data_4L8P
# 
_entry.id   4L8P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4L8P         
RCSB  RCSB080321   
WWPDB D_1000080321 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
TargetTrack JCSG-421787 . unspecified 
PDB         4L8O        
;Crystal structure of a bile-acid 7-alpha dehydratase (CLOHYLEM_06634) from Clostridium hylemonae DSM 15053 at 2.20 A resolution - Ortholog structure
;
unspecified 
PDB         4LEH        
;Crystal structure of a bile-acid 7-alpha dehydratase (CLOSCI_03134) from Clostridium scindens ATCC 35704 at 2.90 A resolution - Ortholog structure
;
unspecified 
# 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.entry_id                        4L8P 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-06-17 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    CASP 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Joint Center for Structural Genomics (JCSG)' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of a bile-acid 7-alpha dehydratase (CLOHIR_00079) from Clostridium hiranonis DSM 13275 at 1.60 A resolution' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
_citation_author.citation_id   primary 
_citation_author.name          'Joint Center for Structural Genomics (JCSG)' 
_citation_author.ordinal       1 
# 
_cell.entry_id           4L8P 
_cell.length_a           58.905 
_cell.length_b           58.905 
_cell.length_c           91.340 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              6 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4L8P 
_symmetry.Int_Tables_number                173 
_symmetry.space_group_name_H-M             'P 63' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Bile acid 7a-dehydratase, BaiE' 22287.031 1   4.2.1.106 ? ? ? 
2 non-polymer syn 'NICKEL (II) ION'                58.693    1   ?         ? ? ? 
3 non-polymer syn 'SODIUM ION'                     22.990    1   ?         ? ? ? 
4 non-polymer syn 'TRIETHYLENE GLYCOL'             150.173   1   ?         ? ? ? 
5 non-polymer syn 'PENTAETHYLENE GLYCOL'           238.278   1   ?         ? ? ? 
6 water       nat water                            18.015    124 ?         ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)GSDKIHHHHHHENLYFQG(MSE)TLEARIEALEKEIQRLNDIEAIKQLKAKYFRCLDGKLWDELETTLSPNIETS
YSDGKLVFHSPKEVTEYLAAA(MSE)PKEEIS(MSE)H(MSE)GHTPEITIDSENTATGRWYLEDNLIFTDGKYKNVGIN
GGAFYTDKYEKIDGQWYIKETGYVRIFEEHF(MSE)RDPKIHITSN(MSE)HKEK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSDKIHHHHHHENLYFQGMTLEARIEALEKEIQRLNDIEAIKQLKAKYFRCLDGKLWDELETTLSPNIETSYSDGKLVF
HSPKEVTEYLAAAMPKEEISMHMGHTPEITIDSENTATGRWYLEDNLIFTDGKYKNVGINGGAFYTDKYEKIDGQWYIKE
TGYVRIFEEHFMRDPKIHITSNMHKEK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         JCSG-421787 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   GLY n 
1 3   SER n 
1 4   ASP n 
1 5   LYS n 
1 6   ILE n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  HIS n 
1 12  HIS n 
1 13  GLU n 
1 14  ASN n 
1 15  LEU n 
1 16  TYR n 
1 17  PHE n 
1 18  GLN n 
1 19  GLY n 
1 20  MSE n 
1 21  THR n 
1 22  LEU n 
1 23  GLU n 
1 24  ALA n 
1 25  ARG n 
1 26  ILE n 
1 27  GLU n 
1 28  ALA n 
1 29  LEU n 
1 30  GLU n 
1 31  LYS n 
1 32  GLU n 
1 33  ILE n 
1 34  GLN n 
1 35  ARG n 
1 36  LEU n 
1 37  ASN n 
1 38  ASP n 
1 39  ILE n 
1 40  GLU n 
1 41  ALA n 
1 42  ILE n 
1 43  LYS n 
1 44  GLN n 
1 45  LEU n 
1 46  LYS n 
1 47  ALA n 
1 48  LYS n 
1 49  TYR n 
1 50  PHE n 
1 51  ARG n 
1 52  CYS n 
1 53  LEU n 
1 54  ASP n 
1 55  GLY n 
1 56  LYS n 
1 57  LEU n 
1 58  TRP n 
1 59  ASP n 
1 60  GLU n 
1 61  LEU n 
1 62  GLU n 
1 63  THR n 
1 64  THR n 
1 65  LEU n 
1 66  SER n 
1 67  PRO n 
1 68  ASN n 
1 69  ILE n 
1 70  GLU n 
1 71  THR n 
1 72  SER n 
1 73  TYR n 
1 74  SER n 
1 75  ASP n 
1 76  GLY n 
1 77  LYS n 
1 78  LEU n 
1 79  VAL n 
1 80  PHE n 
1 81  HIS n 
1 82  SER n 
1 83  PRO n 
1 84  LYS n 
1 85  GLU n 
1 86  VAL n 
1 87  THR n 
1 88  GLU n 
1 89  TYR n 
1 90  LEU n 
1 91  ALA n 
1 92  ALA n 
1 93  ALA n 
1 94  MSE n 
1 95  PRO n 
1 96  LYS n 
1 97  GLU n 
1 98  GLU n 
1 99  ILE n 
1 100 SER n 
1 101 MSE n 
1 102 HIS n 
1 103 MSE n 
1 104 GLY n 
1 105 HIS n 
1 106 THR n 
1 107 PRO n 
1 108 GLU n 
1 109 ILE n 
1 110 THR n 
1 111 ILE n 
1 112 ASP n 
1 113 SER n 
1 114 GLU n 
1 115 ASN n 
1 116 THR n 
1 117 ALA n 
1 118 THR n 
1 119 GLY n 
1 120 ARG n 
1 121 TRP n 
1 122 TYR n 
1 123 LEU n 
1 124 GLU n 
1 125 ASP n 
1 126 ASN n 
1 127 LEU n 
1 128 ILE n 
1 129 PHE n 
1 130 THR n 
1 131 ASP n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LYS n 
1 136 ASN n 
1 137 VAL n 
1 138 GLY n 
1 139 ILE n 
1 140 ASN n 
1 141 GLY n 
1 142 GLY n 
1 143 ALA n 
1 144 PHE n 
1 145 TYR n 
1 146 THR n 
1 147 ASP n 
1 148 LYS n 
1 149 TYR n 
1 150 GLU n 
1 151 LYS n 
1 152 ILE n 
1 153 ASP n 
1 154 GLY n 
1 155 GLN n 
1 156 TRP n 
1 157 TYR n 
1 158 ILE n 
1 159 LYS n 
1 160 GLU n 
1 161 THR n 
1 162 GLY n 
1 163 TYR n 
1 164 VAL n 
1 165 ARG n 
1 166 ILE n 
1 167 PHE n 
1 168 GLU n 
1 169 GLU n 
1 170 HIS n 
1 171 PHE n 
1 172 MSE n 
1 173 ARG n 
1 174 ASP n 
1 175 PRO n 
1 176 LYS n 
1 177 ILE n 
1 178 HIS n 
1 179 ILE n 
1 180 THR n 
1 181 SER n 
1 182 ASN n 
1 183 MSE n 
1 184 HIS n 
1 185 LYS n 
1 186 GLU n 
1 187 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'baiE, CLOHIR_00079' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Clostridium hiranonis DSM 13275' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     500633 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia Coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               HK100 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       SpeedET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q9RB47_9FIRM 
_struct_ref.pdbx_db_accession          Q9RB47 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MTLEARIEALEKEIQRLNDIEAIKQLKAKYFRCLDGKLWDELETTLSPNIETSYSDGKLVFHSPKEVTEYLAAAMPKEEI
SMHMGHTPEITIDSENTATGRWYLEDNLIFTDGKYKNVGINGGAFYTDKYEKIDGQWYIKETGYVRIFEEHFMRDPKIHI
TSNMHKEK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4L8P 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 20 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 187 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9RB47 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  168 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       168 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4L8P MSE A 1  ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' -18 1  
1 4L8P GLY A 2  ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' -17 2  
1 4L8P SER A 3  ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' -16 3  
1 4L8P ASP A 4  ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' -15 4  
1 4L8P LYS A 5  ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' -14 5  
1 4L8P ILE A 6  ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' -13 6  
1 4L8P HIS A 7  ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' -12 7  
1 4L8P HIS A 8  ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' -11 8  
1 4L8P HIS A 9  ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' -10 9  
1 4L8P HIS A 10 ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' -9  10 
1 4L8P HIS A 11 ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' -8  11 
1 4L8P HIS A 12 ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' -7  12 
1 4L8P GLU A 13 ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' -6  13 
1 4L8P ASN A 14 ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' -5  14 
1 4L8P LEU A 15 ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' -4  15 
1 4L8P TYR A 16 ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' -3  16 
1 4L8P PHE A 17 ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' -2  17 
1 4L8P GLN A 18 ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' -1  18 
1 4L8P GLY A 19 ? UNP Q9RB47 ? ? 'LEADER SEQUENCE' 0   19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1PE non-polymer         . 'PENTAETHYLENE GLYCOL' PEG400 'C10 H22 O6'     238.278 
ALA 'L-peptide linking' y ALANINE                ?      'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE               ?      'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE             ?      'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ?      'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE               ?      'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE              ?      'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ?      'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                ?      'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE              ?      'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                  ?      'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE             ?      'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                ?      'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                 ?      'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE       ?      'C5 H11 N O2 Se' 196.106 
NA  non-polymer         . 'SODIUM ION'           ?      'Na 1'           22.990  
NI  non-polymer         . 'NICKEL (II) ION'      ?      'Ni 2'           58.693  
PGE non-polymer         . 'TRIETHYLENE GLYCOL'   ?      'C6 H14 O4'      150.173 
PHE 'L-peptide linking' y PHENYLALANINE          ?      'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                ?      'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                 ?      'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE              ?      'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN             ?      'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE               ?      'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                 ?      'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.entry_id          4L8P 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.05 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   40.07 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    
'50.00% polyethylene glycol 200, 0.1M HEPES pH 7.5, NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 325 mm CCD' 
_diffrn_detector.details                
'Flat mirror (vertical focusing); single crystal Si(111) bent monochromator (horizontal focusing)' 
_diffrn_detector.pdbx_collection_date   2010-11-23 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'single crystal Si(111) bent' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97945 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_wavelength             0.97945 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.entry_id                     4L8P 
_reflns.d_resolution_high            1.60 
_reflns.d_resolution_low             29.452 
_reflns.number_all                   23715 
_reflns.number_obs                   23715 
_reflns.pdbx_netI_over_sigmaI        11.100 
_reflns.pdbx_Rsym_value              0.095 
_reflns.pdbx_redundancy              7.300 
_reflns.percent_possible_obs         100.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.B_iso_Wilson_estimate        17.737 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.60 1.64   ? 12174 ? 0.651 2.7  0.651 ? 7.000 ? 1743 100.0 1  1 
1.64 1.69   ? 11918 ? 0.578 3.0  0.578 ? 7.100 ? 1680 100.0 2  1 
1.69 1.74   ? 11953 ? 0.470 3.6  0.470 ? 7.200 ? 1663 100.0 3  1 
1.74 1.79   ? 11744 ? 0.383 4.3  0.383 ? 7.200 ? 1626 100.0 4  1 
1.79 1.85   ? 11284 ? 0.318 5.0  0.318 ? 7.300 ? 1556 100.0 5  1 
1.85 1.91   ? 10961 ? 0.276 5.8  0.276 ? 7.300 ? 1506 100.0 6  1 
1.91 1.98   ? 10592 ? 0.200 7.4  0.200 ? 7.200 ? 1465 100.0 7  1 
1.98 2.07   ? 10117 ? 0.163 9.2  0.163 ? 7.300 ? 1384 100.0 8  1 
2.07 2.16   ? 9940  ? 0.155 10.8 0.155 ? 7.300 ? 1357 100.0 9  1 
2.16 2.26   ? 9487  ? 0.141 12.1 0.141 ? 7.300 ? 1302 100.0 10 1 
2.26 2.39   ? 8918  ? 0.124 13.7 0.124 ? 7.400 ? 1204 100.0 11 1 
2.39 2.53   ? 8677  ? 0.121 14.2 0.121 ? 7.400 ? 1175 100.0 12 1 
2.53 2.70   ? 8043  ? 0.107 15.8 0.107 ? 7.400 ? 1089 100.0 13 1 
2.70 2.92   ? 7574  ? 0.087 18.2 0.087 ? 7.400 ? 1020 100.0 14 1 
2.92 3.20   ? 6953  ? 0.067 20.7 0.067 ? 7.400 ? 934  100.0 15 1 
3.20 3.58   ? 6232  ? 0.057 25.6 0.057 ? 7.400 ? 841  100.0 16 1 
3.58 4.13   ? 5616  ? 0.058 28.4 0.058 ? 7.400 ? 758  100.0 17 1 
4.13 5.06   ? 4739  ? 0.051 29.2 0.051 ? 7.400 ? 639  100.0 18 1 
5.06 7.16   ? 3628  ? 0.061 24.9 0.061 ? 7.300 ? 495  100.0 19 1 
7.16 29.452 ? 1963  ? 0.058 26.3 0.058 ? 7.100 ? 278  97.9  20 1 
# 
_refine.entry_id                                 4L8P 
_refine.ls_d_res_high                            1.6000 
_refine.ls_d_res_low                             29.452 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.9300 
_refine.ls_number_reflns_obs                     23680 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;1. HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. 2. ATOM RECORDS CONTAIN SUM OF TLS AND RESIDUAL B FACTORS. 3. ANISOU RECORDS CONTAIN SUM OF TLS AND RESIDUAL U FACTORS. 4. WATERS WERE EXCLUDED FROM AUTOMATIC TLS ASSIGNMENT. 5. A MET-INHIBITION PROTOCOL WAS USED FOR SELENOMETHIONINE INCORPORATION DURING PROTEIN EXPRESSION. THE OCCUPANCY OF THE SE ATOMS IN THE MSE RESIDUES WAS REDUCED TO 0.75 FOR THE REDUCED SCATTERING POWER DUE TO PARTIAL S-MET INCORPORATION. 6. A NICKEL ION (NI+2) IS MODELED BASED ON A PEAK IN THE ANOMALOUS DIFFERENCE FOURIER. X-RAY FLUORESCENCE EMISSION SPECTRA SHOWED PEAKS CORRESPONDING TO THE NICKEL AND ZINC K-EDGES. DATA SETS WERE COLLECTED ABOVE AND BELOW THE ZINC AND NICKEL K-EDGES. COMPARING ANOMALOUS DIFFERENCE FOURIER MAPS FROM THESE 4 DATA SETS SUGGESTS A MIXTURE WITH MORE NICKEL THAN ZINC. 7. THE MODELED PEG 200 FRAGMENTS (1PE AND PGE) AND SODIUM IONS ARE PRESENT IN THE CRYSTALLIZATION SOLUTION AND PROTEIN BUFFER. 8. THE SCATTERING FACTORS FOR SULFUR, SELENIUM AND ZINC ATOMS WERE ADJUSTED BY REFMAC 5.7.0032 TO ACCOUNT FOR ANOMALOUS DISPERSION. THE SELENIUM CORRECTION WAS DERIVED FROM THE X-RAY FLUORESCENCE MAD SCAN WITH CHOOCH. THE CORRECTIONS FOR NICKEL AND SULFUR WERE BASED ON THE WAVELENGTH 0.97945 A (S F'= 0.18, SE F'= -7.60, NI F'= 0.06). THE CROMER MANN VALUES LISTED IN THE CIF VERSION OF THE FILE INCLUDE THIS CORRECTION.
;
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1526 
_refine.ls_R_factor_R_work                       0.1512 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.1808 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.2000 
_refine.ls_number_reflns_R_free                  1222 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               24.7923 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.7300 
_refine.aniso_B[2][2]                            0.7300 
_refine.aniso_B[3][3]                            -2.3500 
_refine.aniso_B[1][2]                            0.7300 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9720 
_refine.correlation_coeff_Fo_to_Fc_free          0.9640 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.0760 
_refine.pdbx_overall_ESU_R_Free                  0.0780 
_refine.overall_SU_ML                            0.0520 
_refine.overall_SU_B                             3.0620 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD WITH PHASES' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                96.870 
_refine.B_iso_min                                12.290 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.150 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1366 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.number_atoms_solvent             124 
_refine_hist.number_atoms_total               1518 
_refine_hist.d_res_high                       1.6000 
_refine_hist.d_res_low                        29.452 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       1465 0.011  0.019  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         1369 0.003  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    1973 1.488  1.983  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      3174 0.895  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 176  6.669  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 71   33.408 24.930 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 241  12.031 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 6    11.896 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         207  0.093  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   1632 0.006  0.020  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     322  0.002  0.020  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            695  2.120  3.209  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_other         694  2.117  3.194  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           874  3.206  6.006  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       1.6000 
_refine_ls_shell.d_res_low                        1.6420 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.9400 
_refine_ls_shell.number_reflns_R_work             1648 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2340 
_refine_ls_shell.R_factor_R_free                  0.2840 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             96 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1744 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4L8P 
_struct.title                     
'Crystal structure of a bile-acid 7-alpha dehydratase (CLOHIR_00079) from Clostridium hiranonis DSM 13275 at 1.60 A resolution' 
_struct.pdbx_descriptor           'Bile acid 7-alpha dehydratase, BaiE (E.C.4.2.1.106)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            Y 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.text            
'Cystatin-like, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, LYASE' 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.entry_id        4L8P 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 21 ? LYS A 56 ? THR A 2  LYS A 37 1 ? 36 
HELX_P HELX_P2 2 LEU A 57 ? THR A 63 ? LEU A 38 THR A 44 1 ? 7  
HELX_P HELX_P3 3 SER A 82 ? MSE A 94 ? SER A 63 MSE A 75 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A GLY 19  C   ? ? ? 1_555 A MSE 20  N  ? ? A GLY 0   A MSE 1   1_555 ? ? ? ? ? ? ? 1.325 ? 
covale2  covale ? ? A MSE 20  C   ? ? ? 1_555 A THR 21  N  ? ? A MSE 1   A THR 2   1_555 ? ? ? ? ? ? ? 1.333 ? 
covale3  covale ? ? A ALA 93  C   ? ? ? 1_555 A MSE 94  N  A ? A ALA 74  A MSE 75  1_555 ? ? ? ? ? ? ? 1.339 ? 
covale4  covale ? ? A ALA 93  C   ? ? ? 1_555 A MSE 94  N  B ? A ALA 74  A MSE 75  1_555 ? ? ? ? ? ? ? 1.339 ? 
covale5  covale ? ? A MSE 94  C   A ? ? 1_555 A PRO 95  N  ? ? A MSE 75  A PRO 76  1_555 ? ? ? ? ? ? ? 1.338 ? 
covale6  covale ? ? A MSE 94  C   B ? ? 1_555 A PRO 95  N  ? ? A MSE 75  A PRO 76  1_555 ? ? ? ? ? ? ? 1.351 ? 
covale7  covale ? ? A SER 100 C   ? ? ? 1_555 A MSE 101 N  A ? A SER 81  A MSE 82  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale8  covale ? ? A SER 100 C   ? ? ? 1_555 A MSE 101 N  B ? A SER 81  A MSE 82  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale9  covale ? ? A MSE 101 C   A ? ? 1_555 A HIS 102 N  ? ? A MSE 82  A HIS 83  1_555 ? ? ? ? ? ? ? 1.339 ? 
covale10 covale ? ? A MSE 101 C   B ? ? 1_555 A HIS 102 N  ? ? A MSE 82  A HIS 83  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale11 covale ? ? A HIS 102 C   ? ? ? 1_555 A MSE 103 N  ? ? A HIS 83  A MSE 84  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale12 covale ? ? A MSE 103 C   ? ? ? 1_555 A GLY 104 N  ? ? A MSE 84  A GLY 85  1_555 ? ? ? ? ? ? ? 1.337 ? 
covale13 covale ? ? A PHE 171 C   ? ? ? 1_555 A MSE 172 N  ? ? A PHE 152 A MSE 153 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale14 covale ? ? A MSE 172 C   ? ? ? 1_555 A ARG 173 N  ? ? A MSE 153 A ARG 154 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale15 covale ? ? A ASN 182 C   ? ? ? 1_555 A MSE 183 N  ? ? A ASN 163 A MSE 164 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale16 covale ? ? A MSE 183 C   ? ? ? 1_555 A HIS 184 N  ? ? A MSE 164 A HIS 165 1_555 ? ? ? ? ? ? ? 1.331 ? 
metalc1  metalc ? ? B NI  .   NI  ? ? ? 1_555 F HOH .   O  ? ? A NI  201 A HOH 321 1_555 ? ? ? ? ? ? ? 2.085 ? 
metalc2  metalc ? ? A HIS 105 NE2 ? ? ? 1_555 B NI  .   NI ? ? A HIS 86  A NI  201 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc3  metalc ? ? C NA  .   NA  ? ? ? 1_555 F HOH .   O  ? ? A NA  202 A HOH 350 1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc4  metalc ? ? A GLU 124 OE1 ? ? ? 1_555 C NA  .   NA ? ? A GLU 105 A NA  202 1_555 ? ? ? ? ? ? ? 2.592 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 73  ? SER A 74  ? TYR A 54  SER A 55  
A 2 VAL A 79  ? PHE A 80  ? VAL A 60  PHE A 61  
B 1 GLU A 98  ? ILE A 111 ? GLU A 79  ILE A 92  
B 2 THR A 116 ? PHE A 129 ? THR A 97  PHE A 110 
B 3 VAL A 137 ? ILE A 152 ? VAL A 118 ILE A 133 
B 4 GLN A 155 ? MSE A 172 ? GLN A 136 MSE A 153 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 73  ? N TYR A 54  O PHE A 80  ? O PHE A 61  
B 1 2 N ILE A 99  ? N ILE A 80  O ILE A 128 ? O ILE A 109 
B 2 3 N GLY A 119 ? N GLY A 100 O ASP A 147 ? O ASP A 128 
B 3 4 N LYS A 148 ? N LYS A 129 O GLU A 160 ? O GLU A 141 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NI A 201'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 202'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE PGE A 203' 
AC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE 1PE A 204' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  HIS A 105 ? HIS A 86  . ? 3_565 ? 
2  AC1 6  HIS A 105 ? HIS A 86  . ? 2_665 ? 
3  AC1 6  HIS A 105 ? HIS A 86  . ? 1_555 ? 
4  AC1 6  HOH F .   ? HOH A 321 . ? 2_665 ? 
5  AC1 6  HOH F .   ? HOH A 321 . ? 3_565 ? 
6  AC1 6  HOH F .   ? HOH A 321 . ? 1_555 ? 
7  AC2 6  GLU A 124 ? GLU A 105 . ? 3_565 ? 
8  AC2 6  GLU A 124 ? GLU A 105 . ? 2_665 ? 
9  AC2 6  GLU A 124 ? GLU A 105 . ? 1_555 ? 
10 AC2 6  HOH F .   ? HOH A 350 . ? 2_665 ? 
11 AC2 6  HOH F .   ? HOH A 350 . ? 1_555 ? 
12 AC2 6  HOH F .   ? HOH A 350 . ? 3_565 ? 
13 AC3 4  PHE A 171 ? PHE A 152 . ? 1_555 ? 
14 AC3 4  MSE A 172 ? MSE A 153 . ? 1_555 ? 
15 AC3 4  ASP A 174 ? ASP A 155 . ? 3_565 ? 
16 AC3 4  LYS A 176 ? LYS A 157 . ? 3_565 ? 
17 AC4 10 TYR A 49  ? TYR A 30  . ? 1_555 ? 
18 AC4 10 SER A 74  ? SER A 55  . ? 1_555 ? 
19 AC4 10 ASP A 75  ? ASP A 56  . ? 1_555 ? 
20 AC4 10 LEU A 90  ? LEU A 71  . ? 1_555 ? 
21 AC4 10 TYR A 145 ? TYR A 126 . ? 1_555 ? 
22 AC4 10 THR A 161 ? THR A 142 . ? 1_555 ? 
23 AC4 10 HOH F .   ? HOH A 313 . ? 1_555 ? 
24 AC4 10 HOH F .   ? HOH A 323 . ? 1_555 ? 
25 AC4 10 HOH F .   ? HOH A 325 . ? 1_555 ? 
26 AC4 10 HOH F .   ? HOH A 351 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4L8P 
_atom_sites.fract_transf_matrix[1][1]   0.016977 
_atom_sites.fract_transf_matrix[1][2]   0.009801 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019603 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010948 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
C  2.3100  20.8439 1.0200 10.2075 1.5886 0.5687  0.8650 51.6512 0.2156   ?      ?      
H  0.4930  10.5109 0.3229 26.1257 0.1402 3.1424  0.0408 57.7997 0.0030   ?      ?      
N  12.2126 0.0057  3.1322 9.8933  2.0125 28.9975 1.1663 0.5826  -11.5290 ?      ?      
NA 3.2565  2.6671  3.9362 6.1153  1.3998 0.2001  1.0032 14.0390 0.4609   0.0569 0.0490 
NI 11.4166 3.6766  7.4005 0.2449  5.3442 8.8730  0.9773 22.1626 0.9202   0.0588 1.9499 
O  3.0485  13.2771 2.2868 5.7011  1.5463 0.3239  0.8670 32.9089 0.2508   ?      ?      
