    9.963    246.089 1.00 111.65 ? 52   HIS A NE2 1 
ATOM   329   N  N   . ALA A  1  53  ? 2.900    12.266   239.774 1.00 110.29 ? 53   ALA A N   1 
ATOM   330   C  CA  . ALA A  1  53  ? 3.135    12.161   238.335 1.00 108.34 ? 53   ALA A CA  1 
ATOM   331   C  C   . ALA A  1  53  ? 3.886    13.367   237.761 1.00 108.04 ? 53   ALA A C   1 
ATOM   332   O  O   . ALA A  1  53  ? 4.202    13.396   236.571 1.00 106.59 ? 53   ALA A O   1 
ATOM   333   C  CB  . ALA A  1  53  ? 1.813    11.978   237.608 1.00 107.36 ? 53   ALA A CB  1 
ATOM   334   N  N   . ASN A  1  54  ? 4.153    14.360   238.604 1.00 108.47 ? 54   ASN A N   1 
ATOM   335   C  CA  . ASN A  1  54  ? 4.906    15.547   238.198 1.00 108.49 ? 54   ASN A CA  1 
ATOM   336   C  C   . ASN A  1  54  ? 6.215    15.665   238.971 1.00 109.66 ? 54   ASN A C   1 
ATOM   337   O  O   . ASN A  1  54  ? 6.917    16.672   238.867 1.00 110.07 ? 54   ASN A O   1 
ATOM   338   C  CB  . ASN A  1  54  ? 4.070    16.812   238.407 1.00 109.29 ? 54   ASN A CB  1 
ATOM   339   C  CG  . ASN A  1  54  ? 2.894    16.901   237.456 1.00 108.11 ? 54   ASN A CG  1 
ATOM   340   O  OD1 . ASN A  1  54  ? 2.499    15.911   236.841 1.00 106.87 ? 54   ASN A OD1 1 
ATOM   341   N  ND2 . ASN A  1  54  ? 2.327    18.096   237.331 1.00 108.57 ? 54   ASN A ND2 1 
ATOM   342   N  N   . ALA A  1  55  ? 6.545    14.629   239.737 1.00 103.73 ? 55   ALA A N   1 
ATOM   343   C  CA  . ALA A  1  55  ? 7.687    14.676   240.643 1.00 105.14 ? 55   ALA A CA  1 
ATOM   344   C  C   . ALA A  1  55  ? 9.014    14.750   239.893 1.00 104.38 ? 55   ALA A C   1 
ATOM   345   O  O   . ALA A  1  55  ? 9.894    15.529   240.260 1.00 105.39 ? 55   ALA A O   1 
ATOM   346   C  CB  . ALA A  1  55  ? 7.671    13.462   241.560 1.00 105.97 ? 55   ALA A CB  1 
ATOM   347   N  N   . HIS A  1  56  ? 9.151    13.944   238.845 1.00 108.19 ? 56   HIS A N   1 
ATOM   348   C  CA  . HIS A  1  56  ? 10.400   13.870   238.092 1.00 107.48 ? 56   HIS A CA  1 
ATOM   349   C  C   . HIS A  1  56  ? 10.359   14.706   236.820 1.00 106.23 ? 56   HIS A C   1 
ATOM   350   O  O   . HIS A  1  56  ? 11.355   14.807   236.108 1.00 105.69 ? 56   HIS A O   1 
ATOM   351   C  CB  . HIS A  1  56  ? 10.720   12.417   237.744 1.00 106.61 ? 56   HIS A CB  1 
ATOM   352   C  CG  . HIS A  1  56  ? 11.132   11.596   238.923 1.00 107.97 ? 56   HIS A CG  1 
ATOM   353   N  ND1 . HIS A  1  56  ? 10.937   10.234   238.991 1.00 107.65 ? 56   HIS A ND1 1 
ATOM   354   C  CD2 . HIS A  1  56  ? 11.719   11.951   240.090 1.00 109.80 ? 56   HIS A CD2 1 
ATOM   355   C  CE1 . HIS A  1  56  ? 11.397   9.783    240.144 1.00 109.21 ? 56   HIS A CE1 1 
ATOM   356   N  NE2 . HIS A  1  56  ? 11.880   10.804   240.827 1.00 110.54 ? 56   HIS A NE2 1 
ATOM   357   N  N   . ASP A  1  57  ? 9.211    15.312   236.542 1.00 125.85 ? 57   ASP A N   1 
ATOM   358   C  CA  . ASP A  1  57  ? 9.062    16.140   235.355 1.00 124.81 ? 57   ASP A CA  1 
ATOM   359   C  C   . ASP A  1  57  ? 9.734    17.490   235.602 1.00 125.91 ? 57   ASP A C   1 
ATOM   360   O  O   . ASP A  1  57  ? 9.064    18.509   235.759 1.00 133.37 ? 57   ASP A O   1 
ATOM   361   C  CB  . ASP A  1  57  ? 7.578    16.312   235.012 1.00 124.23 ? 57   ASP A CB  1 
ATOM   362   C  CG  . ASP A  1  57  ? 7.356    16.843   233.608 1.00 133.17 ? 57   ASP A CG  1 
ATOM   363   O  OD1 . ASP A  1  57  ? 8.328    17.308   232.977 1.00 143.79 ? 57   ASP A OD1 1 
ATOM   364   O  OD2 . ASP A  1  57  ? 6.201    16.789   233.133 1.00 136.15 ? 57   ASP A OD2 1 
ATOM   365   N  N   . PHE A  1  58  ? 11.065   17.488   235.631 1.00 107.60 ? 58   PHE A N   1 
ATOM   366   C  CA  . PHE A  1  58  ? 11.833   18.685   235.972 1.00 108.86 ? 58   PHE A CA  1 
ATOM   367   C  C   . PHE A  1  58  ? 11.672   19.818   234.961 1.00 108.34 ? 58   PHE A C   1 
ATOM   368   O  O   . PHE A  1  58  ? 11.915   20.978   235.290 1.00 109.50 ? 58   PHE A O   1 
ATOM   369   C  CB  . PHE A  1  58  ? 13.323   18.343   236.121 1.00 109.31 ? 58   PHE A CB  1 
ATOM   370   C  CG  . PHE A  1  58  ? 13.631   17.413   237.269 1.00 110.28 ? 58   PHE A CG  1 
ATOM   371   C  CD1 . PHE A  1  58  ? 12.831   17.379   238.399 1.00 111.39 ? 58   PHE A CD1 1 
ATOM   372   C  CD2 . PHE A  1  58  ? 14.743   16.589   237.223 1.00 110.23 ? 58   PHE A CD2 1 
ATOM   373   C  CE1 . PHE A  1  58  ? 13.124   16.527   239.449 1.00 112.42 ? 58   PHE A CE1 1 
ATOM   374   C  CE2 . PHE A  1  58  ? 15.039   15.734   238.266 1.00 111.23 ? 58   PHE A CE2 1 
ATOM   375   C  CZ  . PHE A  1  58  ? 14.232   15.706   239.382 1.00 112.34 ? 58   PHE A CZ  1 
ATOM   376   N  N   . ASP A  1  59  ? 11.271   19.491   233.737 1.00 108.03 ? 59   ASP A N   1 
ATOM   377   C  CA  . ASP A  1  59  ? 11.050   20.520   232.725 1.00 107.58 ? 59   ASP A CA  1 
ATOM   378   C  C   . ASP A  1  59  ? 9.894    21.428   233.126 1.00 108.28 ? 59   ASP A C   1 
ATOM   379   O  O   . ASP A  1  59  ? 9.984    22.650   233.018 1.00 109.04 ? 59   ASP A O   1 
ATOM   380   C  CB  . ASP A  1  59  ? 10.763   19.894   231.360 1.00 105.79 ? 59   ASP A CB  1 
ATOM   381   C  CG  . ASP A  1  59  ? 11.730   18.780   231.015 1.00 105.07 ? 59   ASP A CG  1 
ATOM   382   O  OD1 . ASP A  1  59  ? 12.059   17.980   231.916 1.00 105.57 ? 59   ASP A OD1 1 
ATOM   383   O  OD2 . ASP A  1  59  ? 12.164   18.707   229.846 1.00 104.12 ? 59   ASP A OD2 1 
ATOM   384   N  N   . SER A  1  60  ? 8.811    20.818   233.598 1.00 144.11 ? 60   SER A N   1 
ATOM   385   C  CA  . SER A  1  60  ? 7.609    21.556   233.964 1.00 147.74 ? 60   SER A CA  1 
ATOM   386   C  C   . SER A  1  60  ? 7.782    22.304   235.285 1.00 157.30 ? 60   SER A C   1 
ATOM   387   O  O   . SER A  1  60  ? 6.937    23.117   235.657 1.00 167.82 ? 60   SER A O   1 
ATOM   388   C  CB  . SER A  1  60  ? 6.412    20.607   234.055 1.00 136.63 ? 60   SER A CB  1 
ATOM   389   O  OG  . SER A  1  60  ? 6.489    19.799   235.217 1.00 134.91 ? 60   SER A OG  1 
ATOM   390   N  N   . GLN A  1  61  ? 8.877    22.029   235.989 1.00 103.46 ? 61   GLN A N   1 
ATOM   391   C  CA  . GLN A  1  61  ? 9.138    22.662   237.277 1.00 105.47 ? 61   GLN A CA  1 
ATOM   392   C  C   . GLN A  1  61  ? 9.873    23.988   237.097 1.00 106.38 ? 61   GLN A C   1 
ATOM   393   O  O   . GLN A  1  61  ? 9.534    24.982   237.740 1.00 107.84 ? 61   GLN A O   1 
ATOM   394   C  CB  . GLN A  1  61  ? 9.943    21.725   238.182 1.00 106.11 ? 61   GLN A CB  1 
ATOM   395   C  CG  . GLN A  1  61  ? 9.185    20.470   238.598 1.00 105.66 ? 61   GLN A CG  1 
ATOM   396   C  CD  . GLN A  1  61  ? 10.037   19.505   239.403 1.00 106.30 ? 61   GLN A CD  1 
ATOM   397   O  OE1 . GLN A  1  61  ? 11.158   19.827   239.798 1.00 107.29 ? 61   GLN A OE1 1 
ATOM   398   N  NE2 . GLN A  1  61  ? 9.503    18.317   239.659 1.00 105.85 ? 61   GLN A NE2 1 
ATOM   399   N  N   . THR A  1  62  ? 10.876   23.999   236.222 1.00 144.48 ? 62   THR A N   1 
ATOM   400   C  CA  . THR A  1  62  ? 11.628   25.217   235.924 1.00 141.02 ? 62   THR A CA  1 
ATOM   401   C  C   . THR A  1  62  ? 12.051   25.240   234.459 1.00 139.56 ? 62   THR A C   1 
ATOM   402   O  O   . THR A  1  62  ? 12.311   24.194   233.864 1.00 138.20 ? 62   THR A O   1 
ATOM   403   C  CB  . THR A  1  62  ? 12.883   25.349   236.809 1.00 142.52 ? 62   THR A CB  1 
ATOM   404   O  OG1 . THR A  1  62  ? 13.679   24.164   236.698 1.00 141.73 ? 62   THR A OG1 1 
ATOM   405   C  CG2 . THR A  1  62  ? 12.502   25.567   238.268 1.00 144.32 ? 62   THR A CG2 1 
ATOM   406   N  N   . SER A  1  63  ? 12.117   26.437   233.883 1.00 138.30 ? 63   SER A N   1 
ATOM   407   C  CA  . SER A  1  63  ? 12.491   26.599   232.481 1.00 137.17 ? 63   SER A CA  1 
ATOM   408   C  C   . SER A  1  63  ? 13.975   26.914   232.317 1.00 137.80 ? 63   SER A C   1 
ATOM   409   O  O   . SER A  1  63  ? 14.452   27.110   231.199 1.00 137.12 ? 63   SER A O   1 
ATOM   410   C  CB  . SER A  1  63  ? 11.659   27.709   231.837 1.00 154.76 ? 63   SER A CB  1 
ATOM   411   O  OG  . SER A  1  63  ? 11.811   28.929   232.541 1.00 164.10 ? 63   SER A OG  1 
ATOM   412   N  N   . ASP A  1  64  ? 14.704   26.956   233.429 1.00 151.07 ? 64   ASP A N   1 
ATOM   413   C  CA  . ASP A  1  64  ? 16.140   27.202   233.391 1.00 155.81 ? 64   ASP A CA  1 
ATOM   414   C  C   . ASP A  1  64  ? 16.871   25.894   233.116 1.00 158.63 ? 64   ASP A C   1 
ATOM   415   O  O   . ASP A  1  64  ? 16.995   25.044   233.999 1.00 164.73 ? 64   ASP A O   1 
ATOM   416   C  CB  . ASP A  1  64  ? 16.614   27.822   234.707 1.00 160.16 ? 64   ASP A CB  1 
ATOM   417   C  CG  . ASP A  1  64  ? 18.065   28.259   234.660 1.00 166.47 ? 64   ASP A CG  1 
ATOM   418   O  OD1 . ASP A  1  64  ? 18.560   28.576   233.557 1.00 171.26 ? 64   ASP A OD1 1 
ATOM   419   O  OD2 . ASP A  1  64  ? 18.710   28.292   235.728 1.00 167.03 ? 64   ASP A OD2 1 
ATOM   420   N  N   . LEU A  1  65  ? 17.351   25.738   231.886 1.00 104.91 ? 65   LEU A N   1 
ATOM   421   C  CA  . LEU A  1  65  ? 17.961   24.488   231.448 1.00 103.79 ? 65   LEU A CA  1 
ATOM   422   C  C   . LEU A  1  65  ? 19.198   24.137   232.269 1.00 104.92 ? 65   LEU A C   1 
ATOM   423   O  O   . LEU A  1  65  ? 19.574   22.970   232.367 1.00 104.34 ? 65   LEU A O   1 
ATOM   424   C  CB  . LEU A  1  65  ? 18.324   24.567   229.963 1.00 102.74 ? 65   LEU A CB  1 
ATOM   425   C  CG  . LEU A  1  65  ? 18.859   23.288   229.312 1.00 101.49 ? 65   LEU A CG  1 
ATOM   426   C  CD1 . LEU A  1  65  ? 17.903   22.117   229.505 1.00 100.30 ? 65   LEU A CD1 1 
ATOM   427   C  CD2 . LEU A  1  65  ? 19.119   23.523   227.834 1.00 100.66 ? 65   LEU A CD2 1 
ATOM   428   N  N   . GLU A  1  66  ? 19.831   25.147   232.855 1.00 117.80 ? 66   GLU A N   1 
ATOM   429   C  CA  . GLU A  1  66  ? 20.979   24.918   233.723 1.00 119.13 ? 66   GLU A CA  1 
ATOM   430   C  C   . GLU A  1  66  ? 20.541   24.266   235.023 1.00 119.71 ? 66   GLU A C   1 
ATOM   431   O  O   . GLU A  1  66  ? 21.216   23.382   235.546 1.00 120.01 ? 66   GLU A O   1 
ATOM   432   C  CB  . GLU A  1  66  ? 21.703   26.229   234.033 1.00 120.95 ? 66   GLU A CB  1 
ATOM   433   C  CG  . GLU A  1  66  ? 22.894   26.050   234.965 1.00 122.52 ? 66   GLU A CG  1 
ATOM   434   C  CD  . GLU A  1  66  ? 23.807   27.256   234.990 1.00 125.86 ? 66   GLU A CD  1 
ATOM   435   O  OE1 . GLU A  1  66  ? 23.553   28.178   235.794 1.00 135.91 ? 66   GLU A OE1 1 
ATOM   436   O  OE2 . GLU A  1  66  ? 24.780   27.279   234.207 1.00 132.72 ? 66   GLU A OE2 1 
ATOM   437   N  N   . ASP A  1  67  ? 19.404   24.713   235.541 1.00 135.04 ? 67   ASP A N   1 
ATOM   438   C  CA  . ASP A  1  67  ? 18.916   24.232   236.823 1.00 135.85 ? 67   ASP A CA  1 
ATOM   439   C  C   . ASP A  1  67  ? 18.456   22.776   236.731 1.00 134.44 ? 67   ASP A C   1 
ATOM   440   O  O   . ASP A  1  67  ? 18.729   21.984   237.631 1.00 135.09 ? 67   ASP A O   1 
ATOM   441   C  CB  . ASP A  1  67  ? 17.779   25.125   237.326 1.00 136.57 ? 67   ASP A CB  1 
ATOM   442   C  CG  . ASP A  1  67  ? 17.352   24.783   238.739 1.00 146.80 ? 67   ASP A CG  1 
ATOM   443   O  OD1 . ASP A  1  67  ? 18.231   24.442   239.558 1.00 150.35 ? 67   ASP A OD1 1 
ATOM   444   O  OD2 . ASP A  1  67  ? 16.141   24.868   239.037 1.00 159.48 ? 67   ASP A OD2 1 
ATOM   445   N  N   . VAL A  1  68  ? 17.763   22.422   235.649 1.00 120.85 ? 68   VAL A N   1 
ATOM   446   C  CA  . VAL A  1  68  ? 17.241   21.063   235.506 1.00 119.53 ? 68   VAL A CA  1 
ATOM   447   C  C   . VAL A  1  68  ? 18.367   20.064   235.262 1.00 119.18 ? 68   VAL A C   1 
ATOM   448   O  O   . VAL A  1  68  ? 18.325   18.941   235.759 1.00 119.04 ? 68   VAL A O   1 
ATOM   449   C  CB  . VAL A  1  68  ? 16.206   20.944   234.352 1.00 117.74 ? 68   VAL A CB  1 
ATOM   450   C  CG1 . VAL A  1  68  ? 15.128   22.007   234.483 1.00 118.13 ? 68   VAL A CG1 1 
ATOM   451   C  CG2 . VAL A  1  68  ? 16.875   21.026   232.974 1.00 116.68 ? 68   VAL A CG2 1 
ATOM   452   N  N   . SER A  1  69  ? 19.373   20.476   234.497 1.00 104.67 ? 69   SER A N   1 
ATOM   453   C  CA  . SER A  1  69  ? 20.503   19.608   234.200 1.00 104.45 ? 69   SER A CA  1 
ATOM   454   C  C   . SER A  1  69  ? 21.227   19.256   235.491 1.00 106.05 ? 69   SER A C   1 
ATOM   455   O  O   . SER A  1  69  ? 21.828   18.190   235.605 1.00 105.94 ? 69   SER A O   1 
ATOM   456   C  CB  . SER A  1  69  ? 21.457   20.267   233.201 1.00 104.40 ? 69   SER A CB  1 
ATOM   457   O  OG  . SER A  1  69  ? 20.785   20.587   231.994 1.00 103.04 ? 69   SER A OG  1 
ATOM   458   N  N   . ARG A  1  70  ? 21.167   20.161   236.462 1.00 109.74 ? 70   ARG A N   1 
ATOM   459   C  CA  . ARG A  1  70  ? 21.758   19.912   237.769 1.00 111.48 ? 70   ARG A CA  1 
ATOM   460   C  C   . ARG A  1  70  ? 20.891   18.950   238.568 1.00 111.38 ? 70   ARG A C   1 
ATOM   461   O  O   . ARG A  1  70  ? 21.399   18.153   239.357 1.00 112.24 ? 70   ARG A O   1 
ATOM   462   C  CB  . ARG A  1  70  ? 21.936   21.216   238.540 1.00 113.33 ? 70   ARG A CB  1 
ATOM   463   C  CG  . ARG A  1  70  ? 23.001   22.113   237.972 1.00 113.90 ? 70   ARG A CG  1 
ATOM   464   C  CD  . ARG A  1  70  ? 22.872   23.521   238.505 1.00 115.46 ? 70   ARG A CD  1 
ATOM   465   N  NE  . ARG A  1  70  ? 24.021   24.332   238.126 1.00 116.36 ? 70   ARG A NE  1 
ATOM   466   C  CZ  . ARG A  1  70  ? 24.154   25.622   238.408 1.00 117.80 ? 70   ARG A CZ  1 
ATOM   467   N  NH1 . ARG A  1  70  ? 23.205   26.263   239.078 1.00 126.10 ? 70   ARG A NH1 1 
ATOM   468   N  NH2 . ARG A  1  70  ? 25.242   26.273   238.018 1.00 118.62 ? 70   ARG A NH2 1 
ATOM   469   N  N   . LYS A  1  71  ? 19.579   19.031   238.364 1.00 127.83 ? 71   LYS A N   1 
ATOM   470   C  CA  . LYS A  1  71  ? 18.654   18.117   239.019 1.00 127.67 ? 71   LYS A CA  1 
ATOM   471   C  C   . LYS A  1  71  ? 18.854   16.710   238.472 1.00 126.37 ? 71   LYS A C   1 
ATOM   472   O  O   . LYS A  1  71  ? 18.909   15.741   239.228 1.00 126.92 ? 71   LYS A O   1 
ATOM   473   C  CB  . LYS A  1  71  ? 17.203   18.560   238.816 1.00 126.95 ? 71   LYS A CB  1 
ATOM   474   C  CG  . LYS A  1  71  ? 16.835   19.871   239.492 1.00 128.40 ? 71   LYS A CG  1 
ATOM   475   C  CD  . LYS A  1  71  ? 15.434   20.309   239.087 1.00 127.55 ? 71   LYS A CD  1 
ATOM   476   C  CE  . LYS A  1  71  ? 15.069   21.661   239.675 1.00 129.02 ? 71   LYS A CE  1 
ATOM   477   N  NZ  . LYS A  1  71  ? 14.695   21.556   241.109 1.00 130.73 ? 71   LYS A NZ  1 
ATOM   478   N  N   . ILE A  1  72  ? 18.966   16.608   237.150 1.00 105.29 ? 72   ILE A N   1 
ATOM   479   C  CA  . ILE A  1  72  ? 19.168   15.322   236.494 1.00 104.03 ? 72   ILE A CA  1 
ATOM   480   C  C   . ILE A  1  72  ? 20.498   14.708   236.902 1.00 104.98 ? 72   ILE A C   1 
ATOM   481   O  O   . ILE A  1  72  ? 20.577   13.514   237.177 1.00 104.89 ? 72   ILE A O   1 
ATOM   482   C  CB  . ILE A  1  72  ? 19.129   15.454   234.956 1.00 102.33 ? 72   ILE A CB  1 
ATOM   483   C  CG1 . ILE A  1  72  ? 17.749   15.926   234.499 1.00 101.35 ? 72   ILE A CG1 1 
ATOM   484   C  CG2 . ILE A  1  72  ? 19.462   14.119   234.286 1.00 101.22 ? 72   ILE A CG2 1 
ATOM   485   C  CD1 . ILE A  1  72  ? 17.697   16.347   233.045 1.00 100.01 ? 72   ILE A CD1 1 
ATOM   486   N  N   . PHE A  1  73  ? 21.539   15.530   236.951 1.00 106.00 ? 73   PHE A N   1 
ATOM   487   C  CA  . PHE A  1  73  ? 22.875   15.045   237.268 1.00 107.00 ? 73   PHE A CA  1 
ATOM   488   C  C   . PHE A  1  73  ? 22.886   14.381   238.638 1.00 108.42 ? 73   PHE A C   1 
ATOM   489   O  O   . PHE A  1  73  ? 23.458   13.306   238.814 1.00 108.62 ? 73   PHE A O   1 
ATOM   490   C  CB  . PHE A  1  73  ? 23.882   16.195   237.227 1.00 108.13 ? 73   PHE A CB  1 
ATOM   491   C  CG  . PHE A  1  73  ? 25.312   15.757   237.356 1.00 109.08 ? 73   PHE A CG  1 
ATOM   492   C  CD1 . PHE A  1  73  ? 25.862   14.861   236.455 1.00 108.04 ? 73   PHE A CD1 1 
ATOM   493   C  CD2 . PHE A  1  73  ? 26.108   16.246   238.378 1.00 111.13 ? 73   PHE A CD2 1 
ATOM   494   C  CE1 . PHE A  1  73  ? 27.179   14.461   236.571 1.00 109.01 ? 73   PHE A CE1 1 
ATOM   495   C  CE2 . PHE A  1  73  ? 27.425   15.849   238.500 1.00 112.11 ? 73   PHE A CE2 1 
ATOM   496   C  CZ  . PHE A  1  73  ? 27.961   14.955   237.596 1.00 111.04 ? 73   PHE A CZ  1 
ATOM   497   N  N   . SER A  1  74  ? 22.240   15.028   239.601 1.00 109.51 ? 74   SER A N   1 
ATOM   498   C  CA  . SER A  1  74  ? 22.171   14.515   240.962 1.00 111.08 ? 74   SER A CA  1 
ATOM   499   C  C   . SER A  1  74  ? 21.035   13.513   241.145 1.00 110.28 ? 74   SER A C   1 
ATOM   500   O  O   . SER A  1  74  ? 20.898   12.913   242.210 1.00 111.50 ? 74   SER A O   1 
ATOM   501   C  CB  . SER A  1  74  ? 22.025   15.669   241.947 1.00 112.83 ? 74   SER A CB  1 
ATOM   502   O  OG  . SER A  1  74  ? 23.233   16.404   242.011 1.00 114.00 ? 74   SER A OG  1 
ATOM   503   N  N   . ALA A  1  75  ? 20.218   13.341   240.111 1.00 128.62 ? 75   ALA A N   1 
ATOM   504   C  CA  . ALA A  1  75  ? 19.185   12.314   240.126 1.00 127.74 ? 75   ALA A CA  1 
ATOM   505   C  C   . ALA A  1  75  ? 19.831   10.968   239.831 1.00 127.30 ? 75   ALA A C   1 
ATOM   506   O  O   . ALA A  1  75  ? 19.462   9.946    240.409 1.00 127.63 ? 75   ALA A O   1 
ATOM   507   C  CB  . ALA A  1  75  ? 18.100   12.623   239.113 1.00 125.95 ? 75   ALA A CB  1 
ATOM   508   N  N   . HIS A  1  76  ? 20.803   10.985   238.925 1.00 106.40 ? 76   HIS A N   1 
ATOM   509   C  CA  . HIS A  1  76  ? 21.545   9.786    238.551 1.00 106.06 ? 76   HIS A CA  1 
ATOM   510   C  C   . HIS A  1  76  ? 22.353   9.236    239.723 1.00 107.96 ? 76   HIS A C   1 
ATOM   511   O  O   . HIS A  1  76  ? 22.359   8.030    239.966 1.00 108.08 ? 76   HIS A O   1 
ATOM   512   C  CB  . HIS A  1  76  ? 22.471   10.084   237.371 1.00 105.23 ? 76   HIS A CB  1 
ATOM   513   C  CG  . HIS A  1  76  ? 21.745   10.452   236.115 1.00 103.38 ? 76   HIS A CG  1 
ATOM   514   N  ND1 . HIS A  1  76  ? 22.325   10.374   234.867 1.00 102.31 ? 76   HIS A ND1 1 
ATOM   515   C  CD2 . HIS A  1  76  ? 20.481   10.893   235.915 1.00 102.51 ? 76   HIS A CD2 1 
ATOM   516   C  CE1 . HIS A  1  76  ? 21.451   10.757   233.953 1.00 100.88 ? 76   HIS A CE1 1 
ATOM   517   N  NE2 . HIS A  1  76  ? 20.329   11.085   234.564 1.00 100.97 ? 76   HIS A NE2 1 
ATOM   518   N  N   . PHE A  1  77  ? 23.045   10.121   240.435 1.00 118.20 ? 77   PHE A N   1 
ATOM   519   C  CA  . PHE A  1  77  ? 23.807   9.726    241.617 1.00 120.25 ? 77   PHE A CA  1 
ATOM   520   C  C   . PHE A  1  77  ? 22.918   9.017    242.627 1.00 120.98 ? 77   PHE A C   1 
ATOM   521   O  O   . PHE A  1  77  ? 23.350   8.085    243.304 1.00 122.11 ? 77   PHE A O   1 
ATOM   522   C  CB  . PHE A  1  77  ? 24.467   10.945   242.269 1.00 121.91 ? 77   PHE A CB  1 
ATOM   523   C  CG  . PHE A  1  77  ? 25.766   11.347   241.633 1.00 122.03 ? 77   PHE A CG  1 
ATOM   524   C  CD1 . PHE A  1  77  ? 26.787   10.425   241.465 1.00 122.32 ? 77   PHE A CD1 1 
ATOM   525   C  CD2 . PHE A  1  77  ? 25.968   12.648   241.205 1.00 121.97 ? 77   PHE A CD2 1 
ATOM   526   C  CE1 . PHE A  1  77  ? 27.981   10.793   240.879 1.00 122.53 ? 77   PHE A CE1 1 
ATOM   527   C  CE2 . PHE A  1  77  ? 27.160   13.021   240.618 1.00 122.19 ? 77   PHE A CE2 1 
ATOM   528   C  CZ  . PHE A  1  77  ? 28.167   12.093   240.455 1.00 123.68 ? 77   PHE A CZ  1 
ATOM   529   N  N   . GLY A  1  78  ? 21.675   9.472    242.727 1.00 111.80 ? 78   GLY A N   1 
ATOM   530   C  CA  . GLY A  1  78  ? 20.698   8.841    243.591 1.00 112.40 ? 78   GLY A CA  1 
ATOM   531   C  C   . GLY A  1  78  ? 20.308   7.468    243.081 1.00 111.21 ? 78   GLY A C   1 
ATOM   532   O  O   . GLY A  1  78  ? 20.087   6.548    243.864 1.00 112.18 ? 78   GLY A O   1 
ATOM   533   N  N   . HIS A  1  79  ? 20.219   7.330    241.762 1.00 109.22 ? 79   HIS A N   1 
ATOM   534   C  CA  . HIS A  1  79  ? 19.839   6.061    241.155 1.00 108.01 ? 79   HIS A CA  1 
ATOM   535   C  C   . HIS A  1  79  ? 20.954   5.035    241.280 1.00 108.75 ? 79   HIS A C   1 
ATOM   536   O  O   . HIS A  1  79  ? 20.711   3.886    241.639 1.00 109.10 ? 79   HIS A O   1 
ATOM   537   C  CB  . HIS A  1  79  ? 19.483   6.251    239.684 1.00 105.81 ? 79   HIS A CB  1 
ATOM   538   C  CG  . HIS A  1  79  ? 18.859   5.044    239.058 1.00 104.57 ? 79   HIS A CG  1 
ATOM   539   N  ND1 . HIS A  1  79  ? 19.597   4.059    238.439 1.00 104.12 ? 79   HIS A ND1 1 
ATOM   540   C  CD2 . HIS A  1  79  ? 17.564   4.658    238.966 1.00 103.79 ? 79   HIS A CD2 1 
ATOM   541   C  CE1 . HIS A  1  79  ? 18.784   3.120    237.989 1.00 103.11 ? 79   HIS A CE1 1 
ATOM   542   N  NE2 . HIS A  1  79  ? 17.545   3.461    238.294 1.00 102.88 ? 79   HIS A NE2 1 
ATOM   543   N  N   . LEU A  1  80  ? 22.175   5.447    240.959 1.00 109.05 ? 80   LEU A N   1 
ATOM   544   C  CA  . LEU A  1  80  ? 23.328   4.568    241.087 1.00 109.93 ? 80   LEU A CA  1 
ATOM   545   C  C   . LEU A  1  80  ? 23.430   4.048    242.514 1.00 112.04 ? 80   LEU A C   1 
ATOM   546   O  O   . LEU A  1  80  ? 23.916   2.944    242.747 1.00 112.73 ? 80   LEU A O   1 
ATOM   547   C  CB  . LEU A  1  80  ? 24.615   5.299    240.699 1.00 110.28 ? 80   LEU A CB  1 
ATOM   548   C  CG  . LEU A  1  80  ? 24.857   5.557    239.210 1.00 108.46 ? 80   LEU A CG  1 
ATOM   549   C  CD1 . LEU A  1  80  ? 26.060   6.466    239.029 1.00 109.17 ? 80   LEU A CD1 1 
ATOM   550   C  CD2 . LEU A  1  80  ? 25.060   4.254    238.449 1.00 107.56 ? 80   LEU A CD2 1 
ATOM   551   N  N   . ALA A  1  81  ? 22.946   4.841    243.465 1.00 131.37 ? 81   ALA A N   1 
ATOM   552   C  CA  . ALA A  1  81  ? 23.003   4.466    244.870 1.00 133.58 ? 81   ALA A CA  1 
ATOM   553   C  C   . ALA A  1  81  ? 22.065   3.299    245.173 1.00 133.49 ? 81   ALA A C   1 
ATOM   554   O  O   . ALA A  1  81  ? 22.475   2.333    245.815 1.00 134.83 ? 81   ALA A O   1 
ATOM   555   C  CB  . ALA A  1  81  ? 22.665   5.662    245.749 1.00 134.80 ? 81   ALA A CB  1 
ATOM   556   N  N   . VAL A  1  82  ? 20.819   3.372    244.709 1.00 113.81 ? 82   VAL A N   1 
ATOM   557   C  CA  . VAL A  1  82  ? 19.854   2.316    245.013 1.00 113.81 ? 82   VAL A CA  1 
ATOM   558   C  C   . VAL A  1  82  ? 20.253   1.032    244.292 1.00 113.00 ? 82   VAL A C   1 
ATOM   559   O  O   . VAL A  1  82  ? 20.086   -0.063   244.829 1.00 113.91 ? 82   VAL A O   1 
ATOM   560   C  CB  . VAL A  1  82  ? 18.390   2.704    244.640 1.00 112.44 ? 82   VAL A CB  1 
ATOM   561   C  CG1 . VAL A  1  82  ? 18.070   4.117    245.105 1.00 112.99 ? 82   VAL A CG1 1 
ATOM   562   C  CG2 . VAL A  1  82  ? 18.113   2.551    243.141 1.00 109.99 ? 82   VAL A CG2 1 
ATOM   563   N  N   . VAL A  1  83  ? 20.780   1.168    243.078 1.00 111.41 ? 83   VAL A N   1 
ATOM   564   C  CA  . VAL A  1  83  ? 21.221   0.007    242.316 1.00 110.67 ? 83   VAL A CA  1 
ATOM   565   C  C   . VAL A  1  83  ? 22.377   -0.651   243.052 1.00 112.58 ? 83   VAL A C   1 
ATOM   566   O  O   . VAL A  1  83  ? 22.517   -1.871   243.031 1.00 112.87 ? 83   VAL A O   1 
ATOM   567   C  CB  . VAL A  1  83  ? 21.648   0.378    240.876 1.00 108.79 ? 83   VAL A CB  1 
ATOM   568   C  CG1 . VAL A  1  83  ? 22.255   -0.828   240.156 1.00 108.34 ? 83   VAL A CG1 1 
ATOM   569   C  CG2 . VAL A  1  83  ? 20.461   0.919    240.094 1.00 106.95 ? 83   VAL A CG2 1 
ATOM   570   N  N   . PHE A  1  84  ? 23.197   0.158    243.715 1.00 113.98 ? 84   PHE A N   1 
ATOM   571   C  CA  . PHE A  1  84  ? 24.281   -0.378   244.527 1.00 116.05 ? 84   PHE A CA  1 
ATOM   572   C  C   . PHE A  1  84  ? 23.725   -1.121   245.740 1.00 117.76 ? 84   PHE A C   1 
ATOM   573   O  O   . PHE A  1  84  ? 24.234   -2.180   246.107 1.00 118.94 ? 84   PHE A O   1 
ATOM   574   C  CB  . PHE A  1  84  ? 25.237   0.731    244.980 1.00 117.26 ? 84   PHE A CB  1 
ATOM   575   C  CG  . PHE A  1  84  ? 26.462   0.868    244.116 1.00 116.77 ? 84   PHE A CG  1 
ATOM   576   C  CD1 . PHE A  1  84  ? 27.375   -0.168   244.023 1.00 117.47 ? 84   PHE A CD1 1 
ATOM   577   C  CD2 . PHE A  1  84  ? 26.710   2.035    243.413 1.00 115.77 ? 84   PHE A CD2 1 
ATOM   578   C  CE1 . PHE A  1  84  ? 28.505   -0.047   243.239 1.00 117.16 ? 84   PHE A CE1 1 
ATOM   579   C  CE2 . PHE A  1  84  ? 27.837   2.162    242.623 1.00 115.45 ? 84   PHE A CE2 1 
ATOM   580   C  CZ  . PHE A  1  84  ? 28.736   1.118    242.534 1.00 116.14 ? 84   PHE A CZ  1 
ATOM   581   N  N   . VAL A  1  85  ? 22.691   -0.566   246.368 1.00 118.03 ? 85   VAL A N   1 
ATOM   582   C  CA  . VAL A  1  85  ? 22.060   -1.225   247.508 1.00 119.70 ? 85   VAL A CA  1 
ATOM   583   C  C   . VAL A  1  85  ? 21.448   -2.549   247.065 1.00 118.89 ? 85   VAL A C   1 
ATOM   584   O  O   . VAL A  1  85  ? 21.624   -3.573   247.722 1.00 120.41 ? 85   VAL A O   1 
ATOM   585   C  CB  . VAL A  1  85  ? 20.969   -0.354   248.163 1.00 120.04 ? 85   VAL A CB  1 
ATOM   586   C  CG1 . VAL A  1  85  ? 20.256   -1.128   249.275 1.00 121.77 ? 85   VAL A CG1 1 
ATOM   587   C  CG2 . VAL A  1  85  ? 21.572   0.919    248.725 1.00 121.17 ? 85   VAL A CG2 1 
ATOM   588   N  N   . TRP A  1  86  ? 20.730   -2.518   245.946 1.00 116.59 ? 86   TRP A N   1 
ATOM   589   C  CA  . TRP A  1  86  ? 20.121   -3.722   245.392 1.00 115.67 ? 86   TRP A CA  1 
ATOM   590   C  C   . TRP A  1  86  ? 21.175   -4.756   245.055 1.00 116.03 ? 86   TRP A C   1 
ATOM   591   O  O   . TRP A  1  86  ? 21.060   -5.923   245.430 1.00 116.99 ? 86   TRP A O   1 
ATOM   592   C  CB  . TRP A  1  86  ? 19.318   -3.392   244.136 1.00 113.13 ? 86   TRP A CB  1 
ATOM   593   C  CG  . TRP A  1  86  ? 19.001   -4.595   243.291 1.00 112.00 ? 86   TRP A CG  1 
ATOM   594   C  CD1 . TRP A  1  86  ? 18.000   -5.498   243.493 1.00 112.12 ? 86   TRP A CD1 1 
ATOM   595   C  CD2 . TRP A  1  86  ? 19.692   -5.021   242.107 1.00 110.70 ? 86   TRP A CD2 1 
ATOM   596   N  NE1 . TRP A  1  86  ? 18.019   -6.456   242.507 1.00 110.96 ? 86   TRP A NE1 1 
ATOM   597   C  CE2 . TRP A  1  86  ? 19.047   -6.184   241.643 1.00 110.08 ? 86   TRP A CE2 1 
ATOM   598   C  CE3 . TRP A  1  86  ? 20.785   -4.525   241.389 1.00 110.09 ? 86   TRP A CE3 1 
ATOM   599   C  CZ2 . TRP A  1  86  ? 19.464   -6.864   240.500 1.00 108.90 ? 86   TRP A CZ2 1 
ATOM   600   C  CZ3 . TRP A  1  86  ? 21.197   -5.201   240.253 1.00 108.93 ? 86   TRP A CZ3 1 
ATOM   601   C  CH2 . TRP A  1  86  ? 20.537   -6.357   239.820 1.00 108.35 ? 86   TRP A CH2 1 
ATOM   602   N  N   . LEU A  1  87  ? 22.201   -4.319   244.337 1.00 115.35 ? 87   LEU A N   1 
ATOM   603   C  CA  . LEU A  1  87  ? 23.252   -5.220   243.900 1.00 115.62 ? 87   LEU A CA  1 
ATOM   604   C  C   . LEU A  1  87  ? 23.961   -5.813   245.111 1.00 118.23 ? 87   LEU A C   1 
ATOM   605   O  O   . LEU A  1  87  ? 24.261   -7.003   245.135 1.00 118.94 ? 87   LEU A O   1 
ATOM   606   C  CB  . LEU A  1  87  ? 24.245   -4.490   242.994 1.00 114.64 ? 87   LEU A CB  1 
ATOM   607   C  CG  . LEU A  1  87  ? 25.195   -5.364   242.174 1.00 114.36 ? 87   LEU A CG  1 
ATOM   608   C  CD1 . LEU A  1  87  ? 24.426   -6.300   241.248 1.00 112.80 ? 87   LEU A CD1 1 
ATOM   609   C  CD2 . LEU A  1  87  ? 26.144   -4.494   241.373 1.00 113.60 ? 87   LEU A CD2 1 
ATOM   610   N  N   . SER A  1  88  ? 24.200   -4.986   246.123 1.00 119.76 ? 88   SER A N   1 
ATOM   611   C  CA  . SER A  1  88  ? 24.819   -5.450   247.360 1.00 122.44 ? 88   SER A CA  1 
ATOM   612   C  C   . SER A  1  88  ? 23.924   -6.456   248.078 1.00 123.47 ? 88   SER A C   1 
ATOM   613   O  O   . SER A  1  88  ? 24.413   -7.350   248.767 1.00 125.40 ? 88   SER A O   1 
ATOM   614   C  CB  . SER A  1  88  ? 25.126   -4.270   248.283 1.00 123.85 ? 88   SER A CB  1 
ATOM   615   O  OG  . SER A  1  88  ? 23.966   -3.499   248.535 1.00 123.27 ? 88   SER A OG  1 
ATOM   616   N  N   . GLY A  1  89  ? 22.613   -6.300   247.923 1.00 122.30 ? 89   GLY A N   1 
ATOM   617   C  CA  . GLY A  1  89  ? 21.662   -7.210   248.534 1.00 123.19 ? 89   GLY A CA  1 
ATOM   618   C  C   . GLY A  1  89  ? 21.772   -8.611   247.970 1.00 122.89 ? 89   GLY A C   1 
ATOM   619   O  O   . GLY A  1  89  ? 21.557   -9.593   248.678 1.00 124.52 ? 89   GLY A O   1 
ATOM   620   N  N   . MET A  1  90  ? 22.127   -8.705   246.694 1.00 130.47 ? 90   MET A N   1 
ATOM   621   C  CA  . MET A  1  90  ? 22.266   -9.997   246.037 1.00 130.09 ? 90   MET A CA  1 
ATOM   622   C  C   . MET A  1  90  ? 23.523   -10.708  246.527 1.00 132.10 ? 90   MET A C   1 
ATOM   623   O  O   . MET A  1  90  ? 23.535   -11.926  246.695 1.00 133.10 ? 90   MET A O   1 
ATOM   624   C  CB  . MET A  1  90  ? 22.326   -9.823   244.518 1.00 127.54 ? 90   MET A CB  1 
ATOM   625   C  CG  . MET A  1  90  ? 21.111   -9.135   243.903 1.00 125.48 ? 90   MET A CG  1 
ATOM   626   S  SD  . MET A  1  90  ? 19.542   -9.959   244.232 1.00 152.51 ? 90   MET A SD  1 
ATOM   627   C  CE  . MET A  1  90  ? 19.006   -9.114   245.718 1.00 127.28 ? 90   MET A CE  1 
ATOM   628   N  N   . TYR A  1  91  ? 24.576   -9.932   246.760 1.00 123.24 ? 91   TYR A N   1 
ATOM   629   C  CA  . TYR A  1  91  ? 25.833   -10.468  247.266 1.00 125.29 ? 91   TYR A CA  1 
ATOM   630   C  C   . TYR A  1  91  ? 25.722   -10.862  248.731 1.00 128.01 ? 91   TYR A C   1 
ATOM   631   O  O   . TYR A  1  91  ? 26.326   -11.843  249.163 1.00 129.81 ? 91   TYR A O   1 
ATOM   632   C  CB  . TYR A  1  91  ? 26.956   -9.448   247.079 1.00 125.25 ? 91   TYR A CB  1 
ATOM   633   C  CG  . TYR A  1  91  ? 27.469   -9.385   245.661 1.00 123.23 ? 91   TYR A CG  1 
ATOM   634   C  CD1 . TYR A  1  91  ? 28.445   -10.263  245.215 1.00 123.73 ? 91   TYR A CD1 1 
ATOM   635   C  CD2 . TYR A  1  91  ? 26.958   -8.464   244.761 1.00 120.92 ? 91   TYR A CD2 1 
ATOM   636   C  CE1 . TYR A  1  91  ? 28.912   -10.211  243.918 1.00 122.01 ? 91   TYR A CE1 1 
ATOM   637   C  CE2 . TYR A  1  91  ? 27.413   -8.406   243.462 1.00 119.20 ? 91   TYR A CE2 1 
ATOM   638   C  CZ  . TYR A  1  91  ? 28.389   -9.282   243.044 1.00 119.75 ? 91   TYR A CZ  1 
ATOM   639   O  OH  . TYR A  1  91  ? 28.843   -9.224   241.747 1.00 118.15 ? 91   TYR A OH  1 
ATOM   640   N  N   . PHE A  1  92  ? 24.951   -10.098  249.497 1.00 128.44 ? 92   PHE A N   1 
ATOM   641   C  CA  . PHE A  1  92  ? 24.771   -10.399  250.908 1.00 131.12 ? 92   PHE A CA  1 
ATOM   642   C  C   . PHE A  1  92  ? 23.904   -11.643  251.064 1.00 131.56 ? 92   PHE A C   1 
ATOM   643   O  O   . PHE A  1  92  ? 24.160   -12.482  251.927 1.00 133.92 ? 92   PHE A O   1 
ATOM   644   C  CB  . PHE A  1  92  ? 24.152   -9.219   251.656 1.00 131.50 ? 92   PHE A CB  1 
ATOM   645   C  CG  . PHE A  1  92  ? 24.022   -9.452   253.132 1.00 134.45 ? 92   PHE A CG  1 
ATOM   646   C  CD1 . PHE A  1  92  ? 25.091   -9.209   253.978 1.00 136.74 ? 92   PHE A CD1 1 
ATOM   647   C  CD2 . PHE A  1  92  ? 22.838   -9.922   253.673 1.00 135.04 ? 92   PHE A CD2 1 
ATOM   648   C  CE1 . PHE A  1  92  ? 24.981   -9.428   255.337 1.00 139.60 ? 92   PHE A CE1 1 
ATOM   649   C  CE2 . PHE A  1  92  ? 22.722   -10.143  255.032 1.00 137.90 ? 92   PHE A CE2 1 
ATOM   650   C  CZ  . PHE A  1  92  ? 23.795   -9.895   255.865 1.00 140.19 ? 92   PHE A CZ  1 
ATOM   651   N  N   . HIS A  1  93  ? 22.876   -11.758  250.228 1.00 129.39 ? 93   HIS A N   1 
ATOM   652   C  CA  . HIS A  1  93  ? 22.023   -12.942  250.237 1.00 129.63 ? 93   HIS A CA  1 
ATOM   653   C  C   . HIS A  1  93  ? 22.793   -14.183  249.794 1.00 130.10 ? 93   HIS A C   1 
ATOM   654   O  O   . HIS A  1  93  ? 22.537   -15.287  250.275 1.00 131.63 ? 93   HIS A O   1 
ATOM   655   C  CB  . HIS A  1  93  ? 20.805   -12.745  249.332 1.00 127.11 ? 93   HIS A CB  1 
ATOM   656   C  CG  . HIS A  1  93  ? 19.623   -12.145  250.028 1.00 127.39 ? 93   HIS A CG  1 
ATOM   657   N  ND1 . HIS A  1  93  ? 18.618   -12.911  250.577 1.00 128.41 ? 93   HIS A ND1 1 
ATOM   658   C  CD2 . HIS A  1  93  ? 19.276   -10.855  250.250 1.00 126.86 ? 93   HIS A CD2 1 
ATOM   659   C  CE1 . HIS A  1  93  ? 17.710   -12.121  251.119 1.00 128.52 ? 93   HIS A CE1 1 
ATOM   660   N  NE2 . HIS A  1  93  ? 18.083   -10.868  250.931 1.00 127.58 ? 93   HIS A NE2 1 
ATOM   661   N  N   . GLY A  1  94  ? 23.737   -13.995  248.878 1.00 142.86 ? 94   GLY A N   1 
ATOM   662   C  CA  . GLY A  1  94  ? 24.571   -15.084  248.405 1.00 143.33 ? 94   GLY A CA  1 
ATOM   663   C  C   . GLY A  1  94  ? 25.620   -15.515  249.412 1.00 146.21 ? 94   GLY A C   1 
ATOM   664   O  O   . GLY A  1  94  ? 26.200   -16.593  249.288 1.00 147.22 ? 94   GLY A O   1 
ATOM   665   N  N   . ALA A  1  95  ? 25.860   -14.675  250.415 1.00 133.67 ? 95   ALA A N   1 
ATOM   666   C  CA  . ALA A  1  95  ? 26.921   -14.919  251.385 1.00 136.48 ? 95   ALA A CA  1 
ATOM   667   C  C   . ALA A  1  95  ? 26.395   -15.566  252.662 1.00 139.07 ? 95   ALA A C   1 
ATOM   668   O  O   . ALA A  1  95  ? 27.063   -16.417  253.249 1.00 141.40 ? 95   ALA A O   1 
ATOM   669   C  CB  . ALA A  1  95  ? 27.630   -13.618  251.718 1.00 136.75 ? 95   ALA A CB  1 
ATOM   670   N  N   . LYS A  1  96  ? 25.198   -15.166  253.084 1.00 138.77 ? 96   LYS A N   1 
ATOM   671   C  CA  . LYS A  1  96  ? 24.664   -15.580  254.380 1.00 141.37 ? 96   LYS A CA  1 
ATOM   672   C  C   . LYS A  1  96  ? 23.383   -16.410  254.275 1.00 140.96 ? 96   LYS A C   1 
ATOM   673   O  O   . LYS A  1  96  ? 23.069   -17.178  255.185 1.00 143.29 ? 96   LYS A O   1 
ATOM   674   C  CB  . LYS A  1  96  ? 24.411   -14.347  255.248 1.00 142.11 ? 96   LYS A CB  1 
ATOM   675   C  CG  . LYS A  1  96  ? 25.684   -13.590  255.610 1.00 143.21 ? 96   LYS A CG  1 
ATOM   676   C  CD  . LYS A  1  96  ? 26.517   -14.329  256.648 1.00 146.56 ? 96   LYS A CD  1 
ATOM   677   C  CE  . LYS A  1  96  ? 27.750   -13.525  257.031 1.00 147.74 ? 96   LYS A CE  1 
ATOM   678   N  NZ  . LYS A  1  96  ? 28.512   -14.141  258.153 1.00 151.25 ? 96   LYS A NZ  1 
ATOM   679   N  N   . PHE A  1  97  ? 22.650   -16.258  253.175 1.00 156.05 ? 97   PHE A N   1 
ATOM   680   C  CA  . PHE A  1  97  ? 21.388   -16.975  252.985 1.00 155.49 ? 97   PHE A CA  1 
ATOM   681   C  C   . PHE A  1  97  ? 21.394   -17.781  251.691 1.00 153.57 ? 97   PHE A C   1 
ATOM   682   O  O   . PHE A  1  97  ? 20.443   -17.724  250.912 1.00 151.46 ? 97   PHE A O   1 
ATOM   683   C  CB  . PHE A  1  97  ? 20.210   -15.999  252.980 1.00 154.06 ? 97   PHE A CB  1 
ATOM   684   C  CG  . PHE A  1  97  ? 20.198   -15.057  254.149 1.00 155.74 ? 97   PHE A CG  1 
ATOM   685   C  CD1 . PHE A  1  97  ? 20.120   -15.539  255.445 1.00 160.09 ? 97   PHE A CD1 1 
ATOM   686   C  CD2 . PHE A  1  97  ? 20.250   -13.687  253.950 1.00 154.38 ? 97   PHE A CD2 1 
ATOM   687   C  CE1 . PHE A  1  97  ? 20.106   -14.673  256.522 1.00 161.33 ? 97   PHE A CE1 1 
ATOM   688   C  CE2 . PHE A  1  97  ? 20.235   -12.816  255.023 1.00 156.02 ? 97   PHE A CE2 1 
ATOM   689   C  CZ  . PHE A  1  97  ? 20.162   -13.310  256.310 1.00 159.07 ? 97   PHE A CZ  1 
ATOM   690   N  N   . SER A  1  98  ? 22.471   -18.528  251.470 1.00 136.47 ? 98   SER A N   1 
ATOM   691   C  CA  . SER A  1  98  ? 22.636   -19.294  250.241 1.00 134.87 ? 98   SER A CA  1 
ATOM   692   C  C   . SER A  1  98  ? 23.327   -20.625  250.496 1.00 137.00 ? 98   SER A C   1 
ATOM   693   O  O   . SER A  1  98  ? 23.882   -20.858  251.571 1.00 139.66 ? 98   SER A O   1 
ATOM   694   C  CB  . SER A  1  98  ? 23.440   -18.491  249.219 1.00 132.76 ? 98   SER A CB  1 
ATOM   695   O  OG  . SER A  1  98  ? 24.812   -18.842  249.272 1.00 134.07 ? 98   SER A OG  1 
ATOM   696   N  N   . ASN A  1  99  ? 23.278   -21.494  249.492 1.00 167.05 ? 99   ASN A N   1 
ATOM   697   C  CA  . ASN A  1  99  ? 23.984   -22.767  249.515 1.00 169.40 ? 99   ASN A CA  1 
ATOM   698   C  C   . ASN A  1  99  ? 25.072   -22.774  248.449 1.00 175.35 ? 99   ASN A C   1 
ATOM   699   O  O   . ASN A  1  99  ? 25.388   -23.815  247.872 1.00 172.96 ? 99   ASN A O   1 
ATOM   700   C  CB  . ASN A  1  99  ? 23.009   -23.927  249.303 1.00 168.97 ? 99   ASN A CB  1 
ATOM   701   C  CG  . ASN A  1  99  ? 22.366   -23.911  247.927 1.00 166.01 ? 99   ASN A CG  1 
ATOM   702   O  OD1 . ASN A  1  99  ? 22.245   -22.860  247.298 1.00 163.73 ? 99   ASN A OD1 1 
ATOM   703   N  ND2 . ASN A  1  99  ? 21.939   -25.079  247.460 1.00 166.15 ? 99   ASN A ND2 1 
ATOM   704   N  N   . TYR A  1  100 ? 25.638   -21.597  248.195 1.00 135.19 ? 100  TYR A N   1 
ATOM   705   C  CA  . TYR A  1  100 ? 26.618   -21.424  247.127 1.00 133.84 ? 100  TYR A CA  1 
ATOM   706   C  C   . TYR A  1  100 ? 27.835   -22.322  247.305 1.00 135.96 ? 100  TYR A C   1 
ATOM   707   O  O   . TYR A  1  100 ? 28.276   -22.968  246.354 1.00 135.29 ? 100  TYR A O   1 
ATOM   708   C  CB  . TYR A  1  100 ? 27.066   -19.966  247.046 1.00 132.69 ? 100  TYR A CB  1 
ATOM   709   C  CG  . TYR A  1  100 ? 28.137   -19.748  246.009 1.00 131.54 ? 100  TYR A CG  1 
ATOM   710   C  CD1 . TYR A  1  100 ? 27.875   -19.968  244.664 1.00 129.28 ? 100  TYR A CD1 1 
ATOM   711   C  CD2 . TYR A  1  100 ? 29.412   -19.343  246.372 1.00 132.86 ? 100  TYR A CD2 1 
ATOM   712   C  CE1 . TYR A  1  100 ? 28.848   -19.780  243.708 1.00 128.36 ? 100  TYR A CE1 1 
ATOM   713   C  CE2 . TYR A  1  100 ? 30.395   -19.151  245.422 1.00 131.93 ? 100  TYR A CE2 1 
ATOM   714   C  CZ  . TYR A  1  100 ? 30.107   -19.373  244.091 1.00 129.69 ? 100  TYR A CZ  1 
ATOM   715   O  OH  . TYR A  1  100 ? 31.082   -19.185  243.138 1.00 128.88 ? 100  TYR A OH  1 
ATOM   716   N  N   . GLU A  1  101 ? 28.383   -22.358  248.515 1.00 138.61 ? 101  GLU A N   1 
ATOM   717   C  CA  . GLU A  1  101 ? 29.523   -23.220  248.796 1.00 140.93 ? 101  GLU A CA  1 
ATOM   718   C  C   . GLU A  1  101 ? 29.144   -24.676  248.574 1.00 141.73 ? 101  GLU A C   1 
ATOM   719   O  O   . GLU A  1  101 ? 29.948   -25.471  248.087 1.00 142.39 ? 101  GLU A O   1 
ATOM   720   C  CB  . GLU A  1  101 ? 30.024   -23.025  250.226 1.00 143.82 ? 101  GLU A CB  1 
ATOM   721   C  CG  . GLU A  1  101 ? 30.686   -21.684  250.483 1.00 143.55 ? 101  GLU A CG  1 
ATOM   722   C  CD  . GLU A  1  101 ? 31.341   -21.618  251.849 1.00 146.71 ? 101  GLU A CD  1 
ATOM   723   O  OE1 . GLU A  1  101 ? 32.073   -20.642  252.114 1.00 146.95 ? 101  GLU A OE1 1 
ATOM   724   O  OE2 . GLU A  1  101 ? 31.127   -22.545  252.657 1.00 149.04 ? 101  GLU A OE2 1 
ATOM   725   N  N   . GLY A  1  102 ? 27.912   -25.017  248.933 1.00 163.28 ? 102  GLY A N   1 
ATOM   726   C  CA  . GLY A  1  102 ? 27.411   -26.362  248.738 1.00 164.02 ? 102  GLY A CA  1 
ATOM   727   C  C   . GLY A  1  102 ? 27.233   -26.653  247.263 1.00 161.54 ? 102  GLY A C   1 
ATOM   728   O  O   . GLY A  1  102 ? 27.427   -27.783  246.814 1.00 162.21 ? 102  GLY A O   1 
ATOM   729   N  N   . TRP A  1  103 ? 26.862   -25.624  246.506 1.00 137.25 ? 103  TRP A N   1 
ATOM   730   C  CA  . TRP A  1  103 ? 26.668   -25.764  245.069 1.00 134.79 ? 103  TRP A CA  1 
ATOM   731   C  C   . TRP A  1  103 ? 28.003   -25.828  244.323 1.00 134.67 ? 103  TRP A C   1 
ATOM   732   O  O   . TRP A  1  103 ? 28.112   -26.498  243.295 1.00 143.17 ? 103  TRP A O   1 
ATOM   733   C  CB  . TRP A  1  103 ? 25.823   -24.608  244.530 1.00 132.01 ? 103  TRP A CB  1 
ATOM   734   C  CG  . TRP A  1  103 ? 25.713   -24.609  243.038 1.00 129.52 ? 103  TRP A CG  1 
ATOM   735   C  CD1 . TRP A  1  103 ? 24.735   -25.195  242.290 1.00 128.26 ? 103  TRP A CD1 1 
ATOM   736   C  CD2 . TRP A  1  103 ? 26.623   -24.009  242.111 1.00 128.13 ? 103  TRP A CD2 1 
ATOM   737   N  NE1 . TRP A  1  103 ? 24.976   -24.993  240.953 1.00 126.18 ? 103  TRP A NE1 1 
ATOM   738   C  CE2 . TRP A  1  103 ? 26.131   -24.267  240.816 1.00 126.07 ? 103  TRP A CE2 1 
ATOM   739   C  CE3 . TRP A  1  103 ? 27.806   -23.277  242.250 1.00 128.52 ? 103  TRP A CE3 1 
ATOM   740   C  CZ2 . TRP A  1  103 ? 26.779   -23.818  239.669 1.00 124.43 ? 103  TRP A CZ2 1 
ATOM   741   C  CZ3 . TRP A  1  103 ? 28.447   -22.832  241.110 1.00 126.88 ? 103  TRP A CZ3 1 
ATOM   742   C  CH2 . TRP A  1  103 ? 27.932   -23.104  239.836 1.00 124.87 ? 103  TRP A CH2 1 
ATOM   743   N  N   . LEU A  1  104 ? 29.017   -25.140  244.842 1.00 135.60 ? 104  LEU A N   1 
ATOM   744   C  CA  . LEU A  1  104 ? 30.332   -25.122  244.202 1.00 135.66 ? 104  LEU A CA  1 
ATOM   745   C  C   . LEU A  1  104 ? 31.017   -26.484  244.324 1.00 137.97 ? 104  LEU A C   1 
ATOM   746   O  O   . LEU A  1  104 ? 31.925   -26.802  243.555 1.00 137.91 ? 104  LEU A O   1 
ATOM   747   C  CB  . LEU A  1  104 ? 31.218   -24.030  244.814 1.00 136.29 ? 104  LEU A CB  1 
ATOM   748   C  CG  . LEU A  1  104 ? 31.983   -23.143  243.824 1.00 134.48 ? 104  LEU A CG  1 
ATOM   749   C  CD1 . LEU A  1  104 ? 32.787   -22.090  244.565 1.00 135.39 ? 104  LEU A CD1 1 
ATOM   750   C  CD2 . LEU A  1  104 ? 32.896   -23.958  242.918 1.00 134.74 ? 104  LEU A CD2 1 
ATOM   751   N  N   . ALA A  1  105 ? 30.576   -27.284  245.290 1.00 140.10 ? 105  ALA A N   1 
ATOM   752   C  CA  . ALA A  1  105 ? 31.139   -28.613  245.512 1.00 142.55 ? 105  ALA A CA  1 
ATOM   753   C  C   . ALA A  1  105 ? 30.589   -29.635  244.520 1.00 141.65 ? 105  ALA A C   1 
ATOM   754   O  O   . ALA A  1  105 ? 31.323   -30.494  244.030 1.00 142.58 ? 105  ALA A O   1 
ATOM   755   C  CB  . ALA A  1  105 ? 30.862   -29.065  246.935 1.00 145.32 ? 105  ALA A CB  1 
ATOM   756   N  N   . ASP A  1  106 ? 29.295   -29.534  244.232 1.00 180.81 ? 106  ASP A N   1 
ATOM   757   C  CA  . ASP A  1  106 ? 28.623   -30.437  243.300 1.00 179.86 ? 106  ASP A CA  1 
ATOM   758   C  C   . ASP A  1  106 ? 27.706   -29.623  242.393 1.00 176.65 ? 106  ASP A C   1 
ATOM   759   O  O   . ASP A  1  106 ? 26.491   -29.595  242.594 1.00 175.99 ? 106  ASP A O   1 
ATOM   760   C  CB  . ASP A  1  106 ? 27.829   -31.506  244.059 1.00 181.83 ? 106  ASP A CB  1 
ATOM   761   C  CG  . ASP A  1  106 ? 27.313   -32.612  243.152 1.00 190.97 ? 106  ASP A CG  1 
ATOM   762   O  OD1 . ASP A  1  106 ? 27.298   -32.429  241.916 1.00 179.20 ? 106  ASP A OD1 1 
ATOM   763   O  OD2 . ASP A  1  106 ? 26.919   -33.673  243.683 1.00 214.12 ? 106  ASP A OD2 1 
ATOM   764   N  N   . PRO A  1  107 ? 28.288   -28.952  241.387 1.00 133.87 ? 107  PRO A N   1 
ATOM   765   C  CA  . PRO A  1  107 ? 27.512   -28.058  240.518 1.00 130.88 ? 107  PRO A CA  1 
ATOM   766   C  C   . PRO A  1  107 ? 26.424   -28.762  239.707 1.00 129.68 ? 107  PRO A C   1 
ATOM   767   O  O   . PRO A  1  107 ? 25.404   -28.144  239.402 1.00 127.74 ? 107  PRO A O   1 
ATOM   768   C  CB  . PRO A  1  107 ? 28.576   -27.474  239.578 1.00 129.70 ? 107  PRO A CB  1 
ATOM   769   C  CG  . PRO A  1  107 ? 29.875   -27.665  240.282 1.00 132.05 ? 107  PRO A CG  1 
ATOM   770   C  CD  . PRO A  1  107 ? 29.724   -28.930  241.057 1.00 134.56 ? 107  PRO A CD  1 
ATOM   771   N  N   . THR A  1  108 ? 26.631   -30.032  239.374 1.00 164.86 ? 108  THR A N   1 
ATOM   772   C  CA  . THR A  1  108 ? 25.760   -30.719  238.423 1.00 163.72 ? 108  THR A CA  1 
ATOM   773   C  C   . THR A  1  108 ? 24.568   -31.428  239.068 1.00 164.67 ? 108  THR A C   1 
ATOM   774   O  O   . THR A  1  108 ? 23.699   -31.938  238.361 1.00 164.49 ? 108  THR A O   1 
ATOM   775   C  CB  . THR A  1  108 ? 26.558   -31.759  237.604 1.00 168.38 ? 108  THR A CB  1 
ATOM   776   O  OG1 . THR A  1  108 ? 25.752   -32.236  236.520 1.00 190.33 ? 108  THR A OG1 1 
ATOM   777   C  CG2 . THR A  1  108 ? 26.990   -32.939  238.472 1.00 167.63 ? 108  THR A CG2 1 
ATOM   778   N  N   . HIS A  1  109 ? 24.526   -31.461  240.398 1.00 132.66 ? 109  HIS A N   1 
ATOM   779   C  CA  . HIS A  1  109 ? 23.466   -32.171  241.114 1.00 133.94 ? 109  HIS A CA  1 
ATOM   780   C  C   . HIS A  1  109 ? 22.734   -31.273  242.105 1.00 133.82 ? 109  HIS A C   1 
ATOM   781   O  O   . HIS A  1  109 ? 21.579   -31.532  242.444 1.00 133.97 ? 109  HIS A O   1 
ATOM   782   C  CB  . HIS A  1  109 ? 24.044   -33.385  241.838 1.00 137.09 ? 109  HIS A CB  1 
ATOM   783   C  CG  . HIS A  1  109 ? 24.594   -34.428  240.916 1.00 137.50 ? 109  HIS A CG  1 
ATOM   784   N  ND1 . HIS A  1  109 ? 25.790   -35.074  241.149 1.00 139.64 ? 109  HIS A ND1 1 
ATOM   785   C  CD2 . HIS A  1  109 ? 24.114   -34.935  239.755 1.00 136.14 ? 109  HIS A CD2 1 
ATOM   786   C  CE1 . HIS A  1  109 ? 26.020   -35.935  240.174 1.00 139.58 ? 109  HIS A CE1 1 
ATOM   787   N  NE2 . HIS A  1  109 ? 25.019   -35.870  239.315 1.00 137.48 ? 109  HIS A NE2 1 
ATOM   788   N  N   . ILE A  1  110 ? 23.401   -30.219  242.565 1.00 150.95 ? 110  ILE A N   1 
ATOM   789   C  CA  . ILE A  1  110 ? 22.784   -29.275  243.491 1.00 150.86 ? 110  ILE A CA  1 
ATOM   790   C  C   . ILE A  1  110 ? 22.112   -28.157  242.709 1.00 147.83 ? 110  ILE A C   1 
ATOM   791   O  O   . ILE A  1  110 ? 22.649   -27.671  241.712 1.00 146.04 ? 110  ILE A O   1 
ATOM   792   C  CB  . ILE A  1  110 ? 23.809   -28.672  244.471 1.00 152.41 ? 110  ILE A CB  1 
ATOM   793   C  CG1 . ILE A  1  110 ? 24.557   -29.781  245.216 1.00 155.54 ? 110  ILE A CG1 1 
ATOM   794   C  CG2 . ILE A  1  110 ? 23.120   -27.721  245.452 1.00 152.49 ? 110  ILE A CG2 1 
ATOM   795   C  CD1 . ILE A  1  110 ? 23.684   -30.626  246.126 1.00 157.60 ? 110  ILE A CD1 1 
ATOM   796   N  N   . LYS A  1  111 ? 20.934   -27.754  243.171 1.00 140.06 ? 111  LYS A N   1 
ATOM   797   C  CA  . LYS A  1  111 ? 20.188   -26.673  242.546 1.00 137.40 ? 111  LYS A CA  1 
ATOM   798   C  C   . LYS A  1  111 ? 20.461   -25.365  243.290 1.00 137.30 ? 111  LYS A C   1 
ATOM   799   O  O   . LYS A  1  111 ? 20.382   -25.327  244.518 1.00 139.22 ? 111  LYS A O   1 
ATOM   800   C  CB  . LYS A  1  111 ? 18.696   -27.002  242.550 1.00 136.98 ? 111  LYS A CB  1 
ATOM   801   C  CG  . LYS A  1  111 ? 18.333   -28.169  241.650 1.00 136.73 ? 111  LYS A CG  1 
ATOM   802   C  CD  . LYS A  1  111 ? 17.194   -28.980  242.243 1.00 138.08 ? 111  LYS A CD  1 
ATOM   803   C  CE  . LYS A  1  111 ? 16.953   -30.254  241.454 1.00 138.30 ? 111  LYS A CE  1 
ATOM   804   N  NZ  . LYS A  1  111 ? 16.193   -31.262  242.244 1.00 140.48 ? 111  LYS A NZ  1 
ATOM   805   N  N   . PRO A  1  112 ? 20.787   -24.287  242.557 1.00 125.19 ? 112  PRO A N   1 
ATOM   806   C  CA  . PRO A  1  112 ? 21.097   -23.016  243.224 1.00 125.14 ? 112  PRO A CA  1 
ATOM   807   C  C   . PRO A  1  112 ? 19.890   -22.415  243.941 1.00 125.02 ? 112  PRO A C   1 
ATOM   808   O  O   . PRO A  1  112 ? 18.806   -22.331  243.361 1.00 123.43 ? 112  PRO A O   1 
ATOM   809   C  CB  . PRO A  1  112 ? 21.559   -22.119  242.072 1.00 122.73 ? 112  PRO A CB  1 
ATOM   810   C  CG  . PRO A  1  112 ? 20.903   -22.687  240.866 1.00 121.06 ? 112  PRO A CG  1 
ATOM   811   C  CD  . PRO A  1  112 ? 20.859   -24.167  241.090 1.00 122.85 ? 112  PRO A CD  1 
ATOM   812   N  N   . SER A  1  113 ? 20.087   -22.008  245.191 1.00 137.45 ? 113  SER A N   1 
ATOM   813   C  CA  . SER A  1  113 ? 19.002   -21.487  246.012 1.00 137.78 ? 113  SER A CA  1 
ATOM   814   C  C   . SER A  1  113 ? 19.481   -20.419  246.987 1.00 138.74 ? 113  SER A C   1 
ATOM   815   O  O   . SER A  1  113 ? 20.432   -20.629  247.741 1.00 140.79 ? 113  SER A O   1 
ATOM   816   C  CB  . SER A  1  113 ? 18.332   -22.622  246.787 1.00 139.90 ? 113  SER A CB  1 
ATOM   817   O  OG  . SER A  1  113 ? 17.248   -22.141  247.561 1.00 140.30 ? 113  SER A OG  1 
ATOM   818   N  N   . ALA A  1  114 ? 18.810   -19.273  246.956 1.00 167.57 ? 114  ALA A N   1 
ATOM   819   C  CA  . ALA A  1  114 ? 19.014   -18.217  247.937 1.00 172.57 ? 114  ALA A CA  1 
ATOM   820   C  C   . ALA A  1  114 ? 17.670   -17.916  248.582 1.00 188.34 ? 114  ALA A C   1 
ATOM   821   O  O   . ALA A  1  114 ? 16.666   -18.532  248.230 1.00 205.54 ? 114  ALA A O   1 
ATOM   822   C  CB  . ALA A  1  114 ? 19.596   -16.972  247.287 1.00 159.76 ? 114  ALA A CB  1 
ATOM   823   N  N   . GLN A  1  115 ? 17.659   -16.975  249.522 1.00 143.85 ? 115  GLN A N   1 
ATOM   824   C  CA  . GLN A  1  115 ? 16.426   -16.528  250.168 1.00 144.17 ? 115  GLN A CA  1 
ATOM   825   C  C   . GLN A  1  115 ? 15.717   -17.635  250.948 1.00 146.27 ? 115  GLN A C   1 
ATOM   826   O  O   . GLN A  1  115 ? 15.032   -18.481  250.372 1.00 145.60 ? 115  GLN A O   1 
ATOM   827   C  CB  . GLN A  1  115 ? 15.465   -15.947  249.128 1.00 141.38 ? 115  GLN A CB  1 
ATOM   828   C  CG  . GLN A  1  115 ? 14.153   -15.436  249.701 1.00 141.59 ? 115  GLN A CG  1 
ATOM   829   C  CD  . GLN A  1  115 ? 13.167   -15.081  248.618 1.00 138.98 ? 115  GLN A CD  1 
ATOM   830   O  OE1 . GLN A  1  115 ? 13.415   -15.325  247.439 1.00 137.10 ? 115  GLN A OE1 1 
ATOM   831   N  NE2 . GLN A  1  115 ? 12.034   -14.518  249.009 1.00 138.96 ? 115  GLN A NE2 1 
ATOM   832   N  N   . VAL A  1  116 ? 15.880   -17.609  252.266 1.00 193.34 ? 116  VAL A N   1 
ATOM   833   C  CA  . VAL A  1  116 ? 15.145   -18.501  253.154 1.00 184.96 ? 116  VAL A CA  1 
ATOM   834   C  C   . VAL A  1  116 ? 13.838   -17.841  253.571 1.00 180.50 ? 116  VAL A C   1 
ATOM   835   O  O   . VAL A  1  116 ? 13.819   -16.668  253.947 1.00 183.64 ? 116  VAL A O   1 
ATOM   836   C  CB  . VAL A  1  116 ? 15.957   -18.857  254.411 1.00 184.38 ? 116  VAL A CB  1 
ATOM   837   C  CG1 . VAL A  1  116 ? 15.191   -19.849  255.282 1.00 182.96 ? 116  VAL A CG1 1 
ATOM   838   C  CG2 . VAL A  1  116 ? 17.316   -19.417  254.022 1.00 189.79 ? 116  VAL A CG2 1 
ATOM   839   N  N   . VAL A  1  117 ? 12.748   -18.597  253.500 1.00 136.22 ? 117  VAL A N   1 
ATOM   840   C  CA  . VAL A  1  117 ? 11.443   -18.102  253.919 1.00 136.32 ? 117  VAL A CA  1 
ATOM   841   C  C   . VAL A  1  117 ? 11.203   -18.466  255.378 1.00 139.68 ? 117  VAL A C   1 
ATOM   842   O  O   . VAL A  1  117 ? 11.533   -19.570  255.810 1.00 141.68 ? 117  VAL A O   1 
ATOM   843   C  CB  . VAL A  1  117 ? 10.311   -18.681  253.050 1.00 134.74 ? 117  VAL A CB  1 
ATOM   844   C  CG1 . VAL A  1  117 ? 8.986    -18.025  253.400 1.00 134.64 ? 117  VAL A CG1 1 
ATOM   845   C  CG2 . VAL A  1  117 ? 10.623   -18.494  251.571 1.00 131.65 ? 117  VAL A CG2 1 
ATOM   846   N  N   . TRP A  1  118 ? 10.632   -17.537  256.137 1.00 140.41 ? 118  TRP A N   1 
ATOM   847   C  CA  . TRP A  1  118 ? 10.367   -17.774  257.551 1.00 143.70 ? 118  TRP A CA  1 
ATOM   848   C  C   . TRP A  1  118 ? 9.212    -18.751  257.739 1.00 144.75 ? 118  TRP A C   1 
ATOM   849   O  O   . TRP A  1  118 ? 8.175    -18.614  257.090 1.00 143.00 ? 118  TRP A O   1 
ATOM   850   C  CB  . TRP A  1  118 ? 10.047   -16.465  258.278 1.00 144.22 ? 118  TRP A CB  1 
ATOM   851   C  CG  . TRP A  1  118 ? 11.247   -15.635  258.616 1.00 144.60 ? 118  TRP A CG  1 
ATOM   852   C  CD1 . TRP A  1  118 ? 12.447   -16.081  259.084 1.00 146.34 ? 118  TRP A CD1 1 
ATOM   853   C  CD2 . TRP A  1  118 ? 11.358   -14.212  258.520 1.00 143.35 ? 118  TRP A CD2 1 
ATOM   854   N  NE1 . TRP A  1  118 ? 13.299   -15.024  259.287 1.00 146.24 ? 118  TRP A NE1 1 
ATOM   855   C  CE2 . TRP A  1  118 ? 12.655   -13.864  258.945 1.00 144.41 ? 118  TRP A CE2 1 
ATOM   856   C  CE3 . TRP A  1  118 ? 10.487   -13.197  258.115 1.00 141.52 ? 118  TRP A CE3 1 
ATOM   857   C  CZ2 . TRP A  1  118 ? 13.102   -12.545  258.976 1.00 143.71 ? 118  TRP A CZ2 1 
ATOM   858   C  CZ3 . TRP A  1  118 ? 10.931   -11.889  258.146 1.00 140.83 ? 118  TRP A CZ3 1 
ATOM   859   C  CH2 . TRP A  1  118 ? 12.227   -11.575  258.573 1.00 141.92 ? 118  TRP A CH2 1 
ATOM   860   N  N   . PRO A  1  119 ? 9.384    -19.746  258.625 1.00 151.38 ? 119  PRO A N   1 
ATOM   861   C  CA  . PRO A  1  119 ? 8.238    -20.605  258.933 1.00 152.72 ? 119  PRO A CA  1 
ATOM   862   C  C   . PRO A  1  119 ? 7.131    -19.826  259.633 1.00 153.51 ? 119  PRO A C   1 
ATOM   863   O  O   . PRO A  1  119 ? 7.235    -19.515  260.819 1.00 156.08 ? 119  PRO A O   1 
ATOM   864   C  CB  . PRO A  1  119 ? 8.832    -21.675  259.860 1.00 156.05 ? 119  PRO A CB  1 
ATOM   865   C  CG  . PRO A  1  119 ? 10.287   -21.664  259.576 1.00 155.63 ? 119  PRO A CG  1 
ATOM   866   C  CD  . PRO A  1  119 ? 10.623   -20.245  259.246 1.00 153.54 ? 119  PRO A CD  1 
ATOM   867   N  N   . ILE A  1  120 ? 6.083    -19.502  258.888 1.00 147.69 ? 120  ILE A N   1 
ATOM   868   C  CA  . ILE A  1  120 ? 4.929    -18.828  259.457 1.00 148.36 ? 120  ILE A CA  1 
ATOM   869   C  C   . ILE A  1  120 ? 3.759    -19.000  258.504 1.00 146.26 ? 120  ILE A C   1 
ATOM   870   O  O   . ILE A  1  120 ? 3.953    -19.144  257.299 1.00 143.62 ? 120  ILE A O   1 
ATOM   871   C  CB  . ILE A  1  120 ? 5.216    -17.324  259.732 1.00 147.73 ? 120  ILE A CB  1 
ATOM   872   C  CG1 . ILE A  1  120 ? 4.211    -16.759  260.740 1.00 149.65 ? 120  ILE A CG1 1 
ATOM   873   C  CG2 . ILE A  1  120 ? 5.215    -16.501  258.444 1.00 144.04 ? 120  ILE A CG2 1 
ATOM   874   C  CD1 . ILE A  1  120 ? 4.452    -17.216  262.165 1.00 153.53 ? 120  ILE A CD1 1 
ATOM   875   N  N   . VAL A  1  121 ? 2.554    -19.015  259.064 1.00 180.51 ? 121  VAL A N   1 
ATOM   876   C  CA  . VAL A  1  121 ? 1.313    -19.204  258.311 1.00 178.99 ? 121  VAL A CA  1 
ATOM   877   C  C   . VAL A  1  121 ? 1.407    -20.275  257.213 1.00 177.44 ? 121  VAL A C   1 
ATOM   878   O  O   . VAL A  1  121 ? 0.719    -20.197  256.195 1.00 175.13 ? 121  VAL A O   1 
ATOM   879   C  CB  . VAL A  1  121 ? 0.836    -17.861  257.685 1.00 176.41 ? 121  VAL A CB  1 
ATOM   880   C  CG1 . VAL A  1  121 ? 0.645    -16.813  258.775 1.00 178.08 ? 121  VAL A CG1 1 
ATOM   881   C  CG2 . VAL A  1  121 ? 1.784    -17.340  256.600 1.00 173.45 ? 121  VAL A CG2 1 
ATOM   882   N  N   . GLY A  1  122 ? 2.255    -21.277  257.435 1.00 199.72 ? 122  GLY A N   1 
ATOM   883   C  CA  . GLY A  1  122 ? 2.372    -22.411  256.534 1.00 198.57 ? 122  GLY A CA  1 
ATOM   884   C  C   . GLY A  1  122 ? 3.127    -22.117  255.251 1.00 182.56 ? 122  GLY A C   1 
ATOM   885   O  O   . GLY A  1  122 ? 3.120    -22.925  254.322 1.00 180.59 ? 122  GLY A O   1 
ATOM   886   N  N   . GLN A  1  123 ? 3.784    -20.964  255.200 1.00 155.02 ? 123  GLN A N   1 
ATOM   887   C  CA  . GLN A  1  123 ? 4.527    -20.556  254.013 1.00 152.10 ? 123  GLN A CA  1 
ATOM   888   C  C   . GLN A  1  123 ? 5.891    -21.239  253.942 1.00 152.67 ? 123  GLN A C   1 
ATOM   889   O  O   . GLN A  1  123 ? 6.623    -21.079  252.964 1.00 150.54 ? 123  GLN A O   1 
ATOM   890   C  CB  . GLN A  1  123 ? 4.681    -19.036  253.994 1.00 150.68 ? 123  GLN A CB  1 
ATOM   891   C  CG  . GLN A  1  123 ? 5.797    -18.493  254.874 1.00 152.15 ? 123  GLN A CG  1 
ATOM   892   C  CD  . GLN A  1  123 ? 5.731    -16.986  255.018 1.00 151.20 ? 123  GLN A CD  1 
ATOM   893   O  OE1 . GLN A  1  123 ? 4.666    -16.388  254.876 1.00 150.36 ? 123  GLN A OE1 1 
ATOM   894   N  NE2 . GLN A  1  123 ? 6.869    -16.363  255.296 1.00 161.89 ? 123  GLN A NE2 1 
ATOM   895   N  N   . GLY A  1  124 ? 6.233    -21.994  254.983 1.00 153.12 ? 124  GLY A N   1 
ATOM   896   C  CA  . GLY A  1  124 ? 7.493    -22.714  255.026 1.00 154.08 ? 124  GLY A CA  1 
ATOM   897   C  C   . GLY A  1  124 ? 7.599    -23.764  253.935 1.00 152.83 ? 124  GLY A C   1 
ATOM   898   O  O   . GLY A  1  124 ? 8.689    -24.250  253.635 1.00 152.88 ? 124  GLY A O   1 
ATOM   899   N  N   . ILE A  1  125 ? 6.460    -24.121  253.349 1.00 177.53 ? 125  ILE A N   1 
ATOM   900   C  CA  . ILE A  1  125 ? 6.418    -25.097  252.267 1.00 176.33 ? 125  ILE A CA  1 
ATOM   901   C  C   . ILE A  1  125 ? 7.219    -24.630  251.051 1.00 173.45 ? 125  ILE A C   1 
ATOM   902   O  O   . ILE A  1  125 ? 7.719    -25.447  250.278 1.00 172.88 ? 125  ILE A O   1 
ATOM   903   C  CB  . ILE A  1  125 ? 4.959    -25.389  251.841 1.00 179.32 ? 125  ILE A CB  1 
ATOM   904   C  CG1 . ILE A  1  125 ? 4.916    -26.499  250.787 1.00 174.79 ? 125  ILE A CG1 1 
ATOM   905   C  CG2 . ILE A  1  125 ? 4.282    -24.118  251.325 1.00 177.90 ? 125  ILE A CG2 1 
ATOM   906   C  CD1 . ILE A  1  125 ? 3.523    -27.008  250.487 1.00 174.73 ? 125  ILE A CD1 1 
ATOM   907   N  N   . LEU A  1  126 ? 7.347    -23.316  250.891 1.00 164.87 ? 126  LEU A N   1 
ATOM   908   C  CA  . LEU A  1  126 ? 8.059    -22.752  249.748 1.00 162.16 ? 126  LEU A CA  1 
ATOM   909   C  C   . LEU A  1  126 ? 9.560    -23.014  249.829 1.00 162.86 ? 126  LEU A C   1 
ATOM   910   O  O   . LEU A  1  126 ? 10.277   -22.857  248.841 1.00 167.57 ? 126  LEU A O   1 
ATOM   911   C  CB  . LEU A  1  126 ? 7.793    -21.248  249.642 1.00 160.45 ? 126  LEU A CB  1 
ATOM   912   C  CG  . LEU A  1  126 ? 6.319    -20.840  249.560 1.00 159.73 ? 126  LEU A CG  1 
ATOM   913   C  CD1 . LEU A  1  126 ? 6.187    -19.330  249.419 1.00 158.08 ? 126  LEU A CD1 1 
ATOM   914   C  CD2 . LEU A  1  126 ? 5.612    -21.557  248.416 1.00 158.18 ? 126  LEU A CD2 1 
ATOM   915   N  N   . ASN A  1  127 ? 10.031   -23.416  251.006 1.00 171.63 ? 127  ASN A N   1 
ATOM   916   C  CA  . ASN A  1  127 ? 11.419   -23.827  251.170 1.00 171.60 ? 127  ASN A CA  1 
ATOM   917   C  C   . ASN A  1  127 ? 11.601   -25.262  250.695 1.00 177.20 ? 127  ASN A C   1 
ATOM   918   O  O   . ASN A  1  127 ? 11.700   -26.187  251.502 1.00 181.01 ? 127  ASN A O   1 
ATOM   919   C  CB  . ASN A  1  127 ? 11.854   -23.693  252.628 1.00 170.85 ? 127  ASN A CB  1 
ATOM   920   C  CG  . ASN A  1  127 ? 11.810   -22.261  253.120 1.00 177.82 ? 127  ASN A CG  1 
ATOM   921   O  OD1 . ASN A  1  127 ? 12.268   -21.344  252.439 1.00 168.37 ? 127  ASN A OD1 1 
ATOM   922   N  ND2 . ASN A  1  127 ? 11.254   -22.061  254.309 1.00 196.89 ? 127  ASN A ND2 1 
ATOM   923   N  N   . GLY A  1  128 ? 11.645   -25.440  249.379 1.00 213.93 ? 128  GLY A N   1 
ATOM   924   C  CA  . GLY A  1  128 ? 11.716   -26.764  248.792 1.00 212.98 ? 128  GLY A CA  1 
ATOM   925   C  C   . GLY A  1  128 ? 13.112   -27.351  248.830 1.00 211.59 ? 128  GLY A C   1 
ATOM   926   O  O   . GLY A  1  128 ? 14.100   -26.630  248.968 1.00 206.02 ? 128  GLY A O   1 
ATOM   927   N  N   . ASP A  1  129 ? 13.189   -28.672  248.705 1.00 187.82 ? 129  ASP A N   1 
ATOM   928   C  CA  . ASP A  1  129 ? 14.467   -29.368  248.707 1.00 187.20 ? 129  ASP A CA  1 
ATOM   929   C  C   . ASP A  1  129 ? 15.186   -29.156  247.381 1.00 180.18 ? 129  ASP A C   1 
ATOM   930   O  O   . ASP A  1  129 ? 14.680   -29.536  246.325 1.00 178.55 ? 129  ASP A O   1 
ATOM   931   C  CB  . ASP A  1  129 ? 14.264   -30.863  248.965 1.00 196.65 ? 129  ASP A CB  1 
ATOM   932   C  CG  . ASP A  1  129 ? 15.463   -31.508  249.634 1.00 202.24 ? 129  ASP A CG  1 
ATOM   933   O  OD1 . ASP A  1  129 ? 16.603   -31.070  249.369 1.00 202.25 ? 129  ASP A OD1 1 
ATOM   934   O  OD2 . ASP A  1  129 ? 15.265   -32.454  250.425 1.00 205.49 ? 129  ASP A OD2 1 
ATOM   935   N  N   . VAL A  1  130 ? 16.365   -28.547  247.448 1.00 153.13 ? 130  VAL A N   1 
ATOM   936   C  CA  . VAL A  1  130 ? 17.151   -28.240  246.257 1.00 150.98 ? 130  VAL A CA  1 
ATOM   937   C  C   . VAL A  1  130 ? 18.465   -29.016  246.260 1.00 152.55 ? 130  VAL A C   1 
ATOM   938   O  O   . VAL A  1  130 ? 19.387   -28.698  245.507 1.00 151.32 ? 130  VAL A O   1 
ATOM   939   C  CB  . VAL A  1  130 ? 17.436   -26.728  246.154 1.00 149.16 ? 130  VAL A CB  1 
ATOM   940   C  CG1 . VAL A  1  130 ? 16.130   -25.958  246.023 1.00 147.49 ? 130  VAL A CG1 1 
ATOM   941   C  CG2 . VAL A  1  130 ? 18.226   -26.245  247.360 1.00 151.14 ? 130  VAL A CG2 1 
ATOM   942   N  N   . GLY A  1  131 ? 18.544   -30.035  247.111 1.00 168.13 ? 131  GLY A N   1 
ATOM   943   C  CA  . GLY A  1  131 ? 19.736   -30.855  247.214 1.00 169.98 ? 131  GLY A CA  1 
ATOM   944   C  C   . GLY A  1  131 ? 20.820   -30.210  248.054 1.00 171.29 ? 131  GLY A C   1 
ATOM   945   O  O   . GLY A  1  131 ? 20.883   -28.986  248.176 1.00 170.01 ? 131  GLY A O   1 
ATOM   946   N  N   . GLY A  1  132 ? 21.676   -31.042  248.638 1.00 195.24 ? 132  GLY A N   1 
ATOM   947   C  CA  . GLY A  1  132 ? 22.776   -30.564  249.455 1.00 196.89 ? 132  GLY A CA  1 
ATOM   948   C  C   . GLY A  1  132 ? 22.336   -30.258  250.871 1.00 198.91 ? 132  GLY A C   1 
ATOM   949   O  O   . GLY A  1  132 ? 23.029   -29.557  251.607 1.00 202.56 ? 132  GLY A O   1 
ATOM   950   N  N   . GLY A  1  133 ? 21.180   -30.791  251.256 1.00 179.58 ? 133  GLY A N   1 
ATOM   951   C  CA  . GLY A  1  133 ? 20.653   -30.580  252.591 1.00 181.72 ? 133  GLY A CA  1 
ATOM   952   C  C   . GLY A  1  133 ? 20.313   -29.135  252.858 1.00 180.23 ? 133  GLY A C   1 
ATOM   953   O  O   . GLY A  1  133 ? 20.541   -28.625  253.955 1.00 182.01 ? 133  GLY A O   1 
ATOM   954   N  N   . PHE A  1  134 ? 19.762   -28.478  251.845 1.00 205.51 ? 134  PHE A N   1 
ATOM   955   C  CA  . PHE A  1  134 ? 19.411   -27.074  251.951 1.00 208.70 ? 134  PHE A CA  1 
ATOM   956   C  C   . PHE A  1  134 ? 17.974   -26.870  251.494 1.00 212.20 ? 134  PHE A C   1 
ATOM   957   O  O   . PHE A  1  134 ? 17.569   -27.379  250.449 1.00 213.51 ? 134  PHE A O   1 
ATOM   958   C  CB  . PHE A  1  134 ? 20.374   -26.226  251.123 1.00 197.33 ? 134  PHE A CB  1 
ATOM   959   C  CG  . PHE A  1  134 ? 20.212   -24.753  251.331 1.00 187.27 ? 134  PHE A CG  1 
ATOM   960   C  CD1 . PHE A  1  134 ? 20.873   -24.115  252.367 1.00 185.48 ? 134  PHE A CD1 1 
ATOM   961   C  CD2 . PHE A  1  134 ? 19.412   -24.002  250.489 1.00 185.66 ? 134  PHE A CD2 1 
ATOM   962   C  CE1 . PHE A  1  134 ? 20.733   -22.757  252.565 1.00 184.39 ? 134  PHE A CE1 1 
ATOM   963   C  CE2 . PHE A  1  134 ? 19.267   -22.643  250.681 1.00 190.12 ? 134  PHE A CE2 1 
ATOM   964   C  CZ  . PHE A  1  134 ? 19.930   -22.019  251.720 1.00 191.74 ? 134  PHE A CZ  1 
ATOM   965   N  N   . HIS A  1  135 ? 17.208   -26.137  252.295 1.00 191.87 ? 135  HIS A N   1 
ATOM   966   C  CA  . HIS A  1  135 ? 15.809   -25.859  251.992 1.00 185.43 ? 135  HIS A CA  1 
ATOM   967   C  C   . HIS A  1  135 ? 15.592   -24.365  251.802 1.00 191.60 ? 135  HIS A C   1 
ATOM   968   O  O   . HIS A  1  135 ? 15.943   -23.557  252.663 1.00 199.83 ? 135  HIS A O   1 
ATOM   969   C  CB  . HIS A  1  135 ? 14.902   -26.393  253.102 1.00 187.96 ? 135  HIS A CB  1 
ATOM   970   C  CG  . HIS A  1  135 ? 14.813   -27.887  253.142 1.00 189.77 ? 135  HIS A CG  1 
ATOM   971   N  ND1 . HIS A  1  135 ? 15.775   -28.675  253.737 1.00 192.35 ? 135  HIS A ND1 1 
ATOM   972   C  CD2 . HIS A  1  135 ? 13.877   -28.738  252.658 1.00 189.47 ? 135  HIS A CD2 1 
ATOM   973   C  CE1 . HIS A  1  135 ? 15.435   -29.946  253.619 1.00 193.56 ? 135  HIS A CE1 1 
ATOM   974   N  NE2 . HIS A  1  135 ? 14.287   -30.012  252.968 1.00 191.86 ? 135  HIS A NE2 1 
ATOM   975   N  N   . GLY A  1  136 ? 15.011   -24.008  250.662 1.00 171.50 ? 136  GLY A N   1 
ATOM   976   C  CA  . GLY A  1  136 ? 14.762   -22.622  250.321 1.00 163.18 ? 136  GLY A CA  1 
ATOM   977   C  C   . GLY A  1  136 ? 14.150   -22.523  248.938 1.00 160.22 ? 136  GLY A C   1 
ATOM   978   O  O   . GLY A  1  136 ? 13.763   -23.535  248.353 1.00 160.02 ? 136  GLY A O   1 
ATOM   979   N  N   . ILE A  1  137 ? 14.064   -21.304  248.414 1.00 144.19 ? 137  ILE A N   1 
ATOM   980   C  CA  . ILE A  1  137 ? 13.490   -21.079  247.091 1.00 141.37 ? 137  ILE A CA  1 
ATOM   981   C  C   . ILE A  1  137 ? 14.566   -21.163  246.018 1.00 139.94 ? 137  ILE A C   1 
ATOM   982   O  O   . ILE A  1  137 ? 15.603   -20.507  246.109 1.00 139.90 ? 137  ILE A O   1 
ATOM   983   C  CB  . ILE A  1  137 ? 12.788   -19.711  246.993 1.00 139.73 ? 137  ILE A CB  1 
ATOM   984   C  CG1 . ILE A  1  137 ? 11.613   -19.654  247.972 1.00 141.10 ? 137  ILE A CG1 1 
ATOM   985   C  CG2 . ILE A  1  137 ? 12.304   -19.457  245.561 1.00 136.86 ? 137  ILE A CG2 1 
ATOM   986   C  CD1 . ILE A  1  137 ? 10.964   -18.289  248.082 1.00 139.96 ? 137  ILE A CD1 1 
ATOM   987   N  N   . GLN A  1  138 ? 14.310   -21.982  245.006 1.00 125.08 ? 138  GLN A N   1 
ATOM   988   C  CA  . GLN A  1  138 ? 15.233   -22.140  243.892 1.00 123.73 ? 138  GLN A CA  1 
ATOM   989   C  C   . GLN A  1  138 ? 15.264   -20.869  243.052 1.00 121.19 ? 138  GLN A C   1 
ATOM   990   O  O   . GLN A  1  138 ? 14.223   -20.390  242.603 1.00 119.64 ? 138  GLN A O   1 
ATOM   991   C  CB  . GLN A  1  138 ? 14.826   -23.337  243.034 1.00 123.35 ? 138  GLN A CB  1 
ATOM   992   C  CG  . GLN A  1  138 ? 15.732   -23.591  241.844 1.00 122.10 ? 138  GLN A CG  1 
ATOM   993   C  CD  . GLN A  1  138 ? 15.339   -24.834  241.071 1.00 122.03 ? 138  GLN A CD  1 
ATOM   994   O  OE1 . GLN A  1  138 ? 14.617   -25.694  241.578 1.00 123.44 ? 138  GLN A OE1 1 
ATOM   995   N  NE2 . GLN A  1  138 ? 15.802   -24.929  239.831 1.00 120.48 ? 138  GLN A NE2 1 
ATOM   996   N  N   . ILE A  1  139 ? 16.463   -20.331  242.845 1.00 119.63 ? 139  ILE A N   1 
ATOM   997   C  CA  . ILE A  1  139 ? 16.633   -19.079  242.112 1.00 117.47 ? 139  ILE A CA  1 
ATOM   998   C  C   . ILE A  1  139 ? 16.894   -19.323  240.628 1.00 115.55 ? 139  ILE A C   1 
ATOM   999   O  O   . ILE A  1  139 ? 17.378   -20.387  240.240 1.00 116.13 ? 139  ILE A O   1 
ATOM   1000  C  CB  . ILE A  1  139 ? 17.788   -18.247  242.693 1.00 118.21 ? 139  ILE A CB  1 
ATOM   1001  C  CG1 . ILE A  1  139 ? 19.085   -19.059  242.704 1.00 119.56 ? 139  ILE A CG1 1 
ATOM   1002  C  CG2 . ILE A  1  139 ? 17.453   -17.803  244.105 1.00 119.95 ? 139  ILE A CG2 1 
ATOM   1003  C  CD1 . ILE A  1  139 ? 20.320   -18.216  242.620 1.00 119.39 ? 139  ILE A CD1 1 
ATOM   1004  N  N   . THR A  1  140 ? 16.563   -18.329  239.808 1.00 113.38 ? 140  THR A N   1 
ATOM   1005  C  CA  . THR A  1  140 ? 16.734   -18.419  238.360 1.00 111.50 ? 140  THR A CA  1 
ATOM   1006  C  C   . THR A  1  140 ? 17.487   -17.209  237.803 1.00 110.15 ? 140  THR A C   1 
ATOM   1007  O  O   . THR A  1  140 ? 17.426   -16.924  236.606 1.00 108.33 ? 140  THR A O   1 
ATOM   1008  C  CB  . THR A  1  140 ? 15.374   -18.546  237.653 1.00 110.05 ? 140  THR A CB  1 
ATOM   1009  O  OG1 . THR A  1  140 ? 14.545   -17.429  237.997 1.00 109.30 ? 140  THR A OG1 1 
ATOM   1010  C  CG2 . THR A  1  140 ? 14.684   -19.835  238.071 1.00 111.41 ? 140  THR A CG2 1 
ATOM   1011  N  N   . SER A  1  141 ? 18.192   -16.502  238.681 1.00 111.15 ? 141  SER A N   1 
ATOM   1012  C  CA  . SER A  1  141 ? 18.931   -15.303  238.297 1.00 110.15 ? 141  SER A CA  1 
ATOM   1013  C  C   . SER A  1  141 ? 20.279   -15.636  237.664 1.00 110.28 ? 141  SER A C   1 
ATOM   1014  O  O   . SER A  1  141 ? 20.919   -14.778  237.057 1.00 109.26 ? 141  SER A O   1 
ATOM   1015  C  CB  . SER A  1  141 ? 19.153   -14.413  239.520 1.00 111.35 ? 141  SER A CB  1 
ATOM   1016  O  OG  . SER A  1  141 ? 17.929   -14.130  240.170 1.00 111.46 ? 141  SER A OG  1 
ATOM   1017  N  N   . GLY A  1  142 ? 20.703   -16.888  237.804 1.00 118.25 ? 142  GLY A N   1 
ATOM   1018  C  CA  . GLY A  1  142 ? 21.987   -17.329  237.293 1.00 118.69 ? 142  GLY A CA  1 
ATOM   1019  C  C   . GLY A  1  142 ? 23.152   -16.746  238.072 1.00 120.03 ? 142  GLY A C   1 
ATOM   1020  O  O   . GLY A  1  142 ? 24.273   -16.678  237.569 1.00 120.07 ? 142  GLY A O   1 
ATOM   1021  N  N   . LEU A  1  143 ? 22.893   -16.352  239.316 1.00 114.63 ? 143  LEU A N   1 
ATOM   1022  C  CA  . LEU A  1  143 ? 23.915   -15.730  240.153 1.00 116.04 ? 143  LEU A CA  1 
ATOM   1023  C  C   . LEU A  1  143 ? 25.033   -16.705  240.510 1.00 118.05 ? 143  LEU A C   1 
ATOM   1024  O  O   . LEU A  1  143 ? 26.207   -16.343  240.493 1.00 118.61 ? 143  LEU A O   1 
ATOM   1025  C  CB  . LEU A  1  143 ? 23.282   -15.175  241.429 1.00 117.08 ? 143  LEU A CB  1 
ATOM   1026  C  CG  . LEU A  1  143 ? 22.346   -13.985  241.212 1.00 115.35 ? 143  LEU A CG  1 
ATOM   1027  C  CD1 . LEU A  1  143 ? 21.428   -13.793  242.409 1.00 116.46 ? 143  LEU A CD1 1 
ATOM   1028  C  CD2 . LEU A  1  143 ? 23.151   -12.725  240.944 1.00 114.67 ? 143  LEU A CD2 1 
ATOM   1029  N  N   . PHE A  1  144 ? 24.659   -17.938  240.830 1.00 119.21 ? 144  PHE A N   1 
ATOM   1030  C  CA  . PHE A  1  144 ? 25.627   -18.974  241.176 1.00 121.26 ? 144  PHE A CA  1 
ATOM   1031  C  C   . PHE A  1  144 ? 26.561   -19.247  240.009 1.00 120.50 ? 144  PHE A C   1 
ATOM   1032  O  O   . PHE A  1  144 ? 27.751   -19.506  240.192 1.00 121.91 ? 144  PHE A O   1 
ATOM   1033  C  CB  . PHE A  1  144 ? 24.905   -20.256  241.586 1.00 122.46 ? 144  PHE A CB  1 
ATOM   1034  C  CG  . PHE A  1  144 ? 24.330   -20.211  242.970 1.00 124.15 ? 144  PHE A CG  1 
ATOM   1035  C  CD1 . PHE A  1  144 ? 23.559   -19.139  243.383 1.00 123.34 ? 144  PHE A CD1 1 
ATOM   1036  C  CD2 . PHE A  1  144 ? 24.534   -21.257  243.850 1.00 126.65 ? 144  PHE A CD2 1 
ATOM   1037  C  CE1 . PHE A  1  144 ? 23.022   -19.101  244.654 1.00 125.02 ? 144  PHE A CE1 1 
ATOM   1038  C  CE2 . PHE A  1  144 ? 23.993   -21.228  245.119 1.00 128.33 ? 144  PHE A CE2 1 
ATOM   1039  C  CZ  . PHE A  1  144 ? 23.239   -20.148  245.524 1.00 127.53 ? 144  PHE A CZ  1 
ATOM   1040  N  N   . TYR A  1  145 ? 26.007   -19.179  238.805 1.00 118.33 ? 145  TYR A N   1 
ATOM   1041  C  CA  . TYR A  1  145 ? 26.771   -19.420  237.592 1.00 117.49 ? 145  TYR A CA  1 
ATOM   1042  C  C   . TYR A  1  145 ? 27.686   -18.232  237.312 1.00 116.87 ? 145  TYR A C   1 
ATOM   1043  O  O   . TYR A  1  145 ? 28.771   -18.390  236.757 1.00 117.18 ? 145  TYR A O   1 
ATOM   1044  C  CB  . TYR A  1  145 ? 25.827   -19.687  236.417 1.00 115.48 ? 145  TYR A CB  1 
ATOM   1045  C  CG  . TYR A  1  145 ? 24.721   -20.667  236.757 1.00 115.96 ? 145  TYR A CG  1 
ATOM   1046  C  CD1 . TYR A  1  145 ? 24.999   -21.843  237.443 1.00 118.12 ? 145  TYR A CD1 1 
ATOM   1047  C  CD2 . TYR A  1  145 ? 23.403   -20.415  236.401 1.00 114.36 ? 145  TYR A CD2 1 
ATOM   1048  C  CE1 . TYR A  1  145 ? 23.998   -22.742  237.762 1.00 118.69 ? 145  TYR A CE1 1 
ATOM   1049  C  CE2 . TYR A  1  145 ? 22.394   -21.309  236.717 1.00 114.90 ? 145  TYR A CE2 1 
ATOM   1050  C  CZ  . TYR A  1  145 ? 22.698   -22.471  237.396 1.00 117.07 ? 145  TYR A CZ  1 
ATOM   1051  O  OH  . TYR A  1  145 ? 21.700   -23.365  237.712 1.00 117.73 ? 145  TYR A OH  1 
ATOM   1052  N  N   . LEU A  1  146 ? 27.239   -17.042  237.702 1.00 116.09 ? 146  LEU A N   1 
ATOM   1053  C  CA  . LEU A  1  146 ? 28.052   -15.837  237.579 1.00 115.70 ? 146  LEU A CA  1 
ATOM   1054  C  C   . LEU A  1  146 ? 29.230   -15.852  238.555 1.00 117.98 ? 146  LEU A C   1 
ATOM   1055  O  O   . LEU A  1  146 ? 30.354   -15.513  238.184 1.00 118.23 ? 146  LEU A O   1 
ATOM   1056  C  CB  . LEU A  1  146 ? 27.195   -14.590  237.812 1.00 114.45 ? 146  LEU A CB  1 
ATOM   1057  C  CG  . LEU A  1  146 ? 27.934   -13.273  238.079 1.00 114.54 ? 146  LEU A CG  1 
ATOM   1058  C  CD1 . LEU A  1  146 ? 28.788   -12.878  236.886 1.00 113.47 ? 146  LEU A CD1 1 
ATOM   1059  C  CD2 . LEU A  1  146 ? 26.942   -12.174  238.413 1.00 113.53 ? 146  LEU A CD2 1 
ATOM   1060  N  N   . TRP A  1  147 ? 28.964   -16.240  239.800 1.00 129.70 ? 147  TRP A N   1 
ATOM   1061  C  CA  . TRP A  1  147 ? 29.986   -16.238  240.847 1.00 132.07 ? 147  TRP A CA  1 
ATOM   1062  C  C   . TRP A  1  147 ? 31.203   -17.090  240.480 1.00 133.27 ? 147  TRP A C   1 
ATOM   1063  O  O   . TRP A  1  147 ? 32.342   -16.638  240.613 1.00 134.17 ? 147  TRP A O   1 
ATOM   1064  C  CB  . TRP A  1  147 ? 29.401   -16.738  242.174 1.00 133.90 ? 147  TRP A CB  1 
ATOM   1065  C  CG  . TRP A  1  147 ? 28.215   -15.959  242.716 1.00 133.16 ? 147  TRP A CG  1 
ATOM   1066  C  CD1 . TRP A  1  147 ? 27.245   -16.440  243.548 1.00 134.04 ? 147  TRP A CD1 1 
ATOM   1067  C  CD2 . TRP A  1  147 ? 27.876   -14.583  242.466 1.00 131.53 ? 147  TRP A CD2 1 
ATOM   1068  N  NE1 . TRP A  1  147 ? 26.329   -15.458  243.834 1.00 133.07 ? 147  TRP A NE1 1 
ATOM   1069  C  CE2 . TRP A  1  147 ? 26.692   -14.309  243.182 1.00 131.52 ? 147  TRP A CE2 1 
ATOM   1070  C  CE3 . TRP A  1  147 ? 28.456   -13.559  241.709 1.00 130.18 ? 147  TRP A CE3 1 
ATOM   1071  C  CZ2 . TRP A  1  147 ? 26.080   -13.059  243.164 1.00 130.21 ? 147  TRP A CZ2 1 
ATOM   1072  C  CZ3 . TRP A  1  147 ? 27.844   -12.318  241.692 1.00 128.89 ? 147  TRP A CZ3 1 
ATOM   1073  C  CH2 . TRP A  1  147 ? 26.669   -12.079  242.415 1.00 128.91 ? 147  TRP A CH2 1 
ATOM   1074  N  N   . ARG A  1  148 ? 30.965   -18.320  240.031 1.00 123.43 ? 148  ARG A N   1 
ATOM   1075  C  CA  . ARG A  1  148 ? 32.054   -19.232  239.679 1.00 124.70 ? 148  ARG A CA  1 
ATOM   1076  C  C   . ARG A  1  148 ? 32.930   -18.662  238.573 1.00 123.55 ? 148  ARG A C   1 
ATOM   1077  O  O   . ARG A  1  148 ? 34.155   -18.643  238.688 1.00 124.90 ? 148  ARG A O   1 
ATOM   1078  C  CB  . ARG A  1  148 ? 31.509   -20.592  239.243 1.00 124.77 ? 148  ARG A CB  1 
ATOM   1079  C  CG  . ARG A  1  148 ? 31.863   -21.726  240.189 1.00 127.47 ? 148  ARG A CG  1 
ATOM   1080  C  CD  . ARG A  1  148 ? 31.534   -23.081  239.587 1.00 127.62 ? 148  ARG A CD  1 
ATOM   1081  N  NE  . ARG A  1  148 ? 32.346   -23.389  238.411 1.00 127.07 ? 148  ARG A NE  1 
ATOM   1082  C  CZ  . ARG A  1  148 ? 32.686   -24.619  238.031 1.00 128.13 ? 148  ARG A CZ  1 
ATOM   1083  N  NH1 . ARG A  1  148 ? 32.288   -25.676  238.727 1.00 129.82 ? 148  ARG A NH1 1 
ATOM   1084  N  NH2 . ARG A  1  148 ? 33.426   -24.796  236.944 1.00 127.61 ? 148  ARG A NH2 1 
ATOM   1085  N  N   . ALA A  1  149 ? 32.295   -18.196  237.502 1.00 121.14 ? 149  ALA A N   1 
ATOM   1086  C  CA  . ALA A  1  149 ? 33.021   -17.619  236.381 1.00 119.97 ? 149  ALA A CA  1 
ATOM   1087  C  C   . ALA A  1  149 ? 33.773   -16.367  236.825 1.00 120.32 ? 149  ALA A C   1 
ATOM   1088  O  O   . ALA A  1  149 ? 34.739   -15.953  236.187 1.00 120.21 ? 149  ALA A O   1 
ATOM   1089  C  CB  . ALA A  1  149 ? 32.065   -17.291  235.245 1.00 117.42 ? 149  ALA A CB  1 
ATOM   1090  N  N   . SER A  1  150 ? 33.335   -15.785  237.938 1.00 120.89 ? 150  SER A N   1 
ATOM   1091  C  CA  . SER A  1  150 ? 33.971   -14.596  238.493 1.00 121.42 ? 150  SER A CA  1 
ATOM   1092  C  C   . SER A  1  150 ? 35.098   -14.953  239.462 1.00 124.12 ? 150  SER A C   1 
ATOM   1093  O  O   . SER A  1  150 ? 35.909   -14.098  239.817 1.00 124.88 ? 150  SER A O   1 
ATOM   1094  C  CB  . SER A  1  150 ? 32.930   -13.724  239.197 1.00 120.77 ? 150  SER A CB  1 
ATOM   1095  O  OG  . SER A  1  150 ? 31.924   -13.305  238.291 1.00 118.33 ? 150  SER A OG  1 
ATOM   1096  N  N   . GLY A  1  151 ? 35.145   -16.212  239.887 1.00 125.66 ? 151  GLY A N   1 
ATOM   1097  C  CA  . GLY A  1  151 ? 36.232   -16.701  240.718 1.00 128.34 ? 151  GLY A CA  1 
ATOM   1098  C  C   . GLY A  1  151 ? 35.923   -16.745  242.204 1.00 130.22 ? 151  GLY A C   1 
ATOM   1099  O  O   . GLY A  1  151 ? 36.835   -16.843  243.026 1.00 132.52 ? 151  GLY A O   1 
ATOM   1100  N  N   . PHE A  1  152 ? 34.643   -16.674  242.555 1.00 131.36 ? 152  PHE A N   1 
ATOM   1101  C  CA  . PHE A  1  152 ? 34.225   -16.787  243.950 1.00 133.18 ? 152  PHE A CA  1 
ATOM   1102  C  C   . PHE A  1  152 ? 34.326   -18.231  244.428 1.00 135.20 ? 152  PHE A C   1 
ATOM   1103  O  O   . PHE A  1  152 ? 33.933   -19.155  243.716 1.00 134.45 ? 152  PHE A O   1 
ATOM   1104  C  CB  . PHE A  1  152 ? 32.793   -16.282  244.131 1.00 131.69 ? 152  PHE A CB  1 
ATOM   1105  C  CG  . PHE A  1  152 ? 32.679   -14.787  244.226 1.00 130.64 ? 152  PHE A CG  1 
ATOM   1106  C  CD1 . PHE A  1  152 ? 33.028   -14.129  245.394 1.00 132.41 ? 152  PHE A CD1 1 
ATOM   1107  C  CD2 . PHE A  1  152 ? 32.215   -14.041  243.157 1.00 128.02 ? 152  PHE A CD2 1 
ATOM   1108  C  CE1 . PHE A  1  152 ? 32.922   -12.757  245.493 1.00 131.58 ? 152  PHE A CE1 1 
ATOM   1109  C  CE2 . PHE A  1  152 ? 32.106   -12.667  243.252 1.00 127.18 ? 152  PHE A CE2 1 
ATOM   1110  C  CZ  . PHE A  1  152 ? 32.459   -12.026  244.423 1.00 128.96 ? 152  PHE A CZ  1 
ATOM   1111  N  N   . THR A  1  153 ? 34.860   -18.417  245.632 1.00 149.03 ? 153  THR A N   1 
ATOM   1112  C  CA  . THR A  1  153 ? 35.038   -19.748  246.207 1.00 151.33 ? 153  THR A CA  1 
ATOM   1113  C  C   . THR A  1  153 ? 34.704   -19.788  247.699 1.00 153.60 ? 153  THR A C   1 
ATOM   1114  O  O   . THR A  1  153 ? 34.859   -20.826  248.344 1.00 155.86 ? 153  THR A O   1 
ATOM   1115  C  CB  . THR A  1  153 ? 36.481   -20.249  246.014 1.00 152.96 ? 153  THR A CB  1 
ATOM   1116  O  OG1 . THR A  1  153 ? 37.401   -19.297  246.562 1.00 154.03 ? 153  THR A OG1 1 
ATOM   1117  C  CG2 . THR A  1  153 ? 36.786   -20.457  244.538 1.00 151.04 ? 153  THR A CG2 1 
ATOM   1118  N  N   . ASP A  1  154 ? 34.249   -18.663  248.243 1.00 154.36 ? 154  ASP A N   1 
ATOM   1119  C  CA  . ASP A  1  154 ? 33.958   -18.561  249.670 1.00 156.58 ? 154  ASP A CA  1 
ATOM   1120  C  C   . ASP A  1  154 ? 32.823   -17.577  249.928 1.00 155.14 ? 154  ASP A C   1 
ATOM   1121  O  O   . ASP A  1  154 ? 32.617   -16.639  249.159 1.00 152.78 ? 154  ASP A O   1 
ATOM   1122  C  CB  . ASP A  1  154 ? 35.212   -18.128  250.437 1.00 158.89 ? 154  ASP A CB  1 
ATOM   1123  C  CG  . ASP A  1  154 ? 35.127   -18.432  251.922 1.00 161.91 ? 154  ASP A CG  1 
ATOM   1124  O  OD1 . ASP A  1  154 ? 34.095   -18.105  252.543 1.00 161.83 ? 154  ASP A OD1 1 
ATOM   1125  O  OD2 . ASP A  1  154 ? 36.100   -18.993  252.471 1.00 164.48 ? 154  ASP A OD2 1 
ATOM   1126  N  N   . SER A  1  155 ? 32.084   -17.801  251.011 1.00 172.41 ? 155  SER A N   1 
ATOM   1127  C  CA  . SER A  1  155 ? 30.980   -16.922  251.377 1.00 171.41 ? 155  SER A CA  1 
ATOM   1128  C  C   . SER A  1  155 ? 31.506   -15.556  251.790 1.00 171.62 ? 155  SER A C   1 
ATOM   1129  O  O   . SER A  1  155 ? 30.847   -14.536  251.591 1.00 175.31 ? 155  SER A O   1 
ATOM   1130  C  CB  . SER A  1  155 ? 30.163   -17.522  252.523 1.00 173.44 ? 155  SER A CB  1 
ATOM   1131  O  OG  . SER A  1  155 ? 29.522   -18.723  252.134 1.00 173.94 ? 155  SER A OG  1 
ATOM   1132  N  N   . TYR A  1  156 ? 32.706   -15.547  252.361 1.00 147.96 ? 156  TYR A N   1 
ATOM   1133  C  CA  . TYR A  1  156 ? 33.324   -14.318  252.835 1.00 148.58 ? 156  TYR A CA  1 
ATOM   1134  C  C   . TYR A  1  156 ? 33.656   -13.390  251.673 1.00 145.98 ? 156  TYR A C   1 
ATOM   1135  O  O   . TYR A  1  156 ? 33.609   -12.168  251.811 1.00 145.41 ? 156  TYR A O   1 
ATOM   1136  C  CB  . TYR A  1  156 ? 34.586   -14.638  253.636 1.00 151.63 ? 156  TYR A CB  1 
ATOM   1137  C  CG  . TYR A  1  156 ? 35.091   -13.481  254.462 1.00 153.00 ? 156  TYR A CG  1 
ATOM   1138  C  CD1 . TYR A  1  156 ? 34.486   -13.149  255.667 1.00 154.68 ? 156  TYR A CD1 1 
ATOM   1139  C  CD2 . TYR A  1  156 ? 36.175   -12.724  254.043 1.00 152.74 ? 156  TYR A CD2 1 
ATOM   1140  C  CE1 . TYR A  1  156 ? 34.943   -12.094  256.428 1.00 156.05 ? 156  TYR A CE1 1 
ATOM   1141  C  CE2 . TYR A  1  156 ? 36.641   -11.667  254.798 1.00 154.10 ? 156  TYR A CE2 1 
ATOM   1142  C  CZ  . TYR A  1  156 ? 36.021   -11.355  255.990 1.00 155.75 ? 156  TYR A CZ  1 
ATOM   1143  O  OH  . TYR A  1  156 ? 36.480   -10.303  256.747 1.00 157.21 ? 156  TYR A OH  1 
ATOM   1144  N  N   . GLN A  1  157 ? 33.991   -13.976  250.528 1.00 140.28 ? 157  GLN A N   1 
ATOM   1145  C  CA  . GLN A  1  157 ? 34.293   -13.196  249.334 1.00 137.84 ? 157  GLN A CA  1 
ATOM   1146  C  C   . GLN A  1  157 ? 33.059   -12.432  248.873 1.00 135.32 ? 157  GLN A C   1 
ATOM   1147  O  O   . GLN A  1  157 ? 33.148   -11.270  248.481 1.00 134.00 ? 157  GLN A O   1 
ATOM   1148  C  CB  . GLN A  1  157 ? 34.800   -14.099  248.211 1.00 136.94 ? 157  GLN A CB  1 
ATOM   1149  C  CG  . GLN A  1  157 ? 36.171   -14.698  248.464 1.00 139.22 ? 157  GLN A CG  1 
ATOM   1150  C  CD  . GLN A  1  157 ? 36.516   -15.786  247.470 1.00 138.63 ? 157  GLN A CD  1 
ATOM   1151  O  OE1 . GLN A  1  157 ? 35.702   -16.664  247.190 1.00 137.96 ? 157  GLN A OE1 1 
ATOM   1152  N  NE2 . GLN A  1  157 ? 37.722   -15.723  246.916 1.00 138.94 ? 157  GLN A NE2 1 
ATOM   1153  N  N   . LEU A  1  158 ? 31.908   -13.094  248.922 1.00 134.76 ? 158  LEU A N   1 
ATOM   1154  C  CA  . LEU A  1  158 ? 30.646   -12.453  248.582 1.00 132.61 ? 158  LEU A CA  1 
ATOM   1155  C  C   . LEU A  1  158 ? 30.265   -11.418  249.635 1.00 133.56 ? 158  LEU A C   1 
ATOM   1156  O  O   . LEU A  1  158 ? 29.717   -10.363  249.314 1.00 131.90 ? 158  LEU A O   1 
ATOM   1157  C  CB  . LEU A  1  158 ? 29.530   -13.492  248.452 1.00 132.10 ? 158  LEU A CB  1 
ATOM   1158  C  CG  . LEU A  1  158 ? 29.683   -14.549  247.356 1.00 131.01 ? 158  LEU A CG  1 
ATOM   1159  C  CD1 . LEU A  1  158 ? 28.656   -15.653  247.551 1.00 131.30 ? 158  LEU A CD1 1 
ATOM   1160  C  CD2 . LEU A  1  158 ? 29.546   -13.928  245.976 1.00 128.11 ? 158  LEU A CD2 1 
ATOM   1161  N  N   . TYR A  1  159 ? 30.560   -11.730  250.893 1.00 138.80 ? 159  TYR A N   1 
ATOM   1162  C  CA  . TYR A  1  159 ? 30.232   -10.848  252.007 1.00 140.13 ? 159  TYR A CA  1 
ATOM   1163  C  C   . TYR A  1  159 ? 30.978   -9.521   251.900 1.00 139.83 ? 159  TYR A C   1 
ATOM   1164  O  O   . TYR A  1  159 ? 30.380   -8.457   252.041 1.00 139.04 ? 159  TYR A O   1 
ATOM   1165  C  CB  . TYR A  1  159 ? 30.555   -11.537  253.335 1.00 143.43 ? 159  TYR A CB  1 
ATOM   1166  C  CG  . TYR A  1  159 ? 30.286   -10.697  254.565 1.00 145.20 ? 159  TYR A CG  1 
ATOM   1167  C  CD1 . TYR A  1  159 ? 28.986   -10.410  254.962 1.00 144.78 ? 159  TYR A CD1 1 
ATOM   1168  C  CD2 . TYR A  1  159 ? 31.329   -10.204  255.337 1.00 147.42 ? 159  TYR A CD2 1 
ATOM   1169  C  CE1 . TYR A  1  159 ? 28.732   -9.650   256.087 1.00 146.52 ? 159  TYR A CE1 1 
ATOM   1170  C  CE2 . TYR A  1  159 ? 31.085   -9.443   256.465 1.00 149.17 ? 159  TYR A CE2 1 
ATOM   1171  C  CZ  . TYR A  1  159 ? 29.785   -9.170   256.836 1.00 148.72 ? 159  TYR A CZ  1 
ATOM   1172  O  OH  . TYR A  1  159 ? 29.537   -8.413   257.958 1.00 150.57 ? 159  TYR A OH  1 
ATOM   1173  N  N   . CYS A  1  160 ? 32.280   -9.589   251.638 1.00 138.08 ? 160  CYS A N   1 
ATOM   1174  C  CA  . CYS A  1  160 ? 33.088   -8.385   251.468 1.00 137.89 ? 160  CYS A CA  1 
ATOM   1175  C  C   . CYS A  1  160 ? 32.592   -7.566   250.283 1.00 134.82 ? 160  CYS A C   1 
ATOM   1176  O  O   . CYS A  1  160 ? 32.626   -6.336   250.309 1.00 134.37 ? 160  CYS A O   1 
ATOM   1177  C  CB  . CYS A  1  160 ? 34.563   -8.745   251.280 1.00 139.14 ? 160  CYS A CB  1 
ATOM   1178  S  SG  . CYS A  1  160 ? 35.369   -9.366   252.774 1.00 143.14 ? 160  CYS A SG  1 
ATOM   1179  N  N   . THR A  1  161 ? 32.135   -8.255   249.243 1.00 136.24 ? 161  THR A N   1 
ATOM   1180  C  CA  . THR A  1  161 ? 31.613   -7.591   248.056 1.00 133.35 ? 161  THR A CA  1 
ATOM   1181  C  C   . THR A  1  161 ? 30.326   -6.847   248.387 1.00 132.47 ? 161  THR A C   1 
ATOM   1182  O  O   . THR A  1  161 ? 30.056   -5.779   247.839 1.00 130.85 ? 161  THR A O   1 