S  6.9053  1.4679  5.2034 22.2151 1.4379 0.2536  1.5863 56.1720 1.0496   0.1827 0.2341 
SE 17.0006 2.4098  5.8196 0.2726  3.9731 15.2372 4.3543 43.8163 -4.7591  -7.60  4.92   
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 19  ? -0.267 18.201 44.131  1.00 33.94 ? 0   GLY A N   1 
ATOM   2    C  CA  . GLY A 1 19  ? -0.810 19.514 43.688  1.00 33.30 ? 0   GLY A CA  1 
ATOM   3    C  C   . GLY A 1 19  ? 0.300  20.529 43.506  1.00 30.41 ? 0   GLY A C   1 
ATOM   4    O  O   . GLY A 1 19  ? 1.452  20.258 43.841  1.00 31.31 ? 0   GLY A O   1 
HETATM 5    N  N   . MSE A 1 20  ? -0.059 21.683 42.962  1.00 28.13 ? 1   MSE A N   1 
HETATM 6    C  CA  . MSE A 1 20  ? 0.887  22.761 42.644  1.00 26.17 ? 1   MSE A CA  1 
HETATM 7    C  C   . MSE A 1 20  ? 0.554  23.962 43.485  1.00 26.24 ? 1   MSE A C   1 
HETATM 8    O  O   . MSE A 1 20  ? -0.625 24.271 43.700  1.00 28.03 ? 1   MSE A O   1 
HETATM 9    C  CB  . MSE A 1 20  ? 0.798  23.102 41.152  1.00 27.31 ? 1   MSE A CB  1 
HETATM 10   C  CG  . MSE A 1 20  ? 1.515  22.082 40.264  1.00 28.56 ? 1   MSE A CG  1 
HETATM 11   SE SE  . MSE A 1 20  ? 1.103  22.473 38.392  0.75 30.23 ? 1   MSE A SE  1 
HETATM 12   C  CE  . MSE A 1 20  ? 2.394  23.913 38.183  1.00 24.97 ? 1   MSE A CE  1 
ATOM   13   N  N   . THR A 1 21  ? 1.572  24.655 43.995  1.00 21.89 ? 2   THR A N   1 
ATOM   14   C  CA  . THR A 1 21  ? 1.358  25.881 44.733  1.00 20.20 ? 2   THR A CA  1 
ATOM   15   C  C   . THR A 1 21  ? 1.082  27.029 43.741  1.00 18.51 ? 2   THR A C   1 
ATOM   16   O  O   . THR A 1 21  ? 1.323  26.915 42.542  1.00 17.74 ? 2   THR A O   1 
ATOM   17   C  CB  . THR A 1 21  ? 2.612  26.291 45.531  1.00 21.15 ? 2   THR A CB  1 
ATOM   18   O  OG1 . THR A 1 21  ? 3.678  26.509 44.593  1.00 20.70 ? 2   THR A OG1 1 
ATOM   19   C  CG2 . THR A 1 21  ? 2.977  25.233 46.567  1.00 23.37 ? 2   THR A CG2 1 
ATOM   20   N  N   . LEU A 1 22  ? 0.649  28.177 44.262  1.00 19.75 ? 3   LEU A N   1 
ATOM   21   C  CA  . LEU A 1 22  ? 0.487  29.335 43.395  1.00 20.84 ? 3   LEU A CA  1 
ATOM   22   C  C   . LEU A 1 22  ? 1.788  29.723 42.686  1.00 17.88 ? 3   LEU A C   1 
ATOM   23   O  O   . LEU A 1 22  ? 1.769  30.057 41.490  1.00 18.85 ? 3   LEU A O   1 
ATOM   24   C  CB  . LEU A 1 22  ? -0.056 30.535 44.169  1.00 22.06 ? 3   LEU A CB  1 
ATOM   25   C  CG  . LEU A 1 22  ? -1.461 30.421 44.803  1.00 24.57 ? 3   LEU A CG  1 
ATOM   26   C  CD1 . LEU A 1 22  ? -1.912 31.811 45.239  1.00 26.24 ? 3   LEU A CD1 1 
ATOM   27   C  CD2 . LEU A 1 22  ? -2.493 29.813 43.853  1.00 25.79 ? 3   LEU A CD2 1 
ATOM   28   N  N   . GLU A 1 23  ? 2.892  29.698 43.426  1.00 19.34 ? 4   GLU A N   1 
ATOM   29   C  CA  . GLU A 1 23  ? 4.191  30.002 42.818  1.00 18.34 ? 4   GLU A CA  1 
ATOM   30   C  C   . GLU A 1 23  ? 4.545  29.057 41.667  1.00 17.31 ? 4   GLU A C   1 
ATOM   31   O  O   . GLU A 1 23  ? 5.018  29.499 40.604  1.00 17.51 ? 4   GLU A O   1 
ATOM   32   C  CB  . GLU A 1 23  ? 5.325  29.984 43.850  1.00 20.23 ? 4   GLU A CB  1 
ATOM   33   C  CG  . GLU A 1 23  ? 6.640  30.447 43.229  1.00 23.45 ? 4   GLU A CG  1 
ATOM   34   C  CD  . GLU A 1 23  ? 7.726  30.743 44.236  1.00 32.05 ? 4   GLU A CD  1 
ATOM   35   O  OE1 . GLU A 1 23  ? 7.610  30.310 45.407  1.00 33.72 ? 4   GLU A OE1 1 
ATOM   36   O  OE2 . GLU A 1 23  ? 8.689  31.435 43.824  1.00 40.56 ? 4   GLU A OE2 1 
ATOM   37   N  N   . ALA A 1 24  ? 4.315  27.747 41.848  1.00 17.57 ? 5   ALA A N   1 
ATOM   38   C  CA  . ALA A 1 24  ? 4.551  26.794 40.738  1.00 17.90 ? 5   ALA A CA  1 
ATOM   39   C  C   . ALA A 1 24  ? 3.700  27.092 39.506  1.00 17.70 ? 5   ALA A C   1 
ATOM   40   O  O   . ALA A 1 24  ? 4.137  26.955 38.359  1.00 18.15 ? 5   ALA A O   1 
ATOM   41   C  CB  . ALA A 1 24  ? 4.311  25.356 41.192  1.00 19.99 ? 5   ALA A CB  1 
ATOM   42   N  N   . ARG A 1 25  ? 2.452  27.503 39.735  1.00 17.75 ? 6   ARG A N   1 
ATOM   43   C  CA  . ARG A 1 25  ? 1.547  27.791 38.649  1.00 17.29 ? 6   ARG A CA  1 
ATOM   44   C  C   . ARG A 1 25  ? 1.984  29.063 37.897  1.00 16.39 ? 6   ARG A C   1 
ATOM   45   O  O   . ARG A 1 25  ? 1.865  29.142 36.668  1.00 16.70 ? 6   ARG A O   1 
ATOM   46   C  CB  . ARG A 1 25  ? 0.121  27.880 39.197  1.00 19.07 ? 6   ARG A CB  1 
ATOM   47   C  CG  . ARG A 1 25  ? -0.389 26.518 39.691  1.00 18.89 ? 6   ARG A CG  1 
ATOM   48   C  CD  . ARG A 1 25  ? -1.661 26.634 40.508  1.00 20.81 ? 6   ARG A CD  1 
ATOM   49   N  NE  . ARG A 1 25  ? -2.813 27.066 39.717  1.00 20.66 ? 6   ARG A NE  1 
ATOM   50   C  CZ  . ARG A 1 25  ? -4.033 27.284 40.223  1.00 20.43 ? 6   ARG A CZ  1 
ATOM   51   N  NH1 . ARG A 1 25  ? -4.280 27.176 41.527  1.00 21.16 ? 6   ARG A NH1 1 
ATOM   52   N  NH2 . ARG A 1 25  ? -5.022 27.653 39.416  1.00 22.40 ? 6   ARG A NH2 1 
ATOM   53   N  N   . ILE A 1 26  ? 2.488  30.051 38.645  1.00 16.12 ? 7   ILE A N   1 
ATOM   54   C  CA  . ILE A 1 26  ? 3.079  31.264 38.053  1.00 16.02 ? 7   ILE A CA  1 
ATOM   55   C  C   . ILE A 1 26  ? 4.318  30.923 37.204  1.00 15.63 ? 7   ILE A C   1 
ATOM   56   O  O   . ILE A 1 26  ? 4.440  31.380 36.057  1.00 15.85 ? 7   ILE A O   1 
ATOM   57   C  CB  . ILE A 1 26  ? 3.393  32.326 39.132  1.00 16.93 ? 7   ILE A CB  1 
ATOM   58   C  CG1 . ILE A 1 26  ? 2.096  32.897 39.712  1.00 18.38 ? 7   ILE A CG1 1 
ATOM   59   C  CG2 . ILE A 1 26  ? 4.239  33.472 38.579  1.00 18.25 ? 7   ILE A CG2 1 
ATOM   60   C  CD1 . ILE A 1 26  ? 2.278  33.646 41.015  1.00 19.66 ? 7   ILE A CD1 1 
ATOM   61   N  N   . GLU A 1 27  ? 5.200  30.086 37.752  1.00 16.81 ? 8   GLU A N   1 
ATOM   62   C  CA  . GLU A 1 27  ? 6.366  29.618 36.993  1.00 19.67 ? 8   GLU A CA  1 
ATOM   63   C  C   . GLU A 1 27  ? 5.995  28.968 35.680  1.00 18.41 ? 8   GLU A C   1 
ATOM   64   O  O   . GLU A 1 27  ? 6.599  29.233 34.638  1.00 20.03 ? 8   GLU A O   1 
ATOM   65   C  CB  . GLU A 1 27  ? 7.170  28.614 37.806  1.00 20.23 ? 8   GLU A CB  1 
ATOM   66   C  CG  . GLU A 1 27  ? 8.063  29.225 38.836  1.00 24.33 ? 8   GLU A CG  1 
ATOM   67   C  CD  . GLU A 1 27  ? 8.906  28.168 39.550  1.00 27.84 ? 8   GLU A CD  1 
ATOM   68   O  OE1 . GLU A 1 27  ? 8.760  26.934 39.295  1.00 30.92 ? 8   GLU A OE1 1 
ATOM   69   O  OE2 . GLU A 1 27  ? 9.686  28.591 40.400  1.00 32.60 ? 8   GLU A OE2 1 
ATOM   70   N  N   . ALA A 1 28  ? 4.949  28.137 35.701  1.00 17.22 ? 9   ALA A N   1 
ATOM   71   C  CA  . ALA A 1 28  ? 4.494  27.482 34.496  1.00 19.28 ? 9   ALA A CA  1 
ATOM   72   C  C   . ALA A 1 28  ? 3.991  28.518 33.489  1.00 19.15 ? 9   ALA A C   1 
ATOM   73   O  O   . ALA A 1 28  ? 4.301  28.445 32.312  1.00 18.78 ? 9   ALA A O   1 
ATOM   74   C  CB  . ALA A 1 28  ? 3.413  26.471 34.805  1.00 20.04 ? 9   ALA A CB  1 
ATOM   75   N  N   . LEU A 1 29  ? 3.222  29.492 33.965  1.00 15.48 ? 10  LEU A N   1 
ATOM   76   C  CA  . LEU A 1 29  ? 2.682  30.533 33.079  1.00 16.17 ? 10  LEU A CA  1 
ATOM   77   C  C   . LEU A 1 29  ? 3.784  31.388 32.452  1.00 16.53 ? 10  LEU A C   1 
ATOM   78   O  O   . LEU A 1 29  ? 3.691  31.765 31.282  1.00 16.60 ? 10  LEU A O   1 
ATOM   79   C  CB  . LEU A 1 29  ? 1.725  31.430 33.849  1.00 17.12 ? 10  LEU A CB  1 
ATOM   80   C  CG  . LEU A 1 29  ? 0.381  30.795 34.232  1.00 17.05 ? 10  LEU A CG  1 
ATOM   81   C  CD1 . LEU A 1 29  ? -0.302 31.597 35.313  1.00 18.17 ? 10  LEU A CD1 1 
ATOM   82   C  CD2 . LEU A 1 29  ? -0.518 30.683 33.011  1.00 19.53 ? 10  LEU A CD2 1 
ATOM   83   N  N   . GLU A 1 30  ? 4.797  31.707 33.258  1.00 17.50 ? 11  GLU A N   1 
ATOM   84   C  CA  . GLU A 1 30  ? 5.960  32.501 32.801  1.00 18.91 ? 11  GLU A CA  1 
ATOM   85   C  C   . GLU A 1 30  ? 6.691  31.803 31.648  1.00 18.47 ? 11  GLU A C   1 
ATOM   86   O  O   . GLU A 1 30  ? 6.959  32.426 30.623  1.00 19.90 ? 11  GLU A O   1 
ATOM   87   C  CB  . GLU A 1 30  ? 6.902  32.832 33.970  1.00 18.43 ? 11  GLU A CB  1 
ATOM   88   C  CG  . GLU A 1 30  ? 6.310  33.833 34.941  1.00 18.22 ? 11  GLU A CG  1 
ATOM   89   C  CD  . GLU A 1 30  ? 7.079  34.001 36.238  1.00 19.85 ? 11  GLU A CD  1 
ATOM   90   O  OE1 . GLU A 1 30  ? 7.782  33.055 36.679  1.00 22.98 ? 11  GLU A OE1 1 
ATOM   91   O  OE2 . GLU A 1 30  ? 6.954  35.065 36.877  1.00 20.29 ? 11  GLU A OE2 1 
ATOM   92   N  N   . LYS A 1 31  ? 6.883  30.491 31.764  1.00 19.46 ? 12  LYS A N   1 
ATOM   93   C  CA  . LYS A 1 31  ? 7.493  29.694 30.688  1.00 19.33 ? 12  LYS A CA  1 
ATOM   94   C  C   . LYS A 1 31  ? 6.614  29.677 29.422  1.00 18.99 ? 12  LYS A C   1 
ATOM   95   O  O   . LYS A 1 31  ? 7.106  29.915 28.308  1.00 18.25 ? 12  LYS A O   1 
ATOM   96   C  CB  . LYS A 1 31  ? 7.786  28.275 31.205  1.00 20.53 ? 12  LYS A CB  1 
ATOM   97   C  CG  . LYS A 1 31  ? 8.838  28.212 32.314  1.00 28.64 ? 12  LYS A CG  1 
ATOM   98   N  N   . GLU A 1 32  ? 5.312  29.446 29.593  1.00 18.05 ? 13  GLU A N   1 
ATOM   99   C  CA  . GLU A 1 32  ? 4.364  29.408 28.461  1.00 18.22 ? 13  GLU A CA  1 
ATOM   100  C  C   . GLU A 1 32  ? 4.266  30.743 27.747  1.00 16.90 ? 13  GLU A C   1 
ATOM   101  O  O   . GLU A 1 32  ? 4.267  30.803 26.512  1.00 18.28 ? 13  GLU A O   1 
ATOM   102  C  CB  . GLU A 1 32  ? 2.952  28.983 28.907  1.00 21.57 ? 13  GLU A CB  1 
ATOM   103  C  CG  . GLU A 1 32  ? 2.807  27.585 29.444  1.00 25.75 ? 13  GLU A CG  1 
ATOM   104  C  CD  . GLU A 1 32  ? 3.321  26.542 28.476  1.00 36.99 ? 13  GLU A CD  1 
ATOM   105  O  OE1 . GLU A 1 32  ? 2.838  26.504 27.323  1.00 39.02 ? 13  GLU A OE1 1 
ATOM   106  O  OE2 . GLU A 1 32  ? 4.220  25.765 28.858  1.00 46.46 ? 13  GLU A OE2 1 
ATOM   107  N  N   . ILE A 1 33  ? 4.213  31.834 28.504  1.00 17.37 ? 14  ILE A N   1 
ATOM   108  C  CA  . ILE A 1 33  ? 4.085  33.160 27.895  1.00 20.38 ? 14  ILE A CA  1 
ATOM   109  C  C   . ILE A 1 33  ? 5.395  33.538 27.184  1.00 19.51 ? 14  ILE A C   1 
ATOM   110  O  O   . ILE A 1 33  ? 5.364  34.124 26.122  1.00 19.70 ? 14  ILE A O   1 
ATOM   111  C  CB  . ILE A 1 33  ? 3.670  34.254 28.931  1.00 24.71 ? 14  ILE A CB  1 
ATOM   112  C  CG1 . ILE A 1 33  ? 3.104  35.490 28.230  1.00 37.12 ? 14  ILE A CG1 1 
ATOM   113  C  CG2 . ILE A 1 33  ? 4.816  34.687 29.805  1.00 31.57 ? 14  ILE A CG2 1 
ATOM   114  C  CD1 . ILE A 1 33  ? 1.684  35.290 27.763  1.00 44.67 ? 14  ILE A CD1 1 
ATOM   115  N  N   . GLN A 1 34  ? 6.540  33.173 27.763  1.00 19.40 ? 15  GLN A N   1 
ATOM   116  C  CA  . GLN A 1 34  ? 7.814  33.469 27.122  1.00 21.35 ? 15  GLN A CA  1 
ATOM   117  C  C   . GLN A 1 34  ? 7.877  32.758 25.763  1.00 18.54 ? 15  GLN A C   1 
ATOM   118  O  O   . GLN A 1 34  ? 8.330  33.341 24.776  1.00 18.42 ? 15  GLN A O   1 
ATOM   119  C  CB  . GLN A 1 34  ? 9.025  33.065 27.976  1.00 21.87 ? 15  GLN A CB  1 
ATOM   120  C  CG  . GLN A 1 34  ? 10.378 33.457 27.353  1.00 24.25 ? 15  GLN A CG  1 
ATOM   121  C  CD  . GLN A 1 34  ? 10.502 34.971 27.162  1.00 28.04 ? 15  GLN A CD  1 
ATOM   122  O  OE1 . GLN A 1 34  ? 10.492 35.721 28.132  1.00 36.76 ? 15  GLN A OE1 1 
ATOM   123  N  NE2 . GLN A 1 34  ? 10.592 35.429 25.904  1.00 26.99 ? 15  GLN A NE2 1 
ATOM   124  N  N   . ARG A 1 35  ? 7.421  31.518 25.716  1.00 18.60 ? 16  ARG A N   1 
ATOM   125  C  CA  . ARG A 1 35  ? 7.403  30.758 24.465  1.00 17.27 ? 16  ARG A CA  1 
ATOM   126  C  C   . ARG A 1 35  ? 6.540  31.470 23.413  1.00 15.56 ? 16  ARG A C   1 
ATOM   127  O  O   . ARG A 1 35  ? 6.974  31.666 22.256  1.00 14.92 ? 16  ARG A O   1 
ATOM   128  C  CB  . ARG A 1 35  ? 6.916  29.327 24.691  1.00 17.47 ? 16  ARG A CB  1 
ATOM   129  C  CG  . ARG A 1 35  ? 6.767  28.506 23.414  1.00 22.49 ? 16  ARG A CG  1 
ATOM   130  C  CD  . ARG A 1 35  ? 6.322  27.060 23.647  1.00 27.02 ? 16  ARG A CD  1 
ATOM   131  N  NE  . ARG A 1 35  ? 5.792  26.500 22.376  1.00 35.37 ? 16  ARG A NE  1 
ATOM   132  C  CZ  . ARG A 1 35  ? 4.523  26.551 21.931  1.00 44.09 ? 16  ARG A CZ  1 
ATOM   133  N  NH1 . ARG A 1 35  ? 3.538  27.144 22.622  1.00 37.60 ? 16  ARG A NH1 1 
ATOM   134  N  NH2 . ARG A 1 35  ? 4.219  25.988 20.756  1.00 49.05 ? 16  ARG A NH2 1 
ATOM   135  N  N   . LEU A 1 36  ? 5.317  31.862 23.800  1.00 14.62 ? 17  LEU A N   1 
ATOM   136  C  CA  . LEU A 1 36  ? 4.431  32.549 22.859  1.00 15.41 ? 17  LEU A CA  1 
ATOM   137  C  C   . LEU A 1 36  ? 4.975  33.883 22.407  1.00 15.21 ? 17  LEU A C   1 
ATOM   138  O  O   . LEU A 1 36  ? 4.862  34.239 21.231  1.00 15.51 ? 17  LEU A O   1 
ATOM   139  C  CB  . LEU A 1 36  ? 3.047  32.744 23.442  1.00 18.37 ? 17  LEU A CB  1 
ATOM   140  C  CG  . LEU A 1 36  ? 2.262  31.450 23.634  1.00 20.27 ? 17  LEU A CG  1 
ATOM   141  C  CD1 . LEU A 1 36  ? 1.051  31.734 24.494  1.00 24.98 ? 17  LEU A CD1 1 
ATOM   142  C  CD2 . LEU A 1 36  ? 1.840  30.826 22.332  1.00 21.73 ? 17  LEU A CD2 1 
ATOM   143  N  N   . ASN A 1 37  ? 5.573  34.625 23.343  1.00 15.14 ? 18  ASN A N   1 
ATOM   144  C  CA  . ASN A 1 37  ? 6.239  35.872 22.974  1.00 15.47 ? 18  ASN A CA  1 
ATOM   145  C  C   . ASN A 1 37  ? 7.377  35.663 21.973  1.00 13.93 ? 18  ASN A C   1 
ATOM   146  O  O   . ASN A 1 37  ? 7.519  36.445 21.004  1.00 14.79 ? 18  ASN A O   1 
ATOM   147  C  CB  . ASN A 1 37  ? 6.808  36.595 24.206  1.00 16.29 ? 18  ASN A CB  1 
ATOM   148  C  CG  . ASN A 1 37  ? 5.747  37.373 24.964  1.00 21.03 ? 18  ASN A CG  1 
ATOM   149  O  OD1 . ASN A 1 37  ? 4.691  37.690 24.421  1.00 23.61 ? 18  ASN A OD1 1 
ATOM   150  N  ND2 . ASN A 1 37  ? 6.041  37.709 26.208  1.00 22.83 ? 18  ASN A ND2 1 
ATOM   151  N  N   . ASP A 1 38  ? 8.200  34.636 22.208  1.00 14.53 ? 19  ASP A N   1 
ATOM   152  C  CA  . ASP A 1 38  ? 9.295  34.300 21.275  1.00 14.98 ? 19  ASP A CA  1 
ATOM   153  C  C   . ASP A 1 38  ? 8.766  33.915 19.883  1.00 14.14 ? 19  ASP A C   1 
ATOM   154  O  O   . ASP A 1 38  ? 9.287  34.376 18.861  1.00 14.48 ? 19  ASP A O   1 
ATOM   155  C  CB  . ASP A 1 38  ? 10.173 33.191 21.852  1.00 14.70 ? 19  ASP A CB  1 
ATOM   156  C  CG  . ASP A 1 38  ? 11.068 33.666 22.978  1.00 16.61 ? 19  ASP A CG  1 
ATOM   157  O  OD1 . ASP A 1 38  ? 11.445 34.854 23.031  1.00 17.94 ? 19  ASP A OD1 1 
ATOM   158  O  OD2 . ASP A 1 38  ? 11.406 32.809 23.807  1.00 20.22 ? 19  ASP A OD2 1 
ATOM   159  N  N   . ILE A 1 39  ? 7.693  33.131 19.851  1.00 13.94 ? 20  ILE A N   1 
ATOM   160  C  CA  . ILE A 1 39  ? 7.102  32.716 18.587  1.00 13.44 ? 20  ILE A CA  1 
ATOM   161  C  C   . ILE A 1 39  ? 6.640  33.954 17.825  1.00 13.56 ? 20  ILE A C   1 
ATOM   162  O  O   . ILE A 1 39  ? 6.909  34.094 16.609  1.00 13.04 ? 20  ILE A O   1 
ATOM   163  C  CB  . ILE A 1 39  ? 5.964  31.715 18.796  1.00 14.94 ? 20  ILE A CB  1 
ATOM   164  C  CG1 . ILE A 1 39  ? 6.534  30.362 19.218  1.00 15.83 ? 20  ILE A CG1 1 
ATOM   165  C  CG2 . ILE A 1 39  ? 5.082  31.590 17.532  1.00 14.33 ? 20  ILE A CG2 1 
ATOM   166  C  CD1 . ILE A 1 39  ? 5.459  29.384 19.669  1.00 16.58 ? 20  ILE A CD1 1 
ATOM   167  N  N   . GLU A 1 40  ? 5.921  34.838 18.512  1.00 13.57 ? 21  GLU A N   1 
ATOM   168  C  CA  . GLU A 1 40  ? 5.448  36.057 17.850  1.00 15.13 ? 21  GLU A CA  1 
ATOM   169  C  C   . GLU A 1 40  ? 6.601  36.949 17.375  1.00 13.74 ? 21  GLU A C   1 
ATOM   170  O  O   . GLU A 1 40  ? 6.523  37.502 16.287  1.00 15.15 ? 21  GLU A O   1 
ATOM   171  C  CB  . GLU A 1 40  ? 4.482  36.834 18.760  1.00 15.58 ? 21  GLU A CB  1 
ATOM   172  C  CG  . GLU A 1 40  ? 3.926  38.106 18.150  1.00 16.77 ? 21  GLU A CG  1 
ATOM   173  C  CD  . GLU A 1 40  ? 3.087  37.896 16.881  1.00 17.44 ? 21  GLU A CD  1 
ATOM   174  O  OE1 . GLU A 1 40  ? 2.625  36.771 16.585  1.00 17.22 ? 21  GLU A OE1 1 
ATOM   175  O  OE2 . GLU A 1 40  ? 2.864  38.903 16.166  1.00 18.15 ? 21  GLU A OE2 1 
ATOM   176  N  N   . ALA A 1 41  ? 7.655  37.101 18.181  1.00 14.82 ? 22  ALA A N   1 
ATOM   177  C  CA  . ALA A 1 41  ? 8.833  37.899 17.822  1.00 15.91 ? 22  ALA A CA  1 
ATOM   178  C  C   . ALA A 1 41  ? 9.512  37.349 16.563  1.00 14.15 ? 22  ALA A C   1 
ATOM   179  O  O   . ALA A 1 41  ? 9.874  38.105 15.662  1.00 13.56 ? 22  ALA A O   1 
ATOM   180  C  CB  . ALA A 1 41  ? 9.812  37.896 18.962  1.00 16.67 ? 22  ALA A CB  1 
ATOM   181  N  N   . ILE A 1 42  ? 9.582  36.031 16.483  1.00 12.29 ? 23  ILE A N   1 
ATOM   182  C  CA  . ILE A 1 42  ? 10.163 35.348 15.306  1.00 13.86 ? 23  ILE A CA  1 
ATOM   183  C  C   . ILE A 1 42  ? 9.308  35.559 14.048  1.00 15.08 ? 23  ILE A C   1 
ATOM   184  O  O   . ILE A 1 42  ? 9.823  35.837 12.955  1.00 14.42 ? 23  ILE A O   1 
ATOM   185  C  CB  . ILE A 1 42  ? 10.475 33.857 15.585  1.00 14.18 ? 23  ILE A CB  1 
ATOM   186  C  CG1 . ILE A 1 42  ? 11.652 33.768 16.568  1.00 15.13 ? 23  ILE A CG1 1 
ATOM   187  C  CG2 . ILE A 1 42  ? 10.759 33.102 14.305  1.00 13.44 ? 23  ILE A CG2 1 
ATOM   188  C  CD1 . ILE A 1 42  ? 11.795 32.411 17.235  1.00 14.57 ? 23  ILE A CD1 1 
ATOM   189  N  N   . LYS A 1 43  ? 7.996  35.409 14.178  1.00 13.76 ? 24  LYS A N   1 
ATOM   190  C  CA  . LYS A 1 43  ? 7.101  35.664 13.021  1.00 13.90 ? 24  LYS A CA  1 
ATOM   191  C  C   . LYS A 1 43  ? 7.255  37.115 12.503  1.00 13.54 ? 24  LYS A C   1 
ATOM   192  O  O   . LYS A 1 43  ? 7.261  37.346 11.287  1.00 14.82 ? 24  LYS A O   1 
ATOM   193  C  CB  . LYS A 1 43  ? 5.646  35.402 13.388  1.00 15.96 ? 24  LYS A CB  1 
ATOM   194  C  CG  . LYS A 1 43  ? 5.344  33.951 13.678  1.00 16.09 ? 24  LYS A CG  1 
ATOM   195  C  CD  . LYS A 1 43  ? 3.909  33.847 14.135  1.00 16.30 ? 24  LYS A CD  1 
ATOM   196  C  CE  . LYS A 1 43  ? 3.490  32.408 14.354  1.00 18.44 ? 24  LYS A CE  1 
ATOM   197  N  NZ  . LYS A 1 43  ? 2.128  32.392 14.959  1.00 19.26 ? 24  LYS A NZ  1 
ATOM   198  N  N   . GLN A 1 44  ? 7.418  38.079 13.416  1.00 13.97 ? 25  GLN A N   1 
ATOM   199  C  CA  . GLN A 1 44  ? 7.588  39.493 13.027  1.00 13.42 ? 25  GLN A CA  1 
ATOM   200  C  C   . GLN A 1 44  ? 8.967  39.780 12.432  1.00 14.16 ? 25  GLN A C   1 
ATOM   201  O  O   . GLN A 1 44  ? 9.099  40.585 11.517  1.00 14.38 ? 25  GLN A O   1 
ATOM   202  C  CB  . GLN A 1 44  ? 7.313  40.432 14.187  1.00 14.41 ? 25  GLN A CB  1 
ATOM   203  C  CG  . GLN A 1 44  ? 5.868  40.348 14.672  1.00 15.30 ? 25  GLN A CG  1 
ATOM   204  C  CD  . GLN A 1 44  ? 5.346  41.597 15.366  1.00 16.28 ? 25  GLN A CD  1 
ATOM   205  O  OE1 . GLN A 1 44  ? 5.819  42.704 15.126  1.00 18.10 ? 25  GLN A OE1 1 
ATOM   206  N  NE2 . GLN A 1 44  ? 4.310  41.418 16.167  1.00 17.65 ? 25  GLN A NE2 1 
ATOM   207  N  N   . LEU A 1 45  ? 9.964  39.060 12.931  1.00 13.92 ? 26  LEU A N   1 
ATOM   208  C  CA  . LEU A 1 45  ? 11.332 39.124 12.409  1.00 13.47 ? 26  LEU A CA  1 
ATOM   209  C  C   . LEU A 1 45  ? 11.346 38.666 10.963  1.00 13.87 ? 26  LEU A C   1 
ATOM   210  O  O   . LEU A 1 45  ? 11.927 39.312 10.082  1.00 14.78 ? 26  LEU A O   1 
ATOM   211  C  CB  . LEU A 1 45  ? 12.266 38.234 13.258  1.00 13.76 ? 26  LEU A CB  1 
ATOM   212  C  CG  . LEU A 1 45  ? 13.671 37.930 12.723  1.00 13.81 ? 26  LEU A CG  1 
ATOM   213  C  CD1 . LEU A 1 45  ? 14.513 39.186 12.695  1.00 15.63 ? 26  LEU A CD1 1 
ATOM   214  C  CD2 . LEU A 1 45  ? 14.330 36.861 13.583  1.00 13.45 ? 26  LEU A CD2 1 
ATOM   215  N  N   . LYS A 1 46  ? 10.742 37.505 10.696  1.00 13.98 ? 27  LYS A N   1 
ATOM   216  C  CA  . LYS A 1 46  ? 10.705 37.003 9.315   1.00 14.14 ? 27  LYS A CA  1 
ATOM   217  C  C   . LYS A 1 46  ? 9.895  37.925 8.397   1.00 13.27 ? 27  LYS A C   1 
ATOM   218  O  O   . LYS A 1 46  ? 10.273 38.155 7.239   1.00 14.75 ? 27  LYS A O   1 
ATOM   219  C  CB  . LYS A 1 46  ? 10.167 35.575 9.261   1.00 16.90 ? 27  LYS A CB  1 
ATOM   220  C  CG  . LYS A 1 46  ? 10.349 34.916 7.885   1.00 20.34 ? 27  LYS A CG  1 
ATOM   221  C  CD  . LYS A 1 46  ? 11.840 34.679 7.565   1.00 21.57 ? 27  LYS A CD  1 
ATOM   222  C  CE  . LYS A 1 46  ? 12.001 33.765 6.361   1.00 24.40 ? 27  LYS A CE  1 
ATOM   223  N  NZ  . LYS A 1 46  ? 13.344 33.208 6.206   1.00 26.01 ? 27  LYS A NZ  1 
ATOM   224  N  N   . ALA A 1 47  ? 8.815  38.488 8.913   1.00 13.60 ? 28  ALA A N   1 
ATOM   225  C  CA  . ALA A 1 47  ? 8.025  39.480 8.165   1.00 14.18 ? 28  ALA A CA  1 
ATOM   226  C  C   . ALA A 1 47  ? 8.877  40.674 7.759   1.00 15.26 ? 28  ALA A C   1 
ATOM   227  O  O   . ALA A 1 47  ? 8.834  41.108 6.610   1.00 13.80 ? 28  ALA A O   1 
ATOM   228  C  CB  . ALA A 1 47  ? 6.844  39.934 8.989   1.00 13.48 ? 28  ALA A CB  1 
ATOM   229  N  N   . LYS A 1 48  ? 9.661  41.177 8.706   1.00 15.45 ? 29  LYS A N   1 
ATOM   230  C  CA  . LYS A 1 48  ? 10.552 42.303 8.466   1.00 15.97 ? 29  LYS A CA  1 
ATOM   231  C  C   . LYS A 1 48  ? 11.598 41.924 7.412   1.00 16.48 ? 29  LYS A C   1 
ATOM   232  O  O   . LYS A 1 48  ? 11.898 42.730 6.523   1.00 14.60 ? 29  LYS A O   1 
ATOM   233  C  CB  . LYS A 1 48  ? 11.225 42.757 9.769   1.00 14.66 ? 29  LYS A CB  1 
ATOM   234  C  CG  . LYS A 1 48  ? 12.219 43.886 9.618   1.00 17.19 ? 29  LYS A CG  1 
ATOM   235  C  CD  . LYS A 1 48  ? 12.823 44.265 10.974  1.00 20.12 ? 29  LYS A CD  1 
ATOM   236  C  CE  . LYS A 1 48  ? 13.951 45.277 10.839  1.00 26.62 ? 29  LYS A CE  1 
ATOM   237  N  NZ  . LYS A 1 48  ? 14.668 45.487 12.146  1.00 29.45 ? 29  LYS A NZ  1 
ATOM   238  N  N   . TYR A 1 49  ? 12.171 40.726 7.514   1.00 15.01 ? 30  TYR A N   1 
ATOM   239  C  CA  . TYR A 1 49  ? 13.123 40.251 6.511   1.00 15.55 ? 30  TYR A CA  1 
ATOM   240  C  C   . TYR A 1 49  ? 12.530 40.336 5.092   1.00 15.63 ? 30  TYR A C   1 
ATOM   241  O  O   . TYR A 1 49  ? 13.167 40.882 4.175   1.00 15.02 ? 30  TYR A O   1 
ATOM   242  C  CB  . TYR A 1 49  ? 13.606 38.825 6.865   1.00 15.60 ? 30  TYR A CB  1 
ATOM   243  C  CG  . TYR A 1 49  ? 14.451 38.177 5.804   1.00 15.92 ? 30  TYR A CG  1 
ATOM   244  C  CD1 . TYR A 1 49  ? 13.856 37.439 4.782   1.00 15.70 ? 30  TYR A CD1 1 
ATOM   245  C  CD2 . TYR A 1 49  ? 15.837 38.325 5.800   1.00 15.82 ? 30  TYR A CD2 1 
ATOM   246  C  CE1 . TYR A 1 49  ? 14.611 36.884 3.769   1.00 19.38 ? 30  TYR A CE1 1 
ATOM   247  C  CE2 . TYR A 1 49  ? 16.613 37.754 4.790   1.00 17.95 ? 30  TYR A CE2 1 
ATOM   248  C  CZ  . TYR A 1 49  ? 15.991 37.047 3.777   1.00 19.80 ? 30  TYR A CZ  1 
ATOM   249  O  OH  . TYR A 1 49  ? 16.755 36.455 2.776   1.00 24.59 ? 30  TYR A OH  1 
ATOM   250  N  N   . PHE A 1 50  ? 11.320 39.786 4.902   1.00 15.91 ? 31  PHE A N   1 
ATOM   251  C  CA  . PHE A 1 50  ? 10.709 39.791 3.568   1.00 15.64 ? 31  PHE A CA  1 
ATOM   252  C  C   . PHE A 1 50  ? 10.383 41.179 3.064   1.00 16.72 ? 31  PHE A C   1 
ATOM   253  O  O   . PHE A 1 50  ? 10.619 41.500 1.899   1.00 15.23 ? 31  PHE A O   1 
ATOM   254  C  CB  . PHE A 1 50  ? 9.425  38.941 3.529   1.00 15.63 ? 31  PHE A CB  1 
ATOM   255  C  CG  . PHE A 1 50  ? 9.642  37.455 3.665   1.00 16.91 ? 31  PHE A CG  1 
ATOM   256  C  CD1 . PHE A 1 50  ? 10.613 36.795 2.929   1.00 18.49 ? 31  PHE A CD1 1 
ATOM   257  C  CD2 . PHE A 1 50  ? 8.811  36.706 4.504   1.00 17.70 ? 31  PHE A CD2 1 
ATOM   258  C  CE1 . PHE A 1 50  ? 10.763 35.418 3.036   1.00 22.05 ? 31  PHE A CE1 1 
ATOM   259  C  CE2 . PHE A 1 50  ? 8.972  35.336 4.607   1.00 22.40 ? 31  PHE A CE2 1 
ATOM   260  C  CZ  . PHE A 1 50  ? 9.943  34.703 3.874   1.00 20.06 ? 31  PHE A CZ  1 
ATOM   261  N  N   . ARG A 1 51  ? 9.867  42.012 3.956   1.00 16.00 ? 32  ARG A N   1 
ATOM   262  C  CA  . ARG A 1 51  ? 9.553  43.386 3.613   1.00 16.62 ? 32  ARG A CA  1 
ATOM   263  C  C   . ARG A 1 51  ? 10.814 44.160 3.200   1.00 15.31 ? 32  ARG A C   1 
ATOM   264  O  O   . ARG A 1 51  ? 10.812 44.889 2.203   1.00 17.73 ? 32  ARG A O   1 
ATOM   265  C  CB  . ARG A 1 51  ? 8.810  44.042 4.794   1.00 17.52 ? 32  ARG A CB  1 
ATOM   266  C  CG  . ARG A 1 51  ? 8.513  45.507 4.655   1.00 20.95 ? 32  ARG A CG  1 
ATOM   267  C  CD  . ARG A 1 51  ? 7.601  45.972 5.805   1.00 19.40 ? 32  ARG A CD  1 
ATOM   268  N  NE  . ARG A 1 51  ? 8.107  45.718 7.161   1.00 19.08 ? 32  ARG A NE  1 
ATOM   269  C  CZ  . ARG A 1 51  ? 9.021  46.470 7.799   1.00 21.98 ? 32  ARG A CZ  1 
ATOM   270  N  NH1 . ARG A 1 51  ? 9.591  47.518 7.201   1.00 22.32 ? 32  ARG A NH1 1 
ATOM   271  N  NH2 . ARG A 1 51  ? 9.386  46.155 9.038   1.00 22.25 ? 32  ARG A NH2 1 
ATOM   272  N  N   . CYS A 1 52  ? 11.901 43.993 3.949   1.00 15.89 ? 33  CYS A N   1 
ATOM   273  C  CA  . CYS A 1 52  ? 13.155 44.666 3.604   1.00 15.65 ? 33  CYS A CA  1 
ATOM   274  C  C   . CYS A 1 52  ? 13.789 44.090 2.326   1.00 16.53 ? 33  CYS A C   1 
ATOM   275  O  O   . CYS A 1 52  ? 14.372 44.843 1.532   1.00 17.03 ? 33  CYS A O   1 
ATOM   276  C  CB  . CYS A 1 52  ? 14.138 44.604 4.755   1.00 16.57 ? 33  CYS A CB  1 
ATOM   277  S  SG  . CYS A 1 52  ? 13.610 45.555 6.194   1.00 20.37 ? 33  CYS A SG  1 
ATOM   278  N  N   . LEU A 1 53  ? 13.680 42.773 2.145   1.00 15.09 ? 34  LEU A N   1 
ATOM   279  C  CA  . LEU A 1 53  ? 14.203 42.110 0.959   1.00 15.24 ? 34  LEU A CA  1 
ATOM   280  C  C   . LEU A 1 53  ? 13.548 42.664 -0.309  1.00 16.36 ? 34  LEU A C   1 
ATOM   281  O  O   . LEU A 1 53  ? 14.222 43.071 -1.255  1.00 16.87 ? 34  LEU A O   1 
ATOM   282  C  CB  . LEU A 1 53  ? 13.974 40.601 1.055   1.00 16.03 ? 34  LEU A CB  1 
ATOM   283  C  CG  . LEU A 1 53  ? 14.393 39.706 -0.123  1.00 18.37 ? 34  LEU A CG  1 
ATOM   284  C  CD1 . LEU A 1 53  ? 15.892 39.785 -0.324  1.00 21.50 ? 34  LEU A CD1 1 
ATOM   285  C  CD2 . LEU A 1 53  ? 13.983 38.285 0.132   1.00 18.45 ? 34  LEU A CD2 1 
ATOM   286  N  N   . ASP A 1 54  ? 12.217 42.659 -0.317  1.00 15.65 ? 35  ASP A N   1 
ATOM   287  C  CA  . ASP A 1 54  ? 11.477 43.099 -1.497  1.00 14.66 ? 35  ASP A CA  1 
ATOM   288  C  C   . ASP A 1 54  ? 11.484 44.607 -1.653  1.00 17.55 ? 35  ASP A C   1 
ATOM   289  O  O   . ASP A 1 54  ? 11.474 45.120 -2.781  1.00 17.78 ? 35  ASP A O   1 
ATOM   290  C  CB  . ASP A 1 54  ? 10.083 42.515 -1.463  1.00 16.99 ? 35  ASP A CB  1 
ATOM   291  C  CG  . ASP A 1 54  ? 10.084 41.006 -1.610  1.00 17.48 ? 35  ASP A CG  1 
ATOM   292  O  OD1 . ASP A 1 54  ? 10.995 40.433 -2.262  1.00 16.09 ? 35  ASP A OD1 1 
ATOM   293  O  OD2 . ASP A 1 54  ? 9.168  40.392 -1.048  1.00 17.46 ? 35  ASP A OD2 1 
ATOM   294  N  N   . GLY A 1 55  ? 11.551 45.321 -0.543  1.00 16.20 ? 36  GLY A N   1 
ATOM   295  C  CA  . GLY A 1 55  ? 11.722 46.774 -0.604  1.00 16.20 ? 36  GLY A CA  1 
ATOM   296  C  C   . GLY A 1 55  ? 13.137 47.215 -0.918  1.00 17.10 ? 36  GLY A C   1 
ATOM   297  O  O   . GLY A 1 55  ? 13.345 48.404 -1.146  1.00 18.00 ? 36  GLY A O   1 
ATOM   298  N  N   . LYS A 1 56  ? 14.093 46.280 -0.979  1.00 17.48 ? 37  LYS A N   1 
ATOM   299  C  CA  . LYS A 1 56  ? 15.519 46.579 -1.225  1.00 17.12 ? 37  LYS A CA  1 
ATOM   300  C  C   . LYS A 1 56  ? 16.114 47.536 -0.166  1.00 20.08 ? 37  LYS A C   1 
ATOM   301  O  O   . LYS A 1 56  ? 16.936 48.413 -0.484  1.00 21.92 ? 37  LYS A O   1 
ATOM   302  C  CB  . LYS A 1 56  ? 15.750 47.115 -2.658  1.00 19.39 ? 37  LYS A CB  1 
ATOM   303  C  CG  . LYS A 1 56  ? 15.172 46.204 -3.742  1.00 19.53 ? 37  LYS A CG  1 
ATOM   304  C  CD  . LYS A 1 56  ? 15.452 46.696 -5.152  1.00 19.50 ? 37  LYS A CD  1 
ATOM   305  C  CE  . LYS A 1 56  ? 14.621 45.920 -6.173  1.00 18.86 ? 37  LYS A CE  1 
ATOM   306  N  NZ  . LYS A 1 56  ? 15.022 44.496 -6.289  1.00 20.18 ? 37  LYS A NZ  1 
ATOM   307  N  N   . LEU A 1 57  ? 15.650 47.365 1.072   1.00 17.73 ? 38  LEU A N   1 
ATOM   308  C  CA  . LEU A 1 57  ? 16.102 48.163 2.215   1.00 21.19 ? 38  LEU A CA  1 
ATOM   309  C  C   . LEU A 1 57  ? 17.239 47.403 2.877   1.00 19.35 ? 38  LEU A C   1 
ATOM   310  O  O   . LEU A 1 57  ? 17.053 46.719 3.893   1.00 19.72 ? 38  LEU A O   1 
ATOM   311  C  CB  . LEU A 1 57  ? 14.944 48.406 3.181   1.00 20.38 ? 38  LEU A CB  1 
ATOM   312  C  CG  . LEU A 1 57  ? 13.696 49.080 2.583   1.00 23.22 ? 38  LEU A CG  1 
ATOM   313  C  CD1 . LEU A 1 57  ? 12.586 49.163 3.636   1.00 27.53 ? 38  LEU A CD1 1 
ATOM   314  C  CD2 . LEU A 1 57  ? 14.058 50.451 2.034   1.00 29.42 ? 38  LEU A CD2 1 
ATOM   315  N  N   . TRP A 1 58  ? 18.425 47.513 2.281   1.00 19.97 ? 39  TRP A N   1 
ATOM   316  C  CA  . TRP A 1 58  ? 19.477 46.556 2.560   1.00 19.21 ? 39  TRP A CA  1 
ATOM   317  C  C   . TRP A 1 58  ? 20.078 46.741 3.949   1.00 20.73 ? 39  TRP A C   1 
ATOM   318  O  O   . TRP A 1 58  ? 20.320 45.747 4.644   1.00 19.78 ? 39  TRP A O   1 
ATOM   319  C  CB  . TRP A 1 58  ? 20.558 46.574 1.484   1.00 21.00 ? 39  TRP A CB  1 
ATOM   320  C  CG  . TRP A 1 58  ? 20.025 46.337 0.097   1.00 21.39 ? 39  TRP A CG  1 
ATOM   321  C  CD1 . TRP A 1 58  ? 20.183 47.157 -1.003  1.00 24.24 ? 39  TRP A CD1 1 
ATOM   322  C  CD2 . TRP A 1 58  ? 19.277 45.203 -0.352  1.00 20.86 ? 39  TRP A CD2 1 
ATOM   323  N  NE1 . TRP A 1 58  ? 19.553 46.593 -2.102  1.00 23.45 ? 39  TRP A NE1 1 
ATOM   324  C  CE2 . TRP A 1 58  ? 18.989 45.402 -1.726  1.00 22.70 ? 39  TRP A CE2 1 
ATOM   325  C  CE3 . TRP A 1 58  ? 18.786 44.042 0.282   1.00 20.41 ? 39  TRP A CE3 1 
ATOM   326  C  CZ2 . TRP A 1 58  ? 18.266 44.459 -2.492  1.00 21.52 ? 39  TRP A CZ2 1 
ATOM   327  C  CZ3 . TRP A 1 58  ? 18.048 43.101 -0.487  1.00 21.68 ? 39  TRP A CZ3 1 
ATOM   328  C  CH2 . TRP A 1 58  ? 17.793 43.336 -1.856  1.00 22.08 ? 39  TRP A CH2 1 
ATOM   329  N  N   . ASP A 1 59  ? 20.255 48.000 4.360   1.00 21.88 ? 40  ASP A N   1 
ATOM   330  C  CA  . ASP A 1 59  ? 20.729 48.287 5.726   1.00 23.76 ? 40  ASP A CA  1 
ATOM   331  C  C   . ASP A 1 59  ? 19.789 47.777 6.803   1.00 22.76 ? 40  ASP A C   1 
ATOM   332  O  O   . ASP A 1 59  ? 20.237 47.206 7.796   1.00 22.69 ? 40  ASP A O   1 
ATOM   333  C  CB  . ASP A 1 59  ? 20.951 49.792 5.939   1.00 27.76 ? 40  ASP A CB  1 
ATOM   334  C  CG  . ASP A 1 59  ? 22.122 50.328 5.133   1.00 34.88 ? 40  ASP A CG  1 
ATOM   335  O  OD1 . ASP A 1 59  ? 23.008 49.534 4.768   1.00 33.35 ? 40  ASP A OD1 1 
ATOM   336  O  OD2 . ASP A 1 59  ? 22.143 51.550 4.869   1.00 44.38 ? 40  ASP A OD2 1 
ATOM   337  N  N   . GLU A 1 60  ? 18.496 48.005 6.613   1.00 20.97 ? 41  GLU A N   1 
ATOM   338  C  CA  . GLU A 1 60  ? 17.479 47.442 7.520   1.00 20.31 ? 41  GLU A CA  1 
ATOM   339  C  C   . GLU A 1 60  ? 17.434 45.908 7.493   1.00 17.87 ? 41  GLU A C   1 
ATOM   340  O  O   . GLU A 1 60  ? 17.368 45.262 8.553   1.00 19.38 ? 41  GLU A O   1 
ATOM   341  C  CB  . GLU A 1 60  ? 16.094 48.060 7.264   1.00 21.77 ? 41  GLU A CB  1 
ATOM   342  C  CG  . GLU A 1 60  ? 15.122 47.815 8.415   1.00 31.86 ? 41  GLU A CG  1 
ATOM   343  C  CD  . GLU A 1 60  ? 13.840 48.638 8.341   1.00 47.96 ? 41  GLU A CD  1 
ATOM   344  O  OE1 . GLU A 1 60  ? 13.620 49.387 7.357   1.00 42.88 ? 41  GLU A OE1 1 
ATOM   345  O  OE2 . GLU A 1 60  ? 13.034 48.529 9.288   1.00 64.14 ? 41  GLU A OE2 1 
ATOM   346  N  N   . LEU A 1 61  ? 17.525 45.301 6.304   1.00 18.83 ? 42  LEU A N   1 
ATOM   347  C  CA  . LEU A 1 61  ? 17.585 43.839 6.226   1.00 19.99 ? 42  LEU A CA  1 
ATOM   348  C  C   . LEU A 1 61  ? 18.752 43.275 7.040   1.00 19.27 ? 42  LEU A C   1 
ATOM   349  O  O   . LEU A 1 61  ? 18.640 42.244 7.713   1.00 15.80 ? 42  LEU A O   1 
ATOM   350  C  CB  . LEU A 1 61  ? 17.717 43.375 4.787   1.00 19.78 ? 42  LEU A CB  1 
ATOM   351  C  CG  . LEU A 1 61  ? 17.582 41.852 4.613   1.00 21.16 ? 42  LEU A CG  1 
ATOM   352  C  CD1 . LEU A 1 61  ? 16.957 41.600 3.252   1.00 25.97 ? 42  LEU A CD1 1 
ATOM   353  C  CD2 . LEU A 1 61  ? 18.912 41.104 4.650   1.00 23.79 ? 42  LEU A CD2 1 
ATOM   354  N  N   . GLU A 1 62  ? 19.898 43.951 6.991   1.00 18.45 ? 43  GLU A N   1 
ATOM   355  C  CA  . GLU A 1 62  ? 21.074 43.517 7.735   1.00 18.33 ? 43  GLU A CA  1 
ATOM   356  C  C   . GLU A 1 62  ? 20.809 43.365 9.250   1.00 18.16 ? 43  GLU A C   1 
ATOM   357  O  O   . GLU A 1 62  ? 21.371 42.480 9.882   1.00 19.08 ? 43  GLU A O   1 
ATOM   358  C  CB  . GLU A 1 62  ? 22.237 44.512 7.514   1.00 22.40 ? 43  GLU A CB  1 
ATOM   359  C  CG  . GLU A 1 62  ? 23.586 44.006 7.989   1.00 28.83 ? 43  GLU A CG  1 
ATOM   360  C  CD  . GLU A 1 62  ? 24.726 44.975 7.671   1.00 33.58 ? 43  GLU A CD  1 
ATOM   361  O  OE1 . GLU A 1 62  ? 24.632 45.677 6.658   1.00 37.49 ? 43  GLU A OE1 1 
ATOM   362  O  OE2 . GLU A 1 62  ? 25.711 45.000 8.432   1.00 45.61 ? 43  GLU A OE2 1 
ATOM   363  N  N   . THR A 1 63  ? 19.910 44.171 9.802   1.00 17.57 ? 44  THR A N   1 
ATOM   364  C  CA  . THR A 1 63  ? 19.570 44.121 11.242  1.00 20.23 ? 44  THR A CA  1 
ATOM   365  C  C   . THR A 1 63  ? 18.778 42.870 11.643  1.00 19.92 ? 44  THR A C   1 
ATOM   366  O  O   . THR A 1 63  ? 18.676 42.569 12.820  1.00 20.94 ? 44  THR A O   1 
ATOM   367  C  CB  . THR A 1 63  ? 18.785 45.353 11.721  1.00 21.29 ? 44  THR A CB  1 
ATOM   368  O  OG1 . THR A 1 63  ? 17.445 45.353 11.184  1.00 20.55 ? 44  THR A OG1 1 
ATOM   369  C  CG2 . THR A 1 63  ? 19.500 46.645 11.364  1.00 22.98 ? 44  THR A CG2 1 
ATOM   370  N  N   . THR A 1 64  ? 18.223 42.151 10.668  1.00 18.42 ? 45  THR A N   1 
ATOM   371  C  CA  . THR A 1 64  ? 17.538 40.882 10.936  1.00 17.46 ? 45  THR A CA  1 
ATOM   372  C  C   . THR A 1 64  ? 18.480 39.676 11.041  1.00 17.18 ? 45  THR A C   1 
ATOM   373  O  O   . THR A 1 64  ? 18.046 38.606 11.457  1.00 17.34 ? 45  THR A O   1 
ATOM   374  C  CB  . THR A 1 64  ? 16.462 40.576 9.854   1.00 15.47 ? 45  THR A CB  1 
ATOM   375  O  OG1 . THR A 1 64  ? 17.098 40.196 8.624   1.00 16.74 ? 45  THR A OG1 1 
ATOM   376  C  CG2 . THR A 1 64  ? 15.508 41.762 9.656   1.00 16.20 ? 45  THR A CG2 1 
ATOM   377  N  N   . LEU A 1 65  ? 19.742 39.835 10.644  1.00 17.49 ? 46  LEU A N   1 
ATOM   378  C  CA  . LEU A 1 65  ? 20.719 38.757 10.573  1.00 17.83 ? 46  LEU A CA  1 
ATOM   379  C  C   . LEU A 1 65  ? 21.536 38.756 11.846  1.00 17.09 ? 46  LEU A C   1 
ATOM   380  O  O   . LEU A 1 65  ? 21.880 39.824 12.414  1.00 18.81 ? 46  LEU A O   1 
ATOM   381  C  CB  . LEU A 1 65  ? 21.656 38.923 9.359   1.00 17.88 ? 46  LEU A CB  1 
ATOM   382  C  CG  . LEU A 1 65  ? 20.956 39.079 7.996   1.00 18.24 ? 46  LEU A CG  1 
ATOM   383  C  CD1 . LEU A 1 65  ? 21.972 39.270 6.871   1.00 20.22 ? 46  LEU A CD1 1 
ATOM   384  C  CD2 . LEU A 1 65  ? 20.045 37.893 7.719   1.00 20.86 ? 46  LEU A CD2 1 
ATOM   385  N  N   . SER A 1 66  ? 21.869 37.568 12.304  1.00 18.83 ? 47  SER A N   1 
ATOM   386  C  CA  . SER A 1 66  ? 22.607 37.452 13.569  1.00 20.32 ? 47  SER A CA  1 
ATOM   387  C  C   . SER A 1 66  ? 23.930 38.210 13.574  1.00 23.23 ? 47  SER A C   1 
ATOM   388  O  O   . SER A 1 66  ? 24.664 38.131 12.596  1.00 22.28 ? 47  SER A O   1 
ATOM   389  C  CB  . SER A 1 66  ? 22.859 35.991 13.896  1.00 22.98 ? 47  SER A CB  1 
ATOM   390  O  OG  . SER A 1 66  ? 23.621 35.902 15.093  1.00 26.06 ? 47  SER A OG  1 
ATOM   391  N  N   . PRO A 1 67  ? 24.229 38.939 14.680  1.00 22.29 ? 48  PRO A N   1 
ATOM   392  C  CA  . PRO A 1 67  ? 25.549 39.598 14.796  1.00 26.75 ? 48  PRO A CA  1 
ATOM   393  C  C   . PRO A 1 67  ? 26.667 38.633 15.228  1.00 30.73 ? 48  PRO A C   1 
ATOM   394  O  O   . PRO A 1 67  ? 27.836 39.018 15.230  1.00 36.23 ? 48  PRO A O   1 
ATOM   395  C  CB  . PRO A 1 67  ? 25.304 40.679 15.865  1.00 26.42 ? 48  PRO A CB  1 
ATOM   396  C  CG  . PRO A 1 67  ? 24.238 40.118 16.724  1.00 25.79 ? 48  PRO A CG  1 
ATOM   397  C  CD  . PRO A 1 67  ? 23.352 39.292 15.815  1.00 23.15 ? 48  PRO A CD  1 
ATOM   398  N  N   . ASN A 1 68  ? 26.308 37.402 15.583  1.00 32.36 ? 49  ASN A N   1 
ATOM   399  C  CA  . ASN A 1 68  ? 27.267 36.352 15.962  1.00 35.56 ? 49  ASN A CA  1 
ATOM   400  C  C   . ASN A 1 68  ? 27.997 35.827 14.711  1.00 41.27 ? 49  ASN A C   1 
ATOM   401  O  O   . ASN A 1 68  ? 27.478 34.963 14.013  1.00 39.62 ? 49  ASN A O   1 
ATOM   402  C  CB  . ASN A 1 68  ? 26.488 35.229 16.668  1.00 34.92 ? 49  ASN A CB  1 
ATOM   403  C  CG  . ASN A 1 68  ? 27.357 34.079 17.154  1.00 44.08 ? 49  ASN A CG  1 
ATOM   404  O  OD1 . ASN A 1 68  ? 28.558 33.997 16.879  1.00 43.19 ? 49  ASN A OD1 1 
ATOM   405  N  ND2 . ASN A 1 68  ? 26.730 33.169 17.891  1.00 47.23 ? 49  ASN A ND2 1 
ATOM   406  N  N   A ILE A 1 69  ? 29.187 36.345 14.420  0.50 50.67 ? 50  ILE A N   1 
ATOM   407  N  N   B ILE A 1 69  ? 29.203 36.343 14.473  0.50 51.93 ? 50  ILE A N   1 
ATOM   408  C  CA  A ILE A 1 69  ? 29.912 35.925 13.205  0.50 55.18 ? 50  ILE A CA  1 
ATOM   409  C  CA  B ILE A 1 69  ? 30.006 35.979 13.296  0.50 57.68 ? 50  ILE A CA  1 
ATOM   410  C  C   A ILE A 1 69  ? 30.655 34.574 13.327  0.50 54.15 ? 50  ILE A C   1 
ATOM   411  C  C   B ILE A 1 69  ? 30.605 34.562 13.312  0.50 54.40 ? 50  ILE A C   1 
ATOM   412  O  O   A ILE A 1 69  ? 31.454 34.234 12.454  0.50 57.45 ? 50  ILE A O   1 
ATOM   413  O  O   B ILE A 1 69  ? 31.251 34.161 12.341  0.50 53.74 ? 50  ILE A O   1 
ATOM   414  C  CB  A ILE A 1 69  ? 30.842 37.034 12.675  0.50 56.71 ? 50  ILE A CB  1 
ATOM   415  C  CB  B ILE A 1 69  ? 31.148 36.985 13.073  0.50 62.86 ? 50  ILE A CB  1 
ATOM   416  C  CG1 A ILE A 1 69  ? 30.000 38.172 12.089  0.50 52.68 ? 50  ILE A CG1 1 
ATOM   417  C  CG1 B ILE A 1 69  ? 32.031 37.070 14.321  0.50 58.49 ? 50  ILE A CG1 1 
ATOM   418  C  CG2 A ILE A 1 69  ? 31.770 36.482 11.602  0.50 59.11 ? 50  ILE A CG2 1 
ATOM   419  C  CG2 B ILE A 1 69  ? 30.574 38.345 12.696  0.50 66.30 ? 50  ILE A CG2 1 
ATOM   420  C  CD1 A ILE A 1 69  ? 30.818 39.307 11.512  0.50 56.92 ? 50  ILE A CD1 1 
ATOM   421  C  CD1 B ILE A 1 69  ? 33.340 37.787 14.083  0.50 61.16 ? 50  ILE A CD1 1 
ATOM   422  N  N   . GLU A 1 70  ? 30.385 33.805 14.388  1.00 50.27 ? 51  GLU A N   1 
ATOM   423  C  CA  . GLU A 1 70  ? 30.605 32.335 14.364  1.00 60.21 ? 51  GLU A CA  1 
ATOM   424  C  C   . GLU A 1 70  ? 29.585 31.693 13.386  1.00 57.41 ? 51  GLU A C   1 
ATOM   425  O  O   . GLU A 1 70  ? 29.811 30.599 12.879  1.00 55.87 ? 51  GLU A O   1 
ATOM   426  C  CB  . GLU A 1 70  ? 30.443 31.687 15.750  1.00 66.88 ? 51  GLU A CB  1 
ATOM   427  C  CG  . GLU A 1 70  ? 31.295 32.269 16.878  1.00 74.47 ? 51  GLU A CG  1 
ATOM   428  C  CD  . GLU A 1 70  ? 32.794 32.113 16.672  1.00 89.73 ? 51  GLU A CD  1 
ATOM   429  O  OE1 . GLU A 1 70  ? 33.231 31.183 15.954  1.00 96.87 ? 51  GLU A OE1 1 
ATOM   430  O  OE2 . GLU A 1 70  ? 33.546 32.927 17.249  1.00 90.00 ? 51  GLU A OE2 1 
ATOM   431  N  N   . THR A 1 71  ? 28.454 32.378 13.166  1.00 56.61 ? 52  THR A N   1 
ATOM   432  C  CA  . THR A 1 71  ? 27.495 32.060 12.090  1.00 61.19 ? 52  THR A CA  1 
ATOM   433  C  C   . THR A 1 71  ? 28.161 32.007 10.704  1.00 51.71 ? 52  THR A C   1 
ATOM   434  O  O   . THR A 1 71  ? 28.879 32.941 10.306  1.00 45.84 ? 52  THR A O   1 
ATOM   435  C  CB  . THR A 1 71  ? 26.358 33.125 12.009  1.00 54.00 ? 52  THR A CB  1 
ATOM   436  O  OG1 . THR A 1 71  ? 25.740 33.296 13.293  1.00 57.37 ? 52  THR A OG1 1 
ATOM   437  C  CG2 . THR A 1 71  ? 25.291 32.751 10.979  1.00 54.84 ? 52  THR A CG2 1 
ATOM   438  N  N   . SER A 1 72  ? 27.940 30.899 9.995   1.00 57.57 ? 53  SER A N   1 
ATOM   439  C  CA  . SER A 1 72  ? 28.035 30.901 8.541   1.00 53.74 ? 53  SER A CA  1 
ATOM   440  C  C   . SER A 1 72  ? 26.605 31.226 8.086   1.00 39.20 ? 53  SER A C   1 
ATOM   441  O  O   . SER A 1 72  ? 25.630 30.514 8.416   1.00 43.07 ? 53  SER A O   1 
ATOM   442  C  CB  . SER A 1 72  ? 28.573 29.570 7.964   1.00 58.84 ? 53  SER A CB  1 
ATOM   443  O  OG  . SER A 1 72  ? 27.565 28.790 7.319   1.00 47.49 ? 53  SER A OG  1 
ATOM   444  N  N   . TYR A 1 73  ? 26.482 32.321 7.345   1.00 30.37 ? 54  TYR A N   1 
ATOM   445  C  CA  . TYR A 1 73  ? 25.198 32.813 6.891   1.00 25.65 ? 54  TYR A CA  1 
ATOM   446  C  C   . TYR A 1 73  ? 24.906 32.082 5.593   1.00 23.62 ? 54  TYR A C   1 
ATOM   447  O  O   . TYR A 1 73  ? 25.443 32.433 4.537   1.00 26.84 ? 54  TYR A O   1 
ATOM   448  C  CB  . TYR A 1 73  ? 25.220 34.347 6.661   1.00 27.60 ? 54  TYR A CB  1 
ATOM   449  C  CG  . TYR A 1 73  ? 25.587 35.084 7.938   1.00 27.99 ? 54  TYR A CG  1 
ATOM   450  C  CD1 . TYR A 1 73  ? 26.921 35.291 8.270   1.00 30.72 ? 54  TYR A CD1 1 
ATOM   451  C  CD2 . TYR A 1 73  ? 24.616 35.506 8.826   1.00 24.89 ? 54  TYR A CD2 1 
ATOM   452  C  CE1 . TYR A 1 73  ? 27.277 35.929 9.445   1.00 30.10 ? 54  TYR A CE1 1 
ATOM   453  C  CE2 . TYR A 1 73  ? 24.955 36.152 10.016  1.00 27.41 ? 54  TYR A CE2 1 
ATOM   454  C  CZ  . TYR A 1 73  ? 26.299 36.350 10.316  1.00 29.95 ? 54  TYR A CZ  1 
ATOM   455  O  OH  . TYR A 1 73  ? 26.702 36.988 11.477  1.00 31.17 ? 54  TYR A OH  1 