ATOM   1183  C  CB  . THR A  1  161 ? 31.338   -8.591   246.916 1.00 131.60 ? 161  THR A CB  1 
ATOM   1184  O  OG1 . THR A  1  161 ? 32.479   -9.436   246.728 1.00 132.75 ? 161  THR A OG1 1 
ATOM   1185  C  CG2 . THR A  1  161 ? 31.035   -7.853   245.617 1.00 128.82 ? 161  THR A CG2 1 
ATOM   1186  N  N   . ALA A  1  162 ? 29.532   -7.418   249.288 1.00 135.63 ? 162  ALA A N   1 
ATOM   1187  C  CA  . ALA A  1  162 ? 28.264   -6.815   249.677 1.00 135.04 ? 162  ALA A CA  1 
ATOM   1188  C  C   . ALA A  1  162 ? 28.489   -5.516   250.446 1.00 136.12 ? 162  ALA A C   1 
ATOM   1189  O  O   . ALA A  1  162 ? 27.745   -4.552   250.277 1.00 134.87 ? 162  ALA A O   1 
ATOM   1190  C  CB  . ALA A  1  162 ? 27.450   -7.790   250.513 1.00 136.39 ? 162  ALA A CB  1 
ATOM   1191  N  N   . ILE A  1  163 ? 29.516   -5.496   251.290 1.00 133.13 ? 163  ILE A N   1 
ATOM   1192  C  CA  . ILE A  1  163 ? 29.859   -4.293   252.042 1.00 134.42 ? 163  ILE A CA  1 
ATOM   1193  C  C   . ILE A  1  163 ? 30.381   -3.204   251.117 1.00 132.76 ? 163  ILE A C   1 
ATOM   1194  O  O   . ILE A  1  163 ? 30.056   -2.029   251.286 1.00 132.47 ? 163  ILE A O   1 
ATOM   1195  C  CB  . ILE A  1  163 ? 30.917   -4.582   253.126 1.00 137.53 ? 163  ILE A CB  1 
ATOM   1196  C  CG1 . ILE A  1  163 ? 30.461   -5.725   254.039 1.00 139.39 ? 163  ILE A CG1 1 
ATOM   1197  C  CG2 . ILE A  1  163 ? 31.197   -3.331   253.952 1.00 139.00 ? 163  ILE A CG2 1 
ATOM   1198  C  CD1 . ILE A  1  163 ? 29.052   -5.572   254.590 1.00 139.27 ? 163  ILE A CD1 1 
ATOM   1199  N  N   . GLY A  1  164 ? 31.197   -3.600   250.147 1.00 131.79 ? 164  GLY A N   1 
ATOM   1200  C  CA  . GLY A  1  164 ? 31.745   -2.663   249.187 1.00 130.27 ? 164  GLY A CA  1 
ATOM   1201  C  C   . GLY A  1  164 ? 30.639   -1.951   248.436 1.00 127.79 ? 164  GLY A C   1 
ATOM   1202  O  O   . GLY A  1  164 ? 30.782   -0.796   248.038 1.00 126.97 ? 164  GLY A O   1 
ATOM   1203  N  N   . GLY A  1  165 ? 29.530   -2.656   248.238 1.00 126.67 ? 165  GLY A N   1 
ATOM   1204  C  CA  . GLY A  1  165 ? 28.374   -2.093   247.567 1.00 124.42 ? 165  GLY A CA  1 
ATOM   1205  C  C   . GLY A  1  165 ? 27.713   -0.996   248.378 1.00 125.06 ? 165  GLY A C   1 
ATOM   1206  O  O   . GLY A  1  165 ? 27.304   0.025    247.827 1.00 123.60 ? 165  GLY A O   1 
ATOM   1207  N  N   . LEU A  1  166 ? 27.602   -1.203   249.687 1.00 127.34 ? 166  LEU A N   1 
ATOM   1208  C  CA  . LEU A  1  166 ? 27.011   -0.198   250.564 1.00 128.30 ? 166  LEU A CA  1 
ATOM   1209  C  C   . LEU A  1  166 ? 27.919   1.023    250.678 1.00 129.01 ? 166  LEU A C   1 
ATOM   1210  O  O   . LEU A  1  166 ? 27.441   2.150    250.805 1.00 128.74 ? 166  LEU A O   1 
ATOM   1211  C  CB  . LEU A  1  166 ? 26.736   -0.779   251.953 1.00 130.82 ? 166  LEU A CB  1 
ATOM   1212  C  CG  . LEU A  1  166 ? 25.698   -1.903   252.065 1.00 130.54 ? 166  LEU A CG  1 
ATOM   1213  C  CD1 . LEU A  1  166 ? 25.278   -2.068   253.517 1.00 133.14 ? 166  LEU A CD1 1 
ATOM   1214  C  CD2 . LEU A  1  166 ? 24.480   -1.667   251.176 1.00 127.95 ? 166  LEU A CD2 1 
ATOM   1215  N  N   . VAL A  1  167 ? 29.228   0.791    250.642 1.00 130.02 ? 167  VAL A N   1 
ATOM   1216  C  CA  . VAL A  1  167 ? 30.195   1.882    250.594 1.00 130.60 ? 167  VAL A CA  1 
ATOM   1217  C  C   . VAL A  1  167 ? 29.937   2.713    249.350 1.00 128.06 ? 167  VAL A C   1 
ATOM   1218  O  O   . VAL A  1  167 ? 29.739   3.924    249.429 1.00 127.97 ? 167  VAL A O   1 
ATOM   1219  C  CB  . VAL A  1  167 ? 31.652   1.365    250.591 1.00 131.93 ? 167  VAL A CB  1 
ATOM   1220  C  CG1 . VAL A  1  167 ? 32.631   2.459    250.144 1.00 131.89 ? 167  VAL A CG1 1 
ATOM   1221  C  CG2 . VAL A  1  167 ? 32.027   0.833    251.964 1.00 134.90 ? 167  VAL A CG2 1 
ATOM   1222  N  N   . MET A  1  168 ? 29.948   2.047    248.201 1.00 126.11 ? 168  MET A N   1 
ATOM   1223  C  CA  . MET A  1  168 ? 29.668   2.701    246.932 1.00 123.67 ? 168  MET A CA  1 
ATOM   1224  C  C   . MET A  1  168 ? 28.309   3.384    246.972 1.00 122.59 ? 168  MET A C   1 
ATOM   1225  O  O   . MET A  1  168 ? 28.163   4.514    246.507 1.00 121.68 ? 168  MET A O   1 
ATOM   1226  C  CB  . MET A  1  168 ? 29.718   1.687    245.789 1.00 121.93 ? 168  MET A CB  1 
ATOM   1227  C  CG  . MET A  1  168 ? 31.121   1.376    245.295 1.00 122.39 ? 168  MET A CG  1 
ATOM   1228  S  SD  . MET A  1  168 ? 31.958   2.825    244.629 1.00 134.35 ? 168  MET A SD  1 
ATOM   1229  C  CE  . MET A  1  168 ? 33.035   3.254    245.996 1.00 125.13 ? 168  MET A CE  1 
ATOM   1230  N  N   . ALA A  1  169 ? 27.318   2.687    247.519 1.00 122.77 ? 169  ALA A N   1 
ATOM   1231  C  CA  . ALA A  1  169 ? 25.971   3.232    247.647 1.00 121.96 ? 169  ALA A CA  1 
ATOM   1232  C  C   . ALA A  1  169 ? 25.988   4.560    248.396 1.00 123.22 ? 169  ALA A C   1 
ATOM   1233  O  O   . ALA A  1  169 ? 25.389   5.540    247.955 1.00 122.06 ? 169  ALA A O   1 
ATOM   1234  C  CB  . ALA A  1  169 ? 25.064   2.240    248.354 1.00 122.60 ? 169  ALA A CB  1 
ATOM   1235  N  N   . ALA A  1  170 ? 26.682   4.586    249.530 1.00 125.73 ? 170  ALA A N   1 
ATOM   1236  C  CA  . ALA A  1  170 ? 26.817   5.806    250.314 1.00 127.26 ? 170  ALA A CA  1 
ATOM   1237  C  C   . ALA A  1  170 ? 27.633   6.843    249.555 1.00 126.57 ? 170  ALA A C   1 
ATOM   1238  O  O   . ALA A  1  170 ? 27.365   8.040    249.639 1.00 126.64 ? 170  ALA A O   1 
ATOM   1239  C  CB  . ALA A  1  170 ? 27.462   5.509    251.658 1.00 130.22 ? 170  ALA A CB  1 
ATOM   1240  N  N   . LEU A  1  171 ? 28.631   6.377    248.813 1.00 126.02 ? 171  LEU A N   1 
ATOM   1241  C  CA  . LEU A  1  171 ? 29.501   7.275    248.069 1.00 125.52 ? 171  LEU A CA  1 
ATOM   1242  C  C   . LEU A  1  171 ? 28.761   7.913    246.902 1.00 123.03 ? 171  LEU A C   1 
ATOM   1243  O  O   . LEU A  1  171 ? 28.931   9.100    246.629 1.00 122.90 ? 171  LEU A O   1 
ATOM   1244  C  CB  . LEU A  1  171 ? 30.736   6.531    247.561 1.00 125.66 ? 171  LEU A CB  1 
ATOM   1245  C  CG  . LEU A  1  171 ? 31.972   7.411    247.364 1.00 126.51 ? 171  LEU A CG  1 
ATOM   1246  C  CD1 . LEU A  1  171 ? 32.502   7.919    248.702 1.00 129.32 ? 171  LEU A CD1 1 
ATOM   1247  C  CD2 . LEU A  1  171 ? 33.051   6.658    246.609 1.00 126.20 ? 171  LEU A CD2 1 
ATOM   1248  N  N   . MET A  1  172 ? 27.945   7.125    246.211 1.00 121.16 ? 172  MET A N   1 
ATOM   1249  C  CA  . MET A  1  172 ? 27.127   7.652    245.127 1.00 118.86 ? 172  MET A CA  1 
ATOM   1250  C  C   . MET A  1  172 ? 26.104   8.641    245.671 1.00 119.09 ? 172  MET A C   1 
ATOM   1251  O  O   . MET A  1  172 ? 25.825   9.664    245.049 1.00 118.09 ? 172  MET A O   1 
ATOM   1252  C  CB  . MET A  1  172 ? 26.417   6.525    244.374 1.00 117.03 ? 172  MET A CB  1 
ATOM   1253  C  CG  . MET A  1  172 ? 27.336   5.639    243.545 1.00 116.41 ? 172  MET A CG  1 
ATOM   1254  S  SD  . MET A  1  172 ? 28.177   6.517    242.216 1.00 115.18 ? 172  MET A SD  1 
ATOM   1255  C  CE  . MET A  1  172 ? 29.762   6.835    242.985 1.00 117.64 ? 172  MET A CE  1 
ATOM   1256  N  N   . LEU A  1  173 ? 25.547   8.331    246.837 1.00 120.54 ? 173  LEU A N   1 
ATOM   1257  C  CA  . LEU A  1  173 ? 24.516   9.169    247.438 1.00 120.96 ? 173  LEU A CA  1 
ATOM   1258  C  C   . LEU A  1  173 ? 25.079   10.515   247.884 1.00 122.36 ? 173  LEU A C   1 
ATOM   1259  O  O   . LEU A  1  173 ? 24.391   11.533   247.831 1.00 122.04 ? 173  LEU A O   1 
ATOM   1260  C  CB  . LEU A  1  173 ? 23.880   8.450    248.630 1.00 122.46 ? 173  LEU A CB  1 
ATOM   1261  C  CG  . LEU A  1  173 ? 22.600   9.072    249.190 1.00 122.72 ? 173  LEU A CG  1 
ATOM   1262  C  CD1 . LEU A  1  173 ? 21.476   8.998    248.176 1.00 120.28 ? 173  LEU A CD1 1 
ATOM   1263  C  CD2 . LEU A  1  173 ? 22.193   8.379    250.482 1.00 124.69 ? 173  LEU A CD2 1 
ATOM   1264  N  N   . PHE A  1  174 ? 26.334   10.511   248.318 1.00 123.99 ? 174  PHE A N   1 
ATOM   1265  C  CA  . PHE A  1  174 ? 27.001   11.731   248.752 1.00 125.52 ? 174  PHE A CA  1 
ATOM   1266  C  C   . PHE A  1  174 ? 27.274   12.640   247.558 1.00 123.95 ? 174  PHE A C   1 
ATOM   1267  O  O   . PHE A  1  174 ? 27.125   13.859   247.645 1.00 124.38 ? 174  PHE A O   1 
ATOM   1268  C  CB  . PHE A  1  174 ? 28.309   11.390   249.469 1.00 127.69 ? 174  PHE A CB  1 
ATOM   1269  C  CG  . PHE A  1  174 ? 29.065   12.588   249.971 1.00 129.50 ? 174  PHE A CG  1 
ATOM   1270  C  CD1 . PHE A  1  174 ? 29.874   13.317   249.120 1.00 128.90 ? 174  PHE A CD1 1 
ATOM   1271  C  CD2 . PHE A  1  174 ? 28.987   12.969   251.299 1.00 131.94 ? 174  PHE A CD2 1 
ATOM   1272  C  CE1 . PHE A  1  174 ? 30.577   14.413   249.571 1.00 130.65 ? 174  PHE A CE1 1 
ATOM   1273  C  CE2 . PHE A  1  174 ? 29.691   14.067   251.760 1.00 133.71 ? 174  PHE A CE2 1 
ATOM   1274  C  CZ  . PHE A  1  174 ? 30.489   14.788   250.893 1.00 133.05 ? 174  PHE A CZ  1 
ATOM   1275  N  N   . ALA A  1  175 ? 27.680   12.035   246.446 1.00 122.27 ? 175  ALA A N   1 
ATOM   1276  C  CA  . ALA A  1  175 ? 28.009   12.777   245.234 1.00 120.82 ? 175  ALA A CA  1 
ATOM   1277  C  C   . ALA A  1  175 ? 26.796   13.512   244.676 1.00 119.26 ? 175  ALA A C   1 
ATOM   1278  O  O   . ALA A  1  175 ? 26.916   14.624   244.162 1.00 118.97 ? 175  ALA A O   1 
ATOM   1279  C  CB  . ALA A  1  175 ? 28.576   11.840   244.189 1.00 119.39 ? 175  ALA A CB  1 
ATOM   1280  N  N   . GLY A  1  176 ? 25.629   12.884   244.779 1.00 118.36 ? 176  GLY A N   1 
ATOM   1281  C  CA  . GLY A  1  176 ? 24.399   13.486   244.300 1.00 116.96 ? 176  GLY A CA  1 
ATOM   1282  C  C   . GLY A  1  176 ? 24.064   14.738   245.085 1.00 118.40 ? 176  GLY A C   1 
ATOM   1283  O  O   . GLY A  1  176 ? 23.652   15.751   244.522 1.00 117.67 ? 176  GLY A O   1 
ATOM   1284  N  N   . TRP A  1  177 ? 24.246   14.661   246.398 1.00 132.00 ? 177  TRP A N   1 
ATOM   1285  C  CA  . TRP A  1  177 ? 24.059   15.808   247.275 1.00 133.77 ? 177  TRP A CA  1 
ATOM   1286  C  C   . TRP A  1  177 ? 25.092   16.885   246.981 1.00 134.45 ? 177  TRP A C   1 
ATOM   1287  O  O   . TRP A  1  177 ? 24.760   18.062   246.844 1.00 134.56 ? 177  TRP A O   1 
ATOM   1288  C  CB  . TRP A  1  177 ? 24.153   15.364   248.734 1.00 136.10 ? 177  TRP A CB  1 
ATOM   1289  C  CG  . TRP A  1  177 ? 24.216   16.471   249.739 1.00 138.35 ? 177  TRP A CG  1 
ATOM   1290  C  CD1 . TRP A  1  177 ? 23.190   17.278   250.136 1.00 138.76 ? 177  TRP A CD1 1 
ATOM   1291  C  CD2 . TRP A  1  177 ? 25.363   16.882   250.493 1.00 140.65 ? 177  TRP A CD2 1 
ATOM   1292  N  NE1 . TRP A  1  177 ? 23.627   18.168   251.087 1.00 141.17 ? 177  TRP A NE1 1 
ATOM   1293  C  CE2 . TRP A  1  177 ? 24.958   17.946   251.323 1.00 142.36 ? 177  TRP A CE2 1 
ATOM   1294  C  CE3 . TRP A  1  177 ? 26.693   16.455   250.543 1.00 141.50 ? 177  TRP A CE3 1 
ATOM   1295  C  CZ2 . TRP A  1  177 ? 25.836   18.590   252.193 1.00 144.89 ? 177  TRP A CZ2 1 
ATOM   1296  C  CZ3 . TRP A  1  177 ? 27.563   17.096   251.406 1.00 143.99 ? 177  TRP A CZ3 1 
ATOM   1297  C  CH2 . TRP A  1  177 ? 27.131   18.151   252.219 1.00 145.66 ? 177  TRP A CH2 1 
ATOM   1298  N  N   . PHE A  1  178 ? 26.348   16.464   246.880 1.00 123.56 ? 178  PHE A N   1 
ATOM   1299  C  CA  . PHE A  1  178 ? 27.462   17.379   246.673 1.00 124.48 ? 178  PHE A CA  1 
ATOM   1300  C  C   . PHE A  1  178 ? 27.351   18.160   245.363 1.00 122.71 ? 178  PHE A C   1 
ATOM   1301  O  O   . PHE A  1  178 ? 27.704   19.337   245.310 1.00 123.52 ? 178  PHE A O   1 
ATOM   1302  C  CB  . PHE A  1  178 ? 28.779   16.604   246.696 1.00 125.20 ? 178  PHE A CB  1 
ATOM   1303  C  CG  . PHE A  1  178 ? 29.970   17.426   246.307 1.00 125.94 ? 178  PHE A CG  1 
ATOM   1304  C  CD1 . PHE A  1  178 ? 30.463   18.399   247.159 1.00 128.21 ? 178  PHE A CD1 1 
ATOM   1305  C  CD2 . PHE A  1  178 ? 30.590   17.235   245.085 1.00 124.48 ? 178  PHE A CD2 1 
ATOM   1306  C  CE1 . PHE A  1  178 ? 31.558   19.159   246.804 1.00 129.00 ? 178  PHE A CE1 1 
ATOM   1307  C  CE2 . PHE A  1  178 ? 31.685   17.993   244.724 1.00 125.28 ? 178  PHE A CE2 1 
ATOM   1308  C  CZ  . PHE A  1  178 ? 32.170   18.958   245.584 1.00 127.53 ? 178  PHE A CZ  1 
ATOM   1309  N  N   . HIS A  1  179 ? 26.856   17.509   244.314 1.00 120.41 ? 179  HIS A N   1 
ATOM   1310  C  CA  . HIS A  1  179 ? 26.804   18.128   242.990 1.00 118.73 ? 179  HIS A CA  1 
ATOM   1311  C  C   . HIS A  1  179 ? 25.454   18.789   242.704 1.00 117.68 ? 179  HIS A C   1 
ATOM   1312  O  O   . HIS A  1  179 ? 25.039   18.906   241.549 1.00 115.83 ? 179  HIS A O   1 
ATOM   1313  C  CB  . HIS A  1  179 ? 27.127   17.092   241.910 1.00 116.94 ? 179  HIS A CB  1 
ATOM   1314  C  CG  . HIS A  1  179 ? 28.583   16.764   241.814 1.00 117.80 ? 179  HIS A CG  1 
ATOM   1315  N  ND1 . HIS A  1  179 ? 29.556   17.733   241.705 1.00 118.93 ? 179  HIS A ND1 1 
ATOM   1316  C  CD2 . HIS A  1  179 ? 29.231   15.576   241.798 1.00 117.78 ? 179  HIS A CD2 1 
ATOM   1317  C  CE1 . HIS A  1  179 ? 30.743   17.157   241.636 1.00 119.58 ? 179  HIS A CE1 1 
ATOM   1318  N  NE2 . HIS A  1  179 ? 30.573   15.848   241.690 1.00 118.90 ? 179  HIS A NE2 1 
ATOM   1319  N  N   . TYR A  1  180 ? 24.773   19.221   243.760 1.00 118.97 ? 180  TYR A N   1 
ATOM   1320  C  CA  . TYR A  1  180 ? 23.557   20.018   243.608 1.00 118.39 ? 180  TYR A CA  1 
ATOM   1321  C  C   . TYR A  1  180 ? 23.367   21.007   244.755 1.00 120.57 ? 180  TYR A C   1 
ATOM   1322  O  O   . TYR A  1  180 ? 22.601   21.962   244.636 1.00 120.51 ? 180  TYR A O   1 
ATOM   1323  C  CB  . TYR A  1  180 ? 22.325   19.120   243.510 1.00 116.96 ? 180  TYR A CB  1 
ATOM   1324  C  CG  . TYR A  1  180 ? 21.076   19.868   243.114 1.00 116.06 ? 180  TYR A CG  1 
ATOM   1325  C  CD1 . TYR A  1  180 ? 20.951   20.408   241.844 1.00 114.50 ? 180  TYR A CD1 1 
ATOM   1326  C  CD2 . TYR A  1  180 ? 20.030   20.045   244.006 1.00 116.90 ? 180  TYR A CD2 1 
ATOM   1327  C  CE1 . TYR A  1  180 ? 19.817   21.097   241.466 1.00 113.78 ? 180  TYR A CE1 1 
ATOM   1328  C  CE2 . TYR A  1  180 ? 18.892   20.734   243.639 1.00 116.17 ? 180  TYR A CE2 1 
ATOM   1329  C  CZ  . TYR A  1  180 ? 18.790   21.259   242.368 1.00 114.61 ? 180  TYR A CZ  1 
ATOM   1330  O  OH  . TYR A  1  180 ? 17.657   21.947   241.996 1.00 113.98 ? 180  TYR A OH  1 
ATOM   1331  N  N   . HIS A  1  181 ? 24.066   20.774   245.861 1.00 123.66 ? 181  HIS A N   1 
ATOM   1332  C  CA  . HIS A  1  181 ? 23.932   21.602   247.052 1.00 125.98 ? 181  HIS A CA  1 
ATOM   1333  C  C   . HIS A  1  181 ? 25.257   22.231   247.464 1.00 127.95 ? 181  HIS A C   1 
ATOM   1334  O  O   . HIS A  1  181 ? 25.290   23.088   248.347 1.00 130.00 ? 181  HIS A O   1 
ATOM   1335  C  CB  . HIS A  1  181 ? 23.357   20.768   248.195 1.00 126.98 ? 181  HIS A CB  1 
ATOM   1336  C  CG  . HIS A  1  181 ? 21.922   20.398   247.995 1.00 125.55 ? 181  HIS A CG  1 
ATOM   1337  N  ND1 . HIS A  1  181 ? 20.898   20.971   248.717 1.00 126.53 ? 181  HIS A ND1 1 
ATOM   1338  C  CD2 . HIS A  1  181 ? 21.337   19.539   247.128 1.00 123.29 ? 181  HIS A CD2 1 
ATOM   1339  C  CE1 . HIS A  1  181 ? 19.745   20.466   248.317 1.00 124.93 ? 181  HIS A CE1 1 
ATOM   1340  N  NE2 . HIS A  1  181 ? 19.983   19.599   247.350 1.00 122.95 ? 181  HIS A NE2 1 
ATOM   1341  N  N   . VAL A  1  182 ? 26.346   21.800   246.831 1.00 132.53 ? 182  VAL A N   1 
ATOM   1342  C  CA  . VAL A  1  182 ? 27.673   22.315   247.153 1.00 134.38 ? 182  VAL A CA  1 
ATOM   1343  C  C   . VAL A  1  182 ? 28.384   22.851   245.909 1.00 133.32 ? 182  VAL A C   1 
ATOM   1344  O  O   . VAL A  1  182 ? 28.749   24.025   245.861 1.00 134.36 ? 182  VAL A O   1 
ATOM   1345  C  CB  . VAL A  1  182 ? 28.548   21.239   247.817 1.00 135.46 ? 182  VAL A CB  1 
ATOM   1346  C  CG1 . VAL A  1  182 ? 29.780   21.877   248.436 1.00 137.90 ? 182  VAL A CG1 1 
ATOM   1347  C  CG2 . VAL A  1  182 ? 27.750   20.480   248.872 1.00 136.15 ? 182  VAL A CG2 1 
ATOM   1348  N  N   . LYS A  1  183 ? 28.577   21.992   244.912 1.00 125.20 ? 183  LYS A N   1 
ATOM   1349  C  CA  . LYS A  1  183 ? 29.232   22.392   243.668 1.00 124.16 ? 183  LYS A CA  1 
ATOM   1350  C  C   . LYS A  1  183 ? 28.469   21.868   242.457 1.00 121.46 ? 183  LYS A C   1 
ATOM   1351  O  O   . LYS A  1  183 ? 28.743   20.776   241.962 1.00 120.31 ? 183  LYS A O   1 
ATOM   1352  C  CB  . LYS A  1  183 ? 30.676   21.888   243.632 1.00 125.01 ? 183  LYS A CB  1 
ATOM   1353  C  CG  . LYS A  1  183 ? 31.629   22.633   244.555 1.00 127.70 ? 183  LYS A CG  1 
ATOM   1354  C  CD  . LYS A  1  183 ? 33.072   22.270   244.240 1.00 128.33 ? 183  LYS A CD  1 
ATOM   1355  C  CE  . LYS A  1  183 ? 34.021   22.615   245.380 1.00 131.18 ? 183  LYS A CE  1 
ATOM   1356  N  NZ  . LYS A  1  183 ? 34.239   24.077   245.553 1.00 132.67 ? 183  LYS A NZ  1 
ATOM   1357  N  N   . ALA A  1  184 ? 27.523   22.664   241.975 1.00 120.58 ? 184  ALA A N   1 
ATOM   1358  C  CA  . ALA A  1  184 ? 26.691   22.278   240.842 1.00 118.14 ? 184  ALA A CA  1 
ATOM   1359  C  C   . ALA A  1  184 ? 27.347   22.696   239.525 1.00 117.23 ? 184  ALA A C   1 
ATOM   1360  O  O   . ALA A  1  184 ? 27.713   23.858   239.363 1.00 118.14 ? 184  ALA A O   1 
ATOM   1361  C  CB  . ALA A  1  184 ? 25.317   22.902   240.963 1.00 117.73 ? 184  ALA A CB  1 
ATOM   1362  N  N   . PRO A  1  185 ? 27.504   21.755   238.578 1.00 121.68 ? 185  PRO A N   1 
ATOM   1363  C  CA  . PRO A  1  185 ? 28.114   22.139   237.298 1.00 120.90 ? 185  PRO A CA  1 
ATOM   1364  C  C   . PRO A  1  185 ? 27.291   23.171   236.523 1.00 120.08 ? 185  PRO A C   1 
ATOM   1365  O  O   . PRO A  1  185 ? 26.061   23.143   236.570 1.00 119.17 ? 185  PRO A O   1 
ATOM   1366  C  CB  . PRO A  1  185 ? 28.182   20.817   236.526 1.00 119.20 ? 185  PRO A CB  1 
ATOM   1367  C  CG  . PRO A  1  185 ? 28.066   19.748   237.554 1.00 119.64 ? 185  PRO A CG  1 
ATOM   1368  C  CD  . PRO A  1  185 ? 27.215   20.312   238.638 1.00 120.61 ? 185  PRO A CD  1 
ATOM   1369  N  N   . LYS A  1  186 ? 27.974   24.070   235.819 1.00 114.36 ? 186  LYS A N   1 
ATOM   1370  C  CA  . LYS A  1  186 ? 27.318   25.029   234.933 1.00 113.64 ? 186  LYS A CA  1 
ATOM   1371  C  C   . LYS A  1  186 ? 26.684   24.324   233.737 1.00 111.37 ? 186  LYS A C   1 
ATOM   1372  O  O   . LYS A  1  186 ? 27.034   23.186   233.425 1.00 110.48 ? 186  LYS A O   1 
ATOM   1373  C  CB  . LYS A  1  186 ? 28.316   26.081   234.440 1.00 114.79 ? 186  LYS A CB  1 
ATOM   1374  C  CG  . LYS A  1  186 ? 28.088   27.497   234.962 1.00 116.36 ? 186  LYS A CG  1 
ATOM   1375  C  CD  . LYS A  1  186 ? 28.615   27.689   236.375 1.00 118.47 ? 186  LYS A CD  1 
ATOM   1376  C  CE  . LYS A  1  186 ? 28.842   29.164   236.681 1.00 120.34 ? 186  LYS A CE  1 
ATOM   1377  N  NZ  . LYS A  1  186 ? 27.619   29.993   236.475 1.00 119.91 ? 186  LYS A NZ  1 
ATOM   1378  N  N   . LEU A  1  187 ? 25.749   25.000   233.073 1.00 110.55 ? 187  LEU A N   1 
ATOM   1379  C  CA  . LEU A  1  187 ? 25.142   24.471   231.855 1.00 108.54 ? 187  LEU A CA  1 
ATOM   1380  C  C   . LEU A  1  187 ? 26.206   24.233   230.791 1.00 108.21 ? 187  LEU A C   1 
ATOM   1381  O  O   . LEU A  1  187 ? 26.105   23.296   230.002 1.00 106.75 ? 187  LEU A O   1 
ATOM   1382  C  CB  . LEU A  1  187 ? 24.069   25.420   231.317 1.00 108.06 ? 187  LEU A CB  1 
ATOM   1383  C  CG  . LEU A  1  187 ? 23.308   24.934   230.077 1.00 106.08 ? 187  LEU A CG  1 
ATOM   1384  C  CD1 . LEU A  1  187 ? 22.372   23.789   230.432 1.00 104.87 ? 187  LEU A CD1 1 
ATOM   1385  C  CD2 . LEU A  1  187 ? 22.534   26.069   229.423 1.00 105.98 ? 187  LEU A CD2 1 
ATOM   1386  N  N   . GLU A  1  188 ? 27.217   25.093   230.770 1.00 143.63 ? 188  GLU A N   1 
ATOM   1387  C  CA  . GLU A  1  188 ? 28.318   24.963   229.823 1.00 145.10 ? 188  GLU A CA  1 
ATOM   1388  C  C   . GLU A  1  188 ? 29.009   23.612   229.965 1.00 144.77 ? 188  GLU A C   1 
ATOM   1389  O  O   . GLU A  1  188 ? 29.426   23.010   228.976 1.00 142.39 ? 188  GLU A O   1 
ATOM   1390  C  CB  . GLU A  1  188 ? 29.339   26.085   230.032 1.00 161.60 ? 188  GLU A CB  1 
ATOM   1391  C  CG  . GLU A  1  188 ? 30.474   26.098   229.013 1.00 180.06 ? 188  GLU A CG  1 
ATOM   1392  C  CD  . GLU A  1  188 ? 31.817   26.409   229.645 1.00 196.20 ? 188  GLU A CD  1 
ATOM   1393  O  OE1 . GLU A  1  188 ? 31.872   27.289   230.529 1.00 209.17 ? 188  GLU A OE1 1 
ATOM   1394  O  OE2 . GLU A  1  188 ? 32.817   25.763   229.263 1.00 194.11 ? 188  GLU A OE2 1 
ATOM   1395  N  N   . TRP A  1  189 ? 29.119   23.138   231.202 1.00 110.09 ? 189  TRP A N   1 
ATOM   1396  C  CA  . TRP A  1  189 ? 29.848   21.908   231.487 1.00 110.09 ? 189  TRP A CA  1 
ATOM   1397  C  C   . TRP A  1  189 ? 29.168   20.655   230.935 1.00 108.18 ? 189  TRP A C   1 
ATOM   1398  O  O   . TRP A  1  189 ? 29.828   19.787   230.365 1.00 107.71 ? 189  TRP A O   1 
ATOM   1399  C  CB  . TRP A  1  189 ? 30.042   21.757   232.994 1.00 111.55 ? 189  TRP A CB  1 
ATOM   1400  C  CG  . TRP A  1  189 ? 30.784   20.521   233.353 1.00 111.75 ? 189  TRP A CG  1 
ATOM   1401  C  CD1 . TRP A  1  189 ? 32.130   20.326   233.285 1.00 112.81 ? 189  TRP A CD1 1 
ATOM   1402  C  CD2 . TRP A  1  189 ? 30.223   19.295   233.829 1.00 110.98 ? 189  TRP A CD2 1 
ATOM   1403  N  NE1 . TRP A  1  189 ? 32.444   19.052   233.693 1.00 112.74 ? 189  TRP A NE1 1 
ATOM   1404  C  CE2 . TRP A  1  189 ? 31.288   18.399   234.033 1.00 111.63 ? 189  TRP A CE2 1 
ATOM   1405  C  CE3 . TRP A  1  189 ? 28.921   18.868   234.105 1.00 109.88 ? 189  TRP A CE3 1 
ATOM   1406  C  CZ2 . TRP A  1  189 ? 31.092   17.101   234.498 1.00 111.24 ? 189  TRP A CZ2 1 
ATOM   1407  C  CZ3 . TRP A  1  189 ? 28.730   17.582   234.571 1.00 109.50 ? 189  TRP A CZ3 1 
ATOM   1408  C  CH2 . TRP A  1  189 ? 29.807   16.716   234.764 1.00 110.19 ? 189  TRP A CH2 1 
ATOM   1409  N  N   . PHE A  1  190 ? 27.854   20.561   231.111 1.00 107.17 ? 190  PHE A N   1 
ATOM   1410  C  CA  . PHE A  1  190 ? 27.100   19.412   230.620 1.00 105.42 ? 190  PHE A CA  1 
ATOM   1411  C  C   . PHE A  1  190 ? 27.173   19.326   229.099 1.00 104.16 ? 190  PHE A C   1 
ATOM   1412  O  O   . PHE A  1  190 ? 27.029   18.251   228.520 1.00 102.97 ? 190  PHE A O   1 
ATOM   1413  C  CB  . PHE A  1  190 ? 25.637   19.496   231.061 1.00 104.74 ? 190  PHE A CB  1 
ATOM   1414  C  CG  . PHE A  1  190 ? 25.451   19.517   232.551 1.00 105.99 ? 190  PHE A CG  1 
ATOM   1415  C  CD1 . PHE A  1  190 ? 25.756   18.407   233.321 1.00 106.32 ? 190  PHE A CD1 1 
ATOM   1416  C  CD2 . PHE A  1  190 ? 24.960   20.647   233.181 1.00 106.94 ? 190  PHE A CD2 1 
ATOM   1417  C  CE1 . PHE A  1  190 ? 25.580   18.430   234.693 1.00 107.62 ? 190  PHE A CE1 1 
ATOM   1418  C  CE2 . PHE A  1  190 ? 24.782   20.675   234.550 1.00 108.23 ? 190  PHE A CE2 1 
ATOM   1419  C  CZ  . PHE A  1  190 ? 25.092   19.564   235.308 1.00 108.57 ? 190  PHE A CZ  1 
ATOM   1420  N  N   . GLN A  1  191 ? 27.400   20.470   228.464 1.00 104.57 ? 191  GLN A N   1 
ATOM   1421  C  CA  . GLN A  1  191 ? 27.382   20.571   227.009 1.00 103.56 ? 191  GLN A CA  1 
ATOM   1422  C  C   . GLN A  1  191 ? 28.702   20.153   226.365 1.00 103.94 ? 191  GLN A C   1 
ATOM   1423  O  O   . GLN A  1  191 ? 28.844   20.217   225.144 1.00 103.33 ? 191  GLN A O   1 
ATOM   1424  C  CB  . GLN A  1  191 ? 27.036   22.003   226.600 1.00 103.98 ? 191  GLN A CB  1 
ATOM   1425  C  CG  . GLN A  1  191 ? 25.602   22.402   226.916 1.00 103.37 ? 191  GLN A CG  1 
ATOM   1426  C  CD  . GLN A  1  191 ? 25.333   23.872   226.658 1.00 104.10 ? 191  GLN A CD  1 
ATOM   1427  O  OE1 . GLN A  1  191 ? 26.255   24.688   226.617 1.00 105.42 ? 191  GLN A OE1 1 
ATOM   1428  N  NE2 . GLN A  1  191 ? 24.063   24.217   226.479 1.00 103.33 ? 191  GLN A NE2 1 
ATOM   1429  N  N   . ASN A  1  192 ? 29.669   19.736   227.176 1.00 133.71 ? 192  ASN A N   1 
ATOM   1430  C  CA  . ASN A  1  192 ? 30.922   19.222   226.640 1.00 134.16 ? 192  ASN A CA  1 
ATOM   1431  C  C   . ASN A  1  192 ? 30.717   17.805   226.123 1.00 135.09 ? 192  ASN A C   1 
ATOM   1432  O  O   . ASN A  1  192 ? 31.172   16.838   226.732 1.00 142.50 ? 192  ASN A O   1 
ATOM   1433  C  CB  . ASN A  1  192 ? 32.023   19.252   227.700 1.00 136.10 ? 192  ASN A CB  1 
ATOM   1434  C  CG  . ASN A  1  192 ? 32.517   20.655   227.993 1.00 154.61 ? 192  ASN A CG  1 
ATOM   1435  O  OD1 . ASN A  1  192 ? 32.592   21.068   229.149 1.00 165.20 ? 192  ASN A OD1 1 
ATOM   1436  N  ND2 . ASN A  1  192 ? 32.859   21.396   226.944 1.00 162.96 ? 192  ASN A ND2 1 
ATOM   1437  N  N   . VAL A  1  193 ? 30.028   17.693   224.993 1.00 102.76 ? 193  VAL A N   1 
ATOM   1438  C  CA  . VAL A  1  193 ? 29.650   16.395   224.451 1.00 101.40 ? 193  VAL A CA  1 
ATOM   1439  C  C   . VAL A  1  193 ? 30.848   15.647   223.884 1.00 101.79 ? 193  VAL A C   1 
ATOM   1440  O  O   . VAL A  1  193 ? 31.039   14.466   224.174 1.00 101.59 ? 193  VAL A O   1 
ATOM   1441  C  CB  . VAL A  1  193 ? 28.594   16.534   223.342 1.00 99.93  ? 193  VAL A CB  1 
ATOM   1442  C  CG1 . VAL A  1  193 ? 28.113   15.170   222.905 1.00 98.61  ? 193  VAL A CG1 1 
ATOM   1443  C  CG2 . VAL A  1  193 ? 27.421   17.382   223.813 1.00 99.66  ? 193  VAL A CG2 1 
ATOM   1444  N  N   . GLU A  1  194 ? 31.646   16.334   223.072 1.00 123.88 ? 194  GLU A N   1 
ATOM   1445  C  CA  . GLU A  1  194 ? 32.805   15.716   222.439 1.00 124.38 ? 194  GLU A CA  1 
ATOM   1446  C  C   . GLU A  1  194 ? 33.730   15.118   223.486 1.00 128.74 ? 194  GLU A C   1 
ATOM   1447  O  O   . GLU A  1  194 ? 34.295   14.043   223.290 1.00 144.38 ? 194  GLU A O   1 
ATOM   1448  C  CB  . GLU A  1  194 ? 33.567   16.731   221.585 1.00 125.27 ? 194  GLU A CB  1 
ATOM   1449  C  CG  . GLU A  1  194 ? 33.034   16.887   220.168 1.00 124.23 ? 194  GLU A CG  1 
ATOM   1450  C  CD  . GLU A  1  194 ? 31.723   17.642   220.109 1.00 123.33 ? 194  GLU A CD  1 
ATOM   1451  O  OE1 . GLU A  1  194 ? 31.738   18.874   220.315 1.00 124.16 ? 194  GLU A OE1 1 
ATOM   1452  O  OE2 . GLU A  1  194 ? 30.677   17.009   219.857 1.00 121.89 ? 194  GLU A OE2 1 
ATOM   1453  N  N   . SER A  1  195 ? 33.877   15.820   224.602 1.00 105.24 ? 195  SER A N   1 
ATOM   1454  C  CA  . SER A  1  195 ? 34.737   15.362   225.680 1.00 106.57 ? 195  SER A CA  1 
ATOM   1455  C  C   . SER A  1  195 ? 34.057   14.293   226.528 1.00 105.94 ? 195  SER A C   1 
ATOM   1456  O  O   . SER A  1  195 ? 34.706   13.342   226.961 1.00 106.53 ? 195  SER A O   1 
ATOM   1457  C  CB  . SER A  1  195 ? 35.153   16.535   226.557 1.00 108.15 ? 195  SER A CB  1 
ATOM   1458  O  OG  . SER A  1  195 ? 36.131   16.142   227.503 1.00 109.66 ? 195  SER A OG  1 
ATOM   1459  N  N   . MET A  1  196 ? 32.760   14.457   226.784 1.00 116.48 ? 196  MET A N   1 
ATOM   1460  C  CA  . MET A  1  196 ? 32.019   13.474   227.572 1.00 115.92 ? 196  MET A CA  1 
ATOM   1461  C  C   . MET A  1  196 ? 32.120   12.110   226.906 1.00 115.03 ? 196  MET A C   1 
ATOM   1462  O  O   . MET A  1  196 ? 32.208   11.083   227.577 1.00 115.27 ? 196  MET A O   1 
ATOM   1463  C  CB  . MET A  1  196 ? 30.544   13.863   227.733 1.00 114.82 ? 196  MET A CB  1 
ATOM   1464  C  CG  . MET A  1  196 ? 29.818   12.997   228.763 1.00 114.62 ? 196  MET A CG  1 
ATOM   1465  S  SD  . MET A  1  196 ? 28.075   13.389   229.026 1.00 113.49 ? 196  MET A SD  1 
ATOM   1466  C  CE  . MET A  1  196 ? 28.182   15.091   229.572 1.00 114.73 ? 196  MET A CE  1 
ATOM   1467  N  N   . MET A  1  197 ? 32.106   12.110   225.578 1.00 102.53 ? 197  MET A N   1 
ATOM   1468  C  CA  . MET A  1  197 ? 32.131   10.870   224.817 1.00 101.66 ? 197  MET A CA  1 
ATOM   1469  C  C   . MET A  1  197 ? 33.484   10.176   224.906 1.00 102.85 ? 197  MET A C   1 
ATOM   1470  O  O   . MET A  1  197 ? 33.554   8.965    225.103 1.00 102.73 ? 197  MET A O   1 
ATOM   1471  C  CB  . MET A  1  197 ? 31.797   11.139   223.351 1.00 100.57 ? 197  MET A CB  1 
ATOM   1472  C  CG  . MET A  1  197 ? 31.090   9.988    222.672 1.00 99.19  ? 197  MET A CG  1 
ATOM   1473  S  SD  . MET A  1  197 ? 29.488   9.650    223.415 1.00 98.04  ? 197  MET A SD  1 
ATOM   1474  C  CE  . MET A  1  197 ? 28.959   8.270    222.413 1.00 96.69  ? 197  MET A CE  1 
ATOM   1475  N  N   . ASN A  1  198 ? 34.555   10.949   224.757 1.00 104.09 ? 198  ASN A N   1 
ATOM   1476  C  CA  . ASN A  1  198 ? 35.908   10.406   224.803 1.00 105.40 ? 198  ASN A CA  1 
ATOM   1477  C  C   . ASN A  1  198 ? 36.194   9.664    226.104 1.00 106.34 ? 198  ASN A C   1 
ATOM   1478  O  O   . ASN A  1  198 ? 37.025   8.759    226.136 1.00 107.06 ? 198  ASN A O   1 
ATOM   1479  C  CB  . ASN A  1  198 ? 36.937   11.521   224.599 1.00 106.76 ? 198  ASN A CB  1 
ATOM   1480  C  CG  . ASN A  1  198 ? 36.997   12.002   223.160 1.00 106.18 ? 198  ASN A CG  1 
ATOM   1481  O  OD1 . ASN A  1  198 ? 36.493   11.341   222.251 1.00 104.93 ? 198  ASN A OD1 1 
ATOM   1482  N  ND2 . ASN A  1  198 ? 37.628   13.150   222.944 1.00 107.22 ? 198  ASN A ND2 1 
ATOM   1483  N  N   . HIS A  1  199 ? 35.506   10.051   227.173 1.00 106.44 ? 199  HIS A N   1 
ATOM   1484  C  CA  . HIS A  1  199 ? 35.721   9.440    228.479 1.00 107.50 ? 199  HIS A CA  1 
ATOM   1485  C  C   . HIS A  1  199 ? 34.896   8.174    228.659 1.00 106.49 ? 199  HIS A C   1 
ATOM   1486  O  O   . HIS A  1  199 ? 35.377   7.191    229.214 1.00 107.27 ? 199  HIS A O   1 
ATOM   1487  C  CB  . HIS A  1  199 ? 35.388   10.430   229.586 1.00 108.29 ? 199  HIS A CB  1 
ATOM   1488  C  CG  . HIS A  1  199 ? 36.310   11.605   229.633 1.00 109.66 ? 199  HIS A CG  1 
ATOM   1489  N  ND1 . HIS A  1  199 ? 36.246   12.638   228.723 1.00 109.21 ? 199  HIS A ND1 1 
ATOM   1490  C  CD2 . HIS A  1  199 ? 37.323   11.908   230.478 1.00 111.59 ? 199  HIS A CD2 1 
ATOM   1491  C  CE1 . HIS A  1  199 ? 37.174   13.533   229.012 1.00 110.80 ? 199  HIS A CE1 1 
ATOM   1492  N  NE2 . HIS A  1  199 ? 37.843   13.112   230.069 1.00 112.25 ? 199  HIS A NE2 1 
ATOM   1493  N  N   . HIS A  1  200 ? 33.653   8.197    228.195 1.00 104.85 ? 200  HIS A N   1 
ATOM   1494  C  CA  . HIS A  1  200 ? 32.811   7.009    228.259 1.00 103.85 ? 200  HIS A CA  1 
ATOM   1495  C  C   . HIS A  1  200 ? 33.324   5.947    227.304 1.00 103.49 ? 200  HIS A C   1 
ATOM   1496  O  O   . HIS A  1  200 ? 33.334   4.760    227.627 1.00 103.63 ? 200  HIS A O   1 
ATOM   1497  C  CB  . HIS A  1  200 ? 31.360   7.353    227.935 1.00 102.26 ? 200  HIS A CB  1 
ATOM   1498  C  CG  . HIS A  1  200 ? 30.703   8.208    228.969 1.00 102.63 ? 200  HIS A CG  1 
ATOM   1499  N  ND1 . HIS A  1  200 ? 29.364   8.529    228.931 1.00 101.47 ? 200  HIS A ND1 1 
ATOM   1500  C  CD2 . HIS A  1  200 ? 31.202   8.801    230.078 1.00 104.15 ? 200  HIS A CD2 1 
ATOM   1501  C  CE1 . HIS A  1  200 ? 29.068   9.289    229.970 1.00 102.26 ? 200  HIS A CE1 1 
ATOM   1502  N  NE2 . HIS A  1  200 ? 30.166   9.468    230.679 1.00 103.88 ? 200  HIS A NE2 1 
ATOM   1503  N  N   . LEU A  1  201 ? 33.754   6.382    226.126 1.00 103.13 ? 201  LEU A N   1 
ATOM   1504  C  CA  . LEU A  1  201 ? 34.240   5.459    225.115 1.00 102.85 ? 201  LEU A CA  1 
ATOM   1505  C  C   . LEU A  1  201 ? 35.528   4.779    225.558 1.00 104.43 ? 201  LEU A C   1 
ATOM   1506  O  O   . LEU A  1  201 ? 35.789   3.653    225.159 1.00 104.38 ? 201  LEU A O   1 
ATOM   1507  C  CB  . LEU A  1  201 ? 34.465   6.177    223.781 1.00 102.35 ? 201  LEU A CB  1 
ATOM   1508  C  CG  . LEU A  1  201 ? 33.222   6.563    222.974 1.00 100.68 ? 201  LEU A CG  1 
ATOM   1509  C  CD1 . LEU A  1  201 ? 33.625   7.335    221.731 1.00 100.58 ? 201  LEU A CD1 1 
ATOM   1510  C  CD2 . LEU A  1  201 ? 32.426   5.344    222.576 1.00 99.51  ? 201  LEU A CD2 1 
ATOM   1511  N  N   . ALA A  1  202 ? 36.324   5.456    226.380 1.00 105.92 ? 202  ALA A N   1 
ATOM   1512  C  CA  . ALA A  1  202 ? 37.630   4.935    226.784 1.00 107.62 ? 202  ALA A CA  1 
ATOM   1513  C  C   . ALA A  1  202 ? 37.730   4.694    228.296 1.00 108.84 ? 202  ALA A C   1 
ATOM   1514  O  O   . ALA A  1  202 ? 38.239   3.662    228.730 1.00 109.72 ? 202  ALA A O   1 
ATOM   1515  C  CB  . ALA A  1  202 ? 38.724   5.881    226.328 1.00 108.66 ? 202  ALA A CB  1 
ATOM   1516  N  N   . GLY A  1  203 ? 37.258   5.647    229.094 1.00 141.26 ? 203  GLY A N   1 
ATOM   1517  C  CA  . GLY A  1  203 ? 37.335   5.544    230.545 1.00 146.12 ? 203  GLY A CA  1 
ATOM   1518  C  C   . GLY A  1  203 ? 36.381   4.544    231.159 1.00 142.00 ? 203  GLY A C   1 
ATOM   1519  O  O   . GLY A  1  203 ? 36.757   3.797    232.063 1.00 143.23 ? 203  GLY A O   1 
ATOM   1520  N  N   . LEU A  1  204 ? 35.150   4.517    230.668 1.00 108.00 ? 204  LEU A N   1 
ATOM   1521  C  CA  . LEU A  1  204 ? 34.139   3.641    231.234 1.00 107.44 ? 204  LEU A CA  1 
ATOM   1522  C  C   . LEU A  1  204 ? 34.209   2.277    230.559 1.00 106.90 ? 204  LEU A C   1 
ATOM   1523  O  O   . LEU A  1  204 ? 34.397   1.255    231.220 1.00 107.75 ? 204  LEU A O   1 
ATOM   1524  C  CB  . LEU A  1  204 ? 32.748   4.255    231.072 1.00 105.92 ? 204  LEU A CB  1 
ATOM   1525  C  CG  . LEU A  1  204 ? 31.727   3.907    232.159 1.00 105.97 ? 204  LEU A CG  1 
ATOM   1526  C  CD1 . LEU A  1  204 ? 30.403   4.594    231.877 1.00 104.50 ? 204  LEU A CD1 1 
ATOM   1527  C  CD2 . LEU A  1  204 ? 31.535   2.406    232.302 1.00 105.93 ? 204  LEU A CD2 1 
ATOM   1528  N  N   . LEU A  1  205 ? 34.068   2.271    229.239 1.00 105.60 ? 205  LEU A N   1 
ATOM   1529  C  CA  . LEU A  1  205 ? 34.029   1.028    228.481 1.00 104.99 ? 205  LEU A CA  1 
ATOM   1530  C  C   . LEU A  1  205 ? 35.427   0.477    228.209 1.00 106.28 ? 205  LEU A C   1 
ATOM   1531  O  O   . LEU A  1  205 ? 35.659   -0.725   228.330 1.00 106.75 ? 205  LEU A O   1 
ATOM   1532  C  CB  . LEU A  1  205 ? 33.284   1.242    227.166 1.00 103.20 ? 205  LEU A CB  1 
ATOM   1533  C  CG  . LEU A  1  205 ? 31.868   1.801    227.305 1.00 101.89 ? 205  LEU A CG  1 
ATOM   1534  C  CD1 . LEU A  1  205 ? 31.336   2.195    225.949 1.00 100.38 ? 205  LEU A CD1 1 
ATOM   1535  C  CD2 . LEU A  1  205 ? 30.952   0.776    227.951 1.00 101.59 ? 205  LEU A CD2 1 
ATOM   1536  N  N   . GLY A  1  206 ? 36.355   1.354    227.840 1.00 106.93 ? 206  GLY A N   1 
ATOM   1537  C  CA  . GLY A  1  206 ? 37.718   0.941    227.561 1.00 108.27 ? 206  GLY A CA  1 
ATOM   1538  C  C   . GLY A  1  206 ? 38.408   0.332    228.768 1.00 110.06 ? 206  GLY A C   1 
ATOM   1539  O  O   . GLY A  1  206 ? 38.708   -0.861   228.779 1.00 110.56 ? 206  GLY A O   1 
ATOM   1540  N  N   . LEU A  1  207 ? 38.657   1.148    229.788 1.00 136.47 ? 207  LEU A N   1 
ATOM   1541  C  CA  . LEU A  1  207 ? 39.319   0.677    231.002 1.00 138.37 ? 207  LEU A CA  1 
ATOM   1542  C  C   . LEU A  1  207 ? 38.482   -0.344   231.760 1.00 138.21 ? 207  LEU A C   1 
ATOM   1543  O  O   . LEU A  1  207 ? 39.023   -1.202   232.455 1.00 143.29 ? 207  LEU A O   1 
ATOM   1544  C  CB  . LEU A  1  207 ? 39.657   1.856    231.918 1.00 139.55 ? 207  LEU A CB  1 
ATOM   1545  C  CG  . LEU A  1  207 ? 40.662   2.875    231.372 1.00 146.35 ? 207  LEU A CG  1 
ATOM   1546  C  CD1 . LEU A  1  207 ? 41.055   3.858    232.465 1.00 154.44 ? 207  LEU A CD1 1 
ATOM   1547  C  CD2 . LEU A  1  207 ? 41.902   2.192    230.797 1.00 151.71 ? 207  LEU A CD2 1 
ATOM   1548  N  N   . GLY A  1  208 ? 37.164   -0.243   231.638 1.00 120.36 ? 208  GLY A N   1 
ATOM   1549  C  CA  . GLY A  1  208 ? 36.280   -1.203   232.267 1.00 120.14 ? 208  GLY A CA  1 
ATOM   1550  C  C   . GLY A  1  208 ? 36.500   -2.578   231.669 1.00 120.05 ? 208  GLY A C   1 
ATOM   1551  O  O   . GLY A  1  208 ? 36.543   -3.582   232.381 1.00 121.03 ? 208  GLY A O   1 
ATOM   1552  N  N   . SER A  1  209 ? 36.651   -2.615   230.349 1.00 109.88 ? 209  SER A N   1 
ATOM   1553  C  CA  . SER A  1  209 ? 36.867   -3.866   229.635 1.00 109.78 ? 209  SER A CA  1 
ATOM   1554  C  C   . SER A  1  209 ? 38.295   -4.356   229.839 1.00 111.70 ? 209  SER A C   1 
ATOM   1555  O  O   . SER A  1  209 ? 38.546   -5.560   229.895 1.00 112.40 ? 209  SER A O   1 
ATOM   1556  C  CB  . SER A  1  209 ? 36.578   -3.682   228.144 1.00 108.15 ? 209  SER A CB  1 
ATOM   1557  O  OG  . SER A  1  209 ? 36.653   -4.914   227.450 1.00 108.01 ? 209  SER A OG  1 
ATOM   1558  N  N   . LEU A  1  210 ? 39.230   -3.418   229.948 1.00 112.66 ? 210  LEU A N   1 
ATOM   1559  C  CA  . LEU A  1  210 ? 40.627   -3.758   230.179 1.00 114.63 ? 210  LEU A CA  1 
ATOM   1560  C  C   . LEU A  1  210 ? 40.809   -4.245   231.606 1.00 116.30 ? 210  LEU A C   1 
ATOM   1561  O  O   . LEU A  1  210 ? 41.459   -5.260   231.852 1.00 117.64 ? 210  LEU A O   1 
ATOM   1562  C  CB  . LEU A  1  210 ? 41.537   -2.551   229.915 1.00 115.25 ? 210  LEU A CB  1 
ATOM   1563  C  CG  . LEU A  1  210 ? 43.025   -2.792   229.616 1.00 116.96 ? 210  LEU A CG  1 
ATOM   1564  C  CD1 . LEU A  1  210 ? 43.810   -2.971   230.910 1.00 119.18 ? 210  LEU A CD1 1 
ATOM   1565  C  CD2 . LEU A  1  210 ? 43.257   -3.979   228.683 1.00 116.76 ? 210  LEU A CD2 1 
ATOM   1566  N  N   . GLY A  1  211 ? 40.234   -3.504   232.546 1.00 116.33 ? 211  GLY A N   1 
ATOM   1567  C  CA  . GLY A  1  211 ? 40.354   -3.822   233.954 1.00 118.01 ? 211  GLY A CA  1 
ATOM   1568  C  C   . GLY A  1  211 ? 39.749   -5.167   234.303 1.00 118.05 ? 211  GLY A C   1 
ATOM   1569  O  O   . GLY A  1  211 ? 40.298   -5.901   235.122 1.00 119.86 ? 211  GLY A O   1 
ATOM   1570  N  N   . TRP A  1  212 ? 38.614   -5.494   233.694 1.00 116.16 ? 212  TRP A N   1 
ATOM   1571  C  CA  . TRP A  1  212 ? 37.968   -6.775   233.957 1.00 116.15 ? 212  TRP A CA  1 
ATOM   1572  C  C   . TRP A  1  212 ? 38.744   -7.932   233.337 1.00 116.84 ? 212  TRP A C   1 
ATOM   1573  O  O   . TRP A  1  212 ? 38.767   -9.036   233.882 1.00 117.93 ? 212  TRP A O   1 
ATOM   1574  C  CB  . TRP A  1  212 ? 36.536   -6.779   233.433 1.00 113.99 ? 212  TRP A CB  1 
ATOM   1575  C  CG  . TRP A  1  212 ? 35.858   -8.098   233.618 1.00 113.98 ? 212  TRP A CG  1 
ATOM   1576  C  CD1 . TRP A  1  212 ? 35.488   -8.976   232.643 1.00 112.94 ? 212  TRP A CD1 1 
ATOM   1577  C  CD2 . TRP A  1  212 ? 35.489   -8.703   234.863 1.00 115.22 ? 212  TRP A CD2 1 
ATOM   1578  N  NE1 . TRP A  1  212 ? 34.897   -10.083  233.202 1.00 113.42 ? 212  TRP A NE1 1 
ATOM   1579  C  CE2 . TRP A  1  212 ? 34.885   -9.939   234.565 1.00 114.83 ? 212  TRP A CE2 1 
ATOM   1580  C  CE3 . TRP A  1  212 ? 35.599   -8.312   236.201 1.00 116.73 ? 212  TRP A CE3 1 
ATOM   1581  C  CZ2 . TRP A  1  212 ? 34.398   -10.788  235.556 1.00 115.90 ? 212  TRP A CZ2 1 
ATOM   1582  C  CZ3 . TRP A  1  212 ? 35.113   -9.156   237.182 1.00 117.80 ? 212  TRP A CZ3 1 
ATOM   1583  C  CH2 . TRP A  1  212 ? 34.521   -10.380  236.854 1.00 117.38 ? 212  TRP A CH2 1 
ATOM   1584  N  N   . ALA A  1  213 ? 39.380   -7.676   232.199 1.00 116.31 ? 213  ALA A N   1 
ATOM   1585  C  CA  . ALA A  1  213 ? 40.218   -8.679   231.557 1.00 117.10 ? 213  ALA A CA  1 
ATOM   1586  C  C   . ALA A  1  213 ? 41.396   -9.024   232.457 1.00 119.60 ? 213  ALA A C   1 
ATOM   1587  O  O   . ALA A  1  213 ? 41.916   -10.137  232.418 1.00 120.74 ? 213  ALA A O   1 
ATOM   1588  C  CB  . ALA A  1  213 ? 40.706   -8.188   230.205 1.00 116.22 ? 213  ALA A CB  1 
ATOM   1589  N  N   . GLY A  1  214 ? 41.810   -8.059   233.271 1.00 120.54 ? 214  GLY A N   1 
ATOM   1590  C  CA  . GLY A  1  214 ? 42.881   -8.277   234.222 1.00 123.01 ? 214  GLY A CA  1 
ATOM   1591  C  C   . GLY A  1  214 ? 42.443   -9.210   235.335 1.00 124.11 ? 214  GLY A C   1 
ATOM   1592  O  O   . GLY A  1  214 ? 43.226   -10.037  235.803 1.00 126.06 ? 214  GLY A O   1 
ATOM   1593  N  N   . HIS A  1  215 ? 41.190   -9.077   235.761 1.00 128.91 ? 215  HIS A N   1 
ATOM   1594  C  CA  . HIS A  1  215 ? 40.635   -9.959   236.785 1.00 129.87 ? 215  HIS A CA  1 
ATOM   1595  C  C   . HIS A  1  215 ? 40.437   -11.371  236.262 1.00 129.74 ? 215  HIS A C   1 
ATOM   1596  O  O   . HIS A  1  215 ? 40.760   -12.344  236.943 1.00 131.52 ? 215  HIS A O   1 
ATOM   1597  C  CB  . HIS A  1  215 ? 39.298   -9.428   237.293 1.00 128.64 ? 215  HIS A CB  1 
ATOM   1598  C  CG  . HIS A  1  215 ? 38.661   -10.293  238.334 1.00 129.65 ? 215  HIS A CG  1 
ATOM   1599  N  ND1 . HIS A  1  215 ? 39.086   -10.308  239.644 1.00 131.88 ? 215  HIS A ND1 1 
ATOM   1600  C  CD2 . HIS A  1  215 ? 37.623   -11.160  238.266 1.00 128.85 ? 215  HIS A CD2 1 
ATOM   1601  C  CE1 . HIS A  1  215 ? 38.345   -11.152  240.337 1.00 132.43 ? 215  HIS A CE1 1 
ATOM   1602  N  NE2 . HIS A  1  215 ? 37.449   -11.682  239.525 1.00 130.61 ? 215  HIS A NE2 1 
ATOM   1603  N  N   . GLN A  1  216 ? 39.896   -11.475  235.052 1.00 126.77 ? 216  GLN A N   1 
ATOM   1604  C  CA  . GLN A  1  216 ? 39.610   -12.774  234.461 1.00 126.50 ? 216  GLN A CA  1 
ATOM   1605  C  C   . GLN A  1  216 ? 40.877   -13.602  234.351 1.00 128.42 ? 216  GLN A C   1 
ATOM   1606  O  O   . GLN A  1  216 ? 40.869   -14.807  234.598 1.00 129.47 ? 216  GLN A O   1 
ATOM   1607  C  CB  . GLN A  1  216 ? 38.977   -12.624  233.076 1.00 124.15 ? 216  GLN A CB  1 
ATOM   1608  C  CG  . GLN A  1  216 ? 37.474   -12.418  233.090 1.00 122.32 ? 216  GLN A CG  1 
ATOM   1609  C  CD  . GLN A  1  216 ? 36.833   -12.777  231.765 1.00 120.45 ? 216  GLN A CD  1 
ATOM   1610  O  OE1 . GLN A  1  216 ? 35.896   -13.574  231.712 1.00 119.85 ? 216  GLN A OE1 1 
ATOM   1611  N  NE2 . GLN A  1  216 ? 37.346   -12.204  230.684 1.00 119.64 ? 216  GLN A NE2 1 
ATOM   1612  N  N   . ILE A  1  217 ? 41.970   -12.942  233.989 1.00 124.00 ? 217  ILE A N   1 
ATOM   1613  C  CA  . ILE A  1  217 ? 43.228   -13.627  233.750 1.00 125.78 ? 217  ILE A CA  1 
ATOM   1614  C  C   . ILE A  1  217 ? 43.930   -13.994  235.054 1.00 128.39 ? 217  ILE A C   1 
ATOM   1615  O  O   . ILE A  1  217 ? 44.539   -15.059  235.150 1.00 130.02 ? 217  ILE A O   1 
ATOM   1616  C  CB  . ILE A  1  217 ? 44.162   -12.763  232.873 1.00 125.56 ? 217  ILE A CB  1 
ATOM   1617  C  CG1 . ILE A  1  217 ? 43.569   -12.629  231.467 1.00 123.28 ? 217  ILE A CG1 1 
ATOM   1618  C  CG2 . ILE A  1  217 ? 45.555   -13.377  232.780 1.00 127.73 ? 217  ILE A CG2 1 
ATOM   1619  C  CD1 . ILE A  1  217 ? 44.209   -11.551  230.616 1.00 122.72 ? 217  ILE A CD1 1 
ATOM   1620  N  N   . HIS A  1  218 ? 43.843   -13.124  236.054 1.00 131.47 ? 218  HIS A N   1 
ATOM   1621  C  CA  . HIS A  1  218 ? 44.579   -13.328  237.299 1.00 134.08 ? 218  HIS A CA  1 
ATOM   1622  C  C   . HIS A  1  218 ? 43.778   -14.060  238.381 1.00 134.86 ? 218  HIS A C   1 
ATOM   1623  O  O   . HIS A  1  218 ? 44.369   -14.628  239.301 1.00 137.24 ? 218  HIS A O   1 
ATOM   1624  C  CB  . HIS A  1  218 ? 45.075   -11.983  237.828 1.00 134.60 ? 218  HIS A CB  1 
ATOM   1625  C  CG  . HIS A  1  218 ? 46.254   -11.452  237.075 1.00 134.99 ? 218  HIS A CG  1 
ATOM   1626  N  ND1 . HIS A  1  218 ? 46.215   -11.204  235.719 1.00 133.18 ? 218  HIS A ND1 1 
ATOM   1627  C  CD2 . HIS A  1  218 ? 47.510   -11.147  237.478 1.00 137.09 ? 218  HIS A CD2 1 
ATOM   1628  C  CE1 . HIS A  1  218 ? 47.393   -10.755  235.322 1.00 134.16 ? 218  HIS A CE1 1 
ATOM   1629  N  NE2 . HIS A  1  218 ? 48.196   -10.712  236.370 1.00 136.51 ? 218  HIS A NE2 1 
ATOM   1630  N  N   . VAL A  1  219 ? 42.450   -14.049  238.277 1.00 130.42 ? 219  VAL A N   1 
ATOM   1631  C  CA  . VAL A  1  219 ? 41.597   -14.711  239.271 1.00 131.11 ? 219  VAL A CA  1 
ATOM   1632  C  C   . VAL A  1  219 ? 40.728   -15.807  238.662 1.00 129.99 ? 219  VAL A C   1 
ATOM   1633  O  O   . VAL A  1  219 ? 40.877   -16.980  239.001 1.00 131.50 ? 219  VAL A O   1 
ATOM   1634  C  CB  . VAL A  1  219 ? 40.677   -13.700  239.992 1.00 130.28 ? 219  VAL A CB  1 
ATOM   1635  C  CG1 . VAL A  1  219 ? 39.682   -14.422  240.911 1.00 130.86 ? 219  VAL A CG1 1 
ATOM   1636  C  CG2 . VAL A  1  219 ? 41.507   -12.700  240.781 1.00 131.77 ? 219  VAL A CG2 1 
ATOM   1637  N  N   . SER A  1  220 ? 39.824   -15.423  237.767 1.00 127.47 ? 220  SER A N   1 
ATOM   1638  C  CA  . SER A  1  220 ? 38.827   -16.353  237.246 1.00 126.30 ? 220  SER A CA  1 
ATOM   1639  C  C   . SER A  1  220 ? 39.445   -17.532  236.506 1.00 127.00 ? 220  SER A C   1 
ATOM   1640  O  O   . SER A  1  220 ? 39.224   -18.684  236.875 1.00 128.11 ? 220  SER A O   1 
ATOM   1641  C  CB  . SER A  1  220 ? 37.860   -15.626  236.309 1.00 123.51 ? 220  SER A CB  1 
ATOM   1642  O  OG  . SER A  1  220 ? 37.137   -14.625  237.000 1.00 122.86 ? 220  SER A OG  1 
ATOM   1643  N  N   . MET A  1  221 ? 40.229   -17.236  235.474 1.00 126.46 ? 221  MET A N   1 
ATOM   1644  C  CA  . MET A  1  221 ? 40.773   -18.269  234.597 1.00 126.91 ? 221  MET A CA  1 
ATOM   1645  C  C   . MET A  1  221 ? 41.522   -19.371  235.343 1.00 129.61 ? 221  MET A C   1 
ATOM   1646  O  O   . MET A  1  221 ? 41.190   -20.547  235.189 1.00 130.03 ? 221  MET A O   1 
ATOM   1647  C  CB  . MET A  1  221 ? 41.692   -17.643  233.549 1.00 126.39 ? 221  MET A CB  1 
ATOM   1648  C  CG  . MET A  1  221 ? 40.947   -17.140  232.324 1.00 123.78 ? 221  MET A CG  1 
ATOM   1649  S  SD  . MET A  1  221 ? 42.032   -16.851  230.916 1.00 123.52 ? 221  MET A SD  1 
ATOM   1650  C  CE  . MET A  1  221 ? 42.415   -18.536  230.445 1.00 124.85 ? 221  MET A CE  1 
ATOM   1651  N  N   . PRO A  1  222 ? 42.539   -19.007  236.142 1.00 131.55 ? 222  PRO A N   1 
ATOM   1652  C  CA  . PRO A  1  222 ? 43.283   -20.086  236.799 1.00 134.24 ? 222  PRO A CA  1 
ATOM   1653  C  C   . PRO A  1  222 ? 42.417   -20.887  237.766 1.00 135.06 ? 222  PRO A C   1 
ATOM   1654  O  O   . PRO A  1  222 ? 42.485   -22.114  237.749 1.00 136.26 ? 222  PRO A O   1 
ATOM   1655  C  CB  . PRO A  1  222 ? 44.401   -19.349  237.541 1.00 136.01 ? 222  PRO A CB  1 
ATOM   1656  C  CG  . PRO A  1  222 ? 43.911   -17.959  237.703 1.00 134.42 ? 222  PRO A CG  1 
ATOM   1657  C  CD  . PRO A  1  222 ? 43.063   -17.678  236.500 1.00 131.59 ? 222  PRO A CD  1 
ATOM   1658  N  N   . ILE A  1  223 ? 41.619   -20.207  238.583 1.00 134.51 ? 223  ILE A N   1 
ATOM   1659  C  CA  . ILE A  1  223 ? 40.723   -20.886  239.517 1.00 135.28 ? 223  ILE A CA  1 
ATOM   1660  C  C   . ILE A  1  223 ? 39.769   -21.821  238.779 1.00 134.00 ? 223  ILE A C   1 
ATOM   1661  O  O   . ILE A  1  223 ? 39.682   -23.005  239.102 1.00 135.47 ? 223  ILE A O   1 
ATOM   1662  C  CB  . ILE A  1  223 ? 39.908   -19.877  240.366 1.00 134.59 ? 223  ILE A CB  1 
ATOM   1663  C  CG1 . ILE A  1  223 ? 40.805   -19.250  241.436 1.00 136.66 ? 223  ILE A CG1 1 
ATOM   1664  C  CG2 . ILE A  1  223 ? 38.709   -20.560  241.038 1.00 134.76 ? 223  ILE A CG2 1 
ATOM   1665  C  CD1 . ILE A  1  223 ? 40.160   -18.114  242.214 1.00 136.08 ? 223  ILE A CD1 1 
ATOM   1666  N  N   . ASN A  1  224 ? 39.056   -21.286  237.792 1.00 147.59 ? 224  ASN A N   1 
ATOM   1667  C  CA  . ASN A  1  224 ? 38.054   -22.062  237.067 1.00 146.22 ? 224  ASN A CA  1 
ATOM   1668  C  C   . ASN A  1  224 ? 38.660   -23.272  236.359 1.00 147.19 ? 224  ASN A C   1 
ATOM   1669  O  O   . ASN A  1  224 ? 37.973   -24.267  236.127 1.00 147.11 ? 224  ASN A O   1 
ATOM   1670  C  CB  . ASN A  1  224 ? 37.320   -21.179  236.053 1.00 143.31 ? 224  ASN A CB  1 
ATOM   1671  C  CG  . ASN A  1  224 ? 35.815   -21.339  236.125 1.00 141.90 ? 224  ASN A CG  1 
ATOM   1672  O  OD1 . ASN A  1  224 ? 35.106   -20.436  236.570 1.00 140.89 ? 224  ASN A OD1 1 
ATOM   1673  N  ND2 . ASN A  1  224 ? 35.319   -22.487  235.686 1.00 142.42 ? 224  ASN A ND2 1 
ATOM   1674  N  N   . LYS A  1  225 ? 39.941   -23.186  236.013 1.00 135.84 ? 225  LYS A N   1 
ATOM   1675  C  CA  . LYS A  1  225 ? 40.634   -24.309  235.389 1.00 137.05 ? 225  LYS A CA  1 
ATOM   1676  C  C   . LYS A  1  225 ? 40.749   -25.475  236.366 1.00 139.60 ? 225  LYS A C   1 
ATOM   1677  O  O   . LYS A  1  225 ? 40.764   -26.637  235.961 1.00 140.38 ? 225  LYS A O   1 
ATOM   1678  C  CB  . LYS A  1  225 ? 42.025   -23.895  234.906 1.00 137.79 ? 225  LYS A CB  1 
ATOM   1679  C  CG  . LYS A  1  225 ? 42.756   -24.993  234.148 1.00 138.98 ? 225  LYS A CG  1 
ATOM   1680  C  CD  . LYS A  1  225 ? 44.085   -24.507  233.602 1.00 139.61 ? 225  LYS A CD  1 
ATOM   1681  C  CE  . LYS A  1  225 ? 44.817   -25.612  232.860 1.00 140.94 ? 225  LYS A CE  1 
ATOM   1682  N  NZ  . LYS A  1  225 ? 46.104   -25.134  232.290 1.00 141.61 ? 225  LYS A NZ  1 
ATOM   1683  N  N   . LEU A  1  226 ? 40.830   -25.155  237.654 1.00 137.12 ? 226  LEU A N   1 
ATOM   1684  C  CA  . LEU A  1  226 ? 40.950   -26.175  238.689 1.00 139.75 ? 226  LEU A CA  1 
ATOM   1685  C  C   . LEU A  1  226 ? 39.606   -26.826  238.975 1.00 139.24 ? 226  LEU A C   1 
ATOM   1686  O  O   . LEU A  1  226 ? 39.545   -27.952  239.466 1.00 141.15 ? 226  LEU A O   1 
ATOM   1687  C  CB  . LEU A  1  226 ? 41.516   -25.575  239.975 1.00 141.57 ? 226  LEU A CB  1 
ATOM   1688  C  CG  . LEU A  1  226 ? 42.708   -24.638  239.797 1.00 141.83 ? 226  LEU A CG  1 
ATOM   1689  C  CD1 . LEU A  1  226 ? 43.342   -24.331  241.134 1.00 144.23 ? 226  LEU A CD1 1 
ATOM   1690  C  CD2 . LEU A  1  226 ? 43.737   -25.205  238.839 1.00 142.44 ? 226  LEU A CD2 1 
ATOM   1691  N  N   . LEU A  1  227 ? 38.530   -26.111  238.672 1.00 136.78 ? 227  LEU A N   1 
ATOM   1692  C  CA  . LEU A  1  227 ? 37.191   -26.640  238.876 1.00 136.13 ? 227  LEU A CA  1 
ATOM   1693  C  C   . LEU A  1  227 ? 36.833   -27.602  237.748 1.00 135.30 ? 227  LEU A C   1 
ATOM   1694  O  O   . LEU A  1  227 ? 35.946   -28.442  237.896 1.00 135.52 ? 227  LEU A O   1 
ATOM   1695  C  CB  . LEU A  1  227 ? 36.173   -25.502  238.971 1.00 133.90 ? 227  LEU A CB  1 
ATOM   1696  C  CG  . LEU A  1  227 ? 36.428   -24.508  240.112 1.00 134.72 ? 227  LEU A CG  1 
ATOM   1697  C  CD1 . LEU A  1  227 ? 35.404   -23.381  240.103 1.00 132.47 ? 227  LEU A CD1 1 
ATOM   1698  C  CD2 . LEU A  1  227 ? 36.438   -25.209  241.465 1.00 137.45 ? 227  LEU A CD2 1 
ATOM   1699  N  N   . ASP A  1  228 ? 37.529   -27.474  236.620 1.00 195.10 ? 228  ASP A N   1 
ATOM   1700  C  CA  . ASP A  1  228 ? 37.449   -28.468  235.557 1.00 214.45 ? 228  ASP A CA  1 
ATOM   1701  C  C   . ASP A  1  228 ? 38.108   -29.756  236.032 1.00 225.68 ? 228  ASP A C   1 
ATOM   1702  O  O   . ASP A  1  228 ? 37.573   -30.850  235.851 1.00 221.30 ? 228  ASP A O   1 
ATOM   1703  C  CB  . ASP A  1  228 ? 38.131   -27.967  234.282 1.00 222.65 ? 228  ASP A CB  1 
ATOM   1704  C  CG  . ASP A  1  228 ? 37.680   -26.575  233.884 1.00 241.95 ? 228  ASP A CG  1 
ATOM   1705  O  OD1 . ASP A  1  228 ? 36.564   -26.174  234.273 1.00 236.63 ? 228  ASP A OD1 1 
ATOM   1706  O  OD2 . ASP A  1  228 ? 38.444   -25.883  233.179 1.00 264.05 ? 228  ASP A OD2 1 
ATOM   1707  N  N   . ALA A  1  229 ? 39.279   -29.608  236.645 1.00 156.91 ? 229  ALA A N   1 
ATOM   1708  C  CA  . ALA A  1  229 ? 39.985   -30.731  237.248 1.00 158.67 ? 229  ALA A CA  1 
ATOM   1709  C  C   . ALA A  1  229 ? 39.211   -31.247  238.455 1.00 160.02 ? 229  ALA A C   1 
ATOM   1710  O  O   . ALA A  1  229 ? 39.403   -32.383  238.889 1.00 162.33 ? 229  ALA A O   1 
ATOM   1711  C  CB  . ALA A  1  229 ? 41.393   -30.320  237.650 1.00 160.41 ? 229  ALA A CB  1 
ATOM   1712  N  N   . GLY A  1  230 ? 38.338   -30.404  238.996 1.00 165.04 ? 230  GLY A N   1 
ATOM   1713  C  CA  . GLY A  1  230 ? 37.537   -30.766  240.149 1.00 166.23 ? 230  GLY A CA  1 
ATOM   1714  C  C   . GLY A  1  230 ? 38.372   -30.869  241.409 1.00 169.16 ? 230  GLY A C   1 
ATOM   1715  O  O   . GLY A  1  230 ? 38.215   -31.800  242.198 1.00 171.39 ? 230  GLY A O   1 
ATOM   1716  N  N   . VAL A  1  231 ? 39.262   -29.900  241.598 1.00 146.27 ? 231  VAL A N   1 
ATOM   1717  C  CA  . VAL A  1  231 ? 40.127   -29.861  242.772 1.00 149.04 ? 231  VAL A CA  1 
ATOM   1718  C  C   . VAL A  1  231 ? 39.309   -29.622  244.043 1.00 149.79 ? 231  VAL A C   1 
ATOM   1719  O  O   . VAL A  1  231 ? 39.788   -29.875  245.147 1.00 152.48 ? 231  VAL A O   1 
ATOM   1720  C  CB  . VAL A  1  231 ? 41.215   -28.761  242.621 1.00 148.77 ? 231  VAL A CB  1 
ATOM   1721  C  CG1 . VAL A  1  231 ? 42.102   -28.661  243.864 1.00 151.70 ? 231  VAL A CG1 1 
ATOM   1722  C  CG2 . VAL A  1  231 ? 42.071   -29.029  241.393 1.00 148.29 ? 231  VAL A CG2 1 
ATOM   1723  N  N   . ALA A  1  232 ? 38.070   -29.163  243.866 1.00 152.89 ? 232  ALA A N   1 
ATOM   1724  C  CA  . ALA A  1  232 ? 37.179   -28.757  244.957 1.00 153.19 ? 232  ALA A CA  1 
ATOM   1725  C  C   . ALA A  1  232 ? 37.661   -27.429  245.543 1.00 153.11 ? 232  ALA A C   1 
ATOM   1726  O  O   . ALA A  1  232 ? 38.864   -27.188  245.632 1.00 154.34 ? 232  ALA A O   1 
ATOM   1727  C  CB  . ALA A  1  232 ? 37.081   -29.838  246.049 1.00 156.26 ? 232  ALA A CB  1 
ATOM   1728  N  N   . PRO A  1  233 ? 36.717   -26.564  245.948 1.00 146.40 ? 233  PRO A N   1 
ATOM   1729  C  CA  . PRO A  1  233 ? 37.027   -25.162  246.262 1.00 145.71 ? 233  PRO A CA  1 
ATOM   1730  C  C   . PRO A  1  233 ? 38.063   -24.957  247.367 1.00 148.54 ? 233  PRO A C   1 
ATOM   1731  O  O   . PRO A  1  233 ? 38.937   -24.103  247.223 1.00 148.37 ? 233  PRO A O   1 
ATOM   1732  C  CB  . PRO A  1  233 ? 35.669   -24.591  246.695 1.00 144.40 ? 233  PRO A CB  1 
ATOM   1733  C  CG  . PRO A  1  233 ? 34.856   -25.768  247.091 1.00 145.53 ? 233  PRO A CG  1 
ATOM   1734  C  CD  . PRO A  1  233 ? 35.299   -26.877  246.197 1.00 145.69 ? 233  PRO A CD  1 
ATOM   1735  N  N   . LYS A  1  234 ? 37.968   -25.716  248.452 1.00 198.21 ? 234  LYS A N   1 
ATOM   1736  C  CA  . LYS A  1  234 ? 38.816   -25.472  249.614 1.00 201.02 ? 234  LYS A CA  1 
ATOM   1737  C  C   . LYS A  1  234 ? 40.286   -25.796  249.337 1.00 202.57 ? 234  LYS A C   1 
ATOM   1738  O  O   . LYS A  1  234 ? 41.178   -25.130  249.862 1.00 203.87 ? 234  LYS A O   1 
ATOM   1739  C  CB  . LYS A  1  234 ? 38.306   -26.269  250.818 1.00 203.62 ? 234  LYS A CB  1 
ATOM   1740  C  CG  . LYS A  1  234 ? 38.026   -25.401  252.042 1.00 205.60 ? 234  LYS A CG  1 
ATOM   1741  C  CD  . LYS A  1  234 ? 36.927   -25.983  252.920 1.00 212.36 ? 234  LYS A CD  1 
ATOM   1742  C  CE  . LYS A  1  234 ? 36.446   -24.967  253.947 1.00 215.85 ? 234  LYS A CE  1 
ATOM   1743  N  NZ  . LYS A  1  234 ? 35.075   -25.270  254.443 1.00 216.76 ? 234  LYS A NZ  1 
ATOM   1744  N  N   . ASP A  1  235 ? 40.539   -26.813  248.519 1.00 218.81 ? 235  ASP A N   1 
ATOM   1745  C  CA  . ASP A  1  235 ? 41.906   -27.152  248.129 1.00 223.68 ? 235  ASP A CA  1 
ATOM   1746  C  C   . ASP A  1  235 ? 42.507   -26.084  247.217 1.00 227.25 ? 235  ASP A C   1 
ATOM   1747  O  O   . ASP A  1  235 ? 43.719   -25.868  247.218 1.00 232.89 ? 235  ASP A O   1 
ATOM   1748  C  CB  . ASP A  1  235 ? 41.949   -28.514  247.432 1.00 232.99 ? 235  ASP A CB  1 
ATOM   1749  C  CG  . ASP A  1  235 ? 42.296   -29.644  248.382 1.00 252.36 ? 235  ASP A CG  1 
ATOM   1750  O  OD1 . ASP A  1  235 ? 41.374   -30.192  249.020 1.00 264.31 ? 235  ASP A OD1 1 
ATOM   1751  O  OD2 . ASP A  1  235 ? 43.494   -29.985  248.487 1.00 255.89 ? 235  ASP A OD2 1 
ATOM   1752  N  N   . ILE A  1  236 ? 41.655   -25.420  246.441 1.00 151.66 ? 236  ILE A N   1 
ATOM   1753  C  CA  . ILE A  1  236 ? 42.102   -24.369  245.531 1.00 149.55 ? 236  ILE A CA  1 
ATOM   1754  C  C   . ILE A  1  236 ? 42.654   -23.181  246.319 1.00 150.33 ? 236  ILE A C   1 
ATOM   1755  O  O   . ILE A  1  236 ? 42.014   -22.712  247.260 1.00 150.67 ? 236  ILE A O   1 
ATOM   1756  C  CB  . ILE A  1  236 ? 40.951   -23.898  244.610 1.00 146.13 ? 236  ILE A CB  1 
ATOM   1757  C  CG1 . ILE A  1  236 ? 40.565   -25.024  243.647 1.00 145.31 ? 236  ILE A CG1 1 
ATOM   1758  C  CG2 . ILE A  1  236 ? 41.337   -22.627  243.846 1.00 144.09 ? 236  ILE A CG2 1 
ATOM   1759  C  CD1 . ILE A  1  236 ? 39.317   -24.754  242.842 1.00 142.28 ? 236  ILE A CD1 1 
ATOM   1760  N  N   . PRO A  1  237 ? 43.846   -22.685  245.940 1.00 171.16 ? 237  PRO A N   1 
ATOM   1761  C  CA  . PRO A  1  237 ? 44.424   -21.551  246.672 1.00 172.04 ? 237  PRO A CA  1 
ATOM   1762  C  C   . PRO A  1  237 ? 43.639   -20.265  246.450 1.00 178.29 ? 237  PRO A C   1 
ATOM   1763  O  O   . PRO A  1  237 ? 42.888   -20.165  245.482 1.00 186.42 ? 237  PRO A O   1 
ATOM   1764  C  CB  . PRO A  1  237 ? 45.836   -21.439  246.090 1.00 172.84 ? 237  PRO A CB  1 
ATOM   1765  C  CG  . PRO A  1  237 ? 45.728   -22.020  244.731 1.00 171.03 ? 237  PRO A CG  1 
ATOM   1766  C  CD  . PRO A  1  237 ? 44.706   -23.112  244.822 1.00 170.88 ? 237  PRO A CD  1 
ATOM   1767  N  N   . LEU A  1  238 ? 43.815   -19.292  247.337 1.00 149.87 ? 238  LEU A N   1 
ATOM   1768  C  CA  . LEU A  1  238 ? 43.085   -18.038  247.229 1.00 147.67 ? 238  LEU A CA  1 
ATOM   1769  C  C   . LEU A  1  238 ? 43.520   -17.281  245.975 1.00 145.50 ? 238  LEU A C   1 
ATOM   1770  O  O   . LEU A  1  238 ? 44.627   -17.492  245.481 1.00 146.31 ? 238  LEU A O   1 
ATOM   1771  C  CB  . LEU A  1  238 ? 43.305   -17.183  248.479 1.00 149.44 ? 238  LEU A CB  1 
ATOM   1772  C  CG  . LEU A  1  238 ? 42.824   -17.828  249.782 1.00 151.70 ? 238  LEU A CG  1 
ATOM   1773  C  CD1 . LEU A  1  238 ? 43.288   -17.028  250.990 1.00 153.88 ? 238  LEU A CD1 1 
ATOM   1774  C  CD2 . LEU A  1  238 ? 41.308   -17.980  249.789 1.00 149.97 ? 238  LEU A CD2 1 
ATOM   1775  N  N   . PRO A  1  239 ? 42.649   -16.399  245.455 1.00 147.75 ? 239  PRO A N   1 
ATOM   1776  C  CA  . PRO A  1  239 ? 42.945   -15.652  244.224 1.00 145.59 ? 239  PRO A CA  1 
ATOM   1777  C  C   . PRO A  1  239 ? 44.270   -14.892  244.263 1.00 146.82 ? 239  PRO A C   1 
ATOM   1778  O  O   . PRO A  1  239 ? 45.066   -15.000  243.332 1.00 146.52 ? 239  PRO A O   1 
ATOM   1779  C  CB  . PRO A  1  239 ? 41.770   -14.676  244.120 1.00 143.25 ? 239  PRO A CB  1 
ATOM   1780  C  CG  . PRO A  1  239 ? 40.659   -15.350  244.832 1.00 143.50 ? 239  PRO A CG  1 
ATOM   1781  C  CD  . PRO A  1  239 ? 41.295   -16.106  245.959 1.00 146.67 ? 239  PRO A CD  1 
ATOM   1782  N  N   . HIS A  1  240 ? 44.491   -14.129  245.327 1.00 143.37 ? 240  HIS A N   1 
ATOM   1783  C  CA  . HIS A  1  240 ? 45.696   -13.315  245.455 1.00 144.65 ? 240  HIS A CA  1 
ATOM   1784  C  C   . HIS A  1  240 ? 46.954   -14.173  245.545 1.00 147.11 ? 240  HIS A C   1 
ATOM   1785  O  O   . HIS A  1  240 ? 48.050   -13.713  245.227 1.00 147.84 ? 240  HIS A O   1 
ATOM   1786  C  CB  . HIS A  1  240 ? 45.592   -12.408  246.684 1.00 145.95 ? 240  HIS A CB  1 
ATOM   1787  C  CG  . HIS A  1  240 ? 45.259   -13.137  247.949 1.00 148.11 ? 240  HIS A CG  1 
ATOM   1788  N  ND1 . HIS A  1  240 ? 46.200   -13.830  248.680 1.00 151.13 ? 240  HIS A ND1 1 
ATOM   1789  C  CD2 . HIS A  1  240 ? 44.085   -13.289  248.606 1.00 147.81 ? 240  HIS A CD2 1 
ATOM   1790  C  CE1 . HIS A  1  240 ? 45.621   -14.372  249.737 1.00 152.61 ? 240  HIS A CE1 1 
ATOM   1791  N  NE2 . HIS A  1  240 ? 44.338   -14.059  249.715 1.00 150.64 ? 240  HIS A NE2 1 
ATOM   1792  N  N   . GLU A  1  241 ? 46.793   -15.420  245.976 1.00 165.44 ? 241  GLU A N   1 
ATOM   1793  C  CA  . GLU A  1  241 ? 47.924   -16.329  246.122 1.00 167.96 ? 241  GLU A CA  1 
ATOM   1794  C  C   . GLU A  1  241 ? 48.543   -16.658  244.766 1.00 166.91 ? 241  GLU A C   1 
ATOM   1795  O  O   . GLU A  1  241 ? 49.707   -17.049  244.685 1.00 168.80 ? 241  GLU A O   1 
ATOM   1796  C  CB  . GLU A  1  241 ? 47.491   -17.614  246.829 1.00 169.54 ? 241  GLU A CB  1 
ATOM   1797  C  CG  . GLU A  1  241 ? 48.609   -18.304  247.597 1.00 173.02 ? 241  GLU A CG  1 
ATOM   1798  C  CD  . GLU A  1  241 ? 49.079   -17.494  248.790 1.00 175.11 ? 241  GLU A CD  1 
ATOM   1799  O  OE1 . GLU A  1  241 ? 48.230   -17.118  249.626 1.00 175.08 ? 241  GLU A OE1 1 
ATOM   1800  O  OE2 . GLU A  1  241 ? 50.296   -17.230  248.891 1.00 176.88 ? 241  GLU A OE2 1 
ATOM   1801  N  N   . PHE A  1  242 ? 47.758   -16.501  243.704 1.00 169.14 ? 242  PHE A N   1 
ATOM   1802  C  CA  . PHE A  1  242 ? 48.255   -16.723  242.350 1.00 166.93 ? 242  PHE A CA  1 
ATOM   1803  C  C   . PHE A  1  242 ? 49.230   -15.626  241.932 1.00 166.93 ? 242  PHE A C   1 
ATOM   1804  O  O   . PHE A  1  242 ? 50.052   -15.829  241.038 1.00 167.02 ? 242  PHE A O   1 
ATOM   1805  C  CB  . PHE A  1  242 ? 47.093   -16.799  241.356 1.00 163.88 ? 242  PHE A CB  1 
ATOM   1806  C  CG  . PHE A  1  242 ? 46.328   -18.092  241.411 1.00 163.91 ? 242  PHE A CG  1 
ATOM   1807  C  CD1 . PHE A  1  242 ? 45.259   -18.248  242.278 1.00 163.84 ? 242  PHE A CD1 1 
ATOM   1808  C  CD2 . PHE A  1  242 ? 46.681   -19.154  240.595 1.00 164.13 ? 242  PHE A CD2 1 
ATOM   1809  C  CE1 . PHE A  1  242 ? 44.556   -19.438  242.327 1.00 163.98 ? 242  PHE A CE1 1 
ATOM   1810  C  CE2 . PHE A  1  242 ? 45.984   -20.345  240.641 1.00 164.26 ? 242  PHE A CE2 1 
ATOM   1811  C  CZ  . PHE A  1  242 ? 44.920   -20.488  241.507 1.00 164.18 ? 242  PHE A CZ  1 
ATOM   1812  N  N   . ILE A  1  243 ? 49.141   -14.470  242.584 1.00 165.77 ? 243  ILE A N   1 
ATOM   1813  C  CA  . ILE A  1  243 ? 50.025   -13.348  242.283 1.00 165.90 ? 243  ILE A CA  1 
ATOM   1814  C  C   . ILE A  1  243 ? 51.275   -13.395  243.166 1.00 169.14 ? 243  ILE A C   1 
ATOM   1815  O  O   . ILE A  1  243 ? 52.366   -13.037  242.722 1.00 169.95 ? 243  ILE A O   1 
ATOM   1816  C  CB  . ILE A  1  243 ? 49.307   -11.991  242.466 1.00 164.25 ? 243  ILE A CB  1 
ATOM   1817  C  CG1 . ILE A  1  243 ? 48.019   -11.956  241.633 1.00 161.14 ? 243  ILE A CG1 1 
ATOM   1818  C  CG2 . ILE A  1  243 ? 50.226   -10.839  242.058 1.00 164.37 ? 243  ILE A CG2 1 
ATOM   1819  C  CD1 . ILE A  1  243 ? 47.160   -10.721  241.857 1.00 159.54 ? 243  ILE A CD1 1 
ATOM   1820  N  N   . LEU A  1  244 ? 51.115   -13.846  244.408 1.00 179.41 ? 244  LEU A N   1 
ATOM   1821  C  CA  . LEU A  1  244 ? 52.249   -13.991  245.320 1.00 182.71 ? 244  LEU A CA  1 
ATOM   1822  C  C   . LEU A  1  244 ? 53.228   -15.058  244.827 1.00 184.22 ? 244  LEU A C   1 
ATOM   1823  O  O   . LEU A  1  244 ? 54.435   -14.952  245.043 1.00 186.44 ? 244  LEU A O   1 
ATOM   1824  C  CB  . LEU A  1  244 ? 51.760   -14.334  246.730 1.00 184.48 ? 244  LEU A CB  1 
ATOM   1825  C  CG  . LEU A  1  244 ? 51.476   -13.144  247.652 1.00 184.78 ? 244  LEU A CG  1 
ATOM   1826  C  CD1 . LEU A  1  244 ? 52.780   -12.503  248.109 1.00 187.18 ? 244  LEU A CD1 1 
ATOM   1827  C  CD2 . LEU A  1  244 ? 50.579   -12.112  246.977 1.00 181.62 ? 244  LEU A CD2 1 
ATOM   1828  N  N   . GLU A  1  245 ? 52.691   -16.077  244.163 1.00 198.73 ? 245  GLU A N   1 
ATOM   1829  C  CA  . GLU A  1  245 ? 53.488   -17.127  243.529 1.00 199.84 ? 245  GLU A CA  1 
ATOM   1830  C  C   . GLU A  1  245 ? 53.241   -17.133  242.021 1.00 197.21 ? 245  GLU A C   1 
ATOM   1831  O  O   . GLU A  1  245 ? 52.348   -17.824  241.534 1.00 195.63 ? 245  GLU A O   1 
ATOM   1832  C  CB  . GLU A  1  245 ? 53.168   -18.507  244.129 1.00 203.19 ? 245  GLU A CB  1 
ATOM   1833  C  CG  . GLU A  1  245 ? 54.293   -19.145  244.950 1.00 216.61 ? 245  GLU A CG  1 
ATOM   1834  C  CD  . GLU A  1  245 ? 54.511   -18.511  246.310 1.00 216.13 ? 245  GLU A CD  1 
ATOM   1835  O  OE1 . GLU A  1  245 ? 53.647   -17.732  246.762 1.00 226.07 ? 245  GLU A OE1 1 
ATOM   1836  O  OE2 . GLU A  1  245 ? 55.555   -18.805  246.931 1.00 210.06 ? 245  GLU A OE2 1 
ATOM   1837  N  N   . PRO A  1  246 ? 54.021   -16.335  241.273 1.00 180.10 ? 246  PRO A N   1 
ATOM   1838  C  CA  . PRO A  1  246 ? 53.967   -16.401  239.809 1.00 178.05 ? 246  PRO A CA  1 
ATOM   1839  C  C   . PRO A  1  246 ? 54.324   -17.785  239.281 1.00 181.15 ? 246  PRO A C   1 
ATOM   1840  O  O   . PRO A  1  246 ? 54.044   -18.098  238.125 1.00 184.46 ? 246  PRO A O   1 
ATOM   1841  C  CB  . PRO A  1  246 ? 55.002   -15.365  239.373 1.00 178.42 ? 246  PRO A CB  1 
ATOM   1842  C  CG  . PRO A  1  246 ? 55.053   -14.393  240.500 1.00 179.34 ? 246  PRO A CG  1 
ATOM   1843  C  CD  . PRO A  1  246 ? 54.847   -15.210  241.742 1.00 181.31 ? 246  PRO A CD  1 
ATOM   1844  N  N   . SER A  1  247 ? 54.945   -18.598  240.130 1.00 172.71 ? 247  SER A N   1 
ATOM   1845  C  CA  . SER A  1  247 ? 55.208   -19.990  239.803 1.00 173.89 ? 247  SER A CA  1 
ATOM   1846  C  C   . SER A  1  247 ? 53.886   -20.738  239.640 1.00 172.16 ? 247  SER A C   1 
ATOM   1847  O  O   . SER A  1  247 ? 53.754   -21.594  238.765 1.00 171.56 ? 247  SER A O   1 
ATOM   1848  C  CB  . SER A  1  247 ? 56.077   -20.641  240.883 1.00 177.44 ? 247  SER A CB  1 
ATOM   1849  O  OG  . SER A  1  247 ? 55.468   -20.556  242.159 1.00 178.16 ? 247  SER A OG  1 
ATOM   1850  N  N   . LYS A  1  248 ? 52.911   -20.415  240.488 1.00 158.02 ? 248  LYS A N   1 
ATOM   1851  C  CA  . LYS A  1  248 ? 51.574   -20.996  240.373 1.00 156.28 ? 248  LYS A CA  1 
ATOM   1852  C  C   . LYS A  1  248 ? 50.904   -20.585  239.063 1.00 153.08 ? 248  LYS A C   1 
ATOM   1853  O  O   . LYS A  1  248 ? 50.356   -21.424  238.348 1.00 152.07 ? 248  LYS A O   1 
ATOM   1854  C  CB  . LYS A  1  248 ? 50.688   -20.582  241.554 1.00 156.21 ? 248  LYS A CB  1 
ATOM   1855  C  CG  . LYS A  1  248 ? 50.955   -21.336  242.848 1.00 159.23 ? 248  LYS A CG  1 
ATOM   1856  C  CD  . LYS A  1  248 ? 50.041   -20.843  243.962 1.00 159.09 ? 248  LYS A CD  1 
ATOM   1857  C  CE  . LYS A  1  248 ? 50.092   -21.750  245.181 1.00 161.96 ? 248  LYS A CE  1 
ATOM   1858  N  NZ  . LYS A  1  248 ? 51.465   -21.878  245.738 1.00 165.08 ? 248  LYS A NZ  1 
ATOM   1859  N  N   . MET A  1  249 ? 50.952   -19.293  238.752 1.00 146.97 ? 249  MET A N   1 
ATOM   1860  C  CA  . MET A  1  249 ? 50.360   -18.776  237.520 1.00 144.04 ? 249  MET A CA  1 
ATOM   1861  C  C   . MET A  1  249 ? 51.120   -19.244  236.284 1.00 144.08 ? 249  MET A C   1 
ATOM   1862  O  O   . MET A  1  249 ? 50.630   -19.106  235.165 1.00 141.89 ? 249  MET A O   1 
ATOM   1863  C  CB  . MET A  1  249 ? 50.317   -17.246  237.543 1.00 142.78 ? 249  MET A CB  1 
ATOM   1864  C  CG  . MET A  1  249 ? 49.060   -16.659  238.166 1.00 141.23 ? 249  MET A CG  1 
ATOM   1865  S  SD  . MET A  1  249 ? 47.801   -16.201  236.955 1.00 137.52 ? 249  MET A SD  1 
ATOM   1866  C  CE  . MET A  1  249 ? 47.489   -17.772  236.157 1.00 137.30 ? 249  MET A CE  1 
ATOM   1867  N  N   . ALA A  1  250 ? 52.324   -19.770  236.488 1.00 150.04 ? 250  ALA A N   1 
ATOM   1868  C  CA  . ALA A  1  250 ? 53.140   -20.282  235.392 1.00 150.50 ? 250  ALA A CA  1 
ATOM   1869  C  C   . ALA A  1  250 ? 52.884   -21.766  235.151 1.00 151.15 ? 250  ALA A C   1 
ATOM   1870  O  O   . ALA A  1  250 ? 52.899   -22.229  234.010 1.00 150.32 ? 250  ALA A O   1 
ATOM   1871  C  CB  . ALA A  1  250 ? 54.610   -20.044  235.678 1.00 153.04 ? 250  ALA A CB  1 
ATOM   1872  N  N   . GLU A  1  251 ? 52.655   -22.506  236.232 1.00 192.69 ? 251  GLU A N   1 
ATOM   1873  C  CA  . GLU A  1  251 ? 52.423   -23.945  236.152 1.00 193.64 ? 251  GLU A CA  1 
ATOM   1874  C  C   . GLU A  1  251 ? 51.223   -24.253  235.259 1.00 191.00 ? 251  GLU A C   1 
ATOM   1875  O  O   . GLU A  1  251 ? 51.197   -25.269  234.565 1.00 197.96 ? 251  GLU A O   1 
ATOM   1876  C  CB  . GLU A  1  251 ? 52.220   -24.527  237.551 1.00 195.65 ? 251  GLU A CB  1 
ATOM   1877  C  CG  . GLU A  1  251 ? 52.116   -26.044  237.580 1.00 205.78 ? 251  GLU A CG  1 
ATOM   1878  C  CD  . GLU A  1  251 ? 52.704   -26.650  238.842 1.00 218.43 ? 251  GLU A CD  1 
ATOM   1879  O  OE1 . GLU A  1  251 ? 52.741   -25.956  239.880 1.00 229.52 ? 251  GLU A OE1 1 
ATOM   1880  O  OE2 . GLU A  1  251 ? 53.133   -27.823  238.793 1.00 213.45 ? 251  GLU A OE2 1 
ATOM   1881  N  N   . LEU A  1  252 ? 50.233   -23.368  235.293 1.00 165.45 ? 252  LEU A N   1 
ATOM   1882  C  CA  . LEU A  1  252 ? 49.138   -23.385  234.331 1.00 162.71 ? 252  LEU A CA  1 
ATOM   1883  C  C   . LEU A  1  252 ? 49.424   -22.287  233.324 1.00 160.97 ? 252  LEU A C   1 
ATOM   1884  O  O   . LEU A  1  252 ? 49.845   -21.201  233.707 1.00 161.01 ? 252  LEU A O   1 
ATOM   1885  C  CB  . LEU A  1  252 ? 47.791   -23.160  235.014 1.00 161.28 ? 252  LEU A CB  1 
ATOM   1886  C  CG  . LEU A  1  252 ? 47.517   -24.053  236.222 1.00 163.22 ? 252  LEU A CG  1 
ATOM   1887  C  CD1 . LEU A  1  252 ? 46.308   -23.556  236.976 1.00 161.93 ? 252  LEU A CD1 1 
ATOM   1888  C  CD2 . LEU A  1  252 ? 47.319   -25.496  235.782 1.00 163.90 ? 252  LEU A CD2 1 
ATOM   1889  N  N   . TYR A  1  253 ? 49.208   -22.568  232.043 1.00 158.44 ? 253  TYR A N   1 
ATOM   1890  C  CA  . TYR A  1  253 ? 49.537   -21.610  230.992 1.00 159.40 ? 253  TYR A CA  1 
ATOM   1891  C  C   . TYR A  1  253 ? 51.052   -21.345  231.002 1.00 163.44 ? 253  TYR A C   1 
ATOM   1892  O  O   . TYR A  1  253 ? 51.516   -20.408  231.654 1.00 163.18 ? 253  TYR A O   1 
ATOM   1893  C  CB  . TYR A  1  253 ? 48.759   -20.300  231.171 1.00 154.12 ? 253  TYR A CB  1 
ATOM   1894  C  CG  . TYR A  1  253 ? 47.324   -20.469  231.622 1.00 152.60 ? 253  TYR A CG  1 
ATOM   1895  C  CD1 . TYR A  1  253 ? 46.391   -21.116  230.821 1.00 151.05 ? 253  TYR A CD1 1 
ATOM   1896  C  CD2 . TYR A  1  253 ? 46.900   -19.973  232.848 1.00 152.82 ? 253  TYR A CD2 1 
ATOM   1897  C  CE1 . TYR A  1  253 ? 45.078   -21.265  231.231 1.00 149.75 ? 253  TYR A CE1 1 
ATOM   1898  C  CE2 . TYR A  1  253 ? 45.592   -20.118  233.267 1.00 151.55 ? 253  TYR A CE2 1 
ATOM   1899  C  CZ  . TYR A  1  253 ? 44.685   -20.765  232.455 1.00 150.01 ? 253  TYR A CZ  1 
ATOM   1900  O  OH  . TYR A  1  253 ? 43.381   -20.910  232.870 1.00 148.84 ? 253  TYR A OH  1 
ATOM   1901  N  N   . PRO A  1  254 ? 51.830   -22.174  230.284 1.00 173.95 ? 254  PRO A N   1 
ATOM   1902  C  CA  . PRO A  1  254 ? 53.297   -22.110  230.365 1.00 176.34 ? 254  PRO A CA  1 
ATOM   1903  C  C   . PRO A  1  254 ? 53.872   -20.769  229.919 1.00 175.66 ? 254  PRO A C   1 
ATOM   1904  O  O   . PRO A  1  254 ? 55.026   -20.464  230.216 1.00 177.60 ? 254  PRO A O   1 
ATOM   1905  C  CB  . PRO A  1  254 ? 53.751   -23.226  229.419 1.00 177.28 ? 254  PRO A CB  1 
ATOM   1906  C  CG  . PRO A  1  254 ? 52.630   -23.385  228.461 1.00 174.76 ? 254  PRO A CG  1 
ATOM   1907  C  CD  . PRO A  1  254 ? 51.385   -23.122  229.247 1.00 173.20 ? 254  PRO A CD  1 
ATOM   1908  N  N   . SER A  1  255 ? 53.067   -19.982  229.214 1.00 151.38 ? 255  SER A N   1 
ATOM   1909  C  CA  . SER A  1  255 ? 53.525   -18.732  228.619 1.00 150.59 ? 255  SER A CA  1 
ATOM   1910  C  C   . SER A  1  255 ? 53.646   -17.585  229.625 1.00 150.77 ? 255  SER A C   1 
ATOM   1911  O  O   . SER A  1  255 ? 53.413   -16.426  229.282 1.00 149.23 ? 255  SER A O   1 
ATOM   1912  C  CB  . SER A  1  255 ? 52.574   -18.329  227.493 1.00 147.80 ? 255  SER A CB  1 
ATOM   1913  O  OG  . SER A  1  255 ? 51.229   -18.335  227.937 1.00 146.02 ? 255  SER A OG  1 
ATOM   1914  N  N   . PHE A  1  256 ? 54.002   -17.911  230.863 1.00 141.83 ? 256  PHE A N   1 
ATOM   1915  C  CA  . PHE A  1  256 ? 54.279   -16.901  231.878 1.00 142.50 ? 256  PHE A CA  1 
ATOM   1916  C  C   . PHE A  1  256 ? 55.768   -16.893  232.214 1.00 145.34 ? 256  PHE A C   1 
ATOM   1917  O  O   . PHE A  1  256 ? 56.239   -16.022  232.945 1.00 146.25 ? 256  PHE A O   1 
ATOM   1918  C  CB  . PHE A  1  256 ? 53.432   -17.145  233.128 1.00 142.55 ? 256  PHE A CB  1 
ATOM   1919  C  CG  . PHE A  1  256 ? 52.146   -16.364  233.146 1.00 139.92 ? 256  PHE A CG  1 
ATOM   1920  C  CD1 . PHE A  1  256 ? 51.054   -16.781  232.402 1.00 137.74 ? 256  PHE A CD1 1 
ATOM   1921  C  CD2 . PHE A  1  256 ? 52.030   -15.210  233.903 1.00 139.72 ? 256  PHE A CD2 1 
ATOM   1922  C  CE1 . PHE A  1  256 ? 49.871   -16.063  232.415 1.00 135.41 ? 256  PHE A CE1 1 
ATOM   1923  C  CE2 . PHE A  1  256 ? 50.850   -14.488  233.921 1.00 137.40 ? 256  PHE A CE2 1 
ATOM   1924  C  CZ  . PHE A  1  256 ? 49.770   -14.915  233.175 1.00 135.24 ? 256  PHE A CZ  1 
ATOM   1925  N  N   . ALA A  1  257 ? 56.502   -17.872  231.688 1.00 227.70 ? 257  ALA A N   1 
ATOM   1926  C  CA  . ALA A  1  257 ? 57.952   -17.915  231.852 1.00 248.39 ? 257  ALA A CA  1 
ATOM   1927  C  C   . ALA A  1  257 ? 58.574   -16.647  231.277 1.00 252.16 ? 257  ALA A C   1 
ATOM   1928  O  O   . ALA A  1  257 ? 59.343   -15.960  231.949 1.00 256.18 ? 257  ALA A O   1 
ATOM   1929  C  CB  . ALA A  1  257 ? 58.528   -19.147  231.173 1.00 262.00 ? 257  ALA A CB  1 
ATOM   1930  N  N   . GLN A  1  258 ? 58.231   -16.350  230.026 1.00 195.63 ? 258  GLN A N   1 
ATOM   1931  C  CA  . GLN A  1  258 ? 58.460   -15.031  229.450 1.00 185.14 ? 258  GLN A CA  1 
ATOM   1932  C  C   . GLN A  1  258 ? 57.174   -14.232  229.613 1.00 186.53 ? 258  GLN A C   1 
ATOM   1933  O  O   . GLN A  1  258 ? 56.355   -14.163  228.698 1.00 202.78 ? 258  GLN A O   1 
ATOM   1934  C  CB  . GLN A  1  258 ? 58.862   -15.134  227.977 1.00 181.06 ? 258  GLN A CB  1 
ATOM   1935  N  N   . GLY A  1  259 ? 57.008   -13.623  230.783 1.00 197.44 ? 259  GLY A N   1 
ATOM   1936  C  CA  . GLY A  1  259 ? 55.734   -13.042  231.169 1.00 208.48 ? 259  GLY A CA  1 
ATOM   1937  C  C   . GLY A  1  259 ? 55.425   -11.724  230.491 1.00 207.98 ? 259  GLY A C   1 
ATOM   1938  O  O   . GLY A  1  259 ? 54.610   -11.675  229.574 1.00 198.88 ? 259  GLY A O   1 
ATOM   1939  N  N   . LEU A  1  260 ? 56.075   -10.658  230.943 1.00 161.85 ? 260  LEU A N   1 
ATOM   1940  C  CA  . LEU A  1  260 ? 55.962   -9.360   230.291 1.00 160.44 ? 260  LEU A CA  1 
ATOM   1941  C  C   . LEU A  1  260 ? 57.122   -9.189   229.324 1.00 161.55 ? 260  LEU A C   1 
ATOM   1942  O  O   . LEU A  1  260 ? 58.147   -9.851   229.465 1.00 181.37 ? 260  LEU A O   1 
ATOM   1943  C  CB  . LEU A  1  260 ? 55.949   -8.227   231.321 1.00 160.85 ? 260  LEU A CB  1 
ATOM   1944  C  CG  . LEU A  1  260 ? 54.571   -7.667   231.691 1.00 158.63 ? 260  LEU A CG  1 
ATOM   1945  C  CD1 . LEU A  1  260 ? 53.891   -6.989   230.507 1.00 156.15 ? 260  LEU A CD1 1 
ATOM   1946  C  CD2 . LEU A  1  260 ? 53.697   -8.774   232.246 1.00 158.18 ? 260  LEU A CD2 1 
ATOM   1947  N  N   . THR A  1  261 ? 56.906   -8.333   228.326 1.00 146.39 ? 261  THR A N   1 
ATOM   1948  C  CA  . THR A  1  261 ? 57.868   -7.943   227.281 1.00 147.14 ? 261  THR A CA  1 
ATOM   1949  C  C   . THR A  1  261 ? 57.566   -8.634   225.944 1.00 145.94 ? 261  THR A C   1 
ATOM   1950  O  O   . THR A  1  261 ? 57.859   -8.065   224.895 1.00 145.55 ? 261  THR A O   1 
ATOM   1951  C  CB  . THR A  1  261 ? 59.371   -8.197   227.646 1.00 150.23 ? 261  THR A CB  1 
ATOM   1952  O  OG1 . THR A  1  261 ? 59.657   -9.600   227.727 1.00 151.43 ? 261  THR A OG1 1 
ATOM   1953  C  CG2 . THR A  1  261 ? 59.777   -7.465   228.939 1.00 151.69 ? 261  THR A CG2 1 
ATOM   1954  N  N   . PRO A  1  262 ? 56.990   -9.855   225.957 1.00 162.30 ? 262  PRO A N   1 
ATOM   1955  C  CA  . PRO A  1  262 ? 56.420   -10.252  224.665 1.00 160.64 ? 262  PRO A CA  1 
ATOM   1956  C  C   . PRO A  1  262 ? 55.296   -9.313   224.242 1.00 158.01 ? 262  PRO A C   1 
ATOM   1957  O  O   . PRO A  1  262 ? 55.104   -9.058   223.053 1.00 158.36 ? 262  PRO A O   1 
ATOM   1958  C  CB  . PRO A  1  262 ? 55.888   -11.658  224.934 1.00 161.24 ? 262  PRO A CB  1 
ATOM   1959  C  CG  . PRO A  1  262 ? 56.749   -12.175  226.010 1.00 163.09 ? 262  PRO A CG  1 
ATOM   1960  C  CD  . PRO A  1  262 ? 57.046   -10.999  226.887 1.00 163.61 ? 262  PRO A CD  1 
ATOM   1961  N  N   . PHE A  1  263 ? 54.559   -8.812   225.228 1.00 132.82 ? 263  PHE A N   1 
ATOM   1962  C  CA  . PHE A  1  263 ? 53.542   -7.798   224.991 1.00 130.56 ? 263  PHE A CA  1 
ATOM   1963  C  C   . PHE A  1  263 ? 54.187   -6.540   224.422 1.00 130.83 ? 263  PHE A C   1 
ATOM   1964  O  O   . PHE A  1  263 ? 53.703   -5.969   223.445 1.00 129.26 ? 263  PHE A O   1 
ATOM   1965  C  CB  . PHE A  1  263 ? 52.788   -7.483   226.288 1.00 130.07 ? 263  PHE A CB  1 
ATOM   1966  C  CG  . PHE A  1  263 ? 51.962   -6.228   226.222 1.00 128.25 ? 263  PHE A CG  1 
ATOM   1967  C  CD1 . PHE A  1  263 ? 52.517   -5.002   226.549 1.00 128.99 ? 263  PHE A CD1 1 
ATOM   1968  C  CD2 . PHE A  1  263 ? 50.636   -6.273   225.828 1.00 125.90 ? 263  PHE A CD2 1 
ATOM   1969  C  CE1 . PHE A  1  263 ? 51.767   -3.845   226.486 1.00 127.43 ? 263  PHE A CE1 1 
ATOM   1970  C  CE2 . PHE A  1  263 ? 49.878   -5.118   225.765 1.00 124.33 ? 263  PHE A CE2 1 
ATOM   1971  C  CZ  . PHE A  1  263 ? 50.446   -3.903   226.096 1.00 125.10 ? 263  PHE A CZ  1 
ATOM   1972  N  N   . PHE A  1  264 ? 55.287   -6.118   225.040 1.00 132.93 ? 264  PHE A N   1 
ATOM   1973  C  CA  . PHE A  1  264 ? 55.968   -4.888   224.648 1.00 133.48 ? 264  PHE A CA  1 
ATOM   1974  C  C   . PHE A  1  264 ? 56.891   -5.087   223.450 1.00 134.46 ? 264  PHE A C   1 
ATOM   1975  O  O   . PHE A  1  264 ? 57.229   -4.124   222.768 1.00 134.44 ? 264  PHE A O   1 
ATOM   1976  C  CB  . PHE A  1  264 ? 56.768   -4.323   225.822 1.00 135.47 ? 264  PHE A CB  1 
ATOM   1977  C  CG  . PHE A  1  264 ? 55.920   -3.661   226.868 1.00 134.54 ? 264  PHE A CG  1 
ATOM   1978  C  CD1 . PHE A  1  264 ? 55.454   -2.371   226.682 1.00 133.33 ? 264  PHE A CD1 1 
ATOM   1979  C  CD2 . PHE A  1  264 ? 55.588   -4.326   228.035 1.00 135.00 ? 264  PHE A CD2 1 
ATOM   1980  C  CE1 . PHE A  1  264 ? 54.672   -1.756   227.640 1.00 132.58 ? 264  PHE A CE1 1 
ATOM   1981  C  CE2 . PHE A  1  264 ? 54.805   -3.717   228.998 1.00 134.26 ? 264  PHE A CE2 1 
ATOM   1982  C  CZ  . PHE A  1  264 ? 54.348   -2.429   228.800 1.00 133.05 ? 264  PHE A CZ  1 
ATOM   1983  N  N   . THR A  1  265 ? 57.324   -6.323   223.216 1.00 135.47 ? 265  THR A N   1 
ATOM   1984  C  CA  . THR A  1  265 ? 58.120   -6.642   222.031 1.00 136.39 ? 265  THR A CA  1 
ATOM   1985  C  C   . THR A  1  265 ? 57.222   -7.091   220.879 1.00 134.40 ? 265  THR A C   1 
ATOM   1986  O  O   . THR A  1  265 ? 57.701   -7.335   219.772 1.00 134.89 ? 265  THR A O   1 
ATOM   1987  C  CB  . THR A  1  265 ? 59.157   -7.742   222.320 1.00 138.82 ? 265  THR A CB  1 
ATOM   1988  N  N   . LEU A  1  266 ? 55.925   -7.213   221.160 1.00 132.29 ? 266  LEU A N   1 
ATOM   1989  C  CA  . LEU A  1  266 ? 54.916   -7.534   220.150 1.00 130.23 ? 266  LEU A CA  1 
ATOM   1990  C  C   . LEU A  1  266 ? 54.928   -9.009   219.743 1.00 130.66 ? 266  LEU A C   1 
ATOM   1991  O  O   . LEU A  1  266 ? 54.490   -9.355   218.646 1.00 129.65 ? 266  LEU A O   1 
ATOM   1992  C  CB  . LEU A  1  266 ? 55.103   -6.658   218.907 1.00 129.78 ? 266  LEU A CB  1 
ATOM   1993  N  N   . ASN A  1  267 ? 55.426   -9.871   220.626 1.00 167.64 ? 267  ASN A N   1 
ATOM   1994  C  CA  . ASN A  1  267 ? 55.403   -11.312  220.385 1.00 168.18 ? 267  ASN A CA  1 
ATOM   1995  C  C   . ASN A  1  267 ? 53.974   -11.843  220.408 1.00 166.03 ? 267  ASN A C   1 
ATOM   1996  O  O   . ASN A  1  267 ? 53.536   -12.513  219.474 1.00 165.26 ? 267  ASN A O   1 
ATOM   1997  C  CB  . ASN A  1  267 ? 56.254   -12.046  221.423 1.00 170.51 ? 267  ASN A CB  1 
ATOM   1998  N  N   . TRP A  1  268 ? 53.258   -11.536  221.485 1.00 129.79 ? 268  TRP A N   1 
ATOM   1999  C  CA  . TRP A  1  268 ? 51.819   -11.791  221.581 1.00 127.62 ? 268  TRP A CA  1 
ATOM   2000  C  C   . TRP A  1  268 ? 51.440   -13.273  221.488 1.00 127.78 ? 268  TRP A C   1 
ATOM   2001  O  O   . TRP A  1  268 ? 50.888   -13.825  222.439 1.00 127.73 ? 268  TRP A O   1 
ATOM   2002  C  CB  . TRP A  1  268 ? 51.075   -10.988  220.506 1.00 125.52 ? 268  TRP A CB  1 
ATOM   2003  C  CG  . TRP A  1  268 ? 51.016   -9.519   220.824 1.00 124.90 ? 268  TRP A CG  1 
ATOM   2004  C  CD1 . TRP A  1  268 ? 51.897   -8.815   221.593 1.00 126.37 ? 268  TRP A CD1 1 
ATOM   2005  C  CD2 . TRP A  1  268 ? 50.019   -8.581   220.398 1.00 122.75 ? 268  TRP A CD2 1 
ATOM   2006  N  NE1 . TRP A  1  268 ? 51.516   -7.499   221.668 1.00 125.29 ? 268  TRP A NE1 1 
ATOM   2007  C  CE2 . TRP A  1  268 ? 50.365   -7.328   220.944 1.00 123.07 ? 268  TRP A CE2 1 
ATOM   2008  C  CE3 . TRP A  1  268 ? 48.870   -8.676   219.607 1.00 120.70 ? 268  TRP A CE3 1 
ATOM   2009  C  CZ2 . TRP A  1  268 ? 49.606   -6.182   220.725 1.00 121.41 ? 268  TRP A CZ2 1 
ATOM   2010  C  CZ3 . TRP A  1  268 ? 48.116   -7.535   219.390 1.00 119.05 ? 268  TRP A CZ3 1 
ATOM   2011  C  CH2 . TRP A  1  268 ? 48.488   -6.305   219.948 1.00 119.42 ? 268  TRP A CH2 1 
ATOM   2012  N  N   . GLY A  1  269 ? 51.713   -13.911  220.353 1.00 155.98 ? 269  GLY A N   1 
ATOM   2013  C  CA  . GLY A  1  269 ? 51.337   -15.305  220.160 1.00 159.52 ? 269  GLY A CA  1 
ATOM   2014  C  C   . GLY A  1  269 ? 51.865   -16.256  221.214 1.00 155.77 ? 269  GLY A C   1 
ATOM   2015  O  O   . GLY A  1  269 ? 51.387   -17.385  221.328 1.00 155.85 ? 269  GLY A O   1 
ATOM   2016  N  N   . VAL A  1  270 ? 52.856   -15.811  221.979 1.00 131.90 ? 270  VAL A N   1 
ATOM   2017  C  CA  . VAL A  1  270 ? 53.297   -16.563  223.143 1.00 133.79 ? 270  VAL A CA  1 
ATOM   2018  C  C   . VAL A  1  270 ? 52.131   -16.721  224.120 1.00 132.59 ? 270  VAL A C   1 
ATOM   2019  O  O   . VAL A  1  270 ? 51.942   -17.786  224.703 1.00 133.44 ? 270  VAL A O   1 
ATOM   2020  C  CB  . VAL A  1  270 ? 54.496   -15.881  223.842 1.00 135.74 ? 270  VAL A CB  1 
ATOM   2021  C  CG1 . VAL A  1  270 ? 54.152   -14.464  224.271 1.00 134.50 ? 270  VAL A CG1 1 
ATOM   2022  C  CG2 . VAL A  1  270 ? 54.969   -16.705  225.033 1.00 137.87 ? 270  VAL A CG2 1 
ATOM   2023  N  N   . TYR A  1  271 ? 51.344   -15.660  224.277 1.00 131.33 ? 271  TYR A N   1 
ATOM   2024  C  CA  . TYR A  1  271 ? 50.226   -15.647  225.219 1.00 130.19 ? 271  TYR A CA  1 
ATOM   2025  C  C   . TYR A  1  271 ? 49.050   -16.516  224.773 1.00 128.69 ? 271  TYR A C   1 
ATOM   2026  O  O   . TYR A  1  271 ? 48.054   -16.625  225.489 1.00 127.76 ? 271  TYR A O   1 
ATOM   2027  C  CB  . TYR A  1  271 ? 49.741   -14.210  225.436 1.00 128.66 ? 271  TYR A CB  1 
ATOM   2028  C  CG  . TYR A  1  271 ? 50.785   -13.280  226.012 1.00 130.12 ? 271  TYR A CG  1 
ATOM   2029  C  CD1 . TYR A  1  271 ? 51.603   -13.680  227.062 1.00 132.42 ? 271  TYR A CD1 1 
ATOM   2030  C  CD2 . TYR A  1  271 ? 50.959   -12.001  225.498 1.00 129.31 ? 271  TYR A CD2 1 
ATOM   2031  C  CE1 . TYR A  1  271 ? 52.557   -12.828  227.588 1.00 133.84 ? 271  TYR A CE1 1 
ATOM   2032  C  CE2 . TYR A  1  271 ? 51.910   -11.146  226.016 1.00 130.73 ? 271  TYR A CE2 1 
ATOM   2033  C  CZ  . TYR A  1  271 ? 52.705   -11.562  227.058 1.00 132.98 ? 271  TYR A CZ  1 
ATOM   2034  O  OH  . TYR A  1  271 ? 53.649   -10.698  227.562 1.00 134.46 ? 271  TYR A OH  1 
ATOM   2035  N  N   . SER A  1  272 ? 49.158   -17.129  223.597 1.00 127.90 ? 272  SER A N   1 
ATOM   2036  C  CA  . SER A  1  272 ? 48.089   -17.980  223.073 1.00 126.61 ? 272  SER A CA  1 
ATOM   2037  C  C   . SER A  1  272 ? 47.777   -19.156  223.999 1.00 127.63 ? 272  SER A C   1 