ATOM   456  N  N   . SER A 1 74  ? 24.050 31.071 5.676   1.00 22.82 ? 55  SER A N   1 
ATOM   457  C  CA  . SER A 1 74  ? 23.807 30.191 4.540   1.00 20.64 ? 55  SER A CA  1 
ATOM   458  C  C   . SER A 1 74  ? 22.329 29.888 4.354   1.00 20.89 ? 55  SER A C   1 
ATOM   459  O  O   . SER A 1 74  ? 21.553 29.925 5.316   1.00 19.72 ? 55  SER A O   1 
ATOM   460  C  CB  . SER A 1 74  ? 24.548 28.874 4.741   1.00 22.10 ? 55  SER A CB  1 
ATOM   461  O  OG  . SER A 1 74  ? 24.508 28.057 3.563   1.00 23.99 ? 55  SER A OG  1 
ATOM   462  N  N   . ASP A 1 75  ? 21.949 29.609 3.108   1.00 18.03 ? 56  ASP A N   1 
ATOM   463  C  CA  . ASP A 1 75  ? 20.645 29.016 2.814   1.00 17.88 ? 56  ASP A CA  1 
ATOM   464  C  C   . ASP A 1 75  ? 20.789 27.563 2.330   1.00 19.67 ? 56  ASP A C   1 
ATOM   465  O  O   . ASP A 1 75  ? 19.858 27.024 1.767   1.00 18.90 ? 56  ASP A O   1 
ATOM   466  C  CB  . ASP A 1 75  ? 19.856 29.869 1.826   1.00 20.08 ? 56  ASP A CB  1 
ATOM   467  C  CG  . ASP A 1 75  ? 20.463 29.889 0.423   1.00 21.96 ? 56  ASP A CG  1 
ATOM   468  O  OD1 . ASP A 1 75  ? 21.528 29.272 0.204   1.00 19.93 ? 56  ASP A OD1 1 
ATOM   469  O  OD2 . ASP A 1 75  ? 19.854 30.564 -0.453  1.00 24.82 ? 56  ASP A OD2 1 
ATOM   470  N  N   . GLY A 1 76  ? 21.969 26.953 2.544   1.00 20.44 ? 57  GLY A N   1 
ATOM   471  C  CA  . GLY A 1 76  ? 22.231 25.618 2.037   1.00 18.94 ? 57  GLY A CA  1 
ATOM   472  C  C   . GLY A 1 76  ? 22.855 25.612 0.647   1.00 21.12 ? 57  GLY A C   1 
ATOM   473  O  O   . GLY A 1 76  ? 23.366 24.592 0.222   1.00 21.38 ? 57  GLY A O   1 
ATOM   474  N  N   . LYS A 1 77  ? 22.786 26.746 -0.066  1.00 19.97 ? 58  LYS A N   1 
ATOM   475  C  CA  . LYS A 1 77  ? 23.302 26.862 -1.439  1.00 19.81 ? 58  LYS A CA  1 
ATOM   476  C  C   . LYS A 1 77  ? 24.348 27.982 -1.510  1.00 20.06 ? 58  LYS A C   1 
ATOM   477  O  O   . LYS A 1 77  ? 25.437 27.800 -2.016  1.00 21.81 ? 58  LYS A O   1 
ATOM   478  C  CB  . LYS A 1 77  ? 22.147 27.109 -2.414  1.00 24.33 ? 58  LYS A CB  1 
ATOM   479  C  CG  . LYS A 1 77  ? 21.444 25.839 -2.917  1.00 30.49 ? 58  LYS A CG  1 
ATOM   480  C  CD  . LYS A 1 77  ? 20.496 25.244 -1.915  1.00 32.22 ? 58  LYS A CD  1 
ATOM   481  C  CE  . LYS A 1 77  ? 19.640 24.157 -2.553  1.00 34.40 ? 58  LYS A CE  1 
ATOM   482  N  NZ  . LYS A 1 77  ? 18.614 23.650 -1.608  1.00 36.26 ? 58  LYS A NZ  1 
ATOM   483  N  N   . LEU A 1 78  ? 23.954 29.154 -1.023  1.00 20.02 ? 59  LEU A N   1 
ATOM   484  C  CA  . LEU A 1 78  ? 24.795 30.318 -0.950  1.00 23.41 ? 59  LEU A CA  1 
ATOM   485  C  C   . LEU A 1 78  ? 25.288 30.440 0.484   1.00 21.26 ? 59  LEU A C   1 
ATOM   486  O  O   . LEU A 1 78  ? 24.544 30.206 1.427   1.00 23.26 ? 59  LEU A O   1 
ATOM   487  C  CB  . LEU A 1 78  ? 23.978 31.542 -1.359  1.00 25.80 ? 59  LEU A CB  1 
ATOM   488  C  CG  . LEU A 1 78  ? 23.492 31.489 -2.825  1.00 30.69 ? 59  LEU A CG  1 
ATOM   489  C  CD1 . LEU A 1 78  ? 22.523 32.625 -3.130  1.00 36.48 ? 59  LEU A CD1 1 
ATOM   490  C  CD2 . LEU A 1 78  ? 24.669 31.532 -3.794  1.00 35.65 ? 59  LEU A CD2 1 
ATOM   491  N  N   . VAL A 1 79  ? 26.532 30.820 0.651   1.00 22.91 ? 60  VAL A N   1 
ATOM   492  C  CA  . VAL A 1 79  ? 27.113 30.948 1.976   1.00 24.46 ? 60  VAL A CA  1 
ATOM   493  C  C   . VAL A 1 79  ? 27.991 32.191 2.036   1.00 23.93 ? 60  VAL A C   1 
ATOM   494  O  O   . VAL A 1 79  ? 28.834 32.437 1.154   1.00 24.50 ? 60  VAL A O   1 
ATOM   495  C  CB  . VAL A 1 79  ? 27.874 29.659 2.420   1.00 33.72 ? 60  VAL A CB  1 
ATOM   496  C  CG1 . VAL A 1 79  ? 28.734 29.112 1.298   1.00 34.37 ? 60  VAL A CG1 1 
ATOM   497  C  CG2 . VAL A 1 79  ? 28.706 29.906 3.673   1.00 32.92 ? 60  VAL A CG2 1 
ATOM   498  N  N   . PHE A 1 80  ? 27.779 32.967 3.096   1.00 22.91 ? 61  PHE A N   1 
ATOM   499  C  CA  . PHE A 1 80  ? 28.533 34.181 3.373   1.00 25.22 ? 61  PHE A CA  1 
ATOM   500  C  C   . PHE A 1 80  ? 29.032 34.201 4.821   1.00 27.43 ? 61  PHE A C   1 
ATOM   501  O  O   . PHE A 1 80  ? 28.572 33.452 5.688   1.00 24.74 ? 61  PHE A O   1 
ATOM   502  C  CB  . PHE A 1 80  ? 27.679 35.405 3.049   1.00 22.57 ? 61  PHE A CB  1 
ATOM   503  C  CG  . PHE A 1 80  ? 27.054 35.339 1.691   1.00 25.83 ? 61  PHE A CG  1 
ATOM   504  C  CD1 . PHE A 1 80  ? 27.776 35.726 0.557   1.00 31.76 ? 61  PHE A CD1 1 
ATOM   505  C  CD2 . PHE A 1 80  ? 25.786 34.797 1.526   1.00 26.23 ? 61  PHE A CD2 1 
ATOM   506  C  CE1 . PHE A 1 80  ? 27.222 35.627 -0.713  1.00 33.24 ? 61  PHE A CE1 1 
ATOM   507  C  CE2 . PHE A 1 80  ? 25.226 34.712 0.252   1.00 28.55 ? 61  PHE A CE2 1 
ATOM   508  C  CZ  . PHE A 1 80  ? 25.942 35.117 -0.858  1.00 29.05 ? 61  PHE A CZ  1 
ATOM   509  N  N   . HIS A 1 81  ? 29.958 35.109 5.095   1.00 27.86 ? 62  HIS A N   1 
ATOM   510  C  CA  . HIS A 1 81  ? 30.639 35.109 6.403   1.00 30.31 ? 62  HIS A CA  1 
ATOM   511  C  C   . HIS A 1 81  ? 30.358 36.316 7.301   1.00 31.51 ? 62  HIS A C   1 
ATOM   512  O  O   . HIS A 1 81  ? 30.848 36.362 8.425   1.00 31.47 ? 62  HIS A O   1 
ATOM   513  C  CB  . HIS A 1 81  ? 32.134 34.893 6.158   1.00 35.93 ? 62  HIS A CB  1 
ATOM   514  C  CG  . HIS A 1 81  ? 32.409 33.628 5.403   1.00 50.94 ? 62  HIS A CG  1 
ATOM   515  N  ND1 . HIS A 1 81  ? 32.314 32.381 5.986   1.00 57.60 ? 62  HIS A ND1 1 
ATOM   516  C  CD2 . HIS A 1 81  ? 32.681 33.410 4.095   1.00 60.56 ? 62  HIS A CD2 1 
ATOM   517  C  CE1 . HIS A 1 81  ? 32.561 31.452 5.080   1.00 63.98 ? 62  HIS A CE1 1 
ATOM   518  N  NE2 . HIS A 1 81  ? 32.786 32.051 3.924   1.00 69.20 ? 62  HIS A NE2 1 
ATOM   519  N  N   . SER A 1 82  ? 29.544 37.257 6.816   1.00 28.33 ? 63  SER A N   1 
ATOM   520  C  CA  . SER A 1 82  ? 29.040 38.352 7.639   1.00 28.73 ? 63  SER A CA  1 
ATOM   521  C  C   . SER A 1 82  ? 27.681 38.834 7.135   1.00 24.26 ? 63  SER A C   1 
ATOM   522  O  O   . SER A 1 82  ? 27.362 38.618 5.967   1.00 25.37 ? 63  SER A O   1 
ATOM   523  C  CB  . SER A 1 82  ? 30.033 39.520 7.595   1.00 25.69 ? 63  SER A CB  1 
ATOM   524  O  OG  . SER A 1 82  ? 30.031 40.160 6.343   1.00 26.16 ? 63  SER A OG  1 
ATOM   525  N  N   . PRO A 1 83  ? 26.916 39.559 7.981   1.00 25.38 ? 64  PRO A N   1 
ATOM   526  C  CA  . PRO A 1 83  ? 25.701 40.208 7.478   1.00 25.83 ? 64  PRO A CA  1 
ATOM   527  C  C   . PRO A 1 83  ? 25.940 41.157 6.316   1.00 25.60 ? 64  PRO A C   1 
ATOM   528  O  O   . PRO A 1 83  ? 25.121 41.183 5.390   1.00 25.45 ? 64  PRO A O   1 
ATOM   529  C  CB  . PRO A 1 83  ? 25.182 40.976 8.697   1.00 26.26 ? 64  PRO A CB  1 
ATOM   530  C  CG  . PRO A 1 83  ? 25.662 40.174 9.855   1.00 27.41 ? 64  PRO A CG  1 
ATOM   531  C  CD  . PRO A 1 83  ? 27.040 39.730 9.441   1.00 26.26 ? 64  PRO A CD  1 
ATOM   532  N  N   . LYS A 1 84  ? 27.050 41.911 6.335   1.00 24.95 ? 65  LYS A N   1 
ATOM   533  C  CA  . LYS A 1 84  ? 27.350 42.821 5.240   1.00 24.12 ? 65  LYS A CA  1 
ATOM   534  C  C   . LYS A 1 84  ? 27.603 42.095 3.921   1.00 25.20 ? 65  LYS A C   1 
ATOM   535  O  O   . LYS A 1 84  ? 27.227 42.580 2.856   1.00 26.06 ? 65  LYS A O   1 
ATOM   536  C  CB  . LYS A 1 84  ? 28.580 43.697 5.564   1.00 31.23 ? 65  LYS A CB  1 
ATOM   537  C  CG  . LYS A 1 84  ? 28.836 44.769 4.516   1.00 42.51 ? 65  LYS A CG  1 
ATOM   538  C  CD  . LYS A 1 84  ? 29.874 45.803 4.948   1.00 58.71 ? 65  LYS A CD  1 
ATOM   539  C  CE  . LYS A 1 84  ? 29.259 47.125 5.376   1.00 67.37 ? 65  LYS A CE  1 
ATOM   540  N  NZ  . LYS A 1 84  ? 30.314 48.164 5.533   1.00 72.43 ? 65  LYS A NZ  1 
ATOM   541  N  N   . GLU A 1 85  ? 28.276 40.953 3.987   1.00 27.57 ? 66  GLU A N   1 
ATOM   542  C  CA  . GLU A 1 85  ? 28.498 40.127 2.789   1.00 27.14 ? 66  GLU A CA  1 
ATOM   543  C  C   . GLU A 1 85  ? 27.159 39.651 2.222   1.00 21.52 ? 66  GLU A C   1 
ATOM   544  O  O   . GLU A 1 85  ? 26.988 39.598 1.003   1.00 22.55 ? 66  GLU A O   1 
ATOM   545  C  CB  . GLU A 1 85  ? 29.411 38.922 3.066   1.00 27.60 ? 66  GLU A CB  1 
ATOM   546  C  CG  . GLU A 1 85  ? 30.908 39.237 3.181   1.00 37.09 ? 66  GLU A CG  1 
ATOM   547  C  CD  . GLU A 1 85  ? 31.784 37.990 3.275   1.00 38.79 ? 66  GLU A CD  1 
ATOM   548  O  OE1 . GLU A 1 85  ? 31.234 36.878 3.193   1.00 30.88 ? 66  GLU A OE1 1 
ATOM   549  O  OE2 . GLU A 1 85  ? 33.039 38.120 3.411   1.00 35.05 ? 66  GLU A OE2 1 
ATOM   550  N  N   . VAL A 1 86  ? 26.232 39.293 3.100   1.00 22.00 ? 67  VAL A N   1 
ATOM   551  C  CA  . VAL A 1 86  ? 24.903 38.869 2.655   1.00 21.85 ? 67  VAL A CA  1 
ATOM   552  C  C   . VAL A 1 86  ? 24.214 40.015 1.906   1.00 22.97 ? 67  VAL A C   1 
ATOM   553  O  O   . VAL A 1 86  ? 23.716 39.814 0.794   1.00 22.35 ? 67  VAL A O   1 
ATOM   554  C  CB  . VAL A 1 86  ? 24.017 38.378 3.799   1.00 19.83 ? 67  VAL A CB  1 
ATOM   555  C  CG1 . VAL A 1 86  ? 22.601 38.097 3.285   1.00 20.71 ? 67  VAL A CG1 1 
ATOM   556  C  CG2 . VAL A 1 86  ? 24.592 37.127 4.464   1.00 22.42 ? 67  VAL A CG2 1 
ATOM   557  N  N   . THR A 1 87  ? 24.200 41.215 2.498   1.00 25.60 ? 68  THR A N   1 
ATOM   558  C  CA  . THR A 1 87  ? 23.492 42.341 1.864   1.00 26.89 ? 68  THR A CA  1 
ATOM   559  C  C   . THR A 1 87  ? 24.213 42.877 0.622   1.00 26.37 ? 68  THR A C   1 
ATOM   560  O  O   . THR A 1 87  ? 23.547 43.353 -0.306  1.00 30.89 ? 68  THR A O   1 
ATOM   561  C  CB  . THR A 1 87  ? 23.160 43.462 2.876   1.00 27.70 ? 68  THR A CB  1 
ATOM   562  O  OG1 . THR A 1 87  ? 24.377 43.959 3.441   1.00 29.05 ? 68  THR A OG1 1 
ATOM   563  C  CG2 . THR A 1 87  ? 22.280 42.930 3.981   1.00 27.80 ? 68  THR A CG2 1 
ATOM   564  N  N   . GLU A 1 88  ? 25.549 42.788 0.576   1.00 26.34 ? 69  GLU A N   1 
ATOM   565  C  CA  . GLU A 1 88  ? 26.270 43.081 -0.661  1.00 28.81 ? 69  GLU A CA  1 
ATOM   566  C  C   . GLU A 1 88  ? 25.894 42.143 -1.806  1.00 27.26 ? 69  GLU A C   1 
ATOM   567  O  O   . GLU A 1 88  ? 25.726 42.578 -2.937  1.00 30.47 ? 69  GLU A O   1 
ATOM   568  C  CB  . GLU A 1 88  ? 27.783 43.075 -0.449  1.00 35.48 ? 69  GLU A CB  1 
ATOM   569  C  CG  . GLU A 1 88  ? 28.257 44.317 0.285   1.00 48.70 ? 69  GLU A CG  1 
ATOM   570  C  CD  . GLU A 1 88  ? 29.730 44.274 0.695   1.00 59.16 ? 69  GLU A CD  1 
ATOM   571  O  OE1 . GLU A 1 88  ? 30.273 43.180 0.997   1.00 60.80 ? 69  GLU A OE1 1 
ATOM   572  O  OE2 . GLU A 1 88  ? 30.339 45.362 0.738   1.00 63.17 ? 69  GLU A OE2 1 
ATOM   573  N  N   . TYR A 1 89  ? 25.788 40.854 -1.519  1.00 23.92 ? 70  TYR A N   1 
ATOM   574  C  CA  . TYR A 1 89  ? 25.329 39.892 -2.513  1.00 24.71 ? 70  TYR A CA  1 
ATOM   575  C  C   . TYR A 1 89  ? 23.899 40.247 -2.976  1.00 22.90 ? 70  TYR A C   1 
ATOM   576  O  O   . TYR A 1 89  ? 23.629 40.309 -4.177  1.00 24.91 ? 70  TYR A O   1 
ATOM   577  C  CB  . TYR A 1 89  ? 25.376 38.441 -1.979  1.00 25.86 ? 70  TYR A CB  1 
ATOM   578  C  CG  . TYR A 1 89  ? 24.634 37.473 -2.897  1.00 28.28 ? 70  TYR A CG  1 
ATOM   579  C  CD1 . TYR A 1 89  ? 25.251 36.952 -4.051  1.00 30.64 ? 70  TYR A CD1 1 
ATOM   580  C  CD2 . TYR A 1 89  ? 23.301 37.130 -2.656  1.00 30.40 ? 70  TYR A CD2 1 
ATOM   581  C  CE1 . TYR A 1 89  ? 24.565 36.105 -4.916  1.00 30.86 ? 70  TYR A CE1 1 
ATOM   582  C  CE2 . TYR A 1 89  ? 22.604 36.292 -3.525  1.00 31.70 ? 70  TYR A CE2 1 
ATOM   583  C  CZ  . TYR A 1 89  ? 23.240 35.785 -4.647  1.00 32.89 ? 70  TYR A CZ  1 
ATOM   584  O  OH  . TYR A 1 89  ? 22.533 34.957 -5.490  1.00 39.97 ? 70  TYR A OH  1 
ATOM   585  N  N   . LEU A 1 90  ? 23.000 40.446 -2.028  1.00 22.49 ? 71  LEU A N   1 
ATOM   586  C  CA  . LEU A 1 90  ? 21.591 40.674 -2.370  1.00 21.74 ? 71  LEU A CA  1 
ATOM   587  C  C   . LEU A 1 90  ? 21.382 41.947 -3.188  1.00 23.92 ? 71  LEU A C   1 
ATOM   588  O  O   . LEU A 1 90  ? 20.611 41.948 -4.159  1.00 24.55 ? 71  LEU A O   1 
ATOM   589  C  CB  . LEU A 1 90  ? 20.706 40.680 -1.138  1.00 22.19 ? 71  LEU A CB  1 
ATOM   590  C  CG  . LEU A 1 90  ? 20.555 39.346 -0.383  1.00 25.43 ? 71  LEU A CG  1 
ATOM   591  C  CD1 . LEU A 1 90  ? 19.781 39.572 0.907   1.00 24.16 ? 71  LEU A CD1 1 
ATOM   592  C  CD2 . LEU A 1 90  ? 19.877 38.268 -1.222  1.00 26.37 ? 71  LEU A CD2 1 
ATOM   593  N  N   . ALA A 1 91  ? 22.086 43.011 -2.822  1.00 25.08 ? 72  ALA A N   1 
ATOM   594  C  CA  . ALA A 1 91  ? 21.986 44.270 -3.558  1.00 26.40 ? 72  ALA A CA  1 
ATOM   595  C  C   . ALA A 1 91  ? 22.403 44.102 -5.021  1.00 30.17 ? 72  ALA A C   1 
ATOM   596  O  O   . ALA A 1 91  ? 21.767 44.676 -5.912  1.00 29.44 ? 72  ALA A O   1 
ATOM   597  C  CB  . ALA A 1 91  ? 22.806 45.341 -2.866  1.00 27.91 ? 72  ALA A CB  1 
ATOM   598  N  N   . ALA A 1 92  ? 23.439 43.294 -5.266  1.00 29.15 ? 73  ALA A N   1 
ATOM   599  C  CA  . ALA A 1 92  ? 23.878 42.972 -6.632  1.00 33.00 ? 73  ALA A CA  1 
ATOM   600  C  C   . ALA A 1 92  ? 22.951 42.004 -7.348  1.00 32.68 ? 73  ALA A C   1 
ATOM   601  O  O   . ALA A 1 92  ? 22.652 42.192 -8.527  1.00 30.35 ? 73  ALA A O   1 
ATOM   602  C  CB  . ALA A 1 92  ? 25.308 42.416 -6.625  1.00 36.31 ? 73  ALA A CB  1 
ATOM   603  N  N   . ALA A 1 93  ? 22.493 40.974 -6.640  1.00 28.67 ? 74  ALA A N   1 
ATOM   604  C  CA  . ALA A 1 93  ? 21.637 39.940 -7.220  1.00 29.15 ? 74  ALA A CA  1 
ATOM   605  C  C   . ALA A 1 93  ? 20.200 40.380 -7.480  1.00 27.59 ? 74  ALA A C   1 
ATOM   606  O  O   . ALA A 1 93  ? 19.547 39.829 -8.386  1.00 29.49 ? 74  ALA A O   1 
ATOM   607  C  CB  . ALA A 1 93  ? 21.646 38.688 -6.360  1.00 31.87 ? 74  ALA A CB  1 
HETATM 608  N  N   A MSE A 1 94  ? 19.737 41.389 -6.732  0.70 24.94 ? 75  MSE A N   1 
HETATM 609  N  N   B MSE A 1 94  ? 19.684 41.303 -6.659  0.30 25.54 ? 75  MSE A N   1 
HETATM 610  C  CA  A MSE A 1 94  ? 18.344 41.853 -6.779  0.70 24.03 ? 75  MSE A CA  1 
HETATM 611  C  CA  B MSE A 1 94  ? 18.308 41.820 -6.777  0.30 23.77 ? 75  MSE A CA  1 
HETATM 612  C  C   A MSE A 1 94  ? 18.357 43.338 -7.059  0.70 20.94 ? 75  MSE A C   1 
HETATM 613  C  C   B MSE A 1 94  ? 18.363 43.305 -7.053  0.30 22.46 ? 75  MSE A C   1 
HETATM 614  O  O   A MSE A 1 94  ? 17.978 44.168 -6.213  0.70 20.88 ? 75  MSE A O   1 
HETATM 615  O  O   B MSE A 1 94  ? 18.006 44.105 -6.183  0.30 22.84 ? 75  MSE A O   1 
HETATM 616  C  CB  A MSE A 1 94  ? 17.673 41.499 -5.484  0.70 24.83 ? 75  MSE A CB  1 
HETATM 617  C  CB  B MSE A 1 94  ? 17.511 41.609 -5.493  0.30 23.39 ? 75  MSE A CB  1 
HETATM 618  C  CG  A MSE A 1 94  ? 17.766 39.995 -5.324  0.70 28.64 ? 75  MSE A CG  1 
HETATM 619  C  CG  B MSE A 1 94  ? 17.353 40.141 -5.109  0.30 23.24 ? 75  MSE A CG  1 
HETATM 620  SE SE  A MSE A 1 94  ? 16.803 39.584 -3.716  0.52 23.53 ? 75  MSE A SE  1 
HETATM 621  SE SE  B MSE A 1 94  ? 15.614 39.428 -5.715  0.23 21.73 ? 75  MSE A SE  1 
HETATM 622  C  CE  A MSE A 1 94  ? 15.009 39.685 -4.414  0.70 27.14 ? 75  MSE A CE  1 
HETATM 623  C  CE  B MSE A 1 94  ? 15.747 37.780 -4.640  0.30 25.37 ? 75  MSE A CE  1 
ATOM   624  N  N   . PRO A 1 95  ? 18.798 43.704 -8.268  1.00 22.61 ? 76  PRO A N   1 
ATOM   625  C  CA  . PRO A 1 95  ? 18.962 45.129 -8.583  1.00 22.87 ? 76  PRO A CA  1 
ATOM   626  C  C   . PRO A 1 95  ? 17.613 45.847 -8.777  1.00 20.90 ? 76  PRO A C   1 
ATOM   627  O  O   . PRO A 1 95  ? 16.543 45.191 -8.740  1.00 21.20 ? 76  PRO A O   1 
ATOM   628  C  CB  . PRO A 1 95  ? 19.749 45.091 -9.886  1.00 25.39 ? 76  PRO A CB  1 
ATOM   629  C  CG  . PRO A 1 95  ? 19.244 43.855 -10.560 1.00 24.28 ? 76  PRO A CG  1 
ATOM   630  C  CD  . PRO A 1 95  ? 19.173 42.864 -9.430  1.00 24.50 ? 76  PRO A CD  1 
ATOM   631  N  N   . LYS A 1 96  ? 17.665 47.164 -8.993  1.00 22.53 ? 77  LYS A N   1 
ATOM   632  C  CA  . LYS A 1 96  ? 16.450 47.982 -9.160  1.00 23.86 ? 77  LYS A CA  1 
ATOM   633  C  C   . LYS A 1 96  ? 15.554 47.466 -10.287 1.00 21.92 ? 77  LYS A C   1 
ATOM   634  O  O   . LYS A 1 96  ? 14.334 47.592 -10.198 1.00 26.53 ? 77  LYS A O   1 
ATOM   635  C  CB  . LYS A 1 96  ? 16.803 49.453 -9.419  1.00 32.15 ? 77  LYS A CB  1 
ATOM   636  C  CG  . LYS A 1 96  ? 17.437 50.153 -8.219  1.00 45.11 ? 77  LYS A CG  1 
ATOM   637  C  CD  . LYS A 1 96  ? 16.410 50.592 -7.182  1.00 53.52 ? 77  LYS A CD  1 
ATOM   638  C  CE  . LYS A 1 96  ? 16.037 52.060 -7.352  1.00 58.23 ? 77  LYS A CE  1 
ATOM   639  N  NZ  . LYS A 1 96  ? 15.000 52.495 -6.376  1.00 57.84 ? 77  LYS A NZ  1 
ATOM   640  N  N   . GLU A 1 97  ? 16.149 46.852 -11.322 1.00 20.71 ? 78  GLU A N   1 
ATOM   641  C  CA  . GLU A 1 97  ? 15.392 46.333 -12.467 1.00 23.17 ? 78  GLU A CA  1 
ATOM   642  C  C   . GLU A 1 97  ? 14.630 45.064 -12.155 1.00 22.66 ? 78  GLU A C   1 
ATOM   643  O  O   . GLU A 1 97  ? 13.904 44.587 -13.029 1.00 25.49 ? 78  GLU A O   1 
ATOM   644  C  CB  . GLU A 1 97  ? 16.276 45.950 -13.677 1.00 26.64 ? 78  GLU A CB  1 
ATOM   645  C  CG  . GLU A 1 97  ? 17.415 46.841 -14.069 1.00 39.85 ? 78  GLU A CG  1 
ATOM   646  C  CD  . GLU A 1 97  ? 18.636 46.511 -13.250 1.00 39.42 ? 78  GLU A CD  1 
ATOM   647  O  OE1 . GLU A 1 97  ? 19.386 45.537 -13.547 1.00 43.95 ? 78  GLU A OE1 1 
ATOM   648  O  OE2 . GLU A 1 97  ? 18.793 47.248 -12.287 1.00 32.89 ? 78  GLU A OE2 1 
ATOM   649  N  N   . GLU A 1 98  ? 14.829 44.476 -10.963 1.00 21.60 ? 79  GLU A N   1 
ATOM   650  C  CA  . GLU A 1 98  ? 14.122 43.266 -10.571 1.00 22.38 ? 79  GLU A CA  1 
ATOM   651  C  C   . GLU A 1 98  ? 13.077 43.557 -9.490  1.00 21.56 ? 79  GLU A C   1 
ATOM   652  O  O   . GLU A 1 98  ? 13.430 43.881 -8.364  1.00 23.06 ? 79  GLU A O   1 
ATOM   653  C  CB  . GLU A 1 98  ? 15.110 42.206 -10.074 1.00 22.08 ? 79  GLU A CB  1 
ATOM   654  C  CG  . GLU A 1 98  ? 14.456 40.889 -9.659  1.00 25.90 ? 79  GLU A CG  1 
ATOM   655  C  CD  . GLU A 1 98  ? 15.420 39.840 -9.147  1.00 40.53 ? 79  GLU A CD  1 
ATOM   656  O  OE1 . GLU A 1 98  ? 16.651 39.929 -9.379  1.00 38.30 ? 79  GLU A OE1 1 
ATOM   657  O  OE2 . GLU A 1 98  ? 14.917 38.887 -8.516  1.00 43.03 ? 79  GLU A OE2 1 
ATOM   658  N  N   . ILE A 1 99  ? 11.795 43.438 -9.842  1.00 18.70 ? 80  ILE A N   1 
ATOM   659  C  CA  . ILE A 1 99  ? 10.710 43.455 -8.859  1.00 18.55 ? 80  ILE A CA  1 
ATOM   660  C  C   . ILE A 1 99  ? 10.664 42.050 -8.269  1.00 17.57 ? 80  ILE A C   1 
ATOM   661  O  O   . ILE A 1 99  ? 10.579 41.068 -9.022  1.00 18.65 ? 80  ILE A O   1 
ATOM   662  C  CB  . ILE A 1 99  ? 9.331  43.745 -9.509  1.00 19.97 ? 80  ILE A CB  1 
ATOM   663  C  CG1 . ILE A 1 99  ? 9.321  45.122 -10.205 1.00 22.25 ? 80  ILE A CG1 1 
ATOM   664  C  CG2 . ILE A 1 99  ? 8.198  43.603 -8.511  1.00 21.76 ? 80  ILE A CG2 1 
ATOM   665  C  CD1 . ILE A 1 99  ? 8.127  45.337 -11.129 1.00 24.03 ? 80  ILE A CD1 1 
ATOM   666  N  N   . SER A 1 100 ? 10.673 41.952 -6.939  1.00 16.53 ? 81  SER A N   1 
ATOM   667  C  CA  . SER A 1 100 ? 10.545 40.655 -6.256  1.00 14.51 ? 81  SER A CA  1 
ATOM   668  C  C   . SER A 1 100 ? 9.404  40.681 -5.250  1.00 15.89 ? 81  SER A C   1 
ATOM   669  O  O   . SER A 1 100 ? 9.091  41.719 -4.649  1.00 15.99 ? 81  SER A O   1 
ATOM   670  C  CB  . SER A 1 100 ? 11.843 40.252 -5.548  1.00 16.17 ? 81  SER A CB  1 
ATOM   671  O  OG  . SER A 1 100 ? 12.173 41.163 -4.514  1.00 17.09 ? 81  SER A OG  1 
HETATM 672  N  N   A MSE A 1 101 ? 8.778  39.524 -5.085  0.50 15.41 ? 82  MSE A N   1 
HETATM 673  N  N   B MSE A 1 101 ? 8.743  39.535 -5.135  0.50 14.89 ? 82  MSE A N   1 
HETATM 674  C  CA  A MSE A 1 101 ? 7.773  39.306 -4.046  0.50 16.09 ? 82  MSE A CA  1 
HETATM 675  C  CA  B MSE A 1 101 ? 7.795  39.256 -4.056  0.50 15.33 ? 82  MSE A CA  1 
HETATM 676  C  C   A MSE A 1 101 ? 8.025  37.941 -3.450  0.50 16.64 ? 82  MSE A C   1 
HETATM 677  C  C   B MSE A 1 101 ? 8.177  37.926 -3.492  0.50 15.59 ? 82  MSE A C   1 
HETATM 678  O  O   A MSE A 1 101 ? 7.766  36.927 -4.097  0.50 16.40 ? 82  MSE A O   1 
HETATM 679  O  O   B MSE A 1 101 ? 8.187  36.927 -4.206  0.50 15.97 ? 82  MSE A O   1 
HETATM 680  C  CB  A MSE A 1 101 ? 6.355  39.468 -4.622  0.50 17.62 ? 82  MSE A CB  1 
HETATM 681  C  CB  B MSE A 1 101 ? 6.339  39.209 -4.523  0.50 16.24 ? 82  MSE A CB  1 
HETATM 682  C  CG  A MSE A 1 101 ? 5.955  40.949 -4.759  0.50 17.32 ? 82  MSE A CG  1 
HETATM 683  C  CG  B MSE A 1 101 ? 5.928  40.595 -5.008  0.50 16.51 ? 82  MSE A CG  1 
HETATM 684  SE SE  A MSE A 1 101 ? 4.339  41.210 -5.852  0.37 17.03 ? 82  MSE A SE  1 
HETATM 685  SE SE  B MSE A 1 101 ? 3.977  40.887 -4.944  0.38 17.11 ? 82  MSE A SE  1 
HETATM 686  C  CE  A MSE A 1 101 ? 3.162  40.301 -4.552  0.50 16.47 ? 82  MSE A CE  1 
HETATM 687  C  CE  B MSE A 1 101 ? 3.477  39.360 -6.084  0.50 21.46 ? 82  MSE A CE  1 
ATOM   688  N  N   . HIS A 1 102 ? 8.512  37.914 -2.203  1.00 16.24 ? 83  HIS A N   1 
ATOM   689  C  CA  . HIS A 1 102 ? 8.715  36.686 -1.427  1.00 16.97 ? 83  HIS A CA  1 
ATOM   690  C  C   . HIS A 1 102 ? 7.657  36.659 -0.348  1.00 17.59 ? 83  HIS A C   1 
ATOM   691  O  O   . HIS A 1 102 ? 7.689  37.462 0.602   1.00 17.70 ? 83  HIS A O   1 
ATOM   692  C  CB  . HIS A 1 102 ? 10.109 36.712 -0.784  1.00 16.15 ? 83  HIS A CB  1 
ATOM   693  C  CG  . HIS A 1 102 ? 11.214 36.654 -1.771  1.00 18.94 ? 83  HIS A CG  1 
ATOM   694  N  ND1 . HIS A 1 102 ? 11.676 37.770 -2.427  1.00 19.04 ? 83  HIS A ND1 1 
ATOM   695  C  CD2 . HIS A 1 102 ? 11.975 35.614 -2.200  1.00 21.26 ? 83  HIS A CD2 1 
ATOM   696  C  CE1 . HIS A 1 102 ? 12.635 37.414 -3.264  1.00 21.38 ? 83  HIS A CE1 1 
ATOM   697  N  NE2 . HIS A 1 102 ? 12.863 36.115 -3.121  1.00 21.97 ? 83  HIS A NE2 1 
HETATM 698  N  N   . MSE A 1 103 ? 6.687  35.768 -0.524  1.00 16.25 ? 84  MSE A N   1 
HETATM 699  C  CA  . MSE A 1 103 ? 5.461  35.730 0.276   1.00 15.62 ? 84  MSE A CA  1 
HETATM 700  C  C   . MSE A 1 103 ? 5.495  34.492 1.155   1.00 15.72 ? 84  MSE A C   1 
HETATM 701  O  O   . MSE A 1 103 ? 5.421  33.357 0.665   1.00 15.34 ? 84  MSE A O   1 
HETATM 702  C  CB  . MSE A 1 103 ? 4.263  35.744 -0.671  1.00 16.44 ? 84  MSE A CB  1 
HETATM 703  C  CG  . MSE A 1 103 ? 4.212  37.102 -1.393  1.00 18.88 ? 84  MSE A CG  1 
HETATM 704  SE SE  . MSE A 1 103 ? 2.942  37.047 -2.902  0.75 15.60 ? 84  MSE A SE  1 
HETATM 705  C  CE  . MSE A 1 103 ? 4.072  35.986 -4.080  1.00 19.77 ? 84  MSE A CE  1 
ATOM   706  N  N   . GLY A 1 104 ? 5.646  34.710 2.465   1.00 14.41 ? 85  GLY A N   1 
ATOM   707  C  CA  . GLY A 1 104 ? 5.664  33.635 3.434   1.00 14.14 ? 85  GLY A CA  1 
ATOM   708  C  C   . GLY A 1 104 ? 4.258  33.279 3.892   1.00 15.42 ? 85  GLY A C   1 
ATOM   709  O  O   . GLY A 1 104 ? 3.372  34.166 4.099   1.00 18.72 ? 85  GLY A O   1 
ATOM   710  N  N   . HIS A 1 105 ? 4.065  31.977 4.074   1.00 15.30 ? 86  HIS A N   1 
ATOM   711  C  CA  . HIS A 1 105 ? 2.817  31.404 4.564   1.00 13.70 ? 86  HIS A CA  1 
ATOM   712  C  C   . HIS A 1 105 ? 3.060  30.372 5.659   1.00 16.21 ? 86  HIS A C   1 
ATOM   713  O  O   . HIS A 1 105 ? 4.149  29.748 5.739   1.00 14.03 ? 86  HIS A O   1 
ATOM   714  C  CB  . HIS A 1 105 ? 2.041  30.667 3.470   1.00 14.46 ? 86  HIS A CB  1 
ATOM   715  C  CG  . HIS A 1 105 ? 1.884  31.422 2.207   1.00 13.77 ? 86  HIS A CG  1 
ATOM   716  N  ND1 . HIS A 1 105 ? 2.915  31.589 1.308   1.00 15.06 ? 86  HIS A ND1 1 
ATOM   717  C  CD2 . HIS A 1 105 ? 0.816  32.068 1.685   1.00 15.42 ? 86  HIS A CD2 1 
ATOM   718  C  CE1 . HIS A 1 105 ? 2.483  32.289 0.278   1.00 17.15 ? 86  HIS A CE1 1 
ATOM   719  N  NE2 . HIS A 1 105 ? 1.224  32.596 0.493   1.00 16.69 ? 86  HIS A NE2 1 
ATOM   720  N  N   . THR A 1 106 ? 2.013  30.181 6.460   1.00 14.39 ? 87  THR A N   1 
ATOM   721  C  CA  . THR A 1 106 ? 1.846  29.028 7.328   1.00 16.04 ? 87  THR A CA  1 
ATOM   722  C  C   . THR A 1 106 ? 3.129  28.605 8.065   1.00 15.01 ? 87  THR A C   1 
ATOM   723  O  O   . THR A 1 106 ? 3.644  27.515 7.865   1.00 14.76 ? 87  THR A O   1 
ATOM   724  C  CB  . THR A 1 106 ? 1.143  27.850 6.580   1.00 17.42 ? 87  THR A CB  1 
ATOM   725  O  OG1 . THR A 1 106 ? 1.831  27.527 5.353   1.00 16.62 ? 87  THR A OG1 1 
ATOM   726  C  CG2 . THR A 1 106 ? -0.273 28.229 6.245   1.00 17.88 ? 87  THR A CG2 1 
ATOM   727  N  N   . PRO A 1 107 ? 3.637  29.486 8.947   1.00 14.77 ? 88  PRO A N   1 
ATOM   728  C  CA  . PRO A 1 107 ? 4.831  29.162 9.720   1.00 15.06 ? 88  PRO A CA  1 
ATOM   729  C  C   . PRO A 1 107 ? 4.605  28.052 10.755  1.00 16.03 ? 88  PRO A C   1 
ATOM   730  O  O   . PRO A 1 107 ? 3.487  27.908 11.318  1.00 14.97 ? 88  PRO A O   1 
ATOM   731  C  CB  . PRO A 1 107 ? 5.147  30.485 10.433  1.00 14.88 ? 88  PRO A CB  1 
ATOM   732  C  CG  . PRO A 1 107 ? 3.823  31.169 10.540  1.00 15.88 ? 88  PRO A CG  1 
ATOM   733  C  CD  . PRO A 1 107 ? 3.133  30.834 9.260   1.00 15.52 ? 88  PRO A CD  1 
ATOM   734  N  N   . GLU A 1 108 ? 5.642  27.268 10.990  1.00 14.68 ? 89  GLU A N   1 
ATOM   735  C  CA  . GLU A 1 108 ? 5.719  26.326 12.100  1.00 13.59 ? 89  GLU A CA  1 
ATOM   736  C  C   . GLU A 1 108 ? 6.991  26.681 12.889  1.00 14.69 ? 89  GLU A C   1 
ATOM   737  O  O   . GLU A 1 108 ? 8.098  26.235 12.533  1.00 16.41 ? 89  GLU A O   1 
ATOM   738  C  CB  . GLU A 1 108 ? 5.786  24.903 11.601  1.00 15.31 ? 89  GLU A CB  1 
ATOM   739  C  CG  . GLU A 1 108 ? 4.599  24.489 10.735  1.00 16.27 ? 89  GLU A CG  1 
ATOM   740  C  CD  . GLU A 1 108 ? 4.875  23.222 9.957   1.00 17.92 ? 89  GLU A CD  1 
ATOM   741  O  OE1 . GLU A 1 108 ? 4.906  22.134 10.569  1.00 18.54 ? 89  GLU A OE1 1 
ATOM   742  O  OE2 . GLU A 1 108 ? 5.072  23.338 8.716   1.00 18.08 ? 89  GLU A OE2 1 
ATOM   743  N  N   . ILE A 1 109 ? 6.820  27.483 13.934  1.00 15.25 ? 90  ILE A N   1 
ATOM   744  C  CA  . ILE A 1 109 ? 7.911  27.940 14.785  1.00 15.36 ? 90  ILE A CA  1 
ATOM   745  C  C   . ILE A 1 109 ? 8.021  27.043 16.043  1.00 15.89 ? 90  ILE A C   1 
ATOM   746  O  O   . ILE A 1 109 ? 7.041  26.928 16.838  1.00 16.63 ? 90  ILE A O   1 
ATOM   747  C  CB  . ILE A 1 109 ? 7.750  29.413 15.219  1.00 14.83 ? 90  ILE A CB  1 
ATOM   748  C  CG1 . ILE A 1 109 ? 7.434  30.370 14.022  1.00 16.19 ? 90  ILE A CG1 1 
ATOM   749  C  CG2 . ILE A 1 109 ? 8.978  29.862 16.015  1.00 14.88 ? 90  ILE A CG2 1 
ATOM   750  C  CD1 . ILE A 1 109 ? 8.430  30.304 12.902  1.00 17.55 ? 90  ILE A CD1 1 
ATOM   751  N  N   . THR A 1 110 ? 9.207  26.464 16.240  1.00 15.28 ? 91  THR A N   1 
ATOM   752  C  CA  . THR A 1 110 ? 9.555  25.703 17.410  1.00 15.26 ? 91  THR A CA  1 
ATOM   753  C  C   . THR A 1 110 ? 10.648 26.430 18.173  1.00 16.79 ? 91  THR A C   1 
ATOM   754  O  O   . THR A 1 110 ? 11.756 26.668 17.641  1.00 15.05 ? 91  THR A O   1 
ATOM   755  C  CB  . THR A 1 110 ? 10.035 24.295 17.007  1.00 19.76 ? 91  THR A CB  1 
ATOM   756  O  OG1 . THR A 1 110 ? 9.052  23.673 16.145  1.00 21.11 ? 91  THR A OG1 1 
ATOM   757  C  CG2 . THR A 1 110 ? 10.218 23.438 18.232  1.00 19.13 ? 91  THR A CG2 1 
ATOM   758  N  N   . ILE A 1 111 ? 10.355 26.793 19.419  1.00 15.72 ? 92  ILE A N   1 
ATOM   759  C  CA  . ILE A 1 111 ? 11.388 27.330 20.305  1.00 16.72 ? 92  ILE A CA  1 
ATOM   760  C  C   . ILE A 1 111 ? 12.183 26.139 20.883  1.00 17.24 ? 92  ILE A C   1 
ATOM   761  O  O   . ILE A 1 111 ? 11.628 25.295 21.567  1.00 21.15 ? 92  ILE A O   1 
ATOM   762  C  CB  . ILE A 1 111 ? 10.791 28.201 21.410  1.00 16.85 ? 92  ILE A CB  1 
ATOM   763  C  CG1 . ILE A 1 111 ? 9.787  29.231 20.848  1.00 15.86 ? 92  ILE A CG1 1 
ATOM   764  C  CG2 . ILE A 1 111 ? 11.902 28.891 22.216  1.00 18.66 ? 92  ILE A CG2 1 
ATOM   765  C  CD1 . ILE A 1 111 ? 10.305 30.213 19.797  1.00 15.15 ? 92  ILE A CD1 1 
ATOM   766  N  N   . ASP A 1 112 ? 13.475 26.088 20.578  1.00 15.49 ? 93  ASP A N   1 
ATOM   767  C  CA  . ASP A 1 112 ? 14.322 24.931 20.873  1.00 17.60 ? 93  ASP A CA  1 
ATOM   768  C  C   . ASP A 1 112 ? 15.049 25.055 22.198  1.00 17.46 ? 93  ASP A C   1 
ATOM   769  O  O   . ASP A 1 112 ? 15.391 24.047 22.794  1.00 20.16 ? 93  ASP A O   1 
ATOM   770  C  CB  . ASP A 1 112 ? 15.369 24.739 19.761  1.00 17.64 ? 93  ASP A CB  1 
ATOM   771  C  CG  . ASP A 1 112 ? 14.755 24.429 18.440  1.00 21.77 ? 93  ASP A CG  1 
ATOM   772  O  OD1 . ASP A 1 112 ? 13.747 23.670 18.394  1.00 21.15 ? 93  ASP A OD1 1 
ATOM   773  O  OD2 . ASP A 1 112 ? 15.253 24.976 17.433  1.00 22.23 ? 93  ASP A OD2 1 
ATOM   774  N  N   . SER A 1 113 ? 15.267 26.277 22.651  1.00 17.69 ? 94  SER A N   1 
ATOM   775  C  CA  . SER A 1 113 ? 15.925 26.533 23.940  1.00 18.39 ? 94  SER A CA  1 
ATOM   776  C  C   . SER A 1 113 ? 15.568 27.957 24.361  1.00 19.04 ? 94  SER A C   1 
ATOM   777  O  O   . SER A 1 113 ? 14.686 28.580 23.762  1.00 20.15 ? 94  SER A O   1 
ATOM   778  C  CB  . SER A 1 113 ? 17.450 26.277 23.855  1.00 17.86 ? 94  SER A CB  1 
ATOM   779  O  OG  . SER A 1 113 ? 18.155 27.333 23.237  1.00 17.11 ? 94  SER A OG  1 
ATOM   780  N  N   . GLU A 1 114 ? 16.255 28.483 25.368  1.00 18.67 ? 95  GLU A N   1 
ATOM   781  C  CA  . GLU A 1 114 ? 16.043 29.867 25.786  1.00 18.30 ? 95  GLU A CA  1 
ATOM   782  C  C   . GLU A 1 114 ? 16.490 30.882 24.744  1.00 18.80 ? 95  GLU A C   1 
ATOM   783  O  O   . GLU A 1 114 ? 16.063 32.027 24.785  1.00 19.45 ? 95  GLU A O   1 
ATOM   784  C  CB  . GLU A 1 114 ? 16.706 30.135 27.145  1.00 18.37 ? 95  GLU A CB  1 
ATOM   785  C  CG  . GLU A 1 114 ? 18.213 30.398 27.166  1.00 16.86 ? 95  GLU A CG  1 
ATOM   786  C  CD  . GLU A 1 114 ? 19.102 29.132 27.062  1.00 18.15 ? 95  GLU A CD  1 
ATOM   787  O  OE1 . GLU A 1 114 ? 18.631 28.044 26.654  1.00 19.62 ? 95  GLU A OE1 1 
ATOM   788  O  OE2 . GLU A 1 114 ? 20.287 29.231 27.430  1.00 20.05 ? 95  GLU A OE2 1 
ATOM   789  N  N   . ASN A 1 115 ? 17.357 30.475 23.813  1.00 17.33 ? 96  ASN A N   1 
ATOM   790  C  CA  . ASN A 1 115 ? 17.952 31.411 22.843  1.00 16.93 ? 96  ASN A CA  1 
ATOM   791  C  C   . ASN A 1 115 ? 18.185 30.843 21.433  1.00 16.94 ? 96  ASN A C   1 
ATOM   792  O  O   . ASN A 1 115 ? 18.975 31.379 20.664  1.00 16.66 ? 96  ASN A O   1 
ATOM   793  C  CB  . ASN A 1 115 ? 19.256 32.014 23.414  1.00 19.83 ? 96  ASN A CB  1 
ATOM   794  C  CG  . ASN A 1 115 ? 20.267 30.964 23.798  1.00 23.55 ? 96  ASN A CG  1 
ATOM   795  O  OD1 . ASN A 1 115 ? 20.126 29.827 23.443  1.00 19.13 ? 96  ASN A OD1 1 
ATOM   796  N  ND2 . ASN A 1 115 ? 21.272 31.357 24.568  1.00 24.49 ? 96  ASN A ND2 1 
ATOM   797  N  N   . THR A 1 116 ? 17.471 29.776 21.103  1.00 14.70 ? 97  THR A N   1 
ATOM   798  C  CA  . THR A 1 116 ? 17.523 29.158 19.778  1.00 15.23 ? 97  THR A CA  1 
ATOM   799  C  C   . THR A 1 116 ? 16.137 28.715 19.373  1.00 15.71 ? 97  THR A C   1 
ATOM   800  O  O   . THR A 1 116 ? 15.292 28.384 20.210  1.00 15.90 ? 97  THR A O   1 
ATOM   801  C  CB  . THR A 1 116 ? 18.504 27.948 19.703  1.00 15.94 ? 97  THR A CB  1 
ATOM   802  O  OG1 . THR A 1 116 ? 18.032 26.897 20.548  1.00 16.15 ? 97  THR A OG1 1 
ATOM   803  C  CG2 . THR A 1 116 ? 19.888 28.342 20.051  1.00 17.51 ? 97  THR A CG2 1 
ATOM   804  N  N   . ALA A 1 117 ? 15.906 28.696 18.064  1.00 15.15 ? 98  ALA A N   1 
ATOM   805  C  CA  . ALA A 1 117 ? 14.615 28.271 17.539  1.00 14.69 ? 98  ALA A CA  1 
ATOM   806  C  C   . ALA A 1 117 ? 14.729 27.877 16.102  1.00 15.86 ? 98  ALA A C   1 
ATOM   807  O  O   . ALA A 1 117 ? 15.735 28.211 15.441  1.00 15.73 ? 98  ALA A O   1 
ATOM   808  C  CB  . ALA A 1 117 ? 13.606 29.413 17.703  1.00 16.37 ? 98  ALA A CB  1 
ATOM   809  N  N   . THR A 1 118 ? 13.673 27.211 15.627  1.00 15.17 ? 99  THR A N   1 
ATOM   810  C  CA  . THR A 1 118 ? 13.573 26.702 14.253  1.00 16.45 ? 99  THR A CA  1 
ATOM   811  C  C   . THR A 1 118 ? 12.254 27.208 13.701  1.00 16.72 ? 99  THR A C   1 
ATOM   812  O  O   . THR A 1 118 ? 11.261 27.223 14.425  1.00 18.17 ? 99  THR A O   1 
ATOM   813  C  CB  . THR A 1 118 ? 13.612 25.156 14.232  1.00 16.67 ? 99  THR A CB  1 
ATOM   814  O  OG1 . THR A 1 118 ? 14.858 24.693 14.792  1.00 16.99 ? 99  THR A OG1 1 
ATOM   815  C  CG2 . THR A 1 118 ? 13.473 24.588 12.812  1.00 20.38 ? 99  THR A CG2 1 
ATOM   816  N  N   . GLY A 1 119 ? 12.217 27.572 12.419  1.00 15.07 ? 100 GLY A N   1 
ATOM   817  C  CA  . GLY A 1 119 ? 10.988 28.001 11.800  1.00 14.60 ? 100 GLY A CA  1 
ATOM   818  C  C   . GLY A 1 119 ? 10.802 27.477 10.395  1.00 15.81 ? 100 GLY A C   1 
ATOM   819  O  O   . GLY A 1 119 ? 11.617 27.793 9.520   1.00 17.21 ? 100 GLY A O   1 
ATOM   820  N  N   . ARG A 1 120 ? 9.747  26.701 10.185  1.00 13.73 ? 101 ARG A N   1 
ATOM   821  C  CA  . ARG A 1 120 ? 9.342  26.311 8.844   1.00 14.79 ? 101 ARG A CA  1 
ATOM   822  C  C   . ARG A 1 120 ? 8.436  27.369 8.251   1.00 15.26 ? 101 ARG A C   1 
ATOM   823  O  O   . ARG A 1 120 ? 7.509  27.883 8.911   1.00 16.48 ? 101 ARG A O   1 
ATOM   824  C  CB  . ARG A 1 120 ? 8.647  24.980 8.820   1.00 16.33 ? 101 ARG A CB  1 
ATOM   825  C  CG  . ARG A 1 120 ? 9.458  23.830 9.397   1.00 17.63 ? 101 ARG A CG  1 
ATOM   826  C  CD  . ARG A 1 120 ? 8.627  22.566 9.190   1.00 20.54 ? 101 ARG A CD  1 
ATOM   827  N  NE  . ARG A 1 120 ? 9.326  21.338 9.498   1.00 22.88 ? 101 ARG A NE  1 
ATOM   828  C  CZ  . ARG A 1 120 ? 9.976  20.545 8.631   1.00 28.55 ? 101 ARG A CZ  1 
ATOM   829  N  NH1 . ARG A 1 120 ? 10.079 20.817 7.335   1.00 26.07 ? 101 ARG A NH1 1 
ATOM   830  N  NH2 . ARG A 1 120 ? 10.540 19.426 9.090   1.00 34.68 ? 101 ARG A NH2 1 
ATOM   831  N  N   . TRP A 1 121 ? 8.714  27.698 6.993   1.00 13.97 ? 102 TRP A N   1 
ATOM   832  C  CA  . TRP A 1 121 ? 7.932  28.674 6.260   1.00 14.56 ? 102 TRP A CA  1 
ATOM   833  C  C   . TRP A 1 121 ? 7.653  28.114 4.887   1.00 14.18 ? 102 TRP A C   1 
ATOM   834  O  O   . TRP A 1 121 ? 8.514  27.476 4.296   1.00 14.97 ? 102 TRP A O   1 
ATOM   835  C  CB  . TRP A 1 121 ? 8.669  30.004 6.104   1.00 15.11 ? 102 TRP A CB  1 
ATOM   836  C  CG  . TRP A 1 121 ? 8.815  30.758 7.407   1.00 13.48 ? 102 TRP A CG  1 
ATOM   837  C  CD1 . TRP A 1 121 ? 9.822  30.626 8.329   1.00 13.95 ? 102 TRP A CD1 1 
ATOM   838  C  CD2 . TRP A 1 121 ? 7.889  31.693 7.943   1.00 13.00 ? 102 TRP A CD2 1 
ATOM   839  N  NE1 . TRP A 1 121 ? 9.576  31.431 9.404   1.00 14.54 ? 102 TRP A NE1 1 
ATOM   840  C  CE2 . TRP A 1 121 ? 8.408  32.127 9.188   1.00 14.63 ? 102 TRP A CE2 1 
ATOM   841  C  CE3 . TRP A 1 121 ? 6.704  32.272 7.467   1.00 12.63 ? 102 TRP A CE3 1 
ATOM   842  C  CZ2 . TRP A 1 121 ? 7.738  33.089 9.976   1.00 13.69 ? 102 TRP A CZ2 1 
ATOM   843  C  CZ3 . TRP A 1 121 ? 6.068  33.238 8.227   1.00 14.46 ? 102 TRP A CZ3 1 
ATOM   844  C  CH2 . TRP A 1 121 ? 6.600  33.661 9.456   1.00 13.84 ? 102 TRP A CH2 1 
ATOM   845  N  N   . TYR A 1 122 ? 6.471  28.432 4.370   1.00 13.15 ? 103 TYR A N   1 
ATOM   846  C  CA  . TYR A 1 122 ? 6.023  27.984 3.028   1.00 14.85 ? 103 TYR A CA  1 
ATOM   847  C  C   . TYR A 1 122 ? 6.114  29.245 2.160   1.00 13.89 ? 103 TYR A C   1 
ATOM   848  O  O   . TYR A 1 122 ? 5.354  30.196 2.362   1.00 14.48 ? 103 TYR A O   1 
ATOM   849  C  CB  . TYR A 1 122 ? 4.565  27.467 3.110   1.00 17.76 ? 103 TYR A CB  1 
ATOM   850  C  CG  . TYR A 1 122 ? 4.048  26.758 1.856   1.00 17.11 ? 103 TYR A CG  1 
ATOM   851  C  CD1 . TYR A 1 122 ? 4.377  27.196 0.570   1.00 22.52 ? 103 TYR A CD1 1 
ATOM   852  C  CD2 . TYR A 1 122 ? 3.221  25.648 1.970   1.00 18.40 ? 103 TYR A CD2 1 
ATOM   853  C  CE1 . TYR A 1 122 ? 3.895  26.533 -0.565  1.00 21.65 ? 103 TYR A CE1 1 
ATOM   854  C  CE2 . TYR A 1 122 ? 2.740  24.973 0.852   1.00 19.57 ? 103 TYR A CE2 1 
ATOM   855  C  CZ  . TYR A 1 122 ? 3.071  25.432 -0.410  1.00 20.85 ? 103 TYR A CZ  1 
ATOM   856  O  OH  . TYR A 1 122 ? 2.622  24.742 -1.523  1.00 20.76 ? 103 TYR A OH  1 
ATOM   857  N  N   . LEU A 1 123 ? 7.076  29.280 1.245   1.00 14.02 ? 104 LEU A N   1 
ATOM   858  C  CA  . LEU A 1 123 ? 7.375  30.461 0.421   1.00 13.90 ? 104 LEU A CA  1 
ATOM   859  C  C   . LEU A 1 123 ? 6.771  30.340 -0.959  1.00 15.62 ? 104 LEU A C   1 
ATOM   860  O  O   . LEU A 1 123 ? 6.907  29.311 -1.588  1.00 16.18 ? 104 LEU A O   1 
ATOM   861  C  CB  . LEU A 1 123 ? 8.887  30.607 0.241   1.00 18.35 ? 104 LEU A CB  1 
ATOM   862  C  CG  . LEU A 1 123 ? 9.563  31.602 1.136   1.00 23.47 ? 104 LEU A CG  1 
ATOM   863  C  CD1 . LEU A 1 123 ? 9.169  33.043 0.742   1.00 25.01 ? 104 LEU A CD1 1 
ATOM   864  C  CD2 . LEU A 1 123 ? 9.236  31.246 2.585   1.00 27.76 ? 104 LEU A CD2 1 
ATOM   865  N  N   . GLU A 1 124 ? 6.136  31.401 -1.432  1.00 15.56 ? 105 GLU A N   1 
ATOM   866  C  CA  . GLU A 1 124 ? 5.927  31.641 -2.868  1.00 15.42 ? 105 GLU A CA  1 
ATOM   867  C  C   . GLU A 1 124 ? 6.774  32.854 -3.276  1.00 14.16 ? 105 GLU A C   1 
ATOM   868  O  O   . GLU A 1 124 ? 6.733  33.869 -2.609  1.00 16.39 ? 105 GLU A O   1 
ATOM   869  C  CB  . GLU A 1 124 ? 4.456  31.955 -3.190  1.00 16.86 ? 105 GLU A CB  1 
ATOM   870  C  CG  . GLU A 1 124 ? 4.286  32.058 -4.682  1.00 21.61 ? 105 GLU A CG  1 
ATOM   871  C  CD  . GLU A 1 124 ? 2.964  32.502 -5.196  1.00 27.68 ? 105 GLU A CD  1 
ATOM   872  O  OE1 . GLU A 1 124 ? 2.058  32.956 -4.418  1.00 21.18 ? 105 GLU A OE1 1 
ATOM   873  O  OE2 . GLU A 1 124 ? 2.858  32.450 -6.462  1.00 25.80 ? 105 GLU A OE2 1 
ATOM   874  N  N   . ASP A 1 125 ? 7.494  32.752 -4.403  1.00 15.97 ? 106 ASP A N   1 
ATOM   875  C  CA  . ASP A 1 125 ? 8.278  33.853 -4.923  1.00 17.59 ? 106 ASP A CA  1 
ATOM   876  C  C   . ASP A 1 125 ? 7.863  34.166 -6.355  1.00 17.76 ? 106 ASP A C   1 
ATOM   877  O  O   . ASP A 1 125 ? 7.564  33.264 -7.134  1.00 17.62 ? 106 ASP A O   1 
ATOM   878  C  CB  . ASP A 1 125 ? 9.775  33.583 -4.854  1.00 21.40 ? 106 ASP A CB  1 
ATOM   879  C  CG  . ASP A 1 125 ? 10.177 32.324 -5.552  1.00 28.31 ? 106 ASP A CG  1 
ATOM   880  O  OD1 . ASP A 1 125 ? 9.726  31.254 -5.123  1.00 29.09 ? 106 ASP A OD1 1 
ATOM   881  O  OD2 . ASP A 1 125 ? 10.978 32.391 -6.510  1.00 32.40 ? 106 ASP A OD2 1 
ATOM   882  N  N   . ASN A 1 126 ? 7.773  35.455 -6.659  1.00 17.28 ? 107 ASN A N   1 
ATOM   883  C  CA  . ASN A 1 126 ? 7.531  35.945 -8.006  1.00 18.21 ? 107 ASN A CA  1 
ATOM   884  C  C   . ASN A 1 126 ? 8.583  37.032 -8.272  1.00 17.76 ? 107 ASN A C   1 
ATOM   885  O  O   . ASN A 1 126 ? 8.825  37.904 -7.425  1.00 19.88 ? 107 ASN A O   1 
ATOM   886  C  CB  . ASN A 1 126 ? 6.160  36.598 -8.138  1.00 18.67 ? 107 ASN A CB  1 
ATOM   887  C  CG  . ASN A 1 126 ? 4.981  35.652 -7.906  1.00 23.52 ? 107 ASN A CG  1 
ATOM   888  O  OD1 . ASN A 1 126 ? 5.093  34.410 -7.843  1.00 27.67 ? 107 ASN A OD1 1 
ATOM   889  N  ND2 . ASN A 1 126 ? 3.826  36.247 -7.771  1.00 28.28 ? 107 ASN A ND2 1 
ATOM   890  N  N   . LEU A 1 127 ? 9.253  36.924 -9.413  1.00 17.63 ? 108 LEU A N   1 
ATOM   891  C  CA  . LEU A 1 127 ? 10.290 37.869 -9.820  1.00 18.77 ? 108 LEU A CA  1 
ATOM   892  C  C   . LEU A 1 127 ? 9.939  38.369 -11.211 1.00 17.10 ? 108 LEU A C   1 
ATOM   893  O  O   . LEU A 1 127 ? 9.531  37.580 -12.073 1.00 18.09 ? 108 LEU A O   1 
ATOM   894  C  CB  . LEU A 1 127 ? 11.676 37.224 -9.828  1.00 19.02 ? 108 LEU A CB  1 
ATOM   895  C  CG  . LEU A 1 127 ? 12.109 36.370 -8.631  1.00 22.18 ? 108 LEU A CG  1 
ATOM   896  C  CD1 . LEU A 1 127 ? 13.474 35.780 -8.973  1.00 23.75 ? 108 LEU A CD1 1 
ATOM   897  C  CD2 . LEU A 1 127 ? 12.133 37.151 -7.319  1.00 25.90 ? 108 LEU A CD2 1 
ATOM   898  N  N   . ILE A 1 128 ? 10.088 39.683 -11.415 1.00 16.98 ? 109 ILE A N   1 
ATOM   899  C  CA  . ILE A 1 128 ? 9.866  40.328 -12.719 1.00 18.21 ? 109 ILE A CA  1 
ATOM   900  C  C   . ILE A 1 128 ? 11.043 41.268 -13.030 1.00 19.60 ? 109 ILE A C   1 
ATOM   901  O  O   . ILE A 1 128 ? 11.374 42.146 -12.240 1.00 20.55 ? 109 ILE A O   1 
ATOM   902  C  CB  . ILE A 1 128 ? 8.550  41.146 -12.728 1.00 20.50 ? 109 ILE A CB  1 
ATOM   903  C  CG1 . ILE A 1 128 ? 7.340  40.219 -12.476 1.00 20.56 ? 109 ILE A CG1 1 
ATOM   904  C  CG2 . ILE A 1 128 ? 8.401  41.942 -14.032 1.00 22.73 ? 109 ILE A CG2 1 
ATOM   905  C  CD1 . ILE A 1 128 ? 6.048  40.933 -12.143 1.00 27.91 ? 109 ILE A CD1 1 
ATOM   906  N  N   . PHE A 1 129 ? 11.670 41.058 -14.178 1.00 19.69 ? 110 PHE A N   1 
ATOM   907  C  CA  . PHE A 1 129 ? 12.729 41.945 -14.657 1.00 20.71 ? 110 PHE A CA  1 
ATOM   908  C  C   . PHE A 1 129 ? 12.110 42.953 -15.632 1.00 22.08 ? 110 PHE A C   1 
ATOM   909  O  O   . PHE A 1 129 ? 11.502 42.565 -16.638 1.00 21.11 ? 110 PHE A O   1 
ATOM   910  C  CB  . PHE A 1 129 ? 13.846 41.122 -15.306 1.00 23.52 ? 110 PHE A CB  1 
ATOM   911  C  CG  . PHE A 1 129 ? 14.632 40.303 -14.323 1.00 26.51 ? 110 PHE A CG  1 
ATOM   912  C  CD1 . PHE A 1 129 ? 14.219 39.016 -13.976 1.00 28.85 ? 110 PHE A CD1 1 