ATOM   2038  O  O   . SER A  1  272 ? 46.774   -19.845  223.818 1.00 126.61 ? 272  SER A O   1 
ATOM   2039  C  CB  . SER A  1  272 ? 48.455   -18.501  221.682 1.00 126.76 ? 272  SER A CB  1 
ATOM   2040  O  OG  . SER A  1  272 ? 49.532   -19.419  221.747 1.00 129.15 ? 272  SER A OG  1 
ATOM   2041  N  N   . ASP A  1  273 ? 48.638   -19.388  224.985 1.00 129.75 ? 273  ASP A N   1 
ATOM   2042  C  CA  . ASP A  1  273 ? 48.391   -20.419  225.983 1.00 130.95 ? 273  ASP A CA  1 
ATOM   2043  C  C   . ASP A  1  273 ? 47.153   -20.093  226.817 1.00 129.48 ? 273  ASP A C   1 
ATOM   2044  O  O   . ASP A  1  273 ? 46.473   -20.999  227.300 1.00 129.67 ? 273  ASP A O   1 
ATOM   2045  C  CB  . ASP A  1  273 ? 49.607   -20.583  226.895 1.00 133.61 ? 273  ASP A CB  1 
ATOM   2046  N  N   . PHE A  1  274 ? 46.869   -18.803  226.988 1.00 128.15 ? 274  PHE A N   1 
ATOM   2047  C  CA  . PHE A  1  274 ? 45.731   -18.367  227.799 1.00 126.84 ? 274  PHE A CA  1 
ATOM   2048  C  C   . PHE A  1  274 ? 44.889   -17.275  227.129 1.00 124.30 ? 274  PHE A C   1 
ATOM   2049  O  O   . PHE A  1  274 ? 43.853   -16.879  227.663 1.00 123.03 ? 274  PHE A O   1 
ATOM   2050  C  CB  . PHE A  1  274 ? 46.219   -17.889  229.172 1.00 128.32 ? 274  PHE A CB  1 
ATOM   2051  C  CG  . PHE A  1  274 ? 47.185   -16.735  229.121 1.00 128.80 ? 274  PHE A CG  1 
ATOM   2052  C  CD1 . PHE A  1  274 ? 48.489   -16.920  228.689 1.00 130.47 ? 274  PHE A CD1 1 
ATOM   2053  C  CD2 . PHE A  1  274 ? 46.798   -15.474  229.540 1.00 127.72 ? 274  PHE A CD2 1 
ATOM   2054  C  CE1 . PHE A  1  274 ? 49.380   -15.863  228.651 1.00 131.03 ? 274  PHE A CE1 1 
ATOM   2055  C  CE2 . PHE A  1  274 ? 47.686   -14.414  229.507 1.00 128.28 ? 274  PHE A CE2 1 
ATOM   2056  C  CZ  . PHE A  1  274 ? 48.979   -14.610  229.063 1.00 129.93 ? 274  PHE A CZ  1 
ATOM   2057  N  N   . LEU A  1  275 ? 45.332   -16.794  225.970 1.00 132.44 ? 275  LEU A N   1 
ATOM   2058  C  CA  . LEU A  1  275 ? 44.526   -15.898  225.141 1.00 130.12 ? 275  LEU A CA  1 
ATOM   2059  C  C   . LEU A  1  275 ? 44.138   -16.603  223.843 1.00 129.21 ? 275  LEU A C   1 
ATOM   2060  O  O   . LEU A  1  275 ? 44.712   -16.337  222.787 1.00 129.17 ? 275  LEU A O   1 
ATOM   2061  C  CB  . LEU A  1  275 ? 45.287   -14.606  224.838 1.00 130.11 ? 275  LEU A CB  1 
ATOM   2062  C  CG  . LEU A  1  275 ? 45.625   -13.692  226.019 1.00 130.84 ? 275  LEU A CG  1 
ATOM   2063  C  CD1 . LEU A  1  275 ? 46.387   -12.470  225.524 1.00 130.86 ? 275  LEU A CD1 1 
ATOM   2064  C  CD2 . LEU A  1  275 ? 44.378   -13.266  226.779 1.00 129.43 ? 275  LEU A CD2 1 
ATOM   2065  N  N   . THR A  1  276 ? 43.158   -17.498  223.931 1.00 139.82 ? 276  THR A N   1 
ATOM   2066  C  CA  . THR A  1  276 ? 42.816   -18.386  222.822 1.00 139.34 ? 276  THR A CA  1 
ATOM   2067  C  C   . THR A  1  276 ? 41.673   -17.880  221.952 1.00 136.97 ? 276  THR A C   1 
ATOM   2068  O  O   . THR A  1  276 ? 41.102   -16.817  222.198 1.00 135.61 ? 276  THR A O   1 
ATOM   2069  C  CB  . THR A  1  276 ? 42.419   -19.781  223.336 1.00 148.63 ? 276  THR A CB  1 
ATOM   2070  O  OG1 . THR A  1  276 ? 41.254   -19.677  224.162 1.00 150.06 ? 276  THR A OG1 1 
ATOM   2071  C  CG2 . THR A  1  276 ? 43.549   -20.401  224.130 1.00 161.19 ? 276  THR A CG2 1 
ATOM   2072  N  N   . PHE A  1  277 ? 41.359   -18.664  220.924 1.00 132.51 ? 277  PHE A N   1 
ATOM   2073  C  CA  . PHE A  1  277 ? 40.226   -18.400  220.048 1.00 130.44 ? 277  PHE A CA  1 
ATOM   2074  C  C   . PHE A  1  277 ? 39.549   -19.724  219.688 1.00 130.47 ? 277  PHE A C   1 
ATOM   2075  O  O   . PHE A  1  277 ? 39.192   -19.965  218.534 1.00 129.72 ? 277  PHE A O   1 
ATOM   2076  C  CB  . PHE A  1  277 ? 40.681   -17.646  218.795 1.00 129.90 ? 277  PHE A CB  1 
ATOM   2077  C  CG  . PHE A  1  277 ? 39.696   -16.618  218.324 1.00 127.76 ? 277  PHE A CG  1 
ATOM   2078  C  CD1 . PHE A  1  277 ? 38.539   -16.993  217.664 1.00 126.36 ? 277  PHE A CD1 1 
ATOM   2079  C  CD2 . PHE A  1  277 ? 39.925   -15.272  218.555 1.00 127.24 ? 277  PHE A CD2 1 
ATOM   2080  C  CE1 . PHE A  1  277 ? 37.629   -16.044  217.237 1.00 124.49 ? 277  PHE A CE1 1 
ATOM   2081  C  CE2 . PHE A  1  277 ? 39.021   -14.319  218.130 1.00 125.39 ? 277  PHE A CE2 1 
ATOM   2082  C  CZ  . PHE A  1  277 ? 37.869   -14.704  217.474 1.00 124.01 ? 277  PHE A CZ  1 
ATOM   2083  N  N   . LYS A  1  278 ? 39.377   -20.577  220.696 1.00 115.57 ? 278  LYS A N   1 
ATOM   2084  C  CA  . LYS A  1  278 ? 38.724   -21.872  220.528 1.00 115.81 ? 278  LYS A CA  1 
ATOM   2085  C  C   . LYS A  1  278 ? 37.341   -21.736  219.900 1.00 113.75 ? 278  LYS A C   1 
ATOM   2086  O  O   . LYS A  1  278 ? 36.975   -22.504  219.010 1.00 113.60 ? 278  LYS A O   1 
ATOM   2087  C  CB  . LYS A  1  278 ? 38.611   -22.578  221.882 1.00 117.05 ? 278  LYS A CB  1 
ATOM   2088  C  CG  . LYS A  1  278 ? 39.893   -23.255  222.332 1.00 119.49 ? 278  LYS A CG  1 
ATOM   2089  C  CD  . LYS A  1  278 ? 39.873   -23.563  223.821 1.00 120.70 ? 278  LYS A CD  1 
ATOM   2090  C  CE  . LYS A  1  278 ? 41.217   -24.101  224.284 1.00 123.21 ? 278  LYS A CE  1 
ATOM   2091  N  NZ  . LYS A  1  278 ? 41.447   -23.894  225.740 1.00 124.35 ? 278  LYS A NZ  1 
ATOM   2092  N  N   . GLY A  1  279 ? 36.584   -20.749  220.368 1.00 153.47 ? 279  GLY A N   1 
ATOM   2093  C  CA  . GLY A  1  279 ? 35.251   -20.488  219.859 1.00 163.17 ? 279  GLY A CA  1 
ATOM   2094  C  C   . GLY A  1  279 ? 34.339   -21.694  219.969 1.00 155.03 ? 279  GLY A C   1 
ATOM   2095  O  O   . GLY A  1  279 ? 34.067   -22.371  218.982 1.00 143.74 ? 279  GLY A O   1 
ATOM   2096  N  N   . GLY A  1  280 ? 33.868   -21.959  221.182 1.00 130.18 ? 280  GLY A N   1 
ATOM   2097  C  CA  . GLY A  1  280 ? 32.962   -23.064  221.427 1.00 130.39 ? 280  GLY A CA  1 
ATOM   2098  C  C   . GLY A  1  280 ? 32.507   -23.061  222.871 1.00 130.81 ? 280  GLY A C   1 
ATOM   2099  O  O   . GLY A  1  280 ? 32.248   -22.003  223.445 1.00 129.96 ? 280  GLY A O   1 
ATOM   2100  N  N   . LEU A  1  281 ? 32.412   -24.249  223.458 1.00 112.85 ? 281  LEU A N   1 
ATOM   2101  C  CA  . LEU A  1  281 ? 32.032   -24.398  224.858 1.00 113.61 ? 281  LEU A CA  1 
ATOM   2102  C  C   . LEU A  1  281 ? 32.893   -25.457  225.527 1.00 116.03 ? 281  LEU A C   1 
ATOM   2103  O  O   . LEU A  1  281 ? 33.092   -26.542  224.981 1.00 116.96 ? 281  LEU A O   1 
ATOM   2104  C  CB  . LEU A  1  281 ? 30.552   -24.767  224.988 1.00 112.67 ? 281  LEU A CB  1 
ATOM   2105  C  CG  . LEU A  1  281 ? 29.530   -23.749  224.478 1.00 110.36 ? 281  LEU A CG  1 
ATOM   2106  C  CD1 . LEU A  1  281 ? 28.145   -24.371  224.403 1.00 109.70 ? 281  LEU A CD1 1 
ATOM   2107  C  CD2 . LEU A  1  281 ? 29.510   -22.530  225.385 1.00 109.87 ? 281  LEU A CD2 1 
ATOM   2108  N  N   . ASN A  1  282 ? 33.411   -25.136  226.707 1.00 132.35 ? 282  ASN A N   1 
ATOM   2109  C  CA  . ASN A  1  282 ? 34.163   -26.104  227.488 1.00 134.78 ? 282  ASN A CA  1 
ATOM   2110  C  C   . ASN A  1  282 ? 33.237   -27.264  227.877 1.00 144.69 ? 282  ASN A C   1 
ATOM   2111  O  O   . ASN A  1  282 ? 32.317   -27.076  228.672 1.00 172.32 ? 282  ASN A O   1 
ATOM   2112  C  CB  . ASN A  1  282 ? 34.767   -25.432  228.723 1.00 135.80 ? 282  ASN A CB  1 
ATOM   2113  C  CG  . ASN A  1  282 ? 35.615   -26.375  229.553 1.00 138.47 ? 282  ASN A CG  1 
ATOM   2114  O  OD1 . ASN A  1  282 ? 35.895   -27.502  229.148 1.00 139.63 ? 282  ASN A OD1 1 
ATOM   2115  N  ND2 . ASN A  1  282 ? 36.044   -25.906  230.719 1.00 139.57 ? 282  ASN A ND2 1 
ATOM   2116  N  N   . PRO A  1  283 ? 33.470   -28.466  227.310 1.00 121.34 ? 283  PRO A N   1 
ATOM   2117  C  CA  . PRO A  1  283 ? 32.491   -29.559  227.416 1.00 121.72 ? 283  PRO A CA  1 
ATOM   2118  C  C   . PRO A  1  283 ? 32.171   -30.019  228.841 1.00 123.24 ? 283  PRO A C   1 
ATOM   2119  O  O   . PRO A  1  283 ? 31.162   -30.698  229.034 1.00 123.29 ? 283  PRO A O   1 
ATOM   2120  C  CB  . PRO A  1  283 ? 33.151   -30.697  226.625 1.00 123.08 ? 283  PRO A CB  1 
ATOM   2121  C  CG  . PRO A  1  283 ? 34.596   -30.366  226.599 1.00 124.14 ? 283  PRO A CG  1 
ATOM   2122  C  CD  . PRO A  1  283 ? 34.660   -28.879  226.546 1.00 122.40 ? 283  PRO A CD  1 
ATOM   2123  N  N   . VAL A  1  284 ? 33.002   -29.657  229.812 1.00 124.56 ? 284  VAL A N   1 
ATOM   2124  C  CA  . VAL A  1  284 ? 32.732   -29.983  231.211 1.00 126.10 ? 284  VAL A CA  1 
ATOM   2125  C  C   . VAL A  1  284 ? 31.930   -28.856  231.844 1.00 124.64 ? 284  VAL A C   1 
ATOM   2126  O  O   . VAL A  1  284 ? 31.140   -29.070  232.765 1.00 125.15 ? 284  VAL A O   1 
ATOM   2127  C  CB  . VAL A  1  284 ? 34.032   -30.210  232.016 1.00 128.53 ? 284  VAL A CB  1 
ATOM   2128  C  CG1 . VAL A  1  284 ? 34.855   -28.926  232.108 1.00 127.94 ? 284  VAL A CG1 1 
ATOM   2129  C  CG2 . VAL A  1  284 ? 33.711   -30.741  233.407 1.00 130.41 ? 284  VAL A CG2 1 
ATOM   2130  N  N   . THR A  1  285 ? 32.144   -27.652  231.327 1.00 156.36 ? 285  THR A N   1 
ATOM   2131  C  CA  . THR A  1  285 ? 31.530   -26.446  231.857 1.00 147.84 ? 285  THR A CA  1 
ATOM   2132  C  C   . THR A  1  285 ? 30.136   -26.213  231.289 1.00 142.89 ? 285  THR A C   1 
ATOM   2133  O  O   . THR A  1  285 ? 29.183   -25.971  232.030 1.00 142.57 ? 285  THR A O   1 
ATOM   2134  C  CB  . THR A  1  285 ? 32.406   -25.219  231.539 1.00 156.12 ? 285  THR A CB  1 
ATOM   2135  O  OG1 . THR A  1  285 ? 33.743   -25.442  232.003 1.00 176.50 ? 285  THR A OG1 1 
ATOM   2136  C  CG2 . THR A  1  285 ? 31.853   -23.976  232.178 1.00 144.84 ? 285  THR A CG2 1 
ATOM   2137  N  N   . GLY A  1  286 ? 30.025   -26.291  229.967 1.00 118.06 ? 286  GLY A N   1 
ATOM   2138  C  CA  . GLY A  1  286 ? 28.805   -25.922  229.277 1.00 115.93 ? 286  GLY A CA  1 
ATOM   2139  C  C   . GLY A  1  286 ? 28.734   -24.417  229.102 1.00 114.15 ? 286  GLY A C   1 
ATOM   2140  O  O   . GLY A  1  286 ? 27.666   -23.864  228.834 1.00 112.45 ? 286  GLY A O   1 
ATOM   2141  N  N   . GLY A  1  287 ? 29.881   -23.759  229.257 1.00 148.99 ? 287  GLY A N   1 
ATOM   2142  C  CA  . GLY A  1  287 ? 29.977   -22.315  229.137 1.00 163.46 ? 287  GLY A CA  1 
ATOM   2143  C  C   . GLY A  1  287 ? 31.099   -21.897  228.204 1.00 165.27 ? 287  GLY A C   1 
ATOM   2144  O  O   . GLY A  1  287 ? 31.903   -22.729  227.784 1.00 186.25 ? 287  GLY A O   1 
ATOM   2145  N  N   . LEU A  1  288 ? 31.155   -20.607  227.880 1.00 120.99 ? 288  LEU A N   1 
ATOM   2146  C  CA  . LEU A  1  288 ? 32.199   -20.081  227.005 1.00 120.81 ? 288  LEU A CA  1 
ATOM   2147  C  C   . LEU A  1  288 ? 33.571   -20.175  227.659 1.00 122.80 ? 288  LEU A C   1 
ATOM   2148  O  O   . LEU A  1  288 ? 33.699   -20.043  228.876 1.00 123.88 ? 288  LEU A O   1 
ATOM   2149  C  CB  . LEU A  1  288 ? 31.909   -18.627  226.625 1.00 119.04 ? 288  LEU A CB  1 
ATOM   2150  C  CG  . LEU A  1  288 ? 30.736   -18.381  225.674 1.00 117.00 ? 288  LEU A CG  1 
ATOM   2151  C  CD1 . LEU A  1  288 ? 30.435   -16.897  225.571 1.00 115.55 ? 288  LEU A CD1 1 
ATOM   2152  C  CD2 . LEU A  1  288 ? 31.039   -18.949  224.299 1.00 116.73 ? 288  LEU A CD2 1 
ATOM   2153  N  N   . TRP A  1  289 ? 34.593   -20.406  226.842 1.00 114.07 ? 289  TRP A N   1 
ATOM   2154  C  CA  . TRP A  1  289 ? 35.959   -20.498  227.338 1.00 116.01 ? 289  TRP A CA  1 
ATOM   2155  C  C   . TRP A  1  289 ? 36.404   -19.170  227.935 1.00 115.90 ? 289  TRP A C   1 
ATOM   2156  O  O   . TRP A  1  289 ? 36.356   -18.137  227.268 1.00 114.48 ? 289  TRP A O   1 
ATOM   2157  C  CB  . TRP A  1  289 ? 36.914   -20.912  226.215 1.00 116.53 ? 289  TRP A CB  1 
ATOM   2158  C  CG  . TRP A  1  289 ? 36.796   -22.351  225.805 1.00 117.37 ? 289  TRP A CG  1 
ATOM   2159  C  CD1 . TRP A  1  289 ? 36.137   -22.849  224.718 1.00 116.29 ? 289  TRP A CD1 1 
ATOM   2160  C  CD2 . TRP A  1  289 ? 37.358   -23.479  226.484 1.00 119.59 ? 289  TRP A CD2 1 
ATOM   2161  N  NE1 . TRP A  1  289 ? 36.257   -24.218  224.678 1.00 117.71 ? 289  TRP A NE1 1 
ATOM   2162  C  CE2 . TRP A  1  289 ? 37.001   -24.629  225.754 1.00 119.74 ? 289  TRP A CE2 1 
ATOM   2163  C  CE3 . TRP A  1  289 ? 38.129   -23.627  227.641 1.00 121.57 ? 289  TRP A CE3 1 
ATOM   2164  C  CZ2 . TRP A  1  289 ? 37.391   -25.909  226.141 1.00 121.80 ? 289  TRP A CZ2 1 
ATOM   2165  C  CZ3 . TRP A  1  289 ? 38.513   -24.898  228.026 1.00 123.61 ? 289  TRP A CZ3 1 
ATOM   2166  C  CH2 . TRP A  1  289 ? 38.143   -26.022  227.278 1.00 123.71 ? 289  TRP A CH2 1 
ATOM   2167  N  N   . LEU A  1  290 ? 36.833   -19.196  229.193 1.00 117.50 ? 290  LEU A N   1 
ATOM   2168  C  CA  . LEU A  1  290 ? 37.311   -17.985  229.852 1.00 117.69 ? 290  LEU A CA  1 
ATOM   2169  C  C   . LEU A  1  290 ? 38.583   -17.472  229.182 1.00 118.15 ? 290  LEU A C   1 
ATOM   2170  O  O   . LEU A  1  290 ? 38.939   -16.304  229.323 1.00 117.84 ? 290  LEU A O   1 
ATOM   2171  C  CB  . LEU A  1  290 ? 37.566   -18.231  231.343 1.00 119.61 ? 290  LEU A CB  1 
ATOM   2172  C  CG  . LEU A  1  290 ? 36.362   -18.528  232.247 1.00 119.42 ? 290  LEU A CG  1 
ATOM   2173  C  CD1 . LEU A  1  290 ? 36.780   -18.467  233.711 1.00 121.41 ? 290  LEU A CD1 1 
ATOM   2174  C  CD2 . LEU A  1  290 ? 35.190   -17.589  231.986 1.00 117.16 ? 290  LEU A CD2 1 
ATOM   2175  N  N   . SER A  1  291 ? 39.270   -18.352  228.461 1.00 119.00 ? 291  SER A N   1 
ATOM   2176  C  CA  . SER A  1  291 ? 40.447   -17.958  227.699 1.00 119.48 ? 291  SER A CA  1 
ATOM   2177  C  C   . SER A  1  291 ? 40.050   -17.046  226.545 1.00 117.39 ? 291  SER A C   1 
ATOM   2178  O  O   . SER A  1  291 ? 40.812   -16.165  226.149 1.00 117.41 ? 291  SER A O   1 
ATOM   2179  C  CB  . SER A  1  291 ? 41.181   -19.191  227.167 1.00 120.93 ? 291  SER A CB  1 
ATOM   2180  O  OG  . SER A  1  291 ? 40.323   -19.991  226.372 1.00 119.89 ? 291  SER A OG  1 
ATOM   2181  N  N   . ASP A  1  292 ? 38.857   -17.271  226.005 1.00 115.71 ? 292  ASP A N   1 
ATOM   2182  C  CA  . ASP A  1  292 ? 38.330   -16.443  224.926 1.00 113.71 ? 292  ASP A CA  1 
ATOM   2183  C  C   . ASP A  1  292 ? 37.793   -15.104  225.432 1.00 112.54 ? 292  ASP A C   1 
ATOM   2184  O  O   . ASP A  1  292 ? 38.108   -14.056  224.873 1.00 111.86 ? 292  ASP A O   1 
ATOM   2185  C  CB  . ASP A  1  292 ? 37.226   -17.191  224.174 1.00 112.46 ? 292  ASP A CB  1 
ATOM   2186  C  CG  . ASP A  1  292 ? 37.747   -18.395  223.414 1.00 113.45 ? 292  ASP A CG  1 
ATOM   2187  O  OD1 . ASP A  1  292 ? 38.945   -18.407  223.062 1.00 114.65 ? 292  ASP A OD1 1 
ATOM   2188  O  OD2 . ASP A  1  292 ? 36.955   -19.328  223.161 1.00 113.12 ? 292  ASP A OD2 1 
ATOM   2189  N  N   . THR A  1  293 ? 36.992   -15.139  226.493 1.00 112.44 ? 293  THR A N   1 
ATOM   2190  C  CA  . THR A  1  293 ? 36.370   -13.923  227.010 1.00 111.38 ? 293  THR A CA  1 
ATOM   2191  C  C   . THR A  1  293 ? 37.421   -12.952  227.536 1.00 112.40 ? 293  THR A C   1 
ATOM   2192  O  O   . THR A  1  293 ? 37.195   -11.743  227.577 1.00 111.51 ? 293  THR A O   1 
ATOM   2193  C  CB  . THR A  1  293 ? 35.366   -14.228  228.138 1.00 111.40 ? 293  THR A CB  1 
ATOM   2194  O  OG1 . THR A  1  293 ? 36.051   -14.820  229.248 1.00 113.48 ? 293  THR A OG1 1 
ATOM   2195  C  CG2 . THR A  1  293 ? 34.273   -15.169  227.649 1.00 110.44 ? 293  THR A CG2 1 
ATOM   2196  N  N   . ALA A  1  294 ? 38.568   -13.484  227.940 1.00 114.37 ? 294  ALA A N   1 
ATOM   2197  C  CA  . ALA A  1  294 ? 39.657   -12.654  228.438 1.00 115.59 ? 294  ALA A CA  1 
ATOM   2198  C  C   . ALA A  1  294 ? 40.398   -12.013  227.273 1.00 115.19 ? 294  ALA A C   1 
ATOM   2199  O  O   . ALA A  1  294 ? 40.647   -10.809  227.276 1.00 114.87 ? 294  ALA A O   1 
ATOM   2200  C  CB  . ALA A  1  294 ? 40.604   -13.473  229.290 1.00 117.97 ? 294  ALA A CB  1 
ATOM   2201  N  N   . HIS A  1  295 ? 40.761   -12.822  226.283 1.00 115.33 ? 295  HIS A N   1 
ATOM   2202  C  CA  . HIS A  1  295 ? 41.344   -12.302  225.053 1.00 114.90 ? 295  HIS A CA  1 
ATOM   2203  C  C   . HIS A  1  295 ? 40.350   -11.357  224.394 1.00 112.71 ? 295  HIS A C   1 
ATOM   2204  O  O   . HIS A  1  295 ? 40.725   -10.348  223.800 1.00 112.31 ? 295  HIS A O   1 
ATOM   2205  C  CB  . HIS A  1  295 ? 41.720   -13.443  224.103 1.00 115.39 ? 295  HIS A CB  1 
ATOM   2206  C  CG  . HIS A  1  295 ? 42.140   -12.983  222.742 1.00 114.84 ? 295  HIS A CG  1 
ATOM   2207  N  ND1 . HIS A  1  295 ? 42.022   -13.774  221.620 1.00 114.52 ? 295  HIS A ND1 1 
ATOM   2208  C  CD2 . HIS A  1  295 ? 42.684   -11.817  222.325 1.00 114.68 ? 295  HIS A CD2 1 
ATOM   2209  C  CE1 . HIS A  1  295 ? 42.463   -13.109  220.567 1.00 114.19 ? 295  HIS A CE1 1 
ATOM   2210  N  NE2 . HIS A  1  295 ? 42.866   -11.918  220.968 1.00 114.27 ? 295  HIS A NE2 1 
ATOM   2211  N  N   . HIS A  1  296 ? 39.071   -11.678  224.532 1.00 111.42 ? 296  HIS A N   1 
ATOM   2212  C  CA  . HIS A  1  296 ? 38.016   -10.855  223.971 1.00 109.39 ? 296  HIS A CA  1 
ATOM   2213  C  C   . HIS A  1  296 ? 38.009   -9.443   224.558 1.00 109.11 ? 296  HIS A C   1 
ATOM   2214  O  O   . HIS A  1  296 ? 38.166   -8.465   223.828 1.00 108.41 ? 296  HIS A O   1 
ATOM   2215  C  CB  . HIS A  1  296 ? 36.665   -11.512  224.209 1.00 108.33 ? 296  HIS A CB  1 
ATOM   2216  C  CG  . HIS A  1  296 ? 35.509   -10.659  223.807 1.00 106.38 ? 296  HIS A CG  1 
ATOM   2217  N  ND1 . HIS A  1  296 ? 34.291   -10.723  224.441 1.00 105.52 ? 296  HIS A ND1 1 
ATOM   2218  C  CD2 . HIS A  1  296 ? 35.384   -9.724   222.836 1.00 105.22 ? 296  HIS A CD2 1 
ATOM   2219  C  CE1 . HIS A  1  296 ? 33.465   -9.862   223.880 1.00 103.90 ? 296  HIS A CE1 1 
ATOM   2220  N  NE2 . HIS A  1  296 ? 34.100   -9.245   222.902 1.00 103.68 ? 296  HIS A NE2 1 
ATOM   2221  N  N   . HIS A  1  297 ? 37.816   -9.337   225.870 1.00 109.74 ? 297  HIS A N   1 
ATOM   2222  C  CA  . HIS A  1  297 ? 37.722   -8.031   226.520 1.00 109.56 ? 297  HIS A CA  1 
ATOM   2223  C  C   . HIS A  1  297 ? 39.017   -7.251   226.390 1.00 110.68 ? 297  HIS A C   1 
ATOM   2224  O  O   . HIS A  1  297 ? 39.011   -6.021   226.397 1.00 110.26 ? 297  HIS A O   1 
ATOM   2225  C  CB  . HIS A  1  297 ? 37.364   -8.182   227.997 1.00 110.37 ? 297  HIS A CB  1 
ATOM   2226  C  CG  . HIS A  1  297 ? 36.032   -8.817   228.228 1.00 109.34 ? 297  HIS A CG  1 
ATOM   2227  N  ND1 . HIS A  1  297 ? 35.670   -9.374   229.435 1.00 110.23 ? 297  HIS A ND1 1 
ATOM   2228  C  CD2 . HIS A  1  297 ? 34.980   -9.000   227.397 1.00 107.61 ? 297  HIS A CD2 1 
ATOM   2229  C  CE1 . HIS A  1  297 ? 34.446   -9.862   229.341 1.00 109.08 ? 297  HIS A CE1 1 
ATOM   2230  N  NE2 . HIS A  1  297 ? 34.009   -9.655   228.112 1.00 107.48 ? 297  HIS A NE2 1 
ATOM   2231  N  N   . LEU A  1  298 ? 40.128   -7.967   226.268 1.00 112.20 ? 298  LEU A N   1 
ATOM   2232  C  CA  . LEU A  1  298 ? 41.406   -7.321   226.029 1.00 113.38 ? 298  LEU A CA  1 
ATOM   2233  C  C   . LEU A  1  298 ? 41.380   -6.655   224.662 1.00 112.18 ? 298  LEU A C   1 
ATOM   2234  O  O   . LEU A  1  298 ? 41.940   -5.576   224.475 1.00 112.43 ? 298  LEU A O   1 
ATOM   2235  C  CB  . LEU A  1  298 ? 42.557   -8.323   226.119 1.00 115.31 ? 298  LEU A CB  1 
ATOM   2236  C  CG  . LEU A  1  298 ? 43.914   -7.782   225.665 1.00 116.57 ? 298  LEU A CG  1 
ATOM   2237  C  CD1 . LEU A  1  298 ? 44.332   -6.603   226.538 1.00 117.32 ? 298  LEU A CD1 1 
ATOM   2238  C  CD2 . LEU A  1  298 ? 44.969   -8.871   225.687 1.00 118.46 ? 298  LEU A CD2 1 
ATOM   2239  N  N   . ALA A  1  299 ? 40.732   -7.308   223.704 1.00 110.99 ? 299  ALA A N   1 
ATOM   2240  C  CA  . ALA A  1  299 ? 40.629   -6.766   222.359 1.00 109.90 ? 299  ALA A CA  1 
ATOM   2241  C  C   . ALA A  1  299 ? 39.613   -5.627   222.311 1.00 108.27 ? 299  ALA A C   1 
ATOM   2242  O  O   . ALA A  1  299 ? 39.856   -4.600   221.680 1.00 107.96 ? 299  ALA A O   1 
ATOM   2243  C  CB  . ALA A  1  299 ? 40.252   -7.857   221.370 1.00 109.31 ? 299  ALA A CB  1 
ATOM   2244  N  N   . ILE A  1  300 ? 38.470   -5.820   222.965 1.00 109.40 ? 300  ILE A N   1 
ATOM   2245  C  CA  . ILE A  1  300 ? 37.446   -4.781   223.049 1.00 107.96 ? 300  ILE A CA  1 
ATOM   2246  C  C   . ILE A  1  300 ? 37.989   -3.547   223.748 1.00 108.70 ? 300  ILE A C   1 
ATOM   2247  O  O   . ILE A  1  300 ? 37.750   -2.421   223.312 1.00 107.94 ? 300  ILE A O   1 
ATOM   2248  C  CB  . ILE A  1  300 ? 36.191   -5.272   223.810 1.00 107.14 ? 300  ILE A CB  1 
ATOM   2249  C  CG1 . ILE A  1  300 ? 35.496   -6.398   223.041 1.00 106.26 ? 300  ILE A CG1 1 
ATOM   2250  C  CG2 . ILE A  1  300 ? 35.214   -4.119   224.070 1.00 105.93 ? 300  ILE A CG2 1 
ATOM   2251  C  CD1 . ILE A  1  300 ? 34.922   -5.987   221.707 1.00 104.77 ? 300  ILE A CD1 1 
ATOM   2252  N  N   . ALA A  1  301 ? 38.713   -3.773   224.840 1.00 108.21 ? 301  ALA A N   1 
ATOM   2253  C  CA  . ALA A  1  301 ? 39.280   -2.689   225.631 1.00 109.18 ? 301  ALA A CA  1 
ATOM   2254  C  C   . ALA A  1  301 ? 40.104   -1.757   224.756 1.00 109.43 ? 301  ALA A C   1 
ATOM   2255  O  O   . ALA A  1  301 ? 39.822   -0.562   224.671 1.00 108.87 ? 301  ALA A O   1 
ATOM   2256  C  CB  . ALA A  1  301 ? 40.131   -3.244   226.752 1.00 111.12 ? 301  ALA A CB  1 
ATOM   2257  N  N   . VAL A  1  302 ? 41.120   -2.318   224.111 1.00 110.39 ? 302  VAL A N   1 
ATOM   2258  C  CA  . VAL A  1  302 ? 41.991   -1.565   223.217 1.00 110.85 ? 302  VAL A CA  1 
ATOM   2259  C  C   . VAL A  1  302 ? 41.190   -0.790   222.182 1.00 109.17 ? 302  VAL A C   1 
ATOM   2260  O  O   . VAL A  1  302 ? 41.450   0.388    221.940 1.00 109.27 ? 302  VAL A O   1 
ATOM   2261  C  CB  . VAL A  1  302 ? 42.986   -2.504   222.501 1.00 111.91 ? 302  VAL A CB  1 
ATOM   2262  C  CG1 . VAL A  1  302 ? 43.493   -1.904   221.189 1.00 111.83 ? 302  VAL A CG1 1 
ATOM   2263  C  CG2 . VAL A  1  302 ? 44.141   -2.837   223.418 1.00 114.03 ? 302  VAL A CG2 1 
ATOM   2264  N  N   . LEU A  1  303 ? 40.222   -1.462   221.570 1.00 107.74 ? 303  LEU A N   1 
ATOM   2265  C  CA  . LEU A  1  303 ? 39.383   -0.838   220.555 1.00 106.16 ? 303  LEU A CA  1 
ATOM   2266  C  C   . LEU A  1  303 ? 38.654   0.379    221.113 1.00 105.43 ? 303  LEU A C   1 
ATOM   2267  O  O   . LEU A  1  303 ? 38.476   1.380    220.419 1.00 104.86 ? 303  LEU A O   1 
ATOM   2268  C  CB  . LEU A  1  303 ? 38.367   -1.842   220.005 1.00 104.84 ? 303  LEU A CB  1 
ATOM   2269  C  CG  . LEU A  1  303 ? 38.092   -1.788   218.499 1.00 103.92 ? 303  LEU A CG  1 
ATOM   2270  C  CD1 . LEU A  1  303 ? 36.829   -2.578   218.180 1.00 102.47 ? 303  LEU A CD1 1 
ATOM   2271  C  CD2 . LEU A  1  303 ? 37.970   -0.358   217.994 1.00 103.44 ? 303  LEU A CD2 1 
ATOM   2272  N  N   . PHE A  1  304 ? 38.237   0.290    222.372 1.00 110.17 ? 304  PHE A N   1 
ATOM   2273  C  CA  . PHE A  1  304 ? 37.473   1.362    222.996 1.00 109.56 ? 304  PHE A CA  1 
ATOM   2274  C  C   . PHE A  1  304 ? 38.344   2.532    223.429 1.00 110.79 ? 304  PHE A C   1 
ATOM   2275  O  O   . PHE A  1  304 ? 37.924   3.684    223.324 1.00 129.56 ? 304  PHE A O   1 
ATOM   2276  C  CB  . PHE A  1  304 ? 36.697   0.825    224.207 1.00 109.42 ? 304  PHE A CB  1 
ATOM   2277  C  CG  . PHE A  1  304 ? 35.362   0.200    223.872 1.00 107.79 ? 304  PHE A CG  1 
ATOM   2278  C  CD1 . PHE A  1  304 ? 34.719   0.447    222.666 1.00 106.40 ? 304  PHE A CD1 1 
ATOM   2279  C  CD2 . PHE A  1  304 ? 34.735   -0.620   224.794 1.00 107.78 ? 304  PHE A CD2 1 
ATOM   2280  C  CE1 . PHE A  1  304 ? 33.499   -0.131   222.385 1.00 105.02 ? 304  PHE A CE1 1 
ATOM   2281  C  CE2 . PHE A  1  304 ? 33.512   -1.196   224.518 1.00 106.41 ? 304  PHE A CE2 1 
ATOM   2282  C  CZ  . PHE A  1  304 ? 32.892   -0.949   223.316 1.00 105.02 ? 304  PHE A CZ  1 
ATOM   2283  N  N   . ILE A  1  305 ? 39.545   2.251    223.921 1.00 107.90 ? 305  ILE A N   1 
ATOM   2284  C  CA  . ILE A  1  305 ? 40.478   3.328    224.231 1.00 109.24 ? 305  ILE A CA  1 
ATOM   2285  C  C   . ILE A  1  305 ? 40.742   4.103    222.946 1.00 108.88 ? 305  ILE A C   1 
ATOM   2286  O  O   . ILE A  1  305 ? 40.688   5.330    222.934 1.00 108.91 ? 305  ILE A O   1 
ATOM   2287  C  CB  . ILE A  1  305 ? 41.808   2.819    224.829 1.00 111.27 ? 305  ILE A CB  1 
ATOM   2288  C  CG1 . ILE A  1  305 ? 41.555   1.975    226.085 1.00 111.77 ? 305  ILE A CG1 1 
ATOM   2289  C  CG2 . ILE A  1  305 ? 42.732   3.997    225.143 1.00 112.69 ? 305  ILE A CG2 1 
ATOM   2290  C  CD1 . ILE A  1  305 ? 41.017   2.751    227.275 1.00 111.93 ? 305  ILE A CD1 1 
ATOM   2291  N  N   . ILE A  1  306 ? 41.029   3.375    221.870 1.00 108.65 ? 306  ILE A N   1 
ATOM   2292  C  CA  . ILE A  1  306 ? 41.243   3.980    220.558 1.00 108.36 ? 306  ILE A CA  1 
ATOM   2293  C  C   . ILE A  1  306 ? 40.085   4.881    220.160 1.00 106.82 ? 306  ILE A C   1 
ATOM   2294  O  O   . ILE A  1  306 ? 40.283   6.053    219.846 1.00 107.08 ? 306  ILE A O   1 
ATOM   2295  C  CB  . ILE A  1  306 ? 41.446   2.899    219.468 1.00 108.13 ? 306  ILE A CB  1 
ATOM   2296  C  CG1 . ILE A  1  306 ? 42.843   2.281    219.584 1.00 109.98 ? 306  ILE A CG1 1 
ATOM   2297  C  CG2 . ILE A  1  306 ? 41.217   3.468    218.059 1.00 107.38 ? 306  ILE A CG2 1 
ATOM   2298  C  CD1 . ILE A  1  306 ? 43.983   3.213    219.187 1.00 111.38 ? 306  ILE A CD1 1 
ATOM   2299  N  N   . ALA A  1  307 ? 38.877   4.328    220.176 1.00 105.31 ? 307  ALA A N   1 
ATOM   2300  C  CA  . ALA A  1  307 ? 37.695   5.052    219.722 1.00 103.81 ? 307  ALA A CA  1 
ATOM   2301  C  C   . ALA A  1  307 ? 37.442   6.310    220.555 1.00 104.02 ? 307  ALA A C   1 
ATOM   2302  O  O   . ALA A  1  307 ? 36.714   7.206    220.128 1.00 103.17 ? 307  ALA A O   1 
ATOM   2303  C  CB  . ALA A  1  307 ? 36.476   4.142    219.757 1.00 102.35 ? 307  ALA A CB  1 
ATOM   2304  N  N   . GLY A  1  308 ? 38.047   6.373    221.738 1.00 105.26 ? 308  GLY A N   1 
ATOM   2305  C  CA  . GLY A  1  308 ? 37.894   7.517    222.620 1.00 105.71 ? 308  GLY A CA  1 
ATOM   2306  C  C   . GLY A  1  308 ? 38.869   8.653    222.350 1.00 106.96 ? 308  GLY A C   1 
ATOM   2307  O  O   . GLY A  1  308 ? 39.073   9.512    223.207 1.00 107.85 ? 308  GLY A O   1 
ATOM   2308  N  N   . HIS A  1  309 ? 39.474   8.653    221.164 1.00 107.13 ? 309  HIS A N   1 
ATOM   2309  C  CA  . HIS A  1  309 ? 40.444   9.679    220.774 1.00 108.41 ? 309  HIS A CA  1 
ATOM   2310  C  C   . HIS A  1  309 ? 40.083   10.328   219.447 1.00 107.64 ? 309  HIS A C   1 
ATOM   2311  O  O   . HIS A  1  309 ? 40.944   10.866   218.751 1.00 108.65 ? 309  HIS A O   1 
ATOM   2312  C  CB  . HIS A  1  309 ? 41.841   9.076    220.694 1.00 109.98 ? 309  HIS A CB  1 
ATOM   2313  C  CG  . HIS A  1  309 ? 42.380   8.655    222.020 1.00 111.17 ? 309  HIS A CG  1 
ATOM   2314  N  ND1 . HIS A  1  309 ? 42.068   7.446    222.603 1.00 110.79 ? 309  HIS A ND1 1 
ATOM   2315  C  CD2 . HIS A  1  309 ? 43.203   9.290    222.884 1.00 112.82 ? 309  HIS A CD2 1 
ATOM   2316  C  CE1 . HIS A  1  309 ? 42.682   7.353    223.768 1.00 112.19 ? 309  HIS A CE1 1 
ATOM   2317  N  NE2 . HIS A  1  309 ? 43.379   8.456    223.959 1.00 113.43 ? 309  HIS A NE2 1 
ATOM   2318  N  N   . MET A  1  310 ? 38.805   10.275   219.103 1.00 105.96 ? 310  MET A N   1 
ATOM   2319  C  CA  . MET A  1  310 ? 38.334   10.775   217.822 1.00 105.16 ? 310  MET A CA  1 
ATOM   2320  C  C   . MET A  1  310 ? 37.862   12.222   217.894 1.00 105.13 ? 310  MET A C   1 
ATOM   2321  O  O   . MET A  1  310 ? 37.993   12.971   216.926 1.00 105.33 ? 310  MET A O   1 
ATOM   2322  C  CB  . MET A  1  310 ? 37.195   9.896    217.325 1.00 103.42 ? 310  MET A CB  1 
ATOM   2323  C  CG  . MET A  1  310 ? 36.579   10.353   216.020 1.00 102.56 ? 310  MET A CG  1 
ATOM   2324  S  SD  . MET A  1  310 ? 35.564   9.063    215.282 1.00 100.91 ? 310  MET A SD  1 
ATOM   2325  C  CE  . MET A  1  310 ? 34.644   8.504    216.715 1.00 100.07 ? 310  MET A CE  1 
ATOM   2326  N  N   . TYR A  1  311 ? 37.316   12.611   219.041 1.00 105.00 ? 311  TYR A N   1 
ATOM   2327  C  CA  . TYR A  1  311 ? 36.594   13.875   219.155 1.00 104.74 ? 311  TYR A CA  1 
ATOM   2328  C  C   . TYR A  1  311 ? 37.449   15.047   219.627 1.00 106.41 ? 311  TYR A C   1 
ATOM   2329  O  O   . TYR A  1  311 ? 38.445   14.874   220.331 1.00 107.74 ? 311  TYR A O   1 
ATOM   2330  C  CB  . TYR A  1  311 ? 35.409   13.693   220.103 1.00 103.70 ? 311  TYR A CB  1 
ATOM   2331  C  CG  . TYR A  1  311 ? 34.401   12.676   219.612 1.00 102.03 ? 311  TYR A CG  1 
ATOM   2332  C  CD1 . TYR A  1  311 ? 33.977   12.672   218.289 1.00 101.14 ? 311  TYR A CD1 1 
ATOM   2333  C  CD2 . TYR A  1  311 ? 33.891   11.708   220.465 1.00 101.47 ? 311  TYR A CD2 1 
ATOM   2334  C  CE1 . TYR A  1  311 ? 33.061   11.745   217.835 1.00 99.71  ? 311  TYR A CE1 1 
ATOM   2335  C  CE2 . TYR A  1  311 ? 32.976   10.775   220.019 1.00 100.04 ? 311  TYR A CE2 1 
ATOM   2336  C  CZ  . TYR A  1  311 ? 32.564   10.798   218.704 1.00 99.16  ? 311  TYR A CZ  1 
ATOM   2337  O  OH  . TYR A  1  311 ? 31.653   9.869    218.255 1.00 97.83  ? 311  TYR A OH  1 
ATOM   2338  N  N   . ARG A  1  312 ? 37.035   16.244   219.220 1.00 122.02 ? 312  ARG A N   1 
ATOM   2339  C  CA  . ARG A  1  312 ? 37.736   17.480   219.549 1.00 123.61 ? 312  ARG A CA  1 
ATOM   2340  C  C   . ARG A  1  312 ? 37.714   17.747   221.048 1.00 124.29 ? 312  ARG A C   1 
ATOM   2341  O  O   . ARG A  1  312 ? 36.687   17.581   221.702 1.00 123.31 ? 312  ARG A O   1 
ATOM   2342  C  CB  . ARG A  1  312 ? 37.093   18.655   218.801 1.00 123.32 ? 312  ARG A CB  1 
ATOM   2343  C  CG  . ARG A  1  312 ? 37.676   20.031   219.107 1.00 124.96 ? 312  ARG A CG  1 
ATOM   2344  C  CD  . ARG A  1  312 ? 38.152   20.721   217.840 1.00 125.62 ? 312  ARG A CD  1 
ATOM   2345  N  NE  . ARG A  1  312 ? 39.243   19.989   217.206 1.00 129.67 ? 312  ARG A NE  1 
ATOM   2346  C  CZ  . ARG A  1  312 ? 39.621   20.143   215.941 1.00 126.60 ? 312  ARG A CZ  1 
ATOM   2347  N  NH1 . ARG A  1  312 ? 38.996   21.004   215.147 1.00 126.32 ? 312  ARG A NH1 1 
ATOM   2348  N  NH2 . ARG A  1  312 ? 40.628   19.425   215.468 1.00 127.30 ? 312  ARG A NH2 1 
ATOM   2349  N  N   . THR A  1  313 ? 38.856   18.160   221.585 1.00 110.46 ? 313  THR A N   1 
ATOM   2350  C  CA  . THR A  1  313 ? 38.943   18.593   222.974 1.00 111.46 ? 313  THR A CA  1 
ATOM   2351  C  C   . THR A  1  313 ? 39.879   19.797   223.045 1.00 113.36 ? 313  THR A C   1 
ATOM   2352  O  O   . THR A  1  313 ? 39.954   20.581   222.099 1.00 113.52 ? 313  THR A O   1 
ATOM   2353  C  CB  . THR A  1  313 ? 39.427   17.461   223.907 1.00 111.87 ? 313  THR A CB  1 
ATOM   2354  O  OG1 . THR A  1  313 ? 40.752   17.059   223.540 1.00 113.07 ? 313  THR A OG1 1 
ATOM   2355  C  CG2 . THR A  1  313 ? 38.486   16.265   223.832 1.00 110.08 ? 313  THR A CG2 1 
ATOM   2356  N  N   . ASN A  1  314 ? 40.597   19.944   224.152 1.00 120.95 ? 314  ASN A N   1 
ATOM   2357  C  CA  . ASN A  1  314 ? 41.370   21.154   224.400 1.00 122.85 ? 314  ASN A CA  1 
ATOM   2358  C  C   . ASN A  1  314 ? 42.748   21.164   223.742 1.00 124.28 ? 314  ASN A C   1 
ATOM   2359  O  O   . ASN A  1  314 ? 43.464   22.161   223.828 1.00 125.96 ? 314  ASN A O   1 
ATOM   2360  C  CB  . ASN A  1  314 ? 41.528   21.354   225.906 1.00 124.05 ? 314  ASN A CB  1 
ATOM   2361  C  CG  . ASN A  1  314 ? 40.199   21.500   226.609 1.00 122.95 ? 314  ASN A CG  1 
ATOM   2362  O  OD1 . ASN A  1  314 ? 39.307   22.191   226.124 1.00 122.05 ? 314  ASN A OD1 1 
ATOM   2363  N  ND2 . ASN A  1  314 ? 40.054   20.841   227.753 1.00 123.10 ? 314  ASN A ND2 1 
ATOM   2364  N  N   . TRP A  1  315 ? 43.115   20.066   223.087 1.00 117.65 ? 315  TRP A N   1 
ATOM   2365  C  CA  . TRP A  1  315 ? 44.426   19.960   222.450 1.00 119.04 ? 315  TRP A CA  1 
ATOM   2366  C  C   . TRP A  1  315 ? 44.331   19.919   220.929 1.00 118.25 ? 315  TRP A C   1 
ATOM   2367  O  O   . TRP A  1  315 ? 45.203   19.377   220.254 1.00 118.86 ? 315  TRP A O   1 
ATOM   2368  C  CB  . TRP A  1  315 ? 45.165   18.733   222.978 1.00 119.53 ? 315  TRP A CB  1 
ATOM   2369  C  CG  . TRP A  1  315 ? 45.505   18.868   224.422 1.00 120.82 ? 315  TRP A CG  1 
ATOM   2370  C  CD1 . TRP A  1  315 ? 46.682   19.315   224.945 1.00 123.04 ? 315  TRP A CD1 1 
ATOM   2371  C  CD2 . TRP A  1  315 ? 44.657   18.571   225.536 1.00 120.11 ? 315  TRP A CD2 1 
ATOM   2372  N  NE1 . TRP A  1  315 ? 46.623   19.309   226.317 1.00 123.76 ? 315  TRP A NE1 1 
ATOM   2373  C  CE2 . TRP A  1  315 ? 45.390   18.857   226.705 1.00 122.01 ? 315  TRP A CE2 1 
ATOM   2374  C  CE3 . TRP A  1  315 ? 43.352   18.089   225.658 1.00 118.16 ? 315  TRP A CE3 1 
ATOM   2375  C  CZ2 . TRP A  1  315 ? 44.861   18.675   227.980 1.00 122.04 ? 315  TRP A CZ2 1 
ATOM   2376  C  CZ3 . TRP A  1  315 ? 42.829   17.910   226.923 1.00 118.18 ? 315  TRP A CZ3 1 
ATOM   2377  C  CH2 . TRP A  1  315 ? 43.581   18.201   228.068 1.00 120.12 ? 315  TRP A CH2 1 
ATOM   2378  N  N   . GLY A  1  316 ? 43.263   20.494   220.392 1.00 118.62 ? 316  GLY A N   1 
ATOM   2379  C  CA  . GLY A  1  316 ? 43.171   20.754   218.968 1.00 118.21 ? 316  GLY A CA  1 
ATOM   2380  C  C   . GLY A  1  316 ? 43.073   19.542   218.059 1.00 117.03 ? 316  GLY A C   1 
ATOM   2381  O  O   . GLY A  1  316 ? 42.687   19.685   216.899 1.00 116.35 ? 316  GLY A O   1 
ATOM   2382  N  N   . ILE A  1  317 ? 43.405   18.357   218.563 1.00 115.25 ? 317  ILE A N   1 
ATOM   2383  C  CA  . ILE A  1  317 ? 43.312   17.153   217.748 1.00 114.21 ? 317  ILE A CA  1 
ATOM   2384  C  C   . ILE A  1  317 ? 41.924   16.570   217.950 1.00 112.12 ? 317  ILE A C   1 
ATOM   2385  O  O   . ILE A  1  317 ? 41.340   16.708   219.025 1.00 111.75 ? 317  ILE A O   1 
ATOM   2386  C  CB  . ILE A  1  317 ? 44.393   16.093   218.104 1.00 115.20 ? 317  ILE A CB  1 
ATOM   2387  C  CG1 . ILE A  1  317 ? 44.099   15.410   219.447 1.00 114.85 ? 317  ILE A CG1 1 
ATOM   2388  C  CG2 . ILE A  1  317 ? 45.782   16.727   218.106 1.00 117.47 ? 317  ILE A CG2 1 
ATOM   2389  C  CD1 . ILE A  1  317 ? 45.030   14.262   219.753 1.00 115.70 ? 317  ILE A CD1 1 
ATOM   2390  N  N   . GLY A  1  318 ? 41.394   15.938   216.911 1.00 110.86 ? 318  GLY A N   1 
ATOM   2391  C  CA  . GLY A  1  318 ? 40.093   15.301   216.991 1.00 108.92 ? 318  GLY A CA  1 
ATOM   2392  C  C   . GLY A  1  318 ? 39.097   15.842   215.989 1.00 107.77 ? 318  GLY A C   1 
ATOM   2393  O  O   . GLY A  1  318 ? 39.465   16.450   214.983 1.00 108.39 ? 318  GLY A O   1 
ATOM   2394  N  N   . HIS A  1  319 ? 37.823   15.614   216.287 1.00 122.41 ? 319  HIS A N   1 
ATOM   2395  C  CA  . HIS A  1  319 ? 36.726   15.978   215.403 1.00 121.18 ? 319  HIS A CA  1 
ATOM   2396  C  C   . HIS A  1  319 ? 35.675   16.838   216.072 1.00 120.59 ? 319  HIS A C   1 
ATOM   2397  O  O   . HIS A  1  319 ? 35.419   16.706   217.267 1.00 120.49 ? 319  HIS A O   1 
ATOM   2398  C  CB  . HIS A  1  319 ? 36.045   14.726   214.871 1.00 123.62 ? 319  HIS A CB  1 
ATOM   2399  C  CG  . HIS A  1  319 ? 36.770   14.083   213.736 1.00 120.10 ? 319  HIS A CG  1 
ATOM   2400  N  ND1 . HIS A  1  319 ? 36.528   14.409   212.420 1.00 119.90 ? 319  HIS A ND1 1 
ATOM   2401  C  CD2 . HIS A  1  319 ? 37.736   13.137   213.720 1.00 120.79 ? 319  HIS A CD2 1 
ATOM   2402  C  CE1 . HIS A  1  319 ? 37.312   13.688   211.641 1.00 120.46 ? 319  HIS A CE1 1 
ATOM   2403  N  NE2 . HIS A  1  319 ? 38.056   12.911   212.406 1.00 121.00 ? 319  HIS A NE2 1 
ATOM   2404  N  N   . SER A  1  320 ? 35.072   17.722   215.287 1.00 106.17 ? 320  SER A N   1 
ATOM   2405  C  CA  . SER A  1  320 ? 33.881   18.432   215.720 1.00 105.40 ? 320  SER A CA  1 
ATOM   2406  C  C   . SER A  1  320 ? 32.678   17.726   215.117 1.00 103.65 ? 320  SER A C   1 
ATOM   2407  O  O   . SER A  1  320 ? 32.504   17.720   213.899 1.00 103.33 ? 320  SER A O   1 
ATOM   2408  C  CB  . SER A  1  320 ? 33.910   19.897   215.294 1.00 106.31 ? 320  SER A CB  1 
ATOM   2409  O  OG  . SER A  1  320 ? 32.610   20.458   215.379 1.00 105.37 ? 320  SER A OG  1 
ATOM   2410  N  N   . MET A  1  321 ? 31.866   17.110   215.970 1.00 116.55 ? 321  MET A N   1 
ATOM   2411  C  CA  . MET A  1  321 ? 30.687   16.392   215.508 1.00 114.94 ? 321  MET A CA  1 
ATOM   2412  C  C   . MET A  1  321 ? 29.798   17.345   214.724 1.00 114.53 ? 321  MET A C   1 
ATOM   2413  O  O   . MET A  1  321 ? 29.115   16.945   213.780 1.00 113.57 ? 321  MET A O   1 
ATOM   2414  C  CB  . MET A  1  321 ? 29.914   15.797   216.684 1.00 114.15 ? 321  MET A CB  1 
ATOM   2415  C  CG  . MET A  1  321 ? 30.722   14.852   217.553 1.00 114.64 ? 321  MET A CG  1 
ATOM   2416  S  SD  . MET A  1  321 ? 29.658   13.901   218.653 1.00 143.80 ? 321  MET A SD  1 
ATOM   2417  C  CE  . MET A  1  321 ? 30.744   13.650   220.050 1.00 114.95 ? 321  MET A CE  1 
ATOM   2418  N  N   . LYS A  1  322 ? 29.819   18.613   215.127 1.00 102.63 ? 322  LYS A N   1 
ATOM   2419  C  CA  . LYS A  1  322 ? 29.102   19.661   214.416 1.00 102.56 ? 322  LYS A CA  1 
ATOM   2420  C  C   . LYS A  1  322 ? 29.611   19.759   212.981 1.00 102.97 ? 322  LYS A C   1 
ATOM   2421  O  O   . LYS A  1  322 ? 28.826   19.887   212.043 1.00 102.32 ? 322  LYS A O   1 
ATOM   2422  C  CB  . LYS A  1  322 ? 29.254   21.002   215.138 1.00 103.72 ? 322  LYS A CB  1 
ATOM   2423  C  CG  . LYS A  1  322 ? 28.532   22.162   214.468 1.00 103.84 ? 322  LYS A CG  1 
ATOM   2424  C  CD  . LYS A  1  322 ? 28.737   23.457   215.241 1.00 105.13 ? 322  LYS A CD  1 
ATOM   2425  C  CE  . LYS A  1  322 ? 28.407   24.678   214.395 1.00 105.75 ? 322  LYS A CE  1 
ATOM   2426  N  NZ  . LYS A  1  322 ? 26.943   24.821   214.156 1.00 104.61 ? 322  LYS A NZ  1 
ATOM   2427  N  N   . GLU A  1  323 ? 30.930   19.699   212.816 1.00 127.61 ? 323  GLU A N   1 
ATOM   2428  C  CA  . GLU A  1  323 ? 31.531   19.742   211.487 1.00 128.21 ? 323  GLU A CA  1 
ATOM   2429  C  C   . GLU A  1  323 ? 31.121   18.517   210.681 1.00 127.04 ? 323  GLU A C   1 
ATOM   2430  O  O   . GLU A  1  323 ? 30.719   18.631   209.523 1.00 126.82 ? 323  GLU A O   1 
ATOM   2431  C  CB  . GLU A  1  323 ? 33.061   19.811   211.572 1.00 129.78 ? 323  GLU A CB  1 
ATOM   2432  C  CG  . GLU A  1  323 ? 33.658   21.187   211.307 1.00 132.82 ? 323  GLU A CG  1 
ATOM   2433  C  CD  . GLU A  1  323 ? 33.527   22.128   212.488 1.00 158.58 ? 323  GLU A CD  1 
ATOM   2434  O  OE1 . GLU A  1  323 ? 32.422   22.217   213.065 1.00 171.32 ? 323  GLU A OE1 1 
ATOM   2435  O  OE2 . GLU A  1  323 ? 34.534   22.778   212.842 1.00 168.84 ? 323  GLU A OE2 1 
ATOM   2436  N  N   . ILE A  1  324 ? 31.226   17.346   211.300 1.00 99.69  ? 324  ILE A N   1 
ATOM   2437  C  CA  . ILE A  1  324 ? 30.920   16.091   210.624 1.00 98.70  ? 324  ILE A CA  1 
ATOM   2438  C  C   . ILE A  1  324 ? 29.463   16.030   210.187 1.00 97.33  ? 324  ILE A C   1 
ATOM   2439  O  O   . ILE A  1  324 ? 29.167   15.732   209.030 1.00 97.01  ? 324  ILE A O   1 
ATOM   2440  C  CB  . ILE A  1  324 ? 31.215   14.873   211.519 1.00 98.33  ? 324  ILE A CB  1 
ATOM   2441  C  CG1 . ILE A  1  324 ? 32.685   14.854   211.939 1.00 99.77  ? 324  ILE A CG1 1 
ATOM   2442  C  CG2 . ILE A  1  324 ? 30.874   13.577   210.786 1.00 97.40  ? 324  ILE A CG2 1 
ATOM   2443  C  CD1 . ILE A  1  324 ? 32.981   13.870   213.046 1.00 99.65  ? 324  ILE A CD1 1 
ATOM   2444  N  N   . LEU A  1  325 ? 28.561   16.300   211.124 1.00 96.63  ? 325  LEU A N   1 
ATOM   2445  C  CA  . LEU A  1  325 ? 27.132   16.286   210.838 1.00 95.40  ? 325  LEU A CA  1 
ATOM   2446  C  C   . LEU A  1  325 ? 26.789   17.225   209.687 1.00 95.72  ? 325  LEU A C   1 
ATOM   2447  O  O   . LEU A  1  325 ? 26.248   16.793   208.670 1.00 95.13  ? 325  LEU A O   1 
ATOM   2448  C  CB  . LEU A  1  325 ? 26.335   16.671   212.088 1.00 94.95  ? 325  LEU A CB  1 
ATOM   2449  C  CG  . LEU A  1  325 ? 26.299   15.632   213.212 1.00 94.42  ? 325  LEU A CG  1 
ATOM   2450  C  CD1 . LEU A  1  325 ? 25.732   16.237   214.486 1.00 94.43  ? 325  LEU A CD1 1 
ATOM   2451  C  CD2 . LEU A  1  325 ? 25.479   14.423   212.793 1.00 93.13  ? 325  LEU A CD2 1 
ATOM   2452  N  N   . GLU A  1  326 ? 27.126   18.502   209.836 1.00 140.84 ? 326  GLU A N   1 
ATOM   2453  C  CA  . GLU A  1  326 ? 26.792   19.493   208.819 1.00 139.59 ? 326  GLU A CA  1 
ATOM   2454  C  C   . GLU A  1  326 ? 27.420   19.169   207.466 1.00 135.48 ? 326  GLU A C   1 
ATOM   2455  O  O   . GLU A  1  326 ? 26.889   19.557   206.428 1.00 144.40 ? 326  GLU A O   1 
ATOM   2456  C  CB  . GLU A  1  326 ? 27.229   20.890   209.262 1.00 139.07 ? 326  GLU A CB  1 
ATOM   2457  C  CG  . GLU A  1  326 ? 26.376   21.490   210.373 1.00 131.18 ? 326  GLU A CG  1 
ATOM   2458  C  CD  . GLU A  1  326 ? 26.622   22.975   210.573 1.00 132.51 ? 326  GLU A CD  1 
ATOM   2459  O  OE1 . GLU A  1  326 ? 27.183   23.621   209.662 1.00 133.58 ? 326  GLU A OE1 1 
ATOM   2460  O  OE2 . GLU A  1  326 ? 26.248   23.499   211.643 1.00 132.59 ? 326  GLU A OE2 1 
ATOM   2461  N  N   . ALA A  1  327 ? 28.538   18.449   207.477 1.00 98.29  ? 327  ALA A N   1 
ATOM   2462  C  CA  . ALA A  1  327 ? 29.218   18.075   206.239 1.00 98.95  ? 327  ALA A CA  1 
ATOM   2463  C  C   . ALA A  1  327 ? 28.655   16.786   205.641 1.00 97.81  ? 327  ALA A C   1 
ATOM   2464  O  O   . ALA A  1  327 ? 29.326   16.121   204.852 1.00 98.26  ? 327  ALA A O   1 
ATOM   2465  C  CB  . ALA A  1  327 ? 30.712   17.930   206.484 1.00 100.19 ? 327  ALA A CB  1 
ATOM   2466  N  N   . HIS A  1  328 ? 27.424   16.444   206.014 1.00 100.86 ? 328  HIS A N   1 
ATOM   2467  C  CA  . HIS A  1  328 ? 26.741   15.272   205.472 1.00 99.78  ? 328  HIS A CA  1 
ATOM   2468  C  C   . HIS A  1  328 ? 25.411   15.685   204.850 1.00 99.09  ? 328  HIS A C   1 
ATOM   2469  O  O   . HIS A  1  328 ? 24.351   15.508   205.451 1.00 98.00  ? 328  HIS A O   1 
ATOM   2470  C  CB  . HIS A  1  328 ? 26.506   14.228   206.568 1.00 98.78  ? 328  HIS A CB  1 
ATOM   2471  C  CG  . HIS A  1  328 ? 27.672   13.320   206.799 1.00 99.28  ? 328  HIS A CG  1 
ATOM   2472  N  ND1 . HIS A  1  328 ? 28.857   13.753   207.353 1.00 100.42 ? 328  HIS A ND1 1 
ATOM   2473  C  CD2 . HIS A  1  328 ? 27.828   11.997   206.562 1.00 98.89  ? 328  HIS A CD2 1 
ATOM   2474  C  CE1 . HIS A  1  328 ? 29.697   12.737   207.440 1.00 100.71 ? 328  HIS A CE1 1 
ATOM   2475  N  NE2 . HIS A  1  328 ? 29.095   11.659   206.970 1.00 99.80  ? 328  HIS A NE2 1 
ATOM   2476  N  N   . LYS A  1  329 ? 25.482   16.235   203.640 1.00 114.50 ? 329  LYS A N   1 
ATOM   2477  C  CA  . LYS A  1  329 ? 24.297   16.661   202.903 1.00 118.29 ? 329  LYS A CA  1 
ATOM   2478  C  C   . LYS A  1  329 ? 24.200   15.889   201.590 1.00 114.12 ? 329  LYS A C   1 
ATOM   2479  O  O   . LYS A  1  329 ? 25.217   15.578   200.975 1.00 115.03 ? 329  LYS A O   1 
ATOM   2480  C  CB  . LYS A  1  329 ? 24.348   18.168   202.620 1.00 124.92 ? 329  LYS A CB  1 
ATOM   2481  C  CG  . LYS A  1  329 ? 25.110   19.005   203.657 1.00 120.13 ? 329  LYS A CG  1 
ATOM   2482  C  CD  . LYS A  1  329 ? 25.366   20.423   203.149 1.00 117.33 ? 329  LYS A CD  1 
ATOM   2483  C  CE  . LYS A  1  329 ? 26.435   21.136   203.970 1.00 118.42 ? 329  LYS A CE  1 
ATOM   2484  N  NZ  . LYS A  1  329 ? 26.852   22.440   203.382 1.00 120.00 ? 329  LYS A NZ  1 
ATOM   2485  N  N   . GLY A  1  330 ? 22.979   15.606   201.147 1.00 94.18  ? 330  GLY A N   1 
ATOM   2486  C  CA  . GLY A  1  330 ? 22.774   14.868   199.913 1.00 94.23  ? 330  GLY A CA  1 
ATOM   2487  C  C   . GLY A  1  330 ? 21.619   15.401   199.092 1.00 94.15  ? 330  GLY A C   1 
ATOM   2488  O  O   . GLY A  1  330 ? 20.796   16.158   199.606 1.00 93.75  ? 330  GLY A O   1 
ATOM   2489  N  N   . PRO A  1  331 ? 21.552   15.007   197.808 1.00 100.76 ? 331  PRO A N   1 
ATOM   2490  C  CA  . PRO A  1  331 ? 20.483   15.464   196.914 1.00 100.86 ? 331  PRO A CA  1 
ATOM   2491  C  C   . PRO A  1  331 ? 19.089   15.226   197.480 1.00 99.48  ? 331  PRO A C   1 
ATOM   2492  O  O   . PRO A  1  331 ? 18.221   16.089   197.363 1.00 109.31 ? 331  PRO A O   1 
ATOM   2493  C  CB  . PRO A  1  331 ? 20.703   14.627   195.650 1.00 101.40 ? 331  PRO A CB  1 
ATOM   2494  C  CG  . PRO A  1  331 ? 22.141   14.283   195.669 1.00 102.20 ? 331  PRO A CG  1 
ATOM   2495  C  CD  . PRO A  1  331 ? 22.507   14.125   197.111 1.00 101.40 ? 331  PRO A CD  1 
ATOM   2496  N  N   . PHE A  1  332 ? 18.889   14.070   198.101 1.00 92.23  ? 332  PHE A N   1 
ATOM   2497  C  CA  . PHE A  1  332 ? 17.568   13.679   198.575 1.00 90.98  ? 332  PHE A CA  1 
ATOM   2498  C  C   . PHE A  1  332 ? 17.170   14.373   199.882 1.00 90.42  ? 332  PHE A C   1 
ATOM   2499  O  O   . PHE A  1  332 ? 15.981   14.471   200.189 1.00 89.69  ? 332  PHE A O   1 
ATOM   2500  C  CB  . PHE A  1  332 ? 17.505   12.157   198.754 1.00 90.13  ? 332  PHE A CB  1 
ATOM   2501  C  CG  . PHE A  1  332 ? 17.607   11.389   197.462 1.00 90.60  ? 332  PHE A CG  1 
ATOM   2502  C  CD1 . PHE A  1  332 ? 16.536   11.339   196.586 1.00 90.54  ? 332  PHE A CD1 1 
ATOM   2503  C  CD2 . PHE A  1  332 ? 18.767   10.705   197.133 1.00 91.21  ? 332  PHE A CD2 1 
ATOM   2504  C  CE1 . PHE A  1  332 ? 16.622   10.635   195.399 1.00 91.10  ? 332  PHE A CE1 1 
ATOM   2505  C  CE2 . PHE A  1  332 ? 18.858   9.996    195.947 1.00 91.76  ? 332  PHE A CE2 1 
ATOM   2506  C  CZ  . PHE A  1  332 ? 17.784   9.960    195.081 1.00 91.71  ? 332  PHE A CZ  1 
ATOM   2507  N  N   . THR A  1  333 ? 18.154   14.848   200.645 1.00 106.31 ? 333  THR A N   1 
ATOM   2508  C  CA  . THR A  1  333 ? 17.905   15.327   202.011 1.00 105.82 ? 333  THR A CA  1 
ATOM   2509  C  C   . THR A  1  333 ? 18.213   16.808   202.275 1.00 106.75 ? 333  THR A C   1 
ATOM   2510  O  O   . THR A  1  333 ? 18.353   17.215   203.430 1.00 106.63 ? 333  THR A O   1 
ATOM   2511  C  CB  . THR A  1  333 ? 18.713   14.497   203.013 1.00 105.46 ? 333  THR A CB  1 
ATOM   2512  O  OG1 . THR A  1  333 ? 20.084   14.455   202.610 1.00 106.43 ? 333  THR A OG1 1 
ATOM   2513  C  CG2 . THR A  1  333 ? 18.173   13.090   203.082 1.00 104.43 ? 333  THR A CG2 1 
ATOM   2514  N  N   . GLY A  1  334 ? 18.300   17.614   201.223 1.00 92.28  ? 334  GLY A N   1 
ATOM   2515  C  CA  . GLY A  1  334 ? 18.467   19.049   201.382 1.00 93.26  ? 334  GLY A CA  1 
ATOM   2516  C  C   . GLY A  1  334 ? 19.681   19.466   202.196 1.00 93.92  ? 334  GLY A C   1 
ATOM   2517  O  O   . GLY A  1  334 ? 20.818   19.244   201.782 1.00 94.67  ? 334  GLY A O   1 
ATOM   2518  N  N   . GLU A  1  335 ? 19.439   20.077   203.355 1.00 126.81 ? 335  GLU A N   1 
ATOM   2519  C  CA  . GLU A  1  335 ? 20.520   20.611   204.183 1.00 127.59 ? 335  GLU A CA  1 
ATOM   2520  C  C   . GLU A  1  335 ? 21.157   19.544   205.078 1.00 126.96 ? 335  GLU A C   1 
ATOM   2521  O  O   . GLU A  1  335 ? 22.207   19.779   205.677 1.00 127.66 ? 335  GLU A O   1 
ATOM   2522  C  CB  . GLU A  1  335 ? 20.003   21.768   205.043 1.00 132.48 ? 335  GLU A CB  1 
ATOM   2523  C  CG  . GLU A  1  335 ? 20.990   22.920   205.196 1.00 129.36 ? 335  GLU A CG  1 
ATOM   2524  C  CD  . GLU A  1  335 ? 21.187   23.710   203.914 1.00 130.57 ? 335  GLU A CD  1 
ATOM   2525  O  OE1 . GLU A  1  335 ? 20.563   23.361   202.890 1.00 130.26 ? 335  GLU A OE1 1 
ATOM   2526  O  OE2 . GLU A  1  335 ? 21.970   24.684   203.933 1.00 131.94 ? 335  GLU A OE2 1 
ATOM   2527  N  N   . GLY A  1  336 ? 20.519   18.382   205.177 1.00 92.66  ? 336  GLY A N   1 
ATOM   2528  C  CA  . GLY A  1  336 ? 21.108   17.245   205.869 1.00 92.15  ? 336  GLY A CA  1 
ATOM   2529  C  C   . GLY A  1  336 ? 21.033   17.284   207.385 1.00 91.79  ? 336  GLY A C   1 
ATOM   2530  O  O   . GLY A  1  336 ? 20.005   17.633   207.958 1.00 91.26  ? 336  GLY A O   1 
ATOM   2531  N  N   . HIS A  1  337 ? 22.137   16.918   208.032 1.00 92.21  ? 337  HIS A N   1 
ATOM   2532  C  CA  . HIS A  1  337 ? 22.184   16.788   209.489 1.00 91.99  ? 337  HIS A CA  1 
ATOM   2533  C  C   . HIS A  1  337 ? 22.411   18.124   210.177 1.00 92.90  ? 337  HIS A C   1 
ATOM   2534  O  O   . HIS A  1  337 ? 22.729   18.168   211.367 1.00 93.11  ? 337  HIS A O   1 
ATOM   2535  C  CB  . HIS A  1  337 ? 23.300   15.831   209.905 1.00 92.21  ? 337  HIS A CB  1 
ATOM   2536  C  CG  . HIS A  1  337 ? 23.171   14.463   209.318 1.00 91.45  ? 337  HIS A CG  1 
ATOM   2537  N  ND1 . HIS A  1  337 ? 23.585   14.168   208.038 1.00 91.76  ? 337  HIS A ND1 1 
ATOM   2538  C  CD2 . HIS A  1  337 ? 22.676   13.312   209.830 1.00 90.52  ? 337  HIS A CD2 1 
ATOM   2539  C  CE1 . HIS A  1  337 ? 23.351   12.893   207.785 1.00 91.03  ? 337  HIS A CE1 1 
ATOM   2540  N  NE2 . HIS A  1  337 ? 22.799   12.351   208.856 1.00 90.27  ? 337  HIS A NE2 1 
ATOM   2541  N  N   . LYS A  1  338 ? 22.271   19.210   209.428 1.00 99.07  ? 338  LYS A N   1 
ATOM   2542  C  CA  . LYS A  1  338 ? 22.457   20.537   209.987 1.00 100.06 ? 338  LYS A CA  1 
ATOM   2543  C  C   . LYS A  1  338 ? 21.447   20.766   211.104 1.00 99.49  ? 338  LYS A C   1 
ATOM   2544  O  O   . LYS A  1  338 ? 20.251   20.537   210.924 1.00 98.57  ? 338  LYS A O   1 
ATOM   2545  C  CB  . LYS A  1  338 ? 22.302   21.604   208.904 1.00 100.85 ? 338  LYS A CB  1 
ATOM   2546  C  CG  . LYS A  1  338 ? 22.997   22.917   209.219 1.00 102.32 ? 338  LYS A CG  1 
ATOM   2547  C  CD  . LYS A  1  338 ? 22.637   23.988   208.203 1.00 103.10 ? 338  LYS A CD  1 
ATOM   2548  C  CE  . LYS A  1  338 ? 23.680   25.093   208.156 1.00 104.81 ? 338  LYS A CE  1 
ATOM   2549  N  NZ  . LYS A  1  338 ? 23.844   25.779   209.466 1.00 105.35 ? 338  LYS A NZ  1 
ATOM   2550  N  N   . GLY A  1  339 ? 21.937   21.202   212.259 1.00 110.93 ? 339  GLY A N   1 
ATOM   2551  C  CA  . GLY A  1  339 ? 21.070   21.516   213.379 1.00 110.65 ? 339  GLY A CA  1 
ATOM   2552  C  C   . GLY A  1  339 ? 20.923   20.366   214.356 1.00 109.84 ? 339  GLY A C   1 
ATOM   2553  O  O   . GLY A  1  339 ? 20.526   20.570   215.503 1.00 109.91 ? 339  GLY A O   1 
ATOM   2554  N  N   . LEU A  1  340 ? 21.233   19.154   213.906 1.00 95.53  ? 340  LEU A N   1 
ATOM   2555  C  CA  . LEU A  1  340 ? 21.100   17.977   214.754 1.00 94.82  ? 340  LEU A CA  1 
ATOM   2556  C  C   . LEU A  1  340 ? 22.045   18.071   215.943 1.00 95.70  ? 340  LEU A C   1 
ATOM   2557  O  O   . LEU A  1  340 ? 21.715   17.616   217.040 1.00 95.47  ? 340  LEU A O   1 
ATOM   2558  C  CB  . LEU A  1  340 ? 21.369   16.697   213.958 1.00 94.13  ? 340  LEU A CB  1 
ATOM   2559  C  CG  . LEU A  1  340 ? 20.413   16.410   212.794 1.00 93.25  ? 340  LEU A CG  1 
ATOM   2560  C  CD1 . LEU A  1  340 ? 20.713   15.047   212.197 1.00 92.68  ? 340  LEU A CD1 1 
ATOM   2561  C  CD2 . LEU A  1  340 ? 18.954   16.480   213.224 1.00 92.46  ? 340  LEU A CD2 1 
ATOM   2562  N  N   . TYR A  1  341 ? 23.220   18.653   215.723 1.00 94.17  ? 341  TYR A N   1 
ATOM   2563  C  CA  . TYR A  1  341 ? 24.171   18.864   216.806 1.00 95.22  ? 341  TYR A CA  1 
ATOM   2564  C  C   . TYR A  1  341 ? 23.525   19.702   217.900 1.00 95.58  ? 341  TYR A C   1 
ATOM   2565  O  O   . TYR A  1  341 ? 23.598   19.361   219.080 1.00 95.78  ? 341  TYR A O   1 
ATOM   2566  C  CB  . TYR A  1  341 ? 25.435   19.565   216.306 1.00 96.50  ? 341  TYR A CB  1 
ATOM   2567  C  CG  . TYR A  1  341 ? 26.514   19.689   217.362 1.00 97.68  ? 341  TYR A CG  1 
ATOM   2568  C  CD1 . TYR A  1  341 ? 26.441   20.663   218.351 1.00 98.55  ? 341  TYR A CD1 1 
ATOM   2569  C  CD2 . TYR A  1  341 ? 27.612   18.843   217.361 1.00 98.04  ? 341  TYR A CD2 1 
ATOM   2570  C  CE1 . TYR A  1  341 ? 27.421   20.777   219.316 1.00 99.74  ? 341  TYR A CE1 1 
ATOM   2571  C  CE2 . TYR A  1  341 ? 28.601   18.953   218.319 1.00 99.22  ? 341  TYR A CE2 1 
ATOM   2572  C  CZ  . TYR A  1  341 ? 28.500   19.924   219.293 1.00 100.07 ? 341  TYR A CZ  1 
ATOM   2573  O  OH  . TYR A  1  341 ? 29.477   20.043   220.251 1.00 101.35 ? 341  TYR A OH  1 
ATOM   2574  N  N   . GLU A  1  342 ? 22.885   20.793   217.490 1.00 115.72 ? 342  GLU A N   1 
ATOM   2575  C  CA  . GLU A  1  342 ? 22.301   21.749   218.424 1.00 116.27 ? 342  GLU A CA  1 
ATOM   2576  C  C   . GLU A  1  342 ? 21.218   21.122   219.298 1.00 115.41 ? 342  GLU A C   1 
ATOM   2577  O  O   . GLU A  1  342 ? 21.237   21.269   220.519 1.00 115.99 ? 342  GLU A O   1 
ATOM   2578  C  CB  . GLU A  1  342 ? 21.714   22.951   217.673 1.00 116.58 ? 342  GLU A CB  1 
ATOM   2579  C  CG  . GLU A  1  342 ? 22.738   23.970   217.174 1.00 117.94 ? 342  GLU A CG  1 
ATOM   2580  C  CD  . GLU A  1  342 ? 23.507   23.506   215.952 1.00 118.09 ? 342  GLU A CD  1 
ATOM   2581  O  OE1 . GLU A  1  342 ? 23.314   22.351   215.520 1.00 136.99 ? 342  GLU A OE1 1 
ATOM   2582  O  OE2 . GLU A  1  342 ? 24.305   24.306   215.418 1.00 118.98 ? 342  GLU A OE2 1 
ATOM   2583  N  N   . ILE A  1  343 ? 20.268   20.433   218.675 1.00 94.18  ? 343  ILE A N   1 
ATOM   2584  C  CA  . ILE A  1  343 ? 19.129   19.895   219.411 1.00 93.41  ? 343  ILE A CA  1 
ATOM   2585  C  C   . ILE A  1  343 ? 19.560   18.774   220.352 1.00 93.31  ? 343  ILE A C   1 
ATOM   2586  O  O   . ILE A  1  343 ? 18.915   18.531   221.370 1.00 93.24  ? 343  ILE A O   1 
ATOM   2587  C  CB  . ILE A  1  343 ? 18.018   19.387   218.458 1.00 92.14  ? 343  ILE A CB  1 
ATOM   2588  C  CG1 . ILE A  1  343 ? 18.495   18.185   217.634 1.00 91.39  ? 343  ILE A CG1 1 
ATOM   2589  C  CG2 . ILE A  1  343 ? 17.567   20.521   217.539 1.00 92.38  ? 343  ILE A CG2 1 
ATOM   2590  C  CD1 . ILE A  1  343 ? 17.411   17.574   216.755 1.00 90.21  ? 343  ILE A CD1 1 
ATOM   2591  N  N   . LEU A  1  344 ? 20.655   18.102   220.010 1.00 93.41  ? 344  LEU A N   1 
ATOM   2592  C  CA  . LEU A  1  344 ? 21.188   17.029   220.845 1.00 93.48  ? 344  LEU A CA  1 
ATOM   2593  C  C   . LEU A  1  344 ? 22.131   17.554   221.925 1.00 94.87  ? 344  LEU A C   1 
ATOM   2594  O  O   . LEU A  1  344 ? 22.683   16.776   222.704 1.00 95.20  ? 344  LEU A O   1 
ATOM   2595  C  CB  . LEU A  1  344 ? 21.908   15.995   219.977 1.00 93.03  ? 344  LEU A CB  1 
ATOM   2596  C  CG  . LEU A  1  344 ? 20.996   14.972   219.300 1.00 91.67  ? 344  LEU A CG  1 
ATOM   2597  C  CD1 . LEU A  1  344 ? 21.780   14.169   218.279 1.00 91.44  ? 344  LEU A CD1 1 
ATOM   2598  C  CD2 . LEU A  1  344 ? 20.361   14.044   220.330 1.00 91.27  ? 344  LEU A CD2 1 
ATOM   2599  N  N   . THR A  1  345 ? 22.314   18.870   221.964 1.00 98.08  ? 345  THR A N   1 
ATOM   2600  C  CA  . THR A  1  345 ? 23.103   19.507   223.013 1.00 99.53  ? 345  THR A CA  1 
ATOM   2601  C  C   . THR A  1  345 ? 22.296   20.606   223.703 1.00 100.08 ? 345  THR A C   1 
ATOM   2602  O  O   . THR A  1  345 ? 22.863   21.476   224.366 1.00 101.43 ? 345  THR A O   1 
ATOM   2603  C  CB  . THR A  1  345 ? 24.422   20.097   222.457 1.00 100.56 ? 345  THR A CB  1 
ATOM   2604  O  OG1 . THR A  1  345 ? 25.264   20.496   223.546 1.00 102.01 ? 345  THR A OG1 1 
ATOM   2605  C  CG2 . THR A  1  345 ? 24.164   21.299   221.557 1.00 100.76 ? 345  THR A CG2 1 
ATOM   2606  N  N   . THR A  1  346 ? 20.974   20.561   223.542 1.00 115.05 ? 346  THR A N   1 
ATOM   2607  C  CA  . THR A  1  346 ? 20.083   21.507   224.213 1.00 115.54 ? 346  THR A CA  1 
ATOM   2608  C  C   . THR A  1  346 ? 18.825   20.840   224.770 1.00 114.71 ? 346  THR A C   1 
ATOM   2609  O  O   . THR A  1  346 ? 18.206   21.361   225.699 1.00 121.72 ? 346  THR A O   1 
ATOM   2610  C  CB  . THR A  1  346 ? 19.648   22.638   223.261 1.00 115.58 ? 346  THR A CB  1 
ATOM   2611  O  OG1 . THR A  1  346 ? 19.013   22.081   222.103 1.00 114.22 ? 346  THR A OG1 1 
ATOM   2612  C  CG2 . THR A  1  346 ? 20.848   23.473   222.835 1.00 116.71 ? 346  THR A CG2 1 
ATOM   2613  N  N   . SER A  1  347 ? 18.451   19.694   224.201 1.00 95.20  ? 347  SER A N   1 
ATOM   2614  C  CA  . SER A  1  347 ? 17.250   18.973   224.622 1.00 94.39  ? 347  SER A CA  1 
ATOM   2615  C  C   . SER A  1  347 ? 17.607   17.615   225.210 1.00 94.14  ? 347  SER A C   1 
ATOM   2616  O  O   . SER A  1  347 ? 18.170   16.763   224.526 1.00 93.54  ? 347  SER A O   1 
ATOM   2617  C  CB  . SER A  1  347 ? 16.293   18.794   223.442 1.00 93.13  ? 347  SER A CB  1 
ATOM   2618  O  OG  . SER A  1  347 ? 15.109   18.126   223.844 1.00 92.43  ? 347  SER A OG  1 
ATOM   2619  N  N   . TRP A  1  348 ? 17.276   17.417   226.481 1.00 94.73  ? 348  TRP A N   1 
ATOM   2620  C  CA  . TRP A  1  348 ? 17.528   16.141   227.139 1.00 94.66  ? 348  TRP A CA  1 
ATOM   2621  C  C   . TRP A  1  348 ? 16.635   15.044   226.574 1.00 93.29  ? 348  TRP A C   1 
ATOM   2622  O  O   . TRP A  1  348 ? 17.070   13.906   226.413 1.00 92.89  ? 348  TRP A O   1 
ATOM   2623  C  CB  . TRP A  1  348 ? 17.315   16.259   228.646 1.00 95.78  ? 348  TRP A CB  1 
ATOM   2624  C  CG  . TRP A  1  348 ? 18.429   16.964   229.353 1.00 97.28  ? 348  TRP A CG  1 
ATOM   2625  C  CD1 . TRP A  1  348 ? 18.538   18.306   229.581 1.00 98.26  ? 348  TRP A CD1 1 
ATOM   2626  C  CD2 . TRP A  1  348 ? 19.592   16.363   229.933 1.00 98.09  ? 348  TRP A CD2 1 
ATOM   2627  N  NE1 . TRP A  1  348 ? 19.699   18.576   230.263 1.00 99.62  ? 348  TRP A NE1 1 
ATOM   2628  C  CE2 . TRP A  1  348 ? 20.363   17.399   230.493 1.00 99.55  ? 348  TRP A CE2 1 
ATOM   2629  C  CE3 . TRP A  1  348 ? 20.056   15.049   230.032 1.00 97.82  ? 348  TRP A CE3 1 
ATOM   2630  C  CZ2 . TRP A  1  348 ? 21.574   17.163   231.141 1.00 100.73 ? 348  TRP A CZ2 1 
ATOM   2631  C  CZ3 . TRP A  1  348 ? 21.258   14.816   230.677 1.00 99.00  ? 348  TRP A CZ3 1 
ATOM   2632  C  CH2 . TRP A  1  348 ? 22.002   15.868   231.223 1.00 100.43 ? 348  TRP A CH2 1 
ATOM   2633  N  N   . HIS A  1  349 ? 15.383   15.385   226.286 1.00 92.68  ? 349  HIS A N   1 
ATOM   2634  C  CA  . HIS A  1  349 ? 14.439   14.419   225.736 1.00 91.47  ? 349  HIS A CA  1 
ATOM   2635  C  C   . HIS A  1  349 ? 14.909   13.917   224.374 1.00 90.55  ? 349  HIS A C   1 
ATOM   2636  O  O   . HIS A  1  349 ? 14.618   12.785   223.990 1.00 89.73  ? 349  HIS A O   1 
ATOM   2637  C  CB  . HIS A  1  349 ? 13.039   15.030   225.633 1.00 91.14  ? 349  HIS A CB  1 
ATOM   2638  C  CG  . HIS A  1  349 ? 12.368   15.217   226.959 1.00 91.94  ? 349  HIS A CG  1 
ATOM   2639  N  ND1 . HIS A  1  349 ? 11.515   14.278   227.498 1.00 91.66  ? 349  HIS A ND1 1 
ATOM   2640  C  CD2 . HIS A  1  349 ? 12.424   16.232   227.854 1.00 93.13  ? 349  HIS A CD2 1 
ATOM   2641  C  CE1 . HIS A  1  349 ? 11.079   14.703   228.670 1.00 92.65  ? 349  HIS A CE1 1 
ATOM   2642  N  NE2 . HIS A  1  349 ? 11.614   15.887   228.909 1.00 93.56  ? 349  HIS A NE2 1 
ATOM   2643  N  N   . ALA A  1  350 ? 15.633   14.762   223.648 1.00 90.80  ? 350  ALA A N   1 
ATOM   2644  C  CA  . ALA A  1  350 ? 16.212   14.368   222.368 1.00 90.17  ? 350  ALA A CA  1 
ATOM   2645  C  C   . ALA A  1  350 ? 17.258   13.278   222.570 1.00 90.31  ? 350  ALA A C   1 
ATOM   2646  O  O   . ALA A  1  350 ? 17.308   12.304   221.819 1.00 89.57  ? 350  ALA A O   1 
ATOM   2647  C  CB  . ALA A  1  350 ? 16.825   15.566   221.666 1.00 90.67  ? 350  ALA A CB  1 
ATOM   2648  N  N   . GLN A  1  351 ? 18.093   13.449   223.589 1.00 91.38  ? 351  GLN A N   1 
ATOM   2649  C  CA  . GLN A  1  351 ? 19.117   12.465   223.917 1.00 91.75  ? 351  GLN A CA  1 
ATOM   2650  C  C   . GLN A  1  351 ? 18.482   11.189   224.441 1.00 91.28  ? 351  GLN A C   1 
ATOM   2651  O  O   . GLN A  1  351 ? 18.807   10.088   223.993 1.00 90.84  ? 351  GLN A O   1 
ATOM   2652  C  CB  . GLN A  1  351 ? 20.082   13.025   224.960 1.00 93.16  ? 351  GLN A CB  1 
ATOM   2653  C  CG  . GLN A  1  351 ? 21.091   14.001   224.399 1.00 93.81  ? 351  GLN A CG  1 
ATOM   2654  C  CD  . GLN A  1  351 ? 22.139   13.331   223.532 1.00 93.68  ? 351  GLN A CD  1 
ATOM   2655  O  OE1 . GLN A  1  351 ? 22.355   12.122   223.617 1.00 93.41  ? 351  GLN A OE1 1 
ATOM   2656  N  NE2 . GLN A  1  351 ? 22.789   14.115   222.680 1.00 93.97  ? 351  GLN A NE2 1 
ATOM   2657  N  N   . LEU A  1  352 ? 17.578   11.350   225.401 1.00 91.49  ? 352  LEU A N   1 
ATOM   2658  C  CA  . LEU A  1  352 ? 16.935   10.218   226.047 1.00 91.27  ? 352  LEU A CA  1 
ATOM   2659  C  C   . LEU A  1  352 ? 16.205   9.341    225.039 1.00 90.00  ? 352  LEU A C   1 
ATOM   2660  O  O   . LEU A  1  352 ? 16.179   8.120    225.176 1.00 89.79  ? 352  LEU A O   1 
ATOM   2661  C  CB  . LEU A  1  352 ? 15.954   10.697   227.121 1.00 91.74  ? 352  LEU A CB  1 
ATOM   2662  C  CG  . LEU A  1  352 ? 15.252   9.576    227.883 1.00 91.72  ? 352  LEU A CG  1 
ATOM   2663  C  CD1 . LEU A  1  352 ? 16.278   8.671    228.521 1.00 92.48  ? 352  LEU A CD1 1 
ATOM   2664  C  CD2 . LEU A  1  352 ? 14.320   10.134   228.943 1.00 92.36  ? 352  LEU A CD2 1 
ATOM   2665  N  N   . ALA A  1  353 ? 15.614   9.970    224.029 1.00 93.58  ? 353  ALA A N   1 
ATOM   2666  C  CA  . ALA A  1  353 ? 14.875   9.245    223.005 1.00 92.45  ? 353  ALA A CA  1 
ATOM   2667  C  C   . ALA A  1  353 ? 15.789   8.277    222.262 1.00 92.20  ? 353  ALA A C   1 
ATOM   2668  O  O   . ALA A  1  353 ? 15.430   7.120    222.038 1.00 91.68  ? 353  ALA A O   1 
ATOM   2669  C  CB  . ALA A  1  353 ? 14.230   10.217   222.035 1.00 91.92  ? 353  ALA A CB  1 
ATOM   2670  N  N   . ILE A  1  354 ? 16.969   8.753    221.878 1.00 88.33  ? 354  ILE A N   1 
ATOM   2671  C  CA  . ILE A  1  354 ? 17.936   7.913    221.181 1.00 88.28  ? 354  ILE A CA  1 
ATOM   2672  C  C   . ILE A  1  354 ? 18.507   6.858    222.117 1.00 88.86  ? 354  ILE A C   1 
ATOM   2673  O  O   . ILE A  1  354 ? 18.578   5.684    221.763 1.00 88.53  ? 354  ILE A O   1 
ATOM   2674  C  CB  . ILE A  1  354 ? 19.095   8.743    220.593 1.00 88.82  ? 354  ILE A CB  1 
ATOM   2675  C  CG1 . ILE A  1  354 ? 18.599   9.573    219.411 1.00 88.26  ? 354  ILE A CG1 1 
ATOM   2676  C  CG2 . ILE A  1  354 ? 20.257   7.837    220.156 1.00 89.10  ? 354  ILE A CG2 1 
ATOM   2677  C  CD1 . ILE A  1  354 ? 19.590   10.610   218.949 1.00 88.95  ? 354  ILE A CD1 1 
ATOM   2678  N  N   . ASN A  1  355 ? 18.908   7.280    223.311 1.00 89.83  ? 355  ASN A N   1 
ATOM   2679  C  CA  . ASN A  1  355 ? 19.580   6.382    224.242 1.00 90.63  ? 355  ASN A CA  1 
ATOM   2680  C  C   . ASN A  1  355 ? 18.688   5.221    224.654 1.00 90.25  ? 355  ASN A C   1 
ATOM   2681  O  O   . ASN A  1  355 ? 19.169   4.107    224.847 1.00 90.55  ? 355  ASN A O   1 
ATOM   2682  C  CB  . ASN A  1  355 ? 20.059   7.146    225.479 1.00 91.84  ? 355  ASN A CB  1 
ATOM   2683  C  CG  . ASN A  1  355 ? 21.028   8.262    225.136 1.00 92.40  ? 355  ASN A CG  1 
ATOM   2684  O  OD1 . ASN A  1  355 ? 21.572   8.309    224.031 1.00 92.05  ? 355  ASN A OD1 1 
ATOM   2685  N  ND2 . ASN A  1  355 ? 21.275   9.148    226.093 1.00 93.41  ? 355  ASN A ND2 1 
ATOM   2686  N  N   . LEU A  1  356 ? 17.392   5.477    224.795 1.00 89.69  ? 356  LEU A N   1 
ATOM   2687  C  CA  . LEU A  1  356 ? 16.445   4.405    225.080 1.00 89.33  ? 356  LEU A CA  1 
ATOM   2688  C  C   . LEU A  1  356 ? 16.319   3.447    223.902 1.00 88.43  ? 356  LEU A C   1 
ATOM   2689  O  O   . LEU A  1  356 ? 16.358   2.231    224.084 1.00 88.55  ? 356  LEU A O   1 
ATOM   2690  C  CB  . LEU A  1  356 ? 15.073   4.973    225.451 1.00 89.02  ? 356  LEU A CB  1 
ATOM   2691  C  CG  . LEU A  1  356 ? 14.631   4.724    226.896 1.00 89.87  ? 356  LEU A CG  1 
ATOM   2692  C  CD1 . LEU A  1  356 ? 15.681   5.138    227.901 1.00 91.15  ? 356  LEU A CD1 1 
ATOM   2693  C  CD2 . LEU A  1  356 ? 13.333   5.446    227.182 1.00 89.66  ? 356  LEU A CD2 1 
ATOM   2694  N  N   . ALA A  1  357 ? 16.161   3.995    222.701 1.00 87.66  ? 357  ALA A N   1 
ATOM   2695  C  CA  . ALA A  1  357 ? 16.019   3.182    221.495 1.00 86.89  ? 357  ALA A CA  1 
ATOM   2696  C  C   . ALA A  1  357 ? 17.158   2.173    221.341 1.00 87.34  ? 357  ALA A C   1 
ATOM   2697  O  O   . ALA A  1  357 ? 16.925   1.021    220.975 1.00 87.05  ? 357  ALA A O   1 
ATOM   2698  C  CB  . ALA A  1  357 ? 15.941   4.077    220.265 1.00 86.29  ? 357  ALA A CB  1 
ATOM   2699  N  N   . LEU A  1  358 ? 18.386   2.604    221.614 1.00 88.12  ? 358  LEU A N   1 
ATOM   2700  C  CA  . LEU A  1  358 ? 19.548   1.733    221.458 1.00 88.69  ? 358  LEU A CA  1 
ATOM   2701  C  C   . LEU A  1  358 ? 19.776   0.848    222.672 1.00 89.52  ? 358  LEU A C   1 
ATOM   2702  O  O   . LEU A  1  358 ? 20.040   -0.344   222.530 1.00 89.68  ? 358  LEU A O   1 
ATOM   2703  C  CB  . LEU A  1  358 ? 20.807   2.552    221.190 1.00 89.31  ? 358  LEU A CB  1 
ATOM   2704  C  CG  . LEU A  1  358 ? 21.068   2.890    219.725 1.00 88.79  ? 358  LEU A CG  1 
ATOM   2705  C  CD1 . LEU A  1  358 ? 21.571   1.672    218.971 1.00 88.78  ? 358  LEU A CD1 1 
ATOM   2706  C  CD2 . LEU A  1  358 ? 19.817   3.461    219.052 1.00 87.77  ? 358  LEU A CD2 1 
ATOM   2707  N  N   . LEU A  1  359 ? 19.687   1.431    223.861 1.00 90.16  ? 359  LEU A N   1 
ATOM   2708  C  CA  . LEU A  1  359 ? 19.855   0.662    225.086 1.00 91.11  ? 359  LEU A CA  1 
ATOM   2709  C  C   . LEU A  1  359 ? 18.802   -0.431   225.144 1.00 90.65  ? 359  LEU A C   1 
ATOM   2710  O  O   . LEU A  1  359 ? 19.073   -1.548   225.579 1.00 91.25  ? 359  LEU A O   1 
ATOM   2711  C  CB  . LEU A  1  359 ? 19.754   1.555    226.325 1.00 91.89  ? 359  LEU A CB  1 
ATOM   2712  C  CG  . LEU A  1  359 ? 19.862   0.806    227.658 1.00 93.03  ? 359  LEU A CG  1 
ATOM   2713  C  CD1 . LEU A  1  359 ? 21.205   0.099    227.780 1.00 93.98  ? 359  LEU A CD1 1 
ATOM   2714  C  CD2 . LEU A  1  359 ? 19.639   1.743    228.832 1.00 93.83  ? 359  LEU A CD2 1 
ATOM   2715  N  N   . GLY A  1  360 ? 17.596   -0.098   224.700 1.00 95.66  ? 360  GLY A N   1 
ATOM   2716  C  CA  . GLY A  1  360 ? 16.506   -1.053   224.686 1.00 95.22  ? 360  GLY A CA  1 
ATOM   2717  C  C   . GLY A  1  360 ? 16.733   -2.151   223.664 1.00 94.81  ? 360  GLY A C   1 
ATOM   2718  O  O   . GLY A  1  360 ? 16.556   -3.329   223.968 1.00 100.88 ? 360  GLY A O   1 
ATOM   2719  N  N   . SER A  1  361 ? 17.127   -1.771   222.452 1.00 88.21  ? 361  SER A N   1 
ATOM   2720  C  CA  . SER A  1  361 ? 17.432   -2.747   221.411 1.00 87.94  ? 361  SER A CA  1 
ATOM   2721  C  C   . SER A  1  361 ? 18.632   -3.603   221.804 1.00 88.96  ? 361  SER A C   1 
ATOM   2722  O  O   . SER A  1  361 ? 18.742   -4.758   221.395 1.00 89.06  ? 361  SER A O   1 
ATOM   2723  C  CB  . SER A  1  361 ? 17.699   -2.049   220.076 1.00 87.29  ? 361  SER A CB  1 
ATOM   2724  O  OG  . SER A  1  361 ? 16.500   -1.903   219.335 1.00 86.32  ? 361  SER A OG  1 
ATOM   2725  N  N   . LEU A  1  362 ? 19.527   -3.030   222.602 1.00 89.80  ? 362  LEU A N   1 
ATOM   2726  C  CA  . LEU A  1  362 ? 20.722   -3.737   223.043 1.00 90.92  ? 362  LEU A CA  1 
ATOM   2727  C  C   . LEU A  1  362 ? 20.371   -4.836   224.039 1.00 91.61  ? 362  LEU A C   1 
ATOM   2728  O  O   . LEU A  1  362 ? 20.852   -5.961   223.923 1.00 92.15  ? 362  LEU A O   1 
ATOM   2729  C  CB  . LEU A  1  362 ? 21.713   -2.758   223.669 1.00 91.74  ? 362  LEU A CB  1 
ATOM   2730  C  CG  . LEU A  1  362 ? 22.821   -3.347   224.540 1.00 93.15  ? 362  LEU A CG  1 
ATOM   2731  C  CD1 . LEU A  1  362 ? 23.679   -4.329   223.744 1.00 93.45  ? 362  LEU A CD1 1 
ATOM   2732  C  CD2 . LEU A  1  362 ? 23.649   -2.206   225.097 1.00 93.89  ? 362  LEU A CD2 1 
ATOM   2733  N  N   . THR A  1  363 ? 19.538   -4.504   225.020 1.00 91.70  ? 363  THR A N   1 
ATOM   2734  C  CA  . THR A  1  363 ? 19.144   -5.464   226.044 1.00 92.49  ? 363  THR A CA  1 
ATOM   2735  C  C   . THR A  1  363 ? 18.494   -6.683   225.397 1.00 92.04  ? 363  THR A C   1 
ATOM   2736  O  O   . THR A  1  363 ? 18.531   -7.783   225.948 1.00 92.86  ? 363  THR A O   1 
ATOM   2737  C  CB  . THR A  1  363 ? 18.176   -4.848   227.067 1.00 92.59  ? 363  THR A CB  1 
ATOM   2738  O  OG1 . THR A  1  363 ? 18.658   -3.562   227.475 1.00 92.86  ? 363  THR A OG1 1 
ATOM   2739  C  CG2 . THR A  1  363 ? 18.051   -5.747   228.290 1.00 93.81  ? 363  THR A CG2 1 
ATOM   2740  N  N   . ILE A  1  364 ? 17.909   -6.485   224.219 1.00 90.83  ? 364  ILE A N   1 
ATOM   2741  C  CA  . ILE A  1  364 ? 17.359   -7.593   223.450 1.00 90.42  ? 364  ILE A CA  1 
ATOM   2742  C  C   . ILE A  1  364 ? 18.494   -8.397   222.827 1.00 90.92  ? 364  ILE A C   1 
ATOM   2743  O  O   . ILE A  1  364 ? 18.438   -9.626   222.779 1.00 91.37  ? 364  ILE A O   1 
ATOM   2744  C  CB  . ILE A  1  364 ? 16.397   -7.107   222.348 1.00 89.09  ? 364  ILE A CB  1 
ATOM   2745  C  CG1 . ILE A  1  364 ? 15.173   -6.439   222.978 1.00 88.69  ? 364  ILE A CG1 1 
ATOM   2746  C  CG2 . ILE A  1  364 ? 15.944   -8.273   221.471 1.00 88.78  ? 364  ILE A CG2 1 
ATOM   2747  C  CD1 . ILE A  1  364 ? 14.321   -5.661   222.000 1.00 87.50  ? 364  ILE A CD1 1 
ATOM   2748  N  N   . ILE A  1  365 ? 19.521   -7.702   222.348 1.00 90.95  ? 365  ILE A N   1 
ATOM   2749  C  CA  . ILE A  1  365 ? 20.686   -8.369   221.781 1.00 91.57  ? 365  ILE A CA  1 
ATOM   2750  C  C   . ILE A  1  365 ? 21.364   -9.218   222.850 1.00 92.96  ? 365  ILE A C   1 
ATOM   2751  O  O   . ILE A  1  365 ? 21.908   -10.280  222.551 1.00 93.60  ? 365  ILE A O   1 
ATOM   2752  C  CB  . ILE A  1  365 ? 21.692   -7.360   221.181 1.00 91.50  ? 365  ILE A CB  1 
ATOM   2753  C  CG1 . ILE A  1  365 ? 21.080   -6.677   219.956 1.00 90.26  ? 365  ILE A CG1 1 
ATOM   2754  C  CG2 . ILE A  1  365 ? 22.984   -8.060   220.772 1.00 92.41  ? 365  ILE A CG2 1 
ATOM   2755  C  CD1 . ILE A  1  365 ? 21.821   -5.445   219.498 1.00 90.17  ? 365  ILE A CD1 1 
ATOM   2756  N  N   . VAL A  1  366 ? 21.323   -8.753   224.094 1.00 93.55  ? 366  VAL A N   1 
ATOM   2757  C  CA  . VAL A  1  366 ? 21.873   -9.517   225.207 1.00 95.00  ? 366  VAL A CA  1 
ATOM   2758  C  C   . VAL A  1  366 ? 21.152   -10.855  225.345 1.00 95.27  ? 366  VAL A C   1 
ATOM   2759  O  O   . VAL A  1  366 ? 21.789   -11.898  225.501 1.00 96.32  ? 366  VAL A O   1 
ATOM   2760  C  CB  . VAL A  1  366 ? 21.779   -8.730   226.537 1.00 95.61  ? 366  VAL A CB  1 
ATOM   2761  C  CG1 . VAL A  1  366 ? 22.009   -9.645   227.741 1.00 97.13  ? 366  VAL A CG1 1 
ATOM   2762  C  CG2 . VAL A  1  366 ? 22.777   -7.584   226.542 1.00 95.81  ? 366  VAL A CG2 1 
ATOM   2763  N  N   . ALA A  1  367 ? 19.825   -10.822  225.279 1.00 115.64 ? 367  ALA A N   1 
ATOM   2764  C  CA  . ALA A  1  367 ? 19.019   -12.026  225.457 1.00 115.93 ? 367  ALA A CA  1 
ATOM   2765  C  C   . ALA A  1  367 ? 19.298   -13.057  224.366 1.00 115.86 ? 367  ALA A C   1 
ATOM   2766  O  O   . ALA A  1  367 ? 19.579   -14.220  224.656 1.00 116.91 ? 367  ALA A O   1 
ATOM   2767  C  CB  . ALA A  1  367 ? 17.538   -11.672  225.475 1.00 114.96 ? 367  ALA A CB  1 
ATOM   2768  N  N   . GLN A  1  368 ? 19.228   -12.620  223.113 1.00 93.49  ? 368  GLN A N   1 
ATOM   2769  C  CA  . GLN A  1  368 ? 19.385   -13.516  221.972 1.00 93.37  ? 368  GLN A CA  1 
ATOM   2770  C  C   . GLN A  1  368 ? 20.808   -14.042  221.815 1.00 94.44  ? 368  GLN A C   1 
ATOM   2771  O  O   . GLN A  1  368 ? 21.040   -14.994  221.073 1.00 94.75  ? 368  GLN A O   1 
ATOM   2772  C  CB  . GLN A  1  368 ? 18.967   -12.802  220.689 1.00 92.01  ? 368  GLN A CB  1 
ATOM   2773  C  CG  . GLN A  1  368 ? 17.477   -12.531  220.595 1.00 91.01  ? 368  GLN A CG  1 
ATOM   2774  C  CD  . GLN A  1  368 ? 16.770   -13.476  219.644 1.00 90.68  ? 368  GLN A CD  1 
ATOM   2775  O  OE1 . GLN A  1  368 ? 15.939   -13.056  218.839 1.00 89.66  ? 368  GLN A OE1 1 
ATOM   2776  N  NE2 . GLN A  1  368 ? 17.092   -14.762  219.735 1.00 91.64  ? 368  GLN A NE2 1 
ATOM   2777  N  N   . HIS A  1  369 ? 21.755   -13.422  222.509 1.00 95.10  ? 369  HIS A N   1 
ATOM   2778  C  CA  . HIS A  1  369 ? 23.153   -13.835  222.440 1.00 96.24  ? 369  HIS A CA  1 
ATOM   2779  C  C   . HIS A  1  369 ? 23.546   -14.680  223.644 1.00 97.79  ? 369  HIS A C   1 
ATOM   2780  O  O   . HIS A  1  369 ? 24.388   -15.568  223.532 1.00 98.89  ? 369  HIS A O   1 
ATOM   2781  C  CB  . HIS A  1  369 ? 24.067   -12.616  222.318 1.00 96.12  ? 369  HIS A CB  1 
ATOM   2782  C  CG  . HIS A  1  369 ? 24.044   -11.985  220.961 1.00 95.00  ? 369  HIS A CG  1 
ATOM   2783  N  ND1 . HIS A  1  369 ? 25.049   -11.159  220.505 1.00 95.10  ? 369  HIS A ND1 1 
ATOM   2784  C  CD2 . HIS A  1  369 ? 23.147   -12.079  219.951 1.00 93.90  ? 369  HIS A CD2 1 
ATOM   2785  C  CE1 . HIS A  1  369 ? 24.765   -10.761  219.278 1.00 94.11  ? 369  HIS A CE1 1 
ATOM   2786  N  NE2 . HIS A  1  369 ? 23.616   -11.304  218.919 1.00 93.36  ? 369  HIS A NE2 1 
ATOM   2787  N  N   . MET A  1  370 ? 22.947   -14.401  224.796 1.00 113.84 ? 370  MET A N   1 
ATOM   2788  C  CA  . MET A  1  370 ? 23.293   -15.129  226.011 1.00 115.45 ? 370  MET A CA  1 
ATOM   2789  C  C   . MET A  1  370 ? 22.811   -16.585  226.004 1.00 116.10 ? 370  MET A C   1 
ATOM   2790  O  O   . MET A  1  370 ? 23.377   -17.422  226.708 1.00 117.65 ? 370  MET A O   1 
ATOM   2791  C  CB  . MET A  1  370 ? 22.743   -14.408  227.243 1.00 115.61 ? 370  MET A CB  1 
ATOM   2792  C  CG  . MET A  1  370 ? 23.643   -13.278  227.728 1.00 115.95 ? 370  MET A CG  1 
ATOM   2793  S  SD  . MET A  1  370 ? 23.330   -12.803  229.436 1.00 160.48 ? 370  MET A SD  1 
ATOM   2794  C  CE  . MET A  1  370 ? 24.028   -14.217  230.291 1.00 119.12 ? 370  MET A CE  1 
ATOM   2795  N  N   . TYR A  1  371 ? 21.777   -16.894  225.222 1.00 99.19  ? 371  TYR A N   1 
ATOM   2796  C  CA  . TYR A  1  371 ? 21.228   -18.252  225.209 1.00 99.83  ? 371  TYR A CA  1 
ATOM   2797  C  C   . TYR A  1  371 ? 21.970   -19.151  224.222 1.00 100.28 ? 371  TYR A C   1 
ATOM   2798  O  O   . TYR A  1  371 ? 22.192   -20.329  224.497 1.00 101.58 ? 371  TYR A O   1 
ATOM   2799  C  CB  . TYR A  1  371 ? 19.730   -18.233  224.872 1.00 98.66  ? 371  TYR A CB  1 
ATOM   2800  C  CG  . TYR A  1  371 ? 19.417   -18.330  223.393 1.00 97.50  ? 371  TYR A CG  1 
ATOM   2801  C  CD1 . TYR A  1  371 ? 19.273   -19.562  222.767 1.00 97.96  ? 371  TYR A CD1 1 
ATOM   2802  C  CD2 . TYR A  1  371 ? 19.264   -17.188  222.623 1.00 96.07  ? 371  TYR A CD2 1 
ATOM   2803  C  CE1 . TYR A  1  371 ? 18.990   -19.649  221.417 1.00 97.03  ? 371  TYR A CE1 1 
ATOM   2804  C  CE2 . TYR A  1  371 ? 18.979   -17.266  221.275 1.00 95.14  ? 371  TYR A CE2 1 
ATOM   2805  C  CZ  . TYR A  1  371 ? 18.845   -18.497  220.676 1.00 95.63  ? 371  TYR A CZ  1 
ATOM   2806  O  OH  . TYR A  1  371 ? 18.563   -18.573  219.331 1.00 94.83  ? 371  TYR A OH  1 
ATOM   2807  N  N   . ALA A  1  372 ? 22.357   -18.594  223.079 1.00 99.32  ? 372  ALA A N   1 
ATOM   2808  C  CA  . ALA A  1  372 ? 23.034   -19.362  222.038 1.00 99.73  ? 372  ALA A CA  1 
ATOM   2809  C  C   . ALA A  1  372 ? 24.507   -19.576  222.363 1.00 101.15 ? 372  ALA A C   1 
ATOM   2810  O  O   . ALA A  1  372 ? 25.122   -20.534  221.892 1.00 102.11 ? 372  ALA A O   1 
ATOM   2811  C  CB  . ALA A  1  372 ? 22.888   -18.668  220.700 1.00 98.31  ? 372  ALA A CB  1 
ATOM   2812  N  N   . MET A  1  373 ? 25.067   -18.678  223.167 1.00 101.38 ? 373  MET A N   1 
ATOM   2813  C  CA  . MET A  1  373 ? 26.470   -18.750  223.562 1.00 102.79 ? 373  MET A CA  1 
ATOM   2814  C  C   . MET A  1  373 ? 26.601   -18.584  225.072 1.00 103.83 ? 373  MET A C   1 
ATOM   2815  O  O   . MET A  1  373 ? 27.107   -17.563  225.539 1.00 103.81 ? 373  MET A O   1 
ATOM   2816  C  CB  . MET A  1  373 ? 27.287   -17.673  222.841 1.00 102.17 ? 373  MET A CB  1 
ATOM   2817  C  CG  . MET A  1  373 ? 27.185   -17.716  221.321 1.00 101.21 ? 373  MET A CG  1 
ATOM   2818  S  SD  . MET A  1  373 ? 27.685   -16.175  220.522 1.00 100.12 ? 373  MET A SD  1 
ATOM   2819  C  CE  . MET A  1  373 ? 26.368   -15.069  221.024 1.00 98.58  ? 373  MET A CE  1 
ATOM   2820  N  N   . PRO A  1  374 ? 26.142   -19.591  225.840 1.00 113.72 ? 374  PRO A N   1 
ATOM   2821  C  CA  . PRO A  1  374 ? 26.137   -19.508  227.306 1.00 114.83 ? 374  PRO A CA  1 
ATOM   2822  C  C   . PRO A  1  374 ? 27.513   -19.141  227.861 1.00 116.12 ? 374  PRO A C   1 
ATOM   2823  O  O   . PRO A  1  374 ? 28.446   -19.930  227.739 1.00 117.44 ? 374  PRO A O   1 
ATOM   2824  C  CB  . PRO A  1  374 ? 25.721   -20.917  227.744 1.00 116.07 ? 374  PRO A CB  1 
ATOM   2825  C  CG  . PRO A  1  374 ? 25.020   -21.493  226.575 1.00 115.06 ? 374  PRO A CG  1 
ATOM   2826  C  CD  . PRO A  1  374 ? 25.665   -20.900  225.365 1.00 114.08 ? 374  PRO A CD  1 
ATOM   2827  N  N   . PRO A  1  375 ? 27.646   -17.940  228.440 1.00 109.14 ? 375  PRO A N   1 
ATOM   2828  C  CA  . PRO A  1  375 ? 28.947   -17.464  228.917 1.00 110.31 ? 375  PRO A CA  1 
ATOM   2829  C  C   . PRO A  1  375 ? 29.305   -17.914  230.332 1.00 112.29 ? 375  PRO A C   1 
ATOM   2830  O  O   . PRO A  1  375 ? 30.394   -17.585  230.803 1.00 113.47 ? 375  PRO A O   1 
ATOM   2831  C  CB  . PRO A  1  375 ? 28.785   -15.952  228.869 1.00 109.04 ? 375  PRO A CB  1 
ATOM   2832  C  CG  . PRO A  1  375 ? 27.331   -15.740  229.155 1.00 107.94 ? 375  PRO A CG  1 
ATOM   2833  C  CD  . PRO A  1  375 ? 26.601   -16.912  228.583 1.00 107.66 ? 375  PRO A CD  1 
ATOM   2834  N  N   . TYR A  1  376 ? 28.411   -18.646  230.992 1.00 133.64 ? 376  TYR A N   1 
ATOM   2835  C  CA  . TYR A  1  376 ? 28.627   -19.053  232.379 1.00 135.59 ? 376  TYR A CA  1 
ATOM   2836  C  C   . TYR A  1  376 ? 28.592   -20.570  232.556 1.00 137.03 ? 376  TYR A C   1 
ATOM   2837  O  O   . TYR A  1  376 ? 27.965   -21.278  231.768 1.00 136.29 ? 376  TYR A O   1 
ATOM   2838  C  CB  . TYR A  1  376 ? 27.585   -18.412  233.296 1.00 135.21 ? 376  TYR A CB  1 
ATOM   2839  C  CG  . TYR A  1  376 ? 27.679   -16.907  233.379 1.00 134.23 ? 376  TYR A CG  1 
ATOM   2840  C  CD1 . TYR A  1  376 ? 28.808   -16.291  233.903 1.00 135.30 ? 376  TYR A CD1 1 
ATOM   2841  C  CD2 . TYR A  1  376 ? 26.634   -16.102  232.949 1.00 137.62 ? 376  TYR A CD2 1 
ATOM   2842  C  CE1 . TYR A  1  376 ? 28.897   -14.915  233.985 1.00 134.52 ? 376  TYR A CE1 1 
ATOM   2843  C  CE2 . TYR A  1  376 ? 26.715   -14.726  233.027 1.00 139.97 ? 376  TYR A CE2 1 
ATOM   2844  C  CZ  . TYR A  1  376 ? 27.846   -14.138  233.548 1.00 135.02 ? 376  TYR A CZ  1 
ATOM   2845  O  OH  . TYR A  1  376 ? 27.923   -12.767  233.627 1.00 131.95 ? 376  TYR A OH  1 
ATOM   2846  N  N   . PRO A  1  377 ? 29.278   -21.073  233.597 1.00 141.01 ? 377  PRO A N   1 
ATOM   2847  C  CA  . PRO A  1  377 ? 29.303   -22.508  233.895 1.00 142.70 ? 377  PRO A CA  1 
ATOM   2848  C  C   . PRO A  1  377 ? 27.951   -23.076  234.316 1.00 142.59 ? 377  PRO A C   1 
ATOM   2849  O  O   . PRO A  1  377 ? 27.270   -22.508  235.170 1.00 144.90 ? 377  PRO A O   1 
ATOM   2850  C  CB  . PRO A  1  377 ? 30.316   -22.609  235.047 1.00 145.04 ? 377  PRO A CB  1 
ATOM   2851  C  CG  . PRO A  1  377 ? 30.376   -21.250  235.635 1.00 144.54 ? 377  PRO A CG  1 
ATOM   2852  C  CD  . PRO A  1  377 ? 30.177   -20.321  234.488 1.00 142.17 ? 377  PRO A CD  1 
ATOM   2853  N  N   . TYR A  1  378 ? 27.582   -24.197  233.703 1.00 117.77 ? 378  TYR A N   1 
ATOM   2854  C  CA  . TYR A  1  378 ? 26.368   -24.928  234.052 1.00 117.96 ? 378  TYR A CA  1 
ATOM   2855  C  C   . TYR A  1  378 ? 25.105   -24.085  233.879 1.00 115.94 ? 378  TYR A C   1 
ATOM   2856  O  O   . TYR A  1  378 ? 24.058   -24.411  234.435 1.00 116.18 ? 378  TYR A O   1 
ATOM   2857  C  CB  . TYR A  1  378 ? 26.450   -25.442  235.493 1.00 120.30 ? 378  TYR A CB  1 
ATOM   2858  C  CG  . TYR A  1  378 ? 27.658   -26.308  235.782 1.00 122.55 ? 378  TYR A CG  1 
ATOM   2859  C  CD1 . TYR A  1  378 ? 27.645   -27.669  235.502 1.00 123.71 ? 378  TYR A CD1 1 
ATOM   2860  C  CD2 . TYR A  1  378 ? 28.807   -25.767  236.342 1.00 123.62 ? 378  TYR A CD2 1 
ATOM   2861  C  CE1 . TYR A  1  378 ? 28.744   -28.466  235.769 1.00 125.88 ? 378  TYR A CE1 1 
ATOM   2862  C  CE2 . TYR A  1  378 ? 29.911   -26.555  236.612 1.00 125.78 ? 378  TYR A CE2 1 
ATOM   2863  C  CZ  . TYR A  1  378 ? 29.874   -27.903  236.323 1.00 126.90 ? 378  TYR A CZ  1 
ATOM   2864  O  OH  . TYR A  1  378 ? 30.970   -28.691  236.590 1.00 129.15 ? 378  TYR A OH  1 
ATOM   2865  N  N   . GLN A  1  379 ? 25.203   -23.008  233.106 1.00 136.20 ? 379  GLN A N   1 
ATOM   2866  C  CA  . GLN A  1  379 ? 24.036   -22.189  232.796 1.00 134.24 ? 379  GLN A CA  1 
ATOM   2867  C  C   . GLN A  1  379 ? 23.139   -22.920  231.813 1.00 133.24 ? 379  GLN A C   1 
ATOM   2868  O  O   . GLN A  1  379 ? 21.926   -23.007  232.002 1.00 132.73 ? 379  GLN A O   1 
ATOM   2869  C  CB  . GLN A  1  379 ? 24.450   -20.835  232.216 1.00 132.67 ? 379  GLN A CB  1 
ATOM   2870  C  CG  . GLN A  1  379 ? 23.275   -19.916  231.898 1.00 130.72 ? 379  GLN A CG  1 
ATOM   2871  C  CD  . GLN A  1  379 ? 23.679   -18.721  231.063 1.00 135.69 ? 379  GLN A CD  1 
ATOM   2872  O  OE1 . GLN A  1  379 ? 24.806   -18.236  231.158 1.00 151.78 ? 379  GLN A OE1 1 
ATOM   2873  N  NE2 . GLN A  1  379 ? 22.763   -18.249  230.227 1.00 129.92 ? 379  GLN A NE2 1 
ATOM   2874  N  N   . ALA A  1  380 ? 23.755   -23.437  230.757 1.00 110.92 ? 380  ALA A N   1 
ATOM   2875  C  CA  . ALA A  1  380 ? 23.034   -24.109  229.687 1.00 110.02 ? 380  ALA A CA  1 
ATOM   2876  C  C   . ALA A  1  380 ? 22.233   -25.302  230.206 1.00 111.21 ? 380  ALA A C   1 
ATOM   2877  O  O   . ALA A  1  380 ? 21.202   -25.663  229.636 1.00 110.36 ? 380  ALA A O   1 
ATOM   2878  C  CB  . ALA A  1  380 ? 24.004   -24.549  228.617 1.00 110.11 ? 380  ALA A CB  1 
ATOM   2879  N  N   . ILE A  1  381 ? 22.715   -25.915  231.283 1.00 130.59 ? 381  ILE A N   1 
ATOM   2880  C  CA  . ILE A  1  381 ? 22.005   -27.019  231.922 1.00 132.01 ? 381  ILE A CA  1 
ATOM   2881  C  C   . ILE A  1  381 ? 20.690   -26.545  232.528 1.00 131.34 ? 381  ILE A C   1 
ATOM   2882  O  O   . ILE A  1  381 ? 19.645   -27.163  232.327 1.00 131.19 ? 381  ILE A O   1 
ATOM   2883  C  CB  . ILE A  1  381 ? 22.877   -27.684  233.017 1.00 134.54 ? 381  ILE A CB  1 
ATOM   2884  C  CG1 . ILE A  1  381 ? 23.793   -28.734  232.378 1.00 135.66 ? 381  ILE A CG1 1 
ATOM   2885  C  CG2 . ILE A  1  381 ? 22.010   -28.297  234.136 1.00 135.99 ? 381  ILE A CG2 1 
ATOM   2886  C  CD1 . ILE A  1  381 ? 24.673   -29.490  233.357 1.00 138.29 ? 381  ILE A CD1 1 
ATOM   2887  N  N   . ASP A  1  382 ? 20.747   -25.441  233.267 1.00 142.34 ? 382  ASP A N   1 
ATOM   2888  C  CA  . ASP A  1  382 ? 19.569   -24.913  233.941 1.00 141.89 ? 382  ASP A CA  1 
ATOM   2889  C  C   . ASP A  1  382 ? 18.637   -24.268  232.923 1.00 139.55 ? 382  ASP A C   1 
ATOM   2890  O  O   . ASP A  1  382 ? 18.817   -23.110  232.544 1.00 138.08 ? 382  ASP A O   1 
ATOM   2891  C  CB  . ASP A  1  382 ? 19.972   -23.904  235.019 1.00 142.39 ? 382  ASP A CB  1 
ATOM   2892  C  CG  . ASP A  1  382 ? 18.833   -23.565  235.961 1.00 142.61 ? 382  ASP A CG  1 
ATOM   2893  O  OD1 . ASP A  1  382 ? 17.661   -23.777  235.588 1.00 141.74 ? 382  ASP A OD1 1 
ATOM   2894  O  OD2 . ASP A  1  382 ? 19.111   -23.082  237.079 1.00 143.73 ? 382  ASP A OD2 1 
ATOM   2895  N  N   . TYR A  1  383 ? 17.639   -25.027  232.483 1.00 121.09 ? 383  TYR A N   1 
ATOM   2896  C  CA  . TYR A  1  383 ? 16.705   -24.545  231.476 1.00 119.04 ? 383  TYR A CA  1 
ATOM   2897  C  C   . TYR A  1  383 ? 15.807   -23.458  232.047 1.00 118.17 ? 383  TYR A C   1 
ATOM   2898  O  O   . TYR A  1  383 ? 15.251   -22.650  231.305 1.00 116.36 ? 383  TYR A O   1 
ATOM   2899  C  CB  . TYR A  1  383 ? 15.861   -25.699  230.931 1.00 119.26 ? 383  TYR A CB  1 
ATOM   2900  C  CG  . TYR A  1  383 ? 16.669   -26.809  230.290 1.00 120.16 ? 383  TYR A CG  1 
ATOM   2901  C  CD1 . TYR A  1  383 ? 17.943   -26.572  229.787 1.00 120.02 ? 383  TYR A CD1 1 
ATOM   2902  C  CD2 . TYR A  1  383 ? 16.154   -28.093  230.184 1.00 121.24 ? 383  TYR A CD2 1 
ATOM   2903  C  CE1 . TYR A  1  383 ? 18.680   -27.583  229.202 1.00 120.94 ? 383  TYR A CE1 1 
ATOM   2904  C  CE2 . TYR A  1  383 ? 16.884   -29.110  229.600 1.00 122.16 ? 383  TYR A CE2 1 
ATOM   2905  C  CZ  . TYR A  1  383 ? 18.146   -28.850  229.110 1.00 122.01 ? 383  TYR A CZ  1 
ATOM   2906  O  OH  . TYR A  1  383 ? 18.876   -29.859  228.527 1.00 126.31 ? 383  TYR A OH  1 
ATOM   2907  N  N   . ALA A  1  384 ? 15.666   -23.439  233.369 1.00 109.19 ? 384  ALA A N   1 
ATOM   2908  C  CA  . ALA A  1  384 ? 14.888   -22.401  234.029 1.00 108.64 ? 384  ALA A CA  1 
ATOM   2909  C  C   . ALA A  1  384 ? 15.623   -21.069  233.970 1.00 107.66 ? 384  ALA A C   1 
ATOM   2910  O  O   . ALA A  1  384 ? 15.038   -20.047  233.616 1.00 106.11 ? 384  ALA A O   1 
ATOM   2911  C  CB  . ALA A  1  384 ? 14.592   -22.788  235.470 1.00 110.65 ? 384  ALA A CB  1 
ATOM   2912  N  N   . THR A  1  385 ? 16.907   -21.084  234.312 1.00 108.66 ? 385  THR A N   1 
ATOM   2913  C  CA  . THR A  1  385 ? 17.721   -19.876  234.257 1.00 107.94 ? 385  THR A CA  1 
ATOM   2914  C  C   . THR A  1  385 ? 17.877   -19.383  232.820 1.00 105.95 ? 385  THR A C   1 
ATOM   2915  O  O   . THR A  1  385 ? 17.873   -18.180  232.570 1.00 104.70 ? 385  THR A O   1 
ATOM   2916  C  CB  . THR A  1  385 ? 19.113   -20.108  234.877 1.00 109.60 ? 385  THR A CB  1 
ATOM   2917  O  OG1 . THR A  1  385 ? 18.969   -20.448  236.262 1.00 111.54 ? 385  THR A OG1 1 
ATOM   2918  C  CG2 . THR A  1  385 ? 19.982   -18.859  234.752 1.00 108.89 ? 385  THR A CG2 1 
ATOM   2919  N  N   . GLN A  1  386 ? 18.008   -20.314  231.880 1.00 105.77 ? 386  GLN A N   1 
ATOM   2920  C  CA  . GLN A  1  386 ? 18.131   -19.960  230.468 1.00 104.06 ? 386  GLN A CA  1 
ATOM   2921  C  C   . GLN A  1  386 ? 16.863   -19.285  229.966 1.00 102.37 ? 386  GLN A C   1 
ATOM   2922  O  O   . GLN A  1  386 ? 16.920   -18.325  229.198 1.00 100.89 ? 386  GLN A O   1 
ATOM   2923  C  CB  . GLN A  1  386 ? 18.434   -21.198  229.620 1.00 104.44 ? 386  GLN A CB  1 
ATOM   2924  C  CG  . GLN A  1  386 ? 19.915   -21.459  229.393 1.00 105.28 ? 386  GLN A CG  1 
ATOM   2925  C  CD  . GLN A  1  386 ? 20.513   -20.530  228.350 1.00 103.85 ? 386  GLN A CD  1 
ATOM   2926  O  OE1 . GLN A  1  386 ? 20.408   -19.309  228.452 1.00 102.86 ? 386  GLN A OE1 1 
ATOM   2927  N  NE2 . GLN A  1  386 ? 21.134   -21.111  227.329 1.00 103.82 ? 386  GLN A NE2 1 
ATOM   2928  N  N   . LEU A  1  387 ? 15.719   -19.797  230.404 1.00 104.36 ? 387  LEU A N   1 
ATOM   2929  C  CA  . LEU A  1  387 ? 14.436   -19.227  230.026 1.00 102.97 ? 387  LEU A CA  1 
ATOM   2930  C  C   . LEU A  1  387 ? 14.194   -17.931  230.794 1.00 102.62 ? 387  LEU A C   1 
ATOM   2931  O  O   . LEU A  1  387 ? 13.564   -17.005  230.285 1.00 101.18 ? 387  LEU A O   1 
ATOM   2932  C  CB  . LEU A  1  387 ? 13.310   -20.227  230.294 1.00 103.63 ? 387  LEU A CB  1 
ATOM   2933  C  CG  . LEU A  1  387 ? 11.888   -19.772  229.963 1.00 102.42 ? 387  LEU A CG  1 
ATOM   2934  C  CD1 . LEU A  1  387 ? 11.692   -19.674  228.457 1.00 100.83 ? 387  LEU A CD1 1 
ATOM   2935  C  CD2 . LEU A  1  387 ? 10.875   -20.720  230.581 1.00 103.55 ? 387  LEU A CD2 1 
ATOM   2936  N  N   . SER A  1  388 ? 14.704   -17.870  232.020 1.00 102.42 ? 388  SER A N   1 
ATOM   2937  C  CA  . SER A  1  388 ? 14.443   -16.738  232.903 1.00 102.44 ? 388  SER A CA  1 
ATOM   2938  C  C   . SER A  1  388 ? 15.281   -15.510  232.543 1.00 101.52 ? 388  SER A C   1 
ATOM   2939  O  O   . SER A  1  388 ? 14.782   -14.386  232.574 1.00 100.60 ? 388  SER A O   1 
ATOM   2940  C  CB  . SER A  1  388 ? 14.704   -17.138  234.356 1.00 104.51 ? 388  SER A CB  1 
ATOM   2941  O  OG  . SER A  1  388 ? 13.814   -18.160  234.768 1.00 105.45 ? 388  SER A OG  1 
ATOM   2942  N  N   . LEU A  1  389 ? 16.548   -15.721  232.199 1.00 101.85 ? 389  LEU A N   1 
ATOM   2943  C  CA  . LEU A  1  389 ? 17.424   -14.613  231.829 1.00 101.13 ? 389  LEU A CA  1 
ATOM   2944  C  C   . LEU A  1  389 ? 17.083   -14.095  230.441 1.00 99.22  ? 389  LEU A C   1 
ATOM   2945  O  O   . LEU A  1  389 ? 17.277   -12.917  230.148 1.00 98.31  ? 389  LEU A O   1 
ATOM   2946  C  CB  . LEU A  1  389 ? 18.896   -15.035  231.872 1.00 102.21 ? 389  LEU A CB  1 
ATOM   2947  C  CG  . LEU A  1  389 ? 19.627   -14.966  233.215 1.00 104.03 ? 389  LEU A CG  1 
ATOM   2948  C  CD1 . LEU A  1  389 ? 21.023   -15.547  233.071 1.00 105.07 ? 389  LEU A CD1 1 
ATOM   2949  C  CD2 . LEU A  1  389 ? 19.706   -13.534  233.731 1.00 103.74 ? 389  LEU A CD2 1 
ATOM   2950  N  N   . PHE A  1  390 ? 16.571   -14.975  229.587 1.00 98.70  ? 390  PHE A N   1 
ATOM   2951  C  CA  . PHE A  1  390 ? 16.247   -14.589  228.222 1.00 97.04  ? 390  PHE A CA  1 
ATOM   2952  C  C   . PHE A  1  390 ? 15.002   -13.709  228.179 1.00 95.91  ? 390  PHE A C   1 
ATOM   2953  O  O   . PHE A  1  390 ? 15.049   -12.586  227.678 1.00 94.84  ? 390  PHE A O   1 
ATOM   2954  C  CB  . PHE A  1  390 ? 16.038   -15.821  227.340 1.00 96.98  ? 390  PHE A CB  1 
ATOM   2955  C  CG  . PHE A  1  390 ? 15.521   -15.493  225.968 1.00 95.40  ? 390  PHE A CG  1 
ATOM   2956  C  CD1 . PHE A  1  390 ? 16.397   -15.193  224.940 1.00 94.81  ? 390  PHE A CD1 1 
ATOM   2957  C  CD2 . PHE A  1  390 ? 14.160   -15.475  225.709 1.00 94.60  ? 390  PHE A CD2 1 
ATOM   2958  C  CE1 . PHE A  1  390 ? 15.928   -14.883  223.678 1.00 93.49  ? 390  PHE A CE1 1 
ATOM   2959  C  CE2 . PHE A  1  390 ? 13.684   -15.165  224.450 1.00 93.26  ? 390  PHE A CE2 1 
ATOM   2960  C  CZ  . PHE A  1  390 ? 14.569   -14.870  223.432 1.00 92.72  ? 390  PHE A CZ  1 
ATOM   2961  N  N   . THR A  1  391 ? 13.891   -14.216  228.704 1.00 96.24  ? 391  THR A N   1 
ATOM   2962  C  CA  . THR A  1  391 ? 12.634   -13.481  228.641 1.00 95.28  ? 391  THR A CA  1 
ATOM   2963  C  C   . THR A  1  391 ? 12.693   -12.226  229.508 1.00 95.39  ? 391  THR A C   1 
ATOM   2964  O  O   . THR A  1  391 ? 11.979   -11.255  229.254 1.00 94.39  ? 391  THR A O   1 
ATOM   2965  C  CB  . THR A  1  391 ? 11.444   -14.340  229.094 1.00 95.83  ? 391  THR A CB  1 
ATOM   2966  O  OG1 . THR A  1  391 ? 11.587   -14.663  230.479 1.00 97.43  ? 391  THR A OG1 1 
ATOM   2967  C  CG2 . THR A  1  391 ? 11.362   -15.624  228.287 1.00 95.89  ? 391  THR A CG2 1 
ATOM   2968  N  N   . HIS A  1  392 ? 13.543   -12.251  230.531 1.00 96.70  ? 392  HIS A N   1 
ATOM   2969  C  CA  . HIS A  1  392 ? 13.756   -11.075  231.369 1.00 97.00  ? 392  HIS A CA  1 
ATOM   2970  C  C   . HIS A  1  392 ? 14.318   -9.919   230.560 1.00 95.83  ? 392  HIS A C   1 
ATOM   2971  O  O   . HIS A  1  392 ? 13.690   -8.866   230.444 1.00 95.00  ? 392  HIS A O   1 
ATOM   2972  C  CB  . HIS A  1  392 ? 14.703   -11.389  232.526 1.00 98.76  ? 392  HIS A CB  1 
ATOM   2973  C  CG  . HIS A  1  392 ? 15.256   -10.167  233.192 1.00 99.10  ? 392  HIS A CG  1 
ATOM   2974  N  ND1 . HIS A  1  392 ? 14.520   -9.401   234.068 1.00 99.42  ? 392  HIS A ND1 1 
ATOM   2975  C  CD2 . HIS A  1  392 ? 16.469   -9.574   233.102 1.00 99.24  ? 392  HIS A CD2 1 
ATOM   2976  C  CE1 . HIS A  1  392 ? 15.256   -8.391   234.494 1.00 99.76  ? 392  HIS A CE1 1 
ATOM   2977  N  NE2 . HIS A  1  392 ? 16.444   -8.472   233.923 1.00 99.66  ? 392  HIS A NE2 1 
ATOM   2978  N  N   . HIS A  1  393 ? 15.509   -10.120  230.005 1.00 95.88  ? 393  HIS A N   1 
ATOM   2979  C  CA  . HIS A  1  393 ? 16.169   -9.086   229.224 1.00 94.97  ? 393  HIS A CA  1 
ATOM   2980  C  C   . HIS A  1  393 ? 15.351   -8.729   227.991 1.00 93.35  ? 393  HIS A C   1 
ATOM   2981  O  O   . HIS A  1  393 ? 15.508   -7.646   227.429 1.00 98.17  ? 393  HIS A O   1 
ATOM   2982  C  CB  . HIS A  1  393 ? 17.580   -9.525   228.837 1.00 95.49  ? 393  HIS A CB  1 
ATOM   2983  C  CG  . HIS A  1  393 ? 18.549   -9.473   229.976 1.00 97.02  ? 393  HIS A CG  1 
ATOM   2984  N  ND1 . HIS A  1  393 ? 19.490   -10.454  230.206 1.00 98.22  ? 393  HIS A ND1 1 
ATOM   2985  C  CD2 . HIS A  1  393 ? 18.714   -8.556   230.958 1.00 97.66  ? 393  HIS A CD2 1 
ATOM   2986  C  CE1 . HIS A  1  393 ? 20.196   -10.140  231.278 1.00 99.52  ? 393  HIS A CE1 1 
ATOM   2987  N  NE2 . HIS A  1  393 ? 19.742   -8.995   231.754 1.00 99.22  ? 393  HIS A NE2 1 
ATOM   2988  N  N   . MET A  1  394 ? 14.484   -9.639   227.566 1.00 93.02  ? 394  MET A N   1 
ATOM   2989  C  CA  . MET A  1  394 ? 13.563   -9.335   226.481 1.00 91.63  ? 394  MET A CA  1 
ATOM   2990  C  C   . MET A  1  394 ? 12.610   -8.214   226.886 1.00 91.14  ? 394  MET A C   1 
ATOM   2991  O  O   . MET A  1  394 ? 12.476   -7.223   226.169 1.00 90.15  ? 394  MET A O   1 
ATOM   2992  C  CB  . MET A  1  394 ? 12.775   -10.578  226.064 1.00 91.57  ? 394  MET A CB  1 
ATOM   2993  C  CG  . MET A  1  394 ? 13.379   -11.281  224.868 1.00 91.23  ? 394  MET A CG  1 
ATOM   2994  S  SD  . MET A  1  394 ? 13.192   -10.275  223.382 1.00 89.64  ? 394  MET A SD  1 
ATOM   2995  C  CE  . MET A  1  394 ? 14.039   -11.286  222.175 1.00 89.68  ? 394  MET A CE  1 
ATOM   2996  N  N   . TRP A  1  395 ? 11.958   -8.362   228.037 1.00 92.56  ? 395  TRP A N   1 
ATOM   2997  C  CA  . TRP A  1  395 ? 10.991   -7.363   228.481 1.00 92.26  ? 395  TRP A CA  1 
ATOM   2998  C  C   . TRP A  1  395 ? 11.630   -6.007   228.729 1.00 92.21  ? 395  TRP A C   1 
ATOM   2999  O  O   . TRP A  1  395 ? 11.116   -4.986   228.276 1.00 91.35  ? 395  TRP A O   1 
ATOM   3000  C  CB  . TRP A  1  395 ? 10.286   -7.806   229.759 1.00 93.41  ? 395  TRP A CB  1 
ATOM   3001  C  CG  . TRP A  1  395 ? 9.244    -8.838   229.543 1.00 93.36  ? 395  TRP A CG  1 
ATOM   3002  C  CD1 . TRP A  1  395 ? 9.192    -10.067  230.110 1.00 94.45  ? 395  TRP A CD1 1 
ATOM   3003  C  CD2 . TRP A  1  395 ? 8.106    -8.743   228.680 1.00 92.27  ? 395  TRP A CD2 1 
ATOM   3004  N  NE1 . TRP A  1  395 ? 8.084    -10.749  229.670 1.00 94.11  ? 395  TRP A NE1 1 
ATOM   3005  C  CE2 . TRP A  1  395 ? 7.401    -9.957   228.787 1.00 92.77  ? 395  TRP A CE2 1 
ATOM   3006  C  CE3 . TRP A  1  395 ? 7.613    -7.749   227.831 1.00 91.02  ? 395  TRP A CE3 1 
ATOM   3007  C  CZ2 . TRP A  1  395 ? 6.228    -10.204  228.078 1.00 92.05  ? 395  TRP A CZ2 1 
ATOM   3008  C  CZ3 . TRP A  1  395 ? 6.451    -7.995   227.129 1.00 90.32  ? 395  TRP A CZ3 1 
ATOM   3009  C  CH2 . TRP A  1  395 ? 5.770    -9.213   227.256 1.00 90.82  ? 395  TRP A CH2 1 
ATOM   3010  N  N   . ILE A  1  396 ? 12.740   -6.000   229.460 1.00 92.64  ? 396  ILE A N   1 
ATOM   3011  C  CA  . ILE A  1  396 ? 13.438   -4.759   229.768 1.00 92.81  ? 396  ILE A CA  1 
ATOM   3012  C  C   . ILE A  1  396 ? 13.770   -4.031   228.479 1.00 91.57  ? 396  ILE A C   1 
ATOM   3013  O  O   . ILE A  1  396 ? 13.471   -2.848   228.333 1.00 91.07  ? 396  ILE A O   1 
ATOM   3014  C  CB  . ILE A  1  396 ? 14.727   -5.009   230.577 1.00 94.15  ? 396  ILE A CB  1 
ATOM   3015  C  CG1 . ILE A  1  396 ? 14.406   -5.712   231.902 1.00 95.57  ? 396  ILE A CG1 1 
ATOM   3016  C  CG2 . ILE A  1  396 ? 15.461   -3.698   230.841 1.00 94.36  ? 396  ILE A CG2 1 
ATOM   3017  C  CD1 . ILE A  1  396 ? 13.329   -5.027   232.739 1.00 95.83  ? 396  ILE A CD1 1 
ATOM   3018  N  N   . GLY A  1  397 ? 14.389   -4.744   227.547 1.00 94.27  ? 397  GLY A N   1 
ATOM   3019  C  CA  . GLY A  1  397 ? 14.677   -4.186   226.242 1.00 93.20  ? 397  GLY A CA  1 
ATOM   3020  C  C   . GLY A  1  397 ? 13.398   -3.724   225.572 1.00 92.08  ? 397  GLY A C   1 
ATOM   3021  O  O   . GLY A  1  397 ? 13.397   -2.752   224.818 1.00 91.33  ? 397  GLY A O   1 
ATOM   3022  N  N   . GLY A  1  398 ? 12.303   -4.421   225.860 1.00 89.00  ? 398  GLY A N   1 
ATOM   3023  C  CA  . GLY A  1  398 ? 11.013   -4.096   225.279 1.00 88.07  ? 398  GLY A CA  1 
ATOM   3024  C  C   . GLY A  1  398 ? 10.413   -2.820   225.836 1.00 88.04  ? 398  GLY A C   1 
ATOM   3025  O  O   . GLY A  1  398 ? 9.907    -1.991   225.084 1.00 87.20  ? 398  GLY A O   1 
ATOM   3026  N  N   . PHE A  1  399 ? 10.462   -2.654   227.153 1.00 89.06  ? 399  PHE A N   1 
ATOM   3027  C  CA  . PHE A  1  399 ? 9.927    -1.447   227.770 1.00 89.22  ? 399  PHE A CA  1 
ATOM   3028  C  C   . PHE A  1  399 ? 10.733   -0.224   227.363 1.00 88.95  ? 399  PHE A C   1 
ATOM   3029  O  O   . PHE A  1  399 ? 10.169   0.832    227.089 1.00 88.48  ? 399  PHE A O   1 
ATOM   3030  C  CB  . PHE A  1  399 ? 9.898    -1.579   229.294 1.00 90.57  ? 399  PHE A CB  1 
ATOM   3031  C  CG  . PHE A  1  399 ? 8.622    -2.167   229.818 1.00 90.86  ? 399  PHE A CG  1 
ATOM   3032  C  CD1 . PHE A  1  399 ? 8.452    -3.537   229.895 1.00 91.18  ? 399  PHE A CD1 1 
ATOM   3033  C  CD2 . PHE A  1  399 ? 7.583    -1.345   230.220 1.00 90.90  ? 399  PHE A CD2 1 
ATOM   3034  C  CE1 . PHE A  1  399 ? 7.273    -4.079   230.371 1.00 91.55  ? 399  PHE A CE1 1 
ATOM   3035  C  CE2 . PHE A  1  399 ? 6.401    -1.878   230.697 1.00 91.26  ? 399  PHE A CE2 1 
ATOM   3036  C  CZ  . PHE A  1  399 ? 6.244    -3.247   230.772 1.00 91.59  ? 399  PHE A CZ  1 
ATOM   3037  N  N   . LEU A  1  400 ? 12.048   -0.378   227.278 1.00 89.30  ? 400  LEU A N   1 
ATOM   3038  C  CA  . LEU A  1  400 ? 12.919   0.751    226.980 1.00 89.26  ? 400  LEU A CA  1 
ATOM   3039  C  C   . LEU A  1  400 ? 12.647   1.323    225.592 1.00 88.08  ? 400  LEU A C   1 
ATOM   3040  O  O   . LEU A  1  400 ? 12.576   2.540    225.425 1.00 87.91  ? 400  LEU A O   1 
ATOM   3041  C  CB  . LEU A  1  400 ? 14.387   0.338    227.109 1.00 89.95  ? 400  LEU A CB  1 
ATOM   3042  C  CG  . LEU A  1  400 ? 14.843   0.042    228.541 1.00 91.35  ? 400  LEU A CG  1 
ATOM   3043  C  CD1 . LEU A  1  400 ? 16.213   -0.615   228.550 1.00 92.03  ? 400  LEU A CD1 1 
ATOM   3044  C  CD2 . LEU A  1  400 ? 14.851   1.309    229.386 1.00 92.00  ? 400  LEU A CD2 1 
ATOM   3045  N  N   . ILE A  1  401 ? 12.487   0.454    224.600 1.00 87.37  ? 401  ILE A N   1 
ATOM   3046  C  CA  . ILE A  1  401 ? 12.247   0.910    223.232 1.00 86.37  ? 401  ILE A CA  1 
ATOM   3047  C  C   . ILE A  1  401 ? 10.830   1.459    223.040 1.00 85.77  ? 401  ILE A C   1 
ATOM   3048  O  O   . ILE A  1  401 ? 10.490   1.922    221.952 1.00 85.03  ? 401  ILE A O   1 
ATOM   3049  C  CB  . ILE A  1  401 ? 12.506   -0.212   222.194 1.00 85.91  ? 401  ILE A CB  1 
ATOM   3050  C  CG1 . ILE A  1  401 ? 11.649   -1.449   222.500 1.00 85.93  ? 401  ILE A CG1 1 
ATOM   3051  C  CG2 . ILE A  1  401 ? 13.992   -0.543   222.141 1.00 86.47  ? 401  ILE A CG2 1 
ATOM   3052  C  CD1 . ILE A  1  401 ? 12.102   -2.710   221.791 1.00 85.86  ? 401  ILE A CD1 1 
ATOM   3053  N  N   . VAL A  1  402 ? 10.010   1.409    224.087 1.00 86.21  ? 402  VAL A N   1 
ATOM   3054  C  CA  . VAL A  1  402 ? 8.703    2.067    224.065 1.00 85.86  ? 402  VAL A CA  1 
ATOM   3055  C  C   . VAL A  1  402 ? 8.849    3.490    224.577 1.00 86.26  ? 402  VAL A C   1 
ATOM   3056  O  O   . VAL A  1  402 ? 8.258    4.417    224.025 1.00 85.82  ? 402  VAL A O   1 
ATOM   3057  C  CB  . VAL A  1  402 ? 7.655    1.312    224.911 1.00 86.24  ? 402  VAL A CB  1 
ATOM   3058  C  CG1 . VAL A  1  402 ? 6.441    2.196    225.211 1.00 86.22  ? 402  VAL A CG1 1 
ATOM   3059  C  CG2 . VAL A  1  402 ? 7.229    0.051    224.196 1.00 85.73  ? 402  VAL A CG2 1 
ATOM   3060  N  N   . GLY A  1  403 ? 9.644    3.661    225.627 1.00 87.20  ? 403  GLY A N   1 
ATOM   3061  C  CA  . GLY A  1  403 ? 9.949    4.986    226.130 1.00 87.75  ? 403  GLY A CA  1 
ATOM   3062  C  C   . GLY A  1  403 ? 10.694   5.767    225.067 1.00 87.27  ? 403  GLY A C   1 
ATOM   3063  O  O   . GLY A  1  403 ? 10.607   6.992    225.001 1.00 87.38  ? 403  GLY A O   1 
ATOM   3064  N  N   . ALA A  1  404 ? 11.433   5.042    224.233 1.00 86.85  ? 404  ALA A N   1 
ATOM   3065  C  CA  . ALA A  1  404 ? 12.150   5.635    223.113 1.00 86.45  ? 404  ALA A CA  1 
ATOM   3066  C  C   . ALA A  1  404 ? 11.181   6.378    222.201 1.00 85.71  ? 404  ALA A C   1 
ATOM   3067  O  O   . ALA A  1  404 ? 11.562   7.323    221.512 1.00 85.62  ? 404  ALA A O   1 
ATOM   3068  C  CB  . ALA A  1  404 ? 12.898   4.568    222.336 1.00 86.14  ? 404  ALA A CB  1 
ATOM   3069  N  N   . GLY A  1  405 ? 9.928    5.934    222.196 1.00 85.28  ? 405  GLY A N   1 
ATOM   3070  C  CA  . GLY A  1  405 ? 8.887    6.578    221.419 1.00 84.69  ? 405  GLY A CA  1 
ATOM   3071  C  C   . GLY A  1  405 ? 8.211    7.681    222.211 1.00 85.17  ? 405  GLY A C   1 
ATOM   3072  O  O   . GLY A  1  405 ? 7.693    8.638    221.637 1.00 84.97  ? 405  GLY A O   1 
ATOM   3073  N  N   . ALA A  1  406 ? 8.211    7.545    223.535 1.00 85.93  ? 406  ALA A N   1 
ATOM   3074  C  CA  . ALA A  1  406 ? 7.616    8.550    224.408 1.00 86.58  ? 406  ALA A CA  1 
ATOM   3075  C  C   . ALA A  1  406 ? 8.385    9.861    224.335 1.00 87.02  ? 406  ALA A C   1 
ATOM   3076  O  O   . ALA A  1  406 ? 7.829    10.903   223.994 1.00 87.00  ? 406  ALA A O   1 
ATOM   3077  C  CB  . ALA A  1  406 ? 7.573    8.049    225.842 1.00 87.46  ? 406  ALA A CB  1 
ATOM   3078  N  N   . HIS A  1  407 ? 9.672    9.795    224.654 1.00 87.52  ? 407  HIS A N   1 
ATOM   3079  C  CA  . HIS A  1  407 ? 10.519   10.980   224.680 1.00 88.11  ? 407  HIS A CA  1 
ATOM   3080  C  C   . HIS A  1  407 ? 10.850   11.444   223.270 1.00 87.48  ? 407  HIS A C   1 
ATOM   3081  O  O   . HIS A  1  407 ? 11.210   12.601   223.055 1.00 87.88  ? 407  HIS A O   1 
ATOM   3082  C  CB  . HIS A  1  407 ? 11.789   10.696   225.472 1.00 88.94  ? 407  HIS A CB  1 
ATOM   3083  C  CG  . HIS A  1  407 ? 11.524   10.341   226.899 1.00 89.79  ? 407  HIS A CG  1 
ATOM   3084  N  ND1 . HIS A  1  407 ? 11.166   11.279   227.843 1.00 90.70  ? 407  HIS A ND1 1 
ATOM   3085  C  CD2 . HIS A  1  407 ? 11.543   9.150    227.540 1.00 89.98  ? 407  HIS A CD2 1 
ATOM   3086  C  CE1 . HIS A  1  407 ? 10.984   10.682   229.007 1.00 91.43  ? 407  HIS A CE1 1 
ATOM   3087  N  NE2 . HIS A  1  407 ? 11.211   9.390    228.850 1.00 91.02  ? 407  HIS A NE2 1 
ATOM   3088  N  N   . GLY A  1  408 ? 10.738   10.533   222.312 1.00 86.60  ? 408  GLY A N   1 
ATOM   3089  C  CA  . GLY A  1  408 ? 10.865   10.895   220.916 1.00 86.03  ? 408  GLY A CA  1 
ATOM   3090  C  C   . GLY A  1  408 ? 9.755    11.860   220.555 1.00 85.88  ? 408  GLY A C   1 
ATOM   3091  O  O   . GLY A  1  408 ? 9.934    12.737   219.713 1.00 85.89  ? 408  GLY A O   1 
ATOM   3092  N  N   . ALA A  1  409 ? 8.606    11.696   221.207 1.00 85.85  ? 409  ALA A N   1 
ATOM   3093  C  CA  . ALA A  1  409 ? 7.449    12.557   220.975 1.00 85.82  ? 409  ALA A CA  1 
ATOM   3094  C  C   . ALA A  1  409 ? 7.483    13.813   221.843 1.00 86.78  ? 409  ALA A C   1 
ATOM   3095  O  O   . ALA A  1  409 ? 7.109    14.893   221.388 1.00 86.97  ? 409  ALA A O   1 
ATOM   3096  C  CB  . ALA A  1  409 ? 6.166    11.789   221.227 1.00 85.43  ? 409  ALA A CB  1 
ATOM   3097  N  N   . ILE A  1  410 ? 7.930    13.673   223.089 1.00 87.50  ? 410  ILE A N   1 
ATOM   3098  C  CA  . ILE A  1  410 ? 8.013    14.815   223.997 1.00 88.57  ? 410  ILE A CA  1 
ATOM   3099  C  C   . ILE A  1  410 ? 8.934    15.881   223.433 1.00 88.94  ? 410  ILE A C   1 
ATOM   3100  O  O   . ILE A  1  410 ? 8.669    17.076   223.570 1.00 89.58  ? 410  ILE A O   1 
ATOM   3101  C  CB  . ILE A  1  410 ? 8.505    14.402   225.398 1.00 89.40  ? 410  ILE A CB  1 
ATOM   3102  C  CG1 . ILE A  1  410 ? 7.446    13.551   226.094 1.00 89.31  ? 410  ILE A CG1 1 
ATOM   3103  C  CG2 . ILE A  1  410 ? 8.780    15.629   226.263 1.00 90.63  ? 410  ILE A CG2 1 
ATOM   3104  C  CD1 . ILE A  1  410 ? 7.955    12.803   227.300 1.00 90.02  ? 410  ILE A CD1 1 
ATOM   3105  N  N   . PHE A  1  411 ? 10.014   15.446   222.798 1.00 88.63  ? 411  PHE A N   1 
ATOM   3106  C  CA  . PHE A  1  411 ? 10.931   16.371   222.155 1.00 89.01  ? 411  PHE A CA  1 
ATOM   3107  C  C   . PHE A  1  411 ? 10.215   17.218   221.106 1.00 88.74  ? 411  PHE A C   1 
ATOM   3108  O  O   . PHE A  1  411 ? 10.451   18.422   221.006 1.00 89.46  ? 411  PHE A O   1 
ATOM   3109  C  CB  . PHE A  1  411 ? 12.087   15.617   221.506 1.00 88.66  ? 411  PHE A CB  1 
ATOM   3110  C  CG  . PHE A  1  411 ? 12.757   16.388   220.413 1.00 88.78  ? 411  PHE A CG  1 
ATOM   3111  C  CD1 . PHE A  1  411 ? 13.650   17.402   220.712 1.00 89.80  ? 411  PHE A CD1 1 
ATOM   3112  C  CD2 . PHE A  1  411 ? 12.475   16.115   219.086 1.00 87.99  ? 411  PHE A CD2 1 
ATOM   3113  C  CE1 . PHE A  1  411 ? 14.261   18.122   219.705 1.00 90.04  ? 411  PHE A CE1 1 
ATOM   3114  C  CE2 . PHE A  1  411 ? 13.081   16.830   218.074 1.00 88.24  ? 411  PHE A CE2 1 
ATOM   3115  C  CZ  . PHE A  1  411 ? 13.976   17.836   218.383 1.00 89.27  ? 411  PHE A CZ  1 
ATOM   3116  N  N   . MET A  1  412 ? 9.339    16.587   220.330 1.00 87.80  ? 412  MET A N   1 
ATOM   3117  C  CA  . MET A  1  412 ? 8.602    17.289   219.285 1.00 87.58  ? 412  MET A CA  1 
ATOM   3118  C  C   . MET A  1  412 ? 7.638    18.311   219.872 1.00 88.21  ? 412  MET A C   1 
ATOM   3119  O  O   . MET A  1  412 ? 7.488    19.409   219.339 1.00 88.65  ? 412  MET A O   1 
ATOM   3120  C  CB  . MET A  1  412 ? 7.837    16.297   218.406 1.00 86.53  ? 412  MET A CB  1 
ATOM   3121  C  CG  . MET A  1  412 ? 8.722    15.495   217.464 1.00 85.99  ? 412  MET A CG  1 
ATOM   3122  S  SD  . MET A  1  412 ? 9.588    16.527   216.262 1.00 86.42  ? 412  MET A SD  1 
ATOM   3123  C  CE  . MET A  1  412 ? 8.216    17.257   215.369 1.00 86.28  ? 412  MET A CE  1 
ATOM   3124  N  N   . VAL A  1  413 ? 6.989    17.954   220.974 1.00 88.37  ? 413  VAL A N   1 
ATOM   3125  C  CA  . VAL A  1  413 ? 6.039    18.854   221.611 1.00 89.07  ? 413  VAL A CA  1 
ATOM   3126  C  C   . VAL A  1  413 ? 6.753    20.022   222.276 1.00 90.26  ? 413  VAL A C   1 
ATOM   3127  O  O   . VAL A  1  413 ? 6.406    21.181   222.047 1.00 90.88  ? 413  VAL A O   1 
ATOM   3128  C  CB  . VAL A  1  413 ? 5.175    18.110   222.662 1.00 89.06  ? 413  VAL A CB  1 
ATOM   3129  C  CG1 . VAL A  1  413 ? 4.593    19.076   223.704 1.00 90.19  ? 413  VAL A CG1 1 
ATOM   3130  C  CG2 . VAL A  1  413 ? 4.070    17.318   221.978 1.00 88.13  ? 413  VAL A CG2 1 
ATOM   3131  N  N   . ARG A  1  414 ? 7.761    19.713   223.084 1.00 90.68  ? 414  ARG A N   1 
ATOM   3132  C  CA  . ARG A  1  414 ? 8.379    20.721   223.939 1.00 91.97  ? 414  ARG A CA  1 
ATOM   3133  C  C   . ARG A  1  414 ? 9.561    21.463   223.305 1.00 92.39  ? 414  ARG A C   1 
ATOM   3134  O  O   . ARG A  1  414 ? 9.544    22.692   223.230 1.00 101.27 ? 414  ARG A O   1 
ATOM   3135  C  CB  . ARG A  1  414 ? 8.824    20.071   225.250 1.00 92.46  ? 414  ARG A CB  1 
ATOM   3136  C  CG  . ARG A  1  414 ? 7.674    19.795   226.210 1.00 92.70  ? 414  ARG A CG  1 
ATOM   3137  C  CD  . ARG A  1  414 ? 8.172    19.175   227.503 1.00 93.36  ? 414  ARG A CD  1 
ATOM   3138  N  NE  . ARG A  1  414 ? 7.124    19.067   228.515 1.00 93.91  ? 414  ARG A NE  1 
ATOM   3139  C  CZ  . ARG A  1  414 ? 7.263    18.417   229.667 1.00 94.52  ? 414  ARG A CZ  1 
ATOM   3140  N  NH1 . ARG A  1  414 ? 8.409    17.817   229.959 1.00 94.65  ? 414  ARG A NH1 1 
ATOM   3141  N  NH2 . ARG A  1  414 ? 6.259    18.370   230.532 1.00 95.12  ? 414  ARG A NH2 1 
ATOM   3142  N  N   . ASP A  1  415 ? 10.574   20.731   222.846 1.00 92.86  ? 415  ASP A N   1 
ATOM   3143  C  CA  . ASP A  1  415 ? 11.865   21.345   222.514 1.00 93.50  ? 415  ASP A CA  1 
ATOM   3144  C  C   . ASP A  1  415 ? 12.198   21.397   221.019 1.00 92.92  ? 415  ASP A C   1 
ATOM   3145  O  O   . ASP A  1  415 ? 13.337   21.690   220.653 1.00 93.38  ? 415  ASP A O   1 
ATOM   3146  C  CB  . ASP A  1  415 ? 12.987   20.615   223.255 1.00 93.78  ? 415  ASP A CB  1 
ATOM   3147  C  CG  . ASP A  1  415 ? 12.791   20.619   224.758 1.00 94.60  ? 415  ASP A CG  1 
ATOM   3148  O  OD1 . ASP A  1  415 ? 12.029   21.475   225.258 1.00 95.25  ? 415  ASP A OD1 1 
ATOM   3149  O  OD2 . ASP A  1  415 ? 13.405   19.773   225.442 1.00 94.71  ? 415  ASP A OD2 1 
ATOM   3150  N  N   . TYR A  1  416 ? 11.222   21.124   220.158 1.00 91.08  ? 416  TYR A N   1 
ATOM   3151  C  CA  . TYR A  1  416 ? 11.419   21.297   218.718 1.00 90.72  ? 416  TYR A CA  1 
ATOM   3152  C  C   . TYR A  1  416 ? 11.173   22.751   218.339 1.00 91.59  ? 416  TYR A C   1 
ATOM   3153  O  O   . TYR A  1  416 ? 10.118   23.309   218.638 1.00 96.81  ? 416  TYR A O   1 
ATOM   3154  C  CB  . TYR A  1  416 ? 10.492   20.379   217.916 1.00 89.52  ? 416  TYR A CB  1 
ATOM   3155  C  CG  . TYR A  1  416 ? 10.293   20.807   216.472 1.00 89.35  ? 416  TYR A CG  1 
ATOM   3156  C  CD1 . TYR A  1  416 ? 11.222   20.483   215.489 1.00 89.19  ? 416  TYR A CD1 1 
ATOM   3157  C  CD2 . TYR A  1  416 ? 9.168    21.529   216.092 1.00 89.47  ? 416  TYR A CD2 1 
ATOM   3158  C  CE1 . TYR A  1  416 ? 11.036   20.873   214.171 1.00 89.17  ? 416  TYR A CE1 1 
ATOM   3159  C  CE2 . TYR A  1  416 ? 8.975    21.922   214.779 1.00 89.45  ? 416  TYR A CE2 1 
ATOM   3160  C  CZ  . TYR A  1  416 ? 9.911    21.591   213.823 1.00 89.31  ? 416  TYR A CZ  1 
ATOM   3161  O  OH  . TYR A  1  416 ? 9.721    21.979   212.516 1.00 89.43  ? 416  TYR A OH  1 
ATOM   3162  N  N   . ASP A  1  417 ? 12.155   23.355   217.678 1.00 127.74 ? 417  ASP A N   1 
ATOM   3163  C  CA  . ASP A  1  417 ? 12.058   24.744   217.242 1.00 132.02 ? 417  ASP A CA  1 
ATOM   3164  C  C   . ASP A  1  417 ? 12.147   24.800   215.713 1.00 138.86 ? 417  ASP A C   1 
ATOM   3165  O  O   . ASP A  1  417 ? 13.173   24.429   215.145 1.00 162.37 ? 417  ASP A O   1 
ATOM   3166  C  CB  . ASP A  1  417 ? 13.166   25.574   217.887 1.00 123.12 ? 417  ASP A CB  1 
ATOM   3167  C  CG  . ASP A  1  417 ? 12.900   27.067   217.816 1.00 123.72 ? 417  ASP A CG  1 
ATOM   3168  O  OD1 . ASP A  1  417 ? 12.286   27.526   216.830 1.00 123.67 ? 417  ASP A OD1 1 
ATOM   3169  O  OD2 . ASP A  1  417 ? 13.297   27.783   218.760 1.00 124.83 ? 417  ASP A OD2 1 
ATOM   3170  N  N   . PRO A  1  418 ? 11.076   25.265   215.040 1.00 99.21  ? 418  PRO A N   1 
ATOM   3171  C  CA  . PRO A  1  418 ? 11.064   25.276   213.569 1.00 99.02  ? 418  PRO A CA  1 
ATOM   3172  C  C   . PRO A  1  418 ? 12.196   26.087   212.941 1.00 100.08 ? 418  PRO A C   1 
ATOM   3173  O  O   . PRO A  1  418 ? 12.672   25.736   211.861 1.00 99.89  ? 418  PRO A O   1 
ATOM   3174  C  CB  . PRO A  1  418 ? 9.711    25.912   213.233 1.00 99.16  ? 418  PRO A CB  1 
ATOM   3175  C  CG  . PRO A  1  418 ? 8.869    25.676   214.423 1.00 98.86  ? 418  PRO A CG  1 
ATOM   3176  C  CD  . PRO A  1  418 ? 9.792    25.724   215.597 1.00 99.34  ? 418  PRO A CD  1 
ATOM   3177  N  N   . ALA A  1  419 ? 12.614   27.158   213.606 1.00 100.54 ? 419  ALA A N   1 
ATOM   3178  C  CA  . ALA A  1  419 ? 13.643   28.035   213.062 1.00 101.74 ? 419  ALA A CA  1 
ATOM   3179  C  C   . ALA A  1  419 ? 15.002   27.341   213.048 1.00 101.64 ? 419  ALA A C   1 
ATOM   3180  O  O   . ALA A  1  419 ? 15.805   27.553   212.139 1.00 102.18 ? 419  ALA A O   1 
ATOM   3181  C  CB  . ALA A  1  419 ? 13.713   29.324   213.864 1.00 103.12 ? 419  ALA A CB  1 
ATOM   3182  N  N   . LYS A  1  420 ? 15.249   26.512   214.057 1.00 100.29 ? 420  LYS A N   1 
ATOM   3183  C  CA  . LYS A  1  420 ? 16.511   25.786   214.167 1.00 100.23 ? 420  LYS A CA  1 
ATOM   3184  C  C   . LYS A  1  420 ? 16.450   24.461   213.411 1.00 98.98  ? 420  LYS A C   1 
ATOM   3185  O  O   . LYS A  1  420 ? 17.357   23.636   213.515 1.00 98.76  ? 420  LYS A O   1 
ATOM   3186  C  CB  . LYS A  1  420 ? 16.855   25.522   215.635 1.00 100.39 ? 420  LYS A CB  1 
ATOM   3187  C  CG  . LYS A  1  420 ? 17.155   26.764   216.459 1.00 101.82 ? 420  LYS A CG  1 
ATOM   3188  C  CD  . LYS A  1  420 ? 16.535   26.651   217.842 1.00 101.75 ? 420  LYS A CD  1 
ATOM   3189  C  CE  . LYS A  1  420 ? 17.075   27.687   218.809 1.00 103.27 ? 420  LYS A CE  1 
ATOM   3190  N  NZ  . LYS A  1  420 ? 16.450   27.544   220.154 1.00 103.30 ? 420  LYS A NZ  1 
ATOM   3191  N  N   . ASN A  1  421 ? 15.376   24.268   212.650 1.00 100.12 ? 421  ASN A N   1 
ATOM   3192  C  CA  . ASN A  1  421 ? 15.197   23.064   211.849 1.00 99.02  ? 421  ASN A CA  1 
ATOM   3193  C  C   . ASN A  1  421 ? 14.481   23.407   210.554 1.00 98.99  ? 421  ASN A C   1 
ATOM   3194  O  O   . ASN A  1  421 ? 13.260   23.281   210.459 1.00 98.38  ? 421  ASN A O   1 
ATOM   3195  C  CB  . ASN A  1  421 ? 14.403   22.013   212.625 1.00 97.87  ? 421  ASN A CB  1 
ATOM   3196  C  CG  . ASN A  1  421 ? 15.172   21.454   213.806 1.00 97.89  ? 421  ASN A CG  1 
ATOM   3197  O  OD1 . ASN A  1  421 ? 16.090   20.649   213.642 1.00 104.28 ? 421  ASN A OD1 1 
ATOM   3198  N  ND2 . ASN A  1  421 ? 14.802   21.884   215.008 1.00 98.22  ? 421  ASN A ND2 1 
ATOM   3199  N  N   . VAL A  1  422 ? 15.252   23.837   209.561 1.00 93.00  ? 422  VAL A N   1 
ATOM   3200  C  CA  . VAL A  1  422 ? 14.699   24.286   208.287 1.00 93.28  ? 422  VAL A CA  1 
ATOM   3201  C  C   . VAL A  1  422 ? 15.264   23.474   207.131 1.00 93.05  ? 422  VAL A C   1 
ATOM   3202  O  O   . VAL A  1  422 ? 16.456   23.536   206.830 1.00 93.75  ? 422  VAL A O   1 
ATOM   3203  C  CB  . VAL A  1  422 ? 14.973   25.793   208.052 1.00 94.78  ? 422  VAL A CB  1 
ATOM   3204  C  CG1 . VAL A  1  422 ? 16.408   26.160   208.426 1.00 95.74  ? 422  VAL A CG1 1 
ATOM   3205  C  CG2 . VAL A  1  422 ? 14.659   26.191   206.607 1.00 95.29  ? 422  VAL A CG2 1 
ATOM   3206  N  N   . ASN A  1  423 ? 14.384   22.714   206.489 1.00 92.17  ? 423  ASN A N   1 
ATOM   3207  C  CA  . ASN A  1  423 ? 14.752   21.886   205.351 1.00 91.96  ? 423  ASN A CA  1 
ATOM   3208  C  C   . ASN A  1  423 ? 15.938   20.983   205.667 1.00 91.75  ? 423  ASN A C   1 
ATOM   3209  O  O   . ASN A  1  423 ? 16.752   20.688   204.792 1.00 92.19  ? 423  ASN A O   1 
ATOM   3210  C  CB  . ASN A  1  423 ? 15.073   22.764   204.141 1.00 93.18  ? 423  ASN A CB  1 
ATOM   3211  C  CG  . ASN A  1  423 ? 14.824   22.056   202.823 1.00 92.97  ? 423  ASN A CG  1 
ATOM   3212  O  OD1 . ASN A  1  423 ? 13.678   21.839   202.431 1.00 92.44  ? 423  ASN A OD1 1 
ATOM   3213  N  ND2 . ASN A  1  423 ? 15.899   21.690   202.134 1.00 93.48  ? 423  ASN A ND2 1 
ATOM   3214  N  N   . ASN A  1  424 ? 16.022   20.544   206.921 1.00 91.18  ? 424  ASN A N   1 
ATOM   3215  C  CA  . ASN A  1  424 ? 17.008   19.551   207.323 1.00 90.90  ? 424  ASN A CA  1 
ATOM   3216  C  C   . ASN A  1  424 ? 16.320   18.198   207.445 1.00 89.63  ? 424  ASN A C   1 
ATOM   3217  O  O   . ASN A  1  424 ? 15.110   18.089   207.246 1.00 89.01  ? 424  ASN A O   1 
ATOM   3218  C  CB  . ASN A  1  424 ? 17.688   19.943   208.638 1.00 91.33  ? 424  ASN A CB  1 
ATOM   3219  C  CG  . ASN A  1  424 ? 16.738   19.936   209.818 1.00 90.72  ? 424  ASN A CG  1 
ATOM   3220  O  OD1 . ASN A  1  424 ? 15.532   20.121   209.665 1.00 90.26  ? 424  ASN A OD1 1 
ATOM   3221  N  ND2 . ASN A  1  424 ? 17.284   19.722   211.009 1.00 90.80  ? 424  ASN A ND2 1 
ATOM   3222  N  N   . LEU A  1  425 ? 17.098   17.172   207.764 1.00 95.60  ? 425  LEU A N   1 
ATOM   3223  C  CA  . LEU A  1  425 ? 16.587   15.810   207.858 1.00 94.54  ? 425  LEU A CA  1 
ATOM   3224  C  C   . LEU A  1  425 ? 15.370   15.704   208.767 1.00 93.78  ? 425  LEU A C   1 
ATOM   3225  O  O   . LEU A  1  425 ? 14.421   14.981   208.465 1.00 92.99  ? 425  LEU A O   1 
ATOM   3226  C  CB  . LEU A  1  425 ? 17.687   14.881   208.363 1.00 94.56  ? 425  LEU A CB  1 
ATOM   3227  C  CG  . LEU A  1  425 ? 18.815   14.631   207.366 1.00 95.21  ? 425  LEU A CG  1 
ATOM   3228  C  CD1 . LEU A  1  425 ? 20.037   14.084   208.074 1.00 95.57  ? 425  LEU A CD1 1 
ATOM   3229  C  CD2 . LEU A  1  425 ? 18.364   13.675   206.281 1.00 94.69  ? 425  LEU A CD2 1 
ATOM   3230  N  N   . LEU A  1  426 ? 15.399   16.431   209.878 1.00 87.85  ? 426  LEU A N   1 
ATOM   3231  C  CA  . LEU A  1  426 ? 14.290   16.415   210.820 1.00 87.32  ? 426  LEU A CA  1 
ATOM   3232  C  C   . LEU A  1  426 ? 13.058   17.047   210.187 1.00 87.18  ? 426  LEU A C   1 
ATOM   3233  O  O   . LEU A  1  426 ? 11.987   16.444   210.158 1.00 86.43  ? 426  LEU A O   1 
ATOM   3234  C  CB  . LEU A  1  426 ? 14.667   17.144   212.113 1.00 87.93  ? 426  LEU A CB  1 
ATOM   3235  C  CG  . LEU A  1  426 ? 13.542   17.331   213.136 1.00 87.64  ? 426  LEU A CG  1 
ATOM   3236  C  CD1 . LEU A  1  426 ? 12.808   16.025   213.406 1.00 86.65  ? 426  LEU A CD1 1 
ATOM   3237  C  CD2 . LEU A  1  426 ? 14.106   17.891   214.430 1.00 88.37  ? 426  LEU A CD2 1 
ATOM   3238  N  N   . ASP A  1  427 ? 13.217   18.264   209.681 1.00 88.01  ? 427  ASP A N   1 
ATOM   3239  C  CA  . ASP A  1  427 ? 12.106   18.991   209.081 1.00 88.11  ? 427  ASP A CA  1 
ATOM   3240  C  C   . ASP A  1  427 ? 11.592   18.304   207.822 1.00 87.62  ? 427  ASP A C   1 
ATOM   3241  O  O   . ASP A  1  427 ? 10.383   18.221   207.606 1.00 87.20  ? 427  ASP A O   1 
ATOM   3242  C  CB  . ASP A  1  427 ? 12.524   20.423   208.747 1.00 89.28  ? 427  ASP A CB  1 
ATOM   3243  C  CG  . ASP A  1  427 ? 11.383   21.243   208.178 1.00 89.54  ? 427  ASP A CG  1 
ATOM   3244  O  OD1 . ASP A  1  427 ? 10.554   21.739   208.969 1.00 89.55  ? 427  ASP A OD1 1 
ATOM   3245  O  OD2 . ASP A  1  427 ? 11.318   21.392   206.938 1.00 89.83  ? 427  ASP A OD2 1 
ATOM   3246  N  N   . ARG A  1  428 ? 12.512   17.816   206.995 1.00 87.78  ? 428  ARG A N   1 
ATOM   3247  C  CA  . ARG A  1  428 ? 12.142   17.230   205.713 1.00 87.55  ? 428  ARG A CA  1 
ATOM   3248  C  C   . ARG A  1  428 ? 11.201   16.044   205.882 1.00 86.47  ? 428  ARG A C   1 
ATOM   3249  O  O   . ARG A  1  428 ? 10.240   15.901   205.128 1.00 86.26  ? 428  ARG A O   1 
ATOM   3250  C  CB  . ARG A  1  428 ? 13.385   16.798   204.930 1.00 87.98  ? 428  ARG A CB  1 
ATOM   3251  C  CG  . ARG A  1  428 ? 14.097   17.943   204.221 1.00 89.20  ? 428  ARG A CG  1 
ATOM   3252  C  CD  . ARG A  1  428 ? 15.310   17.451   203.448 1.00 89.70  ? 428  ARG A CD  1 
ATOM   3253  N  NE  . ARG A  1  428 ? 14.927   16.794   202.198 1.00 89.58  ? 428  ARG A NE  1 
ATOM   3254  C  CZ  . ARG A  1  428 ? 14.857   17.394   201.011 1.00 90.43  ? 428  ARG A CZ  1 
ATOM   3255  N  NH1 . ARG A  1  428 ? 15.150   18.682   200.881 1.00 91.48  ? 428  ARG A NH1 1 
ATOM   3256  N  NH2 . ARG A  1  428 ? 14.496   16.698   199.941 1.00 90.35  ? 428  ARG A NH2 1 
ATOM   3257  N  N   . MET A  1  429 ? 11.459   15.194   206.870 1.00 105.22 ? 429  MET A N   1 
ATOM   3258  C  CA  . MET A  1  429 ? 10.663   13.983   207.000 1.00 104.32 ? 429  MET A CA  1 
ATOM   3259  C  C   . MET A  1  429 ? 9.349    14.270   207.720 1.00 103.95 ? 429  MET A C   1 
ATOM   3260  O  O   . MET A  1  429 ? 8.390    13.509   207.594 1.00 103.35 ? 429  MET A O   1 
ATOM   3261  C  CB  . MET A  1  429 ? 11.452   12.878   207.710 1.00 103.97 ? 429  MET A CB  1 
ATOM   3262  C  CG  . MET A  1  429 ? 11.422   12.906   209.229 1.00 103.82 ? 429  MET A CG  1 
ATOM   3263  S  SD  . MET A  1  429 ? 12.303   11.492   209.915 1.00 103.53 ? 429  MET A SD  1 
ATOM   3264  C  CE  . MET A  1  429 ? 11.211   10.153   209.439 1.00 102.67 ? 429  MET A CE  1 
ATOM   3265  N  N   . LEU A  1  430 ? 9.302    15.366   208.470 1.00 85.86  ? 430  LEU A N   1 
ATOM   3266  C  CA  . LEU A  1  430 ? 8.039    15.841   209.020 1.00 85.74  ? 430  LEU A CA  1 
ATOM   3267  C  C   . LEU A  1  430 ? 7.130    16.308   207.888 1.00 85.91  ? 430  LEU A C   1 
ATOM   3268  O  O   . LEU A  1  430 ? 5.912    16.382   208.052 1.00 85.70  ? 430  LEU A O   1 
ATOM   3269  C  CB  . LEU A  1  430 ? 8.263    16.970   210.028 1.00 86.39  ? 430  LEU A CB  1 
ATOM   3270  C  CG  . LEU A  1  430 ? 8.947    16.580   211.341 1.00 86.33  ? 430  LEU A CG  1 
ATOM   3271  C  CD1 . LEU A  1  430 ? 9.505    17.808   212.042 1.00 87.24  ? 430  LEU A CD1 1 
ATOM   3272  C  CD2 . LEU A  1  430 ? 7.970    15.849   212.248 1.00 85.74  ? 430  LEU A CD2 1 
ATOM   3273  N  N   . ARG A  1  431 ? 7.729    16.618   206.739 1.00 85.63  ? 431  ARG A N   1 
ATOM   3274  C  CA  . ARG A  1  431 ? 6.981    17.126   205.594 1.00 86.00  ? 431  ARG A CA  1 
ATOM   3275  C  C   . ARG A  1  431 ? 6.518    16.013   204.654 1.00 85.49  ? 431  ARG A C   1 
ATOM   3276  O  O   . ARG A  1  431 ? 5.947    16.293   203.599 1.00 85.85  ? 431  ARG A O   1 
ATOM   3277  C  CB  . ARG A  1  431 ? 7.814    18.158   204.824 1.00 87.03  ? 431  ARG A CB  1 
ATOM   3278  C  CG  . ARG A  1  431 ? 7.943    19.479   205.566 1.00 87.76  ? 431  ARG A CG  1 
ATOM   3279  C  CD  . ARG A  1  431 ? 8.262    20.649   204.651 1.00 88.92  ? 431  ARG A CD  1 
ATOM   3280  N  NE  . ARG A  1  431 ? 9.692    20.802   204.383 1.00 89.50  ? 431  ARG A NE  1 
ATOM   3281  C  CZ  . ARG A  1  431 ? 10.305   20.475   203.247 1.00 89.83  ? 431  ARG A CZ  1 
ATOM   3282  N  NH1 . ARG A  1  431 ? 9.632    19.957   202.228 1.00 89.63  ? 431  ARG A NH1 1 
ATOM   3283  N  NH2 . ARG A  1  431 ? 11.612   20.671   203.130 1.00 90.46  ? 431  ARG A NH2 1 
ATOM   3284  N  N   . HIS A  1  432 ? 6.764    14.757   205.022 1.00 89.48  ? 432  HIS A N   1 
ATOM   3285  C  CA  . HIS A  1  432 ? 6.122    13.640   204.329 1.00 88.97  ? 432  HIS A CA  1 
ATOM   3286  C  C   . HIS A  1  432 ? 5.711    12.547   205.318 1.00 88.15  ? 432  HIS A C   1 
ATOM   3287  O  O   . HIS A  1  432 ? 5.652    11.368   204.976 1.00 87.72  ? 432  HIS A O   1 
ATOM   3288  C  CB  . HIS A  1  432 ? 7.031    13.083   203.221 1.00 89.22  ? 432  HIS A CB  1 
ATOM   3289  C  CG  . HIS A  1  432 ? 8.178    12.257   203.712 1.00 88.97  ? 432  HIS A CG  1 
ATOM   3290  N  ND1 . HIS A  1  432 ? 9.397    12.801   204.056 1.00 89.44  ? 432  HIS A ND1 1 
ATOM   3291  C  CD2 . HIS A  1  432 ? 8.306    10.919   203.875 1.00 88.40  ? 432  HIS A CD2 1 
ATOM   3292  C  CE1 . HIS A  1  432 ? 10.217   11.834   204.430 1.00 89.16  ? 432  HIS A CE1 1 
ATOM   3293  N  NE2 . HIS A  1  432 ? 9.578    10.683   204.334 1.00 88.54  ? 432  HIS A NE2 1 
ATOM   3294  N  N   . ARG A  1  433 ? 5.400    12.964   206.542 1.00 91.54  ? 433  ARG A N   1 
ATOM   3295  C  CA  . ARG A  1  433 ? 4.905    12.064   207.579 1.00 90.93  ? 433  ARG A CA  1 
ATOM   3296  C  C   . ARG A  1  433 ? 3.695    11.269   207.097 1.00 90.52  ? 433  ARG A C   1 
ATOM   3297  O  O   . ARG A  1  433 ? 3.492    10.126   207.501 1.00 90.03  ? 433  ARG A O   1 
ATOM   3298  C  CB  . ARG A  1  433 ? 4.527    12.856   208.826 1.00 91.11  ? 433  ARG A CB  1 
ATOM   3299  C  CG  . ARG A  1  433 ? 3.329    13.756   208.595 1.00 91.40  ? 433  ARG A CG  1 
ATOM   3300  C  CD  . ARG A  1  433 ? 3.173    14.812   209.664 1.00 91.86  ? 433  ARG A CD  1 
ATOM   3301  N  NE  . ARG A  1  433 ? 2.223    15.832   209.235 1.00 92.35  ? 433  ARG A NE  1 
ATOM   3302  C  CZ  . ARG A  1  433 ? 1.806    16.841   209.991 1.00 92.88  ? 433  ARG A CZ  1 
ATOM   3303  N  NH1 . ARG A  1  433 ? 2.256    16.980   211.231 1.00 93.00  ? 433  ARG A NH1 1 
ATOM   3304  N  NH2 . ARG A  1  433 ? 0.936    17.714   209.503 1.00 97.69  ? 433  ARG A NH2 1 
ATOM   3305  N  N   . ASP A  1  434 ? 2.890    11.885   206.235 1.00 93.24  ? 434  ASP A N   1 
ATOM   3306  C  CA  . ASP A  1  434 ? 1.721    11.217   205.677 1.00 93.01  ? 434  ASP A CA  1 
ATOM   3307  C  C   . ASP A  1  434 ? 2.152    10.101   204.736 1.00 92.82  ? 434  ASP A C   1 
ATOM   3308  O  O   . ASP A  1  434 ? 1.448    9.108    204.586 1.00 92.48  ? 434  ASP A O   1 
ATOM   3309  C  CB  . ASP A  1  434 ? 0.817    12.213   204.945 1.00 93.54  ? 434  ASP A CB  1 
ATOM   3310  C  CG  . ASP A  1  434 ? 0.350    13.348   205.838 1.00 93.86  ? 434  ASP A CG  1 
ATOM   3311  O  OD1 . ASP A  1  434 ? -0.629   13.147   206.589 1.00 93.65  ? 434  ASP A OD1 1 
ATOM   3312  O  OD2 . ASP A  1  434 ? 0.954    14.440   205.788 1.00 101.92 ? 434  ASP A OD2 1 
ATOM   3313  N  N   . ALA A  1  435 ? 3.309    10.265   204.103 1.00 82.48  ? 435  ALA A N   1 
ATOM   3314  C  CA  . ALA A  1  435 ? 3.843    9.227    203.227 1.00 82.44  ? 435  ALA A CA  1 
ATOM   3315  C  C   . ALA A  1  435 ? 4.452    8.089    204.043 1.00 81.93  ? 435  ALA A C   1 
ATOM   3316  O  O   . ALA A  1  435 ? 4.325    6.921    203.680 1.00 81.71  ? 435  ALA A O   1 
ATOM   3317  C  CB  . ALA A  1  435 ? 4.877    9.807    202.276 1.00 83.09  ? 435  ALA A CB  1 
ATOM   3318  N  N   . ILE A  1  436 ? 5.107    8.433    205.149 1.00 81.86  ? 436  ILE A N   1 
ATOM   3319  C  CA  . ILE A  1  436 ? 5.745    7.433    206.000 1.00 81.53  ? 436  ILE A CA  1 
ATOM   3320  C  C   . ILE A  1  436 ? 4.703    6.499    206.590 1.00 81.05  ? 436  ILE A C   1 
ATOM   3321  O  O   . ILE A  1  436 ? 4.761    5.289    206.392 1.00 80.85  ? 436  ILE A O   1 
ATOM   3322  C  CB  . ILE A  1  436 ? 6.553    8.085    207.150 1.00 81.67  ? 436  ILE A CB  1 
ATOM   3323  C  CG1 . ILE A  1  436 ? 7.727    8.881    206.584 1.00 82.23  ? 436  ILE A CG1 1 
ATOM   3324  C  CG2 . ILE A  1  436 ? 7.081    7.029    208.118 1.00 81.41  ? 436  ILE A CG2 1 
ATOM   3325  C  CD1 . ILE A  1  436 ? 8.396    9.802    207.584 1.00 82.55  ? 436  ILE A CD1 1 
ATOM   3326  N  N   . ILE A  1  437 ? 3.752    7.070    207.316 1.00 80.97  ? 437  ILE A N   1 
ATOM   3327  C  CA  . ILE A  1  437 ? 2.734    6.284    207.996 1.00 80.64  ? 437  ILE A CA  1 
ATOM   3328  C  C   . ILE A  1  437 ? 1.872    5.498    207.012 1.00 80.53  ? 437  ILE A C   1 
ATOM   3329  O  O   . ILE A  1  437 ? 1.518    4.352    207.286 1.00 80.31  ? 437  ILE A O   1 
ATOM   3330  C  CB  . ILE A  1  437 ? 1.855    7.183    208.899 1.00 80.74  ? 437  ILE A CB  1 
ATOM   3331  C  CG1 . ILE A  1  437 ? 2.377    7.144    210.339 1.00 80.75  ? 437  ILE A CG1 1 
ATOM   3332  C  CG2 . ILE A  1  437 ? 0.391    6.748    208.879 1.00 80.61  ? 437  ILE A CG2 1 
ATOM   3333  C  CD1 . ILE A  1  437 ? 3.876    7.408    210.486 1.00 80.94  ? 437  ILE A CD1 1 
ATOM   3334  N  N   . SER A  1  438 ? 1.535    6.100    205.875 1.00 80.80  ? 438  SER A N   1 
ATOM   3335  C  CA  . SER A  1  438 ? 0.689    5.427    204.891 1.00 80.83  ? 438  SER A CA  1 
ATOM   3336  C  C   . SER A  1  438 ? 1.308    4.110    204.426 1.00 80.74  ? 438  SER A C   1 
ATOM   3337  O  O   . SER A  1  438 ? 0.592    3.154    204.132 1.00 80.68  ? 438  SER A O   1 
ATOM   3338  C  CB  . SER A  1  438 ? 0.431    6.332    203.684 1.00 81.30  ? 438  SER A CB  1 
ATOM   3339  O  OG  . SER A  1  438 ? 1.601    6.503    202.903 1.00 81.59  ? 438  SER A OG  1 
ATOM   3340  N  N   . HIS A  1  439 ? 2.636    4.061    204.368 1.00 80.82  ? 439  HIS A N   1 
ATOM   3341  C  CA  . HIS A  1  439 ? 3.336    2.854    203.939 1.00 80.86  ? 439  HIS A CA  1 
ATOM   3342  C  C   . HIS A  1  439 ? 3.572    1.894    205.088 1.00 80.56  ? 439  HIS A C   1 
ATOM   3343  O  O   . HIS A  1  439 ? 3.377    0.689    204.943 1.00 80.53  ? 439  HIS A O   1 
ATOM   3344  C  CB  . HIS A  1  439 ? 4.662    3.211    203.277 1.00 81.23  ? 439  HIS A CB  1 
ATOM   3345  C  CG  . HIS A  1  439 ? 4.506    3.688    201.871 1.00 81.71  ? 439  HIS A CG  1 
ATOM   3346  N  ND1 . HIS A  1  439 ? 4.278    5.008    201.551 1.00 82.00  ? 439  HIS A ND1 1 
ATOM   3347  C  CD2 . HIS A  1  439 ? 4.506    3.011    200.701 1.00 82.08  ? 439  HIS A CD2 1 
ATOM   3348  C  CE1 . HIS A  1  439 ? 4.162    5.125    200.240 1.00 82.53  ? 439  HIS A CE1 1 
ATOM   3349  N  NE2 . HIS A  1  439 ? 4.292    3.927    199.703 1.00 82.59  ? 439  HIS A NE2 1 
ATOM   3350  N  N   . LEU A  1  440 ? 3.989    2.423    206.231 1.00 80.44  ? 440  LEU A N   1 
ATOM   3351  C  CA  . LEU A  1  440 ? 4.148    1.596    207.415 1.00 80.28  ? 440  LEU A CA  1 
ATOM   3352  C  C   . LEU A  1  440 ? 2.806    0.992    207.798 1.00 80.10  ? 440  LEU A C   1 
ATOM   3353  O  O   . LEU A  1  440 ? 2.740    -0.100   208.361 1.00 80.08  ? 440  LEU A O   1 
ATOM   3354  C  CB  . LEU A  1  440 ? 4.719    2.407    208.574 1.00 80.31  ? 440  LEU A CB  1 
ATOM   3355  C  CG  . LEU A  1  440 ? 5.092    1.602    209.820 1.00 80.32  ? 440  LEU A CG  1 
ATOM   3356  C  CD1 . LEU A  1  440 ? 6.060    0.474    209.502 1.00 80.47  ? 440  LEU A CD1 1 
ATOM   3357  C  CD2 . LEU A  1  440 ? 5.697    2.522    210.858 1.00 80.49  ? 440  LEU A CD2 1 
ATOM   3358  N  N   . ASN A  1  441 ? 1.737    1.714    207.490 1.00 93.83  ? 441  ASN A N   1 
ATOM   3359  C  CA  . ASN A  1  441 ? 0.394    1.189    207.661 1.00 93.77  ? 441  ASN A CA  1 
ATOM   3360  C  C   . ASN A  1  441 ? 0.153    -0.015   206.761 1.00 93.85  ? 441  ASN A C   1 
ATOM   3361  O  O   . ASN A  1  441 ? -0.381   -1.033   207.197 1.00 93.86  ? 441  ASN A O   1 
ATOM   3362  C  CB  . ASN A  1  441 ? -0.638   2.269    207.362 1.00 93.85  ? 441  ASN A CB  1 
ATOM   3363  C  CG  . ASN A  1  441 ? -2.053   1.753    207.437 1.00 93.90  ? 441  ASN A CG  1 
ATOM   3364  O  OD1 . ASN A  1  441 ? -2.333   0.743    208.074 1.00 105.79 ? 441  ASN A OD1 1 
ATOM   3365  N  ND2 . ASN A  1  441 ? -2.956   2.445    206.777 1.00 94.07  ? 441  ASN A ND2 1 
ATOM   3366  N  N   . TRP A  1  442 ? 0.561    0.106    205.502 1.00 85.37  ? 442  TRP A N   1 
ATOM   3367  C  CA  . TRP A  1  442 ? 0.347    -0.958   204.532 1.00 85.58  ? 442  TRP A CA  1 
ATOM   3368  C  C   . TRP A  1  442 ? 1.185    -2.195   204.847 1.00 85.63  ? 442  TRP A C   1 
ATOM   3369  O  O   . TRP A  1  442 ? 0.693    -3.319   204.753 1.00 85.76  ? 442  TRP A O   1 
ATOM   3370  C  CB  . TRP A  1  442 ? 0.677    -0.475   203.124 1.00 85.90  ? 442  TRP A CB  1 
ATOM   3371  C  CG  . TRP A  1  442 ? 0.839    -1.609   202.181 1.00 86.23  ? 442  TRP A CG  1 
ATOM   3372  C  CD1 . TRP A  1  442 ? -0.143   -2.243   201.481 1.00 86.50  ? 442  TRP A CD1 1 
ATOM   3373  C  CD2 . TRP A  1  442 ? 2.059    -2.282   201.864 1.00 86.45  ? 442  TRP A CD2 1 
ATOM   3374  N  NE1 . TRP A  1  442 ? 0.395    -3.262   200.733 1.00 86.87  ? 442  TRP A NE1 1 
ATOM   3375  C  CE2 . TRP A  1  442 ? 1.747    -3.309   200.956 1.00 86.85  ? 442  TRP A CE2 1 
ATOM   3376  C  CE3 . TRP A  1  442 ? 3.386    -2.112   202.260 1.00 86.42  ? 442  TRP A CE3 1 
ATOM   3377  C  CZ2 . TRP A  1  442 ? 2.717    -4.156   200.427 1.00 87.24  ? 442  TRP A CZ2 1 
ATOM   3378  C  CZ3 . TRP A  1  442 ? 4.344    -2.950   201.740 1.00 86.80  ? 442  TRP A CZ3 1 
ATOM   3379  C  CH2 . TRP A  1  442 ? 4.008    -3.962   200.834 1.00 87.20  ? 442  TRP A CH2 1 
ATOM   3380  N  N   . VAL A  1  443 ? 2.453    -1.987   205.195 1.00 80.51  ? 443  VAL A N   1 
ATOM   3381  C  CA  . VAL A  1  443 ? 3.347    -3.093   205.523 1.00 80.66  ? 443  VAL A CA  1 
ATOM   3382  C  C   . VAL A  1  443 ? 2.740    -3.923   206.643 1.00 80.58  ? 443  VAL A C   1 
ATOM   3383  O  O   . VAL A  1  443 ? 2.712    -5.152   206.575 1.00 80.82  ? 443  VAL A O   1 
ATOM   3384  C  CB  . VAL A  1  443 ? 4.750    -2.594   205.950 1.00 80.71  ? 443  VAL A CB  1 
ATOM   3385  C  CG1 . VAL A  1  443 ? 5.576    -3.724   206.572 1.00 80.91  ? 443  VAL A CG1 1 
ATOM   3386  C  CG2 . VAL A  1  443 ? 5.489    -1.995   204.767 1.00 80.96  ? 443  VAL A CG2 1 
ATOM   3387  N  N   . CYS A  1  444 ? 2.252    -3.238   207.669 1.00 80.36  ? 444  CYS A N   1 
ATOM   3388  C  CA  . CYS A  1  444 ? 1.633    -3.899   208.809 1.00 80.40  ? 444  CYS A CA  1 
ATOM   3389  C  C   . CYS A  1  444 ? 0.411    -4.716   208.395 1.00 80.53  ? 444  CYS A C   1 
ATOM   3390  O  O   . CYS A  1  444 ? 0.139    -5.766   208.974 1.00 80.76  ? 444  CYS A O   1 
ATOM   3391  C  CB  . CYS A  1  444 ? 1.251    -2.868   209.871 1.00 80.25  ? 444  CYS A CB  1 
ATOM   3392  S  SG  . CYS A  1  444 ? 2.662    -2.251   210.815 1.00 80.29  ? 444  CYS A SG  1 
ATOM   3393  N  N   . ILE A  1  445 ? -0.333   -4.234   207.406 1.00 80.48  ? 445  ILE A N   1 
ATOM   3394  C  CA  . ILE A  1  445 ? -1.478   -4.983   206.907 1.00 80.70  ? 445  ILE A CA  1 
ATOM   3395  C  C   . ILE A  1  445 ? -0.997   -6.180   206.097 1.00 81.03  ? 445  ILE A C   1 
ATOM   3396  O  O   . ILE A  1  445 ? -1.549   -7.273   206.213 1.00 81.34  ? 445  ILE A O   1 
ATOM   3397  C  CB  . ILE A  1  445 ? -2.416   -4.107   206.051 1.00 80.69  ? 445  ILE A CB  1 
ATOM   3398  C  CG1 . ILE A  1  445 ? -3.065   -3.030   206.924 1.00 80.50  ? 445  ILE A CG1 1 
ATOM   3399  C  CG2 . ILE A  1  445 ? -3.513   -4.954   205.405 1.00 81.04  ? 445  ILE A CG2 1 
ATOM   3400  C  CD1 . ILE A  1  445 ? -3.627   -1.861   206.150 1.00 80.51  ? 445  ILE A CD1 1 
ATOM   3401  N  N   . PHE A  1  446 ? 0.031    -5.972   205.280 1.00 81.07  ? 446  PHE A N   1 
ATOM   3402  C  CA  . PHE A  1  446 ? 0.610    -7.057   204.494 1.00 81.48  ? 446  PHE A CA  1 
ATOM   3403  C  C   . PHE A  1  446 ? 1.152    -8.158   205.400 1.00 81.67  ? 446  PHE A C   1 
ATOM   3404  O  O   . PHE A  1  446 ? 0.854    -9.336   205.206 1.00 82.09  ? 446  PHE A O   1 
ATOM   3405  C  CB  . PHE A  1  446 ? 1.724    -6.539   203.586 1.00 81.58  ? 446  PHE A CB  1 
ATOM   3406  C  CG  . PHE A  1  446 ? 2.479    -7.630   202.886 1.00 82.10  ? 446  PHE A CG  1 
ATOM   3407  C  CD1 . PHE A  1  446 ? 2.057    -8.096   201.653 1.00 82.56  ? 446  PHE A CD1 1 
ATOM   3408  C  CD2 . PHE A  1  446 ? 3.599    -8.201   203.466 1.00 82.24  ? 446  PHE A CD2 1 
ATOM   3409  C  CE1 . PHE A  1  446 ? 2.741    -9.104   201.007 1.00 83.16  ? 446  PHE A CE1 1 
ATOM   3410  C  CE2 . PHE A  1  446 ? 4.287    -9.211   202.826 1.00 82.82  ? 446  PHE A CE2 1 
ATOM   3411  C  CZ  . PHE A  1  446 ? 3.859    -9.663   201.594 1.00 83.28  ? 446  PHE A CZ  1 
ATOM   3412  N  N   . LEU A  1  447 ? 1.953    -7.768   206.387 1.00 81.47  ? 447  LEU A N   1 
ATOM   3413  C  CA  . LEU A  1  447 ? 2.506    -8.725   207.336 1.00 81.74  ? 447  LEU A CA  1 
ATOM   3414  C  C   . LEU A  1  447 ? 1.386    -9.350   208.146 1.00 81.88  ? 447  LEU A C   1 
ATOM   3415  O  O   . LEU A  1  447 ? 1.454    -10.516  208.526 1.00 82.34  ? 447  LEU A O   1 
ATOM   3416  C  CB  . LEU A  1  447 ? 3.511    -8.058   208.273 1.00 81.57  ? 447  LEU A CB  1 
ATOM   3417  C  CG  . LEU A  1  447 ? 4.872    -7.701   207.683 1.00 81.65  ? 447  LEU A CG  1 
ATOM   3418  C  CD1 . LEU A  1  447 ? 5.670    -6.867   208.671 1.00 81.50  ? 447  LEU A CD1 1 
ATOM   3419  C  CD2 . LEU A  1  447 ? 5.629    -8.964   207.321 1.00 82.21  ? 447  LEU A CD2 1 
ATOM   3420  N  N   . GLY A  1  448 ? 0.356    -8.557   208.414 1.00 81.58  ? 448  GLY A N   1 
ATOM   3421  C  CA  . GLY A  1  448 ? -0.767   -9.014   209.203 1.00 81.77  ? 448  GLY A CA  1 
ATOM   3422  C  C   . GLY A  1  448 ? -1.452   -10.210  208.579 1.00 82.24  ? 448  GLY A C   1 
ATOM   3423  O  O   . GLY A  1  448 ? -1.647   -11.225  209.243 1.00 82.71  ? 448  GLY A O   1 
ATOM   3424  N  N   . PHE A  1  449 ? -1.816   -10.102  207.307 1.00 82.24  ? 449  PHE A N   1 
ATOM   3425  C  CA  . PHE A  1  449 ? -2.446   -11.222  206.620 1.00 82.79  ? 449  PHE A CA  1 
ATOM   3426  C  C   . PHE A  1  449 ? -1.451   -12.364  206.447 1.00 83.25  ? 449  PHE A C   1 
ATOM   3427  O  O   . PHE A  1  449 ? -1.702   -13.491  206.864 1.00 83.80  ? 449  PHE A O   1 
ATOM   3428  C  CB  . PHE A  1  449 ? -2.989   -10.802  205.249 1.00 82.80  ? 449  PHE A CB  1 
ATOM   3429  C  CG  . PHE A  1  449 ? -4.202   -9.918   205.313 1.00 82.58  ? 449  PHE A CG  1 
ATOM   3430  C  CD1 . PHE A  1  449 ? -5.370   -10.361  205.914 1.00 82.86  ? 449  PHE A CD1 1 
ATOM   3431  C  CD2 . PHE A  1  449 ? -4.184   -8.654   204.749 1.00 82.21  ? 449  PHE A CD2 1 
ATOM   3432  C  CE1 . PHE A  1  449 ? -6.489   -9.550   205.968 1.00 82.76  ? 449  PHE A CE1 1 
ATOM   3433  C  CE2 . PHE A  1  449 ? -5.299   -7.841   204.799 1.00 82.11  ? 449  PHE A CE2 1 
ATOM   3434  C  CZ  . PHE A  1  449 ? -6.455   -8.290   205.405 1.00 82.38  ? 449  PHE A CZ  1 
ATOM   3435  N  N   . HIS A  1  450 ? -0.297   -12.050  205.872 1.00 83.12  ? 450  HIS A N   1 
ATOM   3436  C  CA  . HIS A  1  450 ? 0.646    -13.072  205.423 1.00 83.67  ? 450  HIS A CA  1 
ATOM   3437  C  C   . HIS A  1  450 ? 1.453    -13.728  206.534 1.00 83.92  ? 450  HIS A C   1 
ATOM   3438  O  O   . HIS A  1  450 ? 2.436    -14.417  206.264 1.00 84.37  ? 450  HIS A O   1 
ATOM   3439  C  CB  . HIS A  1  450 ? 1.591    -12.462  204.393 1.00 83.56  ? 450  HIS A CB  1 
ATOM   3440  C  CG  . HIS A  1  450 ? 0.905    -12.058  203.130 1.00 83.60  ? 450  HIS A CG  1 
ATOM   3441  N  ND1 . HIS A  1  450 ? -0.359   -11.509  203.115 1.00 83.35  ? 450  HIS A ND1 1 
ATOM   3442  C  CD2 . HIS A  1  450 ? 1.303    -12.127  201.839 1.00 83.99  ? 450  HIS A CD2 1 
ATOM   3443  C  CE1 . HIS A  1  450 ? -0.711   -11.258  201.868 1.00 83.57  ? 450  HIS A CE1 1 
ATOM   3444  N  NE2 . HIS A  1  450 ? 0.282    -11.619  201.076 1.00 83.97  ? 450  HIS A NE2 1 
ATOM   3445  N  N   . SER A  1  451 ? 1.046    -13.509  207.777 1.00 86.96  ? 451  SER A N   1 
ATOM   3446  C  CA  . SER A  1  451 ? 1.624    -14.223  208.906 1.00 87.38  ? 451  SER A CA  1 
ATOM   3447  C  C   . SER A  1  451 ? 0.518    -14.933  209.664 1.00 87.80  ? 451  SER A C   1 
ATOM   3448  O  O   . SER A  1  451 ? 0.462    -16.162  209.698 1.00 102.80 ? 451  SER A O   1 
ATOM   3449  C  CB  . SER A  1  451 ? 2.377    -13.268  209.828 1.00 86.96  ? 451  SER A CB  1 
ATOM   3450  O  OG  . SER A  1  451 ? 1.479    -12.415  210.518 1.00 86.54  ? 451  SER A OG  1 
ATOM   3451  N  N   . PHE A  1  452 ? -0.369   -14.149  210.262 1.00 84.19  ? 452  PHE A N   1 
ATOM   3452  C  CA  . PHE A  1  452 ? -1.475   -14.698  211.026 1.00 84.64  ? 452  PHE A CA  1 
ATOM   3453  C  C   . PHE A  1  452 ? -2.470   -15.406  210.113 1.00 85.01  ? 452  PHE A C   1 
ATOM   3454  O  O   . PHE A  1  452 ? -3.023   -16.442  210.475 1.00 85.75  ? 452  PHE A O   1 
ATOM   3455  C  CB  . PHE A  1  452 ? -2.182   -13.602  211.818 1.00 84.20  ? 452  PHE A CB  1 
ATOM   3456  C  CG  . PHE A  1  452 ? -3.440   -14.067  212.480 1.00 84.72  ? 452  PHE A CG  1 
ATOM   3457  C  CD1 . PHE A  1  452 ? -3.381   -14.896  213.583 1.00 85.45  ? 452  PHE A CD1 1 
ATOM   3458  C  CD2 . PHE A  1  452 ? -4.680   -13.687  211.997 1.00 84.60  ? 452  PHE A CD2 1 
ATOM   3459  C  CE1 . PHE A  1  452 ? -4.533   -15.335  214.194 1.00 86.06  ? 452  PHE A CE1 1 
ATOM   3460  C  CE2 . PHE A  1  452 ? -5.838   -14.123  212.610 1.00 85.18  ? 452  PHE A CE2 1 
ATOM   3461  C  CZ  . PHE A  1  452 ? -5.761   -14.948  213.712 1.00 85.91  ? 452  PHE A CZ  1 
ATOM   3462  N  N   . GLY A  1  453 ? -2.706   -14.834  208.936 1.00 84.61  ? 453  GLY A N   1 
ATOM   3463  C  CA  . GLY A  1  453 ? -3.641   -15.408  207.984 1.00 85.02  ? 453  GLY A CA  1 
ATOM   3464  C  C   . GLY A  1  453 ? -3.248   -16.822  207.609 1.00 85.84  ? 453  GLY A C   1 
ATOM   3465  O  O   . GLY A  1  453 ? -4.101   -17.649  207.293 1.00 86.49  ? 453  GLY A O   1 
ATOM   3466  N  N   . LEU A  1  454 ? -1.949   -17.100  207.638 1.00 85.91  ? 454  LEU A N   1 
ATOM   3467  C  CA  . LEU A  1  454 ? -1.452   -18.440  207.355 1.00 86.79  ? 454  LEU A CA  1 
ATOM   3468  C  C   . LEU A  1  454 ? -1.921   -19.431  208.417 1.00 87.54  ? 454  LEU A C   1 
ATOM   3469  O  O   . LEU A  1  454 ? -2.363   -20.532  208.095 1.00 88.40  ? 454  LEU A O   1 
ATOM   3470  C  CB  . LEU A  1  454 ? 0.073    -18.447  207.278 1.00 86.75  ? 454  LEU A CB  1 
ATOM   3471  C  CG  . LEU A  1  454 ? 0.727    -17.546  206.232 1.00 86.19  ? 454  LEU A CG  1 
ATOM   3472  C  CD1 . LEU A  1  454 ? 2.238    -17.647  206.346 1.00 86.32  ? 454  LEU A CD1 1 
ATOM   3473  C  CD2 . LEU A  1  454 ? 0.276    -17.922  204.835 1.00 86.58  ? 454  LEU A CD2 1 
ATOM   3474  N  N   . TYR A  1  455 ? -1.816   -19.038  209.682 1.00 87.33  ? 455  TYR A N   1 
ATOM   3475  C  CA  . TYR A  1  455 ? -2.262   -19.889  210.780 1.00 88.14  ? 455  TYR A CA  1 
ATOM   3476  C  C   . TYR A  1  455 ? -3.750   -20.193  210.686 1.00 88.52  ? 455  TYR A C   1 
ATOM   3477  O  O   . TYR A  1  455 ? -4.184   -21.297  211.010 1.00 89.51  ? 455  TYR A O   1 
ATOM   3478  C  CB  . TYR A  1  455 ? -1.945   -19.239  212.129 1.00 87.87  ? 455  TYR A CB  1 
ATOM   3479  C  CG  . TYR A  1  455 ? -0.482   -19.297  212.501 1.00 87.91  ? 455  TYR A CG  1 
ATOM   3480  C  CD1 . TYR A  1  455 ? 0.397    -18.289  212.131 1.00 87.08  ? 455  TYR A CD1 1 
ATOM   3481  C  CD2 . TYR A  1  455 ? 0.020    -20.368  213.224 1.00 88.90  ? 455  TYR A CD2 1 
ATOM   3482  C  CE1 . TYR A  1  455 ? 1.734    -18.348  212.476 1.00 87.22  ? 455  TYR A CE1 1 
ATOM   3483  C  CE2 . TYR A  1  455 ? 1.350    -20.437  213.572 1.00 89.05  ? 455  TYR A CE2 1 
ATOM   3484  C  CZ  . TYR A  1  455 ? 2.204    -19.427  213.193 1.00 88.20  ? 455  TYR A CZ  1 
ATOM   3485  O  OH  . TYR A  1  455 ? 3.532    -19.497  213.540 1.00 88.44  ? 455  TYR A OH  1 
ATOM   3486  N  N   . ILE A  1  456 ? -4.531   -19.212  210.249 1.00 93.18  ? 456  ILE A N   1 
ATOM   3487  C  CA  . ILE A  1  456 ? -5.965   -19.407  210.087 1.00 93.55  ? 456  ILE A CA  1 
ATOM   3488  C  C   . ILE A  1  456 ? -6.235   -20.314  208.893 1.00 94.18  ? 456  ILE A C   1 
ATOM   3489  O  O   . ILE A  1  456 ? -7.192   -21.087  208.902 1.00 103.64 ? 456  ILE A O   1 
ATOM   3490  C  CB  . ILE A  1  456 ? -6.704   -18.060  209.928 1.00 92.72  ? 456  ILE A CB  1 
ATOM   3491  C  CG1 . ILE A  1  456 ? -6.571   -17.216  211.199 1.00 92.30  ? 456  ILE A CG1 1 
ATOM   3492  C  CG2 . ILE A  1  456 ? -8.176   -18.274  209.596 1.00 93.20  ? 456  ILE A CG2 1 
ATOM   3493  C  CD1 . ILE A  1  456 ? -7.005   -17.926  212.472 1.00 93.14  ? 456  ILE A CD1 1 
ATOM   3494  N  N   . HIS A  1  457 ? -5.399   -20.217  207.864 1.00 88.54  ? 457  HIS A N   1 
ATOM   3495  C  CA  . HIS A  1  457 ? -5.504   -21.129  206.732 1.00 89.28  ? 457  HIS A CA  1 
ATOM   3496  C  C   . HIS A  1  457 ? -5.263   -22.565  207.193 1.00 90.41  ? 457  HIS A C   1 
ATOM   3497  O  O   . HIS A  1  457 ? -5.964   -23.482  206.770 1.00 91.34  ? 457  HIS A O   1 
ATOM   3498  C  CB  . HIS A  1  457 ? -4.517   -20.746  205.627 1.00 88.87  ? 457  HIS A CB  1 
ATOM   3499  C  CG  . HIS A  1  457 ? -4.290   -21.830  204.619 1.00 89.81  ? 457  HIS A CG  1 
ATOM   3500  N  ND1 . HIS A  1  457 ? -5.043   -21.945  203.472 1.00 90.18  ? 457  HIS A ND1 1 
ATOM   3501  C  CD2 . HIS A  1  457 ? -3.389   -22.840  204.578 1.00 90.55  ? 457  HIS A CD2 1 
ATOM   3502  C  CE1 . HIS A  1  457 ? -4.621   -22.979  202.768 1.00 91.11  ? 457  HIS A CE1 1 
ATOM   3503  N  NE2 . HIS A  1  457 ? -3.618   -23.540  203.418 1.00 91.35  ? 457  HIS A NE2 1 
ATOM   3504  N  N   . ASN A  1  458 ? -4.279   -22.757  208.067 1.00 90.44  ? 458  ASN A N   1 
ATOM   3505  C  CA  . ASN A  1  458 ? -3.978   -24.090  208.584 1.00 91.61  ? 458  ASN A CA  1 
ATOM   3506  C  C   . ASN A  1  458 ? -5.062   -24.625  209.511 1.00 92.35  ? 458  ASN A C   1 
ATOM   3507  O  O   . ASN A  1  458 ? -5.552   -25.734  209.313 1.00 93.47  ? 458  ASN A O   1 
ATOM   3508  C  CB  . ASN A  1  458 ? -2.643   -24.098  209.329 1.00 91.53  ? 458  ASN A CB  1 
ATOM   3509  C  CG  . ASN A  1  458 ? -1.456   -24.265  208.406 1.00 91.53  ? 458  ASN A CG  1 
ATOM   3510  O  OD1 . ASN A  1  458 ? -1.513   -23.922  207.226 1.00 91.19  ? 458  ASN A OD1 1 
ATOM   3511  N  ND2 . ASN A  1  458 ? -0.372   -24.817  208.940 1.00 92.04  ? 458  ASN A ND2 1 
ATOM   3512  N  N   . ASP A  1  459 ? -5.428   -23.840  210.520 1.00 92.67  ? 459  ASP A N   1 
ATOM   3513  C  CA  . ASP A  1  459 ? -6.441   -24.267  211.484 1.00 93.44  ? 459  ASP A CA  1 
ATOM   3514  C  C   . ASP A  1  459 ? -7.730   -24.668  210.791 1.00 93.99  ? 459  ASP A C   1 
ATOM   3515  O  O   . ASP A  1  459 ? -8.400   -25.610  211.213 1.00 95.15  ? 459  ASP A O   1 
ATOM   3516  C  CB  . ASP A  1  459 ? -6.734   -23.164  212.503 1.00 92.74  ? 459  ASP A CB  1 
ATOM   3517  C  CG  . ASP A  1  459 ? -5.922   -23.310  213.769 1.00 93.05  ? 459  ASP A CG  1 
ATOM   3518  O  OD1 . ASP A  1  459 ? -6.246   -24.195  214.591 1.00 94.20  ? 459  ASP A OD1 1 
ATOM   3519  O  OD2 . ASP A  1  459 ? -4.956   -22.543  213.941 1.00 92.67  ? 459  ASP A OD2 1 
ATOM   3520  N  N   . THR A  1  460 ? -8.079   -23.954  209.729 1.00 92.41  ? 460  THR A N   1 
ATOM   3521  C  CA  . THR A  1  460 ? -9.302   -24.248  209.000 1.00 92.95  ? 460  THR A CA  1 
ATOM   3522  C  C   . THR A  1  460 ? -9.135   -25.499  208.146 1.00 94.00  ? 460  THR A C   1 
ATOM   3523  O  O   . THR A  1  460 ? -10.014  -26.359  208.124 1.00 95.11  ? 460  THR A O   1 
ATOM   3524  C  CB  . THR A  1  460 ? -9.729   -23.076  208.105 1.00 91.96  ? 460  THR A CB  1 
ATOM   3525  O  OG1 . THR A  1  460 ? -9.741   -21.868  208.875 1.00 90.99  ? 460  THR A OG1 1 
ATOM   3526  C  CG2 . THR A  1  460 ? -11.121  -23.326  207.546 1.00 92.62  ? 460  THR A CG2 1 
ATOM   3527  N  N   . MET A  1  461 ? -8.012   -25.605  207.443 1.00 93.76  ? 461  MET A N   1 
ATOM   3528  C  CA  . MET A  1  461 ? -7.768   -26.772  206.603 1.00 94.84  ? 461  MET A CA  1 
ATOM   3529  C  C   . MET A  1  461 ? -7.659   -28.032  207.452 1.00 96.12  ? 461  MET A C   1 
ATOM   3530  O  O   . MET A  1  461 ? -8.120   -29.100  207.045 1.00 97.36  ? 461  MET A O   1 
ATOM   3531  C  CB  . MET A  1  461 ? -6.501   -26.592  205.764 1.00 94.39  ? 461  MET A CB  1 
ATOM   3532  C  CG  . MET A  1  461 ? -6.671   -25.596  204.633 1.00 93.54  ? 461  MET A CG  1 
ATOM   3533  S  SD  . MET A  1  461 ? -7.767   -26.206  203.342 1.00 94.54  ? 461  MET A SD  1 
ATOM   3534  C  CE  . MET A  1  461 ? -8.036   -24.706  202.399 1.00 93.37  ? 461  MET A CE  1 
ATOM   3535  N  N   . ARG A  1  462 ? -7.052   -27.907  208.629 1.00 95.92  ? 462  ARG A N   1 
ATOM   3536  C  CA  . ARG A  1  462 ? -6.923   -29.041  209.537 1.00 97.21  ? 462  ARG A CA  1 
ATOM   3537  C  C   . ARG A  1  462 ? -8.304   -29.578  209.888 1.00 98.19  ? 462  ARG A C   1 
ATOM   3538  O  O   . ARG A  1  462 ? -8.596   -30.758  209.692 1.00 99.59  ? 462  ARG A O   1 
ATOM   3539  C  CB  . ARG A  1  462 ? -6.196   -28.652  210.826 1.00 96.83  ? 462  ARG A CB  1 
ATOM   3540  C  CG  . ARG A  1  462 ? -5.824   -29.864  211.677 1.00 98.28  ? 462  ARG A CG  1 
ATOM   3541  C  CD  . ARG A  1  462 ? -4.327   -30.131  211.697 1.00 98.34  ? 462  ARG A CD  1 
ATOM   3542  N  NE  . ARG A  1  462 ? -3.678   -29.476  212.832 1.00 97.79  ? 462  ARG A NE  1 
ATOM   3543  C  CZ  . ARG A  1  462 ? -2.368   -29.477  213.054 1.00 97.71  ? 462  ARG A CZ  1 
ATOM   3544  N  NH1 . ARG A  1  462 ? -1.546   -30.061  212.194 1.00 98.08  ? 462  ARG A NH1 1 
ATOM   3545  N  NH2 . ARG A  1  462 ? -1.876   -28.870  214.126 1.00 97.33  ? 462  ARG A NH2 1 
ATOM   3546  N  N   . ALA A  1  463 ? -9.147   -28.694  210.409 1.00 97.55  ? 463  ALA A N   1 
ATOM   3547  C  CA  . ALA A  1  463 ? -10.471  -29.067  210.886 1.00 98.47  ? 463  ALA A CA  1 
ATOM   3548  C  C   . ALA A  1  463 ? -11.327  -29.636  209.765 1.00 99.20  ? 463  ALA A C   1 
ATOM   3549  O  O   . ALA A  1  463 ? -12.214  -30.453  210.009 1.00 100.51 ? 463  ALA A O   1 
ATOM   3550  C  CB  . ALA A  1  463 ? -11.153  -27.870  211.503 1.00 97.55  ? 463  ALA A CB  1 
ATOM   3551  N  N   . LEU A  1  464 ? -11.052  -29.211  208.536 1.00 98.48  ? 464  LEU A N   1 
ATOM   3552  C  CA  . LEU A  1  464 ? -11.807  -29.690  207.386 1.00 99.20  ? 464  LEU A CA  1 
ATOM   3553  C  C   . LEU A  1  464 ? -11.233  -31.005  206.879 1.00 100.46 ? 464  LEU A C   1 
ATOM   3554  O  O   . LEU A  1  464 ? -11.663  -31.520  205.847 1.00 101.21 ? 464  LEU A O   1 
ATOM   3555  C  CB  . LEU A  1  464 ? -11.807  -28.653  206.262 1.00 98.04  ? 464  LEU A CB  1 
ATOM   3556  C  CG  . LEU A  1  464 ? -12.583  -27.369  206.552 1.00 97.00  ? 464  LEU A CG  1 
ATOM   3557  C  CD1 . LEU A  1  464 ? -12.247  -26.285  205.538 1.00 95.80  ? 464  LEU A CD1 1 
ATOM   3558  C  CD2 . LEU A  1  464 ? -14.080  -27.646  206.573 1.00 97.92  ? 464  LEU A CD2 1 
ATOM   3559  N  N   . GLY A  1  465 ? -10.264  -31.548  207.608 1.00 100.80 ? 465  GLY A N   1 
ATOM   3560  C  CA  . GLY A  1  465 ? -9.648   -32.801  207.224 1.00 102.09 ? 465  GLY A CA  1 
ATOM   3561  C  C   . GLY A  1  465 ? -8.938   -32.662  205.894 1.00 101.69 ? 465  GLY A C   1 
ATOM   3562  O  O   . GLY A  1  465 ? -9.077   -33.510  205.013 1.00 102.80 ? 465  GLY A O   1 
ATOM   3563  N  N   . ARG A  1  466 ? -8.180   -31.580  205.752 1.00 100.19 ? 466  ARG A N   1 
ATOM   3564  C  CA  . ARG A  1  466 ? -7.405   -31.334  204.542 1.00 99.79  ? 466  ARG A CA  1 
ATOM   3565  C  C   . ARG A  1  466 ? -5.965   -30.995  204.903 1.00 99.07  ? 466  ARG A C   1 
ATOM   3566  O  O   . ARG A  1  466 ? -5.456   -29.939  204.529 1.00 109.87 ? 466  ARG A O   1 
ATOM   3567  C  CB  . ARG A  1  466 ? -8.031   -30.201  203.725 1.00 98.73  ? 466  ARG A CB  1 
ATOM   3568  C  CG  . ARG A  1  466 ? -9.417   -30.527  203.194 1.00 99.54  ? 466  ARG A CG  1 
ATOM   3569  C  CD  . ARG A  1  466 ? -10.147  -29.285  202.708 1.00 98.47  ? 466  ARG A CD  1 
ATOM   3570  N  NE  . ARG A  1  466 ? -9.472   -28.653  201.578 1.00 97.81  ? 466  ARG A NE  1 
ATOM   3571  C  CZ  . ARG A  1  466 ? -9.948   -27.606  200.911 1.00 97.03  ? 466  ARG A CZ  1 
ATOM   3572  N  NH1 . ARG A  1  466 ? -11.115  -27.071  201.249 1.00 96.79  ? 466  ARG A NH1 1 
ATOM   3573  N  NH2 . ARG A  1  466 ? -9.265   -27.098  199.894 1.00 96.61  ? 466  ARG A NH2 1 
ATOM   3574  N  N   . PRO A  1  467 ? -5.298   -31.903  205.635 1.00 99.97  ? 467  PRO A N   1 
ATOM   3575  C  CA  . PRO A  1  467 ? -3.927   -31.656  206.092 1.00 99.47  ? 467  PRO A CA  1 
ATOM   3576  C  C   . PRO A  1  467 ? -2.912   -31.534  204.952 1.00 99.27  ? 467  PRO A C   1 
ATOM   3577  O  O   . PRO A  1  467 ? -1.799   -31.067  205.190 1.00 98.63  ? 467  PRO A O   1 
ATOM   3578  C  CB  . PRO A  1  467 ? -3.626   -32.876  206.971 1.00 100.90 ? 467  PRO A CB  1 
ATOM   3579  C  CG  . PRO A  1  467 ? -4.564   -33.929  206.515 1.00 102.33 ? 467  PRO A CG  1 
ATOM   3580  C  CD  . PRO A  1  467 ? -5.802   -33.208  206.095 1.00 101.63 ? 467  PRO A CD  1 
ATOM   3581  N  N   . GLN A  1  468 ? -3.277   -31.957  203.744 1.00 99.93  ? 468  GLN A N   1 
ATOM   3582  C  CA  . GLN A  1  468 ? -2.367   -31.846  202.605 1.00 99.91  ? 468  GLN A CA  1 
ATOM   3583  C  C   . GLN A  1  468 ? -2.308   -30.418  202.065 1.00 98.37  ? 468  GLN A C   1 
ATOM   3584  O  O   . GLN A  1  468 ? -1.359   -30.056  201.370 1.00 98.08  ? 468  GLN A O   1 
ATOM   3585  C  CB  . GLN A  1  468 ? -2.770   -32.810  201.479 1.00 101.32 ? 468  GLN A CB  1 
ATOM   3586  C  CG  . GLN A  1  468 ? -3.994   -32.408  200.654 1.00 101.16 ? 468  GLN A CG  1 
ATOM   3587  C  CD  . GLN A  1  468 ? -5.302   -32.642  201.377 1.00 101.43 ? 468  GLN A CD  1 
ATOM   3588  O  OE1 . GLN A  1  468 ? -5.342   -32.730  202.603 1.00 101.30 ? 468  GLN A OE1 1 
ATOM   3589  N  NE2 . GLN A  1  468 ? -6.382   -32.760  200.616 1.00 101.95 ? 468  GLN A NE2 1 
ATOM   3590  N  N   . ASP A  1  469 ? -3.319   -29.614  202.384 1.00 120.06 ? 469  ASP A N   1 
ATOM   3591  C  CA  . ASP A  1  469 ? -3.403   -28.243  201.878 1.00 118.71 ? 469  ASP A CA  1 
ATOM   3592  C  C   . ASP A  1  469 ? -2.702   -27.238  202.788 1.00 117.43 ? 469  ASP A C   1 
ATOM   3593  O  O   . ASP A  1  469 ? -2.169   -26.236  202.313 1.00 116.50 ? 469  ASP A O   1 
ATOM   3594  C  CB  . ASP A  1  469 ? -4.866   -27.834  201.686 1.00 121.94 ? 469  ASP A CB  1 
ATOM   3595  C  CG  . ASP A  1  469 ? -5.507   -28.496  200.477 1.00 129.42 ? 469  ASP A CG  1 
ATOM   3596  O  OD1 . ASP A  1  469 ? -4.771   -28.919  199.561 1.00 131.32 ? 469  ASP A OD1 1 
ATOM   3597  O  OD2 . ASP A  1  469 ? -6.752   -28.586  200.439 1.00 134.62 ? 469  ASP A OD2 1 
ATOM   3598  N  N   . MET A  1  470 ? -2.707   -27.499  204.090 1.00 102.17 ? 470  MET A N   1 
ATOM   3599  C  CA  . MET A  1  470 ? -2.131   -26.563  205.056 1.00 101.08 ? 470  MET A CA  1 
ATOM   3600  C  C   . MET A  1  470 ? -0.625   -26.380  204.875 1.00 100.86 ? 470  MET A C   1 
ATOM   3601  O  O   . MET A  1  470 ? 0.030    -27.161  204.187 1.00 101.71 ? 470  MET A O   1 
ATOM   3602  C  CB  . MET A  1  470 ? -2.415   -27.029  206.485 1.00 101.49 ? 470  MET A CB  1 
ATOM   3603  C  CG  . MET A  1  470 ? -2.187   -28.508  206.729 1.00 103.01 ? 470  MET A CG  1 
ATOM   3604  S  SD  . MET A  1  470 ? -1.952   -28.898  208.476 1.00 103.47 ? 470  MET A SD  1 
ATOM   3605  C  CE  . MET A  1  470 ? -3.185   -27.843  209.229 1.00 102.52 ? 470  MET A CE  1 
ATOM   3606  N  N   . PHE A  1  471 ? -0.088   -25.342  205.510 1.00 92.53  ? 471  PHE A N   1 
ATOM   3607  C  CA  . PHE A  1  471 ? 1.338    -25.036  205.435 1.00 92.28  ? 471  PHE A CA  1 
ATOM   3608  C  C   . PHE A  1  471 ? 2.127    -25.820  206.479 1.00 93.01  ? 471  PHE A C   1 
ATOM   3609  O  O   . PHE A  1  471 ? 1.963    -25.609  207.681 1.00 92.78  ? 471  PHE A O   1 
ATOM   3610  C  CB  . PHE A  1  471 ? 1.574    -23.537  205.619 1.00 90.91  ? 471  PHE A CB  1 
ATOM   3611  C  CG  . PHE A  1  471 ? 0.918    -22.690  204.570 1.00 90.26  ? 471  PHE A CG  1 
ATOM   3612  C  CD1 . PHE A  1  471 ? 1.356    -22.731  203.257 1.00 90.53  ? 471  PHE A CD1 1 
ATOM   3613  C  CD2 . PHE A  1  471 ? -0.133   -21.852  204.894 1.00 89.51  ? 471  PHE A CD2 1 
ATOM   3614  C  CE1 . PHE A  1  471 ? 0.755    -21.954  202.286 1.00 90.07  ? 471  PHE A CE1 1 
ATOM   3615  C  CE2 . PHE A  1  471 ? -0.739   -21.073  203.928 1.00 89.02  ? 471  PHE A CE2 1 
ATOM   3616  C  CZ  . PHE A  1  471 ? -0.294   -21.123  202.622 1.00 89.31  ? 471  PHE A CZ  1 
ATOM   3617  N  N   . SER A  1  472 ? 2.984    -26.722  206.011 1.00 137.83 ? 472  SER A N   1 
ATOM   3618  C  CA  . SER A  1  472 ? 3.755    -27.583  206.901 1.00 148.21 ? 472  SER A CA  1 
ATOM   3619  C  C   . SER A  1  472 ? 4.945    -28.215  206.187 1.00 150.01 ? 472  SER A C   1 
ATOM   3620  O  O   . SER A  1  472 ? 4.952    -28.325  204.961 1.00 159.96 ? 472  SER A O   1 
ATOM   3621  C  CB  . SER A  1  472 ? 2.861    -28.681  207.477 1.00 173.45 ? 472  SER A CB  1 
ATOM   3622  O  OG  . SER A  1  472 ? 3.610    -29.589  208.266 1.00 192.60 ? 472  SER A OG  1 
ATOM   3623  N  N   . ASP A  1  473 ? 5.956    -28.611  206.958 1.00 126.54 ? 473  ASP A N   1 
ATOM   3624  C  CA  . ASP A  1  473 ? 7.113    -29.313  206.411 1.00 128.73 ? 473  ASP A CA  1 
ATOM   3625  C  C   . ASP A  1  473 ? 6.664    -30.537  205.624 1.00 128.68 ? 473  ASP A C   1 
ATOM   3626  O  O   . ASP A  1  473 ? 7.259    -30.896  204.607 1.00 129.32 ? 473  ASP A O   1 
ATOM   3627  C  CB  . ASP A  1  473 ? 8.065    -29.754  207.528 1.00 132.86 ? 473  ASP A CB  1 
ATOM   3628  C  CG  . ASP A  1  473 ? 8.907    -28.616  208.069 1.00 127.05 ? 473  ASP A CG  1 
ATOM   3629  O  OD1 . ASP A  1  473 ? 9.530    -27.896  207.261 1.00 126.96 ? 473  ASP A OD1 1 
ATOM   3630  O  OD2 . ASP A  1  473 ? 8.956    -28.449  209.306 1.00 126.96 ? 473  ASP A OD2 1 
ATOM   3631  N  N   . THR A  1  474 ? 5.597    -31.164  206.106 1.00 118.81 ? 474  THR A N   1 
ATOM   3632  C  CA  . THR A  1  474 ? 5.085    -32.391  205.514 1.00 120.21 ? 474  THR A CA  1 
ATOM   3633  C  C   . THR A  1  474 ? 4.278    -32.114  204.247 1.00 119.88 ? 474  THR A C   1 
ATOM   3634  O  O   . THR A  1  474 ? 4.406    -32.828  203.253 1.00 120.90 ? 474  THR A O   1 
ATOM   3635  C  CB  . THR A  1  474 ? 4.209    -33.154  206.520 1.00 120.98 ? 474  THR A CB  1 
ATOM   3636  O  OG1 . THR A  1  474 ? 3.118    -32.325  206.936 1.00 119.83 ? 474  THR A OG1 1 
ATOM   3637  C  CG2 . THR A  1  474 ? 5.035    -33.554  207.735 1.00 121.61 ? 474  THR A CG2 1 
ATOM   3638  N  N   . ALA A  1  475 ? 3.449    -31.076  204.290 1.00 183.37 ? 475  ALA A N   1 
ATOM   3639  C  CA  . ALA A  1  475 ? 2.643    -30.682  203.137 1.00 189.90 ? 475  ALA A CA  1 
ATOM   3640  C  C   . ALA A  1  475 ? 3.392    -29.625  202.326 1.00 178.22 ? 475  ALA A C   1 
ATOM   3641  O  O   . ALA A  1  475 ? 4.585    -29.776  202.064 1.00 171.07 ? 475  ALA A O   1 
ATOM   3642  C  CB  . ALA A  1  475 ? 1.284    -30.165  203.595 1.00 196.44 ? 475  ALA A CB  1 
ATOM   3643  N  N   . ILE A  1  476 ? 2.699    -28.562  201.926 1.00 104.93 ? 476  ILE A N   1 
ATOM   3644  C  CA  . ILE A  1  476 ? 3.350    -27.413  201.311 1.00 103.97 ? 476  ILE A CA  1 
ATOM   3645  C  C   . ILE A  1  476 ? 4.044    -26.611  202.404 1.00 102.98 ? 476  ILE A C   1 
ATOM   3646  O  O   . ILE A  1  476 ? 3.501    -26.452  203.496 1.00 102.54 ? 476  ILE A O   1 
ATOM   3647  C  CB  . ILE A  1  476 ? 2.347    -26.530  200.538 1.00 103.21 ? 476  ILE A CB  1 
ATOM   3648  C  CG1 . ILE A  1  476 ? 1.246    -26.006  201.473 1.00 102.36 ? 476  ILE A CG1 1 
ATOM   3649  C  CG2 . ILE A  1  476 ? 1.738    -27.332  199.397 1.00 104.33 ? 476  ILE A CG2 1 
ATOM   3650  C  CD1 . ILE A  1  476 ? 0.271    -25.053  200.814 1.00 101.61 ? 476  ILE A CD1 1 
ATOM   3651  N  N   . GLN A  1  477 ? 5.253    -26.133  202.127 1.00 113.09 ? 477  GLN A N   1 
ATOM   3652  C  CA  . GLN A  1  477 ? 6.061    -25.501  203.163 1.00 112.41 ? 477  GLN A CA  1 
ATOM   3653  C  C   . GLN A  1  477 ? 6.782    -24.258  202.668 1.00 111.52 ? 477  GLN A C   1 
ATOM   3654  O  O   . GLN A  1  477 ? 7.272    -24.206  201.539 1.00 111.87 ? 477  GLN A O   1 
ATOM   3655  C  CB  . GLN A  1  477 ? 7.091    -26.490  203.728 1.00 113.48 ? 477  GLN A CB  1 
ATOM   3656  C  CG  . GLN A  1  477 ? 7.237    -27.813  202.971 1.00 115.00 ? 477  GLN A CG  1 
ATOM   3657  C  CD  . GLN A  1  477 ? 8.043    -27.680  201.693 1.00 115.36 ? 477  GLN A CD  1 
ATOM   3658  O  OE1 . GLN A  1  477 ? 7.499    -27.411  200.621 1.00 115.26 ? 477  GLN A OE1 1 
ATOM   3659  N  NE2 . GLN A  1  477 ? 9.353    -27.875  201.803 1.00 115.91 ? 477  GLN A NE2 1 
ATOM   3660  N  N   . LEU A  1  478 ? 6.828    -23.256  203.540 1.00 91.67  ? 478  LEU A N   1 
ATOM   3661  C  CA  . LEU A  1  478 ? 7.579    -22.039  203.291 1.00 90.86  ? 478  LEU A CA  1 
ATOM   3662  C  C   . LEU A  1  478 ? 8.916    -22.195  203.996 1.00 91.21  ? 478  LEU A C   1 
ATOM   3663  O  O   . LEU A  1  478 ? 8.996    -22.070  205.217 1.00 90.95  ? 478  LEU A O   1 
ATOM   3664  C  CB  . LEU A  1  478 ? 6.838    -20.796  203.804 1.00 89.59  ? 478  LEU A CB  1 
ATOM   3665  C  CG  . LEU A  1  478 ? 5.317    -20.664  203.624 1.00 89.22  ? 478  LEU A CG  1 
ATOM   3666  C  CD1 . LEU A  1  478 ? 4.810    -21.280  202.319 1.00 89.91  ? 478  LEU A CD1 1 
ATOM   3667  C  CD2 . LEU A  1  478 ? 4.568    -21.235  204.827 1.00 89.36  ? 478  LEU A CD2 1 
ATOM   3668  N  N   . GLN A  1  479 ? 9.966    -22.473  203.233 1.00 101.85 ? 479  GLN A N   1 
ATOM   3669  C  CA  . GLN A  1  479 ? 11.267   -22.753  203.825 1.00 102.41 ? 479  GLN A CA  1 
ATOM   3670  C  C   . GLN A  1  479 ? 12.110   -21.480  203.921 1.00 101.66 ? 479  GLN A C   1 
ATOM   3671  O  O   . GLN A  1  479 ? 12.288   -20.778  202.926 1.00 101.39 ? 479  GLN A O   1 
ATOM   3672  C  CB  . GLN A  1  479 ? 12.005   -23.818  203.011 1.00 103.79 ? 479  GLN A CB  1 
ATOM   3673  C  CG  . GLN A  1  479 ? 12.705   -24.867  203.863 1.00 104.84 ? 479  GLN A CG  1 
ATOM   3674  C  CD  . GLN A  1  479 ? 11.746   -25.650  204.742 1.00 105.07 ? 479  GLN A CD  1 
ATOM   3675  O  OE1 . GLN A  1  479 ? 10.551   -25.728  204.461 1.00 104.75 ? 479  GLN A OE1 1 
ATOM   3676  N  NE2 . GLN A  1  479 ? 12.266   -26.220  205.824 1.00 105.70 ? 479  GLN A NE2 1 
ATOM   3677  N  N   . PRO A  1  480 ? 12.628   -21.171  205.124 1.00 98.65  ? 480  PRO A N   1 
ATOM   3678  C  CA  . PRO A  1  480 ? 13.503   -20.003  205.261 1.00 98.09  ? 480  PRO A CA  1 
ATOM   3679  C  C   . PRO A  1  480 ? 14.855   -20.255  204.601 1.00 99.00  ? 480  PRO A C   1 
ATOM   3680  O  O   . PRO A  1  480 ? 15.851   -20.505  205.281 1.00 99.57  ? 480  PRO A O   1 
ATOM   3681  C  CB  . PRO A  1  480 ? 13.630   -19.834  206.778 1.00 97.86  ? 480  PRO A CB  1 
ATOM   3682  C  CG  . PRO A  1  480 ? 13.445   -21.200  207.318 1.00 98.82  ? 480  PRO A CG  1 
ATOM   3683  C  CD  . PRO A  1  480 ? 12.461   -21.880  206.407 1.00 99.03  ? 480  PRO A CD  1 
ATOM   3684  N  N   . ILE A  1  481 ? 14.862   -20.207  203.272 1.00 92.05  ? 481  ILE A N   1 
ATOM   3685  C  CA  . ILE A  1  481 ? 16.029   -20.563  202.475 1.00 93.10  ? 481  ILE A CA  1 
ATOM   3686  C  C   . ILE A  1  481 ? 17.271   -19.810  202.929 1.00 93.08  ? 481  ILE A C   1 
ATOM   3687  O  O   . ILE A  1  481 ? 18.367   -20.367  202.984 1.00 94.11  ? 481  ILE A O   1 
ATOM   3688  C  CB  . ILE A  1  481 ? 15.791   -20.256  200.975 1.00 93.21  ? 481  ILE A CB  1 
ATOM   3689  C  CG1 . ILE A  1  481 ? 14.554   -21.006  200.466 1.00 93.35  ? 481  ILE A CG1 1 
ATOM   3690  C  CG2 . ILE A  1  481 ? 17.038   -20.593  200.150 1.00 94.42  ? 481  ILE A CG2 1 
ATOM   3691  C  CD1 . ILE A  1  481 ? 14.237   -20.782  198.999 1.00 93.60  ? 481  ILE A CD1 1 
ATOM   3692  N  N   . PHE A  1  482 ? 17.082   -18.540  203.257 1.00 91.98  ? 482  PHE A N   1 
ATOM   3693  C  CA  . PHE A  1  482 ? 18.188   -17.654  203.589 1.00 91.92  ? 482  PHE A CA  1 
ATOM   3694  C  C   . PHE A  1  482 ? 18.780   -17.955  204.960 1.00 92.20  ? 482  PHE A C   1 
ATOM   3695  O  O   . PHE A  1  482 ? 19.986   -18.163  205.086 1.00 93.06  ? 482  PHE A O   1 
ATOM   3696  C  CB  . PHE A  1  482 ? 17.710   -16.211  203.507 1.00 90.74  ? 482  PHE A CB  1 
ATOM   3697  C  CG  . PHE A  1  482 ? 17.090   -15.876  202.187 1.00 90.55  ? 482  PHE A CG  1 
ATOM   3698  C  CD1 . PHE A  1  482 ? 17.860   -15.832  201.038 1.00 91.34  ? 482  PHE A CD1 1 
ATOM   3699  C  CD2 . PHE A  1  482 ? 15.730   -15.643  202.086 1.00 89.73  ? 482  PHE A CD2 1 
ATOM   3700  C  CE1 . PHE A  1  482 ? 17.290   -15.538  199.816 1.00 91.31  ? 482  PHE A CE1 1 
ATOM   3701  C  CE2 . PHE A  1  482 ? 15.153   -15.349  200.868 1.00 89.68  ? 482  PHE A CE2 1 
ATOM   3702  C  CZ  . PHE A  1  482 ? 15.933   -15.299  199.730 1.00 90.48  ? 482  PHE A CZ  1 
ATOM   3703  N  N   . ALA A  1  483 ? 17.930   -17.975  205.981 1.00 114.06 ? 483  ALA A N   1 
ATOM   3704  C  CA  . ALA A  1  483 ? 18.381   -18.234  207.344 1.00 114.37 ? 483  ALA A CA  1 
ATOM   3705  C  C   . ALA A  1  483 ? 19.096   -19.578  207.412 1.00 115.77 ? 483  ALA A C   1 
ATOM   3706  O  O   . ALA A  1  483 ? 20.057   -19.745  208.163 1.00 131.03 ? 483  ALA A O   1 
ATOM   3707  C  CB  . ALA A  1  483 ? 17.212   -18.205  208.306 1.00 113.67 ? 483  ALA A CB  1 
ATOM   3708  N  N   . GLN A  1  484 ? 18.616   -20.535  206.625 1.00 96.24  ? 484  GLN A N   1 
ATOM   3709  C  CA  . GLN A  1  484 ? 19.254   -21.839  206.537 1.00 97.68  ? 484  GLN A CA  1 
ATOM   3710  C  C   . GLN A  1  484 ? 20.605   -21.723  205.838 1.00 98.51  ? 484  GLN A C   1 
ATOM   3711  O  O   . GLN A  1  484 ? 21.584   -22.338  206.262 1.00 99.64  ? 484  GLN A O   1 
ATOM   3712  C  CB  . GLN A  1  484 ? 18.360   -22.832  205.792 1.00 98.07  ? 484  GLN A CB  1 
ATOM   3713  C  CG  . GLN A  1  484 ? 17.107   -23.240  206.554 1.00 97.64  ? 484  GLN A CG  1 
ATOM   3714  C  CD  . GLN A  1  484 ? 16.139   -24.074  205.725 1.00 97.96  ? 484  GLN A CD  1 
ATOM   3715  O  OE1 . GLN A  1  484 ? 15.027   -24.352  206.166 1.00 97.62  ? 484  GLN A OE1 1 
ATOM   3716  N  NE2 . GLN A  1  484 ? 16.557   -24.486  204.529 1.00 98.71  ? 484  GLN A NE2 1 
ATOM   3717  N  N   . TRP A  1  485 ? 20.656   -20.932  204.768 1.00 95.80  ? 485  TRP A N   1 
ATOM   3718  C  CA  . TRP A  1  485 ? 21.905   -20.710  204.049 1.00 96.61  ? 485  TRP A CA  1 
ATOM   3719  C  C   . TRP A  1  485 ? 22.911   -19.995  204.942 1.00 96.61  ? 485  TRP A C   1 
ATOM   3720  O  O   . TRP A  1  485 ? 24.108   -20.254  204.871 1.00 97.71  ? 485  TRP A O   1 
ATOM   3721  C  CB  . TRP A  1  485 ? 21.665   -19.907  202.766 1.00 96.14  ? 485  TRP A CB  1 
ATOM   3722  C  CG  . TRP A  1  485 ? 22.926   -19.359  202.156 1.00 96.81  ? 485  TRP A CG  1 
ATOM   3723  C  CD1 . TRP A  1  485 ? 24.054   -20.059  201.835 1.00 98.28  ? 485  TRP A CD1 1 
ATOM   3724  C  CD2 . TRP A  1  485 ? 23.184   -17.997  201.787 1.00 96.17  ? 485  TRP A CD2 1 
ATOM   3725  N  NE1 . TRP A  1  485 ? 24.997   -19.219  201.296 1.00 98.59  ? 485  TRP A NE1 1 
ATOM   3726  C  CE2 . TRP A  1  485 ? 24.486   -17.948  201.252 1.00 97.31  ? 485  TRP A CE2 1 
ATOM   3727  C  CE3 . TRP A  1  485 ? 22.438   -16.815  201.856 1.00 99.27  ? 485  TRP A CE3 1 
ATOM   3728  C  CZ2 . TRP A  1  485 ? 25.063   -16.765  200.794 1.00 97.17  ? 485  TRP A CZ2 1 
ATOM   3729  C  CZ3 . TRP A  1  485 ? 23.013   -15.639  201.398 1.00 97.53  ? 485  TRP A CZ3 1 
ATOM   3730  C  CH2 . TRP A  1  485 ? 24.312   -15.624  200.874 1.00 95.86  ? 485  TRP A CH2 1 
ATOM   3731  N  N   . VAL A  1  486 ? 22.412   -19.114  205.801 1.00 95.26  ? 486  VAL A N   1 
ATOM   3732  C  CA  . VAL A  1  486 ? 23.263   -18.402  206.746 1.00 95.26  ? 486  VAL A CA  1 
ATOM   3733  C  C   . VAL A  1  486 ? 23.897   -19.364  207.749 1.00 96.35  ? 486  VAL A C   1 
ATOM   3734  O  O   . VAL A  1  486 ? 25.080   -19.243  208.066 1.00 97.16  ? 486  VAL A O   1 
ATOM   3735  C  CB  . VAL A  1  486 ? 22.463   -17.311  207.496 1.00 93.87  ? 486  VAL A CB  1 
ATOM   3736  C  CG1 . VAL A  1  486 ? 23.225   -16.799  208.713 1.00 94.03  ? 486  VAL A CG1 1 
ATOM   3737  C  CG2 . VAL A  1  486 ? 22.142   -16.156  206.554 1.00 92.98  ? 486  VAL A CG2 1 
ATOM   3738  N  N   . GLN A  1  487 ? 23.111   -20.318  208.240 1.00 110.45 ? 487  GLN A N   1 
ATOM   3739  C  CA  . GLN A  1  487 ? 23.615   -21.325  209.170 1.00 111.63 ? 487  GLN A CA  1 
ATOM   3740  C  C   . GLN A  1  487 ? 24.731   -22.150  208.545 1.00 113.16 ? 487  GLN A C   1 
ATOM   3741  O  O   . GLN A  1  487 ? 25.733   -22.460  209.190 1.00 114.23 ? 487  GLN A O   1 
ATOM   3742  C  CB  . GLN A  1  487 ? 22.495   -22.268  209.607 1.00 111.63 ? 487  GLN A CB  1 
ATOM   3743  C  CG  . GLN A  1  487 ? 21.581   -21.735  210.690 1.00 110.62 ? 487  GLN A CG  1 
ATOM   3744  C  CD  . GLN A  1  487 ? 20.561   -22.771  211.122 1.00 110.89 ? 487  GLN A CD  1 
ATOM   3745  O  OE1 . GLN A  1  487 ? 20.671   -23.946  210.772 1.00 111.98 ? 487  GLN A OE1 1 
ATOM   3746  N  NE2 . GLN A  1  487 ? 19.556   -22.339  211.871 1.00 110.00 ? 487  GLN A NE2 1 
ATOM   3747  N  N   . HIS A  1  488 ? 24.539   -22.499  207.279 1.00 141.37 ? 488  HIS A N   1 
ATOM   3748  C  CA  . HIS A  1  488 ? 25.484   -23.324  206.539 1.00 150.03 ? 488  HIS A CA  1 