ATOM   913  C  CD2 . PHE A 1 129 ? 15.774 40.836 -13.714 1.00 29.77 ? 110 PHE A CD2 1 
ATOM   914  C  CE1 . PHE A 1 129 ? 14.933 38.268 -13.050 1.00 32.10 ? 110 PHE A CE1 1 
ATOM   915  C  CE2 . PHE A 1 129 ? 16.493 40.092 -12.796 1.00 34.00 ? 110 PHE A CE2 1 
ATOM   916  C  CZ  . PHE A 1 129 ? 16.077 38.809 -12.468 1.00 32.16 ? 110 PHE A CZ  1 
ATOM   917  N  N   . THR A 1 130 ? 12.295 44.247 -15.357 1.00 23.33 ? 111 THR A N   1 
ATOM   918  C  CA  . THR A 1 130 ? 11.615 45.299 -16.130 1.00 24.52 ? 111 THR A CA  1 
ATOM   919  C  C   . THR A 1 130 ? 12.495 45.939 -17.170 1.00 27.31 ? 111 THR A C   1 
ATOM   920  O  O   . THR A 1 130 ? 11.980 46.581 -18.089 1.00 31.31 ? 111 THR A O   1 
ATOM   921  C  CB  . THR A 1 130 ? 11.097 46.426 -15.210 1.00 24.39 ? 111 THR A CB  1 
ATOM   922  O  OG1 . THR A 1 130 ? 12.181 46.981 -14.473 1.00 25.26 ? 111 THR A OG1 1 
ATOM   923  C  CG2 . THR A 1 130 ? 10.069 45.877 -14.230 1.00 24.48 ? 111 THR A CG2 1 
ATOM   924  N  N   . ASP A 1 131 ? 13.807 45.831 -16.999 1.00 27.30 ? 112 ASP A N   1 
ATOM   925  C  CA  . ASP A 1 131 ? 14.777 46.543 -17.859 1.00 31.14 ? 112 ASP A CA  1 
ATOM   926  C  C   . ASP A 1 131 ? 16.049 45.743 -17.820 1.00 30.55 ? 112 ASP A C   1 
ATOM   927  O  O   . ASP A 1 131 ? 16.150 44.793 -17.051 1.00 31.72 ? 112 ASP A O   1 
ATOM   928  C  CB  . ASP A 1 131 ? 15.048 47.982 -17.366 1.00 33.92 ? 112 ASP A CB  1 
ATOM   929  C  CG  . ASP A 1 131 ? 13.779 48.847 -17.313 1.00 44.48 ? 112 ASP A CG  1 
ATOM   930  O  OD1 . ASP A 1 131 ? 13.407 49.430 -18.359 1.00 41.42 ? 112 ASP A OD1 1 
ATOM   931  O  OD2 . ASP A 1 131 ? 13.119 48.913 -16.238 1.00 38.40 ? 112 ASP A OD2 1 
ATOM   932  N  N   . GLY A 1 132 ? 17.016 46.108 -18.659 1.00 36.48 ? 113 GLY A N   1 
ATOM   933  C  CA  . GLY A 1 132 ? 18.295 45.405 -18.709 1.00 34.19 ? 113 GLY A CA  1 
ATOM   934  C  C   . GLY A 1 132 ? 18.285 44.145 -19.566 1.00 37.11 ? 113 GLY A C   1 
ATOM   935  O  O   . GLY A 1 132 ? 17.377 43.937 -20.383 1.00 32.53 ? 113 GLY A O   1 
ATOM   936  N  N   . LYS A 1 133 ? 19.307 43.309 -19.353 1.00 37.29 ? 114 LYS A N   1 
ATOM   937  C  CA  . LYS A 1 133 ? 19.575 42.104 -20.153 1.00 43.74 ? 114 LYS A CA  1 
ATOM   938  C  C   . LYS A 1 133 ? 18.490 41.058 -20.007 1.00 44.01 ? 114 LYS A C   1 
ATOM   939  O  O   . LYS A 1 133 ? 18.219 40.303 -20.938 1.00 38.71 ? 114 LYS A O   1 
ATOM   940  C  CB  . LYS A 1 133 ? 20.899 41.461 -19.723 1.00 46.35 ? 114 LYS A CB  1 
ATOM   941  N  N   . TYR A 1 134 ? 17.865 41.014 -18.830 1.00 36.59 ? 115 TYR A N   1 
ATOM   942  C  CA  . TYR A 1 134 ? 16.799 40.067 -18.581 1.00 34.96 ? 115 TYR A CA  1 
ATOM   943  C  C   . TYR A 1 134 ? 15.420 40.714 -18.672 1.00 30.69 ? 115 TYR A C   1 
ATOM   944  O  O   . TYR A 1 134 ? 14.463 40.143 -18.152 1.00 24.42 ? 115 TYR A O   1 
ATOM   945  C  CB  . TYR A 1 134 ? 16.994 39.422 -17.197 1.00 34.42 ? 115 TYR A CB  1 
ATOM   946  C  CG  . TYR A 1 134 ? 18.330 38.736 -17.015 1.00 47.30 ? 115 TYR A CG  1 
ATOM   947  C  CD1 . TYR A 1 134 ? 18.696 37.655 -17.823 1.00 51.21 ? 115 TYR A CD1 1 
ATOM   948  C  CD2 . TYR A 1 134 ? 19.225 39.155 -16.025 1.00 54.36 ? 115 TYR A CD2 1 
ATOM   949  C  CE1 . TYR A 1 134 ? 19.917 37.017 -17.655 1.00 58.96 ? 115 TYR A CE1 1 
ATOM   950  C  CE2 . TYR A 1 134 ? 20.446 38.518 -15.847 1.00 64.48 ? 115 TYR A CE2 1 
ATOM   951  C  CZ  . TYR A 1 134 ? 20.785 37.451 -16.664 1.00 65.47 ? 115 TYR A CZ  1 
ATOM   952  O  OH  . TYR A 1 134 ? 21.989 36.821 -16.490 1.00 75.64 ? 115 TYR A OH  1 
ATOM   953  N  N   . LYS A 1 135 ? 15.296 41.861 -19.355 1.00 28.96 ? 116 LYS A N   1 
ATOM   954  C  CA  . LYS A 1 135 ? 14.001 42.527 -19.533 1.00 27.43 ? 116 LYS A CA  1 
ATOM   955  C  C   . LYS A 1 135 ? 12.931 41.546 -19.983 1.00 26.11 ? 116 LYS A C   1 
ATOM   956  O  O   . LYS A 1 135 ? 13.174 40.791 -20.927 1.00 25.17 ? 116 LYS A O   1 
ATOM   957  C  CB  . LYS A 1 135 ? 14.072 43.666 -20.575 1.00 30.57 ? 116 LYS A CB  1 
ATOM   958  C  CG  . LYS A 1 135 ? 12.792 44.469 -20.696 1.00 36.16 ? 116 LYS A CG  1 
ATOM   959  C  CD  . LYS A 1 135 ? 13.015 45.733 -21.539 1.00 42.05 ? 116 LYS A CD  1 
ATOM   960  C  CE  . LYS A 1 135 ? 11.765 46.597 -21.600 1.00 48.28 ? 116 LYS A CE  1 
ATOM   961  N  NZ  . LYS A 1 135 ? 11.923 47.825 -22.448 1.00 55.60 ? 116 LYS A NZ  1 
ATOM   962  N  N   . ASN A 1 136 ? 11.780 41.574 -19.295 1.00 24.19 ? 117 ASN A N   1 
ATOM   963  C  CA  . ASN A 1 136 ? 10.599 40.745 -19.557 1.00 22.98 ? 117 ASN A CA  1 
ATOM   964  C  C   . ASN A 1 136 ? 10.678 39.283 -19.081 1.00 22.05 ? 117 ASN A C   1 
ATOM   965  O  O   . ASN A 1 136 ? 9.710  38.533 -19.217 1.00 22.68 ? 117 ASN A O   1 
ATOM   966  C  CB  . ASN A 1 136 ? 10.137 40.818 -21.020 1.00 25.84 ? 117 ASN A CB  1 
ATOM   967  C  CG  . ASN A 1 136 ? 9.702  42.212 -21.422 1.00 34.74 ? 117 ASN A CG  1 
ATOM   968  O  OD1 . ASN A 1 136 ? 8.985  42.889 -20.681 1.00 37.84 ? 117 ASN A OD1 1 
ATOM   969  N  ND2 . ASN A 1 136 ? 10.137 42.648 -22.610 1.00 38.79 ? 117 ASN A ND2 1 
ATOM   970  N  N   . VAL A 1 137 ? 11.784 38.903 -18.452 1.00 22.36 ? 118 VAL A N   1 
ATOM   971  C  CA  . VAL A 1 137 ? 11.853 37.594 -17.803 1.00 20.75 ? 118 VAL A CA  1 
ATOM   972  C  C   . VAL A 1 137 ? 10.972 37.633 -16.577 1.00 18.88 ? 118 VAL A C   1 
ATOM   973  O  O   . VAL A 1 137 ? 11.023 38.595 -15.795 1.00 20.97 ? 118 VAL A O   1 
ATOM   974  C  CB  . VAL A 1 137 ? 13.305 37.182 -17.416 1.00 22.46 ? 118 VAL A CB  1 
ATOM   975  C  CG1 . VAL A 1 137 ? 13.307 35.984 -16.476 1.00 23.89 ? 118 VAL A CG1 1 
ATOM   976  C  CG2 . VAL A 1 137 ? 14.121 36.894 -18.666 1.00 24.09 ? 118 VAL A CG2 1 
ATOM   977  N  N   . GLY A 1 138 ? 10.148 36.592 -16.413 1.00 18.36 ? 119 GLY A N   1 
ATOM   978  C  CA  . GLY A 1 138 ? 9.455  36.341 -15.143 1.00 17.82 ? 119 GLY A CA  1 
ATOM   979  C  C   . GLY A 1 138 ? 9.906  35.003 -14.585 1.00 17.27 ? 119 GLY A C   1 
ATOM   980  O  O   . GLY A 1 138 ? 10.214 34.082 -15.345 1.00 17.36 ? 119 GLY A O   1 
ATOM   981  N  N   . ILE A 1 139 ? 9.999  34.916 -13.267 1.00 17.72 ? 120 ILE A N   1 
ATOM   982  C  CA  . ILE A 1 139 ? 10.329 33.679 -12.559 1.00 17.89 ? 120 ILE A CA  1 
ATOM   983  C  C   . ILE A 1 139 ? 9.320  33.534 -11.429 1.00 16.73 ? 120 ILE A C   1 
ATOM   984  O  O   . ILE A 1 139 ? 9.158  34.463 -10.628 1.00 18.71 ? 120 ILE A O   1 
ATOM   985  C  CB  . ILE A 1 139 ? 11.757 33.696 -11.990 1.00 19.82 ? 120 ILE A CB  1 
ATOM   986  C  CG1 . ILE A 1 139 ? 12.800 33.890 -13.100 1.00 21.78 ? 120 ILE A CG1 1 
ATOM   987  C  CG2 . ILE A 1 139 ? 12.043 32.410 -11.207 1.00 20.54 ? 120 ILE A CG2 1 
ATOM   988  C  CD1 . ILE A 1 139 ? 14.177 34.228 -12.575 1.00 22.98 ? 120 ILE A CD1 1 
ATOM   989  N  N   . ASN A 1 140 ? 8.666  32.375 -11.349 1.00 16.60 ? 121 ASN A N   1 
ATOM   990  C  CA  . ASN A 1 140 ? 7.748  32.034 -10.240 1.00 16.00 ? 121 ASN A CA  1 
ATOM   991  C  C   . ASN A 1 140 ? 8.212  30.716 -9.606  1.00 15.15 ? 121 ASN A C   1 
ATOM   992  O  O   . ASN A 1 140 ? 8.693  29.834 -10.304 1.00 17.41 ? 121 ASN A O   1 
ATOM   993  C  CB  . ASN A 1 140 ? 6.315  31.770 -10.740 1.00 16.20 ? 121 ASN A CB  1 
ATOM   994  C  CG  . ASN A 1 140 ? 5.666  32.976 -11.384 1.00 19.35 ? 121 ASN A CG  1 
ATOM   995  O  OD1 . ASN A 1 140 ? 5.897  34.101 -10.977 1.00 21.69 ? 121 ASN A OD1 1 
ATOM   996  N  ND2 . ASN A 1 140 ? 4.835  32.731 -12.389 1.00 22.35 ? 121 ASN A ND2 1 
ATOM   997  N  N   . GLY A 1 141 ? 8.006  30.578 -8.317  1.00 14.34 ? 122 GLY A N   1 
ATOM   998  C  CA  . GLY A 1 141 ? 8.331  29.352 -7.636  1.00 16.01 ? 122 GLY A CA  1 
ATOM   999  C  C   . GLY A 1 141 ? 7.683  29.205 -6.274  1.00 17.03 ? 122 GLY A C   1 
ATOM   1000 O  O   . GLY A 1 141 ? 6.969  30.087 -5.783  1.00 15.79 ? 122 GLY A O   1 
ATOM   1001 N  N   . GLY A 1 142 ? 7.992  28.079 -5.655  1.00 15.14 ? 123 GLY A N   1 
ATOM   1002 C  CA  . GLY A 1 142 ? 7.600  27.788 -4.294  1.00 14.45 ? 123 GLY A CA  1 
ATOM   1003 C  C   . GLY A 1 142 ? 8.701  27.028 -3.614  1.00 15.31 ? 123 GLY A C   1 
ATOM   1004 O  O   . GLY A 1 142 ? 9.466  26.318 -4.268  1.00 17.24 ? 123 GLY A O   1 
ATOM   1005 N  N   . ALA A 1 143 ? 8.765  27.133 -2.294  1.00 15.65 ? 124 ALA A N   1 
ATOM   1006 C  CA  . ALA A 1 143 ? 9.779  26.440 -1.524  1.00 15.84 ? 124 ALA A CA  1 
ATOM   1007 C  C   . ALA A 1 143 ? 9.342  26.208 -0.090  1.00 16.14 ? 124 ALA A C   1 
ATOM   1008 O  O   . ALA A 1 143 ? 8.579  27.002 0.458   1.00 14.39 ? 124 ALA A O   1 
ATOM   1009 C  CB  . ALA A 1 143 ? 11.086 27.236 -1.552  1.00 16.85 ? 124 ALA A CB  1 
ATOM   1010 N  N   . PHE A 1 144 ? 9.845  25.116 0.505   1.00 14.37 ? 125 PHE A N   1 
ATOM   1011 C  CA  . PHE A 1 144 ? 9.712  24.875 1.940   1.00 13.81 ? 125 PHE A CA  1 
ATOM   1012 C  C   . PHE A 1 144 ? 11.055 25.251 2.561   1.00 15.62 ? 125 PHE A C   1 
ATOM   1013 O  O   . PHE A 1 144 ? 12.057 24.599 2.289   1.00 16.72 ? 125 PHE A O   1 
ATOM   1014 C  CB  . PHE A 1 144 ? 9.432  23.405 2.220   1.00 14.71 ? 125 PHE A CB  1 
ATOM   1015 C  CG  . PHE A 1 144 ? 8.150  22.895 1.616   1.00 14.65 ? 125 PHE A CG  1 
ATOM   1016 C  CD1 . PHE A 1 144 ? 6.948  23.468 1.967   1.00 18.36 ? 125 PHE A CD1 1 
ATOM   1017 C  CD2 . PHE A 1 144 ? 8.155  21.793 0.736   1.00 16.54 ? 125 PHE A CD2 1 
ATOM   1018 C  CE1 . PHE A 1 144 ? 5.747  22.982 1.440   1.00 18.96 ? 125 PHE A CE1 1 
ATOM   1019 C  CE2 . PHE A 1 144 ? 6.959  21.306 0.215   1.00 18.67 ? 125 PHE A CE2 1 
ATOM   1020 C  CZ  . PHE A 1 144 ? 5.776  21.920 0.570   1.00 17.80 ? 125 PHE A CZ  1 
ATOM   1021 N  N   . TYR A 1 145 ? 11.044 26.265 3.416   1.00 15.18 ? 126 TYR A N   1 
ATOM   1022 C  CA  . TYR A 1 145 ? 12.241 26.744 4.147   1.00 14.41 ? 126 TYR A CA  1 
ATOM   1023 C  C   . TYR A 1 145 ? 12.175 26.264 5.574   1.00 14.70 ? 126 TYR A C   1 
ATOM   1024 O  O   . TYR A 1 145 ? 11.085 26.189 6.180   1.00 14.69 ? 126 TYR A O   1 
ATOM   1025 C  CB  . TYR A 1 145 ? 12.277 28.277 4.139   1.00 15.46 ? 126 TYR A CB  1 
ATOM   1026 C  CG  . TYR A 1 145 ? 12.966 28.847 2.922   1.00 14.91 ? 126 TYR A CG  1 
ATOM   1027 C  CD1 . TYR A 1 145 ? 12.314 28.949 1.708   1.00 16.69 ? 126 TYR A CD1 1 
ATOM   1028 C  CD2 . TYR A 1 145 ? 14.313 29.228 2.973   1.00 16.00 ? 126 TYR A CD2 1 
ATOM   1029 C  CE1 . TYR A 1 145 ? 12.958 29.442 0.585   1.00 16.68 ? 126 TYR A CE1 1 
ATOM   1030 C  CE2 . TYR A 1 145 ? 14.960 29.733 1.847   1.00 14.72 ? 126 TYR A CE2 1 
ATOM   1031 C  CZ  . TYR A 1 145 ? 14.277 29.836 0.661   1.00 16.86 ? 126 TYR A CZ  1 
ATOM   1032 O  OH  . TYR A 1 145 ? 14.906 30.326 -0.463  1.00 18.32 ? 126 TYR A OH  1 
ATOM   1033 N  N   . THR A 1 146 ? 13.337 25.894 6.101   1.00 14.95 ? 127 THR A N   1 
ATOM   1034 C  CA  . THR A 1 146 ? 13.516 25.667 7.529   1.00 16.96 ? 127 THR A CA  1 
ATOM   1035 C  C   . THR A 1 146 ? 14.638 26.571 8.051   1.00 16.67 ? 127 THR A C   1 
ATOM   1036 O  O   . THR A 1 146 ? 15.821 26.307 7.830   1.00 16.15 ? 127 THR A O   1 
ATOM   1037 C  CB  . THR A 1 146 ? 13.773 24.176 7.832   1.00 20.15 ? 127 THR A CB  1 
ATOM   1038 O  OG1 . THR A 1 146 ? 12.683 23.407 7.294   1.00 19.00 ? 127 THR A OG1 1 
ATOM   1039 C  CG2 . THR A 1 146 ? 13.847 23.950 9.314   1.00 19.24 ? 127 THR A CG2 1 
ATOM   1040 N  N   . ASP A 1 147 ? 14.242 27.632 8.755   1.00 17.04 ? 128 ASP A N   1 
ATOM   1041 C  CA  . ASP A 1 147 ? 15.146 28.668 9.291   1.00 15.93 ? 128 ASP A CA  1 
ATOM   1042 C  C   . ASP A 1 147 ? 15.657 28.254 10.670  1.00 15.94 ? 128 ASP A C   1 
ATOM   1043 O  O   . ASP A 1 147 ? 14.944 27.542 11.406  1.00 15.29 ? 128 ASP A O   1 
ATOM   1044 C  CB  . ASP A 1 147 ? 14.410 29.980 9.556   1.00 15.09 ? 128 ASP A CB  1 
ATOM   1045 C  CG  . ASP A 1 147 ? 13.915 30.693 8.306   1.00 17.65 ? 128 ASP A CG  1 
ATOM   1046 O  OD1 . ASP A 1 147 ? 14.282 30.336 7.148   1.00 17.99 ? 128 ASP A OD1 1 
ATOM   1047 O  OD2 . ASP A 1 147 ? 13.176 31.681 8.481   1.00 18.89 ? 128 ASP A OD2 1 
ATOM   1048 N  N   . LYS A 1 148 ? 16.828 28.771 11.025  1.00 15.27 ? 129 LYS A N   1 
ATOM   1049 C  CA  . LYS A 1 148 ? 17.362 28.670 12.375  1.00 15.59 ? 129 LYS A CA  1 
ATOM   1050 C  C   . LYS A 1 148 ? 17.550 30.109 12.891  1.00 15.75 ? 129 LYS A C   1 
ATOM   1051 O  O   . LYS A 1 148 ? 18.121 30.973 12.184  1.00 15.32 ? 129 LYS A O   1 
ATOM   1052 C  CB  . LYS A 1 148 ? 18.695 27.924 12.411  1.00 17.77 ? 129 LYS A CB  1 
ATOM   1053 C  CG  . LYS A 1 148 ? 18.637 26.499 11.888  1.00 20.44 ? 129 LYS A CG  1 
ATOM   1054 C  CD  . LYS A 1 148 ? 17.803 25.602 12.799  1.00 21.99 ? 129 LYS A CD  1 
ATOM   1055 C  CE  . LYS A 1 148 ? 17.553 24.214 12.222  1.00 26.12 ? 129 LYS A CE  1 
ATOM   1056 N  NZ  . LYS A 1 148 ? 16.913 23.367 13.268  1.00 29.48 ? 129 LYS A NZ  1 
ATOM   1057 N  N   . TYR A 1 149 ? 17.126 30.334 14.134  1.00 14.24 ? 130 TYR A N   1 
ATOM   1058 C  CA  . TYR A 1 149 ? 17.162 31.652 14.761  1.00 15.34 ? 130 TYR A CA  1 
ATOM   1059 C  C   . TYR A 1 149 ? 17.939 31.580 16.051  1.00 16.49 ? 130 TYR A C   1 
ATOM   1060 O  O   . TYR A 1 149 ? 18.034 30.527 16.709  1.00 16.03 ? 130 TYR A O   1 
ATOM   1061 C  CB  . TYR A 1 149 ? 15.750 32.178 15.088  1.00 16.62 ? 130 TYR A CB  1 
ATOM   1062 C  CG  . TYR A 1 149 ? 14.749 32.083 13.956  1.00 15.64 ? 130 TYR A CG  1 
ATOM   1063 C  CD1 . TYR A 1 149 ? 14.702 33.056 12.942  1.00 15.92 ? 130 TYR A CD1 1 
ATOM   1064 C  CD2 . TYR A 1 149 ? 13.882 31.030 13.874  1.00 15.72 ? 130 TYR A CD2 1 
ATOM   1065 C  CE1 . TYR A 1 149 ? 13.790 32.936 11.874  1.00 15.61 ? 130 TYR A CE1 1 
ATOM   1066 C  CE2 . TYR A 1 149 ? 12.974 30.926 12.838  1.00 16.83 ? 130 TYR A CE2 1 
ATOM   1067 C  CZ  . TYR A 1 149 ? 12.924 31.896 11.841  1.00 15.21 ? 130 TYR A CZ  1 
ATOM   1068 O  OH  . TYR A 1 149 ? 12.004 31.778 10.787  1.00 16.34 ? 130 TYR A OH  1 
ATOM   1069 N  N   . GLU A 1 150 ? 18.454 32.723 16.446  1.00 16.40 ? 131 GLU A N   1 
ATOM   1070 C  CA  . GLU A 1 150 ? 19.071 32.834 17.758  1.00 18.71 ? 131 GLU A CA  1 
ATOM   1071 C  C   . GLU A 1 150 ? 18.722 34.139 18.412  1.00 17.72 ? 131 GLU A C   1 
ATOM   1072 O  O   . GLU A 1 150 ? 18.471 35.133 17.741  1.00 16.01 ? 131 GLU A O   1 
ATOM   1073 C  CB  . GLU A 1 150 ? 20.557 32.590 17.671  1.00 26.11 ? 131 GLU A CB  1 
ATOM   1074 C  CG  . GLU A 1 150 ? 21.377 33.698 17.094  1.00 28.48 ? 131 GLU A CG  1 
ATOM   1075 C  CD  . GLU A 1 150 ? 22.862 33.353 17.111  1.00 36.30 ? 131 GLU A CD  1 
ATOM   1076 O  OE1 . GLU A 1 150 ? 23.386 32.914 18.166  1.00 42.36 ? 131 GLU A OE1 1 
ATOM   1077 O  OE2 . GLU A 1 150 ? 23.502 33.539 16.070  1.00 28.55 ? 131 GLU A OE2 1 
ATOM   1078 N  N   . LYS A 1 151 ? 18.687 34.102 19.738  1.00 17.75 ? 132 LYS A N   1 
ATOM   1079 C  CA  . LYS A 1 151 ? 18.270 35.234 20.548  1.00 18.12 ? 132 LYS A CA  1 
ATOM   1080 C  C   . LYS A 1 151 ? 19.521 35.744 21.273  1.00 19.86 ? 132 LYS A C   1 
ATOM   1081 O  O   . LYS A 1 151 ? 20.188 34.993 21.979  1.00 18.45 ? 132 LYS A O   1 
ATOM   1082 C  CB  . LYS A 1 151 ? 17.206 34.823 21.562  1.00 17.46 ? 132 LYS A CB  1 
ATOM   1083 C  CG  . LYS A 1 151 ? 16.489 36.017 22.184  1.00 18.66 ? 132 LYS A CG  1 
ATOM   1084 C  CD  . LYS A 1 151 ? 15.416 35.564 23.176  1.00 20.45 ? 132 LYS A CD  1 
ATOM   1085 C  CE  . LYS A 1 151 ? 14.488 36.690 23.562  1.00 24.09 ? 132 LYS A CE  1 
ATOM   1086 N  NZ  . LYS A 1 151 ? 13.467 36.196 24.537  1.00 23.52 ? 132 LYS A NZ  1 
ATOM   1087 N  N   . ILE A 1 152 ? 19.827 37.019 21.052  1.00 20.56 ? 133 ILE A N   1 
ATOM   1088 C  CA  . ILE A 1 152 ? 21.024 37.660 21.607  1.00 23.95 ? 133 ILE A CA  1 
ATOM   1089 C  C   . ILE A 1 152 ? 20.574 38.958 22.249  1.00 25.82 ? 133 ILE A C   1 
ATOM   1090 O  O   . ILE A 1 152 ? 19.918 39.772 21.587  1.00 24.46 ? 133 ILE A O   1 
ATOM   1091 C  CB  . ILE A 1 152 ? 22.068 37.926 20.503  1.00 26.00 ? 133 ILE A CB  1 
ATOM   1092 C  CG1 . ILE A 1 152 ? 22.546 36.596 19.902  1.00 27.10 ? 133 ILE A CG1 1 
ATOM   1093 C  CG2 . ILE A 1 152 ? 23.238 38.738 21.077  1.00 30.94 ? 133 ILE A CG2 1 
ATOM   1094 C  CD1 . ILE A 1 152 ? 23.321 36.724 18.606  1.00 31.36 ? 133 ILE A CD1 1 
ATOM   1095 N  N   . ASP A 1 153 ? 20.883 39.123 23.548  1.00 29.69 ? 134 ASP A N   1 
ATOM   1096 C  CA  . ASP A 1 153 ? 20.498 40.310 24.323  1.00 30.27 ? 134 ASP A CA  1 
ATOM   1097 C  C   . ASP A 1 153 ? 19.044 40.728 24.130  1.00 30.52 ? 134 ASP A C   1 
ATOM   1098 O  O   . ASP A 1 153 ? 18.757 41.896 23.867  1.00 37.23 ? 134 ASP A O   1 
ATOM   1099 C  CB  . ASP A 1 153 ? 21.459 41.479 24.016  1.00 42.47 ? 134 ASP A CB  1 
ATOM   1100 C  CG  . ASP A 1 153 ? 22.928 41.134 24.289  1.00 50.12 ? 134 ASP A CG  1 
ATOM   1101 O  OD1 . ASP A 1 153 ? 23.219 40.273 25.151  1.00 53.49 ? 134 ASP A OD1 1 
ATOM   1102 O  OD2 . ASP A 1 153 ? 23.804 41.729 23.631  1.00 48.13 ? 134 ASP A OD2 1 
ATOM   1103 N  N   . GLY A 1 154 ? 18.131 39.754 24.195  1.00 31.59 ? 135 GLY A N   1 
ATOM   1104 C  CA  . GLY A 1 154 ? 16.683 39.997 24.146  1.00 27.44 ? 135 GLY A CA  1 
ATOM   1105 C  C   . GLY A 1 154 ? 16.028 40.074 22.777  1.00 27.06 ? 135 GLY A C   1 
ATOM   1106 O  O   . GLY A 1 154 ? 14.812 40.239 22.668  1.00 29.20 ? 135 GLY A O   1 
ATOM   1107 N  N   . GLN A 1 155 ? 16.834 39.959 21.720  1.00 24.08 ? 136 GLN A N   1 
ATOM   1108 C  CA  . GLN A 1 155 ? 16.376 40.167 20.360  1.00 22.42 ? 136 GLN A CA  1 
ATOM   1109 C  C   . GLN A 1 155 ? 16.646 38.911 19.537  1.00 17.28 ? 136 GLN A C   1 
ATOM   1110 O  O   . GLN A 1 155 ? 17.735 38.323 19.635  1.00 18.91 ? 136 GLN A O   1 
ATOM   1111 C  CB  . GLN A 1 155 ? 17.148 41.347 19.744  1.00 24.82 ? 136 GLN A CB  1 
ATOM   1112 C  CG  . GLN A 1 155 ? 16.897 41.623 18.265  1.00 30.37 ? 136 GLN A CG  1 
ATOM   1113 C  CD  . GLN A 1 155 ? 15.497 42.092 17.975  1.00 45.27 ? 136 GLN A CD  1 
ATOM   1114 O  OE1 . GLN A 1 155 ? 14.925 42.890 18.728  1.00 49.22 ? 136 GLN A OE1 1 
ATOM   1115 N  NE2 . GLN A 1 155 ? 14.927 41.605 16.868  1.00 46.42 ? 136 GLN A NE2 1 
ATOM   1116 N  N   . TRP A 1 156 ? 15.670 38.533 18.719  1.00 16.94 ? 137 TRP A N   1 
ATOM   1117 C  CA  . TRP A 1 156 ? 15.806 37.407 17.797  1.00 17.31 ? 137 TRP A CA  1 
ATOM   1118 C  C   . TRP A 1 156 ? 16.426 37.834 16.468  1.00 17.25 ? 137 TRP A C   1 
ATOM   1119 O  O   . TRP A 1 156 ? 16.128 38.915 15.958  1.00 17.21 ? 137 TRP A O   1 
ATOM   1120 C  CB  . TRP A 1 156 ? 14.440 36.739 17.545  1.00 17.47 ? 137 TRP A CB  1 
ATOM   1121 C  CG  . TRP A 1 156 ? 13.969 35.934 18.727  1.00 15.39 ? 137 TRP A CG  1 
ATOM   1122 C  CD1 . TRP A 1 156 ? 13.084 36.321 19.684  1.00 15.48 ? 137 TRP A CD1 1 
ATOM   1123 C  CD2 . TRP A 1 156 ? 14.384 34.596 19.077  1.00 16.05 ? 137 TRP A CD2 1 
ATOM   1124 N  NE1 . TRP A 1 156 ? 12.907 35.316 20.604  1.00 16.42 ? 137 TRP A NE1 1 
ATOM   1125 C  CE2 . TRP A 1 156 ? 13.692 34.241 20.258  1.00 16.49 ? 137 TRP A CE2 1 
ATOM   1126 C  CE3 . TRP A 1 156 ? 15.269 33.656 18.497  1.00 14.70 ? 137 TRP A CE3 1 
ATOM   1127 C  CZ2 . TRP A 1 156 ? 13.856 32.965 20.880  1.00 16.81 ? 137 TRP A CZ2 1 
ATOM   1128 C  CZ3 . TRP A 1 156 ? 15.422 32.404 19.110  1.00 14.50 ? 137 TRP A CZ3 1 
ATOM   1129 C  CH2 . TRP A 1 156 ? 14.730 32.081 20.304  1.00 15.41 ? 137 TRP A CH2 1 
ATOM   1130 N  N   . TYR A 1 157 ? 17.265 36.958 15.932  1.00 15.82 ? 138 TYR A N   1 
ATOM   1131 C  CA  . TYR A 1 157 ? 17.940 37.142 14.655  1.00 15.21 ? 138 TYR A CA  1 
ATOM   1132 C  C   . TYR A 1 157 ? 17.885 35.858 13.837  1.00 17.40 ? 138 TYR A C   1 
ATOM   1133 O  O   . TYR A 1 157 ? 17.805 34.776 14.378  1.00 15.82 ? 138 TYR A O   1 
ATOM   1134 C  CB  . TYR A 1 157 ? 19.420 37.513 14.849  1.00 16.26 ? 138 TYR A CB  1 
ATOM   1135 C  CG  . TYR A 1 157 ? 19.642 38.771 15.637  1.00 17.10 ? 138 TYR A CG  1 
ATOM   1136 C  CD1 . TYR A 1 157 ? 19.715 40.008 14.988  1.00 17.48 ? 138 TYR A CD1 1 
ATOM   1137 C  CD2 . TYR A 1 157 ? 19.786 38.747 17.016  1.00 19.45 ? 138 TYR A CD2 1 
ATOM   1138 C  CE1 . TYR A 1 157 ? 19.916 41.178 15.681  1.00 19.12 ? 138 TYR A CE1 1 
ATOM   1139 C  CE2 . TYR A 1 157 ? 19.992 39.938 17.732  1.00 20.20 ? 138 TYR A CE2 1 
ATOM   1140 C  CZ  . TYR A 1 157 ? 20.056 41.145 17.056  1.00 22.36 ? 138 TYR A CZ  1 