ATOM   3749  C  C   . HIS A  1  488 ? 26.838   -22.636  206.436 1.00 157.95 ? 488  HIS A C   1 
ATOM   3750  O  O   . HIS A  1  488 ? 27.880   -23.291  206.430 1.00 175.07 ? 488  HIS A O   1 
ATOM   3751  C  CB  . HIS A  1  488 ? 24.918   -23.629  205.149 1.00 154.09 ? 488  HIS A CB  1 
ATOM   3752  C  CG  . HIS A  1  488 ? 25.731   -24.604  204.357 1.00 169.61 ? 488  HIS A CG  1 
ATOM   3753  N  ND1 . HIS A  1  488 ? 26.443   -24.239  203.234 1.00 179.62 ? 488  HIS A ND1 1 
ATOM   3754  C  CD2 . HIS A  1  488 ? 25.942   -25.931  204.521 1.00 177.87 ? 488  HIS A CD2 1 
ATOM   3755  C  CE1 . HIS A  1  488 ? 27.053   -25.300  202.738 1.00 187.33 ? 488  HIS A CE1 1 
ATOM   3756  N  NE2 . HIS A  1  488 ? 26.768   -26.339  203.501 1.00 186.91 ? 488  HIS A NE2 1 
ATOM   3757  N  N   . LEU A  1  489 ? 26.814   -21.311  206.362 1.00 100.32 ? 489  LEU A N   1 
ATOM   3758  C  CA  . LEU A  1  489 ? 28.036   -20.521  206.286 1.00 100.76 ? 489  LEU A CA  1 
ATOM   3759  C  C   . LEU A  1  489 ? 28.707   -20.387  207.650 1.00 101.13 ? 489  LEU A C   1 
ATOM   3760  O  O   . LEU A  1  489 ? 29.933   -20.361  207.744 1.00 102.24 ? 489  LEU A O   1 
ATOM   3761  C  CB  . LEU A  1  489 ? 27.734   -19.137  205.714 1.00 99.52  ? 489  LEU A CB  1 
ATOM   3762  C  CG  . LEU A  1  489 ? 27.138   -19.126  204.305 1.00 99.25  ? 489  LEU A CG  1 
ATOM   3763  C  CD1 . LEU A  1  489 ? 26.803   -17.703  203.902 1.00 98.06  ? 489  LEU A CD1 1 
ATOM   3764  C  CD2 . LEU A  1  489 ? 28.069   -19.772  203.290 1.00 100.79 ? 489  LEU A CD2 1 
ATOM   3765  N  N   . HIS A  1  490 ? 27.903   -20.300  208.705 1.00 100.31 ? 490  HIS A N   1 
ATOM   3766  C  CA  . HIS A  1  490 ? 28.432   -20.130  210.054 1.00 100.67 ? 490  HIS A CA  1 
ATOM   3767  C  C   . HIS A  1  490 ? 29.113   -21.396  210.558 1.00 102.33 ? 490  HIS A C   1 
ATOM   3768  O  O   . HIS A  1  490 ? 30.114   -21.329  211.271 1.00 103.27 ? 490  HIS A O   1 
ATOM   3769  C  CB  . HIS A  1  490 ? 27.317   -19.732  211.022 1.00 99.45  ? 490  HIS A CB  1 
ATOM   3770  C  CG  . HIS A  1  490 ? 26.934   -18.288  210.943 1.00 98.05  ? 490  HIS A CG  1 
ATOM   3771  N  ND1 . HIS A  1  490 ? 26.406   -17.716  209.806 1.00 97.14  ? 490  HIS A ND1 1 
ATOM   3772  C  CD2 . HIS A  1  490 ? 27.012   -17.295  211.861 1.00 97.52  ? 490  HIS A CD2 1 
ATOM   3773  C  CE1 . HIS A  1  490 ? 26.172   -16.435  210.028 1.00 96.10  ? 490  HIS A CE1 1 
ATOM   3774  N  NE2 . HIS A  1  490 ? 26.529   -16.155  211.267 1.00 96.30  ? 490  HIS A NE2 1 
ATOM   3775  N  N   . THR A  1  491 ? 28.564   -22.548  210.187 1.00 102.79 ? 491  THR A N   1 
ATOM   3776  C  CA  . THR A  1  491 ? 29.114   -23.831  210.605 1.00 104.47 ? 491  THR A CA  1 
ATOM   3777  C  C   . THR A  1  491 ? 30.379   -24.169  209.820 1.00 105.91 ? 491  THR A C   1 
ATOM   3778  O  O   . THR A  1  491 ? 31.298   -24.794  210.349 1.00 107.42 ? 491  THR A O   1 
ATOM   3779  C  CB  . THR A  1  491 ? 28.087   -24.964  210.429 1.00 104.60 ? 491  THR A CB  1 
ATOM   3780  O  OG1 . THR A  1  491 ? 26.849   -24.592  211.048 1.00 103.23 ? 491  THR A OG1 1 
ATOM   3781  C  CG2 . THR A  1  491 ? 28.595   -26.255  211.056 1.00 106.38 ? 491  THR A CG2 1 
ATOM   3782  N  N   . LEU A  1  492 ? 30.422   -23.742  208.561 1.00 108.68 ? 492  LEU A N   1 
ATOM   3783  C  CA  . LEU A  1  492 ? 31.575   -23.980  207.698 1.00 110.05 ? 492  LEU A CA  1 
ATOM   3784  C  C   . LEU A  1  492 ? 32.561   -22.818  207.755 1.00 110.01 ? 492  LEU A C   1 
ATOM   3785  O  O   . LEU A  1  492 ? 33.417   -22.676  206.881 1.00 110.85 ? 492  LEU A O   1 
ATOM   3786  C  CB  . LEU A  1  492 ? 31.120   -24.191  206.252 1.00 109.92 ? 492  LEU A CB  1 
ATOM   3787  C  CG  . LEU A  1  492 ? 30.247   -25.409  205.953 1.00 110.25 ? 492  LEU A CG  1 
ATOM   3788  C  CD1 . LEU A  1  492 ? 29.656   -25.278  204.567 1.00 109.78 ? 492  LEU A CD1 1 
ATOM   3789  C  CD2 . LEU A  1  492 ? 31.043   -26.695  206.064 1.00 112.28 ? 492  LEU A CD2 1 
ATOM   3790  N  N   . ALA A  1  493 ? 32.443   -21.990  208.789 1.00 106.00 ? 493  ALA A N   1 
ATOM   3791  C  CA  . ALA A  1  493 ? 33.277   -20.800  208.905 1.00 105.88 ? 493  ALA A CA  1 
ATOM   3792  C  C   . ALA A  1  493 ? 34.689   -21.109  209.406 1.00 107.64 ? 493  ALA A C   1 
ATOM   3793  O  O   . ALA A  1  493 ? 35.656   -20.562  208.877 1.00 108.28 ? 493  ALA A O   1 
ATOM   3794  C  CB  . ALA A  1  493 ? 32.610   -19.775  209.817 1.00 104.39 ? 493  ALA A CB  1 
ATOM   3795  N  N   . PRO A  1  494 ? 34.820   -21.979  210.423 1.00 108.55 ? 494  PRO A N   1 
ATOM   3796  C  CA  . PRO A  1  494 ? 36.179   -22.306  210.874 1.00 110.38 ? 494  PRO A CA  1 
ATOM   3797  C  C   . PRO A  1  494 ? 37.015   -22.963  209.779 1.00 111.86 ? 494  PRO A C   1 
ATOM   3798  O  O   . PRO A  1  494 ? 36.466   -23.615  208.891 1.00 111.80 ? 494  PRO A O   1 
ATOM   3799  C  CB  . PRO A  1  494 ? 35.940   -23.278  212.037 1.00 111.09 ? 494  PRO A CB  1 
ATOM   3800  C  CG  . PRO A  1  494 ? 34.558   -22.993  212.498 1.00 109.37 ? 494  PRO A CG  1 
ATOM   3801  C  CD  . PRO A  1  494 ? 33.798   -22.626  211.265 1.00 108.07 ? 494  PRO A CD  1 
ATOM   3802  N  N   . GLY A  1  495 ? 38.330   -22.785  209.847 1.00 125.94 ? 495  GLY A N   1 
ATOM   3803  C  CA  . GLY A  1  495 ? 39.230   -23.377  208.876 1.00 130.19 ? 495  GLY A CA  1 
ATOM   3804  C  C   . GLY A  1  495 ? 39.058   -22.820  207.474 1.00 137.81 ? 495  GLY A C   1 
ATOM   3805  O  O   . GLY A  1  495 ? 39.578   -23.385  206.511 1.00 157.78 ? 495  GLY A O   1 
ATOM   3806  N  N   . ALA A  1  496 ? 38.328   -21.715  207.354 1.00 121.80 ? 496  ALA A N   1 
ATOM   3807  C  CA  . ALA A  1  496 ? 38.092   -21.090  206.056 1.00 121.16 ? 496  ALA A CA  1 
ATOM   3808  C  C   . ALA A  1  496 ? 37.926   -19.579  206.198 1.00 119.76 ? 496  ALA A C   1 
ATOM   3809  O  O   . ALA A  1  496 ? 38.880   -18.823  206.013 1.00 120.39 ? 496  ALA A O   1 
ATOM   3810  C  CB  . ALA A  1  496 ? 36.867   -21.702  205.390 1.00 120.31 ? 496  ALA A CB  1 
ATOM   3811  N  N   . THR A  1  497 ? 36.715   -19.144  206.530 1.00 123.93 ? 497  THR A N   1 
ATOM   3812  C  CA  . THR A  1  497 ? 36.440   -17.726  206.723 1.00 122.57 ? 497  THR A CA  1 
ATOM   3813  C  C   . THR A  1  497 ? 36.839   -17.273  208.127 1.00 122.59 ? 497  THR A C   1 
ATOM   3814  O  O   . THR A  1  497 ? 36.811   -16.083  208.434 1.00 123.44 ? 497  THR A O   1 
ATOM   3815  C  CB  . THR A  1  497 ? 34.957   -17.410  206.484 1.00 120.72 ? 497  THR A CB  1 
ATOM   3816  O  OG1 . THR A  1  497 ? 34.150   -18.126  207.427 1.00 120.22 ? 497  THR A OG1 1 
ATOM   3817  C  CG2 . THR A  1  497 ? 34.547   -17.803  205.068 1.00 120.77 ? 497  THR A CG2 1 
ATOM   3818  N  N   . ALA A  1  498 ? 37.195   -18.232  208.978 1.00 108.29 ? 498  ALA A N   1 
ATOM   3819  C  CA  . ALA A  1  498 ? 37.700   -17.938  210.316 1.00 108.68 ? 498  ALA A CA  1 
ATOM   3820  C  C   . ALA A  1  498 ? 38.768   -18.960  210.699 1.00 110.72 ? 498  ALA A C   1 
ATOM   3821  O  O   . ALA A  1  498 ? 38.569   -19.749  211.622 1.00 111.15 ? 498  ALA A O   1 
ATOM   3822  C  CB  . ALA A  1  498 ? 36.567   -17.940  211.328 1.00 107.42 ? 498  ALA A CB  1 
ATOM   3823  N  N   . PRO A  1  499 ? 39.910   -18.944  209.989 1.00 119.19 ? 499  PRO A N   1 
ATOM   3824  C  CA  . PRO A  1  499 ? 40.955   -19.966  210.158 1.00 121.30 ? 499  PRO A CA  1 
ATOM   3825  C  C   . PRO A  1  499 ? 41.525   -20.071  211.571 1.00 122.20 ? 499  PRO A C   1 
ATOM   3826  O  O   . PRO A  1  499 ? 41.843   -21.175  212.013 1.00 123.56 ? 499  PRO A O   1 
ATOM   3827  C  CB  . PRO A  1  499 ? 42.050   -19.512  209.185 1.00 122.38 ? 499  PRO A CB  1 
ATOM   3828  C  CG  . PRO A  1  499 ? 41.370   -18.620  208.215 1.00 120.87 ? 499  PRO A CG  1 
ATOM   3829  C  CD  . PRO A  1  499 ? 40.292   -17.937  208.984 1.00 118.95 ? 499  PRO A CD  1 
ATOM   3830  N  N   . ASN A  1  500 ? 41.651   -18.946  212.266 1.00 131.81 ? 500  ASN A N   1 
ATOM   3831  C  CA  . ASN A  1  500 ? 42.222   -18.945  213.609 1.00 132.76 ? 500  ASN A CA  1 
ATOM   3832  C  C   . ASN A  1  500 ? 41.178   -19.295  214.666 1.00 131.88 ? 500  ASN A C   1 
ATOM   3833  O  O   . ASN A  1  500 ? 41.503   -19.437  215.846 1.00 132.71 ? 500  ASN A O   1 
ATOM   3834  C  CB  . ASN A  1  500 ? 42.844   -17.585  213.918 1.00 139.56 ? 500  ASN A CB  1 
ATOM   3835  C  CG  . ASN A  1  500 ? 44.006   -17.253  213.005 1.00 144.75 ? 500  ASN A CG  1 
ATOM   3836  O  OD1 . ASN A  1  500 ? 44.813   -18.118  212.664 1.00 153.37 ? 500  ASN A OD1 1 
ATOM   3837  N  ND2 . ASN A  1  500 ? 44.094   -15.991  212.600 1.00 136.85 ? 500  ASN A ND2 1 
ATOM   3838  N  N   . ALA A  1  501 ? 39.928   -19.436  214.235 1.00 129.26 ? 501  ALA A N   1 
ATOM   3839  C  CA  . ALA A  1  501 ? 38.863   -19.926  215.101 1.00 128.54 ? 501  ALA A CA  1 
ATOM   3840  C  C   . ALA A  1  501 ? 38.719   -21.432  214.921 1.00 129.55 ? 501  ALA A C   1 
ATOM   3841  O  O   . ALA A  1  501 ? 38.444   -21.911  213.821 1.00 129.38 ? 501  ALA A O   1 
ATOM   3842  C  CB  . ALA A  1  501 ? 37.553   -19.220  214.791 1.00 126.35 ? 501  ALA A CB  1 
ATOM   3843  N  N   . LEU A  1  502 ? 38.920   -22.176  216.004 1.00 148.20 ? 502  LEU A N   1 
ATOM   3844  C  CA  . LEU A  1  502 ? 38.888   -23.633  215.948 1.00 149.47 ? 502  LEU A CA  1 
ATOM   3845  C  C   . LEU A  1  502 ? 37.497   -24.143  215.589 1.00 148.18 ? 502  LEU A C   1 
ATOM   3846  O  O   . LEU A  1  502 ? 37.326   -24.842  214.589 1.00 148.38 ? 502  LEU A O   1 
ATOM   3847  C  CB  . LEU A  1  502 ? 39.339   -24.226  217.287 1.00 151.03 ? 502  LEU A CB  1 
ATOM   3848  C  CG  . LEU A  1  502 ? 39.565   -25.740  217.332 1.00 152.82 ? 502  LEU A CG  1 
ATOM   3849  C  CD1 . LEU A  1  502 ? 40.655   -26.078  218.336 1.00 154.93 ? 502  LEU A CD1 1 
ATOM   3850  C  CD2 . LEU A  1  502 ? 38.281   -26.490  217.677 1.00 152.98 ? 502  LEU A CD2 1 
ATOM   3851  N  N   . ALA A  1  503 ? 36.511   -23.784  216.405 1.00 144.43 ? 503  ALA A N   1 
ATOM   3852  C  CA  . ALA A  1  503 ? 35.130   -24.209  216.191 1.00 143.22 ? 503  ALA A CA  1 
ATOM   3853  C  C   . ALA A  1  503 ? 34.219   -23.001  216.004 1.00 141.06 ? 503  ALA A C   1 
ATOM   3854  O  O   . ALA A  1  503 ? 34.632   -21.862  216.220 1.00 140.56 ? 503  ALA A O   1 
ATOM   3855  C  CB  . ALA A  1  503 ? 34.656   -25.066  217.353 1.00 144.11 ? 503  ALA A CB  1 
ATOM   3856  N  N   . THR A  1  504 ? 32.979   -23.255  215.596 1.00 120.89 ? 504  THR A N   1 
ATOM   3857  C  CA  . THR A  1  504 ? 32.028   -22.184  215.324 1.00 118.89 ? 504  THR A CA  1 
ATOM   3858  C  C   . THR A  1  504 ? 31.620   -21.461  216.607 1.00 118.27 ? 504  THR A C   1 
ATOM   3859  O  O   . THR A  1  504 ? 31.685   -22.029  217.697 1.00 119.23 ? 504  THR A O   1 
ATOM   3860  C  CB  . THR A  1  504 ? 30.770   -22.723  214.613 1.00 117.94 ? 504  THR A CB  1 
ATOM   3861  O  OG1 . THR A  1  504 ? 29.889   -21.636  214.303 1.00 116.08 ? 504  THR A OG1 1 
ATOM   3862  C  CG2 . THR A  1  504 ? 30.043   -23.741  215.483 1.00 118.43 ? 504  THR A CG2 1 
ATOM   3863  N  N   . ALA A  1  505 ? 31.186   -20.212  216.462 1.00 104.53 ? 505  ALA A N   1 
ATOM   3864  C  CA  . ALA A  1  505 ? 30.874   -19.353  217.605 1.00 103.97 ? 505  ALA A CA  1 
ATOM   3865  C  C   . ALA A  1  505 ? 29.710   -19.876  218.442 1.00 103.63 ? 505  ALA A C   1 
ATOM   3866  O  O   . ALA A  1  505 ? 29.691   -19.706  219.662 1.00 104.04 ? 505  ALA A O   1 
ATOM   3867  C  CB  . ALA A  1  505 ? 30.572   -17.943  217.123 1.00 102.44 ? 505  ALA A CB  1 
ATOM   3868  N  N   . SER A  1  506 ? 28.743   -20.508  217.787 1.00 111.84 ? 506  SER A N   1 
ATOM   3869  C  CA  . SER A  1  506 ? 27.616   -21.115  218.484 1.00 111.66 ? 506  SER A CA  1 
ATOM   3870  C  C   . SER A  1  506 ? 27.141   -22.346  217.730 1.00 112.01 ? 506  SER A C   1 
ATOM   3871  O  O   . SER A  1  506 ? 26.938   -22.303  216.516 1.00 111.33 ? 506  SER A O   1 
ATOM   3872  C  CB  . SER A  1  506 ? 26.470   -20.112  218.634 1.00 109.95 ? 506  SER A CB  1 
ATOM   3873  O  OG  . SER A  1  506 ? 25.407   -20.662  219.393 1.00 109.91 ? 506  SER A OG  1 
ATOM   3874  N  N   . TYR A  1  507 ? 26.954   -23.443  218.457 1.00 109.72 ? 507  TYR A N   1 
ATOM   3875  C  CA  . TYR A  1  507 ? 26.550   -24.701  217.844 1.00 110.32 ? 507  TYR A CA  1 
ATOM   3876  C  C   . TYR A  1  507 ? 25.070   -24.693  217.483 1.00 108.98 ? 507  TYR A C   1 
ATOM   3877  O  O   . TYR A  1  507 ? 24.537   -25.694  217.002 1.00 130.39 ? 507  TYR A O   1 
ATOM   3878  C  CB  . TYR A  1  507 ? 26.855   -25.873  218.776 1.00 112.15 ? 507  TYR A CB  1 
ATOM   3879  C  CG  . TYR A  1  507 ? 28.332   -26.086  219.016 1.00 113.74 ? 507  TYR A CG  1 
ATOM   3880  C  CD1 . TYR A  1  507 ? 29.015   -25.342  219.969 1.00 114.06 ? 507  TYR A CD1 1 
ATOM   3881  C  CD2 . TYR A  1  507 ? 29.046   -27.022  218.282 1.00 115.01 ? 507  TYR A CD2 1 
ATOM   3882  C  CE1 . TYR A  1  507 ? 30.365   -25.532  220.191 1.00 115.60 ? 507  TYR A CE1 1 
ATOM   3883  C  CE2 . TYR A  1  507 ? 30.397   -27.218  218.495 1.00 116.55 ? 507  TYR A CE2 1 
ATOM   3884  C  CZ  . TYR A  1  507 ? 31.052   -26.470  219.450 1.00 116.84 ? 507  TYR A CZ  1 
ATOM   3885  O  OH  . TYR A  1  507 ? 32.397   -26.663  219.666 1.00 118.46 ? 507  TYR A OH  1 
ATOM   3886  N  N   . ALA A  1  508 ? 24.409   -23.562  217.712 1.00 102.11 ? 508  ALA A N   1 
ATOM   3887  C  CA  . ALA A  1  508 ? 23.023   -23.393  217.309 1.00 100.78 ? 508  ALA A CA  1 
ATOM   3888  C  C   . ALA A  1  508 ? 22.932   -23.317  215.788 1.00 100.08 ? 508  ALA A C   1 
ATOM   3889  O  O   . ALA A  1  508 ? 21.897   -23.631  215.201 1.00 99.46  ? 508  ALA A O   1 
ATOM   3890  C  CB  . ALA A  1  508 ? 22.433   -22.149  217.949 1.00 99.51  ? 508  ALA A CB  1 
ATOM   3891  N  N   . PHE A  1  509 ? 24.025   -22.896  215.158 1.00 100.58 ? 509  PHE A N   1 
ATOM   3892  C  CA  . PHE A  1  509 ? 24.089   -22.816  213.704 1.00 100.17 ? 509  PHE A CA  1 
ATOM   3893  C  C   . PHE A  1  509 ? 24.304   -24.196  213.087 1.00 101.45 ? 509  PHE A C   1 
ATOM   3894  O  O   . PHE A  1  509 ? 23.848   -24.462  211.975 1.00 101.15 ? 509  PHE A O   1 
ATOM   3895  C  CB  . PHE A  1  509 ? 25.215   -21.872  213.270 1.00 100.11 ? 509  PHE A CB  1 
ATOM   3896  C  CG  . PHE A  1  509 ? 25.008   -20.440  213.684 1.00 98.85  ? 509  PHE A CG  1 
ATOM   3897  C  CD1 . PHE A  1  509 ? 23.787   -19.814  213.495 1.00 97.39  ? 509  PHE A CD1 1 
ATOM   3898  C  CD2 . PHE A  1  509 ? 26.040   -19.720  214.265 1.00 99.23  ? 509  PHE A CD2 1 
ATOM   3899  C  CE1 . PHE A  1  509 ? 23.601   -18.498  213.874 1.00 96.34  ? 509  PHE A CE1 1 
ATOM   3900  C  CE2 . PHE A  1  509 ? 25.858   -18.405  214.648 1.00 98.19  ? 509  PHE A CE2 1 
ATOM   3901  C  CZ  . PHE A  1  509 ? 24.637   -17.793  214.452 1.00 96.74  ? 509  PHE A CZ  1 
ATOM   3902  N  N   . GLY A  1  510 ? 24.992   -25.072  213.815 1.00 146.48 ? 510  GLY A N   1 
ATOM   3903  C  CA  . GLY A  1  510 ? 25.263   -26.418  213.339 1.00 151.19 ? 510  GLY A CA  1 
ATOM   3904  C  C   . GLY A  1  510 ? 26.535   -27.001  213.930 1.00 149.69 ? 510  GLY A C   1 
ATOM   3905  O  O   . GLY A  1  510 ? 27.453   -26.261  214.284 1.00 152.94 ? 510  GLY A O   1 
ATOM   3906  N  N   . GLY A  1  511 ? 26.586   -28.327  214.040 1.00 127.23 ? 511  GLY A N   1 
ATOM   3907  C  CA  . GLY A  1  511 ? 27.775   -29.020  214.512 1.00 129.13 ? 511  GLY A CA  1 
ATOM   3908  C  C   . GLY A  1  511 ? 27.476   -30.095  215.539 1.00 130.42 ? 511  GLY A C   1 
ATOM   3909  O  O   . GLY A  1  511 ? 26.385   -30.667  215.555 1.00 130.19 ? 511  GLY A O   1 
ATOM   3910  N  N   . GLU A  1  512 ? 28.455   -30.376  216.395 1.00 155.15 ? 512  GLU A N   1 
ATOM   3911  C  CA  . GLU A  1  512 ? 28.280   -31.361  217.456 1.00 156.60 ? 512  GLU A CA  1 
ATOM   3912  C  C   . GLU A  1  512 ? 27.232   -30.883  218.449 1.00 158.91 ? 512  GLU A C   1 
ATOM   3913  O  O   . GLU A  1  512 ? 27.136   -29.692  218.744 1.00 174.85 ? 512  GLU A O   1 
ATOM   3914  C  CB  . GLU A  1  512 ? 29.604   -31.630  218.182 1.00 158.43 ? 512  GLU A CB  1 
ATOM   3915  C  CG  . GLU A  1  512 ? 29.504   -32.608  219.362 1.00 181.04 ? 512  GLU A CG  1 
ATOM   3916  C  CD  . GLU A  1  512 ? 29.211   -34.034  218.937 1.00 189.74 ? 512  GLU A CD  1 
ATOM   3917  O  OE1 . GLU A  1  512 ? 30.071   -34.909  219.171 1.00 197.26 ? 512  GLU A OE1 1 
ATOM   3918  O  OE2 . GLU A  1  512 ? 28.118   -34.285  218.387 1.00 188.22 ? 512  GLU A OE2 1 
ATOM   3919  N  N   . THR A  1  513 ? 26.449   -31.827  218.959 1.00 137.37 ? 513  THR A N   1 
ATOM   3920  C  CA  . THR A  1  513 ? 25.463   -31.541  219.991 1.00 136.78 ? 513  THR A CA  1 
ATOM   3921  C  C   . THR A  1  513 ? 26.107   -31.631  221.373 1.00 138.20 ? 513  THR A C   1 
ATOM   3922  O  O   . THR A  1  513 ? 26.237   -32.719  221.934 1.00 148.17 ? 513  THR A O   1 
ATOM   3923  C  CB  . THR A  1  513 ? 24.270   -32.512  219.907 1.00 137.03 ? 513  THR A CB  1 
ATOM   3924  O  OG1 . THR A  1  513 ? 24.717   -33.851  220.155 1.00 145.65 ? 513  THR A OG1 1 
ATOM   3925  C  CG2 . THR A  1  513 ? 23.626   -32.448  218.525 1.00 135.76 ? 513  THR A CG2 1 
ATOM   3926  N  N   . ILE A  1  514 ? 26.512   -30.486  221.915 1.00 113.34 ? 514  ILE A N   1 
ATOM   3927  C  CA  . ILE A  1  514 ? 27.193   -30.446  223.207 1.00 114.70 ? 514  ILE A CA  1 
ATOM   3928  C  C   . ILE A  1  514 ? 26.245   -30.857  224.325 1.00 115.23 ? 514  ILE A C   1 
ATOM   3929  O  O   . ILE A  1  514 ? 25.087   -30.439  224.357 1.00 113.85 ? 514  ILE A O   1 
ATOM   3930  C  CB  . ILE A  1  514 ? 27.767   -29.039  223.517 1.00 113.74 ? 514  ILE A CB  1 
ATOM   3931  C  CG1 . ILE A  1  514 ? 29.066   -28.799  222.744 1.00 114.06 ? 514  ILE A CG1 1 
ATOM   3932  C  CG2 . ILE A  1  514 ? 28.058   -28.871  225.012 1.00 114.89 ? 514  ILE A CG2 1 
ATOM   3933  C  CD1 . ILE A  1  514 ? 28.901   -28.711  221.245 1.00 112.88 ? 514  ILE A CD1 1 
ATOM   3934  N  N   . ALA A  1  515 ? 26.749   -31.687  225.233 1.00 121.23 ? 515  ALA A N   1 
ATOM   3935  C  CA  . ALA A  1  515 ? 25.969   -32.160  226.369 1.00 122.14 ? 515  ALA A CA  1 
ATOM   3936  C  C   . ALA A  1  515 ? 26.801   -32.119  227.644 1.00 123.86 ? 515  ALA A C   1 
ATOM   3937  O  O   . ALA A  1  515 ? 28.003   -32.382  227.622 1.00 125.16 ? 515  ALA A O   1 
ATOM   3938  C  CB  . ALA A  1  515 ? 25.465   -33.568  226.114 1.00 123.36 ? 515  ALA A CB  1 
ATOM   3939  N  N   . VAL A  1  516 ? 26.150   -31.775  228.750 1.00 120.05 ? 516  VAL A N   1 
ATOM   3940  C  CA  . VAL A  1  516 ? 26.767   -31.823  230.070 1.00 121.90 ? 516  VAL A CA  1 
ATOM   3941  C  C   . VAL A  1  516 ? 25.820   -32.568  230.998 1.00 123.08 ? 516  VAL A C   1 
ATOM   3942  O  O   . VAL A  1  516 ? 24.603   -32.493  230.831 1.00 121.90 ? 516  VAL A O   1 
ATOM   3943  C  CB  . VAL A  1  516 ? 27.060   -30.422  230.633 1.00 120.95 ? 516  VAL A CB  1 
ATOM   3944  C  CG1 . VAL A  1  516 ? 27.934   -30.528  231.877 1.00 123.12 ? 516  VAL A CG1 1 
ATOM   3945  C  CG2 . VAL A  1  516 ? 27.735   -29.555  229.582 1.00 119.40 ? 516  VAL A CG2 1 
ATOM   3946  N  N   . ALA A  1  517 ? 26.378   -33.294  231.963 1.00 156.57 ? 517  ALA A N   1 
ATOM   3947  C  CA  . ALA A  1  517 ? 25.591   -34.209  232.779 1.00 158.13 ? 517  ALA A CA  1 
ATOM   3948  C  C   . ALA A  1  517 ? 24.878   -35.189  231.848 1.00 159.53 ? 517  ALA A C   1 
ATOM   3949  O  O   . ALA A  1  517 ? 25.532   -35.974  231.161 1.00 177.04 ? 517  ALA A O   1 
ATOM   3950  C  CB  . ALA A  1  517 ? 24.599   -33.445  233.661 1.00 157.38 ? 517  ALA A CB  1 
ATOM   3951  N  N   . GLY A  1  518 ? 23.549   -35.152  231.831 1.00 147.49 ? 518  GLY A N   1 
ATOM   3952  C  CA  . GLY A  1  518 ? 22.769   -35.908  230.869 1.00 146.98 ? 518  GLY A CA  1 
ATOM   3953  C  C   . GLY A  1  518 ? 21.866   -34.983  230.075 1.00 144.25 ? 518  GLY A C   1 
ATOM   3954  O  O   . GLY A  1  518 ? 20.874   -35.425  229.500 1.00 143.66 ? 518  GLY A O   1 
ATOM   3955  N  N   . LYS A  1  519 ? 22.220   -33.700  230.043 1.00 126.48 ? 519  LYS A N   1 
ATOM   3956  C  CA  . LYS A  1  519 ? 21.371   -32.660  229.462 1.00 123.97 ? 519  LYS A CA  1 
ATOM   3957  C  C   . LYS A  1  519 ? 22.031   -32.005  228.249 1.00 122.37 ? 519  LYS A C   1 
ATOM   3958  O  O   . LYS A  1  519 ? 23.247   -32.085  228.079 1.00 123.13 ? 519  LYS A O   1 
ATOM   3959  C  CB  . LYS A  1  519 ? 21.049   -31.597  230.518 1.00 123.48 ? 519  LYS A CB  1 
ATOM   3960  C  CG  . LYS A  1  519 ? 20.652   -32.165  231.881 1.00 125.43 ? 519  LYS A CG  1 
ATOM   3961  C  CD  . LYS A  1  519 ? 19.152   -32.124  232.114 1.00 124.78 ? 519  LYS A CD  1 
ATOM   3962  C  CE  . LYS A  1  519 ? 18.682   -30.754  232.571 1.00 123.30 ? 519  LYS A CE  1 
ATOM   3963  N  NZ  . LYS A  1  519 ? 17.653   -30.881  233.637 1.00 124.17 ? 519  LYS A NZ  1 
ATOM   3964  N  N   . VAL A  1  520 ? 21.221   -31.364  227.409 1.00 114.96 ? 520  VAL A N   1 
ATOM   3965  C  CA  . VAL A  1  520 ? 21.726   -30.625  226.254 1.00 113.36 ? 520  VAL A CA  1 
ATOM   3966  C  C   . VAL A  1  520 ? 22.027   -29.179  226.635 1.00 112.15 ? 520  VAL A C   1 
ATOM   3967  O  O   . VAL A  1  520 ? 21.140   -28.451  227.083 1.00 111.13 ? 520  VAL A O   1 
ATOM   3968  C  CB  . VAL A  1  520 ? 20.716   -30.642  225.083 1.00 111.78 ? 520  VAL A CB  1 
ATOM   3969  C  CG1 . VAL A  1  520 ? 21.175   -29.729  223.947 1.00 110.11 ? 520  VAL A CG1 1 
ATOM   3970  C  CG2 . VAL A  1  520 ? 20.517   -32.059  224.573 1.00 113.02 ? 520  VAL A CG2 1 
ATOM   3971  N  N   . ALA A  1  521 ? 23.279   -28.768  226.455 1.00 113.16 ? 521  ALA A N   1 
ATOM   3972  C  CA  . ALA A  1  521 ? 23.671   -27.384  226.697 1.00 112.08 ? 521  ALA A CA  1 
ATOM   3973  C  C   . ALA A  1  521 ? 23.340   -26.514  225.485 1.00 109.91 ? 521  ALA A C   1 
ATOM   3974  O  O   . ALA A  1  521 ? 22.767   -25.432  225.619 1.00 108.49 ? 521  ALA A O   1 
ATOM   3975  C  CB  . ALA A  1  521 ? 25.152   -27.301  227.026 1.00 113.35 ? 521  ALA A CB  1 
ATOM   3976  N  N   . MET A  1  522 ? 23.707   -26.996  224.302 1.00 108.86 ? 522  MET A N   1 
ATOM   3977  C  CA  . MET A  1  522 ? 23.391   -26.302  223.059 1.00 107.02 ? 522  MET A CA  1 
ATOM   3978  C  C   . MET A  1  522 ? 23.584   -27.247  221.880 1.00 107.39 ? 522  MET A C   1 
ATOM   3979  O  O   . MET A  1  522 ? 24.500   -28.068  221.876 1.00 108.96 ? 522  MET A O   1 
ATOM   3980  C  CB  . MET A  1  522 ? 24.262   -25.052  222.893 1.00 106.25 ? 522  MET A CB  1 
ATOM   3981  C  CG  . MET A  1  522 ? 24.011   -24.282  221.602 1.00 104.49 ? 522  MET A CG  1 
ATOM   3982  S  SD  . MET A  1  522 ? 22.262   -23.942  221.300 1.00 102.76 ? 522  MET A SD  1 
ATOM   3983  C  CE  . MET A  1  522 ? 21.783   -23.148  222.832 1.00 102.65 ? 522  MET A CE  1 
ATOM   3984  N  N   . MET A  1  523 ? 22.716   -27.125  220.882 1.00 110.58 ? 523  MET A N   1 
ATOM   3985  C  CA  . MET A  1  523 ? 22.783   -27.976  219.701 1.00 110.89 ? 523  MET A CA  1 
ATOM   3986  C  C   . MET A  1  523 ? 22.095   -27.294  218.522 1.00 109.09 ? 523  MET A C   1 
ATOM   3987  O  O   . MET A  1  523 ? 21.316   -26.363  218.722 1.00 107.69 ? 523  MET A O   1 
ATOM   3988  C  CB  . MET A  1  523 ? 22.153   -29.341  220.001 1.00 112.16 ? 523  MET A CB  1 
ATOM   3989  C  CG  . MET A  1  523 ? 20.687   -29.297  220.402 1.00 111.38 ? 523  MET A CG  1 
ATOM   3990  S  SD  . MET A  1  523 ? 20.021   -30.949  220.709 1.00 113.10 ? 523  MET A SD  1 
ATOM   3991  C  CE  . MET A  1  523 ? 19.988   -31.624  219.050 1.00 112.98 ? 523  MET A CE  1 
ATOM   3992  N  N   . PRO A  1  524 ? 22.391   -27.746  217.289 1.00 111.58 ? 524  PRO A N   1 
ATOM   3993  C  CA  . PRO A  1  524 ? 21.861   -27.106  216.078 1.00 110.07 ? 524  PRO A CA  1 
ATOM   3994  C  C   . PRO A  1  524 ? 20.352   -26.889  216.116 1.00 108.87 ? 524  PRO A C   1 
ATOM   3995  O  O   . PRO A  1  524 ? 19.592   -27.836  216.323 1.00 109.49 ? 524  PRO A O   1 
ATOM   3996  C  CB  . PRO A  1  524 ? 22.237   -28.094  214.973 1.00 111.00 ? 524  PRO A CB  1 
ATOM   3997  C  CG  . PRO A  1  524 ? 23.451   -28.774  215.486 1.00 112.78 ? 524  PRO A CG  1 
ATOM   3998  C  CD  . PRO A  1  524 ? 23.241   -28.904  216.961 1.00 113.32 ? 524  PRO A CD  1 
ATOM   3999  N  N   . ILE A  1  525 ? 19.936   -25.642  215.914 1.00 100.38 ? 525  ILE A N   1 
ATOM   4000  C  CA  . ILE A  1  525 ? 18.524   -25.288  215.891 1.00 99.18  ? 525  ILE A CA  1 
ATOM   4001  C  C   . ILE A  1  525 ? 18.041   -25.200  214.448 1.00 98.36  ? 525  ILE A C   1 
ATOM   4002  O  O   . ILE A  1  525 ? 18.095   -24.140  213.827 1.00 97.20  ? 525  ILE A O   1 
ATOM   4003  C  CB  . ILE A  1  525 ? 18.263   -23.954  216.625 1.00 98.02  ? 525  ILE A CB  1 
ATOM   4004  C  CG1 . ILE A  1  525 ? 18.841   -24.019  218.045 1.00 99.01  ? 525  ILE A CG1 1 
ATOM   4005  C  CG2 . ILE A  1  525 ? 16.765   -23.652  216.655 1.00 96.96  ? 525  ILE A CG2 1 
ATOM   4006  C  CD1 . ILE A  1  525 ? 18.600   -22.780  218.896 1.00 98.12  ? 525  ILE A CD1 1 
ATOM   4007  N  N   . THR A  1  526 ? 17.580   -26.329  213.918 1.00 110.50 ? 526  THR A N   1 
ATOM   4008  C  CA  . THR A  1  526 ? 17.080   -26.387  212.550 1.00 109.96 ? 526  THR A CA  1 
ATOM   4009  C  C   . THR A  1  526 ? 15.892   -25.449  212.371 1.00 108.38 ? 526  THR A C   1 
ATOM   4010  O  O   . THR A  1  526 ? 15.094   -25.263  213.289 1.00 108.03 ? 526  THR A O   1 
ATOM   4011  C  CB  . THR A  1  526 ? 16.644   -27.814  212.161 1.00 111.14 ? 526  THR A CB  1 
ATOM   4012  O  OG1 . THR A  1  526 ? 15.633   -28.273  213.067 1.00 111.33 ? 526  THR A OG1 1 
ATOM   4013  C  CG2 . THR A  1  526 ? 17.826   -28.774  212.193 1.00 112.82 ? 526  THR A CG2 1 
ATOM   4014  N  N   . LEU A  1  527 ? 15.787   -24.864  211.182 1.00 99.73  ? 527  LEU A N   1 
ATOM   4015  C  CA  . LEU A  1  527 ? 14.702   -23.944  210.857 1.00 98.31  ? 527  LEU A CA  1 
ATOM   4016  C  C   . LEU A  1  527 ? 13.807   -24.536  209.778 1.00 98.35  ? 527  LEU A C   1 
ATOM   4017  O  O   . LEU A  1  527 ? 14.274   -24.882  208.695 1.00 108.45 ? 527  LEU A O   1 
ATOM   4018  C  CB  . LEU A  1  527 ? 15.261   -22.599  210.394 1.00 97.32  ? 527  LEU A CB  1 
ATOM   4019  C  CG  . LEU A  1  527 ? 15.909   -21.746  211.485 1.00 97.04  ? 527  LEU A CG  1 
ATOM   4020  C  CD1 . LEU A  1  527 ? 16.761   -20.649  210.871 1.00 96.49  ? 527  LEU A CD1 1 
ATOM   4021  C  CD2 . LEU A  1  527 ? 14.842   -21.152  212.392 1.00 96.19  ? 527  LEU A CD2 1 
ATOM   4022  N  N   . GLY A  1  528 ? 12.520   -24.655  210.088 1.00 127.02 ? 528  GLY A N   1 
ATOM   4023  C  CA  . GLY A  1  528 ? 11.542   -25.170  209.147 1.00 127.06 ? 528  GLY A CA  1 
ATOM   4024  C  C   . GLY A  1  528 ? 10.472   -24.137  208.871 1.00 125.71 ? 528  GLY A C   1 
ATOM   4025  O  O   . GLY A  1  528 ? 10.612   -22.972  209.244 1.00 126.31 ? 528  GLY A O   1 
ATOM   4026  N  N   . THR A  1  529 ? 9.400    -24.559  208.212 1.00 93.54  ? 529  THR A N   1 
ATOM   4027  C  CA  . THR A  1  529 ? 8.306    -23.653  207.899 1.00 92.41  ? 529  THR A CA  1 
ATOM   4028  C  C   . THR A  1  529 ? 7.592    -23.225  209.175 1.00 91.90  ? 529  THR A C   1 
ATOM   4029  O  O   . THR A  1  529 ? 7.022    -22.137  209.241 1.00 90.83  ? 529  THR A O   1 
ATOM   4030  C  CB  . THR A  1  529 ? 7.292    -24.288  206.931 1.00 92.75  ? 529  THR A CB  1 
ATOM   4031  O  OG1 . THR A  1  529 ? 6.246    -23.351  206.651 1.00 91.69  ? 529  THR A OG1 1 
ATOM   4032  C  CG2 . THR A  1  529 ? 6.692    -25.556  207.521 1.00 93.80  ? 529  THR A CG2 1 
ATOM   4033  N  N   . ALA A  1  530 ? 7.611    -24.096  210.178 1.00 97.12  ? 530  ALA A N   1 
ATOM   4034  C  CA  . ALA A  1  530 ? 7.027    -23.780  211.473 1.00 96.89  ? 530  ALA A CA  1 
ATOM   4035  C  C   . ALA A  1  530 ? 7.722    -22.562  212.067 1.00 96.07  ? 530  ALA A C   1 
ATOM   4036  O  O   . ALA A  1  530 ? 7.095    -21.737  212.730 1.00 95.36  ? 530  ALA A O   1 
ATOM   4037  C  CB  . ALA A  1  530 ? 7.139    -24.967  212.411 1.00 98.21  ? 530  ALA A CB  1 
ATOM   4038  N  N   . ASP A  1  531 ? 9.026    -22.469  211.821 1.00 115.48 ? 531  ASP A N   1 
ATOM   4039  C  CA  . ASP A  1  531 ? 9.839    -21.353  212.292 1.00 121.80 ? 531  ASP A CA  1 
ATOM   4040  C  C   . ASP A  1  531 ? 9.718    -20.124  211.381 1.00 117.75 ? 531  ASP A C   1 
ATOM   4041  O  O   . ASP A  1  531 ? 9.739    -18.986  211.852 1.00 114.37 ? 531  ASP A O   1 
ATOM   4042  C  CB  . ASP A  1  531 ? 11.297   -21.793  212.399 1.00 123.19 ? 531  ASP A CB  1 
ATOM   4043  C  CG  . ASP A  1  531 ? 11.515   -22.808  213.504 1.00 116.92 ? 531  ASP A CG  1 
ATOM   4044  O  OD1 . ASP A  1  531 ? 11.105   -23.974  213.327 1.00 117.79 ? 531  ASP A OD1 1 
ATOM   4045  O  OD2 . ASP A  1  531 ? 12.091   -22.440  214.550 1.00 117.09 ? 531  ASP A OD2 1 
ATOM   4046  N  N   . PHE A  1  532 ? 9.605    -20.368  210.078 1.00 89.68  ? 532  PHE A N   1 
ATOM   4047  C  CA  . PHE A  1  532 ? 9.412    -19.309  209.085 1.00 88.74  ? 532  PHE A CA  1 
ATOM   4048  C  C   . PHE A  1  532 ? 8.208    -18.440  209.423 1.00 87.80  ? 532  PHE A C   1 
ATOM   4049  O  O   . PHE A  1  532 ? 8.259    -17.214  209.319 1.00 86.97  ? 532  PHE A O   1 
ATOM   4050  C  CB  . PHE A  1  532 ? 9.241    -19.945  207.699 1.00 89.15  ? 532  PHE A CB  1 
ATOM   4051  C  CG  . PHE A  1  532 ? 8.846    -18.982  206.607 1.00 88.37  ? 532  PHE A CG  1 
ATOM   4052  C  CD1 . PHE A  1  532 ? 7.534    -18.549  206.487 1.00 87.74  ? 532  PHE A CD1 1 
ATOM   4053  C  CD2 . PHE A  1  532 ? 9.770    -18.560  205.665 1.00 88.43  ? 532  PHE A CD2 1 
ATOM   4054  C  CE1 . PHE A  1  532 ? 7.162    -17.684  205.479 1.00 87.15  ? 532  PHE A CE1 1 
ATOM   4055  C  CE2 . PHE A  1  532 ? 9.401    -17.695  204.649 1.00 87.87  ? 532  PHE A CE2 1 
ATOM   4056  C  CZ  . PHE A  1  532 ? 8.094    -17.259  204.555 1.00 87.23  ? 532  PHE A CZ  1 
ATOM   4057  N  N   . MET A  1  533 ? 7.125    -19.090  209.830 1.00 88.68  ? 533  MET A N   1 
ATOM   4058  C  CA  . MET A  1  533 ? 5.874    -18.408  210.119 1.00 87.96  ? 533  MET A CA  1 
ATOM   4059  C  C   . MET A  1  533 ? 5.998    -17.513  211.350 1.00 87.51  ? 533  MET A C   1 
ATOM   4060  O  O   . MET A  1  533 ? 5.711    -16.319  211.280 1.00 86.66  ? 533  MET A O   1 
ATOM   4061  C  CB  . MET A  1  533 ? 4.753    -19.434  210.296 1.00 88.55  ? 533  MET A CB  1 
ATOM   4062  C  CG  . MET A  1  533 ? 4.369    -20.130  208.993 1.00 88.92  ? 533  MET A CG  1 
ATOM   4063  S  SD  . MET A  1  533 ? 3.164    -21.460  209.193 1.00 105.37 ? 533  MET A SD  1 
ATOM   4064  C  CE  . MET A  1  533 ? 1.700    -20.535  209.637 1.00 89.05  ? 533  MET A CE  1 
ATOM   4065  N  N   . VAL A  1  534 ? 6.417    -18.087  212.475 1.00 87.56  ? 534  VAL A N   1 
ATOM   4066  C  CA  . VAL A  1  534 ? 6.577    -17.315  213.707 1.00 87.34  ? 534  VAL A CA  1 
ATOM   4067  C  C   . VAL A  1  534 ? 7.573    -16.167  213.549 1.00 86.74  ? 534  VAL A C   1 
ATOM   4068  O  O   . VAL A  1  534 ? 7.500    -15.174  214.274 1.00 86.30  ? 534  VAL A O   1 
ATOM   4069  C  CB  . VAL A  1  534 ? 7.042    -18.197  214.887 1.00 88.38  ? 534  VAL A CB  1 
ATOM   4070  C  CG1 . VAL A  1  534 ? 5.923    -19.101  215.364 1.00 89.00  ? 534  VAL A CG1 1 
ATOM   4071  C  CG2 . VAL A  1  534 ? 8.262    -19.012  214.504 1.00 89.14  ? 534  VAL A CG2 1 
ATOM   4072  N  N   . HIS A  1  535 ? 8.501    -16.298  212.605 1.00 96.41  ? 535  HIS A N   1 
ATOM   4073  C  CA  . HIS A  1  535 ? 9.451    -15.225  212.338 1.00 95.94  ? 535  HIS A CA  1 
ATOM   4074  C  C   . HIS A  1  535 ? 8.718    -14.044  211.706 1.00 94.95  ? 535  HIS A C   1 
ATOM   4075  O  O   . HIS A  1  535 ? 8.970    -12.891  212.054 1.00 94.45  ? 535  HIS A O   1 
ATOM   4076  C  CB  . HIS A  1  535 ? 10.592   -15.704  211.435 1.00 96.43  ? 535  HIS A CB  1 
ATOM   4077  C  CG  . HIS A  1  535 ? 11.820   -16.120  212.185 1.00 97.23  ? 535  HIS A CG  1 
ATOM   4078  N  ND1 . HIS A  1  535 ? 11.982   -17.386  212.705 1.00 98.22  ? 535  HIS A ND1 1 
ATOM   4079  C  CD2 . HIS A  1  535 ? 12.942   -15.435  212.510 1.00 99.84  ? 535  HIS A CD2 1 
ATOM   4080  C  CE1 . HIS A  1  535 ? 13.153   -17.465  213.313 1.00 98.85  ? 535  HIS A CE1 1 
ATOM   4081  N  NE2 . HIS A  1  535 ? 13.755   -16.294  213.209 1.00 98.29  ? 535  HIS A NE2 1 
ATOM   4082  N  N   . HIS A  1  536 ? 7.809    -14.336  210.779 1.00 85.20  ? 536  HIS A N   1 
ATOM   4083  C  CA  . HIS A  1  536 ? 7.010    -13.295  210.138 1.00 84.40  ? 536  HIS A CA  1 
ATOM   4084  C  C   . HIS A  1  536 ? 5.876    -12.807  211.028 1.00 84.02  ? 536  HIS A C   1 
ATOM   4085  O  O   . HIS A  1  536 ? 5.263    -11.779  210.747 1.00 83.38  ? 536  HIS A O   1 
ATOM   4086  C  CB  . HIS A  1  536 ? 6.451    -13.789  208.806 1.00 84.48  ? 536  HIS A CB  1 
ATOM   4087  C  CG  . HIS A  1  536 ? 7.473    -13.852  207.716 1.00 84.74  ? 536  HIS A CG  1 
ATOM   4088  N  ND1 . HIS A  1  536 ? 8.713    -14.429  207.888 1.00 85.36  ? 536  HIS A ND1 1 
ATOM   4089  C  CD2 . HIS A  1  536 ? 7.446    -13.394  206.443 1.00 84.57  ? 536  HIS A CD2 1 
ATOM   4090  C  CE1 . HIS A  1  536 ? 9.402    -14.329  206.766 1.00 85.56  ? 536  HIS A CE1 1 
ATOM   4091  N  NE2 . HIS A  1  536 ? 8.655    -13.706  205.872 1.00 85.10  ? 536  HIS A NE2 1 
ATOM   4092  N  N   . ILE A  1  537 ? 5.592    -13.543  212.096 1.00 84.51  ? 537  ILE A N   1 
ATOM   4093  C  CA  . ILE A  1  537 ? 4.700    -13.045  213.133 1.00 84.32  ? 537  ILE A CA  1 
ATOM   4094  C  C   . ILE A  1  537 ? 5.458    -12.003  213.940 1.00 84.09  ? 537  ILE A C   1 
ATOM   4095  O  O   . ILE A  1  537 ? 4.904    -10.973  214.318 1.00 83.63  ? 537  ILE A O   1 
ATOM   4096  C  CB  . ILE A  1  537 ? 4.183    -14.172  214.053 1.00 85.10  ? 537  ILE A CB  1 
ATOM   4097  C  CG1 . ILE A  1  537 ? 3.176    -15.049  213.298 1.00 85.32  ? 537  ILE A CG1 1 
ATOM   4098  C  CG2 . ILE A  1  537 ? 3.554    -13.594  215.325 1.00 85.09  ? 537  ILE A CG2 1 
ATOM   4099  C  CD1 . ILE A  1  537 ? 1.812    -14.403  213.077 1.00 84.81  ? 537  ILE A CD1 1 
ATOM   4100  N  N   . HIS A  1  538 ? 6.732    -12.278  214.200 1.00 84.52  ? 538  HIS A N   1 
ATOM   4101  C  CA  . HIS A  1  538 ? 7.573    -11.343  214.936 1.00 84.44  ? 538  HIS A CA  1 
ATOM   4102  C  C   . HIS A  1  538 ? 7.807    -10.062  214.144 1.00 83.71  ? 538  HIS A C   1 
ATOM   4103  O  O   . HIS A  1  538 ? 7.752    -8.965   214.702 1.00 83.40  ? 538  HIS A O   1 
ATOM   4104  C  CB  . HIS A  1  538 ? 8.903    -11.998  215.308 1.00 85.18  ? 538  HIS A CB  1 
ATOM   4105  C  CG  . HIS A  1  538 ? 8.774    -13.040  216.373 1.00 86.04  ? 538  HIS A CG  1 
ATOM   4106  N  ND1 . HIS A  1  538 ? 9.712    -14.030  216.572 1.00 86.91  ? 538  HIS A ND1 1 
ATOM   4107  C  CD2 . HIS A  1  538 ? 7.807    -13.246  217.297 1.00 86.28  ? 538  HIS A CD2 1 
ATOM   4108  C  CE1 . HIS A  1  538 ? 9.330    -14.797  217.578 1.00 87.66  ? 538  HIS A CE1 1 
ATOM   4109  N  NE2 . HIS A  1  538 ? 8.176    -14.344  218.033 1.00 87.29  ? 538  HIS A NE2 1 
ATOM   4110  N  N   . ALA A  1  539 ? 8.072    -10.194  212.850 1.00 83.54  ? 539  ALA A N   1 
ATOM   4111  C  CA  . ALA A  1  539 ? 8.248    -9.020   212.006 1.00 82.97  ? 539  ALA A CA  1 
ATOM   4112  C  C   . ALA A  1  539 ? 6.959    -8.216   211.976 1.00 82.39  ? 539  ALA A C   1 
ATOM   4113  O  O   . ALA A  1  539 ? 6.981    -6.987   211.969 1.00 82.00  ? 539  ALA A O   1 
ATOM   4114  C  CB  . ALA A  1  539 ? 8.647    -9.412   210.613 1.00 83.06  ? 539  ALA A CB  1 
ATOM   4115  N  N   . PHE A  1  540 ? 5.837    -8.926   211.956 1.00 82.43  ? 540  PHE A N   1 
ATOM   4116  C  CA  . PHE A  1  540 ? 4.530    -8.290   211.965 1.00 82.02  ? 540  PHE A CA  1 
ATOM   4117  C  C   . PHE A  1  540 ? 4.304    -7.514   213.259 1.00 81.96  ? 540  PHE A C   1 
ATOM   4118  O  O   . PHE A  1  540 ? 4.014    -6.320   213.227 1.00 81.57  ? 540  PHE A O   1 
ATOM   4119  C  CB  . PHE A  1  540 ? 3.427    -9.331   211.789 1.00 82.25  ? 540  PHE A CB  1 
ATOM   4120  C  CG  . PHE A  1  540 ? 2.061    -8.810   212.098 1.00 82.01  ? 540  PHE A CG  1 
ATOM   4121  C  CD1 . PHE A  1  540 ? 1.575    -7.688   211.450 1.00 81.51  ? 540  PHE A CD1 1 
ATOM   4122  C  CD2 . PHE A  1  540 ? 1.266    -9.427   213.046 1.00 82.39  ? 540  PHE A CD2 1 
ATOM   4123  C  CE1 . PHE A  1  540 ? 0.322    -7.197   211.734 1.00 81.38  ? 540  PHE A CE1 1 
ATOM   4124  C  CE2 . PHE A  1  540 ? 0.010    -8.940   213.333 1.00 82.27  ? 540  PHE A CE2 1 
ATOM   4125  C  CZ  . PHE A  1  540 ? -0.463   -7.821   212.675 1.00 81.75  ? 540  PHE A CZ  1 
ATOM   4126  N  N   . THR A  1  541 ? 4.435    -8.193   214.394 1.00 82.47  ? 541  THR A N   1 
ATOM   4127  C  CA  . THR A  1  541 ? 4.177    -7.563   215.685 1.00 82.61  ? 541  THR A CA  1 
ATOM   4128  C  C   . THR A  1  541 ? 5.122    -6.393   215.957 1.00 82.45  ? 541  THR A C   1 
ATOM   4129  O  O   . THR A  1  541 ? 4.733    -5.419   216.600 1.00 82.35  ? 541  THR A O   1 
ATOM   4130  C  CB  . THR A  1  541 ? 4.292    -8.566   216.853 1.00 83.38  ? 541  THR A CB  1 
ATOM   4131  O  OG1 . THR A  1  541 ? 5.553    -9.245   216.791 1.00 83.78  ? 541  THR A OG1 1 
ATOM   4132  C  CG2 . THR A  1  541 ? 3.158    -9.583   216.813 1.00 83.66  ? 541  THR A CG2 1 
ATOM   4133  N  N   . ILE A  1  542 ? 6.358    -6.485   215.473 1.00 82.51  ? 542  ILE A N   1 
ATOM   4134  C  CA  . ILE A  1  542 ? 7.322    -5.406   215.671 1.00 82.46  ? 542  ILE A CA  1 
ATOM   4135  C  C   . ILE A  1  542 ? 6.923    -4.173   214.869 1.00 81.87  ? 542  ILE A C   1 
ATOM   4136  O  O   . ILE A  1  542 ? 6.955    -3.055   215.382 1.00 81.81  ? 542  ILE A O   1 
ATOM   4137  C  CB  . ILE A  1  542 ? 8.756    -5.831   215.273 1.00 82.78  ? 542  ILE A CB  1 
ATOM   4138  C  CG1 . ILE A  1  542 ? 9.325    -6.803   216.309 1.00 83.53  ? 542  ILE A CG1 1 
ATOM   4139  C  CG2 . ILE A  1  542 ? 9.679    -4.611   215.158 1.00 82.70  ? 542  ILE A CG2 1 
ATOM   4140  C  CD1 . ILE A  1  542 ? 10.590   -7.511   215.865 1.00 83.98  ? 542  ILE A CD1 1 
ATOM   4141  N  N   . HIS A  1  543 ? 6.542    -4.386   213.615 1.00 81.54  ? 543  HIS A N   1 
ATOM   4142  C  CA  . HIS A  1  543 ? 6.201    -3.284   212.724 1.00 81.11  ? 543  HIS A CA  1 
ATOM   4143  C  C   . HIS A  1  543 ? 4.989    -2.496   213.205 1.00 80.89  ? 543  HIS A C   1 
ATOM   4144  O  O   . HIS A  1  543 ? 4.959    -1.272   213.085 1.00 80.72  ? 543  HIS A O   1 
ATOM   4145  C  CB  . HIS A  1  543 ? 5.972    -3.806   211.306 1.00 80.97  ? 543  HIS A CB  1 
ATOM   4146  C  CG  . HIS A  1  543 ? 7.216    -3.827   210.476 1.00 81.14  ? 543  HIS A CG  1 
ATOM   4147  N  ND1 . HIS A  1  543 ? 8.157    -4.828   210.567 1.00 81.56  ? 543  HIS A ND1 1 
ATOM   4148  C  CD2 . HIS A  1  543 ? 7.676    -2.962   209.543 1.00 81.07  ? 543  HIS A CD2 1 
ATOM   4149  C  CE1 . HIS A  1  543 ? 9.144    -4.578   209.725 1.00 81.72  ? 543  HIS A CE1 1 
ATOM   4150  N  NE2 . HIS A  1  543 ? 8.876    -3.452   209.090 1.00 81.44  ? 543  HIS A NE2 1 
ATOM   4151  N  N   . VAL A  1  544 ? 3.989    -3.186   213.741 1.00 80.98  ? 544  VAL A N   1 
ATOM   4152  C  CA  . VAL A  1  544 ? 2.817    -2.502   214.271 1.00 80.90  ? 544  VAL A CA  1 
ATOM   4153  C  C   . VAL A  1  544 ? 3.212    -1.650   215.473 1.00 81.14  ? 544  VAL A C   1 
ATOM   4154  O  O   . VAL A  1  544 ? 2.745    -0.521   215.617 1.00 81.05  ? 544  VAL A O   1 
ATOM   4155  C  CB  . VAL A  1  544 ? 1.704    -3.487   214.676 1.00 81.11  ? 544  VAL A CB  1 
ATOM   4156  C  CG1 . VAL A  1  544 ? 0.529    -2.739   215.298 1.00 81.15  ? 544  VAL A CG1 1 
ATOM   4157  C  CG2 . VAL A  1  544 ? 1.242    -4.294   213.471 1.00 80.96  ? 544  VAL A CG2 1 
ATOM   4158  N  N   . THR A  1  545 ? 4.070    -2.189   216.333 1.00 81.55  ? 545  THR A N   1 
ATOM   4159  C  CA  . THR A  1  545 ? 4.529    -1.451   217.504 1.00 81.93  ? 545  THR A CA  1 
ATOM   4160  C  C   . THR A  1  545 ? 5.296    -0.199   217.088 1.00 81.76  ? 545  THR A C   1 
ATOM   4161  O  O   . THR A  1  545 ? 5.183    0.844    217.731 1.00 81.93  ? 545  THR A O   1 
ATOM   4162  C  CB  . THR A  1  545 ? 5.412    -2.317   218.422 1.00 82.52  ? 545  THR A CB  1 
ATOM   4163  O  OG1 . THR A  1  545 ? 4.794    -3.594   218.622 1.00 82.75  ? 545  THR A OG1 1 
ATOM   4164  C  CG2 . THR A  1  545 ? 5.589    -1.637   219.771 1.00 83.07  ? 545  THR A CG2 1 
ATOM   4165  N  N   . ALA A  1  546 ? 6.078    -0.302   216.019 1.00 81.52  ? 546  ALA A N   1 
ATOM   4166  C  CA  . ALA A  1  546 ? 6.785    0.860    215.493 1.00 81.44  ? 546  ALA A CA  1 
ATOM   4167  C  C   . ALA A  1  546 ? 5.789    1.877    214.950 1.00 81.12  ? 546  ALA A C   1 
ATOM   4168  O  O   . ALA A  1  546 ? 5.918    3.074    215.195 1.00 81.25  ? 546  ALA A O   1 
ATOM   4169  C  CB  . ALA A  1  546 ? 7.764    0.451    214.405 1.00 81.38  ? 546  ALA A CB  1 
ATOM   4170  N  N   . LEU A  1  547 ? 4.800    1.387    214.209 1.00 80.80  ? 547  LEU A N   1 
ATOM   4171  C  CA  . LEU A  1  547 ? 3.786    2.244    213.602 1.00 80.58  ? 547  LEU A CA  1 
ATOM   4172  C  C   . LEU A  1  547 ? 3.067    3.094    214.641 1.00 80.79  ? 547  LEU A C   1 
ATOM   4173  O  O   . LEU A  1  547 ? 2.883    4.294    214.450 1.00 80.84  ? 547  LEU A O   1 
ATOM   4174  C  CB  . LEU A  1  547 ? 2.777    1.397    212.823 1.00 80.34  ? 547  LEU A CB  1 
ATOM   4175  C  CG  . LEU A  1  547 ? 1.601    2.141    212.185 1.00 80.21  ? 547  LEU A CG  1 
ATOM   4176  C  CD1 . LEU A  1  547 ? 2.099    3.203    211.218 1.00 80.19  ? 547  LEU A CD1 1 
ATOM   4177  C  CD2 . LEU A  1  547 ? 0.682    1.165    211.473 1.00 80.09  ? 547  LEU A CD2 1 
ATOM   4178  N  N   . ILE A  1  548 ? 2.660    2.466    215.737 1.00 99.01  ? 548  ILE A N   1 
ATOM   4179  C  CA  . ILE A  1  548 ? 1.951    3.168    216.798 1.00 99.36  ? 548  ILE A CA  1 
ATOM   4180  C  C   . ILE A  1  548 ? 2.844    4.222    217.442 1.00 99.70  ? 548  ILE A C   1 
ATOM   4181  O  O   . ILE A  1  548 ? 2.398    5.333    217.729 1.00 99.92  ? 548  ILE A O   1 
ATOM   4182  C  CB  . ILE A  1  548 ? 1.445    2.188    217.874 1.00 99.70  ? 548  ILE A CB  1 
ATOM   4183  C  CG1 . ILE A  1  548 ? 0.415    1.240    217.265 1.00 106.94 ? 548  ILE A CG1 1 
ATOM   4184  C  CG2 . ILE A  1  548 ? 0.807    2.935    219.041 1.00 100.22 ? 548  ILE A CG2 1 
ATOM   4185  C  CD1 . ILE A  1  548 ? 0.195    -0.024   218.061 1.00 125.38 ? 548  ILE A CD1 1 
ATOM   4186  N  N   . LEU A  1  549 ? 4.105    3.872    217.663 1.00 81.86  ? 549  LEU A N   1 
ATOM   4187  C  CA  . LEU A  1  549 ? 5.037    4.777    218.322 1.00 82.31  ? 549  LEU A CA  1 
ATOM   4188  C  C   . LEU A  1  549 ? 5.555    5.843    217.359 1.00 82.16  ? 549  LEU A C   1 
ATOM   4189  O  O   . LEU A  1  549 ? 5.650    7.016    217.722 1.00 82.51  ? 549  LEU A O   1 
ATOM   4190  C  CB  . LEU A  1  549 ? 6.204    3.995    218.929 1.00 82.65  ? 549  LEU A CB  1 
ATOM   4191  C  CG  . LEU A  1  549 ? 5.824    3.012    220.043 1.00 83.03  ? 549  LEU A CG  1 
ATOM   4192  C  CD1 . LEU A  1  549 ? 7.030    2.182    220.454 1.00 83.41  ? 549  LEU A CD1 1 
ATOM   4193  C  CD2 . LEU A  1  549 ? 5.232    3.736    221.247 1.00 83.61  ? 549  LEU A CD2 1 
ATOM   4194  N  N   . LEU A  1  550 ? 5.894    5.437    216.139 1.00 85.02  ? 550  LEU A N   1 
ATOM   4195  C  CA  . LEU A  1  550 ? 6.404    6.374    215.143 1.00 84.99  ? 550  LEU A CA  1 
ATOM   4196  C  C   . LEU A  1  550 ? 5.360    7.424    214.788 1.00 84.95  ? 550  LEU A C   1 
ATOM   4197  O  O   . LEU A  1  550 ? 5.651    8.621    214.759 1.00 85.28  ? 550  LEU A O   1 
ATOM   4198  C  CB  . LEU A  1  550 ? 6.833    5.645    213.871 1.00 84.66  ? 550  LEU A CB  1 
ATOM   4199  C  CG  . LEU A  1  550 ? 7.582    6.541    212.882 1.00 84.81  ? 550  LEU A CG  1 
ATOM   4200  C  CD1 . LEU A  1  550 ? 8.994    6.803    213.384 1.00 85.28  ? 550  LEU A CD1 1 
ATOM   4201  C  CD2 . LEU A  1  550 ? 7.592    5.950    211.483 1.00 84.56  ? 550  LEU A CD2 1 
ATOM   4202  N  N   . LYS A  1  551 ? 4.146    6.962    214.507 1.00 81.37  ? 551  LYS A N   1 
ATOM   4203  C  CA  . LYS A  1  551 ? 3.035    7.853    214.204 1.00 81.41  ? 551  LYS A CA  1 
ATOM   4204  C  C   . LYS A  1  551 ? 2.811    8.812    215.364 1.00 81.91  ? 551  LYS A C   1 
ATOM   4205  O  O   . LYS A  1  551 ? 2.366    9.942    215.174 1.00 82.17  ? 551  LYS A O   1 
ATOM   4206  C  CB  . LYS A  1  551 ? 1.761    7.053    213.925 1.00 81.11  ? 551  LYS A CB  1 
ATOM   4207  C  CG  . LYS A  1  551 ? 0.539    7.905    213.612 1.00 81.24  ? 551  LYS A CG  1 
ATOM   4208  C  CD  . LYS A  1  551 ? -0.662   7.042    213.270 1.00 81.01  ? 551  LYS A CD  1 
ATOM   4209  C  CE  . LYS A  1  551 ? -1.925   7.875    213.110 1.00 81.26  ? 551  LYS A CE  1 
ATOM   4210  N  NZ  . LYS A  1  551 ? -2.551   8.229    214.415 1.00 81.67  ? 551  LYS A NZ  1 
ATOM   4211  N  N   . GLY A  1  552 ? 3.134    8.350    216.567 1.00 89.99  ? 552  GLY A N   1 
ATOM   4212  C  CA  . GLY A  1  552 ? 2.980    9.157    217.761 1.00 90.59  ? 552  GLY A CA  1 
ATOM   4213  C  C   . GLY A  1  552 ? 3.975    10.299   217.840 1.00 91.03  ? 552  GLY A C   1 
ATOM   4214  O  O   . GLY A  1  552 ? 3.690    11.327   218.453 1.00 93.19  ? 552  GLY A O   1 
ATOM   4215  N  N   . VAL A  1  553 ? 5.140    10.123   217.223 1.00 83.05  ? 553  VAL A N   1 
ATOM   4216  C  CA  . VAL A  1  553 ? 6.182    11.145   217.252 1.00 83.55  ? 553  VAL A CA  1 
ATOM   4217  C  C   . VAL A  1  553 ? 5.960    12.208   216.182 1.00 83.59  ? 553  VAL A C   1 
ATOM   4218  O  O   . VAL A  1  553 ? 6.096    13.402   216.447 1.00 84.18  ? 553  VAL A O   1 
ATOM   4219  C  CB  . VAL A  1  553 ? 7.585    10.523   217.068 1.00 83.54  ? 553  VAL A CB  1 
ATOM   4220  C  CG1 . VAL A  1  553 ? 8.648    11.604   216.871 1.00 84.09  ? 553  VAL A CG1 1 
ATOM   4221  C  CG2 . VAL A  1  553 ? 7.930    9.641    218.260 1.00 83.75  ? 553  VAL A CG2 1 
ATOM   4222  N  N   . LEU A  1  554 ? 5.607    11.773   214.978 1.00 86.20  ? 554  LEU A N   1 
ATOM   4223  C  CA  . LEU A  1  554 ? 5.494    12.681   213.842 1.00 86.33  ? 554  LEU A CA  1 
ATOM   4224  C  C   . LEU A  1  554 ? 4.238    13.545   213.917 1.00 86.56  ? 554  LEU A C   1 
ATOM   4225  O  O   . LEU A  1  554 ? 4.246    14.705   213.501 1.00 87.04  ? 554  LEU A O   1 
ATOM   4226  C  CB  . LEU A  1  554 ? 5.505    11.885   212.536 1.00 85.83  ? 554  LEU A CB  1 
ATOM   4227  C  CG  . LEU A  1  554 ? 6.804    11.120   212.283 1.00 85.73  ? 554  LEU A CG  1 
ATOM   4228  C  CD1 . LEU A  1  554 ? 6.628    10.102   211.170 1.00 85.26  ? 554  LEU A CD1 1 
ATOM   4229  C  CD2 . LEU A  1  554 ? 7.930    12.089   211.953 1.00 86.31  ? 554  LEU A CD2 1 
ATOM   4230  N  N   . TYR A  1  555 ? 3.166    12.972   214.453 1.00 86.19  ? 555  TYR A N   1 
ATOM   4231  C  CA  . TYR A  1  555 ? 1.899    13.678   214.597 1.00 86.46  ? 555  TYR A CA  1 
ATOM   4232  C  C   . TYR A  1  555 ? 1.712    14.159   216.033 1.00 87.02  ? 555  TYR A C   1 
ATOM   4233  O  O   . TYR A  1  555 ? 0.588    14.350   216.494 1.00 87.24  ? 555  TYR A O   1 
ATOM   4234  C  CB  . TYR A  1  555 ? 0.740    12.770   214.180 1.00 85.97  ? 555  TYR A CB  1 
ATOM   4235  C  CG  . TYR A  1  555 ? 0.702    12.464   212.698 1.00 85.61  ? 555  TYR A CG  1 
ATOM   4236  C  CD1 . TYR A  1  555 ? 1.774    11.846   212.068 1.00 85.30  ? 555  TYR A CD1 1 
ATOM   4237  C  CD2 . TYR A  1  555 ? -0.414   12.775   211.934 1.00 85.68  ? 555  TYR A CD2 1 
ATOM   4238  C  CE1 . TYR A  1  555 ? 1.743    11.564   210.719 1.00 85.10  ? 555  TYR A CE1 1 
ATOM   4239  C  CE2 . TYR A  1  555 ? -0.456   12.493   210.583 1.00 85.48  ? 555  TYR A CE2 1 
ATOM   4240  C  CZ  . TYR A  1  555 ? 0.625    11.886   209.982 1.00 85.20  ? 555  TYR A CZ  1 
ATOM   4241  O  OH  . TYR A  1  555 ? 0.590    11.603   208.638 1.00 85.12  ? 555  TYR A OH  1 
ATOM   4242  N  N   . ALA A  1  556 ? 2.825    14.355   216.734 1.00 84.35  ? 556  ALA A N   1 
ATOM   4243  C  CA  . ALA A  1  556 ? 2.792    14.857   218.103 1.00 85.04  ? 556  ALA A CA  1 
ATOM   4244  C  C   . ALA A  1  556 ? 2.415    16.335   218.144 1.00 85.79  ? 556  ALA A C   1 
ATOM   4245  O  O   . ALA A  1  556 ? 1.727    16.783   219.064 1.00 86.37  ? 556  ALA A O   1 
ATOM   4246  C  CB  . ALA A  1  556 ? 4.139    14.641   218.774 1.00 85.28  ? 556  ALA A CB  1 
ATOM   4247  N  N   . ARG A  1  557 ? 2.871    17.086   217.146 1.00 95.40  ? 557  ARG A N   1 
ATOM   4248  C  CA  . ARG A  1  557 ? 2.659    18.530   217.111 1.00 96.24  ? 557  ARG A CA  1 
ATOM   4249  C  C   . ARG A  1  557 ? 1.369    18.927   216.405 1.00 96.25  ? 557  ARG A C   1 
ATOM   4250  O  O   . ARG A  1  557 ? 0.693    19.866   216.827 1.00 96.99  ? 557  ARG A O   1 
ATOM   4251  C  CB  . ARG A  1  557 ? 3.834    19.224   216.422 1.00 96.56  ? 557  ARG A CB  1 
ATOM   4252  C  CG  . ARG A  1  557 ? 5.088    19.326   217.270 1.00 97.00  ? 557  ARG A CG  1 
ATOM   4253  C  CD  . ARG A  1  557 ? 6.075    20.322   216.675 1.00 97.64  ? 557  ARG A CD  1 
ATOM   4254  N  NE  . ARG A  1  557 ? 5.667    21.711   216.880 1.00 98.62  ? 557  ARG A NE  1 
ATOM   4255  C  CZ  . ARG A  1  557 ? 5.893    22.409   217.991 1.00 99.51  ? 557  ARG A CZ  1 
ATOM   4256  N  NH1 . ARG A  1  557 ? 6.518    21.852   219.020 1.00 99.55  ? 557  ARG A NH1 1 
ATOM   4257  N  NH2 . ARG A  1  557 ? 5.486    23.668   218.076 1.00 100.47 ? 557  ARG A NH2 1 
ATOM   4258  N  N   . SER A  1  558 ? 1.030    18.224   215.330 1.00 86.03  ? 558  SER A N   1 
ATOM   4259  C  CA  . SER A  1  558 ? -0.068   18.654   214.471 1.00 86.14  ? 558  SER A CA  1 
ATOM   4260  C  C   . SER A  1  558 ? -0.582   17.554   213.552 1.00 85.33  ? 558  SER A C   1 
ATOM   4261  O  O   . SER A  1  558 ? 0.112    16.575   213.276 1.00 84.70  ? 558  SER A O   1 
ATOM   4262  C  CB  . SER A  1  558 ? 0.377    19.847   213.623 1.00 86.78  ? 558  SER A CB  1 
ATOM   4263  O  OG  . SER A  1  558 ? 1.518    19.517   212.848 1.00 86.46  ? 558  SER A OG  1 
ATOM   4264  N  N   . SER A  1  559 ? -1.813   17.735   213.086 1.00 114.71 ? 559  SER A N   1 
ATOM   4265  C  CA  . SER A  1  559 ? -2.419   16.845   212.107 1.00 114.13 ? 559  SER A CA  1 
ATOM   4266  C  C   . SER A  1  559 ? -3.473   17.613   211.322 1.00 115.03 ? 559  SER A C   1 
ATOM   4267  O  O   . SER A  1  559 ? -3.692   18.801   211.561 1.00 115.45 ? 559  SER A O   1 
ATOM   4268  C  CB  . SER A  1  559 ? -3.044   15.625   212.787 1.00 113.60 ? 559  SER A CB  1 
ATOM   4269  O  OG  . SER A  1  559 ? -4.216   15.982   213.499 1.00 114.06 ? 559  SER A OG  1 
ATOM   4270  N  N   . ARG A  1  560 ? -4.124   16.933   210.386 1.00 95.53  ? 560  ARG A N   1 
ATOM   4271  C  CA  . ARG A  1  560 ? -5.238   17.526   209.661 1.00 95.69  ? 560  ARG A CA  1 
ATOM   4272  C  C   . ARG A  1  560 ? -6.460   17.601   210.566 1.00 104.77 ? 560  ARG A C   1 
ATOM   4273  O  O   . ARG A  1  560 ? -7.402   18.344   210.290 1.00 118.28 ? 560  ARG A O   1 
ATOM   4274  C  CB  . ARG A  1  560 ? -5.567   16.716   208.410 1.00 95.32  ? 560  ARG A CB  1 
ATOM   4275  C  CG  . ARG A  1  560 ? -4.463   16.660   207.373 1.00 95.19  ? 560  ARG A CG  1 
ATOM   4276  C  CD  . ARG A  1  560 ? -4.861   15.715   206.254 1.00 94.88  ? 560  ARG A CD  1 
ATOM   4277  N  NE  . ARG A  1  560 ? -4.153   15.974   205.001 1.00 95.17  ? 560  ARG A NE  1 
ATOM   4278  C  CZ  . ARG A  1  560 ? -3.213   15.190   204.474 1.00 94.74  ? 560  ARG A CZ  1 
ATOM   4279  N  NH1 . ARG A  1  560 ? -2.825   14.078   205.087 1.00 93.97  ? 560  ARG A NH1 1 
ATOM   4280  N  NH2 . ARG A  1  560 ? -2.647   15.528   203.323 1.00 95.19  ? 560  ARG A NH2 1 
ATOM   4281  N  N   . LEU A  1  561 ? -6.437   16.827   211.649 1.00 86.04  ? 561  LEU A N   1 
ATOM   4282  C  CA  . LEU A  1  561 ? -7.550   16.793   212.589 1.00 86.39  ? 561  LEU A CA  1 
ATOM   4283  C  C   . LEU A  1  561 ? -7.389   17.859   213.671 1.00 87.14  ? 561  LEU A C   1 
ATOM   4284  O  O   . LEU A  1  561 ? -8.368   18.468   214.103 1.00 87.87  ? 561  LEU A O   1 
ATOM   4285  C  CB  . LEU A  1  561 ? -7.665   15.413   213.236 1.00 85.75  ? 561  LEU A CB  1 
ATOM   4286  C  CG  . LEU A  1  561 ? -9.046   15.107   213.819 1.00 86.10  ? 561  LEU A CG  1 
ATOM   4287  C  CD1 . LEU A  1  561 ? -10.046  14.859   212.698 1.00 86.12  ? 561  LEU A CD1 1 
ATOM   4288  C  CD2 . LEU A  1  561 ? -9.001   13.928   214.780 1.00 85.72  ? 561  LEU A CD2 1 
ATOM   4289  N  N   . VAL A  1  562 ? -6.150   18.076   214.102 1.00 86.50  ? 562  VAL A N   1 
ATOM   4290  C  CA  . VAL A  1  562 ? -5.848   19.091   215.107 1.00 87.29  ? 562  VAL A CA  1 
ATOM   4291  C  C   . VAL A  1  562 ? -4.504   19.769   214.826 1.00 87.41  ? 562  VAL A C   1 
ATOM   4292  O  O   . VAL A  1  562 ? -3.470   19.343   215.340 1.00 87.08  ? 562  VAL A O   1 
ATOM   4293  C  CB  . VAL A  1  562 ? -5.836   18.490   216.529 1.00 87.28  ? 562  VAL A CB  1 
ATOM   4294  C  CG1 . VAL A  1  562 ? -7.250   18.445   217.091 1.00 87.77  ? 562  VAL A CG1 1 
ATOM   4295  C  CG2 . VAL A  1  562 ? -5.208   17.099   216.535 1.00 86.31  ? 562  VAL A CG2 1 
ATOM   4296  N  N   . PRO A  1  563 ? -4.517   20.833   214.002 1.00 97.92  ? 563  PRO A N   1 
ATOM   4297  C  CA  . PRO A  1  563 ? -3.289   21.552   213.633 1.00 98.19  ? 563  PRO A CA  1 
ATOM   4298  C  C   . PRO A  1  563 ? -2.591   22.191   214.831 1.00 98.80  ? 563  PRO A C   1 
ATOM   4299  O  O   . PRO A  1  563 ? -1.394   22.474   214.766 1.00 98.88  ? 563  PRO A O   1 
ATOM   4300  C  CB  . PRO A  1  563 ? -3.787   22.632   212.663 1.00 98.97  ? 563  PRO A CB  1 
ATOM   4301  C  CG  . PRO A  1  563 ? -5.122   22.171   212.210 1.00 98.80  ? 563  PRO A CG  1 
ATOM   4302  C  CD  . PRO A  1  563 ? -5.702   21.413   213.349 1.00 98.47  ? 563  PRO A CD  1 
ATOM   4303  N  N   . ASP A  1  564 ? -3.341   22.414   215.906 1.00 127.36 ? 564  ASP A N   1 
ATOM   4304  C  CA  . ASP A  1  564 ? -2.809   23.049   217.108 1.00 128.11 ? 564  ASP A CA  1 
ATOM   4305  C  C   . ASP A  1  564 ? -2.647   22.032   218.234 1.00 134.58 ? 564  ASP A C   1 
ATOM   4306  O  O   . ASP A  1  564 ? -2.847   22.354   219.405 1.00 159.21 ? 564  ASP A O   1 
ATOM   4307  C  CB  . ASP A  1  564 ? -3.730   24.185   217.558 1.00 136.25 ? 564  ASP A CB  1 
ATOM   4308  C  CG  . ASP A  1  564 ? -5.169   23.738   217.709 1.00 135.93 ? 564  ASP A CG  1 
ATOM   4309  O  OD1 . ASP A  1  564 ? -5.570   22.784   217.010 1.00 138.92 ? 564  ASP A OD1 1 
ATOM   4310  O  OD2 . ASP A  1  564 ? -5.895   24.335   218.531 1.00 130.18 ? 564  ASP A OD2 1 
ATOM   4311  N  N   . LYS A  1  565 ? -2.278   20.806   217.880 1.00 101.94 ? 565  LYS A N   1 
ATOM   4312  C  CA  . LYS A  1  565 ? -2.132   19.750   218.876 1.00 101.57 ? 565  LYS A CA  1 
ATOM   4313  C  C   . LYS A  1  565 ? -0.931   20.027   219.775 1.00 102.01 ? 565  LYS A C   1 
ATOM   4314  O  O   . LYS A  1  565 ? -0.919   19.638   220.942 1.00 102.28 ? 565  LYS A O   1 
ATOM   4315  C  CB  . LYS A  1  565 ? -1.977   18.379   218.209 1.00 100.42 ? 565  LYS A CB  1 
ATOM   4316  C  CG  . LYS A  1  565 ? -2.093   17.213   219.187 1.00 100.12 ? 565  LYS A CG  1 
ATOM   4317  C  CD  . LYS A  1  565 ? -1.524   15.920   218.622 1.00 99.14  ? 565  LYS A CD  1 
ATOM   4318  C  CE  . LYS A  1  565 ? -2.383   15.358   217.503 1.00 98.52  ? 565  LYS A CE  1 
ATOM   4319  N  NZ  . LYS A  1  565 ? -1.965   13.978   217.132 1.00 97.69  ? 565  LYS A NZ  1 
ATOM   4320  N  N   . ALA A  1  566 ? 0.076    20.699   219.227 1.00 88.90  ? 566  ALA A N   1 
ATOM   4321  C  CA  . ALA A  1  566 ? 1.302    20.970   219.967 1.00 89.37  ? 566  ALA A CA  1 
ATOM   4322  C  C   . ALA A  1  566 ? 1.020    21.845   221.181 1.00 90.55  ? 566  ALA A C   1 
ATOM   4323  O  O   . ALA A  1  566 ? 1.632    21.677   222.234 1.00 90.96  ? 566  ALA A O   1 
ATOM   4324  C  CB  . ALA A  1  566 ? 2.327    21.637   219.066 1.00 89.49  ? 566  ALA A CB  1 
ATOM   4325  N  N   . ASN A  1  567 ? 0.082    22.772   221.026 1.00 122.25 ? 567  ASN A N   1 
ATOM   4326  C  CA  . ASN A  1  567 ? -0.283   23.680   222.104 1.00 123.52 ? 567  ASN A CA  1 
ATOM   4327  C  C   . ASN A  1  567 ? -1.065   22.964   223.198 1.00 123.62 ? 567  ASN A C   1 
ATOM   4328  O  O   . ASN A  1  567 ? -1.054   23.380   224.357 1.00 128.26 ? 567  ASN A O   1 
ATOM   4329  C  CB  . ASN A  1  567 ? -1.097   24.851   221.553 1.00 124.26 ? 567  ASN A CB  1 
ATOM   4330  C  CG  . ASN A  1  567 ? -0.269   25.769   220.677 1.00 124.57 ? 567  ASN A CG  1 
ATOM   4331  O  OD1 . ASN A  1  567 ? 0.839    26.161   221.042 1.00 125.04 ? 567  ASN A OD1 1 
ATOM   4332  N  ND2 . ASN A  1  567 ? -0.801   26.114   219.510 1.00 124.42 ? 567  ASN A ND2 1 
ATOM   4333  N  N   . LEU A  1  568 ? -1.743   21.883   222.822 1.00 91.61  ? 568  LEU A N   1 
ATOM   4334  C  CA  . LEU A  1  568 ? -2.504   21.092   223.778 1.00 91.70  ? 568  LEU A CA  1 
ATOM   4335  C  C   . LEU A  1  568 ? -1.554   20.338   224.700 1.00 91.66  ? 568  LEU A C   1 
ATOM   4336  O  O   . LEU A  1  568 ? -1.898   20.029   225.842 1.00 92.27  ? 568  LEU A O   1 
ATOM   4337  C  CB  . LEU A  1  568 ? -3.433   20.117   223.050 1.00 90.74  ? 568  LEU A CB  1 
ATOM   4338  C  CG  . LEU A  1  568 ? -4.515   20.761   222.179 1.00 90.87  ? 568  LEU A CG  1 
ATOM   4339  C  CD1 . LEU A  1  568 ? -5.269   19.700   221.396 1.00 89.90  ? 568  LEU A CD1 1 
ATOM   4340  C  CD2 . LEU A  1  568 ? -5.480   21.582   223.022 1.00 92.13  ? 568  LEU A CD2 1 
ATOM   4341  N  N   . GLY A  1  569 ? -0.360   20.045   224.192 1.00 140.38 ? 569  GLY A N   1 
ATOM   4342  C  CA  . GLY A  1  569 ? 0.685    19.411   224.976 1.00 140.43 ? 569  GLY A CA  1 
ATOM   4343  C  C   . GLY A  1  569 ? 0.926    17.973   224.562 1.00 149.60 ? 569  GLY A C   1 
ATOM   4344  O  O   . GLY A  1  569 ? 0.287    17.465   223.640 1.00 169.45 ? 569  GLY A O   1 
ATOM   4345  N  N   . PHE A  1  570 ? 1.855    17.318   225.249 1.00 90.02  ? 570  PHE A N   1 
ATOM   4346  C  CA  . PHE A  1  570 ? 2.164    15.918   224.985 1.00 89.10  ? 570  PHE A CA  1 
ATOM   4347  C  C   . PHE A  1  570 ? 1.191    14.984   225.694 1.00 89.15  ? 570  PHE A C   1 
ATOM   4348  O  O   . PHE A  1  570 ? 0.801    13.951   225.148 1.00 88.31  ? 570  PHE A O   1 
ATOM   4349  C  CB  . PHE A  1  570 ? 3.593    15.592   225.415 1.00 89.29  ? 570  PHE A CB  1 
ATOM   4350  C  CG  . PHE A  1  570 ? 3.844    14.126   225.597 1.00 88.76  ? 570  PHE A CG  1 
ATOM   4351  C  CD1 . PHE A  1  570 ? 3.895    13.278   224.504 1.00 87.66  ? 570  PHE A CD1 1 
ATOM   4352  C  CD2 . PHE A  1  570 ? 4.026    13.594   226.862 1.00 89.48  ? 570  PHE A CD2 1 
ATOM   4353  C  CE1 . PHE A  1  570 ? 4.121    11.926   224.670 1.00 87.27  ? 570  PHE A CE1 1 
ATOM   4354  C  CE2 . PHE A  1  570 ? 4.254    12.243   227.034 1.00 89.11  ? 570  PHE A CE2 1 
ATOM   4355  C  CZ  . PHE A  1  570 ? 4.301    11.407   225.937 1.00 88.00  ? 570  PHE A CZ  1 
ATOM   4356  N  N   . ARG A  1  571 ? 0.800    15.359   226.908 1.00 95.21  ? 571  ARG A N   1 
ATOM   4357  C  CA  . ARG A  1  571 ? -0.057   14.521   227.739 1.00 95.52  ? 571  ARG A CA  1 
ATOM   4358  C  C   . ARG A  1  571 ? -1.410   15.173   227.961 1.00 96.11  ? 571  ARG A C   1 
ATOM   4359  O  O   . ARG A  1  571 ? -1.613   15.907   228.930 1.00 97.30  ? 571  ARG A O   1 
ATOM   4360  C  CB  . ARG A  1  571 ? 0.606    14.237   229.085 1.00 96.50  ? 571  ARG A CB  1 
ATOM   4361  C  CG  . ARG A  1  571 ? -0.229   13.358   230.003 1.00 97.01  ? 571  ARG A CG  1 
ATOM   4362  C  CD  . ARG A  1  571 ? 0.575    12.902   231.201 1.00 97.92  ? 571  ARG A CD  1 
ATOM   4363  N  NE  . ARG A  1  571 ? 1.106    14.027   231.964 1.00 99.09  ? 571  ARG A NE  1 
ATOM   4364  C  CZ  . ARG A  1  571 ? 2.008    13.914   232.934 1.00 100.02 ? 571  ARG A CZ  1 
ATOM   4365  N  NH1 . ARG A  1  571 ? 2.482    12.721   233.269 1.00 99.92  ? 571  ARG A NH1 1 
ATOM   4366  N  NH2 . ARG A  1  571 ? 2.436    14.994   233.572 1.00 101.15 ? 571  ARG A NH2 1 
ATOM   4367  N  N   . PHE A  1  572 ? -2.333   14.901   227.047 1.00 104.68 ? 572  PHE A N   1 
ATOM   4368  C  CA  . PHE A  1  572 ? -3.705   15.352   227.192 1.00 105.22 ? 572  PHE A CA  1 
ATOM   4369  C  C   . PHE A  1  572 ? -4.628   14.273   226.648 1.00 104.48 ? 572  PHE A C   1 
ATOM   4370  O  O   . PHE A  1  572 ? -4.290   13.601   225.673 1.00 103.39 ? 572  PHE A O   1 
ATOM   4371  C  CB  . PHE A  1  572 ? -3.924   16.683   226.466 1.00 105.36 ? 572  PHE A CB  1 
ATOM   4372  C  CG  . PHE A  1  572 ? -3.890   16.578   224.965 1.00 104.22 ? 572  PHE A CG  1 
ATOM   4373  C  CD1 . PHE A  1  572 ? -2.684   16.540   224.284 1.00 103.55 ? 572  PHE A CD1 1 
ATOM   4374  C  CD2 . PHE A  1  572 ? -5.066   16.530   224.234 1.00 103.94 ? 572  PHE A CD2 1 
ATOM   4375  C  CE1 . PHE A  1  572 ? -2.652   16.452   222.904 1.00 102.65 ? 572  PHE A CE1 1 
ATOM   4376  C  CE2 . PHE A  1  572 ? -5.040   16.439   222.854 1.00 103.02 ? 572  PHE A CE2 1 
ATOM   4377  C  CZ  . PHE A  1  572 ? -3.831   16.399   222.188 1.00 102.39 ? 572  PHE A CZ  1 
ATOM   4378  N  N   . PRO A  1  573 ? -5.798   14.094   227.279 1.00 90.87  ? 573  PRO A N   1 
ATOM   4379  C  CA  . PRO A  1  573 ? -6.661   12.995   226.842 1.00 90.29  ? 573  PRO A CA  1 
ATOM   4380  C  C   . PRO A  1  573 ? -7.191   13.179   225.431 1.00 89.44  ? 573  PRO A C   1 
ATOM   4381  O  O   . PRO A  1  573 ? -7.154   12.236   224.638 1.00 88.50  ? 573  PRO A O   1 
ATOM   4382  C  CB  . PRO A  1  573 ? -7.812   13.027   227.853 1.00 91.46  ? 573  PRO A CB  1 
ATOM   4383  C  CG  . PRO A  1  573 ? -7.819   14.411   228.387 1.00 92.48  ? 573  PRO A CG  1 
ATOM   4384  C  CD  . PRO A  1  573 ? -6.383   14.840   228.406 1.00 92.28  ? 573  PRO A CD  1 
ATOM   4385  N  N   . CYS A  1  574 ? -7.653   14.383   225.115 1.00 89.86  ? 574  CYS A N   1 
ATOM   4386  C  CA  . CYS A  1  574 ? -8.408   14.589   223.892 1.00 89.35  ? 574  CYS A CA  1 
ATOM   4387  C  C   . CYS A  1  574 ? -8.728   16.053   223.587 1.00 89.97  ? 574  CYS A C   1 
ATOM   4388  O  O   . CYS A  1  574 ? -8.276   16.963   224.284 1.00 90.76  ? 574  CYS A O   1 
ATOM   4389  C  CB  . CYS A  1  574 ? -9.690   13.745   223.966 1.00 89.46  ? 574  CYS A CB  1 
ATOM   4390  S  SG  . CYS A  1  574 ? -10.717  13.937   225.454 1.00 111.46 ? 574  CYS A SG  1 
ATOM   4391  N  N   . ASP A  1  575 ? -9.500   16.260   222.523 1.00 97.36  ? 575  ASP A N   1 
ATOM   4392  C  CA  . ASP A  1  575 ? -9.937   17.588   222.113 1.00 98.01  ? 575  ASP A CA  1 
ATOM   4393  C  C   . ASP A  1  575 ? -11.442  17.589   221.874 1.00 98.46  ? 575  ASP A C   1 
ATOM   4394  O  O   . ASP A  1  575 ? -11.928  18.125   220.877 1.00 98.45  ? 575  ASP A O   1 
ATOM   4395  C  CB  . ASP A  1  575 ? -9.195   18.028   220.845 1.00 97.33  ? 575  ASP A CB  1 
ATOM   4396  C  CG  . ASP A  1  575 ? -9.349   19.511   220.557 1.00 98.16  ? 575  ASP A CG  1 
ATOM   4397  O  OD1 . ASP A  1  575 ? -9.363   20.312   221.516 1.00 99.19  ? 575  ASP A OD1 1 
ATOM   4398  O  OD2 . ASP A  1  575 ? -9.455   19.877   219.368 1.00 97.90  ? 575  ASP A OD2 1 
ATOM   4399  N  N   . GLY A  1  576 ? -12.173  16.973   222.797 1.00 132.38 ? 576  GLY A N   1 
ATOM   4400  C  CA  . GLY A  1  576 ? -13.622  16.974   222.750 1.00 118.29 ? 576  GLY A CA  1 
ATOM   4401  C  C   . GLY A  1  576 ? -14.203  16.006   221.738 1.00 100.65 ? 576  GLY A C   1 
ATOM   4402  O  O   . GLY A  1  576 ? -13.490  15.507   220.869 1.00 99.58  ? 576  GLY A O   1 
ATOM   4403  N  N   . PRO A  1  577 ? -15.514  15.739   221.847 1.00 91.71  ? 577  PRO A N   1 
ATOM   4404  C  CA  . PRO A  1  577 ? -16.229  14.826   220.950 1.00 91.16  ? 577  PRO A CA  1 
ATOM   4405  C  C   . PRO A  1  577 ? -16.390  15.391   219.541 1.00 90.82  ? 577  PRO A C   1 
ATOM   4406  O  O   . PRO A  1  577 ? -16.874  14.689   218.652 1.00 90.35  ? 577  PRO A O   1 
ATOM   4407  C  CB  . PRO A  1  577 ? -17.592  14.669   221.628 1.00 92.25  ? 577  PRO A CB  1 
ATOM   4408  C  CG  . PRO A  1  577 ? -17.776  15.933   222.386 1.00 93.43  ? 577  PRO A CG  1 
ATOM   4409  C  CD  . PRO A  1  577 ? -16.410  16.324   222.859 1.00 93.11  ? 577  PRO A CD  1 
ATOM   4410  N  N   . GLY A  1  578 ? -16.001  16.648   219.350 1.00 127.39 ? 578  GLY A N   1 
ATOM   4411  C  CA  . GLY A  1  578 ? -16.085  17.282   218.048 1.00 118.12 ? 578  GLY A CA  1 
ATOM   4412  C  C   . GLY A  1  578 ? -15.221  16.579   217.023 1.00 106.94 ? 578  GLY A C   1 
ATOM   4413  O  O   . GLY A  1  578 ? -14.373  15.760   217.372 1.00 106.20 ? 578  GLY A O   1 
ATOM   4414  N  N   . ARG A  1  579 ? -15.442  16.904   215.754 1.00 89.69  ? 579  ARG A N   1 
ATOM   4415  C  CA  . ARG A  1  579 ? -14.710  16.289   214.652 1.00 88.68  ? 579  ARG A CA  1 
ATOM   4416  C  C   . ARG A  1  579 ? -14.944  14.777   214.594 1.00 87.99  ? 579  ARG A C   1 
ATOM   4417  O  O   . ARG A  1  579 ? -14.113  14.032   214.071 1.00 87.10  ? 579  ARG A O   1 
ATOM   4418  C  CB  . ARG A  1  579 ? -13.211  16.582   214.767 1.00 88.16  ? 579  ARG A CB  1 
ATOM   4419  C  CG  . ARG A  1  579 ? -12.878  18.036   215.065 1.00 88.94  ? 579  ARG A CG  1 
ATOM   4420  C  CD  . ARG A  1  579 ? -11.375  18.257   215.080 1.00 88.45  ? 579  ARG A CD  1 
ATOM   4421  N  NE  . ARG A  1  579 ? -11.004  19.588   215.556 1.00 89.28  ? 579  ARG A NE  1 
ATOM   4422  C  CZ  . ARG A  1  579 ? -10.956  19.941   216.837 1.00 89.87  ? 579  ARG A CZ  1 
ATOM   4423  N  NH1 . ARG A  1  579 ? -11.261  19.064   217.786 1.00 89.74  ? 579  ARG A NH1 1 
ATOM   4424  N  NH2 . ARG A  1  579 ? -10.603  21.174   217.174 1.00 90.71  ? 579  ARG A NH2 1 
ATOM   4425  N  N   . GLY A  1  580 ? -16.074  14.332   215.137 1.00 104.61 ? 580  GLY A N   1 
ATOM   4426  C  CA  . GLY A  1  580 ? -16.410  12.919   215.166 1.00 104.16 ? 580  GLY A CA  1 
ATOM   4427  C  C   . GLY A  1  580 ? -15.887  12.222   216.408 1.00 103.97 ? 580  GLY A C   1 
ATOM   4428  O  O   . GLY A  1  580 ? -16.327  11.122   216.742 1.00 103.91 ? 580  GLY A O   1 
ATOM   4429  N  N   . GLY A  1  581 ? -14.960  12.877   217.100 1.00 91.19  ? 581  GLY A N   1 
ATOM   4430  C  CA  . GLY A  1  581 ? -14.295  12.305   218.257 1.00 91.07  ? 581  GLY A CA  1 
ATOM   4431  C  C   . GLY A  1  581 ? -12.795  12.420   218.098 1.00 90.35  ? 581  GLY A C   1 
ATOM   4432  O  O   . GLY A  1  581 ? -12.240  12.028   217.072 1.00 89.56  ? 581  GLY A O   1 
ATOM   4433  N  N   . THR A  1  582 ? -12.141  12.963   219.120 1.00 118.90 ? 582  THR A N   1 
ATOM   4434  C  CA  . THR A  1  582 ? -10.705  13.199   219.080 1.00 118.40 ? 582  THR A CA  1 
ATOM   4435  C  C   . THR A  1  582 ? -10.021  12.607   220.305 1.00 118.48 ? 582  THR A C   1 
ATOM   4436  O  O   . THR A  1  582 ? -9.101   13.207   220.861 1.00 118.69 ? 582  THR A O   1 
ATOM   4437  C  CB  . THR A  1  582 ? -10.388  14.702   219.001 1.00 118.93 ? 582  THR A CB  1 
ATOM   4438  O  OG1 . THR A  1  582 ? -10.923  15.362   220.153 1.00 119.98 ? 582  THR A OG1 1 
ATOM   4439  C  CG2 . THR A  1  582 ? -10.993  15.312   217.745 1.00 119.47 ? 582  THR A CG2 1 
ATOM   4440  N  N   . CYS A  1  583 ? -10.474  11.431   220.729 1.00 86.93  ? 583  CYS A N   1 
ATOM   4441  C  CA  . CYS A  1  583 ? -9.895   10.791   221.900 1.00 87.14  ? 583  CYS A CA  1 
ATOM   4442  C  C   . CYS A  1  583 ? -8.555   10.178   221.501 1.00 86.27  ? 583  CYS A C   1 
ATOM   4443  O  O   . CYS A  1  583 ? -8.440   9.573    220.436 1.00 85.48  ? 583  CYS A O   1 
ATOM   4444  C  CB  . CYS A  1  583 ? -10.822  9.713    222.500 1.00 87.52  ? 583  CYS A CB  1 
ATOM   4445  S  SG  . CYS A  1  583 ? -12.627  10.076   222.637 1.00 88.47  ? 583  CYS A SG  1 
ATOM   4446  N  N   . GLN A  1  584 ? -7.539   10.360   222.340 1.00 86.50  ? 584  GLN A N   1 
ATOM   4447  C  CA  . GLN A  1  584 ? -6.243   9.711    222.139 1.00 85.85  ? 584  GLN A CA  1 
ATOM   4448  C  C   . GLN A  1  584 ? -5.518   10.102   220.850 1.00 85.08  ? 584  GLN A C   1 
ATOM   4449  O  O   . GLN A  1  584 ? -5.071   9.233    220.100 1.00 84.36  ? 584  GLN A O   1 
ATOM   4450  C  CB  . GLN A  1  584 ? -6.431   8.191    222.170 1.00 85.52  ? 584  GLN A CB  1 
ATOM   4451  C  CG  . GLN A  1  584 ? -6.906   7.658    223.502 1.00 86.36  ? 584  GLN A CG  1 
ATOM   4452  C  CD  . GLN A  1  584 ? -7.163   6.169    223.464 1.00 86.14  ? 584  GLN A CD  1 
ATOM   4453  O  OE1 . GLN A  1  584 ? -7.064   5.539    222.412 1.00 85.35  ? 584  GLN A OE1 1 
ATOM   4454  N  NE2 . GLN A  1  584 ? -7.491   5.594    224.615 1.00 86.94  ? 584  GLN A NE2 1 
ATOM   4455  N  N   . VAL A  1  585 ? -5.405   11.402   220.594 1.00 85.35  ? 585  VAL A N   1 
ATOM   4456  C  CA  . VAL A  1  585 ? -4.600   11.894   219.477 1.00 84.83  ? 585  VAL A CA  1 
ATOM   4457  C  C   . VAL A  1  585 ? -3.201   12.277   219.957 1.00 84.97  ? 585  VAL A C   1 
ATOM   4458  O  O   . VAL A  1  585 ? -2.260   12.349   219.167 1.00 84.52  ? 585  VAL A O   1 
ATOM   4459  C  CB  . VAL A  1  585 ? -5.254   13.108   218.789 1.00 85.14  ? 585  VAL A CB  1 
ATOM   4460  C  CG1 . VAL A  1  585 ? -6.599   12.716   218.196 1.00 85.05  ? 585  VAL A CG1 1 
ATOM   4461  C  CG2 . VAL A  1  585 ? -5.409   14.268   219.764 1.00 86.11  ? 585  VAL A CG2 1 
ATOM   4462  N  N   . SER A  1  586 ? -3.075   12.513   221.260 1.00 87.60  ? 586  SER A N   1 
ATOM   4463  C  CA  . SER A  1  586 ? -1.820   12.964   221.851 1.00 87.94  ? 586  SER A CA  1 
ATOM   4464  C  C   . SER A  1  586 ? -0.718   11.915   221.750 1.00 87.38  ? 586  SER A C   1 
ATOM   4465  O  O   . SER A  1  586 ? -0.987   10.730   221.552 1.00 86.89  ? 586  SER A O   1 
ATOM   4466  C  CB  . SER A  1  586 ? -2.035   13.333   223.318 1.00 88.97  ? 586  SER A CB  1 
ATOM   4467  O  OG  . SER A  1  586 ? -2.086   12.173   224.129 1.00 89.04  ? 586  SER A OG  1 
ATOM   4468  N  N   . GLY A  1  587 ? 0.525    12.363   221.884 1.00 85.65  ? 587  GLY A N   1 
ATOM   4469  C  CA  . GLY A  1  587 ? 1.666    11.469   221.852 1.00 85.30  ? 587  GLY A CA  1 
ATOM   4470  C  C   . GLY A  1  587 ? 1.681    10.511   223.028 1.00 85.66  ? 587  GLY A C   1 
ATOM   4471  O  O   . GLY A  1  587 ? 2.161    9.385    222.906 1.00 85.27  ? 587  GLY A O   1 
ATOM   4472  N  N   . TRP A  1  588 ? 1.162    10.956   224.169 1.00 86.52  ? 588  TRP A N   1 
ATOM   4473  C  CA  . TRP A  1  588 ? 1.081    10.108   225.355 1.00 87.08  ? 588  TRP A CA  1 
ATOM   4474  C  C   . TRP A  1  588 ? 0.174    8.920    225.076 1.00 86.59  ? 588  TRP A C   1 
ATOM   4475  O  O   . TRP A  1  588 ? 0.440    7.801    225.513 1.00 86.65  ? 588  TRP A O   1 
ATOM   4476  C  CB  . TRP A  1  588 ? 0.565    10.895   226.562 1.00 88.22  ? 588  TRP A CB  1 
ATOM   4477  C  CG  . TRP A  1  588 ? 0.650    10.132   227.857 1.00 89.03  ? 588  TRP A CG  1 
ATOM   4478  C  CD1 . TRP A  1  588 ? 1.610    10.261   228.813 1.00 89.85  ? 588  TRP A CD1 1 
ATOM   4479  C  CD2 . TRP A  1  588 ? -0.260   9.130    228.336 1.00 89.22  ? 588  TRP A CD2 1 
ATOM   4480  N  NE1 . TRP A  1  588 ? 1.362    9.403    229.857 1.00 90.57  ? 588  TRP A NE1 1 
ATOM   4481  C  CE2 . TRP A  1  588 ? 0.220    8.697    229.589 1.00 90.20  ? 588  TRP A CE2 1 
ATOM   4482  C  CE3 . TRP A  1  588 ? -1.430   8.557    227.829 1.00 88.76  ? 588  TRP A CE3 1 
ATOM   4483  C  CZ2 . TRP A  1  588 ? -0.429   7.719    230.342 1.00 90.75  ? 588  TRP A CZ2 1 
ATOM   4484  C  CZ3 . TRP A  1  588 ? -2.073   7.585    228.579 1.00 89.28  ? 588  TRP A CZ3 1 
ATOM   4485  C  CH2 . TRP A  1  588 ? -1.570   7.177    229.821 1.00 90.27  ? 588  TRP A CH2 1 
ATOM   4486  N  N   . ASP A  1  589 ? -0.900   9.174    224.337 1.00 111.99 ? 589  ASP A N   1 
ATOM   4487  C  CA  . ASP A  1  589 ? -1.871   8.139    224.020 1.00 111.62 ? 589  ASP A CA  1 
ATOM   4488  C  C   . ASP A  1  589 ? -1.347   7.223    222.919 1.00 120.77 ? 589  ASP A C   1 
ATOM   4489  O  O   . ASP A  1  589 ? -1.937   6.180    222.639 1.00 158.75 ? 589  ASP A O   1 
ATOM   4490  C  CB  . ASP A  1  589 ? -3.200   8.771    223.607 1.00 111.67 ? 589  ASP A CB  1 
ATOM   4491  C  CG  . ASP A  1  589 ? -3.854   9.537    224.741 1.00 112.74 ? 589  ASP A CG  1 
ATOM   4492  O  OD1 . ASP A  1  589 ? -4.087   8.932    225.807 1.00 126.02 ? 589  ASP A OD1 1 
ATOM   4493  O  OD2 . ASP A  1  589 ? -4.127   10.745   224.574 1.00 113.02 ? 589  ASP A OD2 1 
ATOM   4494  N  N   . HIS A  1  590 ? -0.238   7.618    222.298 1.00 84.53  ? 590  HIS A N   1 
ATOM   4495  C  CA  . HIS A  1  590 ? 0.449    6.765    221.334 1.00 83.79  ? 590  HIS A CA  1 
ATOM   4496  C  C   . HIS A  1  590 ? 1.450    5.856    222.046 1.00 84.03  ? 590  HIS A C   1 
ATOM   4497  O  O   . HIS A  1  590 ? 1.804    4.793    221.542 1.00 83.62  ? 590  HIS A O   1 
ATOM   4498  C  CB  . HIS A  1  590 ? 1.141    7.612    220.268 1.00 83.40  ? 590  HIS A CB  1 
ATOM   4499  C  CG  . HIS A  1  590 ? 0.230    8.034    219.158 1.00 83.00  ? 590  HIS A CG  1 
ATOM   4500  N  ND1 . HIS A  1  590 ? -0.462   9.225    219.174 1.00 83.33  ? 590  HIS A ND1 1 
ATOM   4501  C  CD2 . HIS A  1  590 ? -0.111   7.416    218.003 1.00 82.39  ? 590  HIS A CD2 1 
ATOM   4502  C  CE1 . HIS A  1  590 ? -1.187   9.325    218.074 1.00 82.96  ? 590  HIS A CE1 1 
ATOM   4503  N  NE2 . HIS A  1  590 ? -0.992   8.240    217.346 1.00 82.39  ? 590  HIS A NE2 1 
ATOM   4504  N  N   . VAL A  1  591 ? 1.904    6.283    223.221 1.00 84.80  ? 591  VAL A N   1 
ATOM   4505  C  CA  . VAL A  1  591 ? 2.699    5.429    224.096 1.00 85.27  ? 591  VAL A CA  1 
ATOM   4506  C  C   . VAL A  1  591 ? 1.769    4.436    224.782 1.00 85.63  ? 591  VAL A C   1 
ATOM   4507  O  O   . VAL A  1  591 ? 2.139    3.293    225.050 1.00 85.76  ? 591  VAL A O   1 
ATOM   4508  C  CB  . VAL A  1  591 ? 3.463    6.250    225.156 1.00 86.15  ? 591  VAL A CB  1 
ATOM   4509  C  CG1 . VAL A  1  591 ? 4.211    5.338    226.129 1.00 86.80  ? 591  VAL A CG1 1 
ATOM   4510  C  CG2 . VAL A  1  591 ? 4.417    7.225    224.485 1.00 85.91  ? 591  VAL A CG2 1 
ATOM   4511  N  N   . PHE A  1  592 ? 0.554    4.896    225.058 1.00 85.88  ? 592  PHE A N   1 
ATOM   4512  C  CA  . PHE A  1  592 ? -0.468   4.090    225.708 1.00 86.35  ? 592  PHE A CA  1 
ATOM   4513  C  C   . PHE A  1  592 ? -0.755   2.842    224.882 1.00 85.71  ? 592  PHE A C   1 
ATOM   4514  O  O   . PHE A  1  592 ? -0.626   1.722    225.372 1.00 86.05  ? 592  PHE A O   1 
ATOM   4515  C  CB  . PHE A  1  592 ? -1.736   4.926    225.906 1.00 86.68  ? 592  PHE A CB  1 
ATOM   4516  C  CG  . PHE A  1  592 ? -2.915   4.148    226.417 1.00 87.16  ? 592  PHE A CG  1 
ATOM   4517  C  CD1 . PHE A  1  592 ? -2.937   3.675    227.718 1.00 88.21  ? 592  PHE A CD1 1 
ATOM   4518  C  CD2 . PHE A  1  592 ? -4.013   3.916    225.606 1.00 86.70  ? 592  PHE A CD2 1 
ATOM   4519  C  CE1 . PHE A  1  592 ? -4.023   2.966    228.194 1.00 88.78  ? 592  PHE A CE1 1 
ATOM   4520  C  CE2 . PHE A  1  592 ? -5.104   3.210    226.078 1.00 87.25  ? 592  PHE A CE2 1 
ATOM   4521  C  CZ  . PHE A  1  592 ? -5.109   2.737    227.375 1.00 88.29  ? 592  PHE A CZ  1 
ATOM   4522  N  N   . LEU A  1  593 ? -1.139   3.040    223.626 1.00 84.87  ? 593  LEU A N   1 
ATOM   4523  C  CA  . LEU A  1  593 ? -1.442   1.924    222.737 1.00 84.31  ? 593  LEU A CA  1 
ATOM   4524  C  C   . LEU A  1  593 ? -0.177   1.168    222.349 1.00 84.00  ? 593  LEU A C   1 
ATOM   4525  O  O   . LEU A  1  593 ? -0.218   -0.031   222.073 1.00 83.89  ? 593  LEU A O   1 
ATOM   4526  C  CB  . LEU A  1  593 ? -2.158   2.420    221.480 1.00 83.64  ? 593  LEU A CB  1 
ATOM   4527  C  CG  . LEU A  1  593 ? -3.491   3.132    221.715 1.00 83.97  ? 593  LEU A CG  1 
ATOM   4528  C  CD1 . LEU A  1  593 ? -4.116   3.518    220.383 1.00 83.36  ? 593  LEU A CD1 1 
ATOM   4529  C  CD2 . LEU A  1  593 ? -4.446   2.283    222.547 1.00 84.61  ? 593  LEU A CD2 1 
ATOM   4530  N  N   . GLY A  1  594 ? 0.947    1.874    222.326 1.00 83.93  ? 594  GLY A N   1 
ATOM   4531  C  CA  . GLY A  1  594 ? 2.211    1.264    221.964 1.00 83.74  ? 594  GLY A CA  1 
ATOM   4532  C  C   . GLY A  1  594 ? 2.688    0.272    223.006 1.00 84.43  ? 594  GLY A C   1 
ATOM   4533  O  O   . GLY A  1  594 ? 3.497    -0.606   222.707 1.00 84.36  ? 594  GLY A O   1 
ATOM   4534  N  N   . LEU A  1  595 ? 2.184    0.400    224.230 1.00 85.22  ? 595  LEU A N   1 
ATOM   4535  C  CA  . LEU A  1  595 ? 2.582    -0.502   225.303 1.00 86.08  ? 595  LEU A CA  1 
ATOM   4536  C  C   . LEU A  1  595 ? 1.938    -1.872   225.149 1.00 86.13  ? 595  LEU A C   1 
ATOM   4537  O  O   . LEU A  1  595 ? 2.595    -2.896   225.335 1.00 86.46  ? 595  LEU A O   1 
ATOM   4538  C  CB  . LEU A  1  595 ? 2.220    0.086    226.671 1.00 87.07  ? 595  LEU A CB  1 
ATOM   4539  C  CG  . LEU A  1  595 ? 3.292    0.951    227.337 1.00 87.59  ? 595  LEU A CG  1 
ATOM   4540  C  CD1 . LEU A  1  595 ? 2.743    1.631    228.583 1.00 88.61  ? 595  LEU A CD1 1 
ATOM   4541  C  CD2 . LEU A  1  595 ? 4.518    0.114    227.678 1.00 88.02  ? 595  LEU A CD2 1 
ATOM   4542  N  N   . PHE A  1  596 ? 0.651    -1.887   224.821 1.00 93.09  ? 596  PHE A N   1 
ATOM   4543  C  CA  . PHE A  1  596 ? -0.070   -3.138   224.624 1.00 93.20  ? 596  PHE A CA  1 
ATOM   4544  C  C   . PHE A  1  596 ? 0.557    -3.964   223.505 1.00 92.56  ? 596  PHE A C   1 
ATOM   4545  O  O   . PHE A  1  596 ? 0.604    -5.191   223.581 1.00 92.91  ? 596  PHE A O   1 
ATOM   4546  C  CB  . PHE A  1  596 ? -1.541   -2.868   224.315 1.00 93.03  ? 596  PHE A CB  1 
ATOM   4547  C  CG  . PHE A  1  596 ? -2.305   -2.274   225.465 1.00 93.86  ? 596  PHE A CG  1 
ATOM   4548  C  CD1 . PHE A  1  596 ? -2.945   -3.090   226.384 1.00 94.82  ? 596  PHE A CD1 1 
ATOM   4549  C  CD2 . PHE A  1  596 ? -2.385   -0.901   225.628 1.00 93.80  ? 596  PHE A CD2 1 
ATOM   4550  C  CE1 . PHE A  1  596 ? -3.650   -2.548   227.443 1.00 95.72  ? 596  PHE A CE1 1 
ATOM   4551  C  CE2 . PHE A  1  596 ? -3.089   -0.353   226.684 1.00 94.68  ? 596  PHE A CE2 1 
ATOM   4552  C  CZ  . PHE A  1  596 ? -3.722   -1.177   227.594 1.00 95.64  ? 596  PHE A CZ  1 
ATOM   4553  N  N   . TRP A  1  597 ? 1.037    -3.286   222.468 1.00 84.54  ? 597  TRP A N   1 
ATOM   4554  C  CA  . TRP A  1  597 ? 1.608    -3.971   221.314 1.00 83.99  ? 597  TRP A CA  1 
ATOM   4555  C  C   . TRP A  1  597 ? 3.052    -4.393   221.541 1.00 84.26  ? 597  TRP A C   1 
ATOM   4556  O  O   . TRP A  1  597 ? 3.520    -5.359   220.943 1.00 84.19  ? 597  TRP A O   1 
ATOM   4557  C  CB  . TRP A  1  597 ? 1.501    -3.090   220.073 1.00 83.14  ? 597  TRP A CB  1 
ATOM   4558  C  CG  . TRP A  1  597 ? 0.309    -3.451   219.268 1.00 82.81  ? 597  TRP A CG  1 
ATOM   4559  C  CD1 . TRP A  1  597 ? -0.930   -2.892   219.339 1.00 82.80  ? 597  TRP A CD1 1 
ATOM   4560  C  CD2 . TRP A  1  597 ? 0.233    -4.477   218.275 1.00 82.57  ? 597  TRP A CD2 1 
ATOM   4561  N  NE1 . TRP A  1  597 ? -1.775   -3.504   218.446 1.00 82.56  ? 597  TRP A NE1 1 
ATOM   4562  C  CE2 . TRP A  1  597 ? -1.084   -4.482   217.780 1.00 82.42  ? 597  TRP A CE2 1 
ATOM   4563  C  CE3 . TRP A  1  597 ? 1.153    -5.392   217.755 1.00 82.56  ? 597  TRP A CE3 1 
ATOM   4564  C  CZ2 . TRP A  1  597 ? -1.504   -5.364   216.788 1.00 82.27  ? 597  TRP A CZ2 1 
ATOM   4565  C  CZ3 . TRP A  1  597 ? 0.736    -6.265   216.770 1.00 82.41  ? 597  TRP A CZ3 1 
ATOM   4566  C  CH2 . TRP A  1  597 ? -0.580   -6.244   216.296 1.00 82.27  ? 597  TRP A CH2 1 
ATOM   4567  N  N   . MET A  1  598 ? 3.761    -3.666   222.394 1.00 84.66  ? 598  MET A N   1 
ATOM   4568  C  CA  . MET A  1  598 ? 5.080    -4.102   222.819 1.00 85.15  ? 598  MET A CA  1 
ATOM   4569  C  C   . MET A  1  598 ? 4.918    -5.385   223.628 1.00 85.99  ? 598  MET A C   1 
ATOM   4570  O  O   . MET A  1  598 ? 5.724    -6.309   223.521 1.00 86.29  ? 598  MET A O   1 
ATOM   4571  C  CB  . MET A  1  598 ? 5.781    -3.021   223.638 1.00 85.55  ? 598  MET A CB  1 
ATOM   4572  C  CG  . MET A  1  598 ? 7.190    -3.397   224.061 1.00 86.13  ? 598  MET A CG  1 
ATOM   4573  S  SD  . MET A  1  598 ? 7.269    -4.321   225.608 1.00 87.47  ? 598  MET A SD  1 
ATOM   4574  C  CE  . MET A  1  598 ? 6.675    -3.101   226.780 1.00 88.02  ? 598  MET A CE  1 
ATOM   4575  N  N   . TYR A  1  599 ? 3.866    -5.427   224.442 1.00 89.32  ? 599  TYR A N   1 
ATOM   4576  C  CA  . TYR A  1  599 ? 3.543    -6.608   225.235 1.00 90.25  ? 599  TYR A CA  1 
ATOM   4577  C  C   . TYR A  1  599 ? 3.145    -7.780   224.343 1.00 89.97  ? 599  TYR A C   1 
ATOM   4578  O  O   . TYR A  1  599 ? 3.755    -8.847   224.401 1.00 90.46  ? 599  TYR A O   1 
ATOM   4579  C  CB  . TYR A  1  599 ? 2.419    -6.292   226.223 1.00 90.86  ? 599  TYR A CB  1 
ATOM   4580  C  CG  . TYR A  1  599 ? 1.838    -7.508   226.909 1.00 91.84  ? 599  TYR A CG  1 
ATOM   4581  C  CD1 . TYR A  1  599 ? 2.379    -7.986   228.096 1.00 93.05  ? 599  TYR A CD1 1 
ATOM   4582  C  CD2 . TYR A  1  599 ? 0.744    -8.176   226.372 1.00 91.65  ? 599  TYR A CD2 1 
ATOM   4583  C  CE1 . TYR A  1  599 ? 1.850    -9.096   228.727 1.00 94.08  ? 599  TYR A CE1 1 
ATOM   4584  C  CE2 . TYR A  1  599 ? 0.210    -9.284   226.996 1.00 92.65  ? 599  TYR A CE2 1 
ATOM   4585  C  CZ  . TYR A  1  599 ? 0.764    -9.740   228.170 1.00 93.86  ? 599  TYR A CZ  1 
ATOM   4586  O  OH  . TYR A  1  599 ? 0.225    -10.846  228.784 1.00 94.98  ? 599  TYR A OH  1 
ATOM   4587  N  N   . ASN A  1  600 ? 2.112    -7.577   223.530 1.00 105.28 ? 600  ASN A N   1 
ATOM   4588  C  CA  . ASN A  1  600 ? 1.645    -8.600   222.600 1.00 105.04 ? 600  ASN A CA  1 
ATOM   4589  C  C   . ASN A  1  600 ? 2.761    -9.119   221.701 1.00 104.71 ? 600  ASN A C   1 
ATOM   4590  O  O   . ASN A  1  600 ? 2.802    -10.301  221.381 1.00 105.03 ? 600  ASN A O   1 
ATOM   4591  C  CB  . ASN A  1  600 ? 0.502    -8.056   221.740 1.00 104.30 ? 600  ASN A CB  1 
ATOM   4592  C  CG  . ASN A  1  600 ? -0.031   -9.085   220.759 1.00 111.01 ? 600  ASN A CG  1 
ATOM   4593  O  OD1 . ASN A  1  600 ? 0.507    -9.251   219.664 1.00 117.27 ? 600  ASN A OD1 1 
ATOM   4594  N  ND2 . ASN A  1  600 ? -1.100   -9.775   221.144 1.00 104.70 ? 600  ASN A ND2 1 
ATOM   4595  N  N   . SER A  1  601 ? 3.660    -8.231   221.292 1.00 85.33  ? 601  SER A N   1 
ATOM   4596  C  CA  . SER A  1  601 ? 4.771    -8.618   220.429 1.00 85.09  ? 601  SER A CA  1 
ATOM   4597  C  C   . SER A  1  601 ? 5.716    -9.570   221.149 1.00 86.00  ? 601  SER A C   1 
ATOM   4598  O  O   . SER A  1  601 ? 5.998    -10.661  220.658 1.00 86.25  ? 601  SER A O   1 
ATOM   4599  C  CB  . SER A  1  601 ? 5.541    -7.384   219.952 1.00 84.49  ? 601  SER A CB  1 
ATOM   4600  O  OG  . SER A  1  601 ? 6.684    -7.759   219.202 1.00 84.43  ? 601  SER A OG  1 
ATOM   4601  N  N   . LEU A  1  602 ? 6.202    -9.156   222.315 1.00 86.60  ? 602  LEU A N   1 
ATOM   4602  C  CA  . LEU A  1  602 ? 7.203    -9.933   223.040 1.00 87.57  ? 602  LEU A CA  1 
ATOM   4603  C  C   . LEU A  1  602 ? 6.662    -11.220  223.655 1.00 88.50  ? 602  LEU A C   1 
ATOM   4604  O  O   . LEU A  1  602 ? 7.409    -12.185  223.814 1.00 89.23  ? 602  LEU A O   1 
ATOM   4605  C  CB  . LEU A  1  602 ? 7.846    -9.079   224.129 1.00 88.07  ? 602  LEU A CB  1 
ATOM   4606  C  CG  . LEU A  1  602 ? 9.160    -8.457   223.663 1.00 87.80  ? 602  LEU A CG  1 
ATOM   4607  C  CD1 . LEU A  1  602 ? 8.943    -7.562   222.448 1.00 86.62  ? 602  LEU A CD1 1 
ATOM   4608  C  CD2 . LEU A  1  602 ? 9.823    -7.695   224.792 1.00 88.47  ? 602  LEU A CD2 1 
ATOM   4609  N  N   . SER A  1  603 ? 5.382    -11.240  224.011 1.00 88.57  ? 603  SER A N   1 
ATOM   4610  C  CA  . SER A  1  603 ? 4.780    -12.457  224.545 1.00 89.52  ? 603  SER A CA  1 
ATOM   4611  C  C   . SER A  1  603 ? 4.926    -13.591  223.538 1.00 89.44  ? 603  SER A C   1 
ATOM   4612  O  O   . SER A  1  603 ? 5.121    -14.744  223.913 1.00 90.42  ? 603  SER A O   1 
ATOM   4613  C  CB  . SER A  1  603 ? 3.304    -12.246  224.889 1.00 89.54  ? 603  SER A CB  1 
ATOM   4614  O  OG  . SER A  1  603 ? 3.150    -11.366  225.989 1.00 89.94  ? 603  SER A OG  1 
ATOM   4615  N  N   . ILE A  1  604 ? 4.846    -13.250  222.256 1.00 88.38  ? 604  ILE A N   1 
ATOM   4616  C  CA  . ILE A  1  604 ? 4.980    -14.241  221.196 1.00 88.31  ? 604  ILE A CA  1 
ATOM   4617  C  C   . ILE A  1  604 ? 6.437    -14.645  221.027 1.00 88.67  ? 604  ILE A C   1 
ATOM   4618  O  O   . ILE A  1  604 ? 6.734    -15.780  220.661 1.00 89.22  ? 604  ILE A O   1 
ATOM   4619  C  CB  . ILE A  1  604 ? 4.438    -13.708  219.851 1.00 87.18  ? 604  ILE A CB  1 
ATOM   4620  C  CG1 . ILE A  1  604 ? 2.983    -13.256  219.998 1.00 86.89  ? 604  ILE A CG1 1 
ATOM   4621  C  CG2 . ILE A  1  604 ? 4.580    -14.754  218.747 1.00 87.25  ? 604  ILE A CG2 1 
ATOM   4622  C  CD1 . ILE A  1  604 ? 2.032    -14.342  220.438 1.00 87.71  ? 604  ILE A CD1 1 
ATOM   4623  N  N   . VAL A  1  605 ? 7.347    -13.717  221.299 1.00 88.44  ? 605  VAL A N   1 
ATOM   4624  C  CA  . VAL A  1  605 ? 8.771    -14.008  221.202 1.00 88.87  ? 605  VAL A CA  1 
ATOM   4625  C  C   . VAL A  1  605 ? 9.221    -14.967  222.291 1.00 90.22  ? 605  VAL A C   1 
ATOM   4626  O  O   . VAL A  1  605 ? 9.960    -15.913  222.025 1.00 90.86  ? 605  VAL A O   1 
ATOM   4627  C  CB  . VAL A  1  605 ? 9.613    -12.727  221.282 1.00 88.40  ? 605  VAL A CB  1 
ATOM   4628  C  CG1 . VAL A  1  605 ? 11.100   -13.067  221.299 1.00 89.03  ? 605  VAL A CG1 1 
ATOM   4629  C  CG2 . VAL A  1  605 ? 9.270    -11.800  220.123 1.00 87.19  ? 605  VAL A CG2 1 
ATOM   4630  N  N   . ILE A  1  606 ? 8.775    -14.722  223.517 1.00 90.78  ? 606  ILE A N   1 
ATOM   4631  C  CA  . ILE A  1  606 ? 9.164    -15.568  224.635 1.00 92.22  ? 606  ILE A CA  1 
ATOM   4632  C  C   . ILE A  1  606 ? 8.425    -16.903  224.565 1.00 92.90  ? 606  ILE A C   1 
ATOM   4633  O  O   . ILE A  1  606 ? 8.906    -17.914  225.078 1.00 94.14  ? 606  ILE A O   1 
ATOM   4634  C  CB  . ILE A  1  606 ? 8.901    -14.880  225.994 1.00 92.77  ? 606  ILE A CB  1 
ATOM   4635  C  CG1 . ILE A  1  606 ? 7.409    -14.580  226.179 1.00 92.41  ? 606  ILE A CG1 1 
ATOM   4636  C  CG2 . ILE A  1  606 ? 9.730    -13.597  226.094 1.00 92.27  ? 606  ILE A CG2 1 
ATOM   4637  C  CD1 . ILE A  1  606 ? 7.066    -13.941  227.519 1.00 93.10  ? 606  ILE A CD1 1 
ATOM   4638  N  N   . PHE A  1  607 ? 7.258    -16.903  223.926 1.00 92.19  ? 607  PHE A N   1 
ATOM   4639  C  CA  . PHE A  1  607 ? 6.511    -18.137  223.709 1.00 92.80  ? 607  PHE A CA  1 
ATOM   4640  C  C   . PHE A  1  607 ? 7.154    -18.957  222.595 1.00 92.76  ? 607  PHE A C   1 
ATOM   4641  O  O   . PHE A  1  607 ? 7.167    -20.185  222.652 1.00 93.78  ? 607  PHE A O   1 
ATOM   4642  C  CB  . PHE A  1  607 ? 5.046    -17.830  223.385 1.00 92.13  ? 607  PHE A CB  1 
ATOM   4643  C  CG  . PHE A  1  607 ? 4.201    -17.554  224.601 1.00 92.73  ? 607  PHE A CG  1 
ATOM   4644  C  CD1 . PHE A  1  607 ? 4.791    -17.282  225.825 1.00 93.56  ? 607  PHE A CD1 1 
ATOM   4645  C  CD2 . PHE A  1  607 ? 2.818    -17.567  224.521 1.00 92.59  ? 607  PHE A CD2 1 
ATOM   4646  C  CE1 . PHE A  1  607 ? 4.026    -17.033  226.936 1.00 94.25  ? 607  PHE A CE1 1 
ATOM   4647  C  CE2 . PHE A  1  607 ? 2.043    -17.314  225.639 1.00 93.26  ? 607  PHE A CE2 1 
ATOM   4648  C  CZ  . PHE A  1  607 ? 2.650    -17.046  226.848 1.00 94.10  ? 607  PHE A CZ  1 
ATOM   4649  N  N   . HIS A  1  608 ? 7.676    -18.277  221.578 1.00 91.69  ? 608  HIS A N   1 
ATOM   4650  C  CA  . HIS A  1  608 ? 8.479    -18.937  220.556 1.00 91.76  ? 608  HIS A CA  1 
ATOM   4651  C  C   . HIS A  1  608 ? 9.678    -19.588  221.239 1.00 92.97  ? 608  HIS A C   1 
ATOM   4652  O  O   . HIS A  1  608 ? 9.944    -20.773  221.042 1.00 93.89  ? 608  HIS A O   1 
ATOM   4653  C  CB  . HIS A  1  608 ? 8.919    -17.938  219.471 1.00 90.53  ? 608  HIS A CB  1 
ATOM   4654  C  CG  . HIS A  1  608 ? 9.852    -18.507  218.440 1.00 90.69  ? 608  HIS A CG  1 
ATOM   4655  N  ND1 . HIS A  1  608 ? 9.790    -18.150  217.110 1.00 89.82  ? 608  HIS A ND1 1 
ATOM   4656  C  CD2 . HIS A  1  608 ? 10.895   -19.367  218.546 1.00 91.70  ? 608  HIS A CD2 1 
ATOM   4657  C  CE1 . HIS A  1  608 ? 10.736   -18.784  216.439 1.00 90.31  ? 608  HIS A CE1 1 
ATOM   4658  N  NE2 . HIS A  1  608 ? 11.419   -19.530  217.287 1.00 91.44  ? 608  HIS A NE2 1 
ATOM   4659  N  N   . PHE A  1  609 ? 10.391   -18.807  222.045 1.00 93.06  ? 609  PHE A N   1 
ATOM   4660  C  CA  . PHE A  1  609 ? 11.608   -19.277  222.698 1.00 94.23  ? 609  PHE A CA  1 
ATOM   4661  C  C   . PHE A  1  609 ? 11.362   -20.497  223.577 1.00 95.74  ? 609  PHE A C   1 
ATOM   4662  O  O   . PHE A  1  609 ? 12.074   -21.495  223.475 1.00 96.76  ? 609  PHE A O   1 
ATOM   4663  C  CB  . PHE A  1  609 ? 12.224   -18.160  223.544 1.00 94.16  ? 609  PHE A CB  1 
ATOM   4664  C  CG  . PHE A  1  609 ? 13.526   -18.540  224.190 1.00 95.38  ? 609  PHE A CG  1 
ATOM   4665  C  CD1 . PHE A  1  609 ? 13.544   -19.158  225.430 1.00 96.81  ? 609  PHE A CD1 1 
ATOM   4666  C  CD2 . PHE A  1  609 ? 14.730   -18.286  223.558 1.00 95.23  ? 609  PHE A CD2 1 
ATOM   4667  C  CE1 . PHE A  1  609 ? 14.737   -19.514  226.026 1.00 98.05  ? 609  PHE A CE1 1 
ATOM   4668  C  CE2 . PHE A  1  609 ? 15.928   -18.640  224.149 1.00 96.45  ? 609  PHE A CE2 1 
ATOM   4669  C  CZ  . PHE A  1  609 ? 15.931   -19.255  225.385 1.00 97.86  ? 609  PHE A CZ  1 
ATOM   4670  N  N   . SER A  1  610 ? 10.359   -20.409  224.444 1.00 96.00  ? 610  SER A N   1 
ATOM   4671  C  CA  . SER A  1  610 ? 10.060   -21.482  225.388 1.00 97.57  ? 610  SER A CA  1 
ATOM   4672  C  C   . SER A  1  610 ? 9.780    -22.814  224.695 1.00 98.14  ? 610  SER A C   1 
ATOM   4673  O  O   . SER A  1  610 ? 10.385   -23.834  225.026 1.00 99.53  ? 610  SER A O   1 
ATOM   4674  C  CB  . SER A  1  610 ? 8.864    -21.101  226.261 1.00 97.64  ? 610  SER A CB  1 
ATOM   4675  O  OG  . SER A  1  610 ? 8.519    -22.161  227.136 1.00 99.26  ? 610  SER A OG  1 
ATOM   4676  N  N   . TRP A  1  611 ? 8.867    -22.800  223.730 1.00 97.17  ? 611  TRP A N   1 
ATOM   4677  C  CA  . TRP A  1  611 ? 8.425    -24.029  223.083 1.00 97.76  ? 611  TRP A CA  1 
ATOM   4678  C  C   . TRP A  1  611 ? 9.505    -24.622  222.184 1.00 97.99  ? 611  TRP A C   1 
ATOM   4679  O  O   . TRP A  1  611 ? 9.727    -25.831  222.185 1.00 99.26  ? 611  TRP A O   1 
ATOM   4680  C  CB  . TRP A  1  611 ? 7.164    -23.766  222.257 1.00 96.68  ? 611  TRP A CB  1 
ATOM   4681  C  CG  . TRP A  1  611 ? 6.390    -25.003  221.894 1.00 97.50  ? 611  TRP A CG  1 
ATOM   4682  C  CD1 . TRP A  1  611 ? 6.616    -26.276  222.332 1.00 99.12  ? 611  TRP A CD1 1 
ATOM   4683  C  CD2 . TRP A  1  611 ? 5.264    -25.080  221.010 1.00 96.84  ? 611  TRP A CD2 1 
ATOM   4684  N  NE1 . TRP A  1  611 ? 5.700    -27.137  221.780 1.00 99.51  ? 611  TRP A NE1 1 
ATOM   4685  C  CE2 . TRP A  1  611 ? 4.860    -26.428  220.963 1.00 98.13  ? 611  TRP A CE2 1 
ATOM   4686  C  CE3 . TRP A  1  611 ? 4.560    -24.139  220.254 1.00 95.38  ? 611  TRP A CE3 1 
ATOM   4687  C  CZ2 . TRP A  1  611 ? 3.781    -26.857  220.192 1.00 98.00  ? 611  TRP A CZ2 1 
ATOM   4688  C  CZ3 . TRP A  1  611 ? 3.489    -24.567  219.489 1.00 95.25  ? 611  TRP A CZ3 1 
ATOM   4689  C  CH2 . TRP A  1  611 ? 3.111    -25.914  219.464 1.00 96.55  ? 611  TRP A CH2 1 
ATOM   4690  N  N   . LYS A  1  612 ? 10.172   -23.764  221.420 1.00 96.85  ? 612  LYS A N   1 
ATOM   4691  C  CA  . LYS A  1  612 ? 11.179   -24.205  220.461 1.00 97.00  ? 612  LYS A CA  1 
ATOM   4692  C  C   . LYS A  1  612 ? 12.357   -24.872  221.157 1.00 98.47  ? 612  LYS A C   1 
ATOM   4693  O  O   . LYS A  1  612 ? 12.810   -25.934  220.737 1.00 99.45  ? 612  LYS A O   1 
ATOM   4694  C  CB  . LYS A  1  612 ? 11.675   -23.022  219.627 1.00 95.59  ? 612  LYS A CB  1 
ATOM   4695  C  CG  . LYS A  1  612 ? 12.717   -23.382  218.573 1.00 95.76  ? 612  LYS A CG  1 
ATOM   4696  C  CD  . LYS A  1  612 ? 12.140   -24.257  217.475 1.00 95.86  ? 612  LYS A CD  1 
ATOM   4697  C  CE  . LYS A  1  612 ? 13.205   -24.610  216.454 1.00 96.17  ? 612  LYS A CE  1 
ATOM   4698  N  NZ  . LYS A  1  612 ? 12.650   -25.384  215.312 1.00 96.29  ? 612  LYS A NZ  1 
ATOM   4699  N  N   . MET A  1  613 ? 12.853   -24.246  222.219 1.00 98.71  ? 613  MET A N   1 
ATOM   4700  C  CA  . MET A  1  613 ? 13.985   -24.793  222.952 1.00 100.18 ? 613  MET A CA  1 
ATOM   4701  C  C   . MET A  1  613 ? 13.576   -26.073  223.670 1.00 101.83 ? 613  MET A C   1 
ATOM   4702  O  O   . MET A  1  613 ? 14.345   -27.032  223.720 1.00 103.19 ? 613  MET A O   1 
ATOM   4703  C  CB  . MET A  1  613 ? 14.543   -23.769  223.944 1.00 100.12 ? 613  MET A CB  1 
ATOM   4704  C  CG  . MET A  1  613 ? 15.169   -22.541  223.288 1.00 98.78  ? 613  MET A CG  1 
ATOM   4705  S  SD  . MET A  1  613 ? 16.532   -22.935  222.168 1.00 99.02  ? 613  MET A SD  1 
ATOM   4706  C  CE  . MET A  1  613 ? 17.836   -23.355  223.323 1.00 100.85 ? 613  MET A CE  1 
ATOM   4707  N  N   . GLN A  1  614 ? 12.370   -26.089  224.229 1.00 101.81 ? 614  GLN A N   1 
ATOM   4708  C  CA  . GLN A  1  614 ? 11.858   -27.295  224.868 1.00 103.41 ? 614  GLN A CA  1 
ATOM   4709  C  C   . GLN A  1  614 ? 11.690   -28.426  223.855 1.00 103.83 ? 614  GLN A C   1 
ATOM   4710  O  O   . GLN A  1  614 ? 12.135   -29.549  224.085 1.00 105.44 ? 614  GLN A O   1 
ATOM   4711  C  CB  . GLN A  1  614 ? 10.523   -27.023  225.568 1.00 103.26 ? 614  GLN A CB  1 
ATOM   4712  C  CG  . GLN A  1  614 ? 10.662   -26.416  226.955 1.00 103.84 ? 614  GLN A CG  1 
ATOM   4713  C  CD  . GLN A  1  614 ? 9.351    -26.396  227.714 1.00 104.15 ? 614  GLN A CD  1 
ATOM   4714  O  OE1 . GLN A  1  614 ? 8.691    -27.424  227.853 1.00 105.24 ? 614  GLN A OE1 1 
ATOM   4715  N  NE2 . GLN A  1  614 ? 8.970    -25.228  228.217 1.00 103.31 ? 614  GLN A NE2 1 
ATOM   4716  N  N   . SER A  1  615 ? 11.060   -28.118  222.727 1.00 102.46 ? 615  SER A N   1 
ATOM   4717  C  CA  . SER A  1  615 ? 10.678   -29.142  221.760 1.00 102.85 ? 615  SER A CA  1 
ATOM   4718  C  C   . SER A  1  615 ? 11.814   -29.632  220.857 1.00 103.21 ? 615  SER A C   1 
ATOM   4719  O  O   . SER A  1  615 ? 11.885   -30.821  220.553 1.00 104.45 ? 615  SER A O   1 
ATOM   4720  C  CB  . SER A  1  615 ? 9.539    -28.618  220.883 1.00 101.37 ? 615  SER A CB  1 
ATOM   4721  O  OG  . SER A  1  615 ? 9.133    -29.595  219.942 1.00 101.81 ? 615  SER A OG  1 
ATOM   4722  N  N   . ASP A  1  616 ? 12.695   -28.729  220.432 1.00 111.60 ? 616  ASP A N   1 
ATOM   4723  C  CA  . ASP A  1  616 ? 13.678   -29.051  219.393 1.00 111.75 ? 616  ASP A CA  1 
ATOM   4724  C  C   . ASP A  1  616 ? 15.135   -28.800  219.788 1.00 112.31 ? 616  ASP A C   1 
ATOM   4725  O  O   . ASP A  1  616 ? 16.018   -28.820  218.929 1.00 112.29 ? 616  ASP A O   1 
ATOM   4726  C  CB  . ASP A  1  616 ? 13.359   -28.253  218.124 1.00 113.43 ? 616  ASP A CB  1 
ATOM   4727  C  CG  . ASP A  1  616 ? 12.001   -28.597  217.545 1.00 114.47 ? 616  ASP A CG  1 
ATOM   4728  O  OD1 . ASP A  1  616 ? 11.536   -29.735  217.755 1.00 111.75 ? 616  ASP A OD1 1 
ATOM   4729  O  OD2 . ASP A  1  616 ? 11.402   -27.730  216.876 1.00 109.36 ? 616  ASP A OD2 1 
ATOM   4730  N  N   . VAL A  1  617 ? 15.391   -28.561  221.072 1.00 105.44 ? 617  VAL A N   1 
ATOM   4731  C  CA  . VAL A  1  617 ? 16.759   -28.337  221.545 1.00 106.14 ? 617  VAL A CA  1 
ATOM   4732  C  C   . VAL A  1  617 ? 17.028   -29.039  222.869 1.00 107.94 ? 617  VAL A C   1 
ATOM   4733  O  O   . VAL A  1  617 ? 17.796   -30.000  222.930 1.00 109.50 ? 617  VAL A O   1 
ATOM   4734  C  CB  . VAL A  1  617 ? 17.061   -26.839  221.721 1.00 104.77 ? 617  VAL A CB  1 
ATOM   4735  C  CG1 . VAL A  1  617 ? 18.529   -26.633  222.079 1.00 105.55 ? 617  VAL A CG1 1 
ATOM   4736  C  CG2 . VAL A  1  617 ? 16.697   -26.070  220.462 1.00 103.02 ? 617  VAL A CG2 1 
ATOM   4737  N  N   . TRP A  1  618 ? 16.395   -28.544  223.927 1.00 105.93 ? 618  TRP A N   1 
ATOM   4738  C  CA  . TRP A  1  618 ? 16.575   -29.092  225.265 1.00 107.68 ? 618  TRP A CA  1 
ATOM   4739  C  C   . TRP A  1  618 ? 16.147   -30.551  225.326 1.00 109.25 ? 618  TRP A C   1 
ATOM   4740  O  O   . TRP A  1  618 ? 15.593   -31.088  224.367 1.00 108.89 ? 618  TRP A O   1 
ATOM   4741  C  CB  . TRP A  1  618 ? 15.780   -28.276  226.287 1.00 107.22 ? 618  TRP A CB  1 
ATOM   4742  C  CG  . TRP A  1  618 ? 16.282   -26.877  226.492 1.00 106.08 ? 618  TRP A CG  1 
ATOM   4743  C  CD1 . TRP A  1  618 ? 17.552   -26.420  226.290 1.00 106.04 ? 618  TRP A CD1 1 
ATOM   4744  C  CD2 . TRP A  1  618 ? 15.517   -25.751  226.939 1.00 104.92 ? 618  TRP A CD2 1 
ATOM   4745  N  NE1 . TRP A  1  618 ? 17.626   -25.080  226.587 1.00 104.94 ? 618  TRP A NE1 1 
ATOM   4746  C  CE2 . TRP A  1  618 ? 16.390   -24.646  226.988 1.00 104.24 ? 618  TRP A CE2 1 
ATOM   4747  C  CE3 . TRP A  1  618 ? 14.179   -25.570  227.303 1.00 104.48 ? 618  TRP A CE3 1 
ATOM   4748  C  CZ2 . TRP A  1  618 ? 15.968   -23.379  227.385 1.00 103.15 ? 618  TRP A CZ2 1 
ATOM   4749  C  CZ3 . TRP A  1  618 ? 13.762   -24.312  227.698 1.00 103.40 ? 618  TRP A CZ3 1 
ATOM   4750  C  CH2 . TRP A  1  618 ? 14.653   -23.233  227.736 1.00 102.75 ? 618  TRP A CH2 1 
ATOM   4751  N  N   . GLY A  1  619 ? 16.408   -31.182  226.465 1.00 171.33 ? 619  GLY A N   1 
ATOM   4752  C  CA  . GLY A  1  619 ? 16.088   -32.582  226.662 1.00 194.92 ? 619  GLY A CA  1 
ATOM   4753  C  C   . GLY A  1  619 ? 17.267   -33.333  227.239 1.00 203.63 ? 619  GLY A C   1 
ATOM   4754  O  O   . GLY A  1  619 ? 18.320   -32.749  227.498 1.00 206.84 ? 619  GLY A O   1 
ATOM   4755  N  N   . THR A  1  620 ? 17.085   -34.636  227.433 1.00 126.36 ? 620  THR A N   1 
ATOM   4756  C  CA  . THR A  1  620 ? 18.121   -35.479  228.011 1.00 128.60 ? 620  THR A CA  1 
ATOM   4757  C  C   . THR A  1  620 ? 18.847   -36.271  226.934 1.00 129.12 ? 620  THR A C   1 
ATOM   4758  O  O   . THR A  1  620 ? 18.223   -36.851  226.045 1.00 128.83 ? 620  THR A O   1 
ATOM   4759  C  CB  . THR A  1  620 ? 17.542   -36.461  229.042 1.00 130.70 ? 620  THR A CB  1 
ATOM   4760  O  OG1 . THR A  1  620 ? 16.455   -37.189  228.455 1.00 130.64 ? 620  THR A OG1 1 
ATOM   4761  C  CG2 . THR A  1  620 ? 17.048   -35.713  230.267 1.00 130.64 ? 620  THR A CG2 1 
ATOM   4762  N  N   . VAL A  1  621 ? 20.172   -36.284  227.024 1.00 136.90 ? 621  VAL A N   1 
ATOM   4763  C  CA  . VAL A  1  621 ? 21.007   -37.045  226.107 1.00 137.70 ? 621  VAL A CA  1 
ATOM   4764  C  C   . VAL A  1  621 ? 21.424   -38.345  226.773 1.00 140.47 ? 621  VAL A C   1 
ATOM   4765  O  O   . VAL A  1  621 ? 21.928   -38.340  227.897 1.00 141.82 ? 621  VAL A O   1 
ATOM   4766  C  CB  . VAL A  1  621 ? 22.264   -36.258  225.691 1.00 137.03 ? 621  VAL A CB  1 
ATOM   4767  C  CG1 . VAL A  1  621 ? 22.961   -36.943  224.526 1.00 137.54 ? 621  VAL A CG1 1 
ATOM   4768  C  CG2 . VAL A  1  621 ? 21.903   -34.833  225.323 1.00 134.50 ? 621  VAL A CG2 1 
ATOM   4769  N  N   . SER A  1  622 ? 21.215   -39.460  226.082 1.00 184.71 ? 622  SER A N   1 
ATOM   4770  C  CA  . SER A  1  622 ? 21.682   -40.743  226.580 1.00 189.89 ? 622  SER A CA  1 
ATOM   4771  C  C   . SER A  1  622 ? 23.169   -40.843  226.266 1.00 174.91 ? 622  SER A C   1 
ATOM   4772  O  O   . SER A  1  622 ? 23.664   -40.121  225.404 1.00 173.39 ? 622  SER A O   1 
ATOM   4773  C  CB  . SER A  1  622 ? 20.909   -41.900  225.945 1.00 210.15 ? 622  SER A CB  1 
ATOM   4774  O  OG  . SER A  1  622 ? 20.754   -41.707  224.550 1.00 222.81 ? 622  SER A OG  1 
ATOM   4775  N  N   . PRO A  1  623 ? 23.887   -41.737  226.960 1.00 155.00 ? 623  PRO A N   1 
ATOM   4776  C  CA  . PRO A  1  623 ? 25.329   -41.886  226.729 1.00 162.34 ? 623  PRO A CA  1 
ATOM   4777  C  C   . PRO A  1  623 ? 25.692   -42.096  225.258 1.00 169.88 ? 623  PRO A C   1 
ATOM   4778  O  O   . PRO A  1  623 ? 26.757   -41.656  224.825 1.00 166.14 ? 623  PRO A O   1 
ATOM   4779  C  CB  . PRO A  1  623 ? 25.687   -43.116  227.566 1.00 164.46 ? 623  PRO A CB  1 
ATOM   4780  C  CG  . PRO A  1  623 ? 24.684   -43.122  228.664 1.00 159.49 ? 623  PRO A CG  1 
ATOM   4781  C  CD  . PRO A  1  623 ? 23.414   -42.594  228.062 1.00 157.11 ? 623  PRO A CD  1 
ATOM   4782  N  N   . ASP A  1  624 ? 24.814   -42.752  224.505 1.00 188.98 ? 624  ASP A N   1 
ATOM   4783  C  CA  . ASP A  1  624 ? 25.084   -43.054  223.102 1.00 184.91 ? 624  ASP A CA  1 
ATOM   4784  C  C   . ASP A  1  624 ? 25.083   -41.806  222.226 1.00 171.22 ? 624  ASP A C   1 
ATOM   4785  O  O   . ASP A  1  624 ? 25.761   -41.766  221.198 1.00 180.70 ? 624  ASP A O   1 
ATOM   4786  C  CB  . ASP A  1  624 ? 24.049   -44.044  222.566 1.00 192.11 ? 624  ASP A CB  1 
ATOM   4787  C  CG  . ASP A  1  624 ? 22.670   -43.427  222.432 1.00 197.67 ? 624  ASP A CG  1 
ATOM   4788  O  OD1 . ASP A  1  624 ? 21.930   -43.395  223.437 1.00 199.06 ? 624  ASP A OD1 1 
ATOM   4789  O  OD2 . ASP A  1  624 ? 22.327   -42.971  221.320 1.00 200.72 ? 624  ASP A OD2 1 
ATOM   4790  N  N   . GLY A  1  625 ? 24.321   -40.795  222.633 1.00 136.26 ? 625  GLY A N   1 
ATOM   4791  C  CA  . GLY A  1  625 ? 24.287   -39.523  221.931 1.00 133.77 ? 625  GLY A CA  1 
ATOM   4792  C  C   . GLY A  1  625 ? 22.897   -39.128  221.470 1.00 131.87 ? 625  GLY A C   1 
ATOM   4793  O  O   . GLY A  1  625 ? 22.661   -37.968  221.129 1.00 129.76 ? 625  GLY A O   1 
ATOM   4794  N  N   . SER A  1  626 ? 21.973   -40.085  221.453 1.00 149.13 ? 626  SER A N   1 
ATOM   4795  C  CA  . SER A  1  626 ? 20.603   -39.805  221.039 1.00 147.54 ? 626  SER A CA  1 
ATOM   4796  C  C   . SER A  1  626 ? 19.912   -38.888  222.045 1.00 146.39 ? 626  SER A C   1 
ATOM   4797  O  O   . SER A  1  626 ? 20.015   -39.089  223.255 1.00 147.61 ? 626  SER A O   1 
ATOM   4798  C  CB  . SER A  1  626 ? 19.816   -41.108  220.877 1.00 149.14 ? 626  SER A CB  1 
ATOM   4799  O  OG  . SER A  1  626 ? 19.838   -41.872  222.069 1.00 163.04 ? 626  SER A OG  1 
ATOM   4800  N  N   . VAL A  1  627 ? 19.204   -37.887  221.528 1.00 126.39 ? 627  VAL A N   1 
ATOM   4801  C  CA  . VAL A  1  627 ? 18.546   -36.880  222.358 1.00 125.12 ? 627  VAL A CA  1 
ATOM   4802  C  C   . VAL A  1  627 ? 17.042   -37.109  222.456 1.00 124.72 ? 627  VAL A C   1 
ATOM   4803  O  O   . VAL A  1  627 ? 16.391   -37.444  221.466 1.00 124.20 ? 627  VAL A O   1 
ATOM   4804  C  CB  . VAL A  1  627 ? 18.790   -35.460  221.808 1.00 122.89 ? 627  VAL A CB  1 
ATOM   4805  C  CG1 . VAL A  1  627 ? 18.197   -34.410  222.744 1.00 121.76 ? 627  VAL A CG1 1 
ATOM   4806  C  CG2 . VAL A  1  627 ? 20.278   -35.217  221.605 1.00 123.29 ? 627  VAL A CG2 1 
ATOM   4807  N  N   . THR A  1  628 ? 16.503   -36.932  223.659 1.00 116.57 ? 628  THR A N   1 
ATOM   4808  C  CA  . THR A  1  628 ? 15.062   -36.978  223.881 1.00 116.13 ? 628  THR A CA  1 
ATOM   4809  C  C   . THR A  1  628 ? 14.573   -35.627  224.386 1.00 114.40 ? 628  THR A C   1 
ATOM   4810  O  O   . THR A  1  628 ? 14.748   -35.289  225.557 1.00 114.96 ? 628  THR A O   1 
ATOM   4811  C  CB  . THR A  1  628 ? 14.673   -38.073  224.888 1.00 118.37 ? 628  THR A CB  1 
ATOM   4812  O  OG1 . THR A  1  628 ? 15.277   -39.315  224.505 1.00 120.19 ? 628  THR A OG1 1 
ATOM   4813  C  CG2 . THR A  1  628 ? 13.160   -38.238  224.935 1.00 118.04 ? 628  THR A CG2 1 
ATOM   4814  N  N   . HIS A  1  629 ? 13.959   -34.858  223.493 1.00 131.42 ? 629  HIS A N   1 
ATOM   4815  C  CA  . HIS A  1  629 ? 13.474   -33.527  223.830 1.00 129.70 ? 629  HIS A CA  1 
ATOM   4816  C  C   . HIS A  1  629 ? 12.264   -33.615  224.755 1.00 130.09 ? 629  HIS A C   1 
ATOM   4817  O  O   . HIS A  1  629 ? 11.592   -34.643  224.807 1.00 131.28 ? 629  HIS A O   1 
ATOM   4818  C  CB  . HIS A  1  629 ? 13.132   -32.758  222.554 1.00 127.63 ? 629  HIS A CB  1 
ATOM   4819  C  CG  . HIS A  1  629 ? 14.237   -32.752  221.543 1.00 127.39 ? 629  HIS A CG  1 
ATOM   4820  N  ND1 . HIS A  1  629 ? 15.451   -32.141  221.771 1.00 127.29 ? 629  HIS A ND1 1 
ATOM   4821  C  CD2 . HIS A  1  629 ? 14.317   -33.297  220.306 1.00 127.35 ? 629  HIS A CD2 1 
ATOM   4822  C  CE1 . HIS A  1  629 ? 16.228   -32.302  220.714 1.00 127.20 ? 629  HIS A CE1 1 
ATOM   4823  N  NE2 . HIS A  1  629 ? 15.563   -32.999  219.811 1.00 127.23 ? 629  HIS A NE2 1 
ATOM   4824  N  N   . VAL A  1  630 ? 11.985   -32.536  225.481 1.00 110.17 ? 630  VAL A N   1 
ATOM   4825  C  CA  . VAL A  1  630 ? 10.948   -32.567  226.512 1.00 110.76 ? 630  VAL A CA  1 
ATOM   4826  C  C   . VAL A  1  630 ? 9.555    -32.523  225.896 1.00 109.77 ? 630  VAL A C   1 
ATOM   4827  O  O   . VAL A  1  630 ? 8.578    -32.910  226.538 1.00 110.59 ? 630  VAL A O   1 
ATOM   4828  C  CB  . VAL A  1  630 ? 11.100   -31.401  227.532 1.00 110.25 ? 630  VAL A CB  1 
ATOM   4829  C  CG1 . VAL A  1  630 ? 12.566   -31.176  227.889 1.00 110.79 ? 630  VAL A CG1 1 
ATOM   4830  C  CG2 . VAL A  1  630 ? 10.467   -30.107  227.016 1.00 108.01 ? 630  VAL A CG2 1 
ATOM   4831  N  N   . THR A  1  631 ? 9.468    -32.045  224.657 1.00 108.11 ? 631  THR A N   1 
ATOM   4832  C  CA  . THR A  1  631 ? 8.191    -31.966  223.952 1.00 107.15 ? 631  THR A CA  1 
ATOM   4833  C  C   . THR A  1  631 ? 8.195    -32.872  222.721 1.00 107.38 ? 631  THR A C   1 
ATOM   4834  O  O   . THR A  1  631 ? 7.256    -32.854  221.926 1.00 106.60 ? 631  THR A O   1 
ATOM   4835  C  CB  . THR A  1  631 ? 7.868    -30.523  223.521 1.00 104.98 ? 631  THR A CB  1 
ATOM   4836  O  OG1 . THR A  1  631 ? 8.656    -29.600  224.282 1.00 104.64 ? 631  THR A OG1 1 
ATOM   4837  C  CG2 . THR A  1  631 ? 6.390    -30.229  223.741 1.00 104.51 ? 631  THR A CG2 1 
ATOM   4838  N  N   . LEU A  1  632 ? 9.266    -33.646  222.564 1.00 120.27 ? 632  LEU A N   1 
ATOM   4839  C  CA  . LEU A  1  632 ? 9.323    -34.709  221.564 1.00 121.01 ? 632  LEU A CA  1 
ATOM   4840  C  C   . LEU A  1  632 ? 9.244    -34.189  220.131 1.00 119.38 ? 632  LEU A C   1 
ATOM   4841  O  O   . LEU A  1  632 ? 8.811    -34.904  219.228 1.00 119.70 ? 632  LEU A O   1 
ATOM   4842  C  CB  . LEU A  1  632 ? 8.197    -35.721  221.806 1.00 122.28 ? 632  LEU A CB  1 
ATOM   4843  C  CG  . LEU A  1  632 ? 8.083    -36.300  223.219 1.00 124.08 ? 632  LEU A CG  1 
ATOM   4844  C  CD1 . LEU A  1  632 ? 6.786    -37.077  223.357 1.00 125.03 ? 632  LEU A CD1 1 
ATOM   4845  C  CD2 . LEU A  1  632 ? 9.272    -37.194  223.539 1.00 125.89 ? 632  LEU A CD2 1 
ATOM   4846  N  N   . GLY A  1  633 ? 9.659    -32.945  219.925 1.00 106.02 ? 633  GLY A N   1 
ATOM   4847  C  CA  . GLY A  1  633 ? 9.726    -32.382  218.589 1.00 104.58 ? 633  GLY A CA  1 
ATOM   4848  C  C   . GLY A  1  633 ? 8.363    -32.133  217.969 1.00 103.60 ? 633  GLY A C   1 
ATOM   4849  O  O   . GLY A  1  633 ? 8.214    -32.172  216.748 1.00 103.04 ? 633  GLY A O   1 
ATOM   4850  N  N   . ASN A  1  634 ? 7.368    -31.869  218.810 1.00 103.48 ? 634  ASN A N   1 
ATOM   4851  C  CA  . ASN A  1  634 ? 6.009    -31.628  218.337 1.00 102.68 ? 634  ASN A CA  1 
ATOM   4852  C  C   . ASN A  1  634 ? 5.832    -30.220  217.765 1.00 100.68 ? 634  ASN A C   1 
ATOM   4853  O  O   . ASN A  1  634 ? 4.764    -29.878  217.260 1.00 99.89  ? 634  ASN A O   1 
ATOM   4854  C  CB  . ASN A  1  634 ? 5.015    -31.862  219.475 1.00 103.45 ? 634  ASN A CB  1 
ATOM   4855  C  CG  . ASN A  1  634 ? 5.153    -30.844  220.587 1.00 102.89 ? 634  ASN A CG  1 
ATOM   4856  O  OD1 . ASN A  1  634 ? 6.204    -30.224  220.750 1.00 102.41 ? 634  ASN A OD1 1 
ATOM   4857  N  ND2 . ASN A  1  634 ? 4.097    -30.681  221.373 1.00 103.07 ? 634  ASN A ND2 1 
ATOM   4858  N  N   . PHE A  1  635 ? 6.887    -29.414  217.847 1.00 119.26 ? 635  PHE A N   1 
ATOM   4859  C  CA  . PHE A  1  635 ? 6.847    -28.021  217.412 1.00 117.49 ? 635  PHE A CA  1 
ATOM   4860  C  C   . PHE A  1  635 ? 6.547    -27.910  215.921 1.00 116.68 ? 635  PHE A C   1 
ATOM   4861  O  O   . PHE A  1  635 ? 5.555    -27.303  215.522 1.00 115.70 ? 635  PHE A O   1 
ATOM   4862  C  CB  . PHE A  1  635 ? 8.177    -27.334  217.732 1.00 117.18 ? 635  PHE A CB  1 
ATOM   4863  C  CG  . PHE A  1  635 ? 8.162    -25.844  217.533 1.00 115.54 ? 635  PHE A CG  1 
ATOM   4864  C  CD1 . PHE A  1  635 ? 7.803    -24.997  218.569 1.00 115.11 ? 635  PHE A CD1 1 
ATOM   4865  C  CD2 . PHE A  1  635 ? 8.519    -25.288  216.315 1.00 116.05 ? 635  PHE A CD2 1 
ATOM   4866  C  CE1 . PHE A  1  635 ? 7.794    -23.626  218.391 1.00 115.34 ? 635  PHE A CE1 1 
ATOM   4867  C  CE2 . PHE A  1  635 ? 8.511    -23.917  216.131 1.00 113.16 ? 635  PHE A CE2 1 
ATOM   4868  C  CZ  . PHE A  1  635 ? 8.148    -23.085  217.171 1.00 112.73 ? 635  PHE A CZ  1 
ATOM   4869  N  N   . ALA A  1  636 ? 7.409    -28.508  215.105 1.00 117.84 ? 636  ALA A N   1 
ATOM   4870  C  CA  . ALA A  1  636 ? 7.342    -28.358  213.654 1.00 117.19 ? 636  ALA A CA  1 
ATOM   4871  C  C   . ALA A  1  636 ? 6.009    -28.804  213.053 1.00 117.25 ? 636  ALA A C   1 
ATOM   4872  O  O   . ALA A  1  636 ? 5.712    -28.481  211.902 1.00 116.57 ? 636  ALA A O   1 
ATOM   4873  C  CB  . ALA A  1  636 ? 8.480    -29.135  213.006 1.00 118.14 ? 636  ALA A CB  1 
ATOM   4874  N  N   . GLN A  1  637 ? 5.210    -29.536  213.826 1.00 116.67 ? 637  GLN A N   1 
ATOM   4875  C  CA  . GLN A  1  637 ? 3.955    -30.094  213.328 1.00 117.00 ? 637  GLN A CA  1 
ATOM   4876  C  C   . GLN A  1  637 ? 2.721    -29.523  214.030 1.00 116.45 ? 637  GLN A C   1 
ATOM   4877  O  O   . GLN A  1  637 ? 1.601    -29.687  213.545 1.00 116.42 ? 637  GLN A O   1 
ATOM   4878  C  CB  . GLN A  1  637 ? 3.979    -31.614  213.477 1.00 118.84 ? 637  GLN A CB  1 
ATOM   4879  C  CG  . GLN A  1  637 ? 3.242    -32.356  212.376 1.00 119.36 ? 637  GLN A CG  1 
ATOM   4880  C  CD  . GLN A  1  637 ? 3.463    -33.854  212.442 1.00 170.06 ? 637  GLN A CD  1 
ATOM   4881  O  OE1 . GLN A  1  637 ? 3.772    -34.401  213.500 1.00 189.50 ? 637  GLN A OE1 1 
ATOM   4882  N  NE2 . GLN A  1  637 ? 3.321    -34.523  211.303 1.00 192.27 ? 637  GLN A NE2 1 
ATOM   4883  N  N   . SER A  1  638 ? 2.927    -28.853  215.162 1.00 97.67  ? 638  SER A N   1 
ATOM   4884  C  CA  . SER A  1  638 ? 1.822    -28.297  215.945 1.00 97.30  ? 638  SER A CA  1 
ATOM   4885  C  C   . SER A  1  638 ? 1.908    -26.778  216.073 1.00 95.73  ? 638  SER A C   1 
ATOM   4886  O  O   . SER A  1  638 ? 0.905    -26.113  216.332 1.00 95.14  ? 638  SER A O   1 
ATOM   4887  C  CB  . SER A  1  638 ? 1.786    -28.927  217.336 1.00 98.60  ? 638  SER A CB  1 
ATOM   4888  O  OG  . SER A  1  638 ? 1.679    -30.337  217.253 1.00 100.18 ? 638  SER A OG  1 
ATOM   4889  N  N   . ALA A  1  639 ? 3.104    -26.229  215.890 1.00 118.02 ? 639  ALA A N   1 
ATOM   4890  C  CA  . ALA A  1  639 ? 3.303    -24.786  215.994 1.00 116.64 ? 639  ALA A CA  1 
ATOM   4891  C  C   . ALA A  1  639 ? 2.870    -24.062  214.719 1.00 115.46 ? 639  ALA A C   1 
ATOM   4892  O  O   . ALA A  1  639 ? 3.269    -22.919  214.490 1.00 131.21 ? 639  ALA A O   1 
ATOM   4893  C  CB  . ALA A  1  639 ? 4.763    -24.477  216.303 1.00 116.62 ? 639  ALA A CB  1 
ATOM   4894  N  N   . ILE A  1  640 ? 2.061    -24.726  213.896 1.00 92.93  ? 640  ILE A N   1 
ATOM   4895  C  CA  . ILE A  1  640 ? 1.573    -24.144  212.649 1.00 92.02  ? 640  ILE A CA  1 
ATOM   4896  C  C   . ILE A  1  640 ? 0.058    -23.945  212.668 1.00 91.82  ? 640  ILE A C   1 
ATOM   4897  O  O   . ILE A  1  640 ? -0.549   -23.659  211.638 1.00 91.35  ? 640  ILE A O   1 
ATOM   4898  C  CB  . ILE A  1  640 ? 1.950    -25.020  211.443 1.00 92.60  ? 640  ILE A CB  1 
ATOM   4899  C  CG1 . ILE A  1  640 ? 1.406    -26.441  211.623 1.00 94.01  ? 640  ILE A CG1 1 
ATOM   4900  C  CG2 . ILE A  1  640 ? 3.461    -25.047  211.277 1.00 92.71  ? 640  ILE A CG2 1 
ATOM   4901  C  CD1 . ILE A  1  640 ? 1.518    -27.299  210.389 1.00 94.68  ? 640  ILE A CD1 1 
ATOM   4902  N  N   . THR A  1  641 ? -0.546   -24.106  213.842 1.00 92.31  ? 641  THR A N   1 
ATOM   4903  C  CA  . THR A  1  641 ? -1.957   -23.787  214.031 1.00 92.15  ? 641  THR A CA  1 
ATOM   4904  C  C   . THR A  1  641 ? -2.142   -23.210  215.427 1.00 92.12  ? 641  THR A C   1 
ATOM   4905  O  O   . THR A  1  641 ? -1.375   -23.517  216.340 1.00 92.70  ? 641  THR A O   1 
ATOM   4906  C  CB  . THR A  1  641 ? -2.883   -25.016  213.865 1.00 93.35  ? 641  THR A CB  1 
ATOM   4907  O  OG1 . THR A  1  641 ? -3.065   -25.665  215.132 1.00 94.43  ? 641  THR A OG1 1 
ATOM   4908  C  CG2 . THR A  1  641 ? -2.329   -26.000  212.851 1.00 93.96  ? 641  THR A CG2 1 
ATOM   4909  N  N   . ILE A  1  642 ? -3.164   -22.377  215.591 1.00 91.55  ? 642  ILE A N   1 
ATOM   4910  C  CA  . ILE A  1  642 ? -3.418   -21.739  216.874 1.00 91.56  ? 642  ILE A CA  1 
ATOM   4911  C  C   . ILE A  1  642 ? -3.872   -22.762  217.902 1.00 93.00  ? 642  ILE A C   1 
ATOM   4912  O  O   . ILE A  1  642 ? -3.483   -22.696  219.068 1.00 93.49  ? 642  ILE A O   1 
ATOM   4913  C  CB  . ILE A  1  642 ? -4.495   -20.648  216.767 1.00 90.77  ? 642  ILE A CB  1 
ATOM   4914  C  CG1 . ILE A  1  642 ? -4.193   -19.693  215.607 1.00 89.49  ? 642  ILE A CG1 1 
ATOM   4915  C  CG2 . ILE A  1  642 ? -4.595   -19.896  218.085 1.00 90.79  ? 642  ILE A CG2 1 
ATOM   4916  C  CD1 . ILE A  1  642 ? -2.846   -19.006  215.694 1.00 88.82  ? 642  ILE A CD1 1 
ATOM   4917  N  N   . ASN A  1  643 ? -4.694   -23.709  217.463 1.00 93.86  ? 643  ASN A N   1 
ATOM   4918  C  CA  . ASN A  1  643 ? -5.178   -24.756  218.348 1.00 95.38  ? 643  ASN A CA  1 
ATOM   4919  C  C   . ASN A  1  643 ? -4.016   -25.595  218.855 1.00 96.27  ? 643  ASN A C   1 
ATOM   4920  O  O   . ASN A  1  643 ? -4.071   -26.153  219.949 1.00 97.47  ? 643  ASN A O   1 
ATOM   4921  C  CB  . ASN A  1  643 ? -6.201   -25.638  217.631 1.00 96.10  ? 643  ASN A CB  1 
ATOM   4922  C  CG  . ASN A  1  643 ? -7.226   -26.226  218.581 1.00 97.43  ? 643  ASN A CG  1 
ATOM   4923  O  OD1 . ASN A  1  643 ? -7.932   -25.496  219.280 1.00 97.27  ? 643  ASN A OD1 1 
ATOM   4924  N  ND2 . ASN A  1  643 ? -7.319   -27.550  218.606 1.00 98.85  ? 643  ASN A ND2 1 
ATOM   4925  N  N   . GLY A  1  644 ? -2.958   -25.670  218.054 1.00 110.69 ? 644  GLY A N   1 
ATOM   4926  C  CA  . GLY A  1  644 ? -1.762   -26.393  218.437 1.00 111.50 ? 644  GLY A CA  1 
ATOM   4927  C  C   . GLY A  1  644 ? -1.019   -25.663  219.540 1.00 111.30 ? 644  GLY A C   1 
ATOM   4928  O  O   . GLY A  1  644 ? -0.513   -26.285  220.475 1.00 112.46 ? 644  GLY A O   1 
ATOM   4929  N  N   . TRP A  1  645 ? -0.955   -24.338  219.432 1.00 94.95  ? 645  TRP A N   1 
ATOM   4930  C  CA  . TRP A  1  645 ? -0.370   -23.514  220.484 1.00 94.76  ? 645  TRP A CA  1 
ATOM   4931  C  C   . TRP A  1  645 ? -1.254   -23.564  221.731 1.00 95.65  ? 645  TRP A C   1 
ATOM   4932  O  O   . TRP A  1  645 ? -0.757   -23.643  222.854 1.00 96.46  ? 645  TRP A O   1 
ATOM   4933  C  CB  . TRP A  1  645 ? -0.199   -22.064  220.015 1.00 93.16  ? 645  TRP A CB  1 
ATOM   4934  C  CG  . TRP A  1  645 ? 1.015    -21.813  219.154 1.00 92.44  ? 645  TRP A CG  1 
ATOM   4935  C  CD1 . TRP A  1  645 ? 1.103    -21.958  217.799 1.00 91.89  ? 645  TRP A CD1 1 
ATOM   4936  C  CD2 . TRP A  1  645 ? 2.305    -21.359  219.591 1.00 92.32  ? 645  TRP A CD2 1 
ATOM   4937  N  NE1 . TRP A  1  645 ? 2.365    -21.627  217.366 1.00 91.44  ? 645  TRP A NE1 1 
ATOM   4938  C  CE2 . TRP A  1  645 ? 3.122    -21.257  218.446 1.00 91.68  ? 645  TRP A CE2 1 
ATOM   4939  C  CE3 . TRP A  1  645 ? 2.848    -21.032  220.838 1.00 92.79  ? 645  TRP A CE3 1 
ATOM   4940  C  CZ2 . TRP A  1  645 ? 4.451    -20.843  218.511 1.00 91.49  ? 645  TRP A CZ2 1 
ATOM   4941  C  CZ3 . TRP A  1  645 ? 4.170    -20.621  220.900 1.00 92.59  ? 645  TRP A CZ3 1 
ATOM   4942  C  CH2 . TRP A  1  645 ? 4.955    -20.530  219.744 1.00 91.93  ? 645  TRP A CH2 1 
ATOM   4943  N  N   . LEU A  1  646 ? -2.567   -23.520  221.521 1.00 95.59  ? 646  LEU A N   1 
ATOM   4944  C  CA  . LEU A  1  646 ? -3.528   -23.555  222.620 1.00 96.51  ? 646  LEU A CA  1 
ATOM   4945  C  C   . LEU A  1  646 ? -3.427   -24.868  223.383 1.00 98.31  ? 646  LEU A C   1 
ATOM   4946  O  O   . LEU A  1  646 ? -3.565   -24.899  224.606 1.00 99.32  ? 646  LEU A O   1 
ATOM   4947  C  CB  . LEU A  1  646 ? -4.957   -23.365  222.093 1.00 96.21  ? 646  LEU A CB  1 
ATOM   4948  C  CG  . LEU A  1  646 ? -6.109   -23.493  223.099 1.00 97.29  ? 646  LEU A CG  1 
ATOM   4949  C  CD1 . LEU A  1  646 ? -6.285   -22.210  223.896 1.00 96.76  ? 646  LEU A CD1 1 
ATOM   4950  C  CD2 . LEU A  1  646 ? -7.406   -23.866  222.394 1.00 97.46  ? 646  LEU A CD2 1 
ATOM   4951  N  N   . ARG A  1  647 ? -3.177   -25.948  222.651 1.00 98.83  ? 647  ARG A N   1 
ATOM   4952  C  CA  . ARG A  1  647 ? -3.202   -27.292  223.216 1.00 100.66 ? 647  ARG A CA  1 
ATOM   4953  C  C   . ARG A  1  647 ? -1.824   -27.776  223.645 1.00 101.35 ? 647  ARG A C   1 
ATOM   4954  O  O   . ARG A  1  647 ? -1.597   -28.087  224.815 1.00 102.60 ? 647  ARG A O   1 
ATOM   4955  C  CB  . ARG A  1  647 ? -3.791   -28.266  222.190 1.00 101.07 ? 647  ARG A CB  1 
ATOM   4956  C  CG  . ARG A  1  647 ? -3.645   -29.738  222.555 1.00 102.98 ? 647  ARG A CG  1 
ATOM   4957  C  CD  . ARG A  1  647 ? -4.145   -30.649  221.448 1.00 103.36 ? 647  ARG A CD  1 
ATOM   4958  N  NE  . ARG A  1  647 ? -3.355   -30.515  220.221 1.00 102.28 ? 647  ARG A NE  1 
ATOM   4959  C  CZ  . ARG A  1  647 ? -3.752   -29.886  219.117 1.00 100.94 ? 647  ARG A CZ  1 
ATOM   4960  N  NH1 . ARG A  1  647 ? -4.948   -29.319  219.044 1.00 100.45 ? 647  ARG A NH1 1 
ATOM   4961  N  NH2 . ARG A  1  647 ? -2.945   -29.828  218.065 1.00 100.19 ? 647  ARG A NH2 1 
ATOM   4962  N  N   . ASP A  1  648 ? -0.903   -27.829  222.690 1.00 133.09 ? 648  ASP A N   1 
ATOM   4963  C  CA  . ASP A  1  648 ? 0.373    -28.498  222.897 1.00 133.92 ? 648  ASP A CA  1 
ATOM   4964  C  C   . ASP A  1  648 ? 1.422    -27.611  223.563 1.00 133.42 ? 648  ASP A C   1 
ATOM   4965  O  O   . ASP A  1  648 ? 2.513    -28.083  223.883 1.00 134.21 ? 648  ASP A O   1 
ATOM   4966  C  CB  . ASP A  1  648 ? 0.904    -29.018  221.561 1.00 137.25 ? 648  ASP A CB  1 
ATOM   4967  C  CG  . ASP A  1  648 ? -0.081   -29.937  220.864 1.00 136.90 ? 648  ASP A CG  1 
ATOM   4968  O  OD1 . ASP A  1  648 ? -0.649   -30.821  221.539 1.00 135.71 ? 648  ASP A OD1 1 
ATOM   4969  O  OD2 . ASP A  1  648 ? -0.292   -29.773  219.644 1.00 141.31 ? 648  ASP A OD2 1 
ATOM   4970  N  N   . PHE A  1  649 ? 1.096    -26.337  223.773 1.00 121.98 ? 649  PHE A N   1 
ATOM   4971  C  CA  . PHE A  1  649 ? 1.989    -25.437  224.500 1.00 121.63 ? 649  PHE A CA  1 
ATOM   4972  C  C   . PHE A  1  649 ? 1.334    -24.908  225.770 1.00 122.13 ? 649  PHE A C   1 
ATOM   4973  O  O   . PHE A  1  649 ? 1.849    -25.116  226.866 1.00 123.30 ? 649  PHE A O   1 
ATOM   4974  C  CB  . PHE A  1  649 ? 2.433    -24.269  223.621 1.00 119.81 ? 649  PHE A CB  1 
ATOM   4975  C  CG  . PHE A  1  649 ? 3.362    -23.320  224.320 1.00 119.48 ? 649  PHE A CG  1 
ATOM   4976  C  CD1 . PHE A  1  649 ? 4.629    -23.732  224.701 1.00 120.27 ? 649  PHE A CD1 1 
ATOM   4977  C  CD2 . PHE A  1  649 ? 2.972    -22.023  224.603 1.00 118.49 ? 649  PHE A CD2 1 
ATOM   4978  C  CE1 . PHE A  1  649 ? 5.489    -22.871  225.350 1.00 120.08 ? 649  PHE A CE1 1 
ATOM   4979  C  CE2 . PHE A  1  649 ? 3.829    -21.154  225.252 1.00 118.30 ? 649  PHE A CE2 1 
ATOM   4980  C  CZ  . PHE A  1  649 ? 5.090    -21.579  225.625 1.00 119.09 ? 649  PHE A CZ  1 
ATOM   4981  N  N   . LEU A  1  650 ? 0.201    -24.227  225.634 1.00 99.14  ? 650  LEU A N   1 
ATOM   4982  C  CA  . LEU A  1  650 ? -0.454   -23.645  226.800 1.00 99.62  ? 650  LEU A CA  1 
ATOM   4983  C  C   . LEU A  1  650 ? -1.097   -24.712  227.676 1.00 101.51 ? 650  LEU A C   1 
ATOM   4984  O  O   . LEU A  1  650 ? -0.680   -24.910  228.816 1.00 102.78 ? 650  LEU A O   1 
ATOM   4985  C  CB  . LEU A  1  650 ? -1.511   -22.620  226.379 1.00 98.37  ? 650  LEU A CB  1 
ATOM   4986  C  CG  . LEU A  1  650 ? -1.031   -21.271  225.834 1.00 96.66  ? 650  LEU A CG  1 
ATOM   4987  C  CD1 . LEU A  1  650 ? -2.214   -20.325  225.690 1.00 95.85  ? 650  LEU A CD1 1 
ATOM   4988  C  CD2 . LEU A  1  650 ? 0.045    -20.646  226.717 1.00 96.82  ? 650  LEU A CD2 1 
ATOM   4989  N  N   . TRP A  1  651 ? -2.105   -25.397  227.145 1.00 106.90 ? 651  TRP A N   1 
ATOM   4990  C  CA  . TRP A  1  651 ? -2.847   -26.381  227.924 1.00 108.75 ? 651  TRP A CA  1 
ATOM   4991  C  C   . TRP A  1  651 ? -1.930   -27.448  228.512 1.00 110.36 ? 651  TRP A C   1 
ATOM   4992  O  O   . TRP A  1  651 ? -2.133   -27.900  229.638 1.00 116.70 ? 651  TRP A O   1 
ATOM   4993  C  CB  . TRP A  1  651 ? -3.925   -27.047  227.068 1.00 108.82 ? 651  TRP A CB  1 
ATOM   4994  C  CG  . TRP A  1  651 ? -4.720   -28.054  227.833 1.00 110.80 ? 651  TRP A CG  1 
ATOM   4995  C  CD1 . TRP A  1  651 ? -5.774   -27.805  228.656 1.00 111.56 ? 651  TRP A CD1 1 
ATOM   4996  C  CD2 . TRP A  1  651 ? -4.521   -29.474  227.855 1.00 112.42 ? 651  TRP A CD2 1 
ATOM   4997  N  NE1 . TRP A  1  651 ? -6.245   -28.975  229.194 1.00 113.56 ? 651  TRP A NE1 1 
ATOM   4998  C  CE2 . TRP A  1  651 ? -5.495   -30.017  228.716 1.00 114.12 ? 651  TRP A CE2 1 
ATOM   4999  C  CE3 . TRP A  1  651 ? -3.617   -30.339  227.230 1.00 112.69 ? 651  TRP A CE3 1 
ATOM   5000  C  CZ2 . TRP A  1  651 ? -5.592   -31.382  228.968 1.00 116.06 ? 651  TRP A CZ2 1 
ATOM   5001  C  CZ3 . TRP A  1  651 ? -3.715   -31.696  227.481 1.00 114.61 ? 651  TRP A CZ3 1 
ATOM   5002  C  CH2 . TRP A  1  651 ? -4.696   -32.203  228.343 1.00 116.27 ? 651  TRP A CH2 1 
ATOM   5003  N  N   . ALA A  1  652 ? -0.920   -27.843  227.745 1.00 104.87 ? 652  ALA A N   1 
ATOM   5004  C  CA  . ALA A  1  652 ? -0.009   -28.902  228.164 1.00 106.42 ? 652  ALA A CA  1 
ATOM   5005  C  C   . ALA A  1  652 ? 0.955    -28.437  229.253 1.00 106.94 ? 652  ALA A C   1 
ATOM   5006  O  O   . ALA A  1  652 ? 1.037    -29.044  230.322 1.00 108.76 ? 652  ALA A O   1 
ATOM   5007  C  CB  . ALA A  1  652 ? 0.771    -29.421  226.966 1.00 105.86 ? 652  ALA A CB  1 
ATOM   5008  N  N   . GLN A  1  653 ? 1.679    -27.357  228.978 1.00 117.16 ? 653  GLN A N   1 
ATOM   5009  C  CA  . GLN A  1  653 ? 2.742    -26.899  229.868 1.00 117.58 ? 653  GLN A CA  1 
ATOM   5010  C  C   . GLN A  1  653 ? 2.207    -26.111  231.062 1.00 118.00 ? 653  GLN A C   1 
ATOM   5011  O  O   . GLN A  1  653 ? 2.951    -25.816  231.998 1.00 118.74 ? 653  GLN A O   1 
ATOM   5012  C  CB  . GLN A  1  653 ? 3.745    -26.054  229.083 1.00 115.93 ? 653  GLN A CB  1 
ATOM   5013  C  CG  . GLN A  1  653 ? 4.297    -26.777  227.862 1.00 115.56 ? 653  GLN A CG  1 
ATOM   5014  C  CD  . GLN A  1  653 ? 5.415    -26.021  227.177 1.00 114.24 ? 653  GLN A CD  1 
ATOM   5015  O  OE1 . GLN A  1  653 ? 5.824    -24.949  227.624 1.00 113.60 ? 653  GLN A OE1 1 
ATOM   5016  N  NE2 . GLN A  1  653 ? 5.916    -26.576  226.079 1.00 113.92 ? 653  GLN A NE2 1 
ATOM   5017  N  N   . ALA A  1  654 ? 0.922    -25.774  231.031 1.00 110.04 ? 654  ALA A N   1 
ATOM   5018  C  CA  . ALA A  1  654 ? 0.287    -25.093  232.155 1.00 110.62 ? 654  ALA A CA  1 
ATOM   5019  C  C   . ALA A  1  654 ? -0.116   -26.093  233.235 1.00 112.95 ? 654  ALA A C   1 
ATOM   5020  O  O   . ALA A  1  654 ? -0.541   -25.704  234.321 1.00 113.90 ? 654  ALA A O   1 
ATOM   5021  C  CB  . ALA A  1  654 ? -0.924   -24.310  231.687 1.00 109.38 ? 654  ALA A CB  1 
ATOM   5022  N  N   . ALA A  1  655 ? 0.014    -27.380  232.927 1.00 163.67 ? 655  ALA A N   1 
ATOM   5023  C  CA  . ALA A  1  655 ? -0.332   -28.435  233.871 1.00 172.64 ? 655  ALA A CA  1 
ATOM   5024  C  C   . ALA A  1  655 ? 0.580    -28.414  235.093 1.00 174.22 ? 655  ALA A C   1 
ATOM   5025  O  O   . ALA A  1  655 ? 0.201    -28.876  236.169 1.00 182.48 ? 655  ALA A O   1 
ATOM   5026  C  CB  . ALA A  1  655 ? -0.264   -29.792  233.188 1.00 175.29 ? 655  ALA A CB  1 
ATOM   5027  N  N   . ASN A  1  656 ? 1.781    -27.873  234.923 1.00 114.82 ? 656  ASN A N   1 
ATOM   5028  C  CA  . ASN A  1  656 ? 2.760    -27.831  236.001 1.00 116.18 ? 656  ASN A CA  1 
ATOM   5029  C  C   . ASN A  1  656 ? 2.365    -26.858  237.105 1.00 116.57 ? 656  ASN A C   1 
ATOM   5030  O  O   . ASN A  1  656 ? 2.460    -27.175  238.293 1.00 118.59 ? 656  ASN A O   1 
ATOM   5031  C  CB  . ASN A  1  656 ? 4.129    -27.444  235.444 1.00 115.08 ? 656  ASN A CB  1 
ATOM   5032  C  CG  . ASN A  1  656 ? 4.582    -28.361  234.328 1.00 114.74 ? 656  ASN A CG  1 
ATOM   5033  O  OD1 . ASN A  1  656 ? 4.334    -28.094  233.152 1.00 112.98 ? 656  ASN A OD1 1 
ATOM   5034  N  ND2 . ASN A  1  656 ? 5.241    -29.454  234.690 1.00 116.54 ? 656  ASN A ND2 1 
ATOM   5035  N  N   . VAL A  1  657 ? 1.924    -25.671  236.700 1.00 126.59 ? 657  VAL A N   1 
ATOM   5036  C  CA  . VAL A  1  657 ? 1.623    -24.597  237.640 1.00 126.76 ? 657  VAL A CA  1 
ATOM   5037  C  C   . VAL A  1  657 ? 0.283    -24.782  238.351 1.00 128.01 ? 657  VAL A C   1 
ATOM   5038  O  O   . VAL A  1  657 ? 0.157    -24.454  239.531 1.00 129.39 ? 657  VAL A O   1 
ATOM   5039  C  CB  . VAL A  1  657 ? 1.634    -23.221  236.929 1.00 124.40 ? 657  VAL A CB  1 
ATOM   5040  C  CG1 . VAL A  1  657 ? 0.619    -23.178  235.790 1.00 122.88 ? 657  VAL A CG1 1 
ATOM   5041  C  CG2 . VAL A  1  657 ? 1.381    -22.096  237.918 1.00 124.69 ? 657  VAL A CG2 1 
ATOM   5042  N  N   . ILE A  1  658 ? -0.711   -25.309  237.643 1.00 113.75 ? 658  ILE A N   1 
ATOM   5043  C  CA  . ILE A  1  658 ? -2.043   -25.465  238.220 1.00 114.89 ? 658  ILE A CA  1 
ATOM   5044  C  C   . ILE A  1  658 ? -2.086   -26.618  239.221 1.00 117.60 ? 658  ILE A C   1 
ATOM   5045  O  O   . ILE A  1  658 ? -2.958   -26.662  240.090 1.00 119.08 ? 658  ILE A O   1 
ATOM   5046  C  CB  . ILE A  1  658 ? -3.114   -25.699  237.128 1.00 113.76 ? 658  ILE A CB  1 
ATOM   5047  C  CG1 . ILE A  1  658 ? -2.824   -26.990  236.351 1.00 114.06 ? 658  ILE A CG1 1 
ATOM   5048  C  CG2 . ILE A  1  658 ? -3.179   -24.493  236.194 1.00 111.25 ? 658  ILE A CG2 1 
ATOM   5049  C  CD1 . ILE A  1  658 ? -3.840   -27.312  235.267 1.00 113.15 ? 658  ILE A CD1 1 
ATOM   5050  N  N   . ASN A  1  659 ? -1.138   -27.542  239.097 1.00 133.78 ? 659  ASN A N   1 
ATOM   5051  C  CA  . ASN A  1  659 ? -1.032   -28.672  240.016 1.00 136.46 ? 659  ASN A CA  1 
ATOM   5052  C  C   . ASN A  1  659 ? 0.079    -28.459  241.039 1.00 137.69 ? 659  ASN A C   1 
ATOM   5053  O  O   . ASN A  1  659 ? 0.514    -29.401  241.701 1.00 141.43 ? 659  ASN A O   1 
ATOM   5054  C  CB  . ASN A  1  659 ? -0.784   -29.965  239.238 1.00 136.83 ? 659  ASN A CB  1 
ATOM   5055  C  CG  . ASN A  1  659 ? -2.017   -30.447  238.504 1.00 136.49 ? 659  ASN A CG  1 
ATOM   5056  O  OD1 . ASN A  1  659 ? -2.983   -30.895  239.120 1.00 138.10 ? 659  ASN A OD1 1 
ATOM   5057  N  ND2 . ASN A  1  659 ? -1.991   -30.358  237.180 1.00 134.48 ? 659  ASN A ND2 1 
ATOM   5058  N  N   . SER A  1  660 ? 0.526    -27.215  241.175 1.00 128.90 ? 660  SER A N   1 
ATOM   5059  C  CA  . SER A  1  660 ? 1.633    -26.898  242.067 1.00 129.90 ? 660  SER A CA  1 
ATOM   5060  C  C   . SER A  1  660 ? 1.164    -26.791  243.516 1.00 132.17 ? 660  SER A C   1 
ATOM   5061  O  O   . SER A  1  660 ? 1.979    -26.708  244.434 1.00 133.60 ? 660  SER A O   1 
ATOM   5062  C  CB  . SER A  1  660 ? 2.309    -25.598  241.636 1.00 127.77 ? 660  SER A CB  1 
ATOM   5063  O  OG  . SER A  1  660 ? 1.415    -24.505  241.729 1.00 126.78 ? 660  SER A OG  1 
ATOM   5064  N  N   . TYR A  1  661 ? -0.152   -26.793  243.714 1.00 144.55 ? 661  TYR A N   1 
ATOM   5065  C  CA  . TYR A  1  661 ? -0.727   -26.775  245.053 1.00 146.88 ? 661  TYR A CA  1 
ATOM   5066  C  C   . TYR A  1  661 ? -0.231   -27.947  245.893 1.00 149.66 ? 661  TYR A C   1 
ATOM   5067  O  O   . TYR A  1  661 ? -0.392   -29.106  245.511 1.00 150.39 ? 661  TYR A O   1 
ATOM   5068  C  CB  . TYR A  1  661 ? -2.256   -26.802  244.979 1.00 146.98 ? 661  TYR A CB  1 
ATOM   5069  C  CG  . TYR A  1  661 ? -2.896   -25.442  244.810 1.00 145.29 ? 661  TYR A CG  1 
ATOM   5070  C  CD1 . TYR A  1  661 ? -2.333   -24.479  243.982 1.00 142.75 ? 661  TYR A CD1 1 
ATOM   5071  C  CD2 . TYR A  1  661 ? -4.069   -25.124  245.482 1.00 146.36 ? 661  TYR A CD2 1 
ATOM   5072  C  CE1 . TYR A  1  661 ? -2.922   -23.235  243.833 1.00 141.33 ? 661  TYR A CE1 1 
ATOM   5073  C  CE2 . TYR A  1  661 ? -4.663   -23.887  245.339 1.00 144.94 ? 661  TYR A CE2 1 
ATOM   5074  C  CZ  . TYR A  1  661 ? -4.086   -22.946  244.515 1.00 142.43 ? 661  TYR A CZ  1 
ATOM   5075  O  OH  . TYR A  1  661 ? -4.685   -21.716  244.375 1.00 141.14 ? 661  TYR A OH  1 
ATOM   5076  N  N   . GLY A  1  662 ? 0.377    -27.633  247.033 1.00 131.43 ? 662  GLY A N   1 
ATOM   5077  C  CA  . GLY A  1  662 ? 0.865    -28.647  247.950 1.00 134.31 ? 662  GLY A CA  1 
ATOM   5078  C  C   . GLY A  1  662 ? 2.344    -28.958  247.803 1.00 134.35 ? 662  GLY A C   1 
ATOM   5079  O  O   . GLY A  1  662 ? 2.874    -29.799  248.529 1.00 136.75 ? 662  GLY A O   1 
ATOM   5080  N  N   . SER A  1  663 ? 3.009    -28.284  246.868 1.00 171.26 ? 663  SER A N   1 
ATOM   5081  C  CA  . SER A  1  663 ? 4.438    -28.480  246.638 1.00 171.11 ? 663  SER A CA  1 
ATOM   5082  C  C   . SER A  1  663 ? 5.192    -27.181  246.898 1.00 183.31 ? 663  SER A C   1 
ATOM   5083  O  O   . SER A  1  663 ? 4.591    -26.173  247.269 1.00 201.17 ? 663  SER A O   1 
ATOM   5084  C  CB  . SER A  1  663 ? 4.692    -28.968  245.210 1.00 169.18 ? 663  SER A CB  1 
ATOM   5085  O  OG  . SER A  1  663 ? 4.395    -27.956  244.263 1.00 166.32 ? 663  SER A OG  1 
ATOM   5086  N  N   . ALA A  1  664 ? 6.508    -27.207  246.712 1.00 130.46 ? 664  ALA A N   1 
ATOM   5087  C  CA  . ALA A  1  664 ? 7.321    -26.012  246.907 1.00 129.56 ? 664  ALA A CA  1 
ATOM   5088  C  C   . ALA A  1  664 ? 6.967    -24.955  245.868 1.00 126.51 ? 664  ALA A C   1 
ATOM   5089  O  O   . ALA A  1  664 ? 7.191    -23.764  246.082 1.00 125.67 ? 664  ALA A O   1 
ATOM   5090  C  CB  . ALA A  1  664 ? 8.800    -26.354  246.835 1.00 130.06 ? 664  ALA A CB  1 
ATOM   5091  N  N   . LEU A  1  665 ? 6.407    -25.400  244.746 1.00 150.11 ? 665  LEU A N   1 
ATOM   5092  C  CA  . LEU A  1  665 ? 6.043    -24.505  243.653 1.00 147.28 ? 665  LEU A CA  1 
ATOM   5093  C  C   . LEU A  1  665 ? 4.636    -23.937  243.820 1.00 153.48 ? 665  LEU A C   1 
ATOM   5094  O  O   . LEU A  1  665 ? 4.116    -23.289  242.910 1.00 167.12 ? 665  LEU A O   1 
ATOM   5095  C  CB  . LEU A  1  665 ? 6.140    -25.235  242.311 1.00 145.87 ? 665  LEU A CB  1 
ATOM   5096  C  CG  . LEU A  1  665 ? 7.434    -25.997  242.020 1.00 146.41 ? 665  LEU A CG  1 
ATOM   5097  C  CD1 . LEU A  1  665 ? 7.272    -26.848  240.770 1.00 145.38 ? 665  LEU A CD1 1 
ATOM   5098  C  CD2 . LEU A  1  665 ? 8.602    -25.037  241.866 1.00 145.34 ? 665  LEU A CD2 1 
ATOM   5099  N  N   . SER A  1  666 ? 4.022    -24.182  244.975 1.00 123.89 ? 666  SER A N   1 
ATOM   5100  C  CA  . SER A  1  666 ? 2.649    -23.746  245.222 1.00 123.84 ? 666  SER A CA  1 
ATOM   5101  C  C   . SER A  1  666 ? 2.507    -22.238  245.089 1.00 122.11 ? 666  SER A C   1 
ATOM   5102  O  O   . SER A  1  666 ? 1.424    -21.732  244.795 1.00 121.15 ? 666  SER A O   1 
ATOM   5103  C  CB  . SER A  1  666 ? 2.189    -24.175  246.615 1.00 126.75 ? 666  SER A CB  1 
ATOM   5104  O  OG  . SER A  1  666 ? 2.893    -23.469  247.622 1.00 127.85 ? 666  SER A OG  1 
ATOM   5105  N  N   . ALA A  1  667 ? 3.605    -21.525  245.313 1.00 121.83 ? 667  ALA A N   1 
ATOM   5106  C  CA  . ALA A  1  667 ? 3.618    -20.081  245.151 1.00 120.23 ? 667  ALA A CA  1 
ATOM   5107  C  C   . ALA A  1  667 ? 3.231    -19.710  243.727 1.00 117.49 ? 667  ALA A C   1 
ATOM   5108  O  O   . ALA A  1  667 ? 2.313    -18.923  243.514 1.00 116.47 ? 667  ALA A O   1 
ATOM   5109  C  CB  . ALA A  1  667 ? 4.981    -19.523  245.487 1.00 120.38 ? 667  ALA A CB  1 
ATOM   5110  N  N   . TYR A  1  668 ? 3.922    -20.303  242.759 1.00 117.32 ? 668  TYR A N   1 
ATOM   5111  C  CA  . TYR A  1  668 ? 3.653    -20.044  241.348 1.00 114.86 ? 668  TYR A CA  1 
ATOM   5112  C  C   . TYR A  1  668 ? 2.214    -20.397  240.973 1.00 114.57 ? 668  TYR A C   1 
ATOM   5113  O  O   . TYR A  1  668 ? 1.647    -19.818  240.046 1.00 112.68 ? 668  TYR A O   1 
ATOM   5114  C  CB  . TYR A  1  668 ? 4.634    -20.829  240.471 1.00 114.27 ? 668  TYR A CB  1 
ATOM   5115  C  CG  . TYR A  1  668 ? 6.088    -20.479  240.708 1.00 114.45 ? 668  TYR A CG  1 
ATOM   5116  C  CD1 . TYR A  1  668 ? 6.608    -19.266  240.278 1.00 112.82 ? 668  TYR A CD1 1 
ATOM   5117  C  CD2 . TYR A  1  668 ? 6.939    -21.360  241.364 1.00 116.35 ? 668  TYR A CD2 1 
ATOM   5118  C  CE1 . TYR A  1  668 ? 7.934    -18.939  240.489 1.00 113.06 ? 668  TYR A CE1 1 
ATOM   5119  C  CE2 . TYR A  1  668 ? 8.268    -21.041  241.582 1.00 116.61 ? 668  TYR A CE2 1 
ATOM   5120  C  CZ  . TYR A  1  668 ? 8.760    -19.830  241.142 1.00 114.95 ? 668  TYR A CZ  1 
ATOM   5121  O  OH  . TYR A  1  668 ? 10.080   -19.505  241.357 1.00 115.29 ? 668  TYR A OH  1 
ATOM   5122  N  N   . GLY A  1  669 ? 1.628    -21.345  241.697 1.00 131.40 ? 669  GLY A N   1 
ATOM   5123  C  CA  . GLY A  1  669 ? 0.254    -21.751  241.457 1.00 131.48 ? 669  GLY A CA  1 
ATOM   5124  C  C   . GLY A  1  669 ? -0.744   -20.644  241.730 1.00 130.98 ? 669  GLY A C   1 
ATOM   5125  O  O   . GLY A  1  669 ? -1.613   -20.358  240.906 1.00 129.55 ? 669  GLY A O   1 
ATOM   5126  N  N   . ILE A  1  670 ? -0.614   -20.021  242.897 1.00 116.57 ? 670  ILE A N   1 
ATOM   5127  C  CA  . ILE A  1  670 ? -1.516   -18.949  243.299 1.00 116.42 ? 670  ILE A CA  1 
ATOM   5128  C  C   . ILE A  1  670 ? -1.096   -17.627  242.672 1.00 114.27 ? 670  ILE A C   1 
ATOM   5129  O  O   . ILE A  1  670 ? -1.905   -16.709  242.539 1.00 113.46 ? 670  ILE A O   1 
ATOM   5130  C  CB  . ILE A  1  670 ? -1.568   -18.790  244.837 1.00 118.87 ? 670  ILE A CB  1 
ATOM   5131  C  CG1 . ILE A  1  670 ? -0.166   -18.633  245.420 1.00 119.58 ? 670  ILE A CG1 1 
ATOM   5132  C  CG2 . ILE A  1  670 ? -2.281   -19.977  245.464 1.00 121.08 ? 670  ILE A CG2 1 
ATOM   5133  C  CD1 . ILE A  1  670 ? -0.167   -18.272  246.878 1.00 121.85 ? 670  ILE A CD1 1 
ATOM   5134  N  N   . MET A  1  671 ? 0.171    -17.536  242.282 1.00 113.45 ? 671  MET A N   1 
ATOM   5135  C  CA  . MET A  1  671 ? 0.672    -16.358  241.588 1.00 111.43 ? 671  MET A CA  1 
ATOM   5136  C  C   . MET A  1  671 ? 0.181    -16.360  240.144 1.00 109.28 ? 671  MET A C   1 
ATOM   5137  O  O   . MET A  1  671 ? -0.020   -15.306  239.542 1.00 107.66 ? 671  MET A O   1 
ATOM   5138  C  CB  . MET A  1  671 ? 2.199    -16.313  241.636 1.00 111.42 ? 671  MET A CB  1 
ATOM   5139  C  CG  . MET A  1  671 ? 2.778    -14.918  241.768 1.00 110.63 ? 671  MET A CG  1 
ATOM   5140  S  SD  . MET A  1  671 ? 2.839    -14.363  243.483 1.00 112.97 ? 671  MET A SD  1 
ATOM   5141  C  CE  . MET A  1  671 ? 1.323    -13.418  243.603 1.00 112.58 ? 671  MET A CE  1 
ATOM   5142  N  N   . PHE A  1  672 ? 0.002    -17.557  239.593 1.00 110.63 ? 672  PHE A N   1 
ATOM   5143  C  CA  . PHE A  1  672 ? -0.561   -17.718  238.257 1.00 108.89 ? 672  PHE A CA  1 
ATOM   5144  C  C   . PHE A  1  672 ? -1.976   -17.150  238.224 1.00 108.57 ? 672  PHE A C   1 
ATOM   5145  O  O   . PHE A  1  672 ? -2.399   -16.565  237.226 1.00 106.82 ? 672  PHE A O   1 
ATOM   5146  C  CB  . PHE A  1  672 ? -0.543   -19.197  237.856 1.00 109.52 ? 672  PHE A CB  1 
ATOM   5147  C  CG  . PHE A  1  672 ? -1.166   -19.489  236.514 1.00 108.00 ? 672  PHE A CG  1 
ATOM   5148  C  CD1 . PHE A  1  672 ? -0.522   -19.128  235.341 1.00 106.11 ? 672  PHE A CD1 1 
ATOM   5149  C  CD2 . PHE A  1  672 ? -2.371   -20.168  236.425 1.00 108.61 ? 672  PHE A CD2 1 
ATOM   5150  C  CE1 . PHE A  1  672 ? -1.084   -19.410  234.106 1.00 104.86 ? 672  PHE A CE1 1 
ATOM   5151  C  CE2 . PHE A  1  672 ? -2.935   -20.454  235.194 1.00 107.34 ? 672  PHE A CE2 1 
ATOM   5152  C  CZ  . PHE A  1  672 ? -2.290   -20.076  234.034 1.00 105.47 ? 672  PHE A CZ  1 
ATOM   5153  N  N   . LEU A  1  673 ? -2.702   -17.330  239.324 1.00 113.84 ? 673  LEU A N   1 
ATOM   5154  C  CA  . LEU A  1  673 ? -4.046   -16.777  239.462 1.00 113.88 ? 673  LEU A CA  1 
ATOM   5155  C  C   . LEU A  1  673 ? -4.031   -15.278  239.760 1.00 113.23 ? 673  LEU A C   1 
ATOM   5156  O  O   . LEU A  1  673 ? -4.869   -14.534  239.253 1.00 112.17 ? 673  LEU A O   1 
ATOM   5157  C  CB  . LEU A  1  673 ? -4.812   -17.508  240.568 1.00 116.25 ? 673  LEU A CB  1 
ATOM   5158  C  CG  . LEU A  1  673 ? -5.257   -18.946  240.286 1.00 117.08 ? 673  LEU A CG  1 
ATOM   5159  C  CD1 . LEU A  1  673 ? -5.938   -19.533  241.514 1.00 119.64 ? 673  LEU A CD1 1 
ATOM   5160  C  CD2 . LEU A  1  673 ? -6.182   -19.025  239.078 1.00 115.59 ? 673  LEU A CD2 1 
ATOM   5161  N  N   . ALA A  1  674 ? -3.096   -14.843  240.601 1.00 109.31 ? 674  ALA A N   1 
ATOM   5162  C  CA  . ALA A  1  674 ? -2.981   -13.430  240.957 1.00 108.90 ? 674  ALA A CA  1 
ATOM   5163  C  C   . ALA A  1  674 ? -2.840   -12.570  239.707 1.00 106.49 ? 674  ALA A C   1 
ATOM   5164  O  O   . ALA A  1  674 ? -3.462   -11.514  239.593 1.00 105.83 ? 674  ALA A O   1 
ATOM   5165  C  CB  . ALA A  1  674 ? -1.803   -13.208  241.888 1.00 110.00 ? 674  ALA A CB  1 
ATOM   5166  N  N   . GLY A  1  675 ? -2.012   -13.031  238.775 1.00 105.30 ? 675  GLY A N   1 
ATOM   5167  C  CA  . GLY A  1  675 ? -1.838   -12.356  237.503 1.00 103.12 ? 675  GLY A CA  1 
ATOM   5168  C  C   . GLY A  1  675 ? -3.160   -12.249  236.772 1.00 102.28 ? 675  GLY A C   1 
ATOM   5169  O  O   . GLY A  1  675 ? -3.501   -11.194  236.240 1.00 101.07 ? 675  GLY A O   1 
ATOM   5170  N  N   . HIS A  1  676 ? -3.902   -13.351  236.743 1.00 107.59 ? 676  HIS A N   1 
ATOM   5171  C  CA  . HIS A  1  676 ? -5.206   -13.387  236.091 1.00 107.04 ? 676  HIS A CA  1 
ATOM   5172  C  C   . HIS A  1  676 ? -6.156   -12.350  236.678 1.00 107.43 ? 676  HIS A C   1 
ATOM   5173  O  O   . HIS A  1  676 ? -6.951   -11.750  235.957 1.00 106.38 ? 676  HIS A O   1 
ATOM   5174  C  CB  . HIS A  1  676 ? -5.830   -14.779  236.210 1.00 108.23 ? 676  HIS A CB  1 
ATOM   5175  C  CG  . HIS A  1  676 ? -5.446   -15.711  235.106 1.00 107.35 ? 676  HIS A CG  1 
ATOM   5176  N  ND1 . HIS A  1  676 ? -4.193   -16.279  235.010 1.00 107.35 ? 676  HIS A ND1 1 
ATOM   5177  C  CD2 . HIS A  1  676 ? -6.150   -16.167  234.045 1.00 106.53 ? 676  HIS A CD2 1 
ATOM   5178  C  CE1 . HIS A  1  676 ? -4.146   -17.051  233.939 1.00 106.58 ? 676  HIS A CE1 1 
ATOM   5179  N  NE2 . HIS A  1  676 ? -5.320   -17.000  233.337 1.00 106.07 ? 676  HIS A NE2 1 
ATOM   5180  N  N   . PHE A  1  677 ? -6.075   -12.149  237.989 1.00 111.64 ? 677  PHE A N   1 
ATOM   5181  C  CA  . PHE A  1  677 ? -6.989   -11.244  238.678 1.00 112.36 ? 677  PHE A CA  1 
ATOM   5182  C  C   . PHE A  1  677 ? -6.788   -9.796   238.247 1.00 110.96 ? 677  PHE A C   1 
ATOM   5183  O  O   . PHE A  1  677 ? -7.727   -9.137   237.799 1.00 110.32 ? 677  PHE A O   1 
ATOM   5184  C  CB  . PHE A  1  677 ? -6.807   -11.350  240.192 1.00 114.56 ? 677  PHE A CB  1 
ATOM   5185  C  CG  . PHE A  1  677 ? -7.822   -10.570  240.980 1.00 115.64 ? 677  PHE A CG  1 
ATOM   5186  C  CD1 . PHE A  1  677 ? -7.600   -9.242   241.305 1.00 115.40 ? 677  PHE A CD1 1 
ATOM   5187  C  CD2 . PHE A  1  677 ? -8.993   -11.170  241.407 1.00 117.03 ? 677  PHE A CD2 1 
ATOM   5188  C  CE1 . PHE A  1  677 ? -8.533   -8.527   242.032 1.00 116.52 ? 677  PHE A CE1 1 
ATOM   5189  C  CE2 . PHE A  1  677 ? -9.928   -10.463  242.135 1.00 118.15 ? 677  PHE A CE2 1 
ATOM   5190  C  CZ  . PHE A  1  677 ? -9.697   -9.141   242.451 1.00 117.90 ? 677  PHE A CZ  1 
ATOM   5191  N  N   . VAL A  1  678 ? -5.561   -9.304   238.387 1.00 103.46 ? 678  VAL A N   1 
ATOM   5192  C  CA  . VAL A  1  678 ? -5.266   -7.909   238.087 1.00 102.35 ? 678  VAL A CA  1 
ATOM   5193  C  C   . VAL A  1  678 ? -5.407   -7.642   236.594 1.00 100.28 ? 678  VAL A C   1 
ATOM   5194  O  O   . VAL A  1  678 ? -5.629   -6.505   236.179 1.00 99.37  ? 678  VAL A O   1 
ATOM   5195  C  CB  . VAL A  1  678 ? -3.851   -7.513   238.555 1.00 102.52 ? 678  VAL A CB  1 
ATOM   5196  C  CG1 . VAL A  1  678 ? -3.706   -7.754   240.047 1.00 104.72 ? 678  VAL A CG1 1 
ATOM   5197  C  CG2 . VAL A  1  678 ? -2.788   -8.277   237.784 1.00 101.59 ? 678  VAL A CG2 1 
ATOM   5198  N  N   . PHE A  1  679 ? -5.270   -8.692   235.791 1.00 99.66  ? 679  PHE A N   1 
ATOM   5199  C  CA  . PHE A  1  679 ? -5.512   -8.584   234.360 1.00 97.90  ? 679  PHE A CA  1 
ATOM   5200  C  C   . PHE A  1  679 ? -6.951   -8.152   234.121 1.00 97.81  ? 679  PHE A C   1 
ATOM   5201  O  O   . PHE A  1  679 ? -7.209   -7.159   233.442 1.00 96.70  ? 679  PHE A O   1 
ATOM   5202  C  CB  . PHE A  1  679 ? -5.238   -9.910   233.650 1.00 97.59  ? 679  PHE A CB  1 
ATOM   5203  C  CG  . PHE A  1  679 ? -5.878   -10.009  232.294 1.00 96.24  ? 679  PHE A CG  1 
ATOM   5204  C  CD1 . PHE A  1  679 ? -5.205   -9.578   231.164 1.00 94.65  ? 679  PHE A CD1 1 
ATOM   5205  C  CD2 . PHE A  1  679 ? -7.156   -10.526  232.151 1.00 96.67  ? 679  PHE A CD2 1 
ATOM   5206  C  CE1 . PHE A  1  679 ? -5.791   -9.667   229.916 1.00 93.54  ? 679  PHE A CE1 1 
ATOM   5207  C  CE2 . PHE A  1  679 ? -7.747   -10.616  230.907 1.00 95.54  ? 679  PHE A CE2 1 
ATOM   5208  C  CZ  . PHE A  1  679 ? -7.064   -10.185  229.787 1.00 93.98  ? 679  PHE A CZ  1 
ATOM   5209  N  N   . ALA A  1  680 ? -7.887   -8.912   234.680 1.00 99.10  ? 680  ALA A N   1 
ATOM   5210  C  CA  . ALA A  1  680 ? -9.305   -8.610   234.539 1.00 99.28  ? 680  ALA A CA  1 
ATOM   5211  C  C   . ALA A  1  680 ? -9.643   -7.277   235.198 1.00 99.68  ? 680  ALA A C   1 
ATOM   5212  O  O   . ALA A  1  680 ? -10.493  -6.529   234.713 1.00 99.14  ? 680  ALA A O   1 
ATOM   5213  C  CB  . ALA A  1  680 ? -10.139  -9.719   235.140 1.00 100.84 ? 680  ALA A CB  1 
ATOM   5214  N  N   . PHE A  1  681 ? -8.965   -6.989   236.304 1.00 100.73 ? 681  PHE A N   1 
ATOM   5215  C  CA  . PHE A  1  681 ? -9.160   -5.739   237.029 1.00 101.31 ? 681  PHE A CA  1 
ATOM   5216  C  C   . PHE A  1  681 ? -8.787   -4.545   236.167 1.00 99.68  ? 681  PHE A C   1 
ATOM   5217  O  O   . PHE A  1  681 ? -9.387   -3.478   236.275 1.00 99.76  ? 681  PHE A O   1 
ATOM   5218  C  CB  . PHE A  1  681 ? -8.330   -5.737   238.313 1.00 102.75 ? 681  PHE A CB  1 
ATOM   5219  C  CG  . PHE A  1  681 ? -8.622   -4.580   239.223 1.00 103.76 ? 681  PHE A CG  1 
ATOM   5220  C  CD1 . PHE A  1  681 ? -9.887   -4.403   239.757 1.00 104.95 ? 681  PHE A CD1 1 
ATOM   5221  C  CD2 . PHE A  1  681 ? -7.629   -3.672   239.548 1.00 103.63 ? 681  PHE A CD2 1 
ATOM   5222  C  CE1 . PHE A  1  681 ? -10.157  -3.340   240.597 1.00 106.00 ? 681  PHE A CE1 1 
ATOM   5223  C  CE2 . PHE A  1  681 ? -7.892   -2.607   240.387 1.00 104.68 ? 681  PHE A CE2 1 
ATOM   5224  C  CZ  . PHE A  1  681 ? -9.157   -2.440   240.912 1.00 105.86 ? 681  PHE A CZ  1 
ATOM   5225  N  N   . SER A  1  682 ? -7.788   -4.734   235.315 1.00 98.33  ? 682  SER A N   1 
ATOM   5226  C  CA  . SER A  1  682 ? -7.346   -3.686   234.410 1.00 96.81  ? 682  SER A CA  1 
ATOM   5227  C  C   . SER A  1  682 ? -8.454   -3.315   233.432 1.00 95.93  ? 682  SER A C   1 
ATOM   5228  O  O   . SER A  1  682 ? -8.575   -2.159   233.025 1.00 95.26  ? 682  SER A O   1 
ATOM   5229  C  CB  . SER A  1  682 ? -6.099   -4.131   233.648 1.00 95.67  ? 682  SER A CB  1 
ATOM   5230  O  OG  . SER A  1  682 ? -6.442   -4.890   232.502 1.00 94.67  ? 682  SER A OG  1 
ATOM   5231  N  N   . LEU A  1  683 ? -9.261   -4.303   233.058 1.00 96.02  ? 683  LEU A N   1 
ATOM   5232  C  CA  . LEU A  1  683 ? -10.320  -4.092   232.080 1.00 95.28  ? 683  LEU A CA  1 
ATOM   5233  C  C   . LEU A  1  683 ? -11.398  -3.153   232.623 1.00 96.10  ? 683  LEU A C   1 
ATOM   5234  O  O   . LEU A  1  683 ? -12.117  -2.513   231.855 1.00 95.43  ? 683  LEU A O   1 
ATOM   5235  C  CB  . LEU A  1  683 ? -10.943  -5.430   231.675 1.00 95.46  ? 683  LEU A CB  1 
ATOM   5236  C  CG  . LEU A  1  683 ? -9.978   -6.518   231.207 1.00 94.92  ? 683  LEU A CG  1 
ATOM   5237  C  CD1 . LEU A  1  683 ? -10.755  -7.742   230.741 1.00 95.18  ? 683  LEU A CD1 1 
ATOM   5238  C  CD2 . LEU A  1  683 ? -9.053   -6.010   230.115 1.00 93.29  ? 683  LEU A CD2 1 
ATOM   5239  N  N   . MET A  1  684 ? -11.503  -3.076   233.947 1.00 97.65  ? 684  MET A N   1 
ATOM   5240  C  CA  . MET A  1  684 ? -12.431  -2.158   234.600 1.00 98.66  ? 684  MET A CA  1 
ATOM   5241  C  C   . MET A  1  684 ? -12.121  -0.713   234.223 1.00 97.83  ? 684  MET A C   1 
ATOM   5242  O  O   . MET A  1  684 ? -13.025  0.099    234.027 1.00 97.92  ? 684  MET A O   1 
ATOM   5243  C  CB  . MET A  1  684 ? -12.358  -2.325   236.121 1.00 100.55 ? 684  MET A CB  1 
ATOM   5244  C  CG  . MET A  1  684 ? -13.394  -1.539   236.914 1.00 101.93 ? 684  MET A CG  1 
ATOM   5245  S  SD  . MET A  1  684 ? -13.180  -1.810   238.686 1.00 104.28 ? 684  MET A SD  1 
ATOM   5246  C  CE  . MET A  1  684 ? -14.466  -0.780   239.383 1.00 105.75 ? 684  MET A CE  1 
ATOM   5247  N  N   . PHE A  1  685 ? -10.832  -0.406   234.125 1.00 97.11  ? 685  PHE A N   1 
ATOM   5248  C  CA  . PHE A  1  685 ? -10.375  0.950    233.848 1.00 96.46  ? 685  PHE A CA  1 
ATOM   5249  C  C   . PHE A  1  685 ? -10.305  1.241    232.352 1.00 94.73  ? 685  PHE A C   1 
ATOM   5250  O  O   . PHE A  1  685 ? -10.587  2.358    231.916 1.00 94.33  ? 685  PHE A O   1 
ATOM   5251  C  CB  . PHE A  1  685 ? -9.004   1.181    234.488 1.00 96.68  ? 685  PHE A CB  1 
ATOM   5252  C  CG  . PHE A  1  685 ? -9.018   1.115    235.989 1.00 98.52  ? 685  PHE A CG  1 
ATOM   5253  C  CD1 . PHE A  1  685 ? -9.111   -0.103   236.643 1.00 99.51  ? 685  PHE A CD1 1 
ATOM   5254  C  CD2 . PHE A  1  685 ? -8.935   2.271    236.747 1.00 99.39  ? 685  PHE A CD2 1 
ATOM   5255  C  CE1 . PHE A  1  685 ? -9.125   -0.166   238.023 1.00 101.34 ? 685  PHE A CE1 1 
ATOM   5256  C  CE2 . PHE A  1  685 ? -8.948   2.215    238.128 1.00 101.21 ? 685  PHE A CE2 1 
ATOM   5257  C  CZ  . PHE A  1  685 ? -9.042   0.994    238.768 1.00 102.20 ? 685  PHE A CZ  1 
ATOM   5258  N  N   . LEU A  1  686 ? -9.931   0.234    231.570 1.00 93.83  ? 686  LEU A N   1 
ATOM   5259  C  CA  . LEU A  1  686 ? -9.700   0.422    230.141 1.00 92.26  ? 686  LEU A CA  1 
ATOM   5260  C  C   . LEU A  1  686 ? -10.993  0.481    229.330 1.00 91.97  ? 686  LEU A C   1 
ATOM   5261  O  O   . LEU A  1  686 ? -10.998  0.981    228.204 1.00 90.90  ? 686  LEU A O   1 
ATOM   5262  C  CB  . LEU A  1  686 ? -8.812   -0.701   229.600 1.00 91.53  ? 686  LEU A CB  1 
ATOM   5263  C  CG  . LEU A  1  686 ? -7.399   -0.773   230.183 1.00 91.66  ? 686  LEU A CG  1 
ATOM   5264  C  CD1 . LEU A  1  686 ? -6.759   -2.116   229.875 1.00 91.38  ? 686  LEU A CD1 1 
ATOM   5265  C  CD2 . LEU A  1  686 ? -6.547   0.364    229.641 1.00 90.77  ? 686  LEU A CD2 1 
ATOM   5266  N  N   . PHE A  1  687 ? -12.085  -0.020   229.903 1.00 106.78 ? 687  PHE A N   1 
ATOM   5267  C  CA  . PHE A  1  687 ? -13.361  -0.095   229.191 1.00 106.69 ? 687  PHE A CA  1 
ATOM   5268  C  C   . PHE A  1  687 ? -14.325  1.028    229.573 1.00 107.45 ? 687  PHE A C   1 
ATOM   5269  O  O   . PHE A  1  687 ? -15.274  1.306    228.839 1.00 107.24 ? 687  PHE A O   1 
ATOM   5270  C  CB  . PHE A  1  687 ? -14.037  -1.445   229.458 1.00 107.44 ? 687  PHE A CB  1 
ATOM   5271  C  CG  . PHE A  1  687 ? -13.364  -2.619   228.789 1.00 106.67 ? 687  PHE A CG  1 
ATOM   5272  C  CD1 . PHE A  1  687 ? -12.154  -2.477   228.125 1.00 105.46 ? 687  PHE A CD1 1 
ATOM   5273  C  CD2 . PHE A  1  687 ? -13.952  -3.872   228.830 1.00 107.26 ? 687  PHE A CD2 1 
ATOM   5274  C  CE1 . PHE A  1  687 ? -11.549  -3.561   227.517 1.00 104.87 ? 687  PHE A CE1 1 
ATOM   5275  C  CE2 . PHE A  1  687 ? -13.350  -4.959   228.224 1.00 106.67 ? 687  PHE A CE2 1 
ATOM   5276  C  CZ  . PHE A  1  687 ? -12.148  -4.803   227.567 1.00 105.47 ? 687  PHE A CZ  1 
ATOM   5277  N  N   . SER A  1  688 ? -14.075  1.678    230.707 1.00 94.68  ? 688  SER A N   1 
ATOM   5278  C  CA  . SER A  1  688 ? -14.987  2.695    231.228 1.00 95.68  ? 688  SER A CA  1 
ATOM   5279  C  C   . SER A  1  688 ? -14.387  4.095    231.145 1.00 95.31  ? 688  SER A C   1 
ATOM   5280  O  O   . SER A  1  688 ? -13.337  4.301    230.535 1.00 94.17  ? 688  SER A O   1 
ATOM   5281  C  CB  . SER A  1  688 ? -15.358  2.382    232.679 1.00 97.45  ? 688  SER A CB  1 
ATOM   5282  O  OG  . SER A  1  688 ? -14.295  2.707    233.559 1.00 97.87  ? 688  SER A OG  1 
ATOM   5283  N  N   . GLY A  1  689 ? -15.073  5.051    231.766 1.00 99.27  ? 689  GLY A N   1 
ATOM   5284  C  CA  . GLY A  1  689 ? -14.633  6.435    231.795 1.00 99.22  ? 689  GLY A CA  1 
ATOM   5285  C  C   . GLY A  1  689 ? -15.107  7.100    233.073 1.00 100.96 ? 689  GLY A C   1 
ATOM   5286  O  O   . GLY A  1  689 ? -16.025  6.606    233.727 1.00 102.15 ? 689  GLY A O   1 
ATOM   5287  N  N   . ARG A  1  690 ? -14.494  8.225    233.427 1.00 120.17 ? 690  ARG A N   1 
ATOM   5288  C  CA  . ARG A  1  690 ? -14.730  8.837    234.731 1.00 121.93 ? 690  ARG A CA  1 
ATOM   5289  C  C   . ARG A  1  690 ? -16.110  9.479    234.825 1.00 122.96 ? 690  ARG A C   1 
ATOM   5290  O  O   . ARG A  1  690 ? -16.574  9.798    235.920 1.00 124.64 ? 690  ARG A O   1 
ATOM   5291  C  CB  . ARG A  1  690 ? -13.650  9.879    235.038 1.00 121.96 ? 690  ARG A CB  1 
ATOM   5292  C  CG  . ARG A  1  690 ? -13.762  11.163   234.232 1.00 121.43 ? 690  ARG A CG  1 
ATOM   5293  C  CD  . ARG A  1  690 ? -12.653  12.142   234.584 1.00 121.64 ? 690  ARG A CD  1 
ATOM   5294  N  NE  . ARG A  1  690 ? -12.611  12.477   236.006 1.00 123.39 ? 690  ARG A NE  1 
ATOM   5295  C  CZ  . ARG A  1  690 ? -13.383  13.389   236.591 1.00 124.82 ? 690  ARG A CZ  1 
ATOM   5296  N  NH1 . ARG A  1  690 ? -14.277  14.069   235.884 1.00 124.68 ? 690  ARG A NH1 1 
ATOM   5297  N  NH2 . ARG A  1  690 ? -13.262  13.621   237.891 1.00 126.51 ? 690  ARG A NH2 1 
ATOM   5298  N  N   . GLY A  1  691 ? -16.760  9.670    233.680 1.00 100.23 ? 691  GLY A N   1 
ATOM   5299  C  CA  . GLY A  1  691 ? -18.081  10.269   233.651 1.00 101.18 ? 691  GLY A CA  1 
ATOM   5300  C  C   . GLY A  1  691 ? -19.043  9.464    234.500 1.00 102.60 ? 691  GLY A C   1 
ATOM   5301  O  O   . GLY A  1  691 ? -19.779  10.015   235.319 1.00 104.23 ? 691  GLY A O   1 
ATOM   5302  N  N   . TYR A  1  692 ? -19.033  8.151    234.302 1.00 109.45 ? 692  TYR A N   1 
ATOM   5303  C  CA  . TYR A  1  692 ? -19.830  7.250    235.121 1.00 110.83 ? 692  TYR A CA  1 
ATOM   5304  C  C   . TYR A  1  692 ? -19.352  7.275    236.566 1.00 112.31 ? 692  TYR A C   1 
ATOM   5305  O  O   . TYR A  1  692 ? -20.153  7.362    237.498 1.00 114.10 ? 692  TYR A O   1 
ATOM   5306  C  CB  . TYR A  1  692 ? -19.759  5.822    234.574 1.00 109.93 ? 692  TYR A CB  1 
ATOM   5307  C  CG  . TYR A  1  692 ? -20.399  4.795    235.482 1.00 111.41 ? 692  TYR A CG  1 
ATOM   5308  C  CD1 . TYR A  1  692 ? -21.750  4.498    235.379 1.00 112.27 ? 692  TYR A CD1 1 
ATOM   5309  C  CD2 . TYR A  1  692 ? -19.652  4.122    236.440 1.00 112.06 ? 692  TYR A CD2 1 
ATOM   5310  C  CE1 . TYR A  1  692 ? -22.341  3.564    236.206 1.00 113.74 ? 692  TYR A CE1 1 
ATOM   5311  C  CE2 . TYR A  1  692 ? -20.234  3.186    237.273 1.00 113.55 ? 692  TYR A CE2 1 
ATOM   5312  C  CZ  . TYR A  1  692 ? -21.580  2.912    237.151 1.00 114.39 ? 692  TYR A CZ  1 
ATOM   5313  O  OH  . TYR A  1  692 ? -22.169  1.981    237.976 1.00 115.98 ? 692  TYR A OH  1 
ATOM   5314  N  N   . TRP A  1  693 ? -18.038  7.200    236.742 1.00 104.26 ? 693  TRP A N   1 
ATOM   5315  C  CA  . TRP A  1  693 ? -17.445  7.040    238.064 1.00 105.60 ? 693  TRP A CA  1 
ATOM   5316  C  C   . TRP A  1  693 ? -17.637  8.255    238.957 1.00 107.14 ? 693  TRP A C   1 
ATOM   5317  O  O   . TRP A  1  693 ? -17.754  8.117    240.173 1.00 108.91 ? 693  TRP A O   1 
ATOM   5318  C  CB  . TRP A  1  693 ? -15.957  6.710    237.927 1.00 104.47 ? 693  TRP A CB  1 
ATOM   5319  C  CG  . TRP A  1  693 ? -15.748  5.334    237.393 1.00 103.50 ? 693  TRP A CG  1 
ATOM   5320  C  CD1 . TRP A  1  693 ? -15.191  4.983    236.199 1.00 101.61 ? 693  TRP A CD1 1 
ATOM   5321  C  CD2 . TRP A  1  693 ? -16.124  4.114    238.035 1.00 104.51 ? 693  TRP A CD2 1 
ATOM   5322  N  NE1 . TRP A  1  693 ? -15.189  3.614    236.062 1.00 101.38 ? 693  TRP A NE1 1 
ATOM   5323  C  CE2 . TRP A  1  693 ? -15.757  3.059    237.179 1.00 103.14 ? 693  TRP A CE2 1 
ATOM   5324  C  CE3 . TRP A  1  693 ? -16.732  3.814    239.256 1.00 106.56 ? 693  TRP A CE3 1 
ATOM   5325  C  CZ2 . TRP A  1  693 ? -15.979  1.726    237.508 1.00 103.75 ? 693  TRP A CZ2 1 
ATOM   5326  C  CZ3 . TRP A  1  693 ? -16.949  2.498    239.579 1.00 107.17 ? 693  TRP A CZ3 1 
ATOM   5327  C  CH2 . TRP A  1  693 ? -16.579  1.467    238.709 1.00 105.76 ? 693  TRP A CH2 1 
ATOM   5328  N  N   . GLN A  1  694 ? -17.677  9.443    238.368 1.00 106.60 ? 694  GLN A N   1 
ATOM   5329  C  CA  . GLN A  1  694 ? -17.877  10.644   239.165 1.00 108.12 ? 694  GLN A CA  1 
ATOM   5330  C  C   . GLN A  1  694 ? -19.305  10.706   239.696 1.00 109.84 ? 694  GLN A C   1 
ATOM   5331  O  O   . GLN A  1  694 ? -19.528  11.091   240.844 1.00 111.76 ? 694  GLN A O   1 
ATOM   5332  C  CB  . GLN A  1  694 ? -17.565  11.901   238.354 1.00 107.17 ? 694  GLN A CB  1 
ATOM   5333  C  CG  . GLN A  1  694 ? -17.411  13.137   239.224 1.00 108.67 ? 694  GLN A CG  1 
ATOM   5334  C  CD  . GLN A  1  694 ? -16.284  12.997   240.231 1.00 109.34 ? 694  GLN A CD  1 
ATOM   5335  O  OE1 . GLN A  1  694 ? -15.141  12.729   239.865 1.00 108.06 ? 694  GLN A OE1 1 
ATOM   5336  N  NE2 . GLN A  1  694 ? -16.613  13.133   241.510 1.00 111.45 ? 694  GLN A NE2 1 
ATOM   5337  N  N   . GLU A  1  695 ? -20.267  10.325   238.861 1.00 130.75 ? 695  GLU A N   1 
ATOM   5338  C  CA  . GLU A  1  695 ? -21.668  10.317   239.269 1.00 131.64 ? 695  GLU A CA  1 
ATOM   5339  C  C   . GLU A  1  695 ? -21.907  9.322    240.393 1.00 133.21 ? 695  GLU A C   1 
ATOM   5340  O  O   . GLU A  1  695 ? -22.720  9.561    241.285 1.00 135.23 ? 695  GLU A O   1 
ATOM   5341  C  CB  . GLU A  1  695 ? -22.579  9.981    238.089 1.00 130.65 ? 695  GLU A CB  1 
ATOM   5342  C  CG  . GLU A  1  695 ? -22.689  11.080   237.053 1.00 129.66 ? 695  GLU A CG  1 
ATOM   5343  C  CD  . GLU A  1  695 ? -23.843  10.857   236.095 1.00 129.31 ? 695  GLU A CD  1 
ATOM   5344  O  OE1 . GLU A  1  695 ? -24.273  9.695    235.940 1.00 129.17 ? 695  GLU A OE1 1 
ATOM   5345  O  OE2 . GLU A  1  695 ? -24.323  11.845   235.500 1.00 129.28 ? 695  GLU A OE2 1 
ATOM   5346  N  N   . LEU A  1  696 ? -21.195  8.202    240.343 1.00 111.60 ? 696  LEU A N   1 
ATOM   5347  C  CA  . LEU A  1  696 ? -21.325  7.172    241.363 1.00 113.06 ? 696  LEU A CA  1 
ATOM   5348  C  C   . LEU A  1  696 ? -20.850  7.712    242.706 1.00 114.84 ? 696  LEU A C   1 
ATOM   5349  O  O   . LEU A  1  696 ? -21.494  7.505    243.735 1.00 116.94 ? 696  LEU A O   1 
ATOM   5350  C  CB  . LEU A  1  696 ? -20.529  5.923    240.974 1.00 111.74 ? 696  LEU A CB  1 
ATOM   5351  C  CG  . LEU A  1  696 ? -20.820  4.658    241.787 1.00 113.10 ? 696  LEU A CG  1 
ATOM   5352  C  CD1 . LEU A  1  696 ? -22.212  4.126    241.485 1.00 113.70 ? 696  LEU A CD1 1 
ATOM   5353  C  CD2 . LEU A  1  696 ? -19.773  3.591    241.509 1.00 111.89 ? 696  LEU A CD2 1 
ATOM   5354  N  N   . ILE A  1  697 ? -19.713  8.401    242.683 1.00 114.07 ? 697  ILE A N   1 
ATOM   5355  C  CA  . ILE A  1  697 ? -19.133  8.987    243.886 1.00 115.68 ? 697  ILE A CA  1 
ATOM   5356  C  C   . ILE A  1  697 ? -20.079  9.987    244.550 1.00 117.65 ? 697  ILE A C   1 
ATOM   5357  O  O   . ILE A  1  697 ? -20.133  10.069   245.776 1.00 119.76 ? 697  ILE A O   1 
ATOM   5358  C  CB  . ILE A  1  697 ? -17.791  9.678    243.561 1.00 114.38 ? 697  ILE A CB  1 
ATOM   5359  C  CG1 . ILE A  1  697 ? -16.758  8.636    243.131 1.00 112.83 ? 697  ILE A CG1 1 
ATOM   5360  C  CG2 . ILE A  1  697 ? -17.265  10.462   244.762 1.00 116.16 ? 697  ILE A CG2 1 
ATOM   5361  C  CD1 . ILE A  1  697 ? -15.583  9.212    242.376 1.00 111.06 ? 697  ILE A CD1 1 
ATOM   5362  N  N   . GLU A  1  698 ? -20.821  10.741   243.743 1.00 128.51 ? 698  GLU A N   1 
ATOM   5363  C  CA  . GLU A  1  698 ? -21.757  11.735   244.268 1.00 130.36 ? 698  GLU A CA  1 
ATOM   5364  C  C   . GLU A  1  698 ? -22.780  11.099   245.197 1.00 132.54 ? 698  GLU A C   1 
ATOM   5365  O  O   . GLU A  1  698 ? -23.101  11.644   246.253 1.00 134.75 ? 698  GLU A O   1 
ATOM   5366  C  CB  . GLU A  1  698 ? -22.486  12.447   243.129 1.00 129.33 ? 698  GLU A CB  1 
ATOM   5367  C  CG  . GLU A  1  698 ? -21.621  13.393   242.321 1.00 127.71 ? 698  GLU A CG  1 
ATOM   5368  C  CD  . GLU A  1  698 ? -22.290  13.820   241.033 1.00 126.46 ? 698  GLU A CD  1 
ATOM   5369  O  OE1 . GLU A  1  698 ? -23.524  13.661   240.923 1.00 127.24 ? 698  GLU A OE1 1 
ATOM   5370  O  OE2 . GLU A  1  698 ? -21.587  14.327   240.133 1.00 124.79 ? 698  GLU A OE2 1 
ATOM   5371  N  N   . SER A  1  699 ? -23.288  9.939    244.793 1.00 127.52 ? 699  SER A N   1 
ATOM   5372  C  CA  . SER A  1  699 ? -24.236  9.196    245.608 1.00 129.54 ? 699  SER A CA  1 
ATOM   5373  C  C   . SER A  1  699 ? -23.560  8.701    246.877 1.00 131.07 ? 699  SER A C   1 
ATOM   5374  O  O   . SER A  1  699 ? -24.154  8.702    247.956 1.00 133.51 ? 699  SER A O   1 
ATOM   5375  C  CB  . SER A  1  699 ? -24.806  8.015    244.822 1.00 128.51 ? 699  SER A CB  1 
ATOM   5376  O  OG  . SER A  1  699 ? -25.652  8.455    243.776 1.00 127.62 ? 699  SER A OG  1 
ATOM   5377  N  N   . ILE A  1  700 ? -22.307  8.286    246.735 1.00 122.76 ? 700  ILE A N   1 
ATOM   5378  C  CA  . ILE A  1  700 ? -21.523  7.786    247.856 1.00 124.05 ? 700  ILE A CA  1 
ATOM   5379  C  C   . ILE A  1  700 ? -21.173  8.917    248.819 1.00 125.71 ? 700  ILE A C   1 
ATOM   5380  O  O   . ILE A  1  700 ? -21.276  8.759    250.035 1.00 128.04 ? 700  ILE A O   1 
ATOM   5381  C  CB  . ILE A  1  700 ? -20.241  7.090    247.362 1.00 122.10 ? 700  ILE A CB  1 
ATOM   5382  C  CG1 . ILE A  1  700 ? -20.613  5.885    246.493 1.00 120.74 ? 700  ILE A CG1 1 
ATOM   5383  C  CG2 . ILE A  1  700 ? -19.372  6.650    248.539 1.00 123.55 ? 700  ILE A CG2 1 
ATOM   5384  C  CD1 . ILE A  1  700 ? -19.479  5.352    245.654 1.00 118.42 ? 700  ILE A CD1 1 
ATOM   5385  N  N   . VAL A  1  701 ? -20.748  10.049   248.267 1.00 124.59 ? 701  VAL A N   1 
ATOM   5386  C  CA  . VAL A  1  701 ? -20.440  11.231   249.065 1.00 126.10 ? 701  VAL A CA  1 
ATOM   5387  C  C   . VAL A  1  701 ? -21.641  11.647   249.906 1.00 128.71 ? 701  VAL A C   1 
ATOM   5388  O  O   . VAL A  1  701 ? -21.493  11.995   251.077 1.00 130.93 ? 701  VAL A O   1 
ATOM   5389  C  CB  . VAL A  1  701 ? -19.997  12.415   248.171 1.00 124.46 ? 701  VAL A CB  1 
ATOM   5390  C  CG1 . VAL A  1  701 ? -20.095  13.749   248.917 1.00 126.33 ? 701  VAL A CG1 1 
ATOM   5391  C  CG2 . VAL A  1  701 ? -18.579  12.194   247.666 1.00 122.48 ? 701  VAL A CG2 1 
ATOM   5392  N  N   . TRP A  1  702 ? -22.824  11.612   249.301 1.00 152.57 ? 702  TRP A N   1 
ATOM   5393  C  CA  . TRP A  1  702 ? -24.049  12.013   249.985 1.00 155.01 ? 702  TRP A CA  1 
ATOM   5394  C  C   . TRP A  1  702 ? -24.258  11.252   251.288 1.00 157.51 ? 702  TRP A C   1 
ATOM   5395  O  O   . TRP A  1  702 ? -24.748  11.810   252.271 1.00 160.03 ? 702  TRP A O   1 
ATOM   5396  C  CB  . TRP A  1  702 ? -25.261  11.801   249.077 1.00 154.33 ? 702  TRP A CB  1 
ATOM   5397  C  CG  . TRP A  1  702 ? -26.565  11.941   249.798 1.00 156.94 ? 702  TRP A CG  1 
ATOM   5398  C  CD1 . TRP A  1  702 ? -27.279  13.088   249.987 1.00 158.33 ? 702  TRP A CD1 1 
ATOM   5399  C  CD2 . TRP A  1  702 ? -27.312  10.895   250.434 1.00 158.60 ? 702  TRP A CD2 1 
ATOM   5400  N  NE1 . TRP A  1  702 ? -28.424  12.822   250.697 1.00 160.75 ? 702  TRP A NE1 1 
ATOM   5401  C  CE2 . TRP A  1  702 ? -28.467  11.483   250.985 1.00 160.97 ? 702  TRP A CE2 1 
ATOM   5402  C  CE3 . TRP A  1  702 ? -27.114  9.520    250.591 1.00 158.42 ? 702  TRP A CE3 1 
ATOM   5403  C  CZ2 . TRP A  1  702 ? -29.422  10.744   251.680 1.00 163.14 ? 702  TRP A CZ2 1 
ATOM   5404  C  CZ3 . TRP A  1  702 ? -28.062  8.789    251.282 1.00 160.58 ? 702  TRP A CZ3 1 
ATOM   5405  C  CH2 . TRP A  1  702 ? -29.202  9.402    251.817 1.00 162.91 ? 702  TRP A CH2 1 
ATOM   5406  N  N   . ALA A  1  703 ? -23.882  9.978    251.294 1.00 132.86 ? 703  ALA A N   1 
ATOM   5407  C  CA  . ALA A  1  703 ? -24.043  9.144    252.478 1.00 135.20 ? 703  ALA A CA  1 
ATOM   5408  C  C   . ALA A  1  703 ? -23.136  9.616    253.608 1.00 136.80 ? 703  ALA A C   1 
ATOM   5409  O  O   . ALA A  1  703 ? -23.418  9.375    254.782 1.00 139.46 ? 703  ALA A O   1 
ATOM   5410  C  CB  . ALA A  1  703 ? -23.757  7.695    252.144 1.00 134.07 ? 703  ALA A CB  1 
ATOM   5411  N  N   . HIS A  1  704 ? -22.045  10.283   253.246 1.00 140.04 ? 704  HIS A N   1 
ATOM   5412  C  CA  . HIS A  1  704 ? -21.126  10.838   254.231 1.00 141.45 ? 704  HIS A CA  1 
ATOM   5413  C  C   . HIS A  1  704 ? -21.595  12.211   254.701 1.00 143.16 ? 704  HIS A C   1 
ATOM   5414  O  O   . HIS A  1  704 ? -21.429  12.563   255.869 1.00 145.61 ? 704  HIS A O   1 
ATOM   5415  C  CB  . HIS A  1  704 ? -19.715  10.910   253.654 1.00 139.19 ? 704  HIS A CB  1 
ATOM   5416  C  CG  . HIS A  1  704 ? -19.083  9.568    253.468 1.00 138.07 ? 704  HIS A CG  1 
ATOM   5417  N  ND1 . HIS A  1  704 ? -19.642  8.586    252.679 1.00 136.71 ? 704  HIS A ND1 1 
ATOM   5418  C  CD2 . HIS A  1  704 ? -17.952  9.035    253.987 1.00 138.26 ? 704  HIS A CD2 1 
ATOM   5419  C  CE1 . HIS A  1  704 ? -18.877  7.510    252.711 1.00 136.09 ? 704  HIS A CE1 1 
ATOM   5420  N  NE2 . HIS A  1  704 ? -17.846  7.756    253.498 1.00 137.00 ? 704  HIS A NE2 1 
ATOM   5421  N  N   . ASN A  1  705 ? -22.179  12.985   253.790 1.00 158.37 ? 705  ASN A N   1 
ATOM   5422  C  CA  . ASN A  1  705 ? -22.819  14.240   254.164 1.00 158.84 ? 705  ASN A CA  1 
ATOM   5423  C  C   . ASN A  1  705 ? -23.965  13.980   255.134 1.00 162.97 ? 705  ASN A C   1 
ATOM   5424  O  O   . ASN A  1  705 ? -24.305  14.828   255.959 1.00 166.43 ? 705  ASN A O   1 
ATOM   5425  C  CB  . ASN A  1  705 ? -23.345  14.979   252.931 1.00 157.04 ? 705  ASN A CB  1 
ATOM   5426  C  CG  . ASN A  1  705 ? -22.315  15.907   252.321 1.00 155.32 ? 705  ASN A CG  1 
ATOM   5427  O  OD1 . ASN A  1  705 ? -22.092  17.013   252.812 1.00 156.60 ? 705  ASN A OD1 1 
ATOM   5428  N  ND2 . ASN A  1  705 ? -21.698  15.472   251.229 1.00 152.50 ? 705  ASN A ND2 1 
ATOM   5429  N  N   . LYS A  1  706 ? -24.555  12.794   255.021 1.00 158.73 ? 706  LYS A N   1 
ATOM   5430  C  CA  . LYS A  1  706 ? -25.668  12.392   255.871 1.00 161.47 ? 706  LYS A CA  1 
ATOM   5431  C  C   . LYS A  1  706 ? -25.232  12.087   257.301 1.00 164.13 ? 706  LYS A C   1 
ATOM   5432  O  O   . LYS A  1  706 ? -25.989  12.307   258.248 1.00 167.03 ? 706  LYS A O   1 
ATOM   5433  C  CB  . LYS A  1  706 ? -26.361  11.167   255.272 1.00 160.52 ? 706  LYS A CB  1 
ATOM   5434  C  CG  . LYS A  1  706 ? -27.707  10.850   255.893 1.00 163.11 ? 706  LYS A CG  1 
ATOM   5435  C  CD  . LYS A  1  706 ? -28.773  11.818   255.428 1.00 163.42 ? 706  LYS A CD  1 
ATOM   5436  C  CE  . LYS A  1  706 ? -30.113  11.475   256.041 1.00 166.08 ? 706  LYS A CE  1 
ATOM   5437  N  NZ  . LYS A  1  706 ? -31.185  12.344   255.506 1.00 166.32 ? 706  LYS A NZ  1 
ATOM   5438  N  N   . LEU A  1  707 ? -24.011  11.580   257.448 1.00 146.25 ? 707  LEU A N   1 
ATOM   5439  C  CA  . LEU A  1  707 ? -23.480  11.196   258.752 1.00 148.65 ? 707  LEU A CA  1 
ATOM   5440  C  C   . LEU A  1  707 ? -22.355  12.135   259.180 1.00 148.90 ? 707  LEU A C   1 
ATOM   5441  O  O   . LEU A  1  707 ? -21.678  11.892   260.180 1.00 150.61 ? 707  LEU A O   1 
ATOM   5442  C  CB  . LEU A  1  707 ? -22.974  9.754    258.707 1.00 147.83 ? 707  LEU A CB  1 
ATOM   5443  C  CG  . LEU A  1  707 ? -24.012  8.706    258.297 1.00 147.64 ? 707  LEU A CG  1 
ATOM   5444  C  CD1 . LEU A  1  707 ? -23.346  7.370    258.010 1.00 146.25 ? 707  LEU A CD1 1 
ATOM   5445  C  CD2 . LEU A  1  707 ? -25.070  8.554    259.378 1.00 151.08 ? 707  LEU A CD2 1 
ATOM   5446  N  N   . ASN A  1  708 ? -22.170  13.211   258.419 1.00 224.90 ? 708  ASN A N   1 
ATOM   5447  C  CA  . ASN A  1  708 ? -21.165  14.227   258.719 1.00 228.78 ? 708  ASN A CA  1 
ATOM   5448  C  C   . ASN A  1  708 ? -19.748  13.651   258.728 1.00 227.65 ? 708  ASN A C   1 
ATOM   5449  O  O   . ASN A  1  708 ? -18.961  13.932   259.633 1.00 229.99 ? 708  ASN A O   1 
ATOM   5450  C  CB  . ASN A  1  708 ? -21.469  14.903   260.063 1.00 234.71 ? 708  ASN A CB  1 
ATOM   5451  C  CG  . ASN A  1  708 ? -20.729  16.222   260.237 1.00 240.37 ? 708  ASN A CG  1 
ATOM   5452  O  OD1 . ASN A  1  708 ? -20.277  16.826   259.263 1.00 238.10 ? 708  ASN A OD1 1 
ATOM   5453  N  ND2 . ASN A  1  708 ? -20.609  16.677   261.480 1.00 248.21 ? 708  ASN A ND2 1 
ATOM   5454  N  N   . VAL A  1  709 ? -19.435  12.837   257.723 1.00 143.46 ? 709  VAL A N   1 
ATOM   5455  C  CA  . VAL A  1  709 ? -18.105  12.243   257.586 1.00 142.03 ? 709  VAL A CA  1 
ATOM   5456  C  C   . VAL A  1  709 ? -17.556  12.454   256.174 1.00 138.60 ? 709  VAL A C   1 
ATOM   5457  O  O   . VAL A  1  709 ? -16.763  11.656   255.678 1.00 136.80 ? 709  VAL A O   1 
ATOM   5458  C  CB  . VAL A  1  709 ? -18.121  10.729   257.920 1.00 142.43 ? 709  VAL A CB  1 