ATOM   1141 O  OH  . TYR A 1 157 ? 20.228 42.324 17.751  1.00 25.00 ? 138 TYR A OH  1 
ATOM   1142 N  N   . ILE A 1 158 ? 18.009 36.016 12.522  1.00 15.69 ? 139 ILE A N   1 
ATOM   1143 C  CA  . ILE A 1 158 ? 18.095 34.892 11.588  1.00 16.71 ? 139 ILE A CA  1 
ATOM   1144 C  C   . ILE A 1 158 ? 19.575 34.556 11.419  1.00 16.97 ? 139 ILE A C   1 
ATOM   1145 O  O   . ILE A 1 158 ? 20.373 35.444 11.123  1.00 19.73 ? 139 ILE A O   1 
ATOM   1146 C  CB  . ILE A 1 158 ? 17.475 35.282 10.227  1.00 16.79 ? 139 ILE A CB  1 
ATOM   1147 C  CG1 . ILE A 1 158 ? 16.045 35.798 10.376  1.00 17.58 ? 139 ILE A CG1 1 
ATOM   1148 C  CG2 . ILE A 1 158 ? 17.478 34.101 9.298   1.00 21.30 ? 139 ILE A CG2 1 
ATOM   1149 C  CD1 . ILE A 1 158 ? 15.492 36.424 9.116   1.00 18.58 ? 139 ILE A CD1 1 
ATOM   1150 N  N   A LYS A 1 159 ? 19.905 33.274 11.594  0.50 17.90 ? 140 LYS A N   1 
ATOM   1151 N  N   B LYS A 1 159 ? 19.933 33.286 11.595  0.50 17.81 ? 140 LYS A N   1 
ATOM   1152 C  CA  A LYS A 1 159 ? 21.281 32.763 11.523  0.50 20.12 ? 140 LYS A CA  1 
ATOM   1153 C  CA  B LYS A 1 159 ? 21.301 32.813 11.347  0.50 19.64 ? 140 LYS A CA  1 
ATOM   1154 C  C   A LYS A 1 159 ? 21.522 32.060 10.189  0.50 22.02 ? 140 LYS A C   1 
ATOM   1155 C  C   B LYS A 1 159 ? 21.391 32.248 9.941   0.50 20.47 ? 140 LYS A C   1 
ATOM   1156 O  O   A LYS A 1 159 ? 22.549 32.271 9.544   0.50 22.96 ? 140 LYS A O   1 
ATOM   1157 O  O   B LYS A 1 159 ? 22.166 32.709 9.103   0.50 18.52 ? 140 LYS A O   1 
ATOM   1158 C  CB  A LYS A 1 159 ? 21.534 31.779 12.668  0.50 22.16 ? 140 LYS A CB  1 
ATOM   1159 C  CB  B LYS A 1 159 ? 21.684 31.693 12.315  0.50 22.25 ? 140 LYS A CB  1 
ATOM   1160 C  CG  A LYS A 1 159 ? 22.960 31.263 12.748  0.50 25.11 ? 140 LYS A CG  1 
ATOM   1161 C  CG  B LYS A 1 159 ? 21.478 32.006 13.783  0.50 25.45 ? 140 LYS A CG  1 
ATOM   1162 C  CD  A LYS A 1 159 ? 23.109 30.158 13.789  0.50 25.73 ? 140 LYS A CD  1 
ATOM   1163 C  CD  B LYS A 1 159 ? 21.881 30.817 14.652  0.50 28.82 ? 140 LYS A CD  1 
ATOM   1164 N  N   A GLU A 1 160 ? 20.563 31.235 9.772   0.50 20.45 ? 141 GLU A N   1 
ATOM   1165 N  N   B GLU A 1 160 ? 20.568 31.237 9.692   0.50 19.16 ? 141 GLU A N   1 
ATOM   1166 C  CA  A GLU A 1 160 ? 20.691 30.500 8.509   0.50 20.38 ? 141 GLU A CA  1 
ATOM   1167 C  CA  B GLU A 1 160 ? 20.718 30.422 8.500   0.50 19.57 ? 141 GLU A CA  1 
ATOM   1168 C  C   A GLU A 1 160 ? 19.438 29.689 8.194   0.50 18.30 ? 141 GLU A C   1 
ATOM   1169 C  C   B GLU A 1 160 ? 19.397 29.782 8.138   0.50 17.82 ? 141 GLU A C   1 
ATOM   1170 O  O   A GLU A 1 160 ? 18.505 29.607 9.004   0.50 17.86 ? 141 GLU A O   1 
ATOM   1171 O  O   B GLU A 1 160 ? 18.383 29.921 8.844   0.50 15.70 ? 141 GLU A O   1 
ATOM   1172 C  CB  A GLU A 1 160 ? 21.958 29.626 8.524   0.50 20.50 ? 141 GLU A CB  1 
ATOM   1173 C  CB  B GLU A 1 160 ? 21.782 29.341 8.732   0.50 20.81 ? 141 GLU A CB  1 
ATOM   1174 C  CG  A GLU A 1 160 ? 21.912 28.422 9.451   0.50 20.98 ? 141 GLU A CG  1 
ATOM   1175 C  CG  B GLU A 1 160 ? 21.296 28.228 9.640   0.50 19.95 ? 141 GLU A CG  1 
ATOM   1176 C  CD  A GLU A 1 160 ? 23.207 27.608 9.394   0.50 24.27 ? 141 GLU A CD  1 
ATOM   1177 C  CD  B GLU A 1 160 ? 22.247 27.042 9.747   0.50 24.68 ? 141 GLU A CD  1 
ATOM   1178 O  OE1 A GLU A 1 160 ? 23.646 27.217 8.291   0.50 33.20 ? 141 GLU A OE1 1 
ATOM   1179 O  OE1 B GLU A 1 160 ? 22.872 26.652 8.743   0.50 28.29 ? 141 GLU A OE1 1 
ATOM   1180 O  OE2 A GLU A 1 160 ? 23.808 27.365 10.443  0.50 20.70 ? 141 GLU A OE2 1 
ATOM   1181 O  OE2 B GLU A 1 160 ? 22.343 26.483 10.851  0.50 26.31 ? 141 GLU A OE2 1 
ATOM   1182 N  N   . THR A 1 161 ? 19.393 29.116 6.996   1.00 16.72 ? 142 THR A N   1 
ATOM   1183 C  CA  . THR A 1 161 ? 18.210 28.395 6.556   1.00 17.58 ? 142 THR A CA  1 
ATOM   1184 C  C   . THR A 1 161 ? 18.598 27.301 5.591   1.00 16.69 ? 142 THR A C   1 
ATOM   1185 O  O   . THR A 1 161 ? 19.750 27.187 5.195   1.00 16.74 ? 142 THR A O   1 
ATOM   1186 C  CB  . THR A 1 161 ? 17.156 29.366 5.944   1.00 19.45 ? 142 THR A CB  1 
ATOM   1187 O  OG1 . THR A 1 161 ? 15.889 28.717 5.830   1.00 18.05 ? 142 THR A OG1 1 
ATOM   1188 C  CG2 . THR A 1 161 ? 17.569 29.862 4.576   1.00 19.64 ? 142 THR A CG2 1 
ATOM   1189 N  N   . GLY A 1 162 ? 17.623 26.475 5.274   1.00 16.69 ? 143 GLY A N   1 
ATOM   1190 C  CA  . GLY A 1 162 ? 17.710 25.531 4.179   1.00 17.02 ? 143 GLY A CA  1 
ATOM   1191 C  C   . GLY A 1 162 ? 16.361 25.388 3.540   1.00 18.16 ? 143 GLY A C   1 
ATOM   1192 O  O   . GLY A 1 162 ? 15.324 25.685 4.155   1.00 18.12 ? 143 GLY A O   1 
ATOM   1193 N  N   . TYR A 1 163 ? 16.356 24.921 2.297   1.00 17.36 ? 144 TYR A N   1 
ATOM   1194 C  CA  . TYR A 1 163 ? 15.081 24.789 1.609   1.00 14.90 ? 144 TYR A CA  1 
ATOM   1195 C  C   . TYR A 1 163 ? 15.015 23.646 0.608   1.00 14.83 ? 144 TYR A C   1 
ATOM   1196 O  O   . TYR A 1 163 ? 16.047 23.175 0.099   1.00 17.46 ? 144 TYR A O   1 
ATOM   1197 C  CB  . TYR A 1 163 ? 14.730 26.105 0.916   1.00 15.35 ? 144 TYR A CB  1 
ATOM   1198 C  CG  . TYR A 1 163 ? 15.650 26.524 -0.210  1.00 16.54 ? 144 TYR A CG  1 
ATOM   1199 C  CD1 . TYR A 1 163 ? 16.782 27.264 0.036   1.00 17.42 ? 144 TYR A CD1 1 
ATOM   1200 C  CD2 . TYR A 1 163 ? 15.380 26.159 -1.535  1.00 20.44 ? 144 TYR A CD2 1 
ATOM   1201 C  CE1 . TYR A 1 163 ? 17.618 27.670 -0.991  1.00 17.45 ? 144 TYR A CE1 1 
ATOM   1202 C  CE2 . TYR A 1 163 ? 16.202 26.558 -2.574  1.00 20.36 ? 144 TYR A CE2 1 
ATOM   1203 C  CZ  . TYR A 1 163 ? 17.322 27.315 -2.304  1.00 21.03 ? 144 TYR A CZ  1 
ATOM   1204 O  OH  . TYR A 1 163 ? 18.138 27.679 -3.355  1.00 23.89 ? 144 TYR A OH  1 
ATOM   1205 N  N   . VAL A 1 164 ? 13.781 23.229 0.327   1.00 15.39 ? 145 VAL A N   1 
ATOM   1206 C  CA  . VAL A 1 164 ? 13.450 22.382 -0.775  1.00 16.38 ? 145 VAL A CA  1 
ATOM   1207 C  C   . VAL A 1 164 ? 12.607 23.202 -1.750  1.00 18.23 ? 145 VAL A C   1 
ATOM   1208 O  O   . VAL A 1 164 ? 11.564 23.727 -1.386  1.00 17.72 ? 145 VAL A O   1 
ATOM   1209 C  CB  . VAL A 1 164 ? 12.642 21.152 -0.305  1.00 21.45 ? 145 VAL A CB  1 
ATOM   1210 C  CG1 . VAL A 1 164 ? 12.133 20.351 -1.500  1.00 23.80 ? 145 VAL A CG1 1 
ATOM   1211 C  CG2 . VAL A 1 164 ? 13.493 20.296 0.606   1.00 26.49 ? 145 VAL A CG2 1 
ATOM   1212 N  N   . ARG A 1 165 ? 13.051 23.285 -2.999  1.00 18.03 ? 146 ARG A N   1 
ATOM   1213 C  CA  . ARG A 1 165 ? 12.321 24.015 -4.034  1.00 19.43 ? 146 ARG A CA  1 
ATOM   1214 C  C   . ARG A 1 165 ? 11.179 23.111 -4.522  1.00 19.60 ? 146 ARG A C   1 
ATOM   1215 O  O   . ARG A 1 165 ? 11.437 22.050 -5.079  1.00 20.05 ? 146 ARG A O   1 
ATOM   1216 C  CB  . ARG A 1 165 ? 13.311 24.372 -5.165  1.00 23.21 ? 146 ARG A CB  1 
ATOM   1217 C  CG  . ARG A 1 165 ? 12.894 25.504 -6.064  1.00 27.24 ? 146 ARG A CG  1 
ATOM   1218 C  CD  . ARG A 1 165 ? 13.124 26.828 -5.369  1.00 29.57 ? 146 ARG A CD  1 
ATOM   1219 N  NE  . ARG A 1 165 ? 12.958 27.969 -6.274  1.00 31.69 ? 146 ARG A NE  1 
ATOM   1220 C  CZ  . ARG A 1 165 ? 12.029 28.924 -6.180  1.00 28.08 ? 146 ARG A CZ  1 
ATOM   1221 N  NH1 . ARG A 1 165 ? 11.119 28.933 -5.211  1.00 26.13 ? 146 ARG A NH1 1 
ATOM   1222 N  NH2 . ARG A 1 165 ? 12.032 29.928 -7.063  1.00 26.71 ? 146 ARG A NH2 1 
ATOM   1223 N  N   . ILE A 1 166 ? 9.929  23.533 -4.320  1.00 17.79 ? 147 ILE A N   1 
ATOM   1224 C  CA  . ILE A 1 166 ? 8.774  22.768 -4.779  1.00 18.51 ? 147 ILE A CA  1 
ATOM   1225 C  C   . ILE A 1 166 ? 8.785  22.773 -6.307  1.00 19.05 ? 147 ILE A C   1 
ATOM   1226 O  O   . ILE A 1 166 ? 8.679  21.722 -6.969  1.00 16.98 ? 147 ILE A O   1 
ATOM   1227 C  CB  . ILE A 1 166 ? 7.470  23.375 -4.268  1.00 19.76 ? 147 ILE A CB  1 
ATOM   1228 C  CG1 . ILE A 1 166 ? 7.448  23.407 -2.725  1.00 19.87 ? 147 ILE A CG1 1 
ATOM   1229 C  CG2 . ILE A 1 166 ? 6.259  22.648 -4.846  1.00 19.81 ? 147 ILE A CG2 1 
ATOM   1230 C  CD1 . ILE A 1 166 ? 6.409  24.338 -2.166  1.00 18.84 ? 147 ILE A CD1 1 
ATOM   1231 N  N   . PHE A 1 167 ? 8.902  23.987 -6.834  1.00 17.48 ? 148 PHE A N   1 
ATOM   1232 C  CA  . PHE A 1 167 ? 9.094  24.177 -8.254  1.00 20.32 ? 148 PHE A CA  1 
ATOM   1233 C  C   . PHE A 1 167 ? 9.598  25.573 -8.563  1.00 18.84 ? 148 PHE A C   1 
ATOM   1234 O  O   . PHE A 1 167 ? 9.521  26.474 -7.736  1.00 17.56 ? 148 PHE A O   1 
ATOM   1235 C  CB  . PHE A 1 167 ? 7.816  23.861 -9.039  1.00 27.15 ? 148 PHE A CB  1 
ATOM   1236 C  CG  . PHE A 1 167 ? 6.986  25.062 -9.352  1.00 26.64 ? 148 PHE A CG  1 
ATOM   1237 C  CD1 . PHE A 1 167 ? 6.323  25.744 -8.350  1.00 34.34 ? 148 PHE A CD1 1 
ATOM   1238 C  CD2 . PHE A 1 167 ? 6.854  25.490 -10.660 1.00 32.51 ? 148 PHE A CD2 1 
ATOM   1239 C  CE1 . PHE A 1 167 ? 5.564  26.874 -8.668  1.00 30.18 ? 148 PHE A CE1 1 
ATOM   1240 C  CE2 . PHE A 1 167 ? 6.092  26.602 -10.968 1.00 29.31 ? 148 PHE A CE2 1 
ATOM   1241 C  CZ  . PHE A 1 167 ? 5.463  27.291 -9.969  1.00 33.62 ? 148 PHE A CZ  1 
ATOM   1242 N  N   . GLU A 1 168 ? 10.093 25.725 -9.785  1.00 17.62 ? 149 GLU A N   1 
ATOM   1243 C  CA  . GLU A 1 168 ? 10.514 27.011 -10.293 1.00 18.03 ? 149 GLU A CA  1 
ATOM   1244 C  C   . GLU A 1 168 ? 10.257 27.006 -11.788 1.00 17.42 ? 149 GLU A C   1 
ATOM   1245 O  O   . GLU A 1 168 ? 10.526 25.997 -12.441 1.00 19.43 ? 149 GLU A O   1 
ATOM   1246 C  CB  . GLU A 1 168 ? 11.987 27.265 -10.005 1.00 19.91 ? 149 GLU A CB  1 
ATOM   1247 C  CG  . GLU A 1 168 ? 12.399 28.683 -10.339 1.00 21.00 ? 149 GLU A CG  1 
ATOM   1248 C  CD  . GLU A 1 168 ? 13.840 28.982 -9.940  1.00 28.71 ? 149 GLU A CD  1 
ATOM   1249 O  OE1 . GLU A 1 168 ? 14.123 28.996 -8.746  1.00 30.47 ? 149 GLU A OE1 1 
ATOM   1250 O  OE2 . GLU A 1 168 ? 14.699 29.190 -10.801 1.00 33.08 ? 149 GLU A OE2 1 
ATOM   1251 N  N   . GLU A 1 169 ? 9.725  28.105 -12.311 1.00 17.04 ? 150 GLU A N   1 
ATOM   1252 C  CA  . GLU A 1 169 ? 9.494  28.254 -13.740 1.00 16.75 ? 150 GLU A CA  1 
ATOM   1253 C  C   . GLU A 1 169 ? 10.028 29.600 -14.204 1.00 17.75 ? 150 GLU A C   1 
ATOM   1254 O  O   . GLU A 1 169 ? 9.903  30.597 -13.493 1.00 17.76 ? 150 GLU A O   1 
ATOM   1255 C  CB  . GLU A 1 169 ? 8.004  28.104 -14.099 1.00 17.88 ? 150 GLU A CB  1 
ATOM   1256 C  CG  . GLU A 1 169 ? 7.120  29.196 -13.520 1.00 19.98 ? 150 GLU A CG  1 
ATOM   1257 C  CD  . GLU A 1 169 ? 5.639  29.056 -13.854 1.00 21.74 ? 150 GLU A CD  1 
ATOM   1258 O  OE1 . GLU A 1 169 ? 5.255  28.167 -14.644 1.00 21.28 ? 150 GLU A OE1 1 
ATOM   1259 O  OE2 . GLU A 1 169 ? 4.875  29.913 -13.345 1.00 22.19 ? 150 GLU A OE2 1 
ATOM   1260 N  N   . HIS A 1 170 ? 10.662 29.595 -15.368 1.00 18.28 ? 151 HIS A N   1 
ATOM   1261 C  CA  . HIS A 1 170 ? 11.174 30.795 -16.039 1.00 17.07 ? 151 HIS A CA  1 
ATOM   1262 C  C   . HIS A 1 170 ? 10.437 30.940 -17.360 1.00 17.18 ? 151 HIS A C   1 
ATOM   1263 O  O   . HIS A 1 170 ? 10.209 29.965 -18.092 1.00 18.69 ? 151 HIS A O   1 
ATOM   1264 C  CB  . HIS A 1 170 ? 12.674 30.664 -16.344 1.00 19.67 ? 151 HIS A CB  1 
ATOM   1265 C  CG  . HIS A 1 170 ? 13.562 30.589 -15.138 1.00 21.34 ? 151 HIS A CG  1 
ATOM   1266 N  ND1 . HIS A 1 170 ? 14.782 31.232 -15.088 1.00 22.85 ? 151 HIS A ND1 1 
ATOM   1267 C  CD2 . HIS A 1 170 ? 13.428 29.946 -13.955 1.00 22.21 ? 151 HIS A CD2 1 
ATOM   1268 C  CE1 . HIS A 1 170 ? 15.353 31.003 -13.921 1.00 23.59 ? 151 HIS A CE1 1 
ATOM   1269 N  NE2 . HIS A 1 170 ? 14.565 30.206 -13.224 1.00 23.87 ? 151 HIS A NE2 1 
ATOM   1270 N  N   . PHE A 1 171 ? 10.091 32.184 -17.690 1.00 17.24 ? 152 PHE A N   1 
ATOM   1271 C  CA  . PHE A 1 171 ? 9.292  32.470 -18.884 1.00 19.29 ? 152 PHE A CA  1 
ATOM   1272 C  C   . PHE A 1 171 ? 9.495  33.921 -19.317 1.00 19.81 ? 152 PHE A C   1 
ATOM   1273 O  O   . PHE A 1 171 ? 10.025 34.713 -18.555 1.00 20.25 ? 152 PHE A O   1 
ATOM   1274 C  CB  . PHE A 1 171 ? 7.809  32.184 -18.593 1.00 20.28 ? 152 PHE A CB  1 
ATOM   1275 C  CG  . PHE A 1 171 ? 7.296  32.872 -17.364 1.00 18.61 ? 152 PHE A CG  1 
ATOM   1276 C  CD1 . PHE A 1 171 ? 6.792  34.171 -17.424 1.00 20.69 ? 152 PHE A CD1 1 
ATOM   1277 C  CD2 . PHE A 1 171 ? 7.346  32.233 -16.127 1.00 18.99 ? 152 PHE A CD2 1 
ATOM   1278 C  CE1 . PHE A 1 171 ? 6.338  34.806 -16.285 1.00 22.60 ? 152 PHE A CE1 1 
ATOM   1279 C  CE2 . PHE A 1 171 ? 6.937  32.869 -14.986 1.00 19.84 ? 152 PHE A CE2 1 
ATOM   1280 C  CZ  . PHE A 1 171 ? 6.417  34.154 -15.061 1.00 21.24 ? 152 PHE A CZ  1 
HETATM 1281 N  N   . MSE A 1 172 ? 9.103  34.223 -20.557 1.00 20.11 ? 153 MSE A N   1 
HETATM 1282 C  CA  . MSE A 1 172 ? 9.159  35.600 -21.088 1.00 22.18 ? 153 MSE A CA  1 
HETATM 1283 C  C   . MSE A 1 172 ? 7.769  36.170 -20.970 1.00 23.74 ? 153 MSE A C   1 
HETATM 1284 O  O   . MSE A 1 172 ? 6.806  35.555 -21.411 1.00 26.50 ? 153 MSE A O   1 
HETATM 1285 C  CB  . MSE A 1 172 ? 9.579  35.641 -22.552 1.00 23.08 ? 153 MSE A CB  1 
HETATM 1286 C  CG  . MSE A 1 172 ? 10.996 35.149 -22.768 1.00 27.72 ? 153 MSE A CG  1 
HETATM 1287 SE SE  . MSE A 1 172 ? 12.297 36.256 -21.834 0.75 26.52 ? 153 MSE A SE  1 
HETATM 1288 C  CE  . MSE A 1 172 ? 11.929 38.002 -22.626 1.00 35.28 ? 153 MSE A CE  1 
ATOM   1289 N  N   . ARG A 1 173 ? 7.661  37.343 -20.357 1.00 21.37 ? 154 ARG A N   1 
ATOM   1290 C  CA  . ARG A 1 173 ? 6.402  38.029 -20.204 1.00 22.20 ? 154 ARG A CA  1 
ATOM   1291 C  C   . ARG A 1 173 ? 6.079  38.814 -21.471 1.00 23.67 ? 154 ARG A C   1 
ATOM   1292 O  O   . ARG A 1 173 ? 6.952  39.376 -22.114 1.00 25.26 ? 154 ARG A O   1 
ATOM   1293 C  CB  . ARG A 1 173 ? 6.487  39.008 -19.035 1.00 20.24 ? 154 ARG A CB  1 
ATOM   1294 C  CG  . ARG A 1 173 ? 6.616  38.355 -17.658 1.00 20.59 ? 154 ARG A CG  1 
ATOM   1295 C  CD  . ARG A 1 173 ? 7.176  39.326 -16.635 1.00 19.35 ? 154 ARG A CD  1 
ATOM   1296 N  NE  . ARG A 1 173 ? 6.435  40.588 -16.690 1.00 20.61 ? 154 ARG A NE  1 
ATOM   1297 C  CZ  . ARG A 1 173 ? 5.287  40.849 -16.061 1.00 18.99 ? 154 ARG A CZ  1 
ATOM   1298 N  NH1 . ARG A 1 173 ? 4.652  39.946 -15.310 1.00 20.17 ? 154 ARG A NH1 1 
ATOM   1299 N  NH2 . ARG A 1 173 ? 4.720  42.044 -16.244 1.00 19.90 ? 154 ARG A NH2 1 
ATOM   1300 N  N   . ASP A 1 174 ? 4.800  38.878 -21.790 1.00 22.63 ? 155 ASP A N   1 
ATOM   1301 C  CA  . ASP A 1 174 ? 4.327  39.670 -22.931 1.00 23.98 ? 155 ASP A CA  1 
ATOM   1302 C  C   . ASP A 1 174 ? 4.678  41.153 -22.708 1.00 25.18 ? 155 ASP A C   1 
ATOM   1303 O  O   . ASP A 1 174 ? 4.267  41.732 -21.702 1.00 20.32 ? 155 ASP A O   1 
ATOM   1304 C  CB  . ASP A 1 174 ? 2.814  39.457 -23.059 1.00 27.79 ? 155 ASP A CB  1 
ATOM   1305 C  CG  . ASP A 1 174 ? 2.216  40.125 -24.282 1.00 31.28 ? 155 ASP A CG  1 
ATOM   1306 O  OD1 . ASP A 1 174 ? 2.855  40.984 -24.924 1.00 29.22 ? 155 ASP A OD1 1 
ATOM   1307 O  OD2 . ASP A 1 174 ? 1.075  39.772 -24.614 1.00 38.15 ? 155 ASP A OD2 1 
ATOM   1308 N  N   . PRO A 1 175 ? 5.430  41.781 -23.647 1.00 27.86 ? 156 PRO A N   1 
ATOM   1309 C  CA  . PRO A 1 175 ? 5.785  43.185 -23.393 1.00 29.61 ? 156 PRO A CA  1 
ATOM   1310 C  C   . PRO A 1 175 ? 4.592  44.143 -23.482 1.00 25.06 ? 156 PRO A C   1 
ATOM   1311 O  O   . PRO A 1 175 ? 4.710  45.289 -23.054 1.00 26.53 ? 156 PRO A O   1 
ATOM   1312 C  CB  . PRO A 1 175 ? 6.832  43.484 -24.481 1.00 33.83 ? 156 PRO A CB  1 
ATOM   1313 C  CG  . PRO A 1 175 ? 6.449  42.570 -25.580 1.00 35.81 ? 156 PRO A CG  1 
ATOM   1314 C  CD  . PRO A 1 175 ? 6.024  41.297 -24.912 1.00 32.56 ? 156 PRO A CD  1 
ATOM   1315 N  N   . LYS A 1 176 ? 3.448  43.649 -23.969 1.00 23.98 ? 157 LYS A N   1 
ATOM   1316 C  CA  . LYS A 1 176 ? 2.187  44.421 -23.984 1.00 25.45 ? 157 LYS A CA  1 
ATOM   1317 C  C   . LYS A 1 176 ? 1.524  44.548 -22.612 1.00 21.84 ? 157 LYS A C   1 
ATOM   1318 O  O   . LYS A 1 176 ? 0.622  45.377 -22.445 1.00 21.57 ? 157 LYS A O   1 
ATOM   1319 C  CB  . LYS A 1 176 ? 1.193  43.819 -24.974 1.00 30.46 ? 157 LYS A CB  1 
ATOM   1320 C  CG  . LYS A 1 176 ? 1.697  43.744 -26.424 1.00 38.26 ? 157 LYS A CG  1 
ATOM   1321 C  CD  . LYS A 1 176 ? 0.604  43.303 -27.395 1.00 48.49 ? 157 LYS A CD  1 
ATOM   1322 C  CE  . LYS A 1 176 ? 0.217  41.836 -27.229 1.00 59.47 ? 157 LYS A CE  1 
ATOM   1323 N  NZ  . LYS A 1 176 ? 1.318  40.901 -27.620 1.00 66.22 ? 157 LYS A NZ  1 
ATOM   1324 N  N   . ILE A 1 177 ? 1.924  43.733 -21.635 1.00 20.49 ? 158 ILE A N   1 
ATOM   1325 C  CA  . ILE A 1 177 ? 1.439  43.900 -20.247 1.00 19.97 ? 158 ILE A CA  1 
ATOM   1326 C  C   . ILE A 1 177 ? 1.800  45.323 -19.800 1.00 21.56 ? 158 ILE A C   1 
ATOM   1327 O  O   . ILE A 1 177 ? 2.875  45.830 -20.135 1.00 22.24 ? 158 ILE A O   1 
ATOM   1328 C  CB  . ILE A 1 177 ? 2.042  42.844 -19.285 1.00 20.16 ? 158 ILE A CB  1 
ATOM   1329 C  CG1 . ILE A 1 177 ? 1.512  41.436 -19.640 1.00 19.88 ? 158 ILE A CG1 1 
ATOM   1330 C  CG2 . ILE A 1 177 ? 1.731  43.167 -17.824 1.00 22.08 ? 158 ILE A CG2 1 
ATOM   1331 C  CD1 . ILE A 1 177 ? 2.327  40.327 -19.031 1.00 22.01 ? 158 ILE A CD1 1 
ATOM   1332 N  N   . HIS A 1 178 ? 0.887  45.973 -19.088 1.00 19.29 ? 159 HIS A N   1 
ATOM   1333 C  CA  . HIS A 1 178 ? 1.095  47.320 -18.583 1.00 19.17 ? 159 HIS A CA  1 
ATOM   1334 C  C   . HIS A 1 178 ? 1.440  47.256 -17.118 1.00 19.46 ? 159 HIS A C   1 
ATOM   1335 O  O   . HIS A 1 178 ? 0.587  46.986 -16.297 1.00 18.03 ? 159 HIS A O   1 
ATOM   1336 C  CB  . HIS A 1 178 ? -0.167 48.163 -18.777 1.00 21.02 ? 159 HIS A CB  1 
ATOM   1337 C  CG  . HIS A 1 178 ? 0.026  49.621 -18.484 1.00 22.81 ? 159 HIS A CG  1 
ATOM   1338 N  ND1 . HIS A 1 178 ? -0.981 50.540 -18.672 1.00 24.41 ? 159 HIS A ND1 1 
ATOM   1339 C  CD2 . HIS A 1 178 ? 1.101  50.328 -18.045 1.00 23.38 ? 159 HIS A CD2 1 
ATOM   1340 C  CE1 . HIS A 1 178 ? -0.537 51.749 -18.369 1.00 26.91 ? 159 HIS A CE1 1 
ATOM   1341 N  NE2 . HIS A 1 178 ? 0.719  51.648 -17.975 1.00 24.32 ? 159 HIS A NE2 1 
ATOM   1342 N  N   . ILE A 1 179 ? 2.703  47.511 -16.783 1.00 19.00 ? 160 ILE A N   1 
ATOM   1343 C  CA  . ILE A 1 179 ? 3.094  47.685 -15.398 1.00 18.17 ? 160 ILE A CA  1 
ATOM   1344 C  C   . ILE A 1 179 ? 2.781  49.136 -15.056 1.00 19.07 ? 160 ILE A C   1 
ATOM   1345 O  O   . ILE A 1 179 ? 3.449  50.063 -15.533 1.00 19.66 ? 160 ILE A O   1 
ATOM   1346 C  CB  . ILE A 1 179 ? 4.582  47.358 -15.146 1.00 19.56 ? 160 ILE A CB  1 
ATOM   1347 C  CG1 . ILE A 1 179 ? 4.875  45.890 -15.504 1.00 23.72 ? 160 ILE A CG1 1 
ATOM   1348 C  CG2 . ILE A 1 179 ? 4.956  47.647 -13.690 1.00 21.18 ? 160 ILE A CG2 1 
ATOM   1349 C  CD1 . ILE A 1 179 ? 6.341  45.512 -15.491 1.00 26.11 ? 160 ILE A CD1 1 
ATOM   1350 N  N   . THR A 1 180 ? 1.762  49.319 -14.232 1.00 18.69 ? 161 THR A N   1 
ATOM   1351 C  CA  . THR A 1 180 ? 1.241  50.627 -13.894 1.00 20.07 ? 161 THR A CA  1 
ATOM   1352 C  C   . THR A 1 180 ? 1.872  51.213 -12.635 1.00 19.98 ? 161 THR A C   1 
ATOM   1353 O  O   . THR A 1 180 ? 1.860  52.424 -12.468 1.00 23.53 ? 161 THR A O   1 
ATOM   1354 C  CB  . THR A 1 180 ? -0.287 50.584 -13.739 1.00 21.48 ? 161 THR A CB  1 
ATOM   1355 O  OG1 . THR A 1 180 ? -0.630 49.635 -12.728 1.00 21.31 ? 161 THR A OG1 1 
ATOM   1356 C  CG2 . THR A 1 180 ? -0.936 50.190 -15.059 1.00 21.48 ? 161 THR A CG2 1 
ATOM   1357 N  N   . SER A 1 181 ? 2.428  50.370 -11.785 1.00 21.60 ? 162 SER A N   1 
ATOM   1358 C  CA  . SER A 1 181 ? 3.120  50.809 -10.575 1.00 22.94 ? 162 SER A CA  1 
ATOM   1359 C  C   . SER A 1 181 ? 4.370  49.979 -10.400 1.00 21.36 ? 162 SER A C   1 
ATOM   1360 O  O   . SER A 1 181 ? 4.395  48.768 -10.682 1.00 19.10 ? 162 SER A O   1 
ATOM   1361 C  CB  . SER A 1 181 ? 2.241  50.621 -9.334  1.00 23.47 ? 162 SER A CB  1 
ATOM   1362 O  OG  . SER A 1 181 ? 1.168  51.529 -9.305  1.00 28.62 ? 162 SER A OG  1 
ATOM   1363 N  N   . ASN A 1 182 ? 5.419  50.628 -9.894  1.00 21.31 ? 163 ASN A N   1 
ATOM   1364 C  CA  . ASN A 1 182 ? 6.673  49.939 -9.609  1.00 19.73 ? 163 ASN A CA  1 
ATOM   1365 C  C   . ASN A 1 182 ? 7.422  50.789 -8.592  1.00 20.16 ? 163 ASN A C   1 
ATOM   1366 O  O   . ASN A 1 182 ? 7.923  51.878 -8.944  1.00 20.99 ? 163 ASN A O   1 
ATOM   1367 C  CB  . ASN A 1 182 ? 7.487  49.735 -10.908 1.00 19.76 ? 163 ASN A CB  1 
ATOM   1368 C  CG  . ASN A 1 182 ? 8.847  49.101 -10.669 1.00 19.40 ? 163 ASN A CG  1 
ATOM   1369 O  OD1 . ASN A 1 182 ? 9.263  48.903 -9.524  1.00 21.10 ? 163 ASN A OD1 1 