ATOM   5459  C  CG1 . VAL A  1  709 ? -18.120  10.516   259.425 1.00 145.83 ? 709  VAL A CG1 1 
ATOM   5460  C  CG2 . VAL A  1  709 ? -19.318  10.045   257.272 1.00 141.71 ? 709  VAL A CG2 1 
ATOM   5461  N  N   . ALA A  1  710 ? -17.987  13.533   255.527 1.00 206.98 ? 710  ALA A N   1 
ATOM   5462  C  CA  . ALA A  1  710 ? -17.439  13.916   254.230 1.00 197.99 ? 710  ALA A CA  1 
ATOM   5463  C  C   . ALA A  1  710 ? -16.002  14.423   254.389 1.00 184.03 ? 710  ALA A C   1 
ATOM   5464  O  O   . ALA A  1  710 ? -15.733  15.251   255.258 1.00 184.58 ? 710  ALA A O   1 
ATOM   5465  C  CB  . ALA A  1  710 ? -18.307  14.976   253.576 1.00 199.44 ? 710  ALA A CB  1 
ATOM   5466  N  N   . PRO A  1  711 ? -15.070  13.932   253.553 1.00 152.80 ? 711  PRO A N   1 
ATOM   5467  C  CA  . PRO A  1  711 ? -13.671  14.354   253.689 1.00 152.42 ? 711  PRO A CA  1 
ATOM   5468  C  C   . PRO A  1  711 ? -13.427  15.769   253.171 1.00 151.78 ? 711  PRO A C   1 
ATOM   5469  O  O   . PRO A  1  711 ? -14.101  16.202   252.236 1.00 150.48 ? 711  PRO A O   1 
ATOM   5470  C  CB  . PRO A  1  711 ? -12.917  13.331   252.839 1.00 149.96 ? 711  PRO A CB  1 
ATOM   5471  C  CG  . PRO A  1  711 ? -13.887  12.961   251.778 1.00 148.27 ? 711  PRO A CG  1 
ATOM   5472  C  CD  . PRO A  1  711 ? -15.252  13.010   252.417 1.00 150.33 ? 711  PRO A CD  1 
ATOM   5473  N  N   . ALA A  1  712 ? -12.477  16.477   253.776 1.00 251.23 ? 712  ALA A N   1 
ATOM   5474  C  CA  . ALA A  1  712 ? -12.129  17.824   253.336 1.00 255.11 ? 712  ALA A CA  1 
ATOM   5475  C  C   . ALA A  1  712 ? -11.576  17.784   251.917 1.00 237.03 ? 712  ALA A C   1 
ATOM   5476  O  O   . ALA A  1  712 ? -11.949  18.596   251.071 1.00 237.95 ? 712  ALA A O   1 
ATOM   5477  C  CB  . ALA A  1  712 ? -11.121  18.452   254.284 1.00 269.72 ? 712  ALA A CB  1 
ATOM   5478  N  N   . ILE A  1  713 ? -10.685  16.831   251.664 1.00 127.07 ? 713  ILE A N   1 
ATOM   5479  C  CA  . ILE A  1  713 ? -10.174  16.601   250.320 1.00 124.19 ? 713  ILE A CA  1 
ATOM   5480  C  C   . ILE A  1  713 ? -11.271  15.930   249.503 1.00 122.88 ? 713  ILE A C   1 
ATOM   5481  O  O   . ILE A  1  713 ? -11.435  14.710   249.553 1.00 122.56 ? 713  ILE A O   1 
ATOM   5482  C  CB  . ILE A  1  713 ? -8.895   15.731   250.339 1.00 123.32 ? 713  ILE A CB  1 
ATOM   5483  C  CG1 . ILE A  1  713 ? -7.805   16.431   251.161 1.00 124.75 ? 713  ILE A CG1 1 
ATOM   5484  C  CG2 . ILE A  1  713 ? -8.412   15.452   248.917 1.00 120.42 ? 713  ILE A CG2 1 
ATOM   5485  C  CD1 . ILE A  1  713 ? -6.503   15.657   251.283 1.00 124.22 ? 713  ILE A CD1 1 
ATOM   5486  N  N   . GLN A  1  714 ? -12.024  16.738   248.759 1.00 128.62 ? 714  GLN A N   1 
ATOM   5487  C  CA  . GLN A  1  714 ? -13.201  16.253   248.043 1.00 127.73 ? 714  GLN A CA  1 
ATOM   5488  C  C   . GLN A  1  714 ? -12.879  15.093   247.098 1.00 125.42 ? 714  GLN A C   1 
ATOM   5489  O  O   . GLN A  1  714 ? -11.948  15.188   246.299 1.00 123.63 ? 714  GLN A O   1 
ATOM   5490  C  CB  . GLN A  1  714 ? -13.858  17.383   247.251 1.00 127.22 ? 714  GLN A CB  1 
ATOM   5491  C  CG  . GLN A  1  714 ? -14.703  18.316   248.100 1.00 129.65 ? 714  GLN A CG  1 
ATOM   5492  C  CD  . GLN A  1  714 ? -15.492  19.305   247.267 1.00 129.18 ? 714  GLN A CD  1 
ATOM   5493  O  OE1 . GLN A  1  714 ? -16.706  19.438   247.426 1.00 130.28 ? 714  GLN A OE1 1 
ATOM   5494  N  NE2 . GLN A  1  714 ? -14.807  20.002   246.371 1.00 127.65 ? 714  GLN A NE2 1 
ATOM   5495  N  N   . PRO A  1  715 ? -13.652  13.996   247.179 1.00 128.03 ? 715  PRO A N   1 
ATOM   5496  C  CA  . PRO A  1  715 ? -13.379  12.850   246.302 1.00 125.99 ? 715  PRO A CA  1 
ATOM   5497  C  C   . PRO A  1  715 ? -13.652  13.138   244.828 1.00 123.77 ? 715  PRO A C   1 
ATOM   5498  O  O   . PRO A  1  715 ? -14.700  13.682   244.481 1.00 123.97 ? 715  PRO A O   1 
ATOM   5499  C  CB  . PRO A  1  715 ? -14.332  11.769   246.819 1.00 127.06 ? 715  PRO A CB  1 
ATOM   5500  C  CG  . PRO A  1  715 ? -14.801  12.241   248.147 1.00 129.80 ? 715  PRO A CG  1 
ATOM   5501  C  CD  . PRO A  1  715 ? -14.768  13.720   248.098 1.00 130.17 ? 715  PRO A CD  1 
ATOM   5502  N  N   . ARG A  1  716 ? -12.703  12.764   243.976 1.00 112.93 ? 716  ARG A N   1 
ATOM   5503  C  CA  . ARG A  1  716 ? -12.813  12.972   242.539 1.00 110.82 ? 716  ARG A CA  1 
ATOM   5504  C  C   . ARG A  1  716 ? -12.311  11.743   241.794 1.00 109.06 ? 716  ARG A C   1 
ATOM   5505  O  O   . ARG A  1  716 ? -11.232  11.232   242.091 1.00 108.85 ? 716  ARG A O   1 
ATOM   5506  C  CB  . ARG A  1  716 ? -12.013  14.204   242.111 1.00 110.23 ? 716  ARG A CB  1 
ATOM   5507  C  CG  . ARG A  1  716 ? -12.495  15.522   242.706 1.00 111.90 ? 716  ARG A CG  1 
ATOM   5508  C  CD  . ARG A  1  716 ? -13.813  15.970   242.093 1.00 111.84 ? 716  ARG A CD  1 
ATOM   5509  N  NE  . ARG A  1  716 ? -13.949  17.428   242.103 1.00 112.63 ? 716  ARG A NE  1 
ATOM   5510  C  CZ  . ARG A  1  716 ? -14.705  18.127   242.947 1.00 114.68 ? 716  ARG A CZ  1 
ATOM   5511  N  NH1 . ARG A  1  716 ? -15.430  17.525   243.881 1.00 116.24 ? 716  ARG A NH1 1 
ATOM   5512  N  NH2 . ARG A  1  716 ? -14.740  19.449   242.850 1.00 115.28 ? 716  ARG A NH2 1 
ATOM   5513  N  N   . ALA A  1  717 ? -13.090  11.274   240.824 1.00 109.42 ? 717  ALA A N   1 
ATOM   5514  C  CA  . ALA A  1  717 ? -12.664  10.166   239.978 1.00 107.71 ? 717  ALA A CA  1 
ATOM   5515  C  C   . ALA A  1  717 ? -11.347  10.507   239.295 1.00 106.22 ? 717  ALA A C   1 
ATOM   5516  O  O   . ALA A  1  717 ? -11.049  11.678   239.056 1.00 106.09 ? 717  ALA A O   1 
ATOM   5517  C  CB  . ALA A  1  717 ? -13.728  9.841    238.945 1.00 106.72 ? 717  ALA A CB  1 
ATOM   5518  N  N   . LEU A  1  718 ? -10.561  9.480    238.991 1.00 103.67 ? 718  LEU A N   1 
ATOM   5519  C  CA  . LEU A  1  718 ? -9.250   9.670    238.382 1.00 102.37 ? 718  LEU A CA  1 
ATOM   5520  C  C   . LEU A  1  718 ? -9.371   10.427   237.066 1.00 100.88 ? 718  LEU A C   1 
ATOM   5521  O  O   . LEU A  1  718 ? -10.410  10.382   236.407 1.00 100.45 ? 718  LEU A O   1 
ATOM   5522  C  CB  . LEU A  1  718 ? -8.564   8.324    238.143 1.00 101.52 ? 718  LEU A CB  1 
ATOM   5523  C  CG  . LEU A  1  718 ? -8.528   7.345    239.319 1.00 102.94 ? 718  LEU A CG  1 
ATOM   5524  C  CD1 . LEU A  1  718 ? -7.866   6.044    238.894 1.00 101.98 ? 718  LEU A CD1 1 
ATOM   5525  C  CD2 . LEU A  1  718 ? -7.812   7.947    240.519 1.00 104.48 ? 718  LEU A CD2 1 
ATOM   5526  N  N   . SER A  1  719 ? -8.305   11.127   236.692 1.00 100.22 ? 719  SER A N   1 
ATOM   5527  C  CA  . SER A  1  719 ? -8.269   11.831   235.419 1.00 98.86  ? 719  SER A CA  1 
ATOM   5528  C  C   . SER A  1  719 ? -8.381   10.824   234.285 1.00 97.27  ? 719  SER A C   1 
ATOM   5529  O  O   . SER A  1  719 ? -8.091   9.643    234.471 1.00 97.08  ? 719  SER A O   1 
ATOM   5530  C  CB  . SER A  1  719 ? -6.978   12.638   235.282 1.00 98.56  ? 719  SER A CB  1 
ATOM   5531  O  OG  . SER A  1  719 ? -5.892   11.791   234.943 1.00 97.57  ? 719  SER A OG  1 
ATOM   5532  N  N   . ILE A  1  720 ? -8.809   11.286   233.116 1.00 96.25  ? 720  ILE A N   1 
ATOM   5533  C  CA  . ILE A  1  720 ? -8.974   10.397   231.973 1.00 94.84  ? 720  ILE A CA  1 
ATOM   5534  C  C   . ILE A  1  720 ? -7.637   9.763    231.612 1.00 93.85  ? 720  ILE A C   1 
ATOM   5535  O  O   . ILE A  1  720 ? -7.582   8.604    231.201 1.00 93.14  ? 720  ILE A O   1 
ATOM   5536  C  CB  . ILE A  1  720 ? -9.543   11.136   230.744 1.00 94.02  ? 720  ILE A CB  1 
ATOM   5537  C  CG1 . ILE A  1  720 ? -10.921  11.717   231.063 1.00 95.06  ? 720  ILE A CG1 1 
ATOM   5538  C  CG2 . ILE A  1  720 ? -9.654   10.189   229.549 1.00 92.64  ? 720  ILE A CG2 1 
ATOM   5539  C  CD1 . ILE A  1  720 ? -11.389  12.755   230.069 1.00 94.65  ? 720  ILE A CD1 1 
ATOM   5540  N  N   . ILE A  1  721 ? -6.558   10.523   231.774 1.00 93.90  ? 721  ILE A N   1 
ATOM   5541  C  CA  . ILE A  1  721 ? -5.223   10.003   231.513 1.00 93.16  ? 721  ILE A CA  1 
ATOM   5542  C  C   . ILE A  1  721 ? -4.840   8.943    232.539 1.00 93.87  ? 721  ILE A C   1 
ATOM   5543  O  O   . ILE A  1  721 ? -4.373   7.867    232.170 1.00 97.17  ? 721  ILE A O   1 
ATOM   5544  C  CB  . ILE A  1  721 ? -4.166   11.131   231.506 1.00 93.24  ? 721  ILE A CB  1 
ATOM   5545  C  CG1 . ILE A  1  721 ? -4.338   12.011   230.262 1.00 92.35  ? 721  ILE A CG1 1 
ATOM   5546  C  CG2 . ILE A  1  721 ? -2.743   10.562   231.587 1.00 92.90  ? 721  ILE A CG2 1 
ATOM   5547  C  CD1 . ILE A  1  721 ? -3.940   11.342   228.950 1.00 90.85  ? 721  ILE A CD1 1 
ATOM   5548  N  N   . GLN A  1  722 ? -5.035   9.240    233.820 1.00 95.38  ? 722  GLN A N   1 
ATOM   5549  C  CA  . GLN A  1  722 ? -4.681   8.288    234.868 1.00 96.30  ? 722  GLN A CA  1 
ATOM   5550  C  C   . GLN A  1  722 ? -5.522   7.027    234.732 1.00 96.13  ? 722  GLN A C   1 
ATOM   5551  O  O   . GLN A  1  722 ? -5.037   5.924    234.975 1.00 96.16  ? 722  GLN A O   1 
ATOM   5552  C  CB  . GLN A  1  722 ? -4.861   8.890    236.263 1.00 98.14  ? 722  GLN A CB  1 
ATOM   5553  C  CG  . GLN A  1  722 ? -4.611   7.880    237.381 1.00 99.30  ? 722  GLN A CG  1 
ATOM   5554  C  CD  . GLN A  1  722 ? -4.638   8.498    238.760 1.00 101.23 ? 722  GLN A CD  1 
ATOM   5555  O  OE1 . GLN A  1  722 ? -5.073   9.634    238.940 1.00 101.81 ? 722  GLN A OE1 1 
ATOM   5556  N  NE2 . GLN A  1  722 ? -4.169   7.747    239.747 1.00 102.35 ? 722  GLN A NE2 1 
ATOM   5557  N  N   . GLY A  1  723 ? -6.785   7.199    234.356 1.00 96.06  ? 723  GLY A N   1 
ATOM   5558  C  CA  . GLY A  1  723 ? -7.670   6.072    234.129 1.00 95.92  ? 723  GLY A CA  1 
ATOM   5559  C  C   . GLY A  1  723 ? -7.067   5.115    233.121 1.00 94.50  ? 723  GLY A C   1 
ATOM   5560  O  O   . GLY A  1  723 ? -7.208   3.898    233.239 1.00 94.61  ? 723  GLY A O   1 
ATOM   5561  N  N   . ARG A  1  724 ? -6.381   5.674    232.129 1.00 93.29  ? 724  ARG A N   1 
ATOM   5562  C  CA  . ARG A  1  724 ? -5.703   4.879    231.115 1.00 91.99  ? 724  ARG A CA  1 
ATOM   5563  C  C   . ARG A  1  724 ? -4.343   4.397    231.612 1.00 92.16  ? 724  ARG A C   1 
ATOM   5564  O  O   . ARG A  1  724 ? -3.930   3.276    231.322 1.00 91.74  ? 724  ARG A O   1 
ATOM   5565  C  CB  . ARG A  1  724 ? -5.537   5.689    229.828 1.00 90.77  ? 724  ARG A CB  1 
ATOM   5566  C  CG  . ARG A  1  724 ? -6.848   6.058    229.154 1.00 90.52  ? 724  ARG A CG  1 
ATOM   5567  C  CD  . ARG A  1  724 ? -6.609   6.935    227.936 1.00 89.50  ? 724  ARG A CD  1 
ATOM   5568  N  NE  . ARG A  1  724 ? -7.767   7.762    227.606 1.00 89.70  ? 724  ARG A NE  1 
ATOM   5569  C  CZ  . ARG A  1  724 ? -7.728   8.812    226.790 1.00 89.24  ? 724  ARG A CZ  1 
ATOM   5570  N  NH1 . ARG A  1  724 ? -6.589   9.169    226.213 1.00 88.55  ? 724  ARG A NH1 1 
ATOM   5571  N  NH2 . ARG A  1  724 ? -8.828   9.509    226.544 1.00 89.57  ? 724  ARG A NH2 1 
ATOM   5572  N  N   . ALA A  1  725 ? -3.652   5.246    232.367 1.00 119.41 ? 725  ALA A N   1 
ATOM   5573  C  CA  . ALA A  1  725 ? -2.338   4.900    232.897 1.00 119.73 ? 725  ALA A CA  1 
ATOM   5574  C  C   . ALA A  1  725 ? -2.445   3.733    233.871 1.00 120.77 ? 725  ALA A C   1 
ATOM   5575  O  O   . ALA A  1  725 ? -1.605   2.836    233.868 1.00 120.65 ? 725  ALA A O   1 
ATOM   5576  C  CB  . ALA A  1  725 ? -1.703   6.100    233.575 1.00 120.50 ? 725  ALA A CB  1 
ATOM   5577  N  N   . VAL A  1  726 ? -3.478   3.754    234.707 1.00 95.38  ? 726  VAL A N   1 
ATOM   5578  C  CA  . VAL A  1  726 ? -3.726   2.660    235.638 1.00 96.54  ? 726  VAL A CA  1 
ATOM   5579  C  C   . VAL A  1  726 ? -4.149   1.418    234.870 1.00 95.75  ? 726  VAL A C   1 
ATOM   5580  O  O   . VAL A  1  726 ? -3.774   0.301    235.225 1.00 96.20  ? 726  VAL A O   1 
ATOM   5581  C  CB  . VAL A  1  726 ? -4.810   3.022    236.679 1.00 98.06  ? 726  VAL A CB  1 
ATOM   5582  C  CG1 . VAL A  1  726 ? -5.226   1.792    237.491 1.00 99.25  ? 726  VAL A CG1 1 
ATOM   5583  C  CG2 . VAL A  1  726 ? -4.308   4.117    237.603 1.00 99.15  ? 726  VAL A CG2 1 
ATOM   5584  N  N   . GLY A  1  727 ? -4.932   1.622    233.816 1.00 94.68  ? 727  GLY A N   1 
ATOM   5585  C  CA  . GLY A  1  727 ? -5.420   0.523    233.006 1.00 93.96  ? 727  GLY A CA  1 
ATOM   5586  C  C   . GLY A  1  727 ? -4.279   -0.303   232.444 1.00 93.17  ? 727  GLY A C   1 
ATOM   5587  O  O   . GLY A  1  727 ? -4.210   -1.509   232.670 1.00 93.57  ? 727  GLY A O   1 
ATOM   5588  N  N   . VAL A  1  728 ? -3.376   0.343    231.717 1.00 102.54 ? 728  VAL A N   1 
ATOM   5589  C  CA  . VAL A  1  728 ? -2.253   -0.362   231.113 1.00 101.82 ? 728  VAL A CA  1 
ATOM   5590  C  C   . VAL A  1  728 ? -1.312   -0.898   232.189 1.00 102.90 ? 728  VAL A C   1 
ATOM   5591  O  O   . VAL A  1  728 ? -0.669   -1.929   232.000 1.00 104.45 ? 728  VAL A O   1 
ATOM   5592  C  CB  . VAL A  1  728 ? -1.468   0.543    230.136 1.00 100.66 ? 728  VAL A CB  1 
ATOM   5593  C  CG1 . VAL A  1  728 ? -0.755   1.670    230.878 1.00 101.25 ? 728  VAL A CG1 1 
ATOM   5594  C  CG2 . VAL A  1  728 ? -0.473   -0.282   229.332 1.00 99.88  ? 728  VAL A CG2 1 
ATOM   5595  N  N   . ALA A  1  729 ? -1.237   -0.198   233.318 1.00 93.65  ? 729  ALA A N   1 
ATOM   5596  C  CA  . ALA A  1  729 ? -0.329   -0.583   234.393 1.00 94.84  ? 729  ALA A CA  1 
ATOM   5597  C  C   . ALA A  1  729 ? -0.679   -1.962   234.948 1.00 95.75  ? 729  ALA A C   1 
ATOM   5598  O  O   . ALA A  1  729 ? 0.211    -2.754   235.254 1.00 96.21  ? 729  ALA A O   1 
ATOM   5599  C  CB  . ALA A  1  729 ? -0.350   0.458    235.504 1.00 96.04  ? 729  ALA A CB  1 
ATOM   5600  N  N   . HIS A  1  730 ? -1.973   -2.243   235.079 1.00 96.11  ? 730  HIS A N   1 
ATOM   5601  C  CA  . HIS A  1  730 ? -2.426   -3.534   235.595 1.00 97.09  ? 730  HIS A CA  1 
ATOM   5602  C  C   . HIS A  1  730 ? -2.444   -4.608   234.517 1.00 96.07  ? 730  HIS A C   1 
ATOM   5603  O  O   . HIS A  1  730 ? -2.081   -5.757   234.771 1.00 96.68  ? 730  HIS A O   1 
ATOM   5604  C  CB  . HIS A  1  730 ? -3.821   -3.416   236.205 1.00 98.07  ? 730  HIS A CB  1 
ATOM   5605  C  CG  . HIS A  1  730 ? -3.885   -2.514   237.393 1.00 99.41  ? 730  HIS A CG  1 
ATOM   5606  N  ND1 . HIS A  1  730 ? -5.026   -2.359   238.149 1.00 100.64 ? 730  HIS A ND1 1 
ATOM   5607  C  CD2 . HIS A  1  730 ? -2.945   -1.724   237.961 1.00 99.83  ? 730  HIS A CD2 1 
ATOM   5608  C  CE1 . HIS A  1  730 ? -4.788   -1.508   239.129 1.00 101.77 ? 730  HIS A CE1 1 
ATOM   5609  N  NE2 . HIS A  1  730 ? -3.532   -1.107   239.037 1.00 101.30 ? 730  HIS A NE2 1 
ATOM   5610  N  N   . TYR A  1  731 ? -2.872   -4.229   233.318 1.00 94.64  ? 731  TYR A N   1 
ATOM   5611  C  CA  . TYR A  1  731 ? -2.967   -5.170   232.211 1.00 93.69  ? 731  TYR A CA  1 
ATOM   5612  C  C   . TYR A  1  731 ? -1.601   -5.782   231.928 1.00 93.38  ? 731  TYR A C   1 
ATOM   5613  O  O   . TYR A  1  731 ? -1.485   -6.989   231.716 1.00 93.55  ? 731  TYR A O   1 
ATOM   5614  C  CB  . TYR A  1  731 ? -3.513   -4.480   230.960 1.00 92.26  ? 731  TYR A CB  1 
ATOM   5615  C  CG  . TYR A  1  731 ? -3.862   -5.427   229.833 1.00 91.46  ? 731  TYR A CG  1 
ATOM   5616  C  CD1 . TYR A  1  731 ? -2.874   -5.943   229.005 1.00 90.65  ? 731  TYR A CD1 1 
ATOM   5617  C  CD2 . TYR A  1  731 ? -5.181   -5.784   229.580 1.00 91.58  ? 731  TYR A CD2 1 
ATOM   5618  C  CE1 . TYR A  1  731 ? -3.185   -6.802   227.972 1.00 90.03  ? 731  TYR A CE1 1 
ATOM   5619  C  CE2 . TYR A  1  731 ? -5.502   -6.641   228.546 1.00 90.95  ? 731  TYR A CE2 1 
ATOM   5620  C  CZ  . TYR A  1  731 ? -4.500   -7.146   227.745 1.00 90.18  ? 731  TYR A CZ  1 
ATOM   5621  O  OH  . TYR A  1  731 ? -4.813   -7.998   226.713 1.00 89.66  ? 731  TYR A OH  1 
ATOM   5622  N  N   . LEU A  1  732 ? -0.569   -4.946   231.926 1.00 93.03  ? 732  LEU A N   1 
ATOM   5623  C  CA  . LEU A  1  732 ? 0.784    -5.422   231.671 1.00 92.81  ? 732  LEU A CA  1 
ATOM   5624  C  C   . LEU A  1  732 ? 1.353    -6.149   232.879 1.00 94.34  ? 732  LEU A C   1 
ATOM   5625  O  O   . LEU A  1  732 ? 2.192    -7.036   232.728 1.00 94.48  ? 732  LEU A O   1 
ATOM   5626  C  CB  . LEU A  1  732 ? 1.708    -4.267   231.281 1.00 92.06  ? 732  LEU A CB  1 
ATOM   5627  C  CG  . LEU A  1  732 ? 1.420    -3.530   229.971 1.00 90.57  ? 732  LEU A CG  1 
ATOM   5628  C  CD1 . LEU A  1  732 ? 2.671    -2.790   229.522 1.00 89.99  ? 732  LEU A CD1 1 
ATOM   5629  C  CD2 . LEU A  1  732 ? 0.920    -4.464   228.875 1.00 89.77  ? 732  LEU A CD2 1 
ATOM   5630  N  N   . LEU A  1  733 ? 0.916    -5.772   234.075 1.00 96.31  ? 733  LEU A N   1 
ATOM   5631  C  CA  . LEU A  1  733 ? 1.350    -6.477   235.272 1.00 97.96  ? 733  LEU A CA  1 
ATOM   5632  C  C   . LEU A  1  733 ? 0.873    -7.921   235.193 1.00 98.43  ? 733  LEU A C   1 
ATOM   5633  O  O   . LEU A  1  733 ? 1.671    -8.835   234.991 1.00 98.55  ? 733  LEU A O   1 
ATOM   5634  C  CB  . LEU A  1  733 ? 0.826    -5.813   236.546 1.00 99.35  ? 733  LEU A CB  1 
ATOM   5635  C  CG  . LEU A  1  733 ? 1.296    -6.514   237.827 1.00 101.25 ? 733  LEU A CG  1 
ATOM   5636  C  CD1 . LEU A  1  733 ? 2.777    -6.251   238.064 1.00 101.46 ? 733  LEU A CD1 1 
ATOM   5637  C  CD2 . LEU A  1  733 ? 0.473    -6.092   239.027 1.00 102.79 ? 733  LEU A CD2 1 
ATOM   5638  N  N   . GLY A  1  734 ? -0.434   -8.110   235.356 1.00 98.08  ? 734  GLY A N   1 
ATOM   5639  C  CA  . GLY A  1  734 ? -1.038   -9.431   235.345 1.00 98.70  ? 734  GLY A CA  1 
ATOM   5640  C  C   . GLY A  1  734 ? -0.628   -10.258  234.146 1.00 97.60  ? 734  GLY A C   1 
ATOM   5641  O  O   . GLY A  1  734 ? -0.366   -11.455  234.265 1.00 98.33  ? 734  GLY A O   1 
ATOM   5642  N  N   . GLY A  1  735 ? -0.576   -9.614   232.985 1.00 99.91  ? 735  GLY A N   1 
ATOM   5643  C  CA  . GLY A  1  735 ? -0.167   -10.277  231.762 1.00 98.84  ? 735  GLY A CA  1 
ATOM   5644  C  C   . GLY A  1  735 ? 1.221    -10.882  231.857 1.00 99.18  ? 735  GLY A C   1 
ATOM   5645  O  O   . GLY A  1  735 ? 1.522    -11.857  231.169 1.00 98.95  ? 735  GLY A O   1 
ATOM   5646  N  N   . ILE A  1  736 ? 2.067    -10.303  232.704 1.00 100.89 ? 736  ILE A N   1 
ATOM   5647  C  CA  . ILE A  1  736 ? 3.438    -10.777  232.867 1.00 101.34 ? 736  ILE A CA  1 
ATOM   5648  C  C   . ILE A  1  736 ? 3.595    -11.610  234.141 1.00 103.25 ? 736  ILE A C   1 
ATOM   5649  O  O   . ILE A  1  736 ? 4.428    -12.514  234.185 1.00 103.86 ? 736  ILE A O   1 
ATOM   5650  C  CB  . ILE A  1  736 ? 4.431    -9.596   232.864 1.00 100.82 ? 736  ILE A CB  1 
ATOM   5651  C  CG1 . ILE A  1  736 ? 4.404    -8.930   231.483 1.00 99.02  ? 736  ILE A CG1 1 
ATOM   5652  C  CG2 . ILE A  1  736 ? 5.845    -10.067  233.216 1.00 101.58 ? 736  ILE A CG2 1 
ATOM   5653  C  CD1 . ILE A  1  736 ? 5.292    -7.715   231.335 1.00 98.45  ? 736  ILE A CD1 1 
ATOM   5654  N  N   . VAL A  1  737 ? 2.799    -11.319  235.168 1.00 99.26  ? 737  VAL A N   1 
ATOM   5655  C  CA  . VAL A  1  737 ? 2.755    -12.181  236.347 1.00 101.22 ? 737  VAL A CA  1 
ATOM   5656  C  C   . VAL A  1  737 ? 2.353    -13.583  235.924 1.00 101.51 ? 737  VAL A C   1 
ATOM   5657  O  O   . VAL A  1  737 ? 2.943    -14.571  236.362 1.00 102.71 ? 737  VAL A O   1 
ATOM   5658  C  CB  . VAL A  1  737 ? 1.757    -11.682  237.417 1.00 102.35 ? 737  VAL A CB  1 
ATOM   5659  C  CG1 . VAL A  1  737 ? 1.682    -12.676  238.579 1.00 104.51 ? 737  VAL A CG1 1 
ATOM   5660  C  CG2 . VAL A  1  737 ? 2.169    -10.335  237.950 1.00 102.35 ? 737  VAL A CG2 1 
ATOM   5661  N  N   . THR A  1  738 ? 1.335    -13.652  235.073 1.00 116.91 ? 738  THR A N   1 
ATOM   5662  C  CA  . THR A  1  738 ? 0.821    -14.922  234.578 1.00 117.13 ? 738  THR A CA  1 
ATOM   5663  C  C   . THR A  1  738 ? 1.925    -15.721  233.898 1.00 116.83 ? 738  THR A C   1 
ATOM   5664  O  O   . THR A  1  738 ? 2.173    -16.875  234.246 1.00 118.07 ? 738  THR A O   1 
ATOM   5665  C  CB  . THR A  1  738 ? -0.338   -14.710  233.585 1.00 115.87 ? 738  THR A CB  1 
ATOM   5666  O  OG1 . THR A  1  738 ? -1.326   -13.852  234.170 1.00 116.11 ? 738  THR A OG1 1 
ATOM   5667  C  CG2 . THR A  1  738 ? -0.982   -16.038  233.213 1.00 116.39 ? 738  THR A CG2 1 
ATOM   5668  N  N   . THR A  1  739 ? 2.583    -15.100  232.926 1.00 98.86  ? 739  THR A N   1 
ATOM   5669  C  CA  . THR A  1  739 ? 3.665    -15.752  232.201 1.00 98.53  ? 739  THR A CA  1 
ATOM   5670  C  C   . THR A  1  739 ? 4.826    -16.079  233.133 1.00 99.89  ? 739  THR A C   1 
ATOM   5671  O  O   . THR A  1  739 ? 5.418    -17.154  233.044 1.00 100.62 ? 739  THR A O   1 
ATOM   5672  C  CB  . THR A  1  739 ? 4.180    -14.881  231.047 1.00 96.74  ? 739  THR A CB  1 
ATOM   5673  O  OG1 . THR A  1  739 ? 3.169    -13.943  230.660 1.00 95.68  ? 739  THR A OG1 1 
ATOM   5674  C  CG2 . THR A  1  739 ? 4.537    -15.750  229.866 1.00 96.13  ? 739  THR A CG2 1 
ATOM   5675  N  N   . TRP A  1  740 ? 5.153    -15.140  234.016 1.00 100.31 ? 740  TRP A N   1 
ATOM   5676  C  CA  . TRP A  1  740 ? 6.238    -15.321  234.974 1.00 101.71 ? 740  TRP A CA  1 
ATOM   5677  C  C   . TRP A  1  740 ? 6.076    -16.594  235.799 1.00 103.62 ? 740  TRP A C   1 
ATOM   5678  O  O   . TRP A  1  740 ? 7.029    -17.350  235.974 1.00 104.54 ? 740  TRP A O   1 
ATOM   5679  C  CB  . TRP A  1  740 ? 6.329    -14.115  235.909 1.00 102.09 ? 740  TRP A CB  1 
ATOM   5680  C  CG  . TRP A  1  740 ? 7.392    -14.259  236.946 1.00 103.68 ? 740  TRP A CG  1 
ATOM   5681  C  CD1 . TRP A  1  740 ? 8.735    -14.102  236.772 1.00 103.60 ? 740  TRP A CD1 1 
ATOM   5682  C  CD2 . TRP A  1  740 ? 7.201    -14.592  238.325 1.00 105.72 ? 740  TRP A CD2 1 
ATOM   5683  N  NE1 . TRP A  1  740 ? 9.394    -14.318  237.959 1.00 105.45 ? 740  TRP A NE1 1 
ATOM   5684  C  CE2 . TRP A  1  740 ? 8.473    -14.620  238.928 1.00 106.80 ? 740  TRP A CE2 1 
ATOM   5685  C  CE3 . TRP A  1  740 ? 6.077    -14.869  239.109 1.00 106.85 ? 740  TRP A CE3 1 
ATOM   5686  C  CZ2 . TRP A  1  740 ? 8.653    -14.913  240.278 1.00 108.97 ? 740  TRP A CZ2 1 
ATOM   5687  C  CZ3 . TRP A  1  740 ? 6.259    -15.158  240.449 1.00 109.01 ? 740  TRP A CZ3 1 
ATOM   5688  C  CH2 . TRP A  1  740 ? 7.535    -15.178  241.019 1.00 110.05 ? 740  TRP A CH2 1 
ATOM   5689  N  N   . ALA A  1  741 ? 4.870    -16.826  236.305 1.00 111.14 ? 741  ALA A N   1 
ATOM   5690  C  CA  . ALA A  1  741 ? 4.594    -18.022  237.094 1.00 113.07 ? 741  ALA A CA  1 
ATOM   5691  C  C   . ALA A  1  741 ? 4.550    -19.261  236.208 1.00 112.90 ? 741  ALA A C   1 
ATOM   5692  O  O   . ALA A  1  741 ? 5.064    -20.319  236.576 1.00 119.57 ? 741  ALA A O   1 
ATOM   5693  C  CB  . ALA A  1  741 ? 3.287    -17.870  237.847 1.00 113.90 ? 741  ALA A CB  1 
ATOM   5694  N  N   . PHE A  1  742 ? 3.937    -19.121  235.038 1.00 104.42 ? 742  PHE A N   1 
ATOM   5695  C  CA  . PHE A  1  742 ? 3.823    -20.223  234.090 1.00 104.18 ? 742  PHE A CA  1 
ATOM   5696  C  C   . PHE A  1  742 ? 5.188    -20.710  233.612 1.00 104.13 ? 742  PHE A C   1 
ATOM   5697  O  O   . PHE A  1  742 ? 5.412    -21.912  233.486 1.00 105.08 ? 742  PHE A O   1 
ATOM   5698  C  CB  . PHE A  1  742 ? 2.967    -19.801  232.897 1.00 102.37 ? 742  PHE A CB  1 
ATOM   5699  C  CG  . PHE A  1  742 ? 3.222    -20.598  231.653 1.00 101.66 ? 742  PHE A CG  1 
ATOM   5700  C  CD1 . PHE A  1  742 ? 2.852    -21.930  231.575 1.00 102.74 ? 742  PHE A CD1 1 
ATOM   5701  C  CD2 . PHE A  1  742 ? 3.816    -20.008  230.552 1.00 100.01 ? 742  PHE A CD2 1 
ATOM   5702  C  CE1 . PHE A  1  742 ? 3.078    -22.659  230.424 1.00 102.18 ? 742  PHE A CE1 1 
ATOM   5703  C  CE2 . PHE A  1  742 ? 4.046    -20.730  229.398 1.00 99.46  ? 742  PHE A CE2 1 
ATOM   5704  C  CZ  . PHE A  1  742 ? 3.677    -22.059  229.333 1.00 100.54 ? 742  PHE A CZ  1 
ATOM   5705  N  N   . PHE A  1  743 ? 6.096    -19.779  233.343 1.00 103.13 ? 743  PHE A N   1 
ATOM   5706  C  CA  . PHE A  1  743 ? 7.430    -20.138  232.876 1.00 103.09 ? 743  PHE A CA  1 
ATOM   5707  C  C   . PHE A  1  743 ? 8.257    -20.800  233.969 1.00 105.10 ? 743  PHE A C   1 
ATOM   5708  O  O   . PHE A  1  743 ? 8.944    -21.788  233.717 1.00 105.83 ? 743  PHE A O   1 
ATOM   5709  C  CB  . PHE A  1  743 ? 8.173    -18.901  232.351 1.00 101.61 ? 743  PHE A CB  1 
ATOM   5710  C  CG  . PHE A  1  743 ? 7.930    -18.592  230.890 1.00 99.74  ? 743  PHE A CG  1 
ATOM   5711  C  CD1 . PHE A  1  743 ? 7.365    -19.524  230.028 1.00 99.50  ? 743  PHE A CD1 1 
ATOM   5712  C  CD2 . PHE A  1  743 ? 8.299    -17.360  230.374 1.00 98.34  ? 743  PHE A CD2 1 
ATOM   5713  C  CE1 . PHE A  1  743 ? 7.164    -19.223  228.695 1.00 97.91  ? 743  PHE A CE1 1 
ATOM   5714  C  CE2 . PHE A  1  743 ? 8.098    -17.059  229.042 1.00 96.76  ? 743  PHE A CE2 1 
ATOM   5715  C  CZ  . PHE A  1  743 ? 7.531    -17.991  228.202 1.00 96.55  ? 743  PHE A CZ  1 
ATOM   5716  N  N   . LEU A  1  744 ? 8.201    -20.257  235.179 1.00 106.09 ? 744  LEU A N   1 
ATOM   5717  C  CA  . LEU A  1  744 ? 8.985    -20.801  236.279 1.00 108.13 ? 744  LEU A CA  1 
ATOM   5718  C  C   . LEU A  1  744 ? 8.493    -22.189  236.664 1.00 109.80 ? 744  LEU A C   1 
ATOM   5719  O  O   . LEU A  1  744 ? 9.284    -23.125  236.744 1.00 110.97 ? 744  LEU A O   1 
ATOM   5720  C  CB  . LEU A  1  744 ? 8.938    -19.863  237.486 1.00 108.90 ? 744  LEU A CB  1 
ATOM   5721  C  CG  . LEU A  1  744 ? 10.040   -18.800  237.547 1.00 108.35 ? 744  LEU A CG  1 
ATOM   5722  C  CD1 . LEU A  1  744 ? 11.305   -19.397  238.136 1.00 109.98 ? 744  LEU A CD1 1 
ATOM   5723  C  CD2 . LEU A  1  744 ? 10.332   -18.199  236.173 1.00 106.13 ? 744  LEU A CD2 1 
ATOM   5724  N  N   . ALA A  1  745 ? 7.190    -22.322  236.883 1.00 148.34 ? 745  ALA A N   1 
ATOM   5725  C  CA  . ALA A  1  745 ? 6.602    -23.608  237.246 1.00 168.87 ? 745  ALA A CA  1 
ATOM   5726  C  C   . ALA A  1  745 ? 6.896    -24.668  236.187 1.00 182.43 ? 745  ALA A C   1 
ATOM   5727  O  O   . ALA A  1  745 ? 7.144    -25.830  236.512 1.00 188.12 ? 745  ALA A O   1 
ATOM   5728  C  CB  . ALA A  1  745 ? 5.103    -23.464  237.445 1.00 170.34 ? 745  ALA A CB  1 
ATOM   5729  N  N   . ARG A  1  746 ? 6.863    -24.263  234.922 1.00 109.29 ? 746  ARG A N   1 
ATOM   5730  C  CA  . ARG A  1  746 ? 7.134    -25.174  233.816 1.00 108.90 ? 746  ARG A CA  1 
ATOM   5731  C  C   . ARG A  1  746 ? 8.605    -25.562  233.743 1.00 109.50 ? 746  ARG A C   1 
ATOM   5732  O  O   . ARG A  1  746 ? 8.940    -26.741  233.646 1.00 110.72 ? 746  ARG A O   1 
ATOM   5733  C  CB  . ARG A  1  746 ? 6.703    -24.540  232.489 1.00 106.63 ? 746  ARG A CB  1 
ATOM   5734  C  CG  . ARG A  1  746 ? 7.166    -25.291  231.243 1.00 106.08 ? 746  ARG A CG  1 
ATOM   5735  C  CD  . ARG A  1  746 ? 6.681    -26.731  231.243 1.00 107.53 ? 746  ARG A CD  1 
ATOM   5736  N  NE  . ARG A  1  746 ? 7.163    -27.472  230.081 1.00 107.18 ? 746  ARG A NE  1 
ATOM   5737  C  CZ  . ARG A  1  746 ? 6.715    -28.670  229.720 1.00 108.09 ? 746  ARG A CZ  1 
ATOM   5738  N  NH1 . ARG A  1  746 ? 5.770    -29.272  230.430 1.00 109.40 ? 746  ARG A NH1 1 
ATOM   5739  N  NH2 . ARG A  1  746 ? 7.213    -29.272  228.648 1.00 107.80 ? 746  ARG A NH2 1 
ATOM   5740  N  N   . SER A  1  747 ? 9.479    -24.564  233.791 1.00 109.03 ? 747  SER A N   1 
ATOM   5741  C  CA  . SER A  1  747 ? 10.902   -24.791  233.580 1.00 109.39 ? 747  SER A CA  1 
ATOM   5742  C  C   . SER A  1  747 ? 11.559   -25.490  234.767 1.00 111.75 ? 747  SER A C   1 
ATOM   5743  O  O   . SER A  1  747 ? 12.482   -26.283  234.589 1.00 112.67 ? 747  SER A O   1 
ATOM   5744  C  CB  . SER A  1  747 ? 11.609   -23.468  233.301 1.00 107.95 ? 747  SER A CB  1 
ATOM   5745  O  OG  . SER A  1  747 ? 11.503   -22.586  234.405 1.00 108.38 ? 747  SER A OG  1 
ATOM   5746  N  N   . LEU A  1  748 ? 11.091   -25.194  235.975 1.00 112.51 ? 748  LEU A N   1 
ATOM   5747  C  CA  . LEU A  1  748 ? 11.623   -25.838  237.175 1.00 114.94 ? 748  LEU A CA  1 
ATOM   5748  C  C   . LEU A  1  748 ? 11.241   -27.317  237.241 1.00 116.55 ? 748  LEU A C   1 
ATOM   5749  O  O   . LEU A  1  748 ? 12.004   -28.136  237.754 1.00 118.42 ? 748  LEU A O   1 
ATOM   5750  C  CB  . LEU A  1  748 ? 11.133   -25.116  238.437 1.00 115.77 ? 748  LEU A CB  1 
ATOM   5751  C  CG  . LEU A  1  748 ? 12.091   -24.153  239.154 1.00 116.08 ? 748  LEU A CG  1 
ATOM   5752  C  CD1 . LEU A  1  748 ? 13.008   -23.388  238.205 1.00 114.27 ? 748  LEU A CD1 1 
ATOM   5753  C  CD2 . LEU A  1  748 ? 11.287   -23.171  239.997 1.00 116.08 ? 748  LEU A CD2 1 
ATOM   5754  N  N   . SER A  1  749 ? 10.063   -27.655  236.727 1.00 158.98 ? 749  SER A N   1 
ATOM   5755  C  CA  . SER A  1  749 ? 9.567    -29.027  236.798 1.00 159.56 ? 749  SER A CA  1 
ATOM   5756  C  C   . SER A  1  749 ? 10.199   -29.927  235.741 1.00 159.40 ? 749  SER A C   1 
ATOM   5757  O  O   . SER A  1  749 ? 10.259   -31.145  235.916 1.00 161.16 ? 749  SER A O   1 
ATOM   5758  C  CB  . SER A  1  749 ? 8.045    -29.056  236.642 1.00 159.06 ? 749  SER A CB  1 
ATOM   5759  O  OG  . SER A  1  749 ? 7.403    -28.401  237.721 1.00 159.65 ? 749  SER A OG  1 
ATOM   5760  N  N   . ILE A  1  750 ? 10.673   -29.329  234.651 1.00 115.35 ? 750  ILE A N   1 
ATOM   5761  C  CA  . ILE A  1  750 ? 11.216   -30.098  233.535 1.00 115.07 ? 750  ILE A CA  1 
ATOM   5762  C  C   . ILE A  1  750 ? 12.714   -30.335  233.703 1.00 116.04 ? 750  ILE A C   1 
ATOM   5763  O  O   . ILE A  1  750 ? 13.240   -31.356  233.258 1.00 116.96 ? 750  ILE A O   1 
ATOM   5764  C  CB  . ILE A  1  750 ? 10.944   -29.387  232.180 1.00 112.55 ? 750  ILE A CB  1 
ATOM   5765  C  CG1 . ILE A  1  750 ? 10.837   -30.413  231.051 1.00 112.50 ? 750  ILE A CG1 1 
ATOM   5766  C  CG2 . ILE A  1  750 ? 12.016   -28.337  231.858 1.00 111.29 ? 750  ILE A CG2 1 
ATOM   5767  C  CD1 . ILE A  1  750 ? 9.515    -31.152  231.023 1.00 113.03 ? 750  ILE A CD1 1 
ATOM   5768  N  N   . GLY A  1  751 ? 13.392   -29.392  234.351 1.00 194.35 ? 751  GLY A N   1 
ATOM   5769  C  CA  . GLY A  1  751 ? 14.822   -29.492  234.583 1.00 213.18 ? 751  GLY A CA  1 
ATOM   5770  C  C   . GLY A  1  751 ? 15.545   -28.195  234.275 1.00 231.07 ? 751  GLY A C   1 
ATOM   5771  O  O   . GLY A  1  751 ? 16.535   -28.183  233.544 1.00 243.10 ? 751  GLY A O   1 
ATOM   5772  O  OXT . GLY A  1  751 ? 15.161   -27.124  234.743 1.00 232.77 ? 751  GLY A OXT 1 
ATOM   5773  N  N   . THR B  2  3   ? -34.578  10.163   197.025 1.00 215.17 ? 3    THR B N   1 
ATOM   5774  C  CA  . THR B  2  3   ? -34.474  9.768    198.425 1.00 229.21 ? 3    THR B CA  1 
ATOM   5775  C  C   . THR B  2  3   ? -33.136  9.090    198.696 1.00 238.02 ? 3    THR B C   1 
ATOM   5776  O  O   . THR B  2  3   ? -32.929  7.934    198.326 1.00 246.21 ? 3    THR B O   1 
ATOM   5777  C  CB  . THR B  2  3   ? -35.622  8.815    198.835 1.00 223.08 ? 3    THR B CB  1 
ATOM   5778  O  OG1 . THR B  2  3   ? -36.859  9.538    198.873 1.00 235.74 ? 3    THR B OG1 1 
ATOM   5779  C  CG2 . THR B  2  3   ? -35.364  8.182    200.207 1.00 199.67 ? 3    THR B CG2 1 
ATOM   5780  N  N   . LYS B  2  4   ? -32.227  9.821    199.330 1.00 171.00 ? 4    LYS B N   1 
ATOM   5781  C  CA  . LYS B  2  4   ? -30.995  9.240    199.844 1.00 159.62 ? 4    LYS B CA  1 
ATOM   5782  C  C   . LYS B  2  4   ? -31.365  8.246    200.941 1.00 153.68 ? 4    LYS B C   1 
ATOM   5783  O  O   . LYS B  2  4   ? -32.475  8.296    201.473 1.00 157.56 ? 4    LYS B O   1 
ATOM   5784  C  CB  . LYS B  2  4   ? -30.069  10.336   200.381 1.00 139.25 ? 4    LYS B CB  1 
ATOM   5785  C  CG  . LYS B  2  4   ? -28.627  9.920    200.662 1.00 137.65 ? 4    LYS B CG  1 
ATOM   5786  C  CD  . LYS B  2  4   ? -27.726  10.120   199.446 1.00 141.06 ? 4    LYS B CD  1 
ATOM   5787  C  CE  . LYS B  2  4   ? -26.332  10.562   199.869 1.00 139.95 ? 4    LYS B CE  1 
ATOM   5788  N  NZ  . LYS B  2  4   ? -25.424  10.794   198.713 1.00 136.04 ? 4    LYS B NZ  1 
ATOM   5789  N  N   . PHE B  2  5   ? -30.444  7.353    201.288 1.00 97.00  ? 5    PHE B N   1 
ATOM   5790  C  CA  . PHE B  2  5   ? -30.664  6.422    202.391 1.00 96.66  ? 5    PHE B CA  1 
ATOM   5791  C  C   . PHE B  2  5   ? -30.803  7.266    203.683 1.00 96.71  ? 5    PHE B C   1 
ATOM   5792  O  O   . PHE B  2  5   ? -30.703  8.492    203.625 1.00 96.98  ? 5    PHE B O   1 
ATOM   5793  C  CB  . PHE B  2  5   ? -29.532  5.381    202.422 1.00 95.34  ? 5    PHE B CB  1 
ATOM   5794  C  CG  . PHE B  2  5   ? -29.705  4.296    203.441 1.00 95.08  ? 5    PHE B CG  1 
ATOM   5795  C  CD1 . PHE B  2  5   ? -30.953  3.774    203.734 1.00 96.16  ? 5    PHE B CD1 1 
ATOM   5796  C  CD2 . PHE B  2  5   ? -28.600  3.796    204.111 1.00 93.86  ? 5    PHE B CD2 1 
ATOM   5797  C  CE1 . PHE B  2  5   ? -31.092  2.783    204.684 1.00 96.02  ? 5    PHE B CE1 1 
ATOM   5798  C  CE2 . PHE B  2  5   ? -28.733  2.811    205.059 1.00 93.72  ? 5    PHE B CE2 1 
ATOM   5799  C  CZ  . PHE B  2  5   ? -29.976  2.300    205.345 1.00 94.81  ? 5    PHE B CZ  1 
ATOM   5800  N  N   . PRO B  2  6   ? -30.963  6.629    204.853 1.00 102.46 ? 6    PRO B N   1 
ATOM   5801  C  CA  . PRO B  2  6   ? -31.955  7.123    205.809 1.00 103.46 ? 6    PRO B CA  1 
ATOM   5802  C  C   . PRO B  2  6   ? -32.998  8.071    205.205 1.00 104.87 ? 6    PRO B C   1 
ATOM   5803  O  O   . PRO B  2  6   ? -32.838  9.291    205.248 1.00 105.08 ? 6    PRO B O   1 
ATOM   5804  C  CB  . PRO B  2  6   ? -31.090  7.837    206.859 1.00 102.69 ? 6    PRO B CB  1 
ATOM   5805  C  CG  . PRO B  2  6   ? -29.692  7.273    206.680 1.00 101.19 ? 6    PRO B CG  1 
ATOM   5806  C  CD  . PRO B  2  6   ? -29.752  6.245    205.591 1.00 101.10 ? 6    PRO B CD  1 
ATOM   5807  N  N   . LYS B  2  7   ? -34.059  7.504    204.638 1.00 111.76 ? 7    LYS B N   1 
ATOM   5808  C  CA  . LYS B  2  7   ? -35.197  8.303    204.205 1.00 113.31 ? 7    LYS B CA  1 
ATOM   5809  C  C   . LYS B  2  7   ? -35.826  8.957    205.429 1.00 114.06 ? 7    LYS B C   1 
ATOM   5810  O  O   . LYS B  2  7   ? -36.360  10.063   205.359 1.00 115.06 ? 7    LYS B O   1 
ATOM   5811  C  CB  . LYS B  2  7   ? -36.230  7.440    203.474 1.00 114.38 ? 7    LYS B CB  1 
ATOM   5812  C  CG  . LYS B  2  7   ? -37.456  8.209    202.980 1.00 116.14 ? 7    LYS B CG  1 
ATOM   5813  C  CD  . LYS B  2  7   ? -38.659  7.300    202.808 1.00 117.38 ? 7    LYS B CD  1 
ATOM   5814  C  CE  . LYS B  2  7   ? -39.263  6.939    204.159 1.00 117.77 ? 7    LYS B CE  1 
ATOM   5815  N  NZ  . LYS B  2  7   ? -40.495  6.122    204.030 1.00 119.17 ? 7    LYS B NZ  1 
ATOM   5816  N  N   . PHE B  2  8   ? -35.737  8.256    206.554 1.00 108.15 ? 8    PHE B N   1 
ATOM   5817  C  CA  . PHE B  2  8   ? -36.388  8.669    207.792 1.00 108.99 ? 8    PHE B CA  1 
ATOM   5818  C  C   . PHE B  2  8   ? -35.635  9.745    208.578 1.00 108.47 ? 8    PHE B C   1 
ATOM   5819  O  O   . PHE B  2  8   ? -36.074  10.140   209.658 1.00 109.17 ? 8    PHE B O   1 
ATOM   5820  C  CB  . PHE B  2  8   ? -36.581  7.444    208.686 1.00 108.89 ? 8    PHE B CB  1 
ATOM   5821  C  CG  . PHE B  2  8   ? -35.292  6.794    209.103 1.00 107.26 ? 8    PHE B CG  1 
ATOM   5822  C  CD1 . PHE B  2  8   ? -34.593  7.254    210.206 1.00 106.68 ? 8    PHE B CD1 1 
ATOM   5823  C  CD2 . PHE B  2  8   ? -34.772  5.732    208.382 1.00 106.42 ? 8    PHE B CD2 1 
ATOM   5824  C  CE1 . PHE B  2  8   ? -33.406  6.664    210.587 1.00 105.28 ? 8    PHE B CE1 1 
ATOM   5825  C  CE2 . PHE B  2  8   ? -33.584  5.137    208.759 1.00 105.02 ? 8    PHE B CE2 1 
ATOM   5826  C  CZ  . PHE B  2  8   ? -32.900  5.604    209.863 1.00 104.45 ? 8    PHE B CZ  1 
ATOM   5827  N  N   . SER B  2  9   ? -34.507  10.215   208.052 1.00 132.50 ? 9    SER B N   1 
ATOM   5828  C  CA  . SER B  2  9   ? -33.703  11.211   208.758 1.00 131.99 ? 9    SER B CA  1 
ATOM   5829  C  C   . SER B  2  9   ? -32.851  12.038   207.799 1.00 131.42 ? 9    SER B C   1 
ATOM   5830  O  O   . SER B  2  9   ? -31.858  11.548   207.262 1.00 130.20 ? 9    SER B O   1 
ATOM   5831  C  CB  . SER B  2  9   ? -32.806  10.530   209.796 1.00 130.83 ? 9    SER B CB  1 
ATOM   5832  O  OG  . SER B  2  9   ? -32.079  11.487   210.547 1.00 130.49 ? 9    SER B OG  1 
ATOM   5833  N  N   . GLN B  2  10  ? -33.243  13.290   207.585 1.00 127.23 ? 10   GLN B N   1 
ATOM   5834  C  CA  . GLN B  2  10  ? -32.483  14.188   206.722 1.00 126.92 ? 10   GLN B CA  1 
ATOM   5835  C  C   . GLN B  2  10  ? -31.151  14.564   207.364 1.00 125.70 ? 10   GLN B C   1 
ATOM   5836  O  O   . GLN B  2  10  ? -30.191  14.892   206.668 1.00 124.98 ? 10   GLN B O   1 
ATOM   5837  C  CB  . GLN B  2  10  ? -33.282  15.457   206.415 1.00 128.46 ? 10   GLN B CB  1 
ATOM   5838  C  CG  . GLN B  2  10  ? -34.549  15.235   205.601 1.00 129.81 ? 10   GLN B CG  1 
ATOM   5839  C  CD  . GLN B  2  10  ? -35.222  16.540   205.215 1.00 150.73 ? 10   GLN B CD  1 
ATOM   5840  O  OE1 . GLN B  2  10  ? -34.745  17.622   205.558 1.00 157.69 ? 10   GLN B OE1 1 
ATOM   5841  N  NE2 . GLN B  2  10  ? -36.337  16.444   204.500 1.00 170.53 ? 10   GLN B NE2 1 
ATOM   5842  N  N   . ASP B  2  11  ? -31.102  14.518   208.693 1.00 134.26 ? 11   ASP B N   1 
ATOM   5843  C  CA  . ASP B  2  11  ? -29.873  14.801   209.429 1.00 133.21 ? 11   ASP B CA  1 
ATOM   5844  C  C   . ASP B  2  11  ? -28.750  13.865   209.002 1.00 135.40 ? 11   ASP B C   1 
ATOM   5845  O  O   . ASP B  2  11  ? -27.598  14.278   208.867 1.00 145.42 ? 11   ASP B O   1 
ATOM   5846  C  CB  . ASP B  2  11  ? -30.107  14.675   210.936 1.00 136.21 ? 11   ASP B CB  1 
ATOM   5847  C  CG  . ASP B  2  11  ? -30.984  15.783   211.489 1.00 146.85 ? 11   ASP B CG  1 
ATOM   5848  O  OD1 . ASP B  2  11  ? -30.872  16.931   211.011 1.00 154.11 ? 11   ASP B OD1 1 
ATOM   5849  O  OD2 . ASP B  2  11  ? -31.784  15.504   212.407 1.00 151.09 ? 11   ASP B OD2 1 
ATOM   5850  N  N   . LEU B  2  12  ? -29.099  12.600   208.791 1.00 100.48 ? 12   LEU B N   1 
ATOM   5851  C  CA  . LEU B  2  12  ? -28.126  11.585   208.410 1.00 99.15  ? 12   LEU B CA  1 
ATOM   5852  C  C   . LEU B  2  12  ? -27.880  11.588   206.907 1.00 98.98  ? 12   LEU B C   1 
ATOM   5853  O  O   . LEU B  2  12  ? -26.757  11.370   206.454 1.00 97.95  ? 12   LEU B O   1 
ATOM   5854  C  CB  . LEU B  2  12  ? -28.607  10.205   208.857 1.00 99.07  ? 12   LEU B CB  1 
ATOM   5855  C  CG  . LEU B  2  12  ? -28.778  10.033   210.367 1.00 99.26  ? 12   LEU B CG  1 
ATOM   5856  C  CD1 . LEU B  2  12  ? -29.409  8.686    210.676 1.00 99.46  ? 12   LEU B CD1 1 
ATOM   5857  C  CD2 . LEU B  2  12  ? -27.449  10.191   211.093 1.00 98.17  ? 12   LEU B CD2 1 
ATOM   5858  N  N   . ALA B  2  13  ? -28.939  11.832   206.143 1.00 96.12  ? 13   ALA B N   1 
ATOM   5859  C  CA  . ALA B  2  13  ? -28.860  11.831   204.687 1.00 96.25  ? 13   ALA B CA  1 
ATOM   5860  C  C   . ALA B  2  13  ? -27.841  12.846   204.177 1.00 95.87  ? 13   ALA B C   1 
ATOM   5861  O  O   . ALA B  2  13  ? -27.187  12.622   203.159 1.00 95.42  ? 13   ALA B O   1 
ATOM   5862  C  CB  . ALA B  2  13  ? -30.229  12.116   204.090 1.00 97.78  ? 13   ALA B CB  1 
ATOM   5863  N  N   . GLN B  2  14  ? -27.712  13.963   204.887 1.00 136.25 ? 14   GLN B N   1 
ATOM   5864  C  CA  . GLN B  2  14  ? -26.799  15.025   204.479 1.00 136.08 ? 14   GLN B CA  1 
ATOM   5865  C  C   . GLN B  2  14  ? -25.350  14.710   204.834 1.00 134.63 ? 14   GLN B C   1 
ATOM   5866  O  O   . GLN B  2  14  ? -24.429  15.306   204.275 1.00 134.33 ? 14   GLN B O   1 
ATOM   5867  C  CB  . GLN B  2  14  ? -27.199  16.349   205.127 1.00 137.06 ? 14   GLN B CB  1 
ATOM   5868  C  CG  . GLN B  2  14  ? -28.482  16.954   204.570 1.00 138.67 ? 14   GLN B CG  1 
ATOM   5869  C  CD  . GLN B  2  14  ? -28.393  18.456   204.360 1.00 139.60 ? 14   GLN B CD  1 
ATOM   5870  O  OE1 . GLN B  2  14  ? -27.343  18.987   203.994 1.00 151.33 ? 14   GLN B OE1 1 
ATOM   5871  N  NE2 . GLN B  2  14  ? -29.498  19.151   204.604 1.00 141.05 ? 14   GLN B NE2 1 
ATOM   5872  N  N   . ASP B  2  15  ? -25.152  13.782   205.765 1.00 135.34 ? 15   ASP B N   1 
ATOM   5873  C  CA  . ASP B  2  15  ? -23.808  13.394   206.179 1.00 137.86 ? 15   ASP B CA  1 
ATOM   5874  C  C   . ASP B  2  15  ? -23.023  12.862   204.980 1.00 123.51 ? 15   ASP B C   1 
ATOM   5875  O  O   . ASP B  2  15  ? -23.358  11.809   204.439 1.00 123.39 ? 15   ASP B O   1 
ATOM   5876  C  CB  . ASP B  2  15  ? -23.866  12.338   207.285 1.00 143.55 ? 15   ASP B CB  1 
ATOM   5877  C  CG  . ASP B  2  15  ? -22.572  12.249   208.075 1.00 139.92 ? 15   ASP B CG  1 
ATOM   5878  O  OD1 . ASP B  2  15  ? -21.493  12.479   207.490 1.00 140.48 ? 15   ASP B OD1 1 
ATOM   5879  O  OD2 . ASP B  2  15  ? -22.636  11.947   209.285 1.00 137.56 ? 15   ASP B OD2 1 
ATOM   5880  N  N   . PRO B  2  16  ? -21.971  13.585   204.559 1.00 126.74 ? 16   PRO B N   1 
ATOM   5881  C  CA  . PRO B  2  16  ? -21.248  13.176   203.352 1.00 128.35 ? 16   PRO B CA  1 
ATOM   5882  C  C   . PRO B  2  16  ? -20.257  12.046   203.612 1.00 124.86 ? 16   PRO B C   1 
ATOM   5883  O  O   . PRO B  2  16  ? -19.562  11.619   202.690 1.00 128.95 ? 16   PRO B O   1 
ATOM   5884  C  CB  . PRO B  2  16  ? -20.521  14.456   202.942 1.00 135.32 ? 16   PRO B CB  1 
ATOM   5885  C  CG  . PRO B  2  16  ? -20.232  15.132   204.235 1.00 130.62 ? 16   PRO B CG  1 
ATOM   5886  C  CD  . PRO B  2  16  ? -21.372  14.787   205.168 1.00 126.60 ? 16   PRO B CD  1 
ATOM   5887  N  N   . THR B  2  17  ? -20.203  11.569   204.853 1.00 93.76  ? 17   THR B N   1 
ATOM   5888  C  CA  . THR B  2  17  ? -19.227  10.561   205.248 1.00 92.67  ? 17   THR B CA  1 
ATOM   5889  C  C   . THR B  2  17  ? -19.856  9.175    205.330 1.00 92.57  ? 17   THR B C   1 
ATOM   5890  O  O   . THR B  2  17  ? -21.055  9.004    205.092 1.00 93.34  ? 17   THR B O   1 
ATOM   5891  C  CB  . THR B  2  17  ? -18.597  10.897   206.613 1.00 92.23  ? 17   THR B CB  1 
ATOM   5892  O  OG1 . THR B  2  17  ? -19.499  10.530   207.664 1.00 92.56  ? 17   THR B OG1 1 
ATOM   5893  C  CG2 . THR B  2  17  ? -18.279  12.384   206.713 1.00 92.64  ? 17   THR B CG2 1 
ATOM   5894  N  N   . THR B  2  18  ? -19.033  8.190    205.677 1.00 88.24  ? 18   THR B N   1 
ATOM   5895  C  CA  . THR B  2  18  ? -19.490  6.820    205.863 1.00 88.14  ? 18   THR B CA  1 
ATOM   5896  C  C   . THR B  2  18  ? -20.351  6.698    207.112 1.00 88.55  ? 18   THR B C   1 
ATOM   5897  O  O   . THR B  2  18  ? -21.057  5.706    207.297 1.00 89.85  ? 18   THR B O   1 
ATOM   5898  C  CB  . THR B  2  18  ? -18.310  5.847    205.986 1.00 87.20  ? 18   THR B CB  1 
ATOM   5899  O  OG1 . THR B  2  18  ? -17.452  6.264    207.055 1.00 86.69  ? 18   THR B OG1 1 
ATOM   5900  C  CG2 . THR B  2  18  ? -17.522  5.799    204.691 1.00 86.93  ? 18   THR B CG2 1 
ATOM   5901  N  N   . ARG B  2  19  ? -20.283  7.713    207.968 1.00 87.71  ? 19   ARG B N   1 
ATOM   5902  C  CA  . ARG B  2  19  ? -21.036  7.725    209.213 1.00 88.22  ? 19   ARG B CA  1 
ATOM   5903  C  C   . ARG B  2  19  ? -22.530  7.645    208.930 1.00 89.25  ? 19   ARG B C   1 
ATOM   5904  O  O   . ARG B  2  19  ? -23.310  7.245    209.790 1.00 89.77  ? 19   ARG B O   1 
ATOM   5905  C  CB  . ARG B  2  19  ? -20.721  8.989    210.014 1.00 88.39  ? 19   ARG B CB  1 
ATOM   5906  C  CG  . ARG B  2  19  ? -21.063  8.887    211.484 1.00 88.74  ? 19   ARG B CG  1 
ATOM   5907  C  CD  . ARG B  2  19  ? -20.953  10.234   212.174 1.00 89.19  ? 19   ARG B CD  1 
ATOM   5908  N  NE  . ARG B  2  19  ? -22.034  11.130   211.764 1.00 90.21  ? 19   ARG B NE  1 
ATOM   5909  C  CZ  . ARG B  2  19  ? -23.177  11.300   212.426 1.00 91.23  ? 19   ARG B CZ  1 
ATOM   5910  N  NH1 . ARG B  2  19  ? -23.410  10.651   213.559 1.00 91.39  ? 19   ARG B NH1 1 
ATOM   5911  N  NH2 . ARG B  2  19  ? -24.093  12.137   211.956 1.00 92.20  ? 19   ARG B NH2 1 
ATOM   5912  N  N   . ARG B  2  20  ? -22.919  8.030    207.718 1.00 89.65  ? 20   ARG B N   1 
ATOM   5913  C  CA  . ARG B  2  20  ? -24.314  7.977    207.306 1.00 90.71  ? 20   ARG B CA  1 
ATOM   5914  C  C   . ARG B  2  20  ? -24.840  6.549    207.335 1.00 90.77  ? 20   ARG B C   1 
ATOM   5915  O  O   . ARG B  2  20  ? -25.898  6.275    207.900 1.00 91.56  ? 20   ARG B O   1 
ATOM   5916  C  CB  . ARG B  2  20  ? -24.477  8.551    205.900 1.00 91.13  ? 20   ARG B CB  1 
ATOM   5917  C  CG  . ARG B  2  20  ? -25.897  8.478    205.372 1.00 92.32  ? 20   ARG B CG  1 
ATOM   5918  C  CD  . ARG B  2  20  ? -26.056  9.321    204.122 1.00 92.93  ? 20   ARG B CD  1 
ATOM   5919  N  NE  . ARG B  2  20  ? -25.271  8.798    203.005 1.00 92.37  ? 20   ARG B NE  1 
ATOM   5920  C  CZ  . ARG B  2  20  ? -25.692  7.859    202.162 1.00 92.65  ? 20   ARG B CZ  1 
ATOM   5921  N  NH1 . ARG B  2  20  ? -26.901  7.336    202.289 1.00 93.48  ? 20   ARG B NH1 1 
ATOM   5922  N  NH2 . ARG B  2  20  ? -24.908  7.444    201.177 1.00 92.20  ? 20   ARG B NH2 1 
ATOM   5923  N  N   . ILE B  2  21  ? -24.086  5.645    206.721 1.00 90.03  ? 21   ILE B N   1 
ATOM   5924  C  CA  . ILE B  2  21  ? -24.498  4.255    206.590 1.00 90.13  ? 21   ILE B CA  1 
ATOM   5925  C  C   . ILE B  2  21  ? -24.672  3.590    207.950 1.00 90.13  ? 21   ILE B C   1 
ATOM   5926  O  O   . ILE B  2  21  ? -25.694  2.957    208.207 1.00 90.90  ? 21   ILE B O   1 
ATOM   5927  C  CB  . ILE B  2  21  ? -23.480  3.465    205.746 1.00 89.32  ? 21   ILE B CB  1 
ATOM   5928  C  CG1 . ILE B  2  21  ? -23.527  3.955    204.298 1.00 89.62  ? 21   ILE B CG1 1 
ATOM   5929  C  CG2 . ILE B  2  21  ? -23.762  1.963    205.801 1.00 89.40  ? 21   ILE B CG2 1 
ATOM   5930  C  CD1 . ILE B  2  21  ? -22.320  3.580    203.486 1.00 88.85  ? 21   ILE B CD1 1 
ATOM   5931  N  N   . TRP B  2  22  ? -23.679  3.741    208.819 1.00 99.45  ? 22   TRP B N   1 
ATOM   5932  C  CA  . TRP B  2  22  ? -23.733  3.140    210.147 1.00 99.52  ? 22   TRP B CA  1 
ATOM   5933  C  C   . TRP B  2  22  ? -24.900  3.697    210.954 1.00 100.58 ? 22   TRP B C   1 
ATOM   5934  O  O   . TRP B  2  22  ? -25.771  2.948    211.399 1.00 103.95 ? 22   TRP B O   1 
ATOM   5935  C  CB  . TRP B  2  22  ? -22.425  3.380    210.899 1.00 98.64  ? 22   TRP B CB  1 
ATOM   5936  C  CG  . TRP B  2  22  ? -21.228  2.816    210.212 1.00 97.66  ? 22   TRP B CG  1 
ATOM   5937  C  CD1 . TRP B  2  22  ? -20.219  3.516    209.620 1.00 97.00  ? 22   TRP B CD1 1 
ATOM   5938  C  CD2 . TRP B  2  22  ? -20.906  1.430    210.048 1.00 97.36  ? 22   TRP B CD2 1 
ATOM   5939  N  NE1 . TRP B  2  22  ? -19.289  2.653    209.095 1.00 96.30  ? 22   TRP B NE1 1 
ATOM   5940  C  CE2 . TRP B  2  22  ? -19.687  1.366    209.345 1.00 96.50  ? 22   TRP B CE2 1 
ATOM   5941  C  CE3 . TRP B  2  22  ? -21.529  0.238    210.426 1.00 97.82  ? 22   TRP B CE3 1 
ATOM   5942  C  CZ2 . TRP B  2  22  ? -19.079  0.155    209.013 1.00 96.10  ? 22   TRP B CZ2 1 
ATOM   5943  C  CZ3 . TRP B  2  22  ? -20.924  -0.961   210.095 1.00 97.42  ? 22   TRP B CZ3 1 
ATOM   5944  C  CH2 . TRP B  2  22  ? -19.712  -0.993   209.395 1.00 96.56  ? 22   TRP B CH2 1 
ATOM   5945  N  N   . TYR B  2  23  ? -24.911  5.014    211.139 1.00 97.30  ? 23   TYR B N   1 
ATOM   5946  C  CA  . TYR B  2  23  ? -25.952  5.669    211.922 1.00 98.39  ? 23   TYR B CA  1 
ATOM   5947  C  C   . TYR B  2  23  ? -27.323  5.501    211.277 1.00 99.61  ? 23   TYR B C   1 
ATOM   5948  O  O   . TYR B  2  23  ? -28.349  5.641    211.942 1.00 121.44 ? 23   TYR B O   1 
ATOM   5949  C  CB  . TYR B  2  23  ? -25.648  7.159    212.091 1.00 98.47  ? 23   TYR B CB  1 
ATOM   5950  C  CG  . TYR B  2  23  ? -24.763  7.490    213.272 1.00 98.05  ? 23   TYR B CG  1 
ATOM   5951  C  CD1 . TYR B  2  23  ? -23.399  7.231    213.244 1.00 96.91  ? 23   TYR B CD1 1 
ATOM   5952  C  CD2 . TYR B  2  23  ? -25.296  8.065    214.417 1.00 98.92  ? 23   TYR B CD2 1 
ATOM   5953  C  CE1 . TYR B  2  23  ? -22.589  7.544    214.322 1.00 96.63  ? 23   TYR B CE1 1 
ATOM   5954  C  CE2 . TYR B  2  23  ? -24.497  8.377    215.498 1.00 98.67  ? 23   TYR B CE2 1 
ATOM   5955  C  CZ  . TYR B  2  23  ? -23.148  8.112    215.449 1.00 97.53  ? 23   TYR B CZ  1 
ATOM   5956  O  OH  . TYR B  2  23  ? -22.361  8.425    216.532 1.00 97.38  ? 23   TYR B OH  1 
ATOM   5957  N  N   . GLY B  2  24  ? -27.339  5.199    209.983 1.00 155.78 ? 24   GLY B N   1 
ATOM   5958  C  CA  . GLY B  2  24  ? -28.583  4.956    209.278 1.00 159.17 ? 24   GLY B CA  1 
ATOM   5959  C  C   . GLY B  2  24  ? -29.202  3.652    209.734 1.00 154.50 ? 24   GLY B C   1 
ATOM   5960  O  O   . GLY B  2  24  ? -30.423  3.516    209.804 1.00 165.23 ? 24   GLY B O   1 
ATOM   5961  N  N   . ILE B  2  25  ? -28.345  2.686    210.039 1.00 93.29  ? 25   ILE B N   1 
ATOM   5962  C  CA  . ILE B  2  25  ? -28.783  1.375    210.496 1.00 93.68  ? 25   ILE B CA  1 
ATOM   5963  C  C   . ILE B  2  25  ? -29.184  1.391    211.968 1.00 94.30  ? 25   ILE B C   1 
ATOM   5964  O  O   . ILE B  2  25  ? -30.204  0.817    212.345 1.00 95.35  ? 25   ILE B O   1 
ATOM   5965  C  CB  . ILE B  2  25  ? -27.682  0.322    210.272 1.00 92.64  ? 25   ILE B CB  1 
ATOM   5966  C  CG1 . ILE B  2  25  ? -27.337  0.237    208.782 1.00 92.21  ? 25   ILE B CG1 1 
ATOM   5967  C  CG2 . ILE B  2  25  ? -28.133  -1.045   210.766 1.00 93.17  ? 25   ILE B CG2 1 
ATOM   5968  C  CD1 . ILE B  2  25  ? -26.036  -0.471   208.488 1.00 91.10  ? 25   ILE B CD1 1 
ATOM   5969  N  N   . ALA B  2  26  ? -28.380  2.047    212.796 1.00 93.74  ? 26   ALA B N   1 
ATOM   5970  C  CA  . ALA B  2  26  ? -28.581  2.016    214.242 1.00 94.31  ? 26   ALA B CA  1 
ATOM   5971  C  C   . ALA B  2  26  ? -29.810  2.796    214.696 1.00 95.66  ? 26   ALA B C   1 
ATOM   5972  O  O   . ALA B  2  26  ? -30.308  2.582    215.801 1.00 96.51  ? 26   ALA B O   1 
ATOM   5973  C  CB  . ALA B  2  26  ? -27.356  2.546    214.936 1.00 93.42  ? 26   ALA B CB  1 
ATOM   5974  N  N   . THR B  2  27  ? -30.293  3.695    213.845 1.00 108.11 ? 27   THR B N   1 
ATOM   5975  C  CA  . THR B  2  27  ? -31.454  4.517    214.175 1.00 109.46 ? 27   THR B CA  1 
ATOM   5976  C  C   . THR B  2  27  ? -32.679  4.108    213.361 1.00 110.47 ? 27   THR B C   1 
ATOM   5977  O  O   . THR B  2  27  ? -33.693  4.805    213.365 1.00 111.65 ? 27   THR B O   1 
ATOM   5978  C  CB  . THR B  2  27  ? -31.173  6.009    213.928 1.00 109.34 ? 27   THR B CB  1 
ATOM   5979  O  OG1 . THR B  2  27  ? -30.770  6.206    212.568 1.00 108.64 ? 27   THR B OG1 1 
ATOM   5980  C  CG2 . THR B  2  27  ? -30.080  6.513    214.861 1.00 108.62 ? 27   THR B CG2 1 
ATOM   5981  N  N   . ALA B  2  28  ? -32.586  2.977    212.669 1.00 97.94  ? 28   ALA B N   1 
ATOM   5982  C  CA  . ALA B  2  28  ? -33.659  2.538    211.786 1.00 98.87  ? 28   ALA B CA  1 
ATOM   5983  C  C   . ALA B  2  28  ? -34.898  2.118    212.570 1.00 100.39 ? 28   ALA B C   1 
ATOM   5984  O  O   . ALA B  2  28  ? -36.022  2.371    212.136 1.00 101.60 ? 28   ALA B O   1 
ATOM   5985  C  CB  . ALA B  2  28  ? -33.182  1.390    210.906 1.00 98.15  ? 28   ALA B CB  1 
ATOM   5986  N  N   . HIS B  2  29  ? -34.692  1.485    213.722 1.00 115.29 ? 29   HIS B N   1 
ATOM   5987  C  CA  . HIS B  2  29  ? -35.800  0.940    214.504 1.00 116.80 ? 29   HIS B CA  1 
ATOM   5988  C  C   . HIS B  2  29  ? -36.231  1.861    215.640 1.00 117.72 ? 29   HIS B C   1 
ATOM   5989  O  O   . HIS B  2  29  ? -37.046  1.477    216.479 1.00 119.02 ? 29   HIS B O   1 
ATOM   5990  C  CB  . HIS B  2  29  ? -35.436  -0.438   215.059 1.00 116.61 ? 29   HIS B CB  1 
ATOM   5991  C  CG  . HIS B  2  29  ? -35.487  -1.525   214.035 1.00 116.40 ? 29   HIS B CG  1 
ATOM   5992  N  ND1 . HIS B  2  29  ? -34.560  -2.543   213.976 1.00 115.44 ? 29   HIS B ND1 1 
ATOM   5993  C  CD2 . HIS B  2  29  ? -36.351  -1.743   213.017 1.00 117.13 ? 29   HIS B CD2 1 
ATOM   5994  C  CE1 . HIS B  2  29  ? -34.860  -3.349   212.973 1.00 115.60 ? 29   HIS B CE1 1 
ATOM   5995  N  NE2 . HIS B  2  29  ? -35.945  -2.887   212.377 1.00 116.63 ? 29   HIS B NE2 1 
ATOM   5996  N  N   . ASP B  2  30  ? -35.693  3.077    215.659 1.00 117.84 ? 30   ASP B N   1 
ATOM   5997  C  CA  . ASP B  2  30  ? -36.151  4.094    216.598 1.00 118.84 ? 30   ASP B CA  1 
ATOM   5998  C  C   . ASP B  2  30  ? -37.100  5.027    215.866 1.00 119.80 ? 30   ASP B C   1 
ATOM   5999  O  O   . ASP B  2  30  ? -36.715  6.109    215.424 1.00 119.35 ? 30   ASP B O   1 
ATOM   6000  C  CB  . ASP B  2  30  ? -34.978  4.874    217.193 1.00 117.82 ? 30   ASP B CB  1 
ATOM   6001  C  CG  . ASP B  2  30  ? -35.389  5.734    218.374 1.00 118.97 ? 30   ASP B CG  1 
ATOM   6002  O  OD1 . ASP B  2  30  ? -36.481  5.503    218.935 1.00 120.51 ? 30   ASP B OD1 1 
ATOM   6003  O  OD2 . ASP B  2  30  ? -34.618  6.647    218.740 1.00 119.90 ? 30   ASP B OD2 1 
ATOM   6004  N  N   . PHE B  2  31  ? -38.348  4.591    215.743 1.00 114.77 ? 31   PHE B N   1 
ATOM   6005  C  CA  . PHE B  2  31  ? -39.326  5.295    214.929 1.00 115.81 ? 31   PHE B CA  1 
ATOM   6006  C  C   . PHE B  2  31  ? -39.635  6.679    215.490 1.00 116.66 ? 31   PHE B C   1 
ATOM   6007  O  O   . PHE B  2  31  ? -39.960  7.595    214.738 1.00 117.02 ? 31   PHE B O   1 
ATOM   6008  C  CB  . PHE B  2  31  ? -40.610  4.472    214.820 1.00 117.32 ? 31   PHE B CB  1 
ATOM   6009  C  CG  . PHE B  2  31  ? -40.398  3.068    214.321 1.00 116.74 ? 31   PHE B CG  1 
ATOM   6010  C  CD1 . PHE B  2  31  ? -39.315  2.746    213.523 1.00 115.07 ? 31   PHE B CD1 1 
ATOM   6011  C  CD2 . PHE B  2  31  ? -41.294  2.072    214.651 1.00 117.97 ? 31   PHE B CD2 1 
ATOM   6012  C  CE1 . PHE B  2  31  ? -39.131  1.454    213.068 1.00 114.65 ? 31   PHE B CE1 1 
ATOM   6013  C  CE2 . PHE B  2  31  ? -41.117  0.777    214.201 1.00 117.57 ? 31   PHE B CE2 1 
ATOM   6014  C  CZ  . PHE B  2  31  ? -40.033  0.468    213.408 1.00 115.90 ? 31   PHE B CZ  1 
ATOM   6015  N  N   . GLU B  2  32  ? -39.500  6.840    216.803 1.00 127.60 ? 32   GLU B N   1 
ATOM   6016  C  CA  . GLU B  2  32  ? -39.811  8.111    217.449 1.00 128.58 ? 32   GLU B CA  1 
ATOM   6017  C  C   . GLU B  2  32  ? -38.898  9.230    216.953 1.00 127.49 ? 32   GLU B C   1 
ATOM   6018  O  O   . GLU B  2  32  ? -39.266  10.403   216.995 1.00 128.35 ? 32   GLU B O   1 
ATOM   6019  C  CB  . GLU B  2  32  ? -39.696  7.981    218.971 1.00 129.13 ? 32   GLU B CB  1 
ATOM   6020  C  CG  . GLU B  2  32  ? -40.631  6.945    219.581 1.00 130.46 ? 32   GLU B CG  1 
ATOM   6021  C  CD  . GLU B  2  32  ? -39.909  5.970    220.491 1.00 129.85 ? 32   GLU B CD  1 
ATOM   6022  O  OE1 . GLU B  2  32  ? -39.168  5.108    219.973 1.00 128.46 ? 32   GLU B OE1 1 
ATOM   6023  O  OE2 . GLU B  2  32  ? -40.087  6.062    221.724 1.00 130.87 ? 32   GLU B OE2 1 
ATOM   6024  N  N   . THR B  2  33  ? -37.710  8.862    216.483 1.00 133.87 ? 33   THR B N   1 
ATOM   6025  C  CA  . THR B  2  33  ? -36.739  9.835    215.994 1.00 132.80 ? 33   THR B CA  1 
ATOM   6026  C  C   . THR B  2  33  ? -37.002  10.223   214.539 1.00 132.75 ? 33   THR B C   1 
ATOM   6027  O  O   . THR B  2  33  ? -36.495  11.237   214.060 1.00 132.37 ? 33   THR B O   1 
ATOM   6028  C  CB  . THR B  2  33  ? -35.304  9.294    216.105 1.00 130.98 ? 33   THR B CB  1 
ATOM   6029  O  OG1 . THR B  2  33  ? -35.173  8.519    217.303 1.00 131.09 ? 33   THR B OG1 1 
ATOM   6030  C  CG2 . THR B  2  33  ? -34.299  10.436   216.132 1.00 138.02 ? 33   THR B CG2 1 
ATOM   6031  N  N   . HIS B  2  34  ? -37.797  9.416    213.842 1.00 112.77 ? 34   HIS B N   1 
ATOM   6032  C  CA  . HIS B  2  34  ? -38.026  9.599    212.411 1.00 112.76 ? 34   HIS B CA  1 
ATOM   6033  C  C   . HIS B  2  34  ? -38.629  10.959   212.078 1.00 113.92 ? 34   HIS B C   1 
ATOM   6034  O  O   . HIS B  2  34  ? -39.299  11.574   212.907 1.00 115.18 ? 34   HIS B O   1 
ATOM   6035  C  CB  . HIS B  2  34  ? -38.946  8.501    211.879 1.00 113.47 ? 34   HIS B CB  1 
ATOM   6036  C  CG  . HIS B  2  34  ? -38.328  7.138    211.885 1.00 112.35 ? 34   HIS B CG  1 
ATOM   6037  N  ND1 . HIS B  2  34  ? -38.911  6.056    211.262 1.00 112.73 ? 34   HIS B ND1 1 
ATOM   6038  C  CD2 . HIS B  2  34  ? -37.175  6.683    212.430 1.00 110.95 ? 34   HIS B CD2 1 
ATOM   6039  C  CE1 . HIS B  2  34  ? -38.145  4.993    211.426 1.00 111.62 ? 34   HIS B CE1 1 
ATOM   6040  N  NE2 . HIS B  2  34  ? -37.087  5.345    212.133 1.00 110.52 ? 34   HIS B NE2 1 
ATOM   6041  N  N   . ASP B  2  35  ? -38.383  11.422   210.855 1.00 119.03 ? 35   ASP B N   1 
ATOM   6042  C  CA  . ASP B  2  35  ? -38.885  12.717   210.412 1.00 120.14 ? 35   ASP B CA  1 
ATOM   6043  C  C   . ASP B  2  35  ? -40.406  12.720   210.360 1.00 122.08 ? 35   ASP B C   1 
ATOM   6044  O  O   . ASP B  2  35  ? -41.019  11.840   209.758 1.00 122.45 ? 35   ASP B O   1 
ATOM   6045  C  CB  . ASP B  2  35  ? -38.325  13.080   209.032 1.00 119.50 ? 35   ASP B CB  1 
ATOM   6046  C  CG  . ASP B  2  35  ? -36.821  13.272   209.038 1.00 117.77 ? 35   ASP B CG  1 
ATOM   6047  O  OD1 . ASP B  2  35  ? -36.269  13.654   210.091 1.00 120.29 ? 35   ASP B OD1 1 
ATOM   6048  O  OD2 . ASP B  2  35  ? -36.191  13.052   207.982 1.00 116.91 ? 35   ASP B OD2 1 
ATOM   6049  N  N   . GLY B  2  36  ? -41.006  13.719   210.999 1.00 181.90 ? 36   GLY B N   1 
ATOM   6050  C  CA  . GLY B  2  36  ? -42.443  13.904   210.950 1.00 191.86 ? 36   GLY B CA  1 
ATOM   6051  C  C   . GLY B  2  36  ? -43.224  12.770   211.585 1.00 195.65 ? 36   GLY B C   1 
ATOM   6052  O  O   . GLY B  2  36  ? -44.398  12.572   211.273 1.00 211.09 ? 36   GLY B O   1 
ATOM   6053  N  N   . MET B  2  37  ? -42.580  12.022   212.474 1.00 126.28 ? 37   MET B N   1 
ATOM   6054  C  CA  . MET B  2  37  ? -43.246  10.908   213.136 1.00 126.92 ? 37   MET B CA  1 
ATOM   6055  C  C   . MET B  2  37  ? -44.250  11.429   214.154 1.00 128.82 ? 37   MET B C   1 
ATOM   6056  O  O   . MET B  2  37  ? -43.888  12.168   215.067 1.00 128.89 ? 37   MET B O   1 
ATOM   6057  C  CB  . MET B  2  37  ? -42.232  9.999    213.833 1.00 125.38 ? 37   MET B CB  1 
ATOM   6058  C  CG  . MET B  2  37  ? -42.860  8.779    214.507 1.00 126.08 ? 37   MET B CG  1 
ATOM   6059  S  SD  . MET B  2  37  ? -43.603  7.621    213.337 1.00 139.84 ? 37   MET B SD  1 
ATOM   6060  C  CE  . MET B  2  37  ? -42.182  7.129    212.360 1.00 124.13 ? 37   MET B CE  1 
ATOM   6061  N  N   . THR B  2  38  ? -45.509  11.037   213.990 1.00 139.14 ? 38   THR B N   1 
ATOM   6062  C  CA  . THR B  2  38  ? -46.555  11.379   214.946 1.00 141.13 ? 38   THR B CA  1 
ATOM   6063  C  C   . THR B  2  38  ? -46.707  10.228   215.926 1.00 141.31 ? 38   THR B C   1 
ATOM   6064  O  O   . THR B  2  38  ? -46.029  9.209    215.801 1.00 139.91 ? 38   THR B O   1 
ATOM   6065  C  CB  . THR B  2  38  ? -47.906  11.653   214.257 1.00 148.58 ? 38   THR B CB  1 
ATOM   6066  O  OG1 . THR B  2  38  ? -48.448  10.426   213.752 1.00 155.65 ? 38   THR B OG1 1 
ATOM   6067  C  CG2 . THR B  2  38  ? -47.742  12.644   213.114 1.00 149.32 ? 38   THR B CG2 1 
ATOM   6068  N  N   . GLU B  2  39  ? -47.593  10.385   216.902 1.00 132.81 ? 39   GLU B N   1 
ATOM   6069  C  CA  . GLU B  2  39  ? -47.856  9.313    217.850 1.00 133.31 ? 39   GLU B CA  1 
ATOM   6070  C  C   . GLU B  2  39  ? -48.760  8.268    217.212 1.00 134.14 ? 39   GLU B C   1 
ATOM   6071  O  O   . GLU B  2  39  ? -48.568  7.072    217.404 1.00 133.64 ? 39   GLU B O   1 
ATOM   6072  C  CB  . GLU B  2  39  ? -48.491  9.857    219.130 1.00 135.12 ? 39   GLU B CB  1 
ATOM   6073  C  CG  . GLU B  2  39  ? -48.574  8.833    220.253 1.00 135.59 ? 39   GLU B CG  1 
ATOM   6074  C  CD  . GLU B  2  39  ? -49.248  9.377    221.495 1.00 137.60 ? 39   GLU B CD  1 
ATOM   6075  O  OE1 . GLU B  2  39  ? -49.783  10.504   221.439 1.00 138.77 ? 39   GLU B OE1 1 
ATOM   6076  O  OE2 . GLU B  2  39  ? -49.239  8.678    222.530 1.00 138.09 ? 39   GLU B OE2 1 
ATOM   6077  N  N   . GLU B  2  40  ? -49.746  8.723    216.448 1.00 175.28 ? 40   GLU B N   1 
ATOM   6078  C  CA  . GLU B  2  40  ? -50.688  7.812    215.809 1.00 179.70 ? 40   GLU B CA  1 
ATOM   6079  C  C   . GLU B  2  40  ? -49.996  6.982    214.727 1.00 171.26 ? 40   GLU B C   1 
ATOM   6080  O  O   . GLU B  2  40  ? -50.263  5.788    214.591 1.00 167.72 ? 40   GLU B O   1 
ATOM   6081  C  CB  . GLU B  2  40  ? -51.868  8.589    215.224 1.00 185.26 ? 40   GLU B CB  1 
ATOM   6082  C  CG  . GLU B  2  40  ? -52.904  7.715    214.536 1.00 194.49 ? 40   GLU B CG  1 
ATOM   6083  C  CD  . GLU B  2  40  ? -54.320  8.211    214.760 1.00 199.77 ? 40   GLU B CD  1 
ATOM   6084  O  OE1 . GLU B  2  40  ? -55.182  7.395    215.150 1.00 192.45 ? 40   GLU B OE1 1 
ATOM   6085  O  OE2 . GLU B  2  40  ? -54.571  9.416    214.544 1.00 209.19 ? 40   GLU B OE2 1 
ATOM   6086  N  N   . ASN B  2  41  ? -49.110  7.612    213.961 1.00 135.04 ? 41   ASN B N   1 
ATOM   6087  C  CA  . ASN B  2  41  ? -48.374  6.909    212.914 1.00 133.41 ? 41   ASN B CA  1 
ATOM   6088  C  C   . ASN B  2  41  ? -47.285  6.014    213.491 1.00 131.70 ? 41   ASN B C   1 
ATOM   6089  O  O   . ASN B  2  41  ? -46.764  5.139    212.802 1.00 130.57 ? 41   ASN B O   1 
ATOM   6090  C  CB  . ASN B  2  41  ? -47.761  7.898    211.922 1.00 132.47 ? 41   ASN B CB  1 
ATOM   6091  C  CG  . ASN B  2  41  ? -48.807  8.612    211.091 1.00 143.66 ? 41   ASN B CG  1 
ATOM   6092  O  OD1 . ASN B  2  41  ? -49.040  9.810    211.255 1.00 161.16 ? 41   ASN B OD1 1 
ATOM   6093  N  ND2 . ASN B  2  41  ? -49.445  7.875    210.187 1.00 141.01 ? 41   ASN B ND2 1 
ATOM   6094  N  N   . LEU B  2  42  ? -46.938  6.238    214.755 1.00 117.48 ? 42   LEU B N   1 
ATOM   6095  C  CA  . LEU B  2  42  ? -45.959  5.394    215.425 1.00 116.10 ? 42   LEU B CA  1 
ATOM   6096  C  C   . LEU B  2  42  ? -46.534  4.008    215.650 1.00 116.86 ? 42   LEU B C   1 
ATOM   6097  O  O   . LEU B  2  42  ? -46.065  3.031    215.068 1.00 115.84 ? 42   LEU B O   1 
ATOM   6098  C  CB  . LEU B  2  42  ? -45.533  5.997    216.767 1.00 116.11 ? 42   LEU B CB  1 
ATOM   6099  C  CG  . LEU B  2  42  ? -44.556  5.136    217.574 1.00 114.91 ? 42   LEU B CG  1 
ATOM   6100  C  CD1 . LEU B  2  42  ? -43.247  4.972    216.835 1.00 112.68 ? 42   LEU B CD1 1 
ATOM   6101  C  CD2 . LEU B  2  42  ? -44.319  5.719    218.955 1.00 115.36 ? 42   LEU B CD2 1 
ATOM   6102  N  N   . TYR B  2  43  ? -47.568  3.946    216.485 1.00 118.78 ? 43   TYR B N   1 
ATOM   6103  C  CA  . TYR B  2  43  ? -48.210  2.691    216.860 1.00 119.84 ? 43   TYR B CA  1 
ATOM   6104  C  C   . TYR B  2  43  ? -48.564  1.851    215.639 1.00 119.83 ? 43   TYR B C   1 
ATOM   6105  O  O   . TYR B  2  43  ? -48.371  0.636    215.634 1.00 119.52 ? 43   TYR B O   1 
ATOM   6106  C  CB  . TYR B  2  43  ? -49.475  2.970    217.675 1.00 122.25 ? 43   TYR B CB  1 
ATOM   6107  C  CG  . TYR B  2  43  ? -49.217  3.433    219.093 1.00 122.62 ? 43   TYR B CG  1 
ATOM   6108  C  CD1 . TYR B  2  43  ? -48.668  4.681    219.347 1.00 122.02 ? 43   TYR B CD1 1 
ATOM   6109  C  CD2 . TYR B  2  43  ? -49.539  2.629    220.177 1.00 123.73 ? 43   TYR B CD2 1 
ATOM   6110  C  CE1 . TYR B  2  43  ? -48.435  5.114    220.637 1.00 122.47 ? 43   TYR B CE1 1 
ATOM   6111  C  CE2 . TYR B  2  43  ? -49.312  3.053    221.472 1.00 124.22 ? 43   TYR B CE2 1 
ATOM   6112  C  CZ  . TYR B  2  43  ? -48.760  4.297    221.696 1.00 123.58 ? 43   TYR B CZ  1 
ATOM   6113  O  OH  . TYR B  2  43  ? -48.529  4.726    222.984 1.00 124.17 ? 43   TYR B OH  1 
ATOM   6114  N  N   . GLN B  2  44  ? -49.082  2.508    214.607 1.00 133.29 ? 44   GLN B N   1 
ATOM   6115  C  CA  . GLN B  2  44  ? -49.491  1.821    213.389 1.00 133.51 ? 44   GLN B CA  1 
ATOM   6116  C  C   . GLN B  2  44  ? -48.309  1.143    212.696 1.00 131.43 ? 44   GLN B C   1 
ATOM   6117  O  O   . GLN B  2  44  ? -48.492  0.163    211.973 1.00 136.07 ? 44   GLN B O   1 
ATOM   6118  C  CB  . GLN B  2  44  ? -50.181  2.802    212.438 1.00 134.40 ? 44   GLN B CB  1 
ATOM   6119  C  CG  . GLN B  2  44  ? -51.614  3.129    212.851 1.00 136.89 ? 44   GLN B CG  1 
ATOM   6120  C  CD  . GLN B  2  44  ? -52.155  4.386    212.195 1.00 137.76 ? 44   GLN B CD  1 
ATOM   6121  O  OE1 . GLN B  2  44  ? -51.514  4.975    211.325 1.00 137.27 ? 44   GLN B OE1 1 
ATOM   6122  N  NE2 . GLN B  2  44  ? -53.345  4.803    212.613 1.00 139.95 ? 44   GLN B NE2 1 
ATOM   6123  N  N   . LYS B  2  45  ? -47.103  1.661    212.915 1.00 116.63 ? 45   LYS B N   1 
ATOM   6124  C  CA  . LYS B  2  45  ? -45.896  1.030    212.386 1.00 114.67 ? 45   LYS B CA  1 
ATOM   6125  C  C   . LYS B  2  45  ? -45.450  -0.112   213.293 1.00 114.28 ? 45   LYS B C   1 
ATOM   6126  O  O   . LYS B  2  45  ? -44.978  -1.145   212.817 1.00 113.51 ? 45   LYS B O   1 
ATOM   6127  C  CB  . LYS B  2  45  ? -44.763  2.046    212.231 1.00 113.01 ? 45   LYS B CB  1 
ATOM   6128  C  CG  . LYS B  2  45  ? -43.541  1.489    211.505 1.00 111.08 ? 45   LYS B CG  1 
ATOM   6129  C  CD  . LYS B  2  45  ? -42.370  2.458    211.540 1.00 109.51 ? 45   LYS B CD  1 
ATOM   6130  C  CE  . LYS B  2  45  ? -42.463  3.498    210.443 1.00 109.54 ? 45   LYS B CE  1 
ATOM   6131  N  NZ  . LYS B  2  45  ? -42.205  2.914    209.099 1.00 108.97 ? 45   LYS B NZ  1 
ATOM   6132  N  N   . ILE B  2  46  ? -45.603  0.080    214.601 1.00 114.93 ? 46   ILE B N   1 
ATOM   6133  C  CA  . ILE B  2  46  ? -45.277  -0.961   215.571 1.00 114.87 ? 46   ILE B CA  1 
ATOM   6134  C  C   . ILE B  2  46  ? -46.180  -2.162   215.357 1.00 116.24 ? 46   ILE B C   1 
ATOM   6135  O  O   . ILE B  2  46  ? -45.722  -3.303   215.287 1.00 115.68 ? 46   ILE B O   1 
ATOM   6136  C  CB  . ILE B  2  46  ? -45.449  -0.480   217.030 1.00 115.73 ? 46   ILE B CB  1 
ATOM   6137  C  CG1 . ILE B  2  46  ? -44.790  0.881    217.252 1.00 114.82 ? 46   ILE B CG1 1 
ATOM   6138  C  CG2 . ILE B  2  46  ? -44.895  -1.516   218.001 1.00 115.48 ? 46   ILE B CG2 1 
ATOM   6139  C  CD1 . ILE B  2  46  ? -43.368  0.947    216.799 1.00 112.57 ? 46   ILE B CD1 1 
ATOM   6140  N  N   . PHE B  2  47  ? -47.475  -1.879   215.268 1.00 118.17 ? 47   PHE B N   1 
ATOM   6141  C  CA  . PHE B  2  47  ? -48.495  -2.899   215.093 1.00 119.81 ? 47   PHE B CA  1 
ATOM   6142  C  C   . PHE B  2  47  ? -48.184  -3.780   213.890 1.00 119.02 ? 47   PHE B C   1 
ATOM   6143  O  O   . PHE B  2  47  ? -48.338  -4.999   213.946 1.00 147.65 ? 47   PHE B O   1 
ATOM   6144  C  CB  . PHE B  2  47  ? -49.866  -2.239   214.938 1.00 121.84 ? 47   PHE B CB  1 
ATOM   6145  C  CG  . PHE B  2  47  ? -51.013  -3.203   215.000 1.00 123.87 ? 47   PHE B CG  1 
ATOM   6146  C  CD1 . PHE B  2  47  ? -51.288  -3.899   216.165 1.00 124.94 ? 47   PHE B CD1 1 
ATOM   6147  C  CD2 . PHE B  2  47  ? -51.826  -3.400   213.899 1.00 124.83 ? 47   PHE B CD2 1 
ATOM   6148  C  CE1 . PHE B  2  47  ? -52.347  -4.783   216.226 1.00 126.91 ? 47   PHE B CE1 1 
ATOM   6149  C  CE2 . PHE B  2  47  ? -52.885  -4.280   213.956 1.00 126.79 ? 47   PHE B CE2 1 
ATOM   6150  C  CZ  . PHE B  2  47  ? -53.146  -4.973   215.119 1.00 127.83 ? 47   PHE B CZ  1 
ATOM   6151  N  N   . ALA B  2  48  ? -47.740  -3.155   212.805 1.00 117.85 ? 48   ALA B N   1 
ATOM   6152  C  CA  . ALA B  2  48  ? -47.398  -3.885   211.592 1.00 117.12 ? 48   ALA B CA  1 
ATOM   6153  C  C   . ALA B  2  48  ? -46.074  -4.620   211.765 1.00 115.30 ? 48   ALA B C   1 
ATOM   6154  O  O   . ALA B  2  48  ? -45.910  -5.745   211.293 1.00 115.19 ? 48   ALA B O   1 
ATOM   6155  C  CB  . ALA B  2  48  ? -47.328  -2.941   210.414 1.00 116.63 ? 48   ALA B CB  1 
ATOM   6156  N  N   . SER B  2  49  ? -45.129  -3.970   212.436 1.00 129.27 ? 49   SER B N   1 
ATOM   6157  C  CA  . SER B  2  49  ? -43.822  -4.565   212.687 1.00 127.58 ? 49   SER B CA  1 
ATOM   6158  C  C   . SER B  2  49  ? -43.924  -5.837   213.527 1.00 128.26 ? 49   SER B C   1 
ATOM   6159  O  O   . SER B  2  49  ? -43.104  -6.743   213.384 1.00 127.30 ? 49   SER B O   1 
ATOM   6160  C  CB  . SER B  2  49  ? -42.903  -3.555   213.376 1.00 126.31 ? 49   SER B CB  1 
ATOM   6161  O  OG  . SER B  2  49  ? -42.638  -2.451   212.527 1.00 125.55 ? 49   SER B OG  1 
ATOM   6162  N  N   . HIS B  2  50  ? -44.924  -5.906   214.401 1.00 114.71 ? 50   HIS B N   1 
ATOM   6163  C  CA  . HIS B  2  50  ? -45.131  -7.096   215.221 1.00 115.65 ? 50   HIS B CA  1 
ATOM   6164  C  C   . HIS B  2  50  ? -45.591  -8.271   214.369 1.00 116.37 ? 50   HIS B C   1 
ATOM   6165  O  O   . HIS B  2  50  ? -45.129  -9.398   214.554 1.00 116.17 ? 50   HIS B O   1 
ATOM   6166  C  CB  . HIS B  2  50  ? -46.152  -6.840   216.331 1.00 117.57 ? 50   HIS B CB  1 
ATOM   6167  C  CG  . HIS B  2  50  ? -45.621  -6.026   217.469 1.00 117.11 ? 50   HIS B CG  1 
ATOM   6168  N  ND1 . HIS B  2  50  ? -46.175  -6.068   218.731 1.00 118.62 ? 50   HIS B ND1 1 
ATOM   6169  C  CD2 . HIS B  2  50  ? -44.595  -5.146   217.537 1.00 115.42 ? 50   HIS B CD2 1 
ATOM   6170  C  CE1 . HIS B  2  50  ? -45.508  -5.254   219.529 1.00 117.89 ? 50   HIS B CE1 1 
ATOM   6171  N  NE2 . HIS B  2  50  ? -44.548  -4.679   218.828 1.00 115.94 ? 50   HIS B NE2 1 
ATOM   6172  N  N   . PHE B  2  51  ? -46.510  -8.004   213.446 1.00 118.93 ? 51   PHE B N   1 
ATOM   6173  C  CA  . PHE B  2  51  ? -47.005  -9.030   212.535 1.00 119.74 ? 51   PHE B CA  1 
ATOM   6174  C  C   . PHE B  2  51  ? -45.873  -9.710   211.778 1.00 118.09 ? 51   PHE B C   1 
ATOM   6175  O  O   . PHE B  2  51  ? -45.845  -10.934  211.649 1.00 118.51 ? 51   PHE B O   1 
ATOM   6176  C  CB  . PHE B  2  51  ? -47.983  -8.424   211.531 1.00 120.75 ? 51   PHE B CB  1 
ATOM   6177  C  CG  . PHE B  2  51  ? -49.391  -8.341   212.030 1.00 123.05 ? 51   PHE B CG  1 
ATOM   6178  C  CD1 . PHE B  2  51  ? -50.124  -9.490   212.262 1.00 124.69 ? 51   PHE B CD1 1 
ATOM   6179  C  CD2 . PHE B  2  51  ? -49.986  -7.115   212.255 1.00 123.69 ? 51   PHE B CD2 1 
ATOM   6180  C  CE1 . PHE B  2  51  ? -51.423  -9.416   212.717 1.00 126.92 ? 51   PHE B CE1 1 
ATOM   6181  C  CE2 . PHE B  2  51  ? -51.284  -7.033   212.708 1.00 125.91 ? 51   PHE B CE2 1 
ATOM   6182  C  CZ  . PHE B  2  51  ? -52.005  -8.185   212.941 1.00 127.53 ? 51   PHE B CZ  1 
ATOM   6183  N  N   . GLY B  2  52  ? -44.943  -8.905   211.278 1.00 130.53 ? 52   GLY B N   1 
ATOM   6184  C  CA  . GLY B  2  52  ? -43.804  -9.426   210.552 1.00 128.94 ? 52   GLY B CA  1 
ATOM   6185  C  C   . GLY B  2  52  ? -42.931  -10.272  211.452 1.00 128.25 ? 52   GLY B C   1 
ATOM   6186  O  O   . GLY B  2  52  ? -42.335  -11.252  211.009 1.00 127.74 ? 52   GLY B O   1 
ATOM   6187  N  N   . HIS B  2  53  ? -42.863  -9.900   212.726 1.00 112.52 ? 53   HIS B N   1 
ATOM   6188  C  CA  . HIS B  2  53  ? -42.002  -10.601  213.664 1.00 111.93 ? 53   HIS B CA  1 
ATOM   6189  C  C   . HIS B  2  53  ? -42.588  -11.954  214.038 1.00 113.47 ? 53   HIS B C   1 
ATOM   6190  O  O   . HIS B  2  53  ? -41.869  -12.951  214.103 1.00 113.00 ? 53   HIS B O   1 
ATOM   6191  C  CB  . HIS B  2  53  ? -41.782  -9.777   214.929 1.00 111.76 ? 53   HIS B CB  1 
ATOM   6192  C  CG  . HIS B  2  53  ? -40.746  -10.355  215.839 1.00 110.99 ? 53   HIS B CG  1 
ATOM   6193  N  ND1 . HIS B  2  53  ? -41.035  -11.326  216.773 1.00 112.23 ? 53   HIS B ND1 1 
ATOM   6194  C  CD2 . HIS B  2  53  ? -39.418  -10.116  215.941 1.00 109.21 ? 53   HIS B CD2 1 
ATOM   6195  C  CE1 . HIS B  2  53  ? -39.929  -11.656  217.417 1.00 111.26 ? 53   HIS B CE1 1 
ATOM   6196  N  NE2 . HIS B  2  53  ? -38.935  -10.934  216.934 1.00 109.41 ? 53   HIS B NE2 1 
ATOM   6197  N  N   . ILE B  2  54  ? -43.891  -11.982  214.297 1.00 125.34 ? 54   ILE B N   1 
ATOM   6198  C  CA  . ILE B  2  54  ? -44.574  -13.228  214.622 1.00 127.06 ? 54   ILE B CA  1 
ATOM   6199  C  C   . ILE B  2  54  ? -44.400  -14.234  213.496 1.00 126.93 ? 54   ILE B C   1 
ATOM   6200  O  O   . ILE B  2  54  ? -44.156  -15.416  213.740 1.00 127.35 ? 54   ILE B O   1 
ATOM   6201  C  CB  . ILE B  2  54  ? -46.081  -13.006  214.886 1.00 129.25 ? 54   ILE B CB  1 
ATOM   6202  C  CG1 . ILE B  2  54  ? -46.290  -12.182  216.160 1.00 129.72 ? 54   ILE B CG1 1 
ATOM   6203  C  CG2 . ILE B  2  54  ? -46.823  -14.341  214.985 1.00 131.13 ? 54   ILE B CG2 1 
ATOM   6204  C  CD1 . ILE B  2  54  ? -45.833  -12.869  217.433 1.00 130.02 ? 54   ILE B CD1 1 
ATOM   6205  N  N   . ALA B  2  55  ? -44.526  -13.758  212.263 1.00 116.51 ? 55   ALA B N   1 
ATOM   6206  C  CA  . ALA B  2  55  ? -44.416  -14.622  211.096 1.00 116.51 ? 55   ALA B CA  1 
ATOM   6207  C  C   . ALA B  2  55  ? -43.041  -15.271  211.019 1.00 114.93 ? 55   ALA B C   1 
ATOM   6208  O  O   . ALA B  2  55  ? -42.915  -16.435  210.639 1.00 115.38 ? 55   ALA B O   1 
ATOM   6209  C  CB  . ALA B  2  55  ? -44.689  -13.837  209.839 1.00 116.20 ? 55   ALA B CB  1 
ATOM   6210  N  N   . ILE B  2  56  ? -42.014  -14.510  211.378 1.00 113.18 ? 56   ILE B N   1 
ATOM   6211  C  CA  . ILE B  2  56  ? -40.648  -15.016  211.355 1.00 111.65 ? 56   ILE B CA  1 
ATOM   6212  C  C   . ILE B  2  56  ? -40.489  -16.166  212.343 1.00 112.40 ? 56   ILE B C   1 
ATOM   6213  O  O   . ILE B  2  56  ? -39.850  -17.170  212.033 1.00 112.13 ? 56   ILE B O   1 
ATOM   6214  C  CB  . ILE B  2  56  ? -39.631  -13.898  211.669 1.00 109.80 ? 56   ILE B CB  1 
ATOM   6215  C  CG1 . ILE B  2  56  ? -39.539  -12.943  210.478 1.00 108.91 ? 56   ILE B CG1 1 
ATOM   6216  C  CG2 . ILE B  2  56  ? -38.249  -14.481  211.987 1.00 108.47 ? 56   ILE B CG2 1 
ATOM   6217  C  CD1 . ILE B  2  56  ? -38.807  -11.652  210.765 1.00 107.44 ? 56   ILE B CD1 1 
ATOM   6218  N  N   . ILE B  2  57  ? -41.071  -16.018  213.529 1.00 113.46 ? 57   ILE B N   1 
ATOM   6219  C  CA  . ILE B  2  57  ? -40.997  -17.066  214.540 1.00 114.42 ? 57   ILE B CA  1 
ATOM   6220  C  C   . ILE B  2  57  ? -41.657  -18.342  214.030 1.00 115.97 ? 57   ILE B C   1 
ATOM   6221  O  O   . ILE B  2  57  ? -41.092  -19.427  214.155 1.00 116.05 ? 57   ILE B O   1 
ATOM   6222  C  CB  . ILE B  2  57  ? -41.656  -16.630  215.868 1.00 115.58 ? 57   ILE B CB  1 
ATOM   6223  C  CG1 . ILE B  2  57  ? -40.825  -15.531  216.532 1.00 114.09 ? 57   ILE B CG1 1 
ATOM   6224  C  CG2 . ILE B  2  57  ? -41.789  -17.813  216.828 1.00 117.03 ? 57   ILE B CG2 1 
ATOM   6225  C  CD1 . ILE B  2  57  ? -41.541  -14.810  217.654 1.00 115.19 ? 57   ILE B CD1 1 
ATOM   6226  N  N   . PHE B  2  58  ? -42.847  -18.215  213.452 1.00 122.14 ? 58   PHE B N   1 
ATOM   6227  C  CA  . PHE B  2  58  ? -43.545  -19.375  212.910 1.00 123.76 ? 58   PHE B CA  1 
ATOM   6228  C  C   . PHE B  2  58  ? -42.783  -19.955  211.728 1.00 122.77 ? 58   PHE B C   1 
ATOM   6229  O  O   . PHE B  2  58  ? -42.761  -21.169  211.529 1.00 138.80 ? 58   PHE B O   1 
ATOM   6230  C  CB  . PHE B  2  58  ? -44.972  -19.012  212.491 1.00 125.38 ? 58   PHE B CB  1 
ATOM   6231  C  CG  . PHE B  2  58  ? -45.873  -18.644  213.640 1.00 126.83 ? 58   PHE B CG  1 
ATOM   6232  C  CD1 . PHE B  2  58  ? -45.676  -19.185  214.901 1.00 127.45 ? 58   PHE B CD1 1 
ATOM   6233  C  CD2 . PHE B  2  58  ? -46.931  -17.771  213.453 1.00 127.73 ? 58   PHE B CD2 1 
ATOM   6234  C  CE1 . PHE B  2  58  ? -46.506  -18.854  215.952 1.00 128.92 ? 58   PHE B CE1 1 
ATOM   6235  C  CE2 . PHE B  2  58  ? -47.767  -17.437  214.502 1.00 129.19 ? 58   PHE B CE2 1 
ATOM   6236  C  CZ  . PHE B  2  58  ? -47.554  -17.980  215.753 1.00 129.79 ? 58   PHE B CZ  1 
ATOM   6237  N  N   . LEU B  2  59  ? -42.161  -19.084  210.945 1.00 116.21 ? 59   LEU B N   1 
ATOM   6238  C  CA  . LEU B  2  59  ? -41.334  -19.529  209.834 1.00 115.18 ? 59   LEU B CA  1 
ATOM   6239  C  C   . LEU B  2  59  ? -40.080  -20.245  210.331 1.00 114.19 ? 59   LEU B C   1 
ATOM   6240  O  O   . LEU B  2  59  ? -39.591  -21.172  209.688 1.00 114.16 ? 59   LEU B O   1 
ATOM   6241  C  CB  . LEU B  2  59  ? -40.951  -18.350  208.945 1.00 113.69 ? 59   LEU B CB  1 
ATOM   6242  C  CG  . LEU B  2  59  ? -42.006  -17.969  207.906 1.00 114.69 ? 59   LEU B CG  1 
ATOM   6243  C  CD1 . LEU B  2  59  ? -41.840  -16.529  207.446 1.00 113.50 ? 59   LEU B CD1 1 
ATOM   6244  C  CD2 . LEU B  2  59  ? -41.928  -18.920  206.722 1.00 115.15 ? 59   LEU B CD2 1 
ATOM   6245  N  N   . TRP B  2  60  ? -39.554  -19.804  211.469 1.00 113.46 ? 60   TRP B N   1 
ATOM   6246  C  CA  . TRP B  2  60  ? -38.379  -20.435  212.062 1.00 112.64 ? 60   TRP B CA  1 
ATOM   6247  C  C   . TRP B  2  60  ? -38.676  -21.842  212.559 1.00 114.29 ? 60   TRP B C   1 
ATOM   6248  O  O   . TRP B  2  60  ? -37.963  -22.786  212.224 1.00 114.11 ? 60   TRP B O   1 
ATOM   6249  C  CB  . TRP B  2  60  ? -37.829  -19.583  213.205 1.00 111.67 ? 60   TRP B CB  1 
ATOM   6250  C  CG  . TRP B  2  60  ? -36.906  -20.338  214.107 1.00 111.47 ? 60   TRP B CG  1 
ATOM   6251  C  CD1 . TRP B  2  60  ? -35.684  -20.850  213.786 1.00 110.32 ? 60   TRP B CD1 1 
ATOM   6252  C  CD2 . TRP B  2  60  ? -37.125  -20.656  215.486 1.00 112.55 ? 60   TRP B CD2 1 
ATOM   6253  N  NE1 . TRP B  2  60  ? -35.131  -21.475  214.877 1.00 110.62 ? 60   TRP B NE1 1 
ATOM   6254  C  CE2 . TRP B  2  60  ? -35.995  -21.366  215.935 1.00 112.00 ? 60   TRP B CE2 1 
ATOM   6255  C  CE3 . TRP B  2  60  ? -38.166  -20.408  216.386 1.00 114.05 ? 60   TRP B CE3 1 
ATOM   6256  C  CZ2 . TRP B  2  60  ? -35.880  -21.835  217.241 1.00 112.91 ? 60   TRP B CZ2 1 
ATOM   6257  C  CZ3 . TRP B  2  60  ? -38.049  -20.872  217.682 1.00 114.95 ? 60   TRP B CZ3 1 
ATOM   6258  C  CH2 . TRP B  2  60  ? -36.914  -21.577  218.098 1.00 114.39 ? 60   TRP B CH2 1 
ATOM   6259  N  N   . THR B  2  61  ? -39.727  -21.979  213.360 1.00 116.00 ? 61   THR B N   1 
ATOM   6260  C  CA  . THR B  2  61  ? -40.097  -23.275  213.912 1.00 117.81 ? 61   THR B CA  1 
ATOM   6261  C  C   . THR B  2  61  ? -40.439  -24.239  212.787 1.00 118.71 ? 61   THR B C   1 
ATOM   6262  O  O   . THR B  2  61  ? -40.240  -25.447  212.905 1.00 119.63 ? 61   THR B O   1 
ATOM   6263  C  CB  . THR B  2  61  ? -41.293  -23.161  214.858 1.00 119.67 ? 61   THR B CB  1 
ATOM   6264  O  OG1 . THR B  2  61  ? -42.419  -22.628  214.152 1.00 120.42 ? 61   THR B OG1 1 
ATOM   6265  C  CG2 . THR B  2  61  ? -40.959  -22.255  216.010 1.00 118.96 ? 61   THR B CG2 1 
ATOM   6266  N  N   . SER B  2  62  ? -40.956  -23.689  211.695 1.00 118.54 ? 62   SER B N   1 
ATOM   6267  C  CA  . SER B  2  62  ? -41.245  -24.474  210.507 1.00 119.32 ? 62   SER B CA  1 
ATOM   6268  C  C   . SER B  2  62  ? -39.948  -25.067  209.972 1.00 118.06 ? 62   SER B C   1 
ATOM   6269  O  O   . SER B  2  62  ? -39.924  -26.194  209.479 1.00 119.01 ? 62   SER B O   1 
ATOM   6270  C  CB  . SER B  2  62  ? -41.926  -23.612  209.443 1.00 119.21 ? 62   SER B CB  1 
ATOM   6271  O  OG  . SER B  2  62  ? -41.990  -24.287  208.201 1.00 119.70 ? 62   SER B OG  1 
ATOM   6272  N  N   . GLY B  2  63  ? -38.871  -24.295  210.071 1.00 116.01 ? 63   GLY B N   1 
ATOM   6273  C  CA  . GLY B  2  63  ? -37.566  -24.733  209.612 1.00 114.72 ? 63   GLY B CA  1 
ATOM   6274  C  C   . GLY B  2  63  ? -37.041  -25.947  210.355 1.00 115.41 ? 63   GLY B C   1 
ATOM   6275  O  O   . GLY B  2  63  ? -36.482  -26.858  209.746 1.00 115.52 ? 63   GLY B O   1 
ATOM   6276  N  N   . THR B  2  64  ? -37.216  -25.961  211.674 1.00 115.98 ? 64   THR B N   1 
ATOM   6277  C  CA  . THR B  2  64  ? -36.760  -27.082  212.491 1.00 116.81 ? 64   THR B CA  1 
ATOM   6278  C  C   . THR B  2  64  ? -37.538  -28.353  212.182 1.00 118.97 ? 64   THR B C   1 
ATOM   6279  O  O   . THR B  2  64  ? -36.949  -29.405  211.938 1.00 119.34 ? 64   THR B O   1 
ATOM   6280  C  CB  . THR B  2  64  ? -36.889  -26.782  213.997 1.00 117.21 ? 64   THR B CB  1 
ATOM   6281  O  OG1 . THR B  2  64  ? -38.200  -26.275  214.277 1.00 118.40 ? 64   THR B OG1 1 
ATOM   6282  C  CG2 . THR B  2  64  ? -35.851  -25.764  214.433 1.00 115.15 ? 64   THR B CG2 1 
ATOM   6283  N  N   . LEU B  2  65  ? -38.863  -28.251  212.200 1.00 124.18 ? 65   LEU B N   1 
ATOM   6284  C  CA  . LEU B  2  65  ? -39.728  -29.381  211.884 1.00 126.40 ? 65   LEU B CA  1 
ATOM   6285  C  C   . LEU B  2  65  ? -39.405  -29.934  210.509 1.00 126.21 ? 65   LEU B C   1 
ATOM   6286  O  O   . LEU B  2  65  ? -39.254  -31.141  210.329 1.00 131.23 ? 65   LEU B O   1 
ATOM   6287  C  CB  . LEU B  2  65  ? -41.194  -28.964  211.928 1.00 127.85 ? 65   LEU B CB  1 
ATOM   6288  C  CG  . LEU B  2  65  ? -41.775  -28.710  213.313 1.00 128.84 ? 65   LEU B CG  1 
ATOM   6289  C  CD1 . LEU B  2  65  ? -42.995  -27.835  213.188 1.00 129.52 ? 65   LEU B CD1 1 
ATOM   6290  C  CD2 . LEU B  2  65  ? -42.124  -30.024  213.997 1.00 131.05 ? 65   LEU B CD2 1 
ATOM   6291  N  N   . PHE B  2  66  ? -39.298  -29.030  209.543 1.00 121.17 ? 66   PHE B N   1 
ATOM   6292  C  CA  . PHE B  2  66  ? -39.112  -29.413  208.155 1.00 121.11 ? 66   PHE B CA  1 
ATOM   6293  C  C   . PHE B  2  66  ? -37.795  -30.150  207.944 1.00 120.28 ? 66   PHE B C   1 
ATOM   6294  O  O   . PHE B  2  66  ? -37.733  -31.110  207.178 1.00 121.21 ? 66   PHE B O   1 
ATOM   6295  C  CB  . PHE B  2  66  ? -39.161  -28.180  207.256 1.00 119.74 ? 66   PHE B CB  1 
ATOM   6296  C  CG  . PHE B  2  66  ? -38.994  -28.496  205.803 1.00 119.76 ? 66   PHE B CG  1 
ATOM   6297  C  CD1 . PHE B  2  66  ? -40.078  -28.895  205.042 1.00 121.53 ? 66   PHE B CD1 1 
ATOM   6298  C  CD2 . PHE B  2  66  ? -37.750  -28.416  205.204 1.00 118.16 ? 66   PHE B CD2 1 
ATOM   6299  C  CE1 . PHE B  2  66  ? -39.927  -29.195  203.705 1.00 121.70 ? 66   PHE B CE1 1 
ATOM   6300  C  CE2 . PHE B  2  66  ? -37.591  -28.716  203.868 1.00 118.32 ? 66   PHE B CE2 1 
ATOM   6301  C  CZ  . PHE B  2  66  ? -38.681  -29.108  203.116 1.00 120.10 ? 66   PHE B CZ  1 
ATOM   6302  N  N   . HIS B  2  67  ? -36.743  -29.704  208.623 1.00 128.08 ? 67   HIS B N   1 
ATOM   6303  C  CA  . HIS B  2  67  ? -35.434  -30.328  208.471 1.00 127.25 ? 67   HIS B CA  1 
ATOM   6304  C  C   . HIS B  2  67  ? -35.363  -31.671  209.194 1.00 128.85 ? 67   HIS B C   1 
ATOM   6305  O  O   . HIS B  2  67  ? -34.729  -32.608  208.709 1.00 129.18 ? 67   HIS B O   1 
ATOM   6306  C  CB  . HIS B  2  67  ? -34.329  -29.402  208.982 1.00 125.07 ? 67   HIS B CB  1 
ATOM   6307  C  CG  . HIS B  2  67  ? -33.757  -28.512  207.923 1.00 123.34 ? 67   HIS B CG  1 
ATOM   6308  N  ND1 . HIS B  2  67  ? -32.648  -28.856  207.181 1.00 122.46 ? 67   HIS B ND1 1 
ATOM   6309  C  CD2 . HIS B  2  67  ? -34.140  -27.291  207.482 1.00 122.43 ? 67   HIS B CD2 1 
ATOM   6310  C  CE1 . HIS B  2  67  ? -32.375  -27.888  206.326 1.00 121.10 ? 67   HIS B CE1 1 
ATOM   6311  N  NE2 . HIS B  2  67  ? -33.263  -26.925  206.490 1.00 121.05 ? 67   HIS B NE2 1 
ATOM   6312  N  N   . VAL B  2  68  ? -36.014  -31.763  210.349 1.00 120.51 ? 68   VAL B N   1 
ATOM   6313  C  CA  . VAL B  2  68  ? -36.042  -33.011  211.104 1.00 122.26 ? 68   VAL B CA  1 
ATOM   6314  C  C   . VAL B  2  68  ? -36.801  -34.076  210.323 1.00 124.27 ? 68   VAL B C   1 
ATOM   6315  O  O   . VAL B  2  68  ? -36.380  -35.229  210.262 1.00 125.25 ? 68   VAL B O   1 
ATOM   6316  C  CB  . VAL B  2  68  ? -36.683  -32.819  212.499 1.00 123.21 ? 68   VAL B CB  1 
ATOM   6317  C  CG1 . VAL B  2  68  ? -37.043  -34.164  213.137 1.00 125.57 ? 68   VAL B CG1 1 
ATOM   6318  C  CG2 . VAL B  2  68  ? -35.742  -32.039  213.408 1.00 121.50 ? 68   VAL B CG2 1 
ATOM   6319  N  N   . ALA B  2  69  ? -37.922  -33.685  209.727 1.00 124.97 ? 69   ALA B N   1 
ATOM   6320  C  CA  . ALA B  2  69  ? -38.742  -34.618  208.967 1.00 126.99 ? 69   ALA B CA  1 
ATOM   6321  C  C   . ALA B  2  69  ? -38.025  -35.050  207.693 1.00 126.46 ? 69   ALA B C   1 
ATOM   6322  O  O   . ALA B  2  69  ? -38.191  -36.178  207.231 1.00 128.09 ? 69   ALA B O   1 
ATOM   6323  C  CB  . ALA B  2  69  ? -40.085  -33.994  208.631 1.00 127.82 ? 69   ALA B CB  1 
ATOM   6324  N  N   . TRP B  2  70  ? -37.225  -34.147  207.133 1.00 130.30 ? 70   TRP B N   1 
ATOM   6325  C  CA  . TRP B  2  70  ? -36.563  -34.394  205.856 1.00 129.74 ? 70   TRP B CA  1 
ATOM   6326  C  C   . TRP B  2  70  ? -35.213  -35.084  206.035 1.00 129.10 ? 70   TRP B C   1 
ATOM   6327  O  O   . TRP B  2  70  ? -34.918  -36.064  205.348 1.00 130.03 ? 70   TRP B O   1 
ATOM   6328  C  CB  . TRP B  2  70  ? -36.390  -33.071  205.097 1.00 127.87 ? 70   TRP B CB  1 
ATOM   6329  C  CG  . TRP B  2  70  ? -35.703  -33.201  203.763 1.00 127.27 ? 70   TRP B CG  1 
ATOM   6330  C  CD1 . TRP B  2  70  ? -35.534  -34.342  203.034 1.00 128.55 ? 70   TRP B CD1 1 
ATOM   6331  C  CD2 . TRP B  2  70  ? -35.108  -32.145  202.995 1.00 125.39 ? 70   TRP B CD2 1 
ATOM   6332  N  NE1 . TRP B  2  70  ? -34.865  -34.066  201.867 1.00 127.59 ? 70   TRP B NE1 1 
ATOM   6333  C  CE2 . TRP B  2  70  ? -34.593  -32.725  201.818 1.00 125.66 ? 70   TRP B CE2 1 
ATOM   6334  C  CE3 . TRP B  2  70  ? -34.958  -30.769  203.190 1.00 123.62 ? 70   TRP B CE3 1 
ATOM   6335  C  CZ2 . TRP B  2  70  ? -33.940  -31.977  200.841 1.00 124.24 ? 70   TRP B CZ2 1 
ATOM   6336  C  CZ3 . TRP B  2  70  ? -34.308  -30.028  202.218 1.00 122.20 ? 70   TRP B CZ3 1 
ATOM   6337  C  CH2 . TRP B  2  70  ? -33.808  -30.634  201.059 1.00 122.52 ? 70   TRP B CH2 1 
ATOM   6338  N  N   . GLN B  2  71  ? -34.412  -34.595  206.975 1.00 121.63 ? 71   GLN B N   1 
ATOM   6339  C  CA  . GLN B  2  71  ? -33.027  -35.040  207.113 1.00 120.74 ? 71   GLN B CA  1 
ATOM   6340  C  C   . GLN B  2  71  ? -32.714  -35.618  208.492 1.00 121.36 ? 71   GLN B C   1 
ATOM   6341  O  O   . GLN B  2  71  ? -31.565  -35.957  208.780 1.00 120.68 ? 71   GLN B O   1 
ATOM   6342  C  CB  . GLN B  2  71  ? -32.095  -33.869  206.814 1.00 118.25 ? 71   GLN B CB  1 
ATOM   6343  C  CG  . GLN B  2  71  ? -32.237  -33.344  205.392 1.00 117.68 ? 71   GLN B CG  1 
ATOM   6344  C  CD  . GLN B  2  71  ? -31.694  -31.940  205.220 1.00 115.43 ? 71   GLN B CD  1 
ATOM   6345  O  OE1 . GLN B  2  71  ? -31.086  -31.377  206.130 1.00 114.19 ? 71   GLN B OE1 1 
ATOM   6346  N  NE2 . GLN B  2  71  ? -31.919  -31.362  204.046 1.00 115.01 ? 71   GLN B NE2 1 
ATOM   6347  N  N   . GLY B  2  72  ? -33.737  -35.740  209.335 1.00 136.56 ? 72   GLY B N   1 
ATOM   6348  C  CA  . GLY B  2  72  ? -33.554  -36.216  210.695 1.00 137.33 ? 72   GLY B CA  1 
ATOM   6349  C  C   . GLY B  2  72  ? -33.983  -37.659  210.882 1.00 139.84 ? 72   GLY B C   1 
ATOM   6350  O  O   . GLY B  2  72  ? -34.829  -38.166  210.145 1.00 141.29 ? 72   GLY B O   1 
ATOM   6351  N  N   . ASN B  2  73  ? -33.391  -38.318  211.873 1.00 128.16 ? 73   ASN B N   1 
ATOM   6352  C  CA  . ASN B  2  73  ? -33.710  -39.708  212.189 1.00 130.64 ? 73   ASN B CA  1 
ATOM   6353  C  C   . ASN B  2  73  ? -34.741  -39.811  213.312 1.00 132.35 ? 73   ASN B C   1 
ATOM   6354  O  O   . ASN B  2  73  ? -34.569  -40.586  214.254 1.00 133.74 ? 73   ASN B O   1 
ATOM   6355  C  CB  . ASN B  2  73  ? -32.437  -40.467  212.578 1.00 130.57 ? 73   ASN B CB  1 
ATOM   6356  C  CG  . ASN B  2  73  ? -31.723  -39.843  213.765 1.00 129.36 ? 73   ASN B CG  1 
ATOM   6357  O  OD1 . ASN B  2  73  ? -31.996  -38.701  214.137 1.00 128.11 ? 73   ASN B OD1 1 
ATOM   6358  N  ND2 . ASN B  2  73  ? -30.803  -40.591  214.364 1.00 129.83 ? 73   ASN B ND2 1 
ATOM   6359  N  N   . PHE B  2  74  ? -35.816  -39.035  213.205 1.00 152.29 ? 74   PHE B N   1 
ATOM   6360  C  CA  . PHE B  2  74  ? -36.832  -38.994  214.254 1.00 151.65 ? 74   PHE B CA  1 
ATOM   6361  C  C   . PHE B  2  74  ? -37.548  -40.330  214.420 1.00 150.60 ? 74   PHE B C   1 
ATOM   6362  O  O   . PHE B  2  74  ? -37.848  -40.739  215.542 1.00 152.14 ? 74   PHE B O   1 
ATOM   6363  C  CB  . PHE B  2  74  ? -37.854  -37.889  213.966 1.00 151.07 ? 74   PHE B CB  1 
ATOM   6364  C  CG  . PHE B  2  74  ? -38.977  -37.830  214.965 1.00 148.94 ? 74   PHE B CG  1 
ATOM   6365  C  CD1 . PHE B  2  74  ? -38.765  -37.331  216.240 1.00 148.62 ? 74   PHE B CD1 1 
ATOM   6366  C  CD2 . PHE B  2  74  ? -40.250  -38.260  214.624 1.00 151.01 ? 74   PHE B CD2 1 
ATOM   6367  C  CE1 . PHE B  2  74  ? -39.795  -37.276  217.160 1.00 150.36 ? 74   PHE B CE1 1 
ATOM   6368  C  CE2 . PHE B  2  74  ? -41.285  -38.204  215.540 1.00 152.74 ? 74   PHE B CE2 1 
ATOM   6369  C  CZ  . PHE B  2  74  ? -41.058  -37.711  216.808 1.00 152.42 ? 74   PHE B CZ  1 
ATOM   6370  N  N   . GLU B  2  75  ? -37.822  -41.013  213.314 1.00 140.30 ? 75   GLU B N   1 
ATOM   6371  C  CA  . GLU B  2  75  ? -38.552  -42.273  213.378 1.00 143.19 ? 75   GLU B CA  1 
ATOM   6372  C  C   . GLU B  2  75  ? -37.688  -43.386  213.968 1.00 144.18 ? 75   GLU B C   1 
ATOM   6373  O  O   . GLU B  2  75  ? -38.201  -44.282  214.638 1.00 146.59 ? 75   GLU B O   1 
ATOM   6374  C  CB  . GLU B  2  75  ? -39.069  -42.672  211.996 1.00 143.92 ? 75   GLU B CB  1 
ATOM   6375  C  CG  . GLU B  2  75  ? -40.141  -41.726  211.463 1.00 143.59 ? 75   GLU B CG  1 
ATOM   6376  C  CD  . GLU B  2  75  ? -40.962  -42.322  210.333 1.00 145.23 ? 75   GLU B CD  1 
ATOM   6377  O  OE1 . GLU B  2  75  ? -40.794  -43.522  210.031 1.00 146.85 ? 75   GLU B OE1 1 
ATOM   6378  O  OE2 . GLU B  2  75  ? -41.784  -41.586  209.749 1.00 145.01 ? 75   GLU B OE2 1 
ATOM   6379  N  N   . GLN B  2  76  ? -36.383  -43.334  213.720 1.00 139.27 ? 76   GLN B N   1 
ATOM   6380  C  CA  . GLN B  2  76  ? -35.464  -44.288  214.333 1.00 140.06 ? 76   GLN B CA  1 
ATOM   6381  C  C   . GLN B  2  76  ? -35.172  -43.893  215.776 1.00 139.80 ? 76   GLN B C   1 
ATOM   6382  O  O   . GLN B  2  76  ? -34.730  -44.718  216.574 1.00 141.12 ? 76   GLN B O   1 
ATOM   6383  C  CB  . GLN B  2  76  ? -34.151  -44.380  213.551 1.00 138.40 ? 76   GLN B CB  1 
ATOM   6384  C  CG  . GLN B  2  76  ? -34.298  -44.886  212.128 1.00 138.83 ? 76   GLN B CG  1 
ATOM   6385  C  CD  . GLN B  2  76  ? -34.629  -43.778  211.152 1.00 137.03 ? 76   GLN B CD  1 
ATOM   6386  O  OE1 . GLN B  2  76  ? -35.781  -43.604  210.757 1.00 137.92 ? 76   GLN B OE1 1 
ATOM   6387  N  NE2 . GLN B  2  76  ? -33.613  -43.019  210.756 1.00 134.57 ? 76   GLN B NE2 1 
ATOM   6388  N  N   . TRP B  2  77  ? -35.421  -42.630  216.110 1.00 137.31 ? 77   TRP B N   1 
ATOM   6389  C  CA  . TRP B  2  77  ? -35.115  -42.126  217.444 1.00 136.92 ? 77   TRP B CA  1 
ATOM   6390  C  C   . TRP B  2  77  ? -36.102  -42.668  218.473 1.00 139.58 ? 77   TRP B C   1 
ATOM   6391  O  O   . TRP B  2  77  ? -35.710  -43.076  219.565 1.00 140.53 ? 77   TRP B O   1 
ATOM   6392  C  CB  . TRP B  2  77  ? -35.117  -40.596  217.459 1.00 134.54 ? 77   TRP B CB  1 
ATOM   6393  C  CG  . TRP B  2  77  ? -34.670  -40.014  218.769 1.00 133.97 ? 77   TRP B CG  1 
ATOM   6394  C  CD1 . TRP B  2  77  ? -33.385  -39.888  219.211 1.00 132.65 ? 77   TRP B CD1 1 
ATOM   6395  C  CD2 . TRP B  2  77  ? -35.503  -39.472  219.801 1.00 134.80 ? 77   TRP B CD2 1 
ATOM   6396  N  NE1 . TRP B  2  77  ? -33.366  -39.307  220.455 1.00 132.62 ? 77   TRP B NE1 1 
ATOM   6397  C  CE2 . TRP B  2  77  ? -34.653  -39.041  220.840 1.00 133.94 ? 77   TRP B CE2 1 
ATOM   6398  C  CE3 . TRP B  2  77  ? -36.884  -39.310  219.948 1.00 136.28 ? 77   TRP B CE3 1 
ATOM   6399  C  CZ2 . TRP B  2  77  ? -35.139  -38.460  222.008 1.00 134.54 ? 77   TRP B CZ2 1 
ATOM   6400  C  CZ3 . TRP B  2  77  ? -37.364  -38.733  221.110 1.00 136.86 ? 77   TRP B CZ3 1 
ATOM   6401  C  CH2 . TRP B  2  77  ? -36.493  -38.315  222.125 1.00 136.00 ? 77   TRP B CH2 1 
ATOM   6402  N  N   . ILE B  2  78  ? -37.382  -42.672  218.119 1.00 140.88 ? 78   ILE B N   1 
ATOM   6403  C  CA  . ILE B  2  78  ? -38.426  -43.120  219.035 1.00 143.50 ? 78   ILE B CA  1 
ATOM   6404  C  C   . ILE B  2  78  ? -38.293  -44.607  219.374 1.00 146.04 ? 78   ILE B C   1 
ATOM   6405  O  O   . ILE B  2  78  ? -38.862  -45.075  220.359 1.00 148.27 ? 78   ILE B O   1 
ATOM   6406  C  CB  . ILE B  2  78  ? -39.833  -42.846  218.458 1.00 144.44 ? 78   ILE B CB  1 
ATOM   6407  C  CG1 . ILE B  2  78  ? -39.964  -43.426  217.046 1.00 144.66 ? 78   ILE B CG1 1 
ATOM   6408  C  CG2 . ILE B  2  78  ? -40.104  -41.347  218.433 1.00 142.38 ? 78   ILE B CG2 1 
ATOM   6409  C  CD1 . ILE B  2  78  ? -41.384  -43.440  216.515 1.00 146.23 ? 78   ILE B CD1 1 
ATOM   6410  N  N   . LYS B  2  79  ? -37.544  -45.345  218.559 1.00 187.16 ? 79   LYS B N   1 
ATOM   6411  C  CA  . LYS B  2  79  ? -37.344  -46.776  218.780 1.00 205.58 ? 79   LYS B CA  1 
ATOM   6412  C  C   . LYS B  2  79  ? -36.346  -47.057  219.901 1.00 214.12 ? 79   LYS B C   1 
ATOM   6413  O  O   . LYS B  2  79  ? -36.501  -48.024  220.648 1.00 216.23 ? 79   LYS B O   1 
ATOM   6414  C  CB  . LYS B  2  79  ? -36.868  -47.451  217.489 1.00 208.39 ? 79   LYS B CB  1 
ATOM   6415  C  CG  . LYS B  2  79  ? -37.896  -47.464  216.360 1.00 197.70 ? 79   LYS B CG  1 
ATOM   6416  C  CD  . LYS B  2  79  ? -39.225  -48.096  216.777 1.00 192.95 ? 79   LYS B CD  1 
ATOM   6417  C  CE  . LYS B  2  79  ? -39.045  -49.507  217.335 1.00 202.75 ? 79   LYS B CE  1 
ATOM   6418  N  NZ  . LYS B  2  79  ? -40.330  -50.096  217.796 1.00 216.19 ? 79   LYS B NZ  1 
ATOM   6419  N  N   . ASP B  2  80  ? -35.325  -46.214  220.014 1.00 217.26 ? 80   ASP B N   1 
ATOM   6420  C  CA  . ASP B  2  80  ? -34.285  -46.398  221.020 1.00 211.81 ? 80   ASP B CA  1 
ATOM   6421  C  C   . ASP B  2  80  ? -33.696  -45.041  221.394 1.00 195.33 ? 80   ASP B C   1 
ATOM   6422  O  O   . ASP B  2  80  ? -32.499  -44.811  221.231 1.00 184.41 ? 80   ASP B O   1 
ATOM   6423  C  CB  . ASP B  2  80  ? -33.193  -47.339  220.499 1.00 218.57 ? 80   ASP B CB  1 
ATOM   6424  C  CG  . ASP B  2  80  ? -32.307  -47.886  221.607 1.00 218.54 ? 80   ASP B CG  1 
ATOM   6425  O  OD1 . ASP B  2  80  ? -32.003  -47.145  222.565 1.00 220.30 ? 80   ASP B OD1 1 
ATOM   6426  O  OD2 . ASP B  2  80  ? -31.907  -49.065  221.514 1.00 215.70 ? 80   ASP B OD2 1 
ATOM   6427  N  N   . PRO B  2  81  ? -34.539  -44.143  221.927 1.00 143.05 ? 81   PRO B N   1 
ATOM   6428  C  CA  . PRO B  2  81  ? -34.175  -42.737  222.136 1.00 140.49 ? 81   PRO B CA  1 
ATOM   6429  C  C   . PRO B  2  81  ? -33.059  -42.535  223.156 1.00 139.79 ? 81   PRO B C   1 
ATOM   6430  O  O   . PRO B  2  81  ? -32.537  -41.425  223.273 1.00 137.54 ? 81   PRO B O   1 
ATOM   6431  C  CB  . PRO B  2  81  ? -35.479  -42.112  222.639 1.00 141.37 ? 81   PRO B CB  1 
ATOM   6432  C  CG  . PRO B  2  81  ? -36.200  -43.234  223.294 1.00 144.61 ? 81   PRO B CG  1 
ATOM   6433  C  CD  . PRO B  2  81  ? -35.865  -44.456  222.488 1.00 145.57 ? 81   PRO B CD  1 
ATOM   6434  N  N   . LEU B  2  82  ? -32.698  -43.592  223.877 1.00 141.48 ? 82   LEU B N   1 
ATOM   6435  C  CA  . LEU B  2  82  ? -31.708  -43.489  224.943 1.00 141.25 ? 82   LEU B CA  1 
ATOM   6436  C  C   . LEU B  2  82  ? -30.293  -43.837  224.474 1.00 139.95 ? 82   LEU B C   1 
ATOM   6437  O  O   . LEU B  2  82  ? -29.338  -43.693  225.239 1.00 139.49 ? 82   LEU B O   1 
ATOM   6438  C  CB  . LEU B  2  82  ? -32.107  -44.392  226.113 1.00 144.33 ? 82   LEU B CB  1 
ATOM   6439  C  CG  . LEU B  2  82  ? -32.320  -43.687  227.457 1.00 144.75 ? 82   LEU B CG  1 
ATOM   6440  C  CD1 . LEU B  2  82  ? -33.438  -42.655  227.372 1.00 144.16 ? 82   LEU B CD1 1 
ATOM   6441  C  CD2 . LEU B  2  82  ? -32.618  -44.699  228.552 1.00 147.99 ? 82   LEU B CD2 1 
ATOM   6442  N  N   . ASN B  2  83  ? -30.160  -44.293  223.230 1.00 172.65 ? 83   ASN B N   1 
ATOM   6443  C  CA  . ASN B  2  83  ? -28.850  -44.642  222.674 1.00 171.50 ? 83   ASN B CA  1 
ATOM   6444  C  C   . ASN B  2  83  ? -28.554  -43.988  221.324 1.00 169.03 ? 83   ASN B C   1 
ATOM   6445  O  O   . ASN B  2  83  ? -27.392  -43.737  221.003 1.00 167.30 ? 83   ASN B O   1 
ATOM   6446  C  CB  . ASN B  2  83  ? -28.717  -46.162  222.534 1.00 173.89 ? 83   ASN B CB  1 
ATOM   6447  C  CG  . ASN B  2  83  ? -28.375  -46.841  223.847 1.00 175.92 ? 83   ASN B CG  1 
ATOM   6448  O  OD1 . ASN B  2  83  ? -27.245  -46.750  224.326 1.00 176.50 ? 83   ASN B OD1 1 
ATOM   6449  N  ND2 . ASN B  2  83  ? -29.341  -47.547  224.423 1.00 178.63 ? 83   ASN B ND2 1 
ATOM   6450  N  N   . ILE B  2  84  ? -29.589  -43.715  220.534 1.00 165.10 ? 84   ILE B N   1 
ATOM   6451  C  CA  . ILE B  2  84  ? -29.399  -43.083  219.228 1.00 162.94 ? 84   ILE B CA  1 
ATOM   6452  C  C   . ILE B  2  84  ? -29.440  -41.558  219.342 1.00 160.61 ? 84   ILE B C   1 
ATOM   6453  O  O   . ILE B  2  84  ? -30.249  -41.002  220.085 1.00 161.04 ? 84   ILE B O   1 
ATOM   6454  C  CB  . ILE B  2  84  ? -30.461  -43.567  218.207 1.00 164.11 ? 84   ILE B CB  1 
ATOM   6455  C  CG1 . ILE B  2  84  ? -30.103  -43.116  216.787 1.00 162.16 ? 84   ILE B CG1 1 
ATOM   6456  C  CG2 . ILE B  2  84  ? -31.840  -43.063  218.555 1.00 164.90 ? 84   ILE B CG2 1 
ATOM   6457  C  CD1 . ILE B  2  84  ? -28.903  -43.822  216.201 1.00 167.77 ? 84   ILE B CD1 1 
ATOM   6458  N  N   . ARG B  2  85  ? -28.551  -40.891  218.609 1.00 138.09 ? 85   ARG B N   1 
ATOM   6459  C  CA  . ARG B  2  85  ? -28.447  -39.435  218.652 1.00 135.79 ? 85   ARG B CA  1 
ATOM   6460  C  C   . ARG B  2  85  ? -29.470  -38.781  217.723 1.00 135.21 ? 85   ARG B C   1 
ATOM   6461  O  O   . ARG B  2  85  ? -29.638  -39.219  216.584 1.00 135.38 ? 85   ARG B O   1 
ATOM   6462  C  CB  . ARG B  2  85  ? -27.040  -38.976  218.258 1.00 133.59 ? 85   ARG B CB  1 
ATOM   6463  C  CG  . ARG B  2  85  ? -25.903  -39.616  219.039 1.00 134.06 ? 85   ARG B CG  1 
ATOM   6464  C  CD  . ARG B  2  85  ? -25.833  -39.112  220.472 1.00 134.21 ? 85   ARG B CD  1 
ATOM   6465  N  NE  . ARG B  2  85  ? -26.508  -40.018  221.401 1.00 136.85 ? 85   ARG B NE  1 
ATOM   6466  C  CZ  . ARG B  2  85  ? -27.622  -39.744  222.075 1.00 137.95 ? 85   ARG B CZ  1 
ATOM   6467  N  NH1 . ARG B  2  85  ? -28.228  -38.568  221.958 1.00 142.09 ? 85   ARG B NH1 1 
ATOM   6468  N  NH2 . ARG B  2  85  ? -28.135  -40.659  222.887 1.00 140.49 ? 85   ARG B NH2 1 
ATOM   6469  N  N   . PRO B  2  86  ? -30.162  -37.732  218.200 1.00 126.81 ? 86   PRO B N   1 
ATOM   6470  C  CA  . PRO B  2  86  ? -31.107  -37.037  217.319 1.00 126.24 ? 86   PRO B CA  1 
ATOM   6471  C  C   . PRO B  2  86  ? -30.391  -36.152  216.301 1.00 123.74 ? 86   PRO B C   1 
ATOM   6472  O  O   . PRO B  2  86  ? -29.444  -35.457  216.666 1.00 122.07 ? 86   PRO B O   1 
ATOM   6473  C  CB  . PRO B  2  86  ? -31.933  -36.191  218.291 1.00 126.49 ? 86   PRO B CB  1 
ATOM   6474  C  CG  . PRO B  2  86  ? -31.009  -35.922  219.422 1.00 125.90 ? 86   PRO B CG  1 
ATOM   6475  C  CD  . PRO B  2  86  ? -30.120  -37.129  219.545 1.00 126.78 ? 86   PRO B CD  1 
ATOM   6476  N  N   . ILE B  2  87  ? -30.837  -36.179  215.048 1.00 122.27 ? 87   ILE B N   1 
ATOM   6477  C  CA  . ILE B  2  87  ? -30.205  -35.389  213.994 1.00 120.12 ? 87   ILE B CA  1 
ATOM   6478  C  C   . ILE B  2  87  ? -30.881  -34.029  213.863 1.00 118.95 ? 87   ILE B C   1 
ATOM   6479  O  O   . ILE B  2  87  ? -32.107  -33.929  213.880 1.00 120.07 ? 87   ILE B O   1 
ATOM   6480  C  CB  . ILE B  2  87  ? -30.250  -36.116  212.632 1.00 120.62 ? 87   ILE B CB  1 
ATOM   6481  C  CG1 . ILE B  2  87  ? -29.399  -37.387  212.673 1.00 121.58 ? 87   ILE B CG1 1 
ATOM   6482  C  CG2 . ILE B  2  87  ? -29.744  -35.205  211.511 1.00 118.55 ? 87   ILE B CG2 1 
ATOM   6483  C  CD1 . ILE B  2  87  ? -29.620  -38.314  211.491 1.00 122.71 ? 87   ILE B CD1 1 
ATOM   6484  N  N   . ALA B  2  88  ? -30.069  -32.986  213.723 1.00 116.77 ? 88   ALA B N   1 
ATOM   6485  C  CA  . ALA B  2  88  ? -30.579  -31.635  213.519 1.00 115.54 ? 88   ALA B CA  1 
ATOM   6486  C  C   . ALA B  2  88  ? -30.937  -31.406  212.056 1.00 115.12 ? 88   ALA B C   1 
ATOM   6487  O  O   . ALA B  2  88  ? -32.097  -31.173  211.719 1.00 115.91 ? 88   ALA B O   1 
ATOM   6488  C  CB  . ALA B  2  88  ? -29.557  -30.611  213.983 1.00 113.52 ? 88   ALA B CB  1 
ATOM   6489  N  N   . HIS B  2  89  ? -29.933  -31.479  211.189 1.00 113.97 ? 89   HIS B N   1 
ATOM   6490  C  CA  . HIS B  2  89  ? -30.138  -31.284  209.760 1.00 113.60 ? 89   HIS B CA  1 
ATOM   6491  C  C   . HIS B  2  89  ? -28.934  -31.800  208.980 1.00 112.93 ? 89   HIS B C   1 
ATOM   6492  O  O   . HIS B  2  89  ? -27.923  -32.184  209.568 1.00 112.57 ? 89   HIS B O   1 
ATOM   6493  C  CB  . HIS B  2  89  ? -30.388  -29.806  209.452 1.00 112.09 ? 89   HIS B CB  1 
ATOM   6494  C  CG  . HIS B  2  89  ? -29.246  -28.911  209.821 1.00 110.08 ? 89   HIS B CG  1 
ATOM   6495  N  ND1 . HIS B  2  89  ? -28.747  -27.950  208.969 1.00 108.45 ? 89   HIS B ND1 1 
ATOM   6496  C  CD2 . HIS B  2  89  ? -28.498  -28.840  210.947 1.00 109.56 ? 89   HIS B CD2 1 
ATOM   6497  C  CE1 . HIS B  2  89  ? -27.747  -27.319  209.557 1.00 106.99 ? 89   HIS B CE1 1 
ATOM   6498  N  NE2 . HIS B  2  89  ? -27.571  -27.845  210.755 1.00 107.62 ? 89   HIS B NE2 1 
ATOM   6499  N  N   . ALA B  2  90  ? -29.044  -31.801  207.656 1.00 112.85 ? 90   ALA B N   1 
ATOM   6500  C  CA  . ALA B  2  90  ? -27.966  -32.294  206.806 1.00 112.38 ? 90   ALA B CA  1 
ATOM   6501  C  C   . ALA B  2  90  ? -26.827  -31.289  206.733 1.00 110.20 ? 90   ALA B C   1 
ATOM   6502  O  O   . ALA B  2  90  ? -26.981  -30.134  207.127 1.00 109.04 ? 90   ALA B O   1 
ATOM   6503  C  CB  . ALA B  2  90  ? -28.489  -32.598  205.410 1.00 113.17 ? 90   ALA B CB  1 
ATOM   6504  N  N   . ILE B  2  91  ? -25.686  -31.746  206.227 1.00 109.76 ? 91   ILE B N   1 
ATOM   6505  C  CA  . ILE B  2  91  ? -24.534  -30.882  205.991 1.00 107.84 ? 91   ILE B CA  1 
ATOM   6506  C  C   . ILE B  2  91  ? -24.152  -30.949  204.521 1.00 107.64 ? 91   ILE B C   1 
ATOM   6507  O  O   . ILE B  2  91  ? -24.076  -32.028  203.932 1.00 108.88 ? 91   ILE B O   1 
ATOM   6508  C  CB  . ILE B  2  91  ? -23.326  -31.272  206.867 1.00 107.40 ? 91   ILE B CB  1 
ATOM   6509  C  CG1 . ILE B  2  91  ? -23.592  -30.902  208.325 1.00 107.30 ? 91   ILE B CG1 1 
ATOM   6510  C  CG2 . ILE B  2  91  ? -22.050  -30.576  206.386 1.00 105.66 ? 91   ILE B CG2 1 
ATOM   6511  C  CD1 . ILE B  2  91  ? -22.623  -31.527  209.306 1.00 107.46 ? 91   ILE B CD1 1 
ATOM   6512  N  N   . TRP B  2  92  ? -23.920  -29.780  203.939 1.00 115.99 ? 92   TRP B N   1 
ATOM   6513  C  CA  . TRP B  2  92  ? -23.475  -29.676  202.560 1.00 115.71 ? 92   TRP B CA  1 
ATOM   6514  C  C   . TRP B  2  92  ? -22.430  -28.574  202.457 1.00 113.79 ? 92   TRP B C   1 
ATOM   6515  O  O   . TRP B  2  92  ? -22.761  -27.416  202.203 1.00 112.88 ? 92   TRP B O   1 
ATOM   6516  C  CB  . TRP B  2  92  ? -24.656  -29.390  201.631 1.00 116.44 ? 92   TRP B CB  1 
ATOM   6517  C  CG  . TRP B  2  92  ? -24.304  -29.503  200.190 1.00 116.61 ? 92   TRP B CG  1 
ATOM   6518  C  CD1 . TRP B  2  92  ? -23.640  -28.586  199.431 1.00 115.36 ? 92   TRP B CD1 1 
ATOM   6519  C  CD2 . TRP B  2  92  ? -24.596  -30.605  199.325 1.00 118.28 ? 92   TRP B CD2 1 
ATOM   6520  N  NE1 . TRP B  2  92  ? -23.499  -29.049  198.146 1.00 116.15 ? 92   TRP B NE1 1 
ATOM   6521  C  CE2 . TRP B  2  92  ? -24.078  -30.287  198.055 1.00 117.94 ? 92   TRP B CE2 1 
ATOM   6522  C  CE3 . TRP B  2  92  ? -25.245  -31.831  199.502 1.00 120.13 ? 92   TRP B CE3 1 
ATOM   6523  C  CZ2 . TRP B  2  92  ? -24.188  -31.151  196.967 1.00 119.39 ? 92   TRP B CZ2 1 
ATOM   6524  C  CZ3 . TRP B  2  92  ? -25.355  -32.685  198.421 1.00 121.54 ? 92   TRP B CZ3 1 
ATOM   6525  C  CH2 . TRP B  2  92  ? -24.830  -32.341  197.169 1.00 121.17 ? 92   TRP B CH2 1 
ATOM   6526  N  N   . ASP B  2  93  ? -21.169  -28.942  202.658 1.00 119.78 ? 93   ASP B N   1 
ATOM   6527  C  CA  . ASP B  2  93  ? -20.074  -27.977  202.647 1.00 118.06 ? 93   ASP B CA  1 
ATOM   6528  C  C   . ASP B  2  93  ? -18.942  -28.429  201.721 1.00 118.00 ? 93   ASP B C   1 
ATOM   6529  O  O   . ASP B  2  93  ? -18.227  -29.378  202.040 1.00 118.54 ? 93   ASP B O   1 
ATOM   6530  C  CB  . ASP B  2  93  ? -19.544  -27.778  204.064 1.00 117.35 ? 93   ASP B CB  1 
ATOM   6531  C  CG  . ASP B  2  93  ? -18.422  -26.760  204.131 1.00 115.64 ? 93   ASP B CG  1 
ATOM   6532  O  OD1 . ASP B  2  93  ? -18.323  -25.917  203.216 1.00 114.87 ? 93   ASP B OD1 1 
ATOM   6533  O  OD2 . ASP B  2  93  ? -17.628  -26.810  205.092 1.00 115.17 ? 93   ASP B OD2 1 
ATOM   6534  N  N   . PRO B  2  94  ? -18.762  -27.745  200.575 1.00 101.17 ? 94   PRO B N   1 
ATOM   6535  C  CA  . PRO B  2  94  ? -17.720  -28.155  199.623 1.00 101.26 ? 94   PRO B CA  1 
ATOM   6536  C  C   . PRO B  2  94  ? -16.307  -28.072  200.199 1.00 100.27 ? 94   PRO B C   1 
ATOM   6537  O  O   . PRO B  2  94  ? -15.363  -28.563  199.580 1.00 100.49 ? 94   PRO B O   1 
ATOM   6538  C  CB  . PRO B  2  94  ? -17.880  -27.162  198.467 1.00 100.73 ? 94   PRO B CB  1 
ATOM   6539  C  CG  . PRO B  2  94  ? -19.224  -26.560  198.632 1.00 100.85 ? 94   PRO B CG  1 
ATOM   6540  C  CD  . PRO B  2  94  ? -19.530  -26.588  200.084 1.00 100.60 ? 94   PRO B CD  1 
ATOM   6541  N  N   . HIS B  2  95  ? -16.168  -27.444  201.361 1.00 114.23 ? 95   HIS B N   1 
ATOM   6542  C  CA  . HIS B  2  95  ? -14.862  -27.234  201.973 1.00 113.26 ? 95   HIS B CA  1 
ATOM   6543  C  C   . HIS B  2  95  ? -14.416  -28.435  202.799 1.00 114.13 ? 95   HIS B C   1 
ATOM   6544  O  O   . HIS B  2  95  ? -13.285  -28.479  203.281 1.00 134.04 ? 95   HIS B O   1 
ATOM   6545  C  CB  . HIS B  2  95  ? -14.897  -25.972  202.828 1.00 111.88 ? 95   HIS B CB  1 
ATOM   6546  C  CG  . HIS B  2  95  ? -15.137  -24.733  202.028 1.00 110.98 ? 95   HIS B CG  1 
ATOM   6547  N  ND1 . HIS B  2  95  ? -14.243  -24.280  201.083 1.00 110.38 ? 95   HIS B ND1 1 
ATOM   6548  C  CD2 . HIS B  2  95  ? -16.184  -23.877  201.998 1.00 110.73 ? 95   HIS B CD2 1 
ATOM   6549  C  CE1 . HIS B  2  95  ? -14.719  -23.185  200.520 1.00 109.79 ? 95   HIS B CE1 1 
ATOM   6550  N  NE2 . HIS B  2  95  ? -15.897  -22.920  201.055 1.00 109.98 ? 95   HIS B NE2 1 
ATOM   6551  N  N   . PHE B  2  96  ? -15.304  -29.410  202.959 1.00 100.60 ? 96   PHE B N   1 
ATOM   6552  C  CA  . PHE B  2  96  ? -14.988  -30.599  203.737 1.00 101.67 ? 96   PHE B CA  1 
ATOM   6553  C  C   . PHE B  2  96  ? -13.952  -31.474  203.046 1.00 102.29 ? 96   PHE B C   1 
ATOM   6554  O  O   . PHE B  2  96  ? -13.821  -31.464  201.821 1.00 102.43 ? 96   PHE B O   1 
ATOM   6555  C  CB  . PHE B  2  96  ? -16.251  -31.415  204.004 1.00 103.20 ? 96   PHE B CB  1 
ATOM   6556  C  CG  . PHE B  2  96  ? -16.933  -31.063  205.291 1.00 103.07 ? 96   PHE B CG  1 
ATOM   6557  C  CD1 . PHE B  2  96  ? -17.113  -29.742  205.654 1.00 101.66 ? 96   PHE B CD1 1 
ATOM   6558  C  CD2 . PHE B  2  96  ? -17.389  -32.054  206.141 1.00 104.47 ? 96   PHE B CD2 1 
ATOM   6559  C  CE1 . PHE B  2  96  ? -17.736  -29.413  206.840 1.00 101.65 ? 96   PHE B CE1 1 
ATOM   6560  C  CE2 . PHE B  2  96  ? -18.014  -31.734  207.330 1.00 104.49 ? 96   PHE B CE2 1 
ATOM   6561  C  CZ  . PHE B  2  96  ? -18.188  -30.410  207.680 1.00 103.07 ? 96   PHE B CZ  1 
ATOM   6562  N  N   . GLY B  2  97  ? -13.223  -32.232  203.859 1.00 102.78 ? 97   GLY B N   1 
ATOM   6563  C  CA  . GLY B  2  97  ? -12.275  -33.215  203.377 1.00 103.64 ? 97   GLY B CA  1 
ATOM   6564  C  C   . GLY B  2  97  ? -12.705  -34.607  203.793 1.00 105.51 ? 97   GLY B C   1 
ATOM   6565  O  O   . GLY B  2  97  ? -13.754  -34.784  204.414 1.00 106.12 ? 97   GLY B O   1 
ATOM   6566  N  N   . GLU B  2  98  ? -11.889  -35.597  203.449 1.00 145.78 ? 98   GLU B N   1 
ATOM   6567  C  CA  . GLU B  2  98  ? -12.199  -36.990  203.741 1.00 147.73 ? 98   GLU B CA  1 
ATOM   6568  C  C   . GLU B  2  98  ? -12.356  -37.210  205.241 1.00 148.01 ? 98   GLU B C   1 
ATOM   6569  O  O   . GLU B  2  98  ? -13.285  -37.884  205.688 1.00 149.31 ? 98   GLU B O   1 
ATOM   6570  C  CB  . GLU B  2  98  ? -11.105  -37.909  203.196 1.00 157.54 ? 98   GLU B CB  1 
ATOM   6571  C  CG  . GLU B  2  98  ? -11.023  -37.958  201.672 1.00 180.90 ? 98   GLU B CG  1 
ATOM   6572  C  CD  . GLU B  2  98  ? -10.433  -36.694  201.068 1.00 196.21 ? 98   GLU B CD  1 
ATOM   6573  O  OE1 . GLU B  2  98  ? -9.902   -35.857  201.830 1.00 194.64 ? 98   GLU B OE1 1 
ATOM   6574  O  OE2 . GLU B  2  98  ? -10.502  -36.535  199.831 1.00 208.81 ? 98   GLU B OE2 1 
ATOM   6575  N  N   . GLY B  2  99  ? -11.442  -36.630  206.010 1.00 107.61 ? 99   GLY B N   1 
ATOM   6576  C  CA  . GLY B  2  99  ? -11.456  -36.757  207.456 1.00 107.84 ? 99   GLY B CA  1 
ATOM   6577  C  C   . GLY B  2  99  ? -12.653  -36.075  208.088 1.00 107.43 ? 99   GLY B C   1 
ATOM   6578  O  O   . GLY B  2  99  ? -13.078  -36.439  209.186 1.00 108.24 ? 99   GLY B O   1 
ATOM   6579  N  N   . ALA B  2  100 ? -13.199  -35.083  207.391 1.00 107.69 ? 100  ALA B N   1 
ATOM   6580  C  CA  . ALA B  2  100 ? -14.320  -34.308  207.907 1.00 107.22 ? 100  ALA B CA  1 
ATOM   6581  C  C   . ALA B  2  100 ? -15.653  -34.986  207.615 1.00 108.70 ? 100  ALA B C   1 
ATOM   6582  O  O   . ALA B  2  100 ? -16.557  -34.968  208.448 1.00 109.23 ? 100  ALA B O   1 
ATOM   6583  C  CB  . ALA B  2  100 ? -14.301  -32.912  207.315 1.00 105.41 ? 100  ALA B CB  1 
ATOM   6584  N  N   . VAL B  2  101 ? -15.774  -35.582  206.433 1.00 108.07 ? 101  VAL B N   1 
ATOM   6585  C  CA  . VAL B  2  101 ? -16.995  -36.288  206.066 1.00 109.63 ? 101  VAL B CA  1 
ATOM   6586  C  C   . VAL B  2  101 ? -17.160  -37.511  206.962 1.00 111.44 ? 101  VAL B C   1 
ATOM   6587  O  O   . VAL B  2  101 ? -18.243  -37.769  207.485 1.00 112.45 ? 101  VAL B O   1 
ATOM   6588  C  CB  . VAL B  2  101 ? -16.981  -36.717  204.581 1.00 110.22 ? 101  VAL B CB  1 
ATOM   6589  C  CG1 . VAL B  2  101 ? -18.179  -37.604  204.252 1.00 112.12 ? 101  VAL B CG1 1 
ATOM   6590  C  CG2 . VAL B  2  101 ? -16.976  -35.493  203.680 1.00 108.65 ? 101  VAL B CG2 1 
ATOM   6591  N  N   . ASN B  2  102 ? -16.072  -38.253  207.141 1.00 138.57 ? 102  ASN B N   1 
ATOM   6592  C  CA  . ASN B  2  102 ? -16.095  -39.472  207.939 1.00 140.43 ? 102  ASN B CA  1 
ATOM   6593  C  C   . ASN B  2  102 ? -16.329  -39.202  209.423 1.00 140.37 ? 102  ASN B C   1 
ATOM   6594  O  O   . ASN B  2  102 ? -16.687  -40.107  210.175 1.00 142.06 ? 102  ASN B O   1 
ATOM   6595  C  CB  . ASN B  2  102 ? -14.780  -40.236  207.770 1.00 140.90 ? 102  ASN B CB  1 
ATOM   6596  C  CG  . ASN B  2  102 ? -14.539  -40.676  206.339 1.00 141.34 ? 102  ASN B CG  1 
ATOM   6597  O  OD1 . ASN B  2  102 ? -15.479  -40.930  205.586 1.00 142.15 ? 102  ASN B OD1 1 
ATOM   6598  N  ND2 . ASN B  2  102 ? -13.269  -40.777  205.960 1.00 140.92 ? 102  ASN B ND2 1 
ATOM   6599  N  N   . ALA B  2  103 ? -16.132  -37.954  209.835 1.00 120.41 ? 103  ALA B N   1 
ATOM   6600  C  CA  . ALA B  2  103 ? -16.248  -37.579  211.241 1.00 120.26 ? 103  ALA B CA  1 
ATOM   6601  C  C   . ALA B  2  103 ? -17.669  -37.153  211.598 1.00 120.54 ? 103  ALA B C   1 
ATOM   6602  O  O   . ALA B  2  103 ? -18.140  -37.405  212.707 1.00 121.50 ? 103  ALA B O   1 
ATOM   6603  C  CB  . ALA B  2  103 ? -15.273  -36.463  211.564 1.00 118.30 ? 103  ALA B CB  1 
ATOM   6604  N  N   . PHE B  2  104 ? -18.343  -36.510  210.652 1.00 128.04 ? 104  PHE B N   1 
ATOM   6605  C  CA  . PHE B  2  104 ? -19.684  -35.981  210.879 1.00 128.19 ? 104  PHE B CA  1 
ATOM   6606  C  C   . PHE B  2  104 ? -20.751  -36.933  210.354 1.00 130.06 ? 104  PHE B C   1 
ATOM   6607  O  O   . PHE B  2  104 ? -21.947  -36.688  210.512 1.00 130.58 ? 104  PHE B O   1 
ATOM   6608  C  CB  . PHE B  2  104 ? -19.818  -34.608  210.225 1.00 126.31 ? 104  PHE B CB  1 
ATOM   6609  C  CG  . PHE B  2  104 ? -19.065  -33.532  210.946 1.00 124.62 ? 104  PHE B CG  1 
ATOM   6610  C  CD1 . PHE B  2  104 ? -17.681  -33.543  210.973 1.00 123.82 ? 104  PHE B CD1 1 
ATOM   6611  C  CD2 . PHE B  2  104 ? -19.735  -32.514  211.601 1.00 123.94 ? 104  PHE B CD2 1 
ATOM   6612  C  CE1 . PHE B  2  104 ? -16.979  -32.564  211.638 1.00 122.38 ? 104  PHE B CE1 1 
ATOM   6613  C  CE2 . PHE B  2  104 ? -19.036  -31.528  212.268 1.00 122.50 ? 104  PHE B CE2 1 
ATOM   6614  C  CZ  . PHE B  2  104 ? -17.654  -31.556  212.285 1.00 121.72 ? 104  PHE B CZ  1 
ATOM   6615  N  N   . THR B  2  105 ? -20.309  -38.017  209.727 1.00 134.70 ? 105  THR B N   1 
ATOM   6616  C  CA  . THR B  2  105 ? -21.202  -39.108  209.371 1.00 136.79 ? 105  THR B CA  1 
ATOM   6617  C  C   . THR B  2  105 ? -21.463  -39.938  210.624 1.00 138.47 ? 105  THR B C   1 
ATOM   6618  O  O   . THR B  2  105 ? -20.693  -40.843  210.948 1.00 139.41 ? 105  THR B O   1 
ATOM   6619  C  CB  . THR B  2  105 ? -20.604  -39.990  208.259 1.00 137.51 ? 105  THR B CB  1 
ATOM   6620  O  OG1 . THR B  2  105 ? -20.321  -39.187  207.107 1.00 136.01 ? 105  THR B OG1 1 
ATOM   6621  C  CG2 . THR B  2  105 ? -21.568  -41.100  207.872 1.00 139.77 ? 105  THR B CG2 1 
ATOM   6622  N  N   . GLN B  2  106 ? -22.545  -39.618  211.329 1.00 119.08 ? 106  GLN B N   1 
ATOM   6623  C  CA  . GLN B  2  106 ? -22.841  -40.248  212.613 1.00 120.65 ? 106  GLN B CA  1 
ATOM   6624  C  C   . GLN B  2  106 ? -24.344  -40.426  212.820 1.00 122.13 ? 106  GLN B C   1 
ATOM   6625  O  O   . GLN B  2  106 ? -25.135  -40.220  211.898 1.00 122.13 ? 106  GLN B O   1 
ATOM   6626  C  CB  . GLN B  2  106 ? -22.249  -39.414  213.755 1.00 119.39 ? 106  GLN B CB  1 
ATOM   6627  C  CG  . GLN B  2  106 ? -22.577  -37.931  213.671 1.00 117.43 ? 106  GLN B CG  1 
ATOM   6628  C  CD  . GLN B  2  106 ? -21.984  -37.140  214.820 1.00 116.36 ? 106  GLN B CD  1 
ATOM   6629  O  OE1 . GLN B  2  106 ? -21.887  -37.634  215.944 1.00 117.51 ? 106  GLN B OE1 1 
ATOM   6630  N  NE2 . GLN B  2  106 ? -21.580  -35.905  214.542 1.00 114.24 ? 106  GLN B NE2 1 
ATOM   6631  N  N   . ALA B  2  107 ? -24.724  -40.819  214.034 1.00 123.08 ? 107  ALA B N   1 
ATOM   6632  C  CA  . ALA B  2  107 ? -26.125  -40.998  214.404 1.00 124.67 ? 107  ALA B CA  1 
ATOM   6633  C  C   . ALA B  2  107 ? -26.829  -41.995  213.489 1.00 126.44 ? 107  ALA B C   1 
ATOM   6634  O  O   . ALA B  2  107 ? -28.042  -41.924  213.295 1.00 127.32 ? 107  ALA B O   1 
ATOM   6635  C  CB  . ALA B  2  107 ? -26.851  -39.658  214.388 1.00 123.24 ? 107  ALA B CB  1 
ATOM   6636  N  N   . GLY B  2  108 ? -26.061  -42.926  212.933 1.00 166.61 ? 108  GLY B N   1 
ATOM   6637  C  CA  . GLY B  2  108 ? -26.612  -43.938  212.052 1.00 172.72 ? 108  GLY B CA  1 
ATOM   6638  C  C   . GLY B  2  108 ? -27.025  -43.390  210.699 1.00 167.44 ? 108  GLY B C   1 
ATOM   6639  O  O   . GLY B  2  108 ? -27.701  -44.074  209.931 1.00 168.94 ? 108  GLY B O   1 
ATOM   6640  N  N   . ALA B  2  109 ? -26.623  -42.156  210.406 1.00 125.49 ? 109  ALA B N   1 
ATOM   6641  C  CA  . ALA B  2  109 ? -26.897  -41.555  209.106 1.00 124.49 ? 109  ALA B CA  1 
ATOM   6642  C  C   . ALA B  2  109 ? -25.757  -41.881  208.147 1.00 123.87 ? 109  ALA B C   1 
ATOM   6643  O  O   . ALA B  2  109 ? -24.607  -42.009  208.564 1.00 123.22 ? 109  ALA B O   1 
ATOM   6644  C  CB  . ALA B  2  109 ? -27.079  -40.053  209.238 1.00 122.39 ? 109  ALA B CB  1 
ATOM   6645  N  N   . SER B  2  110 ? -26.080  -42.012  206.864 1.00 155.61 ? 110  SER B N   1 
ATOM   6646  C  CA  . SER B  2  110 ? -25.093  -42.394  205.858 1.00 155.33 ? 110  SER B CA  1 
ATOM   6647  C  C   . SER B  2  110 ? -24.387  -41.181  205.256 1.00 152.89 ? 110  SER B C   1 
ATOM   6648  O  O   . SER B  2  110 ? -23.456  -41.330  204.464 1.00 152.41 ? 110  SER B O   1 
ATOM   6649  C  CB  . SER B  2  110 ? -25.755  -43.213  204.749 1.00 158.22 ? 110  SER B CB  1 
ATOM   6650  O  OG  . SER B  2  110 ? -26.766  -42.467  204.097 1.00 174.36 ? 110  SER B OG  1 
ATOM   6651  N  N   . ASN B  2  111 ? -24.839  -39.988  205.632 1.00 163.10 ? 111  ASN B N   1 
ATOM   6652  C  CA  . ASN B  2  111 ? -24.235  -38.743  205.170 1.00 162.87 ? 111  ASN B CA  1 
ATOM   6653  C  C   . ASN B  2  111 ? -23.894  -37.847  206.357 1.00 172.80 ? 111  ASN B C   1 
ATOM   6654  O  O   . ASN B  2  111 ? -24.379  -38.081  207.464 1.00 195.64 ? 111  ASN B O   1 
ATOM   6655  C  CB  . ASN B  2  111 ? -25.175  -38.021  204.207 1.00 161.28 ? 111  ASN B CB  1 
ATOM   6656  C  CG  . ASN B  2  111 ? -26.463  -37.575  204.871 1.00 166.16 ? 111  ASN B CG  1 
ATOM   6657  O  OD1 . ASN B  2  111 ? -27.369  -38.378  205.094 1.00 163.30 ? 111  ASN B OD1 1 
ATOM   6658  N  ND2 . ASN B  2  111 ? -26.550  -36.290  205.194 1.00 174.10 ? 111  ASN B ND2 1 
ATOM   6659  N  N   . PRO B  2  112 ? -23.047  -36.828  206.138 1.00 114.19 ? 112  PRO B N   1 
ATOM   6660  C  CA  . PRO B  2  112 ? -22.684  -35.919  207.232 1.00 112.77 ? 112  PRO B CA  1 
ATOM   6661  C  C   . PRO B  2  112 ? -23.893  -35.207  207.833 1.00 112.78 ? 112  PRO B C   1 
ATOM   6662  O  O   . PRO B  2  112 ? -24.730  -34.697  207.089 1.00 112.69 ? 112  PRO B O   1 
ATOM   6663  C  CB  . PRO B  2  112 ? -21.744  -34.915  206.555 1.00 110.74 ? 112  PRO B CB  1 
ATOM   6664  C  CG  . PRO B  2  112 ? -21.203  -35.634  205.381 1.00 111.29 ? 112  PRO B CG  1 
ATOM   6665  C  CD  . PRO B  2  112 ? -22.315  -36.511  204.900 1.00 113.22 ? 112  PRO B CD  1 
ATOM   6666  N  N   . VAL B  2  113 ? -23.971  -35.171  209.161 1.00 112.99 ? 113  VAL B N   1 
ATOM   6667  C  CA  . VAL B  2  113 ? -25.101  -34.557  209.856 1.00 113.21 ? 113  VAL B CA  1 
ATOM   6668  C  C   . VAL B  2  113 ? -24.683  -33.980  211.210 1.00 112.45 ? 113  VAL B C   1 
ATOM   6669  O  O   . VAL B  2  113 ? -23.692  -34.413  211.798 1.00 112.40 ? 113  VAL B O   1 
ATOM   6670  C  CB  . VAL B  2  113 ? -26.245  -35.576  210.083 1.00 115.53 ? 113  VAL B CB  1 
ATOM   6671  C  CG1 . VAL B  2  113 ? -26.845  -36.031  208.757 1.00 116.39 ? 113  VAL B CG1 1 
ATOM   6672  C  CG2 . VAL B  2  113 ? -25.749  -36.775  210.886 1.00 116.94 ? 113  VAL B CG2 1 
ATOM   6673  N  N   . ASN B  2  114 ? -25.457  -33.012  211.698 1.00 113.30 ? 114  ASN B N   1 
ATOM   6674  C  CA  . ASN B  2  114 ? -25.243  -32.427  213.022 1.00 112.83 ? 114  ASN B CA  1 
ATOM   6675  C  C   . ASN B  2  114 ? -26.211  -32.976  214.057 1.00 114.70 ? 114  ASN B C   1 
ATOM   6676  O  O   . ASN B  2  114 ? -27.410  -33.080  213.805 1.00 115.77 ? 114  ASN B O   1 
ATOM   6677  C  CB  . ASN B  2  114 ? -25.383  -30.903  212.975 1.00 111.10 ? 114  ASN B CB  1 
ATOM   6678  C  CG  . ASN B  2  114 ? -24.215  -30.224  212.294 1.00 109.16 ? 114  ASN B CG  1 
ATOM   6679  O  OD1 . ASN B  2  114 ? -24.403  -29.365  211.435 1.00 110.04 ? 114  ASN B OD1 1 
ATOM   6680  N  ND2 . ASN B  2  114 ? -22.999  -30.590  212.691 1.00 108.78 ? 114  ASN B ND2 1 
ATOM   6681  N  N   . ILE B  2  115 ? -25.682  -33.323  215.224 1.00 136.28 ? 115  ILE B N   1 
ATOM   6682  C  CA  . ILE B  2  115 ? -26.505  -33.841  216.307 1.00 143.81 ? 115  ILE B CA  1 
ATOM   6683  C  C   . ILE B  2  115 ? -27.262  -32.717  216.993 1.00 137.75 ? 115  ILE B C   1 
ATOM   6684  O  O   . ILE B  2  115 ? -26.655  -31.808  217.544 1.00 136.40 ? 115  ILE B O   1 
ATOM   6685  C  CB  . ILE B  2  115 ? -25.656  -34.576  217.357 1.00 163.08 ? 115  ILE B CB  1 
ATOM   6686  C  CG1 . ILE B  2  115 ? -24.729  -35.592  216.683 1.00 173.11 ? 115  ILE B CG1 1 
ATOM   6687  C  CG2 . ILE B  2  115 ? -26.552  -35.247  218.390 1.00 167.18 ? 115  ILE B CG2 1 
ATOM   6688  C  CD1 . ILE B  2  115 ? -25.436  -36.556  215.750 1.00 174.90 ? 115  ILE B CD1 1 
ATOM   6689  N  N   . ALA B  2  116 ? -28.587  -32.813  216.998 1.00 127.32 ? 116  ALA B N   1 
ATOM   6690  C  CA  . ALA B  2  116 ? -29.430  -31.759  217.549 1.00 127.12 ? 116  ALA B CA  1 
ATOM   6691  C  C   . ALA B  2  116 ? -29.337  -31.745  219.069 1.00 127.92 ? 116  ALA B C   1 
ATOM   6692  O  O   . ALA B  2  116 ? -29.323  -32.797  219.709 1.00 147.87 ? 116  ALA B O   1 
ATOM   6693  C  CB  . ALA B  2  116 ? -30.869  -31.948  217.112 1.00 128.52 ? 116  ALA B CB  1 
ATOM   6694  N  N   . TYR B  2  117 ? -29.267  -30.544  219.636 1.00 135.51 ? 117  TYR B N   1 
ATOM   6695  C  CA  . TYR B  2  117 ? -29.147  -30.372  221.079 1.00 136.18 ? 117  TYR B CA  1 
ATOM   6696  C  C   . TYR B  2  117 ? -30.250  -29.461  221.620 1.00 136.60 ? 117  TYR B C   1 
ATOM   6697  O  O   . TYR B  2  117 ? -30.236  -29.082  222.791 1.00 137.05 ? 117  TYR B O   1 
ATOM   6698  C  CB  . TYR B  2  117 ? -27.766  -29.808  221.422 1.00 134.48 ? 117  TYR B CB  1 
ATOM   6699  C  CG  . TYR B  2  117 ? -26.634  -30.758  221.095 1.00 134.34 ? 117  TYR B CG  1 
ATOM   6700  C  CD1 . TYR B  2  117 ? -26.646  -32.070  221.552 1.00 136.28 ? 117  TYR B CD1 1 
ATOM   6701  C  CD2 . TYR B  2  117 ? -25.562  -30.349  220.311 1.00 132.39 ? 117  TYR B CD2 1 
ATOM   6702  C  CE1 . TYR B  2  117 ? -25.618  -32.943  221.250 1.00 138.96 ? 117  TYR B CE1 1 
ATOM   6703  C  CE2 . TYR B  2  117 ? -24.530  -31.216  220.003 1.00 132.37 ? 117  TYR B CE2 1 
ATOM   6704  C  CZ  . TYR B  2  117 ? -24.563  -32.512  220.475 1.00 134.31 ? 117  TYR B CZ  1 
ATOM   6705  O  OH  . TYR B  2  117 ? -23.538  -33.379  220.171 1.00 134.39 ? 117  TYR B OH  1 
ATOM   6706  N  N   . SER B  2  118 ? -31.202  -29.114  220.757 1.00 117.16 ? 118  SER B N   1 
ATOM   6707  C  CA  . SER B  2  118 ? -32.346  -28.295  221.147 1.00 117.71 ? 118  SER B CA  1 
ATOM   6708  C  C   . SER B  2  118 ? -33.387  -29.089  221.937 1.00 120.31 ? 118  SER B C   1 
ATOM   6709  O  O   . SER B  2  118 ? -34.296  -28.512  222.534 1.00 121.13 ? 118  SER B O   1 
ATOM   6710  C  CB  . SER B  2  118 ? -32.997  -27.683  219.905 1.00 116.88 ? 118  SER B CB  1 
ATOM   6711  O  OG  . SER B  2  118 ? -33.318  -28.684  218.956 1.00 117.71 ? 118  SER B OG  1 
ATOM   6712  N  N   . GLY B  2  119 ? -33.252  -30.412  221.933 1.00 158.28 ? 119  GLY B N   1 
ATOM   6713  C  CA  . GLY B  2  119 ? -34.156  -31.280  222.667 1.00 158.26 ? 119  GLY B CA  1 
ATOM   6714  C  C   . GLY B  2  119 ? -35.575  -31.262  222.131 1.00 152.55 ? 119  GLY B C   1 
ATOM   6715  O  O   . GLY B  2  119 ? -36.517  -31.606  222.843 1.00 159.71 ? 119  GLY B O   1 
ATOM   6716  N  N   . VAL B  2  120 ? -35.730  -30.865  220.871 1.00 124.22 ? 120  VAL B N   1 
ATOM   6717  C  CA  . VAL B  2  120 ? -37.048  -30.795  220.249 1.00 125.26 ? 120  VAL B CA  1 
ATOM   6718  C  C   . VAL B  2  120 ? -37.568  -32.189  219.908 1.00 127.34 ? 120  VAL B C   1 
ATOM   6719  O  O   . VAL B  2  120 ? -38.779  -32.405  219.840 1.00 129.07 ? 120  VAL B O   1 
ATOM   6720  C  CB  . VAL B  2  120 ? -37.027  -29.934  218.971 1.00 123.37 ? 120  VAL B CB  1 
ATOM   6721  C  CG1 . VAL B  2  120 ? -36.609  -28.509  219.304 1.00 121.48 ? 120  VAL B CG1 1 
ATOM   6722  C  CG2 . VAL B  2  120 ? -36.099  -30.537  217.921 1.00 122.33 ? 120  VAL B CG2 1 
ATOM   6723  N  N   . TYR B  2  121 ? -36.650  -33.124  219.680 1.00 130.38 ? 121  TYR B N   1 
ATOM   6724  C  CA  . TYR B  2  121 ? -37.013  -34.523  219.477 1.00 132.49 ? 121  TYR B CA  1 
ATOM   6725  C  C   . TYR B  2  121 ? -37.826  -35.024  220.664 1.00 134.99 ? 121  TYR B C   1 
ATOM   6726  O  O   . TYR B  2  121 ? -38.819  -35.731  220.499 1.00 137.06 ? 121  TYR B O   1 
ATOM   6727  C  CB  . TYR B  2  121 ? -35.764  -35.387  219.286 1.00 132.04 ? 121  TYR B CB  1 
ATOM   6728  C  CG  . TYR B  2  121 ? -35.262  -35.451  217.859 1.00 130.65 ? 121  TYR B CG  1 
ATOM   6729  C  CD1 . TYR B  2  121 ? -34.878  -34.302  217.181 1.00 128.29 ? 121  TYR B CD1 1 
ATOM   6730  C  CD2 . TYR B  2  121 ? -35.159  -36.666  217.196 1.00 131.80 ? 121  TYR B CD2 1 
ATOM   6731  C  CE1 . TYR B  2  121 ? -34.415  -34.362  215.878 1.00 127.15 ? 121  TYR B CE1 1 
ATOM   6732  C  CE2 . TYR B  2  121 ? -34.697  -36.737  215.896 1.00 130.67 ? 121  TYR B CE2 1 
ATOM   6733  C  CZ  . TYR B  2  121 ? -34.327  -35.583  215.241 1.00 128.36 ? 121  TYR B CZ  1 
ATOM   6734  O  OH  . TYR B  2  121 ? -33.866  -35.651  213.946 1.00 127.36 ? 121  TYR B OH  1 
ATOM   6735  N  N   . HIS B  2  122 ? -37.391  -34.647  221.861 1.00 131.73 ? 122  HIS B N   1 
ATOM   6736  C  CA  . HIS B  2  122 ? -38.069  -35.041  223.088 1.00 134.10 ? 122  HIS B CA  1 
ATOM   6737  C  C   . HIS B  2  122 ? -39.419  -34.338  223.216 1.00 134.97 ? 122  HIS B C   1 
ATOM   6738  O  O   . HIS B  2  122 ? -40.379  -34.915  223.725 1.00 137.44 ? 122  HIS B O   1 
ATOM   6739  C  CB  . HIS B  2  122 ? -37.187  -34.747  224.304 1.00 133.68 ? 122  HIS B CB  1 
ATOM   6740  C  CG  . HIS B  2  122 ? -35.811  -35.329  224.205 1.00 132.73 ? 122  HIS B CG  1 
ATOM   6741  N  ND1 . HIS B  2  122 ? -34.835  -34.805  223.385 1.00 130.17 ? 122  HIS B ND1 1 
ATOM   6742  C  CD2 . HIS B  2  122 ? -35.251  -36.401  224.816 1.00 134.12 ? 122  HIS B CD2 1 
ATOM   6743  C  CE1 . HIS B  2  122 ? -33.732  -35.524  223.500 1.00 130.01 ? 122  HIS B CE1 1 
ATOM   6744  N  NE2 . HIS B  2  122 ? -33.958  -36.498  224.362 1.00 132.37 ? 122  HIS B NE2 1 
ATOM   6745  N  N   . TRP B  2  123 ? -39.489  -33.093  222.756 1.00 133.06 ? 123  TRP B N   1 
ATOM   6746  C  CA  . TRP B  2  123 ? -40.732  -32.327  222.804 1.00 133.75 ? 123  TRP B CA  1 
ATOM   6747  C  C   . TRP B  2  123 ? -41.773  -32.902  221.852 1.00 135.11 ? 123  TRP B C   1 
ATOM   6748  O  O   . TRP B  2  123 ? -42.909  -33.150  222.251 1.00 137.31 ? 123  TRP B O   1 
ATOM   6749  C  CB  . TRP B  2  123 ? -40.471  -30.855  222.471 1.00 131.34 ? 123  TRP B CB  1 
ATOM   6750  C  CG  . TRP B  2  123 ? -41.717  -30.018  222.354 1.00 131.92 ? 123  TRP B CG  1 
ATOM   6751  C  CD1 . TRP B  2  123 ? -42.881  -30.163  223.056 1.00 134.28 ? 123  TRP B CD1 1 
ATOM   6752  C  CD2 . TRP B  2  123 ? -41.923  -28.913  221.468 1.00 130.25 ? 123  TRP B CD2 1 
ATOM   6753  N  NE1 . TRP B  2  123 ? -43.792  -29.213  222.668 1.00 134.14 ? 123  TRP B NE1 1 
ATOM   6754  C  CE2 . TRP B  2  123 ? -43.229  -28.434  221.691 1.00 131.70 ? 123  TRP B CE2 1 
ATOM   6755  C  CE3 . TRP B  2  123 ? -41.129  -28.282  220.507 1.00 127.77 ? 123  TRP B CE3 1 
ATOM   6756  C  CZ2 . TRP B  2  123 ? -43.757  -27.354  220.990 1.00 130.75 ? 123  TRP B CZ2 1 
ATOM   6757  C  CZ3 . TRP B  2  123 ? -41.655  -27.211  219.812 1.00 126.84 ? 123  TRP B CZ3 1 
ATOM   6758  C  CH2 . TRP B  2  123 ? -42.957  -26.757  220.057 1.00 128.33 ? 123  TRP B CH2 1 
ATOM   6759  N  N   . PHE B  2  124 ? -41.383  -33.120  220.599 1.00 133.90 ? 124  PHE B N   1 
ATOM   6760  C  CA  . PHE B  2  124 ? -42.312  -33.622  219.591 1.00 135.09 ? 124  PHE B CA  1 
ATOM   6761  C  C   . PHE B  2  124 ? -42.873  -34.980  219.991 1.00 137.92 ? 124  PHE B C   1 
ATOM   6762  O  O   . PHE B  2  124 ? -44.080  -35.214  219.908 1.00 139.88 ? 124  PHE B O   1 
ATOM   6763  C  CB  . PHE B  2  124 ? -41.619  -33.727  218.229 1.00 133.38 ? 124  PHE B CB  1 
ATOM   6764  C  CG  . PHE B  2  124 ? -41.109  -32.416  217.701 1.00 130.72 ? 124  PHE B CG  1 
ATOM   6765  C  CD1 . PHE B  2  124 ? -41.741  -31.227  218.023 1.00 130.32 ? 124  PHE B CD1 1 
ATOM   6766  C  CD2 . PHE B  2  124 ? -39.997  -32.375  216.876 1.00 128.74 ? 124  PHE B CD2 1 
ATOM   6767  C  CE1 . PHE B  2  124 ? -41.274  -30.022  217.536 1.00 127.99 ? 124  PHE B CE1 1 
ATOM   6768  C  CE2 . PHE B  2  124 ? -39.525  -31.173  216.386 1.00 126.41 ? 124  PHE B CE2 1 
ATOM   6769  C  CZ  . PHE B  2  124 ? -40.165  -29.995  216.717 1.00 126.04 ? 124  PHE B CZ  1 
ATOM   6770  N  N   . TYR B  2  125 ? -41.992  -35.864  220.443 1.00 138.24 ? 125  TYR B N   1 
ATOM   6771  C  CA  . TYR B  2  125 ? -42.386  -37.212  220.824 1.00 140.95 ? 125  TYR B CA  1 
ATOM   6772  C  C   . TYR B  2  125 ? -43.399  -37.176  221.963 1.00 143.20 ? 125  TYR B C   1 
ATOM   6773  O  O   . TYR B  2  125 ? -44.404  -37.884  221.935 1.00 145.63 ? 125  TYR B O   1 
ATOM   6774  C  CB  . TYR B  2  125 ? -41.156  -38.028  221.235 1.00 140.77 ? 125  TYR B CB  1 
ATOM   6775  C  CG  . TYR B  2  125 ? -41.441  -39.477  221.568 1.00 143.56 ? 125  TYR B CG  1 
ATOM   6776  C  CD1 . TYR B  2  125 ? -42.493  -40.159  220.971 1.00 145.56 ? 125  TYR B CD1 1 
ATOM   6777  C  CD2 . TYR B  2  125 ? -40.655  -40.163  222.486 1.00 144.31 ? 125  TYR B CD2 1 
ATOM   6778  C  CE1 . TYR B  2  125 ? -42.753  -41.482  221.276 1.00 148.22 ? 125  TYR B CE1 1 
ATOM   6779  C  CE2 . TYR B  2  125 ? -40.908  -41.486  222.797 1.00 146.97 ? 125  TYR B CE2 1 
ATOM   6780  C  CZ  . TYR B  2  125 ? -41.957  -42.140  222.190 1.00 148.92 ? 125  TYR B CZ  1 
ATOM   6781  O  OH  . TYR B  2  125 ? -42.210  -43.457  222.499 1.00 151.68 ? 125  TYR B OH  1 
ATOM   6782  N  N   . THR B  2  126 ? -43.123  -36.347  222.963 1.00 142.48 ? 126  THR B N   1 
ATOM   6783  C  CA  . THR B  2  126 ? -43.945  -36.285  224.167 1.00 144.62 ? 126  THR B CA  1 
ATOM   6784  C  C   . THR B  2  126 ? -45.371  -35.796  223.893 1.00 145.77 ? 126  THR B C   1 
ATOM   6785  O  O   . THR B  2  126 ? -46.313  -36.250  224.541 1.00 148.40 ? 126  THR B O   1 
ATOM   6786  C  CB  . THR B  2  126 ? -43.294  -35.372  225.231 1.00 143.43 ? 126  THR B CB  1 
ATOM   6787  O  OG1 . THR B  2  126 ? -41.959  -35.822  225.500 1.00 142.45 ? 126  THR B OG1 1 
ATOM   6788  C  CG2 . THR B  2  126 ? -44.093  -35.390  226.529 1.00 145.88 ? 126  THR B CG2 1 
ATOM   6789  N  N   . ILE B  2  127 ? -45.533  -34.882  222.937 1.00 143.93 ? 127  ILE B N   1 
ATOM   6790  C  CA  . ILE B  2  127 ? -46.844  -34.279  222.680 1.00 144.87 ? 127  ILE B CA  1 
ATOM   6791  C  C   . ILE B  2  127 ? -47.688  -35.061  221.671 1.00 146.38 ? 127  ILE B C   1 
ATOM   6792  O  O   . ILE B  2  127 ? -48.859  -34.737  221.466 1.00 147.61 ? 127  ILE B O   1 
ATOM   6793  C  CB  . ILE B  2  127 ? -46.714  -32.821  222.177 1.00 142.37 ? 127  ILE B CB  1 
ATOM   6794  C  CG1 . ILE B  2  127 ? -45.939  -32.764  220.855 1.00 140.10 ? 127  ILE B CG1 1 
ATOM   6795  C  CG2 . ILE B  2  127 ? -46.058  -31.953  223.246 1.00 141.19 ? 127  ILE B CG2 1 
ATOM   6796  C  CD1 . ILE B  2  127 ? -45.901  -31.386  220.226 1.00 137.88 ? 127  ILE B CD1 1 
ATOM   6797  N  N   . GLY B  2  128 ? -47.101  -36.080  221.046 1.00 148.00 ? 128  GLY B N   1 
ATOM   6798  C  CA  . GLY B  2  128 ? -47.853  -36.988  220.195 1.00 149.77 ? 128  GLY B CA  1 
ATOM   6799  C  C   . GLY B  2  128 ? -47.337  -37.147  218.776 1.00 148.20 ? 128  GLY B C   1 
ATOM   6800  O  O   . GLY B  2  128 ? -47.947  -37.856  217.977 1.00 149.62 ? 128  GLY B O   1 
ATOM   6801  N  N   . MET B  2  129 ? -46.223  -36.500  218.451 1.00 154.65 ? 129  MET B N   1 
ATOM   6802  C  CA  . MET B  2  129 ? -45.609  -36.681  217.139 1.00 153.17 ? 129  MET B CA  1 
ATOM   6803  C  C   . MET B  2  129 ? -45.033  -38.094  217.053 1.00 154.28 ? 129  MET B C   1 
ATOM   6804  O  O   . MET B  2  129 ? -44.248  -38.498  217.912 1.00 154.26 ? 129  MET B O   1 
ATOM   6805  C  CB  . MET B  2  129 ? -44.514  -35.638  216.891 1.00 150.32 ? 129  MET B CB  1 
ATOM   6806  C  CG  . MET B  2  129 ? -44.996  -34.186  216.941 1.00 150.99 ? 129  MET B CG  1 
ATOM   6807  S  SD  . MET B  2  129 ? -46.150  -33.769  215.620 1.00 155.29 ? 129  MET B SD  1 
ATOM   6808  C  CE  . MET B  2  129 ? -45.740  -32.049  215.337 1.00 146.35 ? 129  MET B CE  1 
ATOM   6809  N  N   . THR B  2  130 ? -45.423  -38.836  216.018 1.00 144.45 ? 130  THR B N   1 
ATOM   6810  C  CA  . THR B  2  130 ? -45.025  -40.237  215.868 1.00 145.88 ? 130  THR B CA  1 
ATOM   6811  C  C   . THR B  2  130 ? -44.161  -40.459  214.630 1.00 144.33 ? 130  THR B C   1 
ATOM   6812  O  O   . THR B  2  130 ? -43.260  -41.299  214.643 1.00 144.37 ? 130  THR B O   1 
ATOM   6813  C  CB  . THR B  2  130 ? -46.251  -41.171  215.776 1.00 149.05 ? 130  THR B CB  1 
ATOM   6814  O  OG1 . THR B  2  130 ? -47.241  -40.769  216.729 1.00 150.47 ? 130  THR B OG1 1 
ATOM   6815  C  CG2 . THR B  2  130 ? -45.846  -42.616  216.052 1.00 150.89 ? 130  THR B CG2 1 
ATOM   6816  N  N   . THR B  2  131 ? -44.436  -39.706  213.567 1.00 143.10 ? 131  THR B N   1 
ATOM   6817  C  CA  . THR B  2  131 ? -43.760  -39.906  212.286 1.00 141.92 ? 131  THR B CA  1 
ATOM   6818  C  C   . THR B  2  131 ? -43.336  -38.591  211.637 1.00 139.16 ? 131  THR B C   1 
ATOM   6819  O  O   . THR B  2  131 ? -43.710  -37.510  212.092 1.00 138.30 ? 131  THR B O   1 
ATOM   6820  C  CB  . THR B  2  131 ? -44.664  -40.671  211.302 1.00 143.99 ? 131  THR B CB  1 
ATOM   6821  O  OG1 . THR B  2  131 ? -45.781  -39.851  210.939 1.00 144.25 ? 131  THR B OG1 1 
ATOM   6822  C  CG2 . THR B  2  131 ? -45.168  -41.965  211.929 1.00 146.93 ? 131  THR B CG2 1 
ATOM   6823  N  N   . ASN B  2  132 ? -42.550  -38.698  210.569 1.00 156.91 ? 132  ASN B N   1 
ATOM   6824  C  CA  . ASN B  2  132 ? -42.082  -37.530  209.832 1.00 154.42 ? 132  ASN B CA  1 
ATOM   6825  C  C   . ASN B  2  132 ? -43.217  -36.838  209.092 1.00 154.83 ? 132  ASN B C   1 
ATOM   6826  O  O   . ASN B  2  132 ? -43.139  -35.648  208.789 1.00 153.05 ? 132  ASN B O   1 
ATOM   6827  C  CB  . ASN B  2  132 ? -40.993  -37.927  208.833 1.00 156.08 ? 132  ASN B CB  1 
ATOM   6828  C  CG  . ASN B  2  132 ? -39.759  -38.493  209.505 1.00 158.85 ? 132  ASN B CG  1 
ATOM   6829  O  OD1 . ASN B  2  132 ? -39.570  -38.346  210.712 1.00 177.74 ? 132  ASN B OD1 1 
ATOM   6830  N  ND2 . ASN B  2  132 ? -38.906  -39.144  208.721 1.00 152.37 ? 132  ASN B ND2 1 
ATOM   6831  N  N   . GLN B  2  133 ? -44.268  -37.593  208.797 1.00 164.27 ? 133  GLN B N   1 
ATOM   6832  C  CA  . GLN B  2  133 ? -45.415  -37.060  208.077 1.00 165.02 ? 133  GLN B CA  1 
ATOM   6833  C  C   . GLN B  2  133 ? -46.158  -36.022  208.910 1.00 164.86 ? 133  GLN B C   1 
ATOM   6834  O  O   . GLN B  2  133 ? -46.690  -35.052  208.372 1.00 164.26 ? 133  GLN B O   1 
ATOM   6835  C  CB  . GLN B  2  133 ? -46.357  -38.195  207.671 1.00 167.91 ? 133  GLN B CB  1 
ATOM   6836  C  CG  . GLN B  2  133 ? -45.656  -39.332  206.945 1.00 168.40 ? 133  GLN B CG  1 
ATOM   6837  C  CD  . GLN B  2  133 ? -44.648  -38.836  205.926 1.00 166.13 ? 133  GLN B CD  1 
ATOM   6838  O  OE1 . GLN B  2  133 ? -44.988  -38.074  205.021 1.00 167.04 ? 133  GLN B OE1 1 
ATOM   6839  N  NE2 . GLN B  2  133 ? -43.398  -39.255  206.078 1.00 165.01 ? 133  GLN B NE2 1 
ATOM   6840  N  N   . GLU B  2  134 ? -46.189  -36.227  210.222 1.00 164.89 ? 134  GLU B N   1 
ATOM   6841  C  CA  . GLU B  2  134 ? -46.861  -35.299  211.124 1.00 167.89 ? 134  GLU B CA  1 
ATOM   6842  C  C   . GLU B  2  134 ? -46.046  -34.021  211.313 1.00 161.44 ? 134  GLU B C   1 
ATOM   6843  O  O   . GLU B  2  134 ? -46.605  -32.940  211.495 1.00 158.95 ? 134  GLU B O   1 
ATOM   6844  C  CB  . GLU B  2  134 ? -47.116  -35.965  212.477 1.00 177.05 ? 134  GLU B CB  1 
ATOM   6845  C  CG  . GLU B  2  134 ? -48.363  -36.841  212.499 1.00 190.93 ? 134  GLU B CG  1 
ATOM   6846  C  CD  . GLU B  2  134 ? -48.402  -37.797  213.678 1.00 195.44 ? 134  GLU B CD  1 
ATOM   6847  O  OE1 . GLU B  2  134 ? -49.452  -38.446  213.878 1.00 196.32 ? 134  GLU B OE1 1 
ATOM   6848  O  OE2 . GLU B  2  134 ? -47.390  -37.905  214.402 1.00 194.25 ? 134  GLU B OE2 1 
ATOM   6849  N  N   . LEU B  2  135 ? -44.725  -34.155  211.271 1.00 134.96 ? 135  LEU B N   1 
ATOM   6850  C  CA  . LEU B  2  135 ? -43.828  -33.014  211.416 1.00 132.30 ? 135  LEU B CA  1 
ATOM   6851  C  C   . LEU B  2  135 ? -43.890  -32.128  210.179 1.00 130.95 ? 135  LEU B C   1 
ATOM   6852  O  O   . LEU B  2  135 ? -44.088  -30.917  210.280 1.00 129.83 ? 135  LEU B O   1 
ATOM   6853  C  CB  . LEU B  2  135 ? -42.395  -33.494  211.647 1.00 131.00 ? 135  LEU B CB  1 
ATOM   6854  C  CG  . LEU B  2  135 ? -42.157  -34.340  212.899 1.00 132.20 ? 135  LEU B CG  1 
ATOM   6855  C  CD1 . LEU B  2  135 ? -40.722  -34.834  212.933 1.00 130.95 ? 135  LEU B CD1 1 
ATOM   6856  C  CD2 . LEU B  2  135 ? -42.478  -33.557  214.158 1.00 132.15 ? 135  LEU B CD2 1 
ATOM   6857  N  N   . TYR B  2  136 ? -43.715  -32.745  209.015 1.00 137.72 ? 136  TYR B N   1 
ATOM   6858  C  CA  . TYR B  2  136 ? -43.784  -32.038  207.742 1.00 136.74 ? 136  TYR B CA  1 
ATOM   6859  C  C   . TYR B  2  136 ? -45.148  -31.384  207.572 1.00 137.88 ? 136  TYR B C   1 
ATOM   6860  O  O   . TYR B  2  136 ? -45.255  -30.265  207.069 1.00 136.69 ? 136  TYR B O   1 
ATOM   6861  C  CB  . TYR B  2  136 ? -43.516  -33.000  206.584 1.00 137.39 ? 136  TYR B CB  1 
ATOM   6862  C  CG  . TYR B  2  136 ? -43.848  -32.436  205.220 1.00 137.08 ? 136  TYR B CG  1 
ATOM   6863  C  CD1 . TYR B  2  136 ? -45.140  -32.515  204.712 1.00 138.99 ? 136  TYR B CD1 1 
ATOM   6864  C  CD2 . TYR B  2  136 ? -42.870  -31.849  204.429 1.00 135.04 ? 136  TYR B CD2 1 
ATOM   6865  C  CE1 . TYR B  2  136 ? -45.452  -32.007  203.470 1.00 138.85 ? 136  TYR B CE1 1 
ATOM   6866  C  CE2 . TYR B  2  136 ? -43.173  -31.341  203.180 1.00 134.91 ? 136  TYR B CE2 1 
ATOM   6867  C  CZ  . TYR B  2  136 ? -44.466  -31.424  202.706 1.00 136.83 ? 136  TYR B CZ  1 
ATOM   6868  O  OH  . TYR B  2  136 ? -44.779  -30.922  201.464 1.00 136.84 ? 136  TYR B OH  1 
ATOM   6869  N  N   . SER B  2  137 ? -46.189  -32.097  207.988 1.00 152.02 ? 137  SER B N   1 
ATOM   6870  C  CA  . SER B  2  137 ? -47.547  -31.574  207.916 1.00 153.41 ? 137  SER B CA  1 
ATOM   6871  C  C   . SER B  2  137 ? -47.664  -30.358  208.822 1.00 152.35 ? 137  SER B C   1 
ATOM   6872  O  O   . SER B  2  137 ? -48.433  -29.436  208.551 1.00 152.45 ? 137  SER B O   1 
ATOM   6873  C  CB  . SER B  2  137 ? -48.566  -32.642  208.315 1.00 156.31 ? 137  SER B CB  1 
ATOM   6874  O  OG  . SER B  2  137 ? -49.890  -32.154  208.188 1.00 157.77 ? 137  SER B OG  1 
ATOM   6875  N  N   . GLY B  2  138 ? -46.889  -30.364  209.902 1.00 170.52 ? 138  GLY B N   1 
ATOM   6876  C  CA  . GLY B  2  138 ? -46.855  -29.244  210.820 1.00 160.46 ? 138  GLY B CA  1 
ATOM   6877  C  C   . GLY B  2  138 ? -46.026  -28.118  210.244 1.00 154.48 ? 138  GLY B C   1 
ATOM   6878  O  O   . GLY B  2  138 ? -46.300  -26.944  210.488 1.00 155.42 ? 138  GLY B O   1 
ATOM   6879  N  N   . ALA B  2  139 ? -45.003  -28.479  209.476 1.00 150.37 ? 139  ALA B N   1 
ATOM   6880  C  CA  . ALA B  2  139 ? -44.126  -27.493  208.861 1.00 147.97 ? 139  ALA B CA  1 
ATOM   6881  C  C   . ALA B  2  139 ? -44.874  -26.627  207.848 1.00 148.00 ? 139  ALA B C   1 
ATOM   6882  O  O   . ALA B  2  139 ? -44.701  -25.408  207.823 1.00 158.63 ? 139  ALA B O   1 
ATOM   6883  C  CB  . ALA B  2  139 ? -42.947  -28.182  208.196 1.00 146.94 ? 139  ALA B CB  1 
ATOM   6884  N  N   . VAL B  2  140 ? -45.706  -27.255  207.019 1.00 127.59 ? 140  VAL B N   1 
ATOM   6885  C  CA  . VAL B  2  140 ? -46.460  -26.520  206.007 1.00 127.89 ? 140  VAL B CA  1 
ATOM   6886  C  C   . VAL B  2  140 ? -47.612  -25.742  206.635 1.00 128.90 ? 140  VAL B C   1 
ATOM   6887  O  O   . VAL B  2  140 ? -48.030  -24.711  206.109 1.00 128.53 ? 140  VAL B O   1 
ATOM   6888  C  CB  . VAL B  2  140 ? -47.018  -27.452  204.908 1.00 129.61 ? 140  VAL B CB  1 
ATOM   6889  C  CG1 . VAL B  2  140 ? -45.881  -28.165  204.190 1.00 128.67 ? 140  VAL B CG1 1 
ATOM   6890  C  CG2 . VAL B  2  140 ? -48.009  -28.456  205.485 1.00 132.15 ? 140  VAL B CG2 1 
ATOM   6891  N  N   . PHE B  2  141 ? -48.125  -26.237  207.756 1.00 130.28 ? 141  PHE B N   1 
ATOM   6892  C  CA  . PHE B  2  141 ? -49.192  -25.541  208.465 1.00 131.37 ? 141  PHE B CA  1 
ATOM   6893  C  C   . PHE B  2  141 ? -48.694  -24.220  209.041 1.00 129.47 ? 141  PHE B C   1 
ATOM   6894  O  O   . PHE B  2  141 ? -49.420  -23.228  209.054 1.00 129.73 ? 141  PHE B O   1 
ATOM   6895  C  CB  . PHE B  2  141 ? -49.768  -26.412  209.584 1.00 133.34 ? 141  PHE B CB  1 
ATOM   6896  C  CG  . PHE B  2  141 ? -50.726  -25.680  210.480 1.00 134.38 ? 141  PHE B CG  1 
ATOM   6897  C  CD1 . PHE B  2  141 ? -51.968  -25.284  210.013 1.00 135.92 ? 141  PHE B CD1 1 
ATOM   6898  C  CD2 . PHE B  2  141 ? -50.385  -25.389  211.791 1.00 133.94 ? 141  PHE B CD2 1 
ATOM   6899  C  CE1 . PHE B  2  141 ? -52.849  -24.606  210.835 1.00 136.98 ? 141  PHE B CE1 1 
ATOM   6900  C  CE2 . PHE B  2  141 ? -51.263  -24.713  212.618 1.00 135.01 ? 141  PHE B CE2 1 
ATOM   6901  C  CZ  . PHE B  2  141 ? -52.496  -24.322  212.139 1.00 136.53 ? 141  PHE B CZ  1 
ATOM   6902  N  N   . LEU B  2  142 ? -47.456  -24.210  209.521 1.00 127.66 ? 142  LEU B N   1 
ATOM   6903  C  CA  . LEU B  2  142 ? -46.862  -22.990  210.051 1.00 125.80 ? 142  LEU B CA  1 
ATOM   6904  C  C   . LEU B  2  142 ? -46.446  -22.054  208.924 1.00 124.16 ? 142  LEU B C   1 
ATOM   6905  O  O   . LEU B  2  142 ? -46.315  -20.847  209.128 1.00 123.03 ? 142  LEU B O   1 
ATOM   6906  C  CB  . LEU B  2  142 ? -45.662  -23.320  210.936 1.00 124.53 ? 142  LEU B CB  1 
ATOM   6907  C  CG  . LEU B  2  142 ? -45.997  -24.104  212.205 1.00 126.10 ? 142  LEU B CG  1 
ATOM   6908  C  CD1 . LEU B  2  142 ? -44.725  -24.625  212.839 1.00 124.95 ? 142  LEU B CD1 1 
ATOM   6909  C  CD2 . LEU B  2  142 ? -46.779  -23.245  213.192 1.00 126.84 ? 142  LEU B CD2 1 
ATOM   6910  N  N   . LEU B  2  143 ? -46.238  -22.612  207.736 1.00 124.15 ? 143  LEU B N   1 
ATOM   6911  C  CA  . LEU B  2  143 ? -45.927  -21.805  206.563 1.00 122.92 ? 143  LEU B CA  1 
ATOM   6912  C  C   . LEU B  2  143 ? -47.111  -20.912  206.215 1.00 123.94 ? 143  LEU B C   1 
ATOM   6913  O  O   . LEU B  2  143 ? -46.952  -19.709  206.003 1.00 122.79 ? 143  LEU B O   1 
ATOM   6914  C  CB  . LEU B  2  143 ? -45.565  -22.693  205.368 1.00 123.08 ? 143  LEU B CB  1 
ATOM   6915  C  CG  . LEU B  2  143 ? -44.232  -22.389  204.680 1.00 120.94 ? 143  LEU B CG  1 
ATOM   6916  C  CD1 . LEU B  2  143 ? -43.063  -22.544  205.637 1.00 119.44 ? 143  LEU B CD1 1 
ATOM   6917  C  CD2 . LEU B  2  143 ? -44.039  -23.283  203.463 1.00 121.48 ? 143  LEU B CD2 1 
ATOM   6918  N  N   . VAL B  2  144 ? -48.297  -21.507  206.158 1.00 126.21 ? 144  VAL B N   1 
ATOM   6919  C  CA  . VAL B  2  144 ? -49.510  -20.761  205.844 1.00 127.50 ? 144  VAL B CA  1 
ATOM   6920  C  C   . VAL B  2  144 ? -49.947  -19.904  207.029 1.00 127.61 ? 144  VAL B C   1 
ATOM   6921  O  O   . VAL B  2  144 ? -50.565  -18.855  206.849 1.00 127.83 ? 144  VAL B O   1 
ATOM   6922  C  CB  . VAL B  2  144 ? -50.667  -21.697  205.441 1.00 130.06 ? 144  VAL B CB  1 
ATOM   6923  C  CG1 . VAL B  2  144 ? -50.318  -22.439  204.160 1.00 130.11 ? 144  VAL B CG1 1 
ATOM   6924  C  CG2 . VAL B  2  144 ? -50.986  -22.683  206.556 1.00 131.44 ? 144  VAL B CG2 1 
ATOM   6925  N  N   . LEU B  2  145 ? -49.629  -20.357  208.238 1.00 127.58 ? 145  LEU B N   1 
ATOM   6926  C  CA  . LEU B  2  145 ? -49.888  -19.568  209.436 1.00 127.61 ? 145  LEU B CA  1 
ATOM   6927  C  C   . LEU B  2  145 ? -49.061  -18.292  209.368 1.00 125.38 ? 145  LEU B C   1 
ATOM   6928  O  O   . LEU B  2  145 ? -49.578  -17.189  209.542 1.00 125.49 ? 145  LEU B O   1 
ATOM   6929  C  CB  . LEU B  2  145 ? -49.544  -20.360  210.701 1.00 127.94 ? 145  LEU B CB  1 
ATOM   6930  C  CG  . LEU B  2  145 ? -50.248  -19.969  212.006 1.00 129.14 ? 145  LEU B CG  1 
ATOM   6931  C  CD1 . LEU B  2  145 ? -49.560  -20.650  213.181 1.00 128.97 ? 145  LEU B CD1 1 
ATOM   6932  C  CD2 . LEU B  2  145 ? -50.298  -18.463  212.220 1.00 128.19 ? 145  LEU B CD2 1 
ATOM   6933  N  N   . ALA B  2  146 ? -47.770  -18.458  209.105 1.00 137.08 ? 146  ALA B N   1 
ATOM   6934  C  CA  . ALA B  2  146 ? -46.862  -17.329  208.970 1.00 134.93 ? 146  ALA B CA  1 
ATOM   6935  C  C   . ALA B  2  146 ? -47.322  -16.393  207.860 1.00 136.18 ? 146  ALA B C   1 
ATOM   6936  O  O   . ALA B  2  146 ? -47.148  -15.179  207.950 1.00 155.55 ? 146  ALA B O   1 
ATOM   6937  C  CB  . ALA B  2  146 ? -45.455  -17.817  208.698 1.00 133.13 ? 146  ALA B CB  1 
ATOM   6938  N  N   . SER B  2  147 ? -47.910  -16.964  206.815 1.00 122.41 ? 147  SER B N   1 
ATOM   6939  C  CA  . SER B  2  147 ? -48.407  -16.175  205.696 1.00 122.64 ? 147  SER B CA  1 
ATOM   6940  C  C   . SER B  2  147 ? -49.583  -15.291  206.093 1.00 123.97 ? 147  SER B C   1 
ATOM   6941  O  O   . SER B  2  147 ? -49.717  -14.174  205.594 1.00 123.56 ? 147  SER B O   1 
ATOM   6942  C  CB  . SER B  2  147 ? -48.821  -17.084  204.541 1.00 123.86 ? 147  SER B CB  1 
ATOM   6943  O  OG  . SER B  2  147 ? -47.709  -17.784  204.012 1.00 122.63 ? 147  SER B OG  1 
ATOM   6944  N  N   . LEU B  2  148 ? -50.438  -15.788  206.981 1.00 125.66 ? 148  LEU B N   1 
ATOM   6945  C  CA  . LEU B  2  148 ? -51.602  -15.018  207.407 1.00 127.14 ? 148  LEU B CA  1 
ATOM   6946  C  C   . LEU B  2  148 ? -51.184  -13.749  208.137 1.00 125.85 ? 148  LEU B C   1 
ATOM   6947  O  O   . LEU B  2  148 ? -51.747  -12.679  207.909 1.00 126.22 ? 148  LEU B O   1 
ATOM   6948  C  CB  . LEU B  2  148 ? -52.517  -15.849  208.312 1.00 129.25 ? 148  LEU B CB  1 
ATOM   6949  C  CG  . LEU B  2  148 ? -53.734  -16.539  207.685 1.00 131.65 ? 148  LEU B CG  1 
ATOM   6950  C  CD1 . LEU B  2  148 ? -54.550  -17.217  208.776 1.00 133.64 ? 148  LEU B CD1 1 
ATOM   6951  C  CD2 . LEU B  2  148 ? -54.609  -15.578  206.881 1.00 132.51 ? 148  LEU B CD2 1 
ATOM   6952  N  N   . PHE B  2  149 ? -50.199  -13.874  209.018 1.00 124.45 ? 149  PHE B N   1 
ATOM   6953  C  CA  . PHE B  2  149 ? -49.737  -12.735  209.798 1.00 123.27 ? 149  PHE B CA  1 
ATOM   6954  C  C   . PHE B  2  149 ? -48.988  -11.732  208.932 1.00 121.47 ? 149  PHE B C   1 
ATOM   6955  O  O   . PHE B  2  149 ? -49.074  -10.525  209.154 1.00 121.13 ? 149  PHE B O   1 
ATOM   6956  C  CB  . PHE B  2  149 ? -48.851  -13.213  210.945 1.00 122.35 ? 149  PHE B CB  1 
ATOM   6957  C  CG  . PHE B  2  149 ? -49.624  -13.718  212.122 1.00 124.15 ? 149  PHE B CG  1 
ATOM   6958  C  CD1 . PHE B  2  149 ? -50.437  -14.831  212.003 1.00 126.03 ? 149  PHE B CD1 1 
ATOM   6959  C  CD2 . PHE B  2  149 ? -49.548  -13.078  213.345 1.00 124.10 ? 149  PHE B CD2 1 
ATOM   6960  C  CE1 . PHE B  2  149 ? -51.158  -15.298  213.081 1.00 127.83 ? 149  PHE B CE1 1 
ATOM   6961  C  CE2 . PHE B  2  149 ? -50.266  -13.539  214.430 1.00 125.90 ? 149  PHE B CE2 1 
ATOM   6962  C  CZ  . PHE B  2  149 ? -51.072  -14.653  214.298 1.00 127.78 ? 149  PHE B CZ  1 
ATOM   6963  N  N   . LEU B  2  150 ? -48.263  -12.230  207.937 1.00 120.45 ? 150  LEU B N   1 
ATOM   6964  C  CA  . LEU B  2  150 ? -47.594  -11.352  206.987 1.00 118.97 ? 150  LEU B CA  1 
ATOM   6965  C  C   . LEU B  2  150 ? -48.628  -10.610  206.157 1.00 120.22 ? 150  LEU B C   1 
ATOM   6966  O  O   . LEU B  2  150 ? -48.372  -9.508   205.674 1.00 119.42 ? 150  LEU B O   1 
ATOM   6967  C  CB  . LEU B  2  150 ? -46.650  -12.142  206.082 1.00 117.87 ? 150  LEU B CB  1 
ATOM   6968  C  CG  . LEU B  2  150 ? -45.402  -12.661  206.790 1.00 116.30 ? 150  LEU B CG  1 
ATOM   6969  C  CD1 . LEU B  2  150 ? -44.755  -13.782  205.993 1.00 115.91 ? 150  LEU B CD1 1 
ATOM   6970  C  CD2 . LEU B  2  150 ? -44.407  -11.534  207.056 1.00 114.38 ? 150  LEU B CD2 1 
ATOM   6971  N  N   . PHE B  2  151 ? -49.797  -11.220  205.990 1.00 122.30 ? 151  PHE B N   1 
ATOM   6972  C  CA  . PHE B  2  151 ? -50.883  -10.572  205.270 1.00 123.78 ? 151  PHE B CA  1 
ATOM   6973  C  C   . PHE B  2  151 ? -51.646  -9.624   206.188 1.00 124.67 ? 151  PHE B C   1 
ATOM   6974  O  O   . PHE B  2  151 ? -52.172  -8.606   205.742 1.00 125.19 ? 151  PHE B O   1 
ATOM   6975  C  CB  . PHE B  2  151 ? -51.851  -11.595  204.681 1.00 125.80 ? 151  PHE B CB  1 
ATOM   6976  C  CG  . PHE B  2  151 ? -53.025  -10.966  203.996 1.00 127.54 ? 151  PHE B CG  1 
ATOM   6977  C  CD1 . PHE B  2  151 ? -52.852  -10.278  202.809 1.00 127.11 ? 151  PHE B CD1 1 
ATOM   6978  C  CD2 . PHE B  2  151 ? -54.292  -11.033  204.547 1.00 129.69 ? 151  PHE B CD2 1 
ATOM   6979  C  CE1 . PHE B  2  151 ? -53.923  -9.681   202.176 1.00 128.80 ? 151  PHE B CE1 1 
ATOM   6980  C  CE2 . PHE B  2  151 ? -55.369  -10.439  203.916 1.00 131.37 ? 151  PHE B CE2 1 
ATOM   6981  C  CZ  . PHE B  2  151 ? -55.183  -9.762   202.728 1.00 130.92 ? 151  PHE B CZ  1 
ATOM   6982  N  N   . ALA B  2  152 ? -51.704  -9.963   207.471 1.00 141.38 ? 152  ALA B N   1 
ATOM   6983  C  CA  . ALA B  2  152 ? -52.392  -9.126   208.447 1.00 142.32 ? 152  ALA B CA  1 
ATOM   6984  C  C   . ALA B  2  152 ? -51.642  -7.813   208.652 1.00 140.67 ? 152  ALA B C   1 
ATOM   6985  O  O   . ALA B  2  152 ? -52.251  -6.745   208.718 1.00 141.39 ? 152  ALA B O   1 
ATOM   6986  C  CB  . ALA B  2  152 ? -52.538  -9.863   209.762 1.00 143.03 ? 152  ALA B CB  1 
ATOM   6987  N  N   . GLY B  2  153 ? -50.320  -7.901   208.759 1.00 140.47 ? 153  GLY B N   1 
ATOM   6988  C  CA  . GLY B  2  153 ? -49.491  -6.724   208.945 1.00 138.84 ? 153  GLY B CA  1 
ATOM   6989  C  C   . GLY B  2  153 ? -49.594  -5.783   207.764 1.00 138.65 ? 153  GLY B C   1 
ATOM   6990  O  O   . GLY B  2  153 ? -49.628  -4.564   207.929 1.00 138.47 ? 153  GLY B O   1 
ATOM   6991  N  N   . TRP B  2  154 ? -49.651  -6.354   206.566 1.00 120.48 ? 154  TRP B N   1 
ATOM   6992  C  CA  . TRP B  2  154 ? -49.795  -5.566   205.351 1.00 120.54 ? 154  TRP B CA  1 
ATOM   6993  C  C   . TRP B  2  154 ? -51.150  -4.877   205.314 1.00 122.59 ? 154  TRP B C   1 
ATOM   6994  O  O   . TRP B  2  154 ? -51.270  -3.740   204.859 1.00 122.62 ? 154  TRP B O   1 
ATOM   6995  C  CB  . TRP B  2  154 ? -49.630  -6.453   204.114 1.00 120.56 ? 154  TRP B CB  1 
ATOM   6996  C  CG  . TRP B  2  154 ? -49.965  -5.754   202.832 1.00 121.09 ? 154  TRP B CG  1 
ATOM   6997  C  CD1 . TRP B  2  154 ? -49.097  -5.128   201.989 1.00 119.76 ? 154  TRP B CD1 1 
ATOM   6998  C  CD2 . TRP B  2  154 ? -51.266  -5.613   202.246 1.00 123.25 ? 154  TRP B CD2 1 
ATOM   6999  N  NE1 . TRP B  2  154 ? -49.775  -4.601   200.916 1.00 120.96 ? 154  TRP B NE1 1 
ATOM   7000  C  CE2 . TRP B  2  154 ? -51.109  -4.886   201.051 1.00 123.11 ? 154  TRP B CE2 1 
ATOM   7001  C  CE3 . TRP B  2  154 ? -52.547  -6.029   202.619 1.00 125.38 ? 154  TRP B CE3 1 
ATOM   7002  C  CZ2 . TRP B  2  154 ? -52.184  -4.568   200.225 1.00 125.02 ? 154  TRP B CZ2 1 
ATOM   7003  C  CZ3 . TRP B  2  154 ? -53.612  -5.711   201.799 1.00 127.25 ? 154  TRP B CZ3 1 
ATOM   7004  C  CH2 . TRP B  2  154 ? -53.425  -4.989   200.617 1.00 127.06 ? 154  TRP B CH2 1 
ATOM   7005  N  N   . LEU B  2  155 ? -52.170  -5.575   205.797 1.00 124.39 ? 155  LEU B N   1 
ATOM   7006  C  CA  . LEU B  2  155 ? -53.537  -5.084   205.710 1.00 126.59 ? 155  LEU B CA  1 
ATOM   7007  C  C   . LEU B  2  155 ? -53.775  -3.883   206.619 1.00 126.80 ? 155  LEU B C   1 
ATOM   7008  O  O   . LEU B  2  155 ? -54.446  -2.929   206.227 1.00 127.83 ? 155  LEU B O   1 
ATOM   7009  C  CB  . LEU B  2  155 ? -54.522  -6.201   206.053 1.00 128.52 ? 155  LEU B CB  1 
ATOM   7010  C  CG  . LEU B  2  155 ? -56.000  -5.814   205.996 1.00 131.04 ? 155  LEU B CG  1 
ATOM   7011  C  CD1 . LEU B  2  155 ? -56.376  -5.254   204.628 1.00 131.63 ? 155  LEU B CD1 1 
ATOM   7012  C  CD2 . LEU B  2  155 ? -56.863  -7.008   206.333 1.00 132.88 ? 155  LEU B CD2 1 
ATOM   7013  N  N   . HIS B  2  156 ? -53.226  -3.927   207.830 1.00 127.89 ? 156  HIS B N   1 
ATOM   7014  C  CA  . HIS B  2  156 ? -53.480  -2.878   208.815 1.00 128.28 ? 156  HIS B CA  1 
ATOM   7015  C  C   . HIS B  2  156 ? -52.596  -1.652   208.599 1.00 126.64 ? 156  HIS B C   1 
ATOM   7016  O  O   . HIS B  2  156 ? -52.491  -0.793   209.474 1.00 126.52 ? 156  HIS B O   1 
ATOM   7017  C  CB  . HIS B  2  156 ? -53.288  -3.421   210.232 1.00 128.24 ? 156  HIS B CB  1 
ATOM   7018  C  CG  . HIS B  2  156 ? -54.406  -4.304   210.688 1.00 130.40 ? 156  HIS B CG  1 
ATOM   7019  N  ND1 . HIS B  2  156 ? -54.695  -5.509   210.086 1.00 131.03 ? 156  HIS B ND1 1 
ATOM   7020  C  CD2 . HIS B  2  156 ? -55.328  -4.141   211.667 1.00 132.23 ? 156  HIS B CD2 1 
ATOM   7021  C  CE1 . HIS B  2  156 ? -55.734  -6.060   210.687 1.00 133.12 ? 156  HIS B CE1 1 
ATOM   7022  N  NE2 . HIS B  2  156 ? -56.137  -5.251   211.651 1.00 133.89 ? 156  HIS B NE2 1 
ATOM   7023  N  N   . LEU B  2  157 ? -51.961  -1.580   207.433 1.00 123.52 ? 157  LEU B N   1 
ATOM   7024  C  CA  . LEU B  2  157 ? -51.312  -0.353   206.984 1.00 122.38 ? 157  LEU B CA  1 
ATOM   7025  C  C   . LEU B  2  157 ? -52.124  0.297    205.871 1.00 123.72 ? 157  LEU B C   1 
ATOM   7026  O  O   . LEU B  2  157 ? -51.779  1.378    205.393 1.00 123.19 ? 157  LEU B O   1 
ATOM   7027  C  CB  . LEU B  2  157 ? -49.883  -0.630   206.515 1.00 120.07 ? 157  LEU B CB  1 
ATOM   7028  C  CG  . LEU B  2  157 ? -48.891  -1.109   207.579 1.00 118.55 ? 157  LEU B CG  1 
ATOM   7029  C  CD1 . LEU B  2  157 ? -47.490  -1.160   206.999 1.00 116.38 ? 157  LEU B CD1 1 
ATOM   7030  C  CD2 . LEU B  2  157 ? -48.923  -0.223   208.823 1.00 118.66 ? 157  LEU B CD2 1 
ATOM   7031  N  N   . GLN B  2  158 ? -53.201  -0.365   205.459 1.00 147.15 ? 158  GLN B N   1 
ATOM   7032  C  CA  . GLN B  2  158 ? -54.133  0.215    204.501 1.00 148.80 ? 158  GLN B CA  1 
ATOM   7033  C  C   . GLN B  2  158 ? -55.127  1.122    205.231 1.00 150.50 ? 158  GLN B C   1 
ATOM   7034  O  O   . GLN B  2  158 ? -55.625  0.753    206.294 1.00 151.34 ? 158  GLN B O   1 
ATOM   7035  C  CB  . GLN B  2  158 ? -54.859  -0.885   203.730 1.00 150.15 ? 158  GLN B CB  1 
ATOM   7036  C  CG  . GLN B  2  158 ? -53.915  -1.930   203.166 1.00 148.64 ? 158  GLN B CG  1 
ATOM   7037  C  CD  . GLN B  2  158 ? -52.818  -1.315   202.319 1.00 146.89 ? 158  GLN B CD  1 
ATOM   7038  O  OE1 . GLN B  2  158 ? -53.046  -0.343   201.599 1.00 150.07 ? 158  GLN B OE1 1 
ATOM   7039  N  NE2 . GLN B  2  158 ? -51.613  -1.861   202.423 1.00 148.02 ? 158  GLN B NE2 1 
ATOM   7040  N  N   . PRO B  2  159 ? -55.437  2.296    204.649 1.00 165.91 ? 159  PRO B N   1 
ATOM   7041  C  CA  . PRO B  2  159 ? -56.141  3.376    205.360 1.00 171.28 ? 159  PRO B CA  1 
ATOM   7042  C  C   . PRO B  2  159 ? -57.421  2.938    206.071 1.00 187.97 ? 159  PRO B C   1 
ATOM   7043  O  O   . PRO B  2  159 ? -57.698  3.394    207.182 1.00 197.31 ? 159  PRO B O   1 
ATOM   7044  C  CB  . PRO B  2  159 ? -56.482  4.370    204.242 1.00 169.14 ? 159  PRO B CB  1 
ATOM   7045  C  CG  . PRO B  2  159 ? -55.556  4.051    203.135 1.00 166.52 ? 159  PRO B CG  1 
ATOM   7046  C  CD  . PRO B  2  159 ? -55.320  2.585    203.208 1.00 165.90 ? 159  PRO B CD  1 
ATOM   7047  N  N   . LYS B  2  160 ? -58.188  2.066    205.428 1.00 208.40 ? 160  LYS B N   1 
ATOM   7048  C  CA  . LYS B  2  160 ? -59.498  1.672    205.932 1.00 207.26 ? 160  LYS B CA  1 
ATOM   7049  C  C   . LYS B  2  160 ? -59.378  0.738    207.133 1.00 204.18 ? 160  LYS B C   1 
ATOM   7050  O  O   . LYS B  2  160 ? -60.376  0.432    207.787 1.00 214.78 ? 160  LYS B O   1 
ATOM   7051  C  CB  . LYS B  2  160 ? -60.317  0.994    204.829 1.00 202.71 ? 160  LYS B CB  1 
ATOM   7052  C  CG  . LYS B  2  160 ? -60.692  1.901    203.652 1.00 197.99 ? 160  LYS B CG  1 
ATOM   7053  C  CD  . LYS B  2  160 ? -59.597  1.990    202.588 1.00 199.15 ? 160  LYS B CD  1 
ATOM   7054  C  CE  . LYS B  2  160 ? -59.426  0.680    201.824 1.00 204.08 ? 160  LYS B CE  1 
ATOM   7055  N  NZ  . LYS B  2  160 ? -58.021  0.479    201.373 1.00 199.16 ? 160  LYS B NZ  1 
ATOM   7056  N  N   . PHE B  2  161 ? -58.156  0.293    207.422 1.00 138.23 ? 161  PHE B N   1 
ATOM   7057  C  CA  . PHE B  2  161 ? -57.922  -0.711   208.457 1.00 137.90 ? 161  PHE B CA  1 
ATOM   7058  C  C   . PHE B  2  161 ? -56.902  -0.248   209.492 1.00 136.14 ? 161  PHE B C   1 
ATOM   7059  O  O   . PHE B  2  161 ? -56.690  -0.922   210.500 1.00 135.96 ? 161  PHE B O   1 
ATOM   7060  C  CB  . PHE B  2  161 ? -57.440  -2.019   207.825 1.00 137.03 ? 161  PHE B CB  1 
ATOM   7061  C  CG  . PHE B  2  161 ? -58.349  -2.546   206.751 1.00 138.69 ? 161  PHE B CG  1 
ATOM   7062  C  CD1 . PHE B  2  161 ? -58.251  -2.078   205.451 1.00 138.47 ? 161  PHE B CD1 1 
ATOM   7063  C  CD2 . PHE B  2  161 ? -59.295  -3.514   207.038 1.00 140.60 ? 161  PHE B CD2 1 
ATOM   7064  C  CE1 . PHE B  2  161 ? -59.083  -2.563   204.462 1.00 140.11 ? 161  PHE B CE1 1 
ATOM   7065  C  CE2 . PHE B  2  161 ? -60.129  -4.002   206.052 1.00 142.22 ? 161  PHE B CE2 1 
ATOM   7066  C  CZ  . PHE B  2  161 ? -60.024  -3.527   204.764 1.00 141.98 ? 161  PHE B CZ  1 
ATOM   7067  N  N   . ARG B  2  162 ? -56.271  0.897    209.248 1.00 159.40 ? 162  ARG B N   1 
ATOM   7068  C  CA  . ARG B  2  162 ? -55.340  1.466    210.216 1.00 157.89 ? 162  ARG B CA  1 
ATOM   7069  C  C   . ARG B  2  162 ? -56.086  1.772    211.519 1.00 159.51 ? 162  ARG B C   1 
ATOM   7070  O  O   . ARG B  2  162 ? -56.978  2.619    211.530 1.00 163.66 ? 162  ARG B O   1 
ATOM   7071  C  CB  . ARG B  2  162 ? -54.684  2.734    209.661 1.00 156.73 ? 162  ARG B CB  1 
ATOM   7072  C  CG  . ARG B  2  162 ? -53.741  2.482    208.487 1.00 154.93 ? 162  ARG B CG  1 
ATOM   7073  C  CD  . ARG B  2  162 ? -53.184  3.778    207.912 1.00 157.54 ? 162  ARG B CD  1 
ATOM   7074  N  NE  . ARG B  2  162 ? -52.038  4.284    208.666 1.00 154.36 ? 162  ARG B NE  1 
ATOM   7075  C  CZ  . ARG B  2  162 ? -50.765  4.012    208.387 1.00 150.11 ? 162  ARG B CZ  1 
ATOM   7076  N  NH1 . ARG B  2  162 ? -50.446  3.233    207.360 1.00 149.45 ? 162  ARG B NH1 1 
ATOM   7077  N  NH2 . ARG B  2  162 ? -49.801  4.525    209.138 1.00 148.69 ? 162  ARG B NH2 1 
ATOM   7078  N  N   . PRO B  2  163 ? -55.734  1.084    212.621 1.00 130.83 ? 163  PRO B N   1 
ATOM   7079  C  CA  . PRO B  2  163 ? -56.473  1.332    213.867 1.00 132.56 ? 163  PRO B CA  1 
ATOM   7080  C  C   . PRO B  2  163 ? -56.262  2.749    214.401 1.00 132.43 ? 163  PRO B C   1 
ATOM   7081  O  O   . PRO B  2  163 ? -55.221  3.353    214.145 1.00 130.52 ? 163  PRO B O   1 
ATOM   7082  C  CB  . PRO B  2  163 ? -55.898  0.292    214.840 1.00 131.88 ? 163  PRO B CB  1 
ATOM   7083  C  CG  . PRO B  2  163 ? -55.171  -0.697   213.992 1.00 130.30 ? 163  PRO B CG  1 
ATOM   7084  C  CD  . PRO B  2  163 ? -54.702  0.048    212.793 1.00 129.05 ? 163  PRO B CD  1 
ATOM   7085  N  N   . SER B  2  164 ? -57.246  3.267    215.130 1.00 149.01 ? 164  SER B N   1 
ATOM   7086  C  CA  . SER B  2  164 ? -57.148  4.598    215.723 1.00 149.22 ? 164  SER B CA  1 
ATOM   7087  C  C   . SER B  2  164 ? -56.236  4.581    216.944 1.00 148.09 ? 164  SER B C   1 
ATOM   7088  O  O   . SER B  2  164 ? -55.944  3.520    217.493 1.00 147.72 ? 164  SER B O   1 
ATOM   7089  C  CB  . SER B  2  164 ? -58.535  5.117    216.108 1.00 152.05 ? 164  SER B CB  1 
ATOM   7090  O  OG  . SER B  2  164 ? -59.372  4.060    216.543 1.00 165.76 ? 164  SER B OG  1 
ATOM   7091  N  N   . LEU B  2  165 ? -55.787  5.759    217.367 1.00 133.20 ? 165  LEU B N   1 
ATOM   7092  C  CA  . LEU B  2  165 ? -54.845  5.856    218.477 1.00 132.09 ? 165  LEU B CA  1 
ATOM   7093  C  C   . LEU B  2  165 ? -55.493  5.472    219.804 1.00 133.95 ? 165  LEU B C   1 
ATOM   7094  O  O   . LEU B  2  165 ? -54.826  4.958    220.702 1.00 133.24 ? 165  LEU B O   1 
ATOM   7095  C  CB  . LEU B  2  165 ? -54.274  7.273    218.574 1.00 131.41 ? 165  LEU B CB  1 
ATOM   7096  C  CG  . LEU B  2  165 ? -53.295  7.522    219.727 1.00 130.41 ? 165  LEU B CG  1 
ATOM   7097  C  CD1 . LEU B  2  165 ? -52.187  6.474    219.768 1.00 128.31 ? 165  LEU B CD1 1 
ATOM   7098  C  CD2 . LEU B  2  165 ? -52.697  8.915    219.621 1.00 129.66 ? 165  LEU B CD2 1 
ATOM   7099  N  N   . ALA B  2  166 ? -56.791  5.720    219.925 1.00 136.43 ? 166  ALA B N   1 
ATOM   7100  C  CA  . ALA B  2  166 ? -57.521  5.356    221.132 1.00 138.50 ? 166  ALA B CA  1 
ATOM   7101  C  C   . ALA B  2  166 ? -57.582  3.840    221.279 1.00 138.54 ? 166  ALA B C   1 
ATOM   7102  O  O   . ALA B  2  166 ? -57.630  3.317    222.393 1.00 139.37 ? 166  ALA B O   1 
ATOM   7103  C  CB  . ALA B  2  166 ? -58.922  5.945    221.107 1.00 141.22 ? 166  ALA B CB  1 
ATOM   7104  N  N   . TRP B  2  167 ? -57.568  3.139    220.149 1.00 147.01 ? 167  TRP B N   1 
ATOM   7105  C  CA  . TRP B  2  167 ? -57.687  1.685    220.142 1.00 147.17 ? 167  TRP B CA  1 
ATOM   7106  C  C   . TRP B  2  167 ? -56.471  1.019    220.772 1.00 145.32 ? 167  TRP B C   1 
ATOM   7107  O  O   . TRP B  2  167 ? -56.593  0.012    221.467 1.00 146.05 ? 167  TRP B O   1 
ATOM   7108  C  CB  . TRP B  2  167 ? -57.859  1.174    218.711 1.00 146.62 ? 167  TRP B CB  1 
ATOM   7109  C  CG  . TRP B  2  167 ? -58.019  -0.309   218.624 1.00 146.92 ? 167  TRP B CG  1 
ATOM   7110  C  CD1 . TRP B  2  167 ? -59.184  -1.012   218.704 1.00 149.22 ? 167  TRP B CD1 1 
ATOM   7111  C  CD2 . TRP B  2  167 ? -56.976  -1.277   218.448 1.00 144.95 ? 167  TRP B CD2 1 
ATOM   7112  N  NE1 . TRP B  2  167 ? -58.933  -2.358   218.585 1.00 148.82 ? 167  TRP B NE1 1 
ATOM   7113  C  CE2 . TRP B  2  167 ? -57.585  -2.546   218.424 1.00 146.21 ? 167  TRP B CE2 1 
ATOM   7114  C  CE3 . TRP B  2  167 ? -55.587  -1.193   218.304 1.00 142.33 ? 167  TRP B CE3 1 
ATOM   7115  C  CZ2 . TRP B  2  167 ? -56.854  -3.723   218.272 1.00 144.96 ? 167  TRP B CZ2 1 
ATOM   7116  C  CZ3 . TRP B  2  167 ? -54.864  -2.366   218.146 1.00 141.08 ? 167  TRP B CZ3 1 
ATOM   7117  C  CH2 . TRP B  2  167 ? -55.499  -3.612   218.130 1.00 142.39 ? 167  TRP B CH2 1 
ATOM   7118  N  N   . PHE B  2  168 ? -55.299  1.590    220.524 1.00 133.74 ? 168  PHE B N   1 
ATOM   7119  C  CA  . PHE B  2  168 ? -54.065  1.076    221.101 1.00 131.93 ? 168  PHE B CA  1 
ATOM   7120  C  C   . PHE B  2  168 ? -54.016  1.371    222.594 1.00 132.90 ? 168  PHE B C   1 
ATOM   7121  O  O   . PHE B  2  168 ? -53.475  0.588    223.375 1.00 132.56 ? 168  PHE B O   1 
ATOM   7122  C  CB  . PHE B  2  168 ? -52.852  1.687    220.397 1.00 129.36 ? 168  PHE B CB  1 
ATOM   7123  C  CG  . PHE B  2  168 ? -52.609  1.132    219.023 1.00 128.11 ? 168  PHE B CG  1 
ATOM   7124  C  CD1 . PHE B  2  168 ? -51.913  -0.053   218.852 1.00 126.87 ? 168  PHE B CD1 1 
ATOM   7125  C  CD2 . PHE B  2  168 ? -53.089  1.788    217.902 1.00 128.33 ? 168  PHE B CD2 1 
ATOM   7126  C  CE1 . PHE B  2  168 ? -51.692  -0.566   217.589 1.00 125.84 ? 168  PHE B CE1 1 
ATOM   7127  C  CE2 . PHE B  2  168 ? -52.871  1.280    216.637 1.00 127.32 ? 168  PHE B CE2 1 
ATOM   7128  C  CZ  . PHE B  2  168 ? -52.173  0.100    216.479 1.00 126.08 ? 168  PHE B CZ  1 
ATOM   7129  N  N   . LYS B  2  169 ? -54.594  2.503    222.984 1.00 134.22 ? 169  LYS B N   1 
ATOM   7130  C  CA  . LYS B  2  169 ? -54.543  2.955    224.369 1.00 135.24 ? 169  LYS B CA  1 
ATOM   7131  C  C   . LYS B  2  169 ? -55.664  2.358    225.217 1.00 137.95 ? 169  LYS B C   1 
ATOM   7132  O  O   . LYS B  2  169 ? -55.718  2.583    226.426 1.00 139.13 ? 169  LYS B O   1 
ATOM   7133  C  CB  . LYS B  2  169 ? -54.600  4.483    224.426 1.00 135.50 ? 169  LYS B CB  1 
ATOM   7134  C  CG  . LYS B  2  169 ? -53.345  5.155    223.893 1.00 132.93 ? 169  LYS B CG  1 
ATOM   7135  C  CD  . LYS B  2  169 ? -53.342  6.650    224.167 1.00 133.37 ? 169  LYS B CD  1 
ATOM   7136  C  CE  . LYS B  2  169 ? -52.041  7.293    223.710 1.00 130.90 ? 169  LYS B CE  1 
ATOM   7137  N  NZ  . LYS B  2  169 ? -50.879  6.861    224.535 1.00 129.50 ? 169  LYS B NZ  1 
ATOM   7138  N  N   . ASN B  2  170 ? -56.560  1.602    224.587 1.00 203.88 ? 170  ASN B N   1 
ATOM   7139  C  CA  . ASN B  2  170 ? -57.596  0.888    225.323 1.00 217.54 ? 170  ASN B CA  1 
ATOM   7140  C  C   . ASN B  2  170 ? -56.975  -0.264   226.106 1.00 207.95 ? 170  ASN B C   1 
ATOM   7141  O  O   . ASN B  2  170 ? -57.038  -1.421   225.690 1.00 204.21 ? 170  ASN B O   1 
ATOM   7142  C  CB  . ASN B  2  170 ? -58.683  0.373    224.374 1.00 227.48 ? 170  ASN B CB  1 
ATOM   7143  C  CG  . ASN B  2  170 ? -59.904  -0.157   225.110 1.00 215.29 ? 170  ASN B CG  1 
ATOM   7144  O  OD1 . ASN B  2  170 ? -59.830  -0.528   226.282 1.00 211.37 ? 170  ASN B OD1 1 
ATOM   7145  N  ND2 . ASN B  2  170 ? -61.041  -0.184   224.424 1.00 203.33 ? 170  ASN B ND2 1 
ATOM   7146  N  N   . ALA B  2  171 ? -56.371  0.065    227.243 1.00 141.15 ? 171  ALA B N   1 
ATOM   7147  C  CA  . ALA B  2  171 ? -55.676  -0.922   228.060 1.00 140.77 ? 171  ALA B CA  1 
ATOM   7148  C  C   . ALA B  2  171 ? -56.658  -1.858   228.752 1.00 143.40 ? 171  ALA B C   1 
ATOM   7149  O  O   . ALA B  2  171 ? -56.362  -3.034   228.967 1.00 143.28 ? 171  ALA B O   1 
ATOM   7150  C  CB  . ALA B  2  171 ? -54.804  -0.225   229.091 1.00 140.17 ? 171  ALA B CB  1 
ATOM   7151  N  N   . GLU B  2  172 ? -57.824  -1.325   229.100 1.00 180.87 ? 172  GLU B N   1 
ATOM   7152  C  CA  . GLU B  2  172 ? -58.828  -2.076   229.842 1.00 188.87 ? 172  GLU B CA  1 
ATOM   7153  C  C   . GLU B  2  172 ? -59.292  -3.300   229.060 1.00 183.96 ? 172  GLU B C   1 
ATOM   7154  O  O   . GLU B  2  172 ? -59.443  -4.387   229.617 1.00 185.10 ? 172  GLU B O   1 
ATOM   7155  C  CB  . GLU B  2  172 ? -60.027  -1.182   230.170 1.00 210.01 ? 172  GLU B CB  1 
ATOM   7156  C  CG  . GLU B  2  172 ? -59.661  0.123    230.869 1.00 222.48 ? 172  GLU B CG  1 
ATOM   7157  C  CD  . GLU B  2  172 ? -59.126  -0.090   232.269 1.00 221.94 ? 172  GLU B CD  1 
ATOM   7158  O  OE1 . GLU B  2  172 ? -59.340  -1.186   232.826 1.00 227.89 ? 172  GLU B OE1 1 
ATOM   7159  O  OE2 . GLU B  2  172 ? -58.488  0.838    232.810 1.00 211.30 ? 172  GLU B OE2 1 
ATOM   7160  N  N   . SER B  2  173 ? -59.506  -3.114   227.762 1.00 148.02 ? 173  SER B N   1 
ATOM   7161  C  CA  . SER B  2  173 ? -60.012  -4.177   226.903 1.00 148.38 ? 173  SER B CA  1 
ATOM   7162  C  C   . SER B  2  173 ? -58.911  -5.156   226.515 1.00 146.10 ? 173  SER B C   1 
ATOM   7163  O  O   . SER B  2  173 ? -59.144  -6.362   226.430 1.00 146.81 ? 173  SER B O   1 
ATOM   7164  C  CB  . SER B  2  173 ? -60.646  -3.585   225.644 1.00 148.31 ? 173  SER B CB  1 
ATOM   7165  O  OG  . SER B  2  173 ? -61.485  -4.529   225.002 1.00 149.61 ? 173  SER B OG  1 
ATOM   7166  N  N   . ARG B  2  174 ? -57.714  -4.631   226.273 1.00 143.47 ? 174  ARG B N   1 
ATOM   7167  C  CA  . ARG B  2  174 ? -56.587  -5.454   225.855 1.00 141.18 ? 174  ARG B CA  1 
ATOM   7168  C  C   . ARG B  2  174 ? -56.250  -6.494   226.921