ATOM   1370 N  ND2 . ASN A 1 182 ? 9.528  48.715 -11.756 1.00 21.77 ? 163 ASN A ND2 1 
HETATM 1371 N  N   . MSE A 1 183 ? 7.513  50.303 -7.348  1.00 20.58 ? 164 MSE A N   1 
HETATM 1372 C  CA  . MSE A 1 183 ? 8.133  51.111 -6.273  1.00 20.59 ? 164 MSE A CA  1 
HETATM 1373 C  C   . MSE A 1 183 ? 9.597  51.404 -6.522  1.00 21.03 ? 164 MSE A C   1 
HETATM 1374 O  O   . MSE A 1 183 ? 10.136 52.363 -5.937  1.00 21.53 ? 164 MSE A O   1 
HETATM 1375 C  CB  . MSE A 1 183 ? 7.943  50.495 -4.898  1.00 19.92 ? 164 MSE A CB  1 
HETATM 1376 C  CG  . MSE A 1 183 ? 8.719  49.199 -4.779  1.00 17.97 ? 164 MSE A CG  1 
HETATM 1377 SE SE  . MSE A 1 183 ? 8.632  48.461 -2.981  0.75 15.14 ? 164 MSE A SE  1 
HETATM 1378 C  CE  . MSE A 1 183 ? 9.668  49.719 -1.928  1.00 24.00 ? 164 MSE A CE  1 
ATOM   1379 N  N   . HIS A 1 184 ? 10.238 50.638 -7.401  1.00 19.19 ? 165 HIS A N   1 
ATOM   1380 C  CA  . HIS A 1 184 ? 11.676 50.767 -7.644  1.00 19.41 ? 165 HIS A CA  1 
ATOM   1381 C  C   . HIS A 1 184 ? 11.970 51.778 -8.745  1.00 25.13 ? 165 HIS A C   1 
ATOM   1382 O  O   . HIS A 1 184 ? 13.141 52.033 -9.018  1.00 31.73 ? 165 HIS A O   1 
ATOM   1383 C  CB  . HIS A 1 184 ? 12.283 49.414 -7.974  1.00 20.66 ? 165 HIS A CB  1 
ATOM   1384 C  CG  . HIS A 1 184 ? 11.892 48.362 -6.987  1.00 20.30 ? 165 HIS A CG  1 
ATOM   1385 N  ND1 . HIS A 1 184 ? 12.258 48.431 -5.662  1.00 21.72 ? 165 HIS A ND1 1 
ATOM   1386 C  CD2 . HIS A 1 184 ? 11.085 47.279 -7.100  1.00 22.47 ? 165 HIS A CD2 1 
ATOM   1387 C  CE1 . HIS A 1 184 ? 11.713 47.425 -5.004  1.00 21.05 ? 165 HIS A CE1 1 
ATOM   1388 N  NE2 . HIS A 1 184 ? 11.009 46.700 -5.857  1.00 21.15 ? 165 HIS A NE2 1 
ATOM   1389 N  N   . LYS A 1 185 ? 10.918 52.326 -9.360  1.00 24.03 ? 166 LYS A N   1 
ATOM   1390 C  CA  . LYS A 1 185 ? 11.015 53.501 -10.253 1.00 32.88 ? 166 LYS A CA  1 
ATOM   1391 C  C   . LYS A 1 185 ? 10.446 54.778 -9.637  1.00 39.94 ? 166 LYS A C   1 
ATOM   1392 O  O   . LYS A 1 185 ? 10.808 55.876 -10.064 1.00 44.77 ? 166 LYS A O   1 
ATOM   1393 C  CB  . LYS A 1 185 ? 10.248 53.213 -11.526 1.00 34.75 ? 166 LYS A CB  1 
ATOM   1394 C  CG  . LYS A 1 185 ? 10.865 52.103 -12.356 1.00 41.95 ? 166 LYS A CG  1 
ATOM   1395 C  CD  . LYS A 1 185 ? 10.107 51.920 -13.674 1.00 48.48 ? 166 LYS A CD  1 
ATOM   1396 C  CE  . LYS A 1 185 ? 10.738 50.861 -14.579 1.00 49.50 ? 166 LYS A CE  1 
ATOM   1397 N  NZ  . LYS A 1 185 ? 12.123 51.184 -15.005 1.00 54.40 ? 166 LYS A NZ  1 
ATOM   1398 N  N   . GLU A 1 186 ? 9.542  54.631 -8.659  1.00 50.27 ? 167 GLU A N   1 
ATOM   1399 C  CA  . GLU A 1 186 ? 8.762  55.740 -8.085  1.00 65.77 ? 167 GLU A CA  1 
ATOM   1400 C  C   . GLU A 1 186 ? 9.404  56.218 -6.785  1.00 70.36 ? 167 GLU A C   1 
ATOM   1401 O  O   . GLU A 1 186 ? 9.174  55.645 -5.719  1.00 71.11 ? 167 GLU A O   1 
ATOM   1402 C  CB  . GLU A 1 186 ? 7.294  55.300 -7.851  1.00 66.59 ? 167 GLU A CB  1 
ATOM   1403 C  CG  . GLU A 1 186 ? 6.387  55.426 -9.082  1.00 66.64 ? 167 GLU A CG  1 
ATOM   1404 C  CD  . GLU A 1 186 ? 5.660  54.131 -9.457  1.00 65.61 ? 167 GLU A CD  1 
ATOM   1405 O  OE1 . GLU A 1 186 ? 4.946  53.529 -8.612  1.00 49.98 ? 167 GLU A OE1 1 
ATOM   1406 O  OE2 . GLU A 1 186 ? 5.808  53.704 -10.623 1.00 68.10 ? 167 GLU A OE2 1 
HETATM 1407 NI NI  . NI  B 2 .   ? 0.001  34.008 -0.854  0.15 12.68 2 201 NI  A NI  1 
HETATM 1408 NA NA  . NA  C 3 .   ? 0.001  34.008 -5.594  0.33 23.64 1 202 NA  A NA  1 
HETATM 1409 C  C1  . PGE D 4 .   ? 5.618  32.703 -22.014 1.00 54.58 ? 203 PGE A C1  1 
HETATM 1410 O  O1  . PGE D 4 .   ? 4.407  32.016 -21.683 1.00 69.56 ? 203 PGE A O1  1 
HETATM 1411 C  C2  . PGE D 4 .   ? 6.543  31.787 -22.801 1.00 44.81 ? 203 PGE A C2  1 
HETATM 1412 O  O2  . PGE D 4 .   ? 7.914  32.114 -22.520 1.00 39.91 ? 203 PGE A O2  1 
HETATM 1413 C  C3  . PGE D 4 .   ? 8.718  30.981 -22.283 1.00 35.39 ? 203 PGE A C3  1 
HETATM 1414 C  C4  . PGE D 4 .   ? 10.145 31.218 -22.720 1.00 32.80 ? 203 PGE A C4  1 
HETATM 1415 O  O4  . PGE D 4 .   ? 13.641 32.626 -19.748 1.00 48.68 ? 203 PGE A O4  1 
HETATM 1416 C  C6  . PGE D 4 .   ? 12.966 31.446 -20.225 1.00 44.03 ? 203 PGE A C6  1 
HETATM 1417 C  C5  . PGE D 4 .   ? 11.939 31.862 -21.264 1.00 34.26 ? 203 PGE A C5  1 
HETATM 1418 O  O3  . PGE D 4 .   ? 11.067 30.806 -21.689 1.00 40.99 ? 203 PGE A O3  1 
HETATM 1419 O  OH2 . 1PE E 5 .   ? 17.513 33.400 5.128   1.00 28.99 ? 204 1PE A OH2 1 
HETATM 1420 C  C12 . 1PE E 5 .   ? 18.692 33.180 5.913   1.00 37.58 ? 204 1PE A C12 1 
HETATM 1421 C  C22 . 1PE E 5 .   ? 19.583 34.416 5.741   1.00 41.21 ? 204 1PE A C22 1 
HETATM 1422 O  OH3 . 1PE E 5 .   ? 20.942 34.200 5.348   1.00 49.07 ? 204 1PE A OH3 1 
HETATM 1423 C  C13 . 1PE E 5 .   ? 22.000 33.962 3.155   1.00 35.37 ? 204 1PE A C13 1 
HETATM 1424 C  C23 . 1PE E 5 .   ? 21.337 33.272 4.336   1.00 46.36 ? 204 1PE A C23 1 
HETATM 1425 O  OH4 . 1PE E 5 .   ? 21.261 33.570 2.005   1.00 37.73 ? 204 1PE A OH4 1 
HETATM 1426 C  C14 . 1PE E 5 .   ? 20.393 33.997 -0.164  1.00 33.98 ? 204 1PE A C14 1 
HETATM 1427 C  C24 . 1PE E 5 .   ? 21.399 34.416 0.875   1.00 40.90 ? 204 1PE A C24 1 
HETATM 1428 O  OH5 . 1PE E 5 .   ? 19.223 34.780 -0.032  1.00 36.70 ? 204 1PE A OH5 1 
HETATM 1429 C  C15 . 1PE E 5 .   ? 17.046 35.341 -0.920  1.00 39.96 ? 204 1PE A C15 1 
HETATM 1430 C  C25 . 1PE E 5 .   ? 18.474 34.924 -1.244  1.00 40.42 ? 204 1PE A C25 1 
HETATM 1431 O  OH6 . 1PE E 5 .   ? 16.543 34.321 -0.056  1.00 41.96 ? 204 1PE A OH6 1 
HETATM 1432 C  C16 . 1PE E 5 .   ? 14.272 33.801 0.376   1.00 45.62 ? 204 1PE A C16 1 
HETATM 1433 C  C26 . 1PE E 5 .   ? 15.444 34.650 0.777   1.00 43.44 ? 204 1PE A C26 1 
HETATM 1434 O  OH7 . 1PE E 5 .   ? 13.520 33.450 1.535   1.00 44.68 ? 204 1PE A OH7 1 
HETATM 1435 O  O   . HOH F 6 .   ? 20.409 27.484 24.344  1.00 14.72 ? 301 HOH A O   1 
HETATM 1436 O  O   . HOH F 6 .   ? 5.739  37.587 3.069   1.00 15.43 ? 302 HOH A O   1 
HETATM 1437 O  O   . HOH F 6 .   ? 3.166  25.061 5.439   1.00 15.97 ? 303 HOH A O   1 
HETATM 1438 O  O   . HOH F 6 .   ? 5.461  25.477 7.053   1.00 16.19 ? 304 HOH A O   1 
HETATM 1439 O  O   . HOH F 6 .   ? 2.216  40.239 13.940  1.00 16.77 ? 305 HOH A O   1 
HETATM 1440 O  O   . HOH F 6 .   ? 7.555  24.876 5.294   1.00 17.06 ? 306 HOH A O   1 
HETATM 1441 O  O   . HOH F 6 .   ? 10.276 44.159 -5.081  1.00 18.18 ? 307 HOH A O   1 
HETATM 1442 O  O   . HOH F 6 .   ? 9.810  23.394 5.924   1.00 18.47 ? 308 HOH A O   1 
HETATM 1443 O  O   . HOH F 6 .   ? 14.213 42.854 -4.113  1.00 18.69 ? 309 HOH A O   1 
HETATM 1444 O  O   . HOH F 6 .   ? 18.931 24.576 1.075   1.00 19.28 ? 310 HOH A O   1 
HETATM 1445 O  O   . HOH F 6 .   ? 0.876  28.307 10.573  1.00 19.37 ? 311 HOH A O   1 
HETATM 1446 O  O   . HOH F 6 .   ? 5.771  37.333 35.614  1.00 20.00 ? 312 HOH A O   1 
HETATM 1447 O  O   . HOH F 6 .   ? 17.280 31.327 -0.153  1.00 21.14 ? 313 HOH A O   1 
HETATM 1448 O  O   . HOH F 6 .   ? 1.746  34.941 6.054   1.00 21.47 ? 314 HOH A O   1 
HETATM 1449 O  O   . HOH F 6 .   ? 6.805  36.584 -11.978 1.00 22.08 ? 315 HOH A O   1 
HETATM 1450 O  O   . HOH F 6 .   ? 2.306  34.110 17.210  1.00 22.27 ? 316 HOH A O   1 
HETATM 1451 O  O   . HOH F 6 .   ? 2.951  29.754 46.330  1.00 22.99 ? 317 HOH A O   1 
HETATM 1452 O  O   . HOH F 6 .   ? 3.116  39.837 25.059  1.00 23.38 ? 318 HOH A O   1 
HETATM 1453 O  O   . HOH F 6 .   ? 5.262  37.428 -14.162 1.00 23.53 ? 319 HOH A O   1 
HETATM 1454 O  O   . HOH F 6 .   ? 9.518  24.126 13.512  1.00 23.60 ? 320 HOH A O   1 
HETATM 1455 O  O   . HOH F 6 .   ? 1.661  34.078 -2.114  1.00 24.36 ? 321 HOH A O   1 
HETATM 1456 O  O   . HOH F 6 .   ? 7.991  25.833 20.690  1.00 24.99 ? 322 HOH A O   1 
HETATM 1457 O  O   . HOH F 6 .   ? 12.740 32.195 3.550   1.00 25.01 ? 323 HOH A O   1 
HETATM 1458 O  O   . HOH F 6 .   ? 19.499 46.350 -5.266  1.00 25.01 ? 324 HOH A O   1 
HETATM 1459 O  O   . HOH F 6 .   ? 15.514 34.598 6.059   1.00 25.14 ? 325 HOH A O   1 
HETATM 1460 O  O   . HOH F 6 .   ? 21.427 31.351 28.518  1.00 25.27 ? 326 HOH A O   1 
HETATM 1461 O  O   . HOH F 6 .   ? 13.595 33.011 25.466  1.00 25.34 ? 327 HOH A O   1 
HETATM 1462 O  O   . HOH F 6 .   ? 19.872 29.715 -3.056  1.00 25.43 ? 328 HOH A O   1 
HETATM 1463 O  O   . HOH F 6 .   ? 18.957 24.791 19.418  1.00 25.48 ? 329 HOH A O   1 
HETATM 1464 O  O   . HOH F 6 .   ? 17.647 50.088 4.645   1.00 25.98 ? 330 HOH A O   1 
HETATM 1465 O  O   . HOH F 6 .   ? 8.290  49.154 -14.524 1.00 25.99 ? 331 HOH A O   1 
HETATM 1466 O  O   . HOH F 6 .   ? 6.454  23.577 16.826  1.00 26.35 ? 332 HOH A O   1 
HETATM 1467 O  O   . HOH F 6 .   ? 17.775 25.391 16.957  1.00 26.50 ? 333 HOH A O   1 
HETATM 1468 O  O   . HOH F 6 .   ? 5.849  45.931 -19.692 1.00 26.65 ? 334 HOH A O   1 
HETATM 1469 O  O   . HOH F 6 .   ? 11.140 40.487 16.327  1.00 26.67 ? 335 HOH A O   1 
HETATM 1470 O  O   . HOH F 6 .   ? 13.110 39.892 18.702  1.00 26.91 ? 336 HOH A O   1 
HETATM 1471 O  O   . HOH F 6 .   ? 4.590  30.775 -7.754  1.00 27.23 ? 337 HOH A O   1 
HETATM 1472 O  O   . HOH F 6 .   ? -2.486 26.183 43.718  1.00 27.42 ? 338 HOH A O   1 
HETATM 1473 O  O   . HOH F 6 .   ? 13.114 22.275 16.150  1.00 27.85 ? 339 HOH A O   1 
HETATM 1474 O  O   . HOH F 6 .   ? 10.526 30.519 25.188  1.00 28.32 ? 340 HOH A O   1 
HETATM 1475 O  O   . HOH F 6 .   ? 15.537 22.023 -3.757  1.00 28.51 ? 341 HOH A O   1 
HETATM 1476 O  O   . HOH F 6 .   ? 16.686 41.320 14.575  1.00 28.64 ? 342 HOH A O   1 
HETATM 1477 O  O   . HOH F 6 .   ? 12.184 47.653 -11.779 1.00 28.65 ? 343 HOH A O   1 
HETATM 1478 O  O   . HOH F 6 .   ? 6.123  50.988 -14.780 1.00 28.69 ? 344 HOH A O   1 
HETATM 1479 O  O   . HOH F 6 .   ? 17.955 22.926 21.479  1.00 29.30 ? 345 HOH A O   1 
HETATM 1480 O  O   . HOH F 6 .   ? 19.112 27.945 16.045  1.00 29.62 ? 346 HOH A O   1 
HETATM 1481 O  O   . HOH F 6 .   ? 20.312 48.262 -8.947  1.00 29.99 ? 347 HOH A O   1 
HETATM 1482 O  O   . HOH F 6 .   ? 9.615  30.981 41.243  1.00 30.12 ? 348 HOH A O   1 
HETATM 1483 O  O   . HOH F 6 .   ? 19.368 36.093 2.865   1.00 30.18 ? 349 HOH A O   1 
HETATM 1484 O  O   . HOH F 6 .   ? 1.485  35.196 -7.305  1.00 30.24 ? 350 HOH A O   1 
HETATM 1485 O  O   . HOH F 6 .   ? 18.082 32.898 2.435   1.00 30.43 ? 351 HOH A O   1 
HETATM 1486 O  O   . HOH F 6 .   ? 3.092  35.249 10.743  1.00 30.61 ? 352 HOH A O   1 
HETATM 1487 O  O   . HOH F 6 .   ? 13.546 20.573 -5.858  1.00 30.79 ? 353 HOH A O   1 
HETATM 1488 O  O   . HOH F 6 .   ? 9.588  29.735 27.578  1.00 31.08 ? 354 HOH A O   1 
HETATM 1489 O  O   . HOH F 6 .   ? 0.019  28.071 47.135  1.00 31.53 ? 355 HOH A O   1 
HETATM 1490 O  O   . HOH F 6 .   ? 2.027  34.125 8.662   1.00 31.54 ? 356 HOH A O   1 
HETATM 1491 O  O   . HOH F 6 .   ? 22.352 48.153 9.223   1.00 31.87 ? 357 HOH A O   1 
HETATM 1492 O  O   . HOH F 6 .   ? 15.731 26.265 -10.617 1.00 32.37 ? 358 HOH A O   1 
HETATM 1493 O  O   . HOH F 6 .   ? 2.950  37.119 -20.369 1.00 32.64 ? 359 HOH A O   1 
HETATM 1494 O  O   . HOH F 6 .   ? 13.890 50.375 -4.618  1.00 32.70 ? 360 HOH A O   1 
HETATM 1495 O  O   . HOH F 6 .   ? 26.551 44.835 -4.049  1.00 33.06 ? 361 HOH A O   1 
HETATM 1496 O  O   . HOH F 6 .   ? 9.022  48.828 4.679   1.00 33.19 ? 362 HOH A O   1 
HETATM 1497 O  O   . HOH F 6 .   ? 22.355 26.217 5.985   1.00 33.19 ? 363 HOH A O   1 
HETATM 1498 O  O   . HOH F 6 .   ? 19.943 50.430 2.630   1.00 33.20 ? 364 HOH A O   1 
HETATM 1499 O  O   . HOH F 6 .   ? 2.643  33.382 19.450  1.00 33.36 ? 365 HOH A O   1 
HETATM 1500 O  O   . HOH F 6 .   ? 5.565  43.276 -19.177 1.00 33.51 ? 366 HOH A O   1 
HETATM 1501 O  O   . HOH F 6 .   ? 18.838 23.175 15.480  1.00 33.54 ? 367 HOH A O   1 
HETATM 1502 O  O   . HOH F 6 .   ? 5.981  24.960 37.643  1.00 33.64 ? 368 HOH A O   1 
HETATM 1503 O  O   . HOH F 6 .   ? 29.033 39.491 -0.868  1.00 33.82 ? 369 HOH A O   1 
HETATM 1504 O  O   . HOH F 6 .   ? 11.479 38.288 25.081  1.00 33.92 ? 370 HOH A O   1 
HETATM 1505 O  O   . HOH F 6 .   ? 8.211  42.550 -17.627 1.00 34.02 ? 371 HOH A O   1 
HETATM 1506 O  O   . HOH F 6 .   ? 10.879 37.788 22.626  1.00 34.29 ? 372 HOH A O   1 
HETATM 1507 O  O   . HOH F 6 .   ? 2.422  29.252 -12.184 1.00 34.36 ? 373 HOH A O   1 
HETATM 1508 O  O   . HOH F 6 .   ? 28.794 42.512 8.803   1.00 34.41 ? 374 HOH A O   1 
HETATM 1509 O  O   . HOH F 6 .   ? 13.068 21.567 20.100  1.00 34.44 ? 375 HOH A O   1 
HETATM 1510 O  O   . HOH F 6 .   ? 2.340  53.580 -17.331 1.00 34.96 ? 376 HOH A O   1 
HETATM 1511 O  O   . HOH F 6 .   ? 20.868 42.064 20.305  1.00 35.36 ? 377 HOH A O   1 
HETATM 1512 O  O   . HOH F 6 .   ? 8.855  38.865 -24.136 1.00 35.42 ? 378 HOH A O   1 
HETATM 1513 O  O   . HOH F 6 .   ? 1.294  17.098 41.714  1.00 35.50 ? 379 HOH A O   1 
HETATM 1514 O  O   . HOH F 6 .   ? 14.603 42.871 13.663  1.00 36.19 ? 380 HOH A O   1 
HETATM 1515 O  O   . HOH F 6 .   ? 8.838  41.907 17.941  1.00 36.91 ? 381 HOH A O   1 
HETATM 1516 O  O   . HOH F 6 .   ? -3.588 49.581 -19.324 1.00 36.95 ? 382 HOH A O   1 
HETATM 1517 O  O   . HOH F 6 .   ? 17.970 49.939 -2.395  1.00 37.26 ? 383 HOH A O   1 
HETATM 1518 O  O   . HOH F 6 .   ? 9.103  24.172 22.325  1.00 37.56 ? 384 HOH A O   1 
HETATM 1519 O  O   . HOH F 6 .   ? 32.155 41.680 5.903   1.00 37.61 ? 385 HOH A O   1 
HETATM 1520 O  O   . HOH F 6 .   ? 12.162 39.711 21.202  1.00 37.81 ? 386 HOH A O   1 
HETATM 1521 O  O   . HOH F 6 .   ? 10.875 47.904 10.917  1.00 37.91 ? 387 HOH A O   1 
HETATM 1522 O  O   . HOH F 6 .   ? 17.707 24.065 8.126   1.00 37.96 ? 388 HOH A O   1 
HETATM 1523 O  O   . HOH F 6 .   ? 13.150 22.703 4.328   1.00 38.25 ? 389 HOH A O   1 
HETATM 1524 O  O   . HOH F 6 .   ? 18.812 36.662 25.101  1.00 38.30 ? 390 HOH A O   1 
HETATM 1525 O  O   . HOH F 6 .   ? 4.697  25.601 31.539  1.00 38.55 ? 391 HOH A O   1 
HETATM 1526 O  O   . HOH F 6 .   ? 15.702 21.296 11.647  1.00 39.07 ? 392 HOH A O   1 
HETATM 1527 O  O   . HOH F 6 .   ? 1.294  25.846 21.283  1.00 39.19 ? 393 HOH A O   1 
HETATM 1528 O  O   . HOH F 6 .   ? 7.771  21.789 12.608  1.00 39.40 ? 394 HOH A O   1 
HETATM 1529 O  O   . HOH F 6 .   ? 9.975  51.116 5.511   1.00 39.73 ? 395 HOH A O   1 
HETATM 1530 O  O   . HOH F 6 .   ? 9.904  31.443 35.965  1.00 40.11 ? 396 HOH A O   1 
HETATM 1531 O  O   . HOH F 6 .   ? 17.709 42.669 -16.535 1.00 40.27 ? 397 HOH A O   1 
HETATM 1532 O  O   . HOH F 6 .   ? 5.515  28.850 47.253  1.00 40.44 ? 398 HOH A O   1 
HETATM 1533 O  O   . HOH F 6 .   ? 11.200 30.771 -2.394  1.00 40.47 ? 399 HOH A O   1 
HETATM 1534 O  O   . HOH F 6 .   ? 15.659 21.816 4.253   1.00 40.53 ? 400 HOH A O   1 
HETATM 1535 O  O   . HOH F 6 .   ? 6.088  25.041 19.059  1.00 40.72 ? 401 HOH A O   1 
HETATM 1536 O  O   . HOH F 6 .   ? 25.294 37.940 24.553  1.00 40.81 ? 402 HOH A O   1 
HETATM 1537 O  O   . HOH F 6 .   ? 15.657 33.064 -17.022 1.00 41.78 ? 403 HOH A O   1 
HETATM 1538 O  O   . HOH F 6 .   ? 21.004 48.485 -11.778 1.00 42.92 ? 404 HOH A O   1 
HETATM 1539 O  O   . HOH F 6 .   ? 11.421 20.718 3.949   1.00 42.98 ? 405 HOH A O   1 
HETATM 1540 O  O   . HOH F 6 .   ? 13.934 29.527 -3.216  1.00 43.39 ? 406 HOH A O   1 
HETATM 1541 O  O   . HOH F 6 .   ? 19.409 42.838 -14.466 1.00 44.36 ? 407 HOH A O   1 
HETATM 1542 O  O   . HOH F 6 .   ? 13.465 38.179 26.777  1.00 44.85 ? 408 HOH A O   1 
HETATM 1543 O  O   . HOH F 6 .   ? 22.991 42.350 12.595  1.00 44.87 ? 409 HOH A O   1 
HETATM 1544 O  O   . HOH F 6 .   ? 11.544 42.473 14.104  1.00 45.43 ? 410 HOH A O   1 
HETATM 1545 O  O   . HOH F 6 .   ? 9.825  47.769 2.220   1.00 45.89 ? 411 HOH A O   1 
HETATM 1546 O  O   . HOH F 6 .   ? 18.846 48.980 -4.938  1.00 46.04 ? 412 HOH A O   1 
HETATM 1547 O  O   . HOH F 6 .   ? 3.877  21.423 13.071  1.00 46.29 ? 413 HOH A O   1 
HETATM 1548 O  O   . HOH F 6 .   ? -2.127 16.573 45.241  1.00 47.16 ? 414 HOH A O   1 
HETATM 1549 O  O   . HOH F 6 .   ? 23.172 43.856 -10.771 1.00 48.82 ? 415 HOH A O   1 
HETATM 1550 O  O   . HOH F 6 .   ? 14.008 17.992 -4.505  1.00 49.14 ? 416 HOH A O   1 
HETATM 1551 O  O   . HOH F 6 .   ? 0.479  25.801 48.812  1.00 52.20 ? 417 HOH A O   1 
HETATM 1552 O  O   . HOH F 6 .   ? 8.201  49.999 2.250   1.00 53.24 ? 418 HOH A O   1 
HETATM 1553 O  O   . HOH F 6 .   ? 23.599 42.239 20.825  1.00 55.03 ? 419 HOH A O   1 
HETATM 1554 O  O   . HOH F 6 .   ? 20.708 40.685 -12.583 1.00 56.99 ? 420 HOH A O   1 
HETATM 1555 O  O   . HOH F 6 .   ? 0.001  34.008 -9.148  0.33 25.01 ? 421 HOH A O   1 
HETATM 1556 O  O   . HOH F 6 .   ? 0.001  34.008 20.677  0.33 40.34 ? 422 HOH A O   1 
HETATM 1557 O  O   A HOH F 6 .   ? 15.158 35.945 27.215  0.50 30.27 ? 423 HOH A O   1 
HETATM 1558 O  O   B HOH F 6 .   ? 16.239 37.121 26.872  0.50 38.28 ? 423 HOH A O   1 
HETATM 1559 O  O   B HOH F 6 .   ? 22.382 27.603 13.067  0.50 36.57 ? 424 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . GLY A 19  ? 0.4695 0.4720 0.3481 0.0025  0.0060  0.0789  0   GLY A N   
2    C  CA  . GLY A 19  ? 0.4583 0.4669 0.3400 0.0051  0.0102  0.0739  0   GLY A CA  
3    C  C   . GLY A 19  ? 0.4235 0.4283 0.3037 0.0086  0.0066  0.0667  0   GLY A C   
4    O  O   . GLY A 19  ? 0.4382 0.4367 0.3144 0.0092  0.0013  0.0657  0   GLY A O   
5    N  N   . MSE A 20  ? 0.3922 0.4008 0.2759 0.0108  0.0095  0.0620  1   MSE A N   
6    C  CA  . MSE A 20  ? 0.3684 0.3738 0.2519 0.0136  0.0065  0.0550  1   MSE A CA  
7    C  C   . MSE A 20  ? 0.3719 0.3790 0.2460 0.0173  0.0099  0.0519  1   MSE A C   
8    O  O   . MSE A 20  ? 0.3929 0.4061 0.2660 0.0181  0.0158  0.0535  1   MSE A O   
9    C  CB  . MSE A 20  ? 0.3782 0.3854 0.2740 0.0130  0.0065  0.0519  1   MSE A CB  
10   C  CG  . MSE A 20  ? 0.3925 0.3959 0.2965 0.0103  0.0018  0.0531  1   MSE A CG  
11   SE SE  . MSE A 20  ? 0.4078 0.4145 0.3262 0.0093  0.0030  0.0500  1   MSE A SE  
12   C  CE  . MSE A 20  ? 0.3430 0.3460 0.2595 0.0126  -0.0001 0.0420  1   MSE A CE  
13   N  N   . THR A 21  ? 0.3208 0.3228 0.1879 0.0196  0.0063  0.0475  2   THR A N   
14   C  CA  . THR A 21  ? 0.3025 0.3047 0.1602 0.0233  0.0088  0.0436  2   THR A CA  
15   C  C   . THR A 21  ? 0.2782 0.2821 0.1428 0.0249  0.0106  0.0385  2   THR A C   
16   O  O   . THR A 21  ? 0.2648 0.2689 0.1403 0.0232  0.0089  0.0374  2   THR A O   
17   C  CB  . THR A 21  ? 0.3200 0.3154 0.1682 0.0249  0.0034  0.0401  2   THR A CB  
18   O  OG1 . THR A 21  ? 0.3126 0.3047 0.1690 0.0240  -0.0017 0.0362  2   THR A OG1 
19   C  CG2 . THR A 21  ? 0.3516 0.3444 0.1918 0.0238  0.0009  0.0449  2   THR A CG2 
20   N  N   . LEU A 22  ? 0.2962 0.3006 0.1534 0.0286  0.0137  0.0350  3   LEU A N   
21   C  CA  . LEU A 22  ? 0.3082 0.3128 0.1706 0.0304  0.0148  0.0299  3   LEU A CA  
22   C  C   . LEU A 22  ? 0.2712 0.2699 0.1380 0.0294  0.0088  0.0255  3   LEU A C   
23   O  O   . LEU A 22  ? 0.2800 0.2796 0.1566 0.0286  0.0087  0.0236  3   LEU A O   
24   C  CB  . LEU A 22  ? 0.3271 0.3315 0.1794 0.0350  0.0185  0.0263  3   LEU A CB  
25   C  CG  . LEU A 22  ? 0.3577 0.3694 0.2061 0.0370  0.0256  0.0299  3   LEU A CG  
26   C  CD1 . LEU A 22  ? 0.3818 0.3926 0.2223 0.0423  0.0288  0.0249  3   LEU A CD1 
27   C  CD2 . LEU A 22  ? 0.3662 0.3861 0.2273 0.0348  0.0294  0.0341  3   LEU A CD2 
28   N  N   . GLU A 23  ? 0.2941 0.2872 0.1536 0.0294  0.0039  0.0240  4   GLU A N   
29   C  CA  . GLU A 23  ? 0.2814 0.2699 0.1455 0.0281  -0.0019 0.0202  4   GLU A CA  
30   C  C   . GLU A 23  ? 0.2634 0.2538 0.1403 0.0248  -0.0039 0.0226  4   GLU A C   
31   O  O   . GLU A 23  ? 0.2635 0.2531 0.1486 0.0240  -0.0056 0.0196  4   GLU A O   
32   C  CB  . GLU A 23  ? 0.3102 0.2934 0.1650 0.0283  -0.0073 0.0188  4   GLU A CB  
33   C  CG  . GLU A 23  ? 0.3505 0.3299 0.2106 0.0270  -0.0131 0.0146  4   GLU A CG  
34   C  CD  . GLU A 23  ? 0.4641 0.4385 0.3149 0.0275  -0.0186 0.0122  4   GLU A CD  
35   O  OE1 . GLU A 23  ? 0.4890 0.4623 0.3295 0.0286  -0.0188 0.0145  4   GLU A OE1 
36   O  OE2 . GLU A 23  ? 0.5718 0.5433 0.4257 0.0267  -0.0227 0.0080  4   GLU A OE2 
37   N  N   . ALA A 24  ? 0.2656 0.2579 0.1440 0.0230  -0.0038 0.0280  5   ALA A N   
38   C  CA  . ALA A 24  ? 0.2654 0.2589 0.1555 0.0201  -0.0055 0.0302  5   ALA A CA  
39   C  C   . ALA A 24  ? 0.2584 0.2559 0.1581 0.0196  -0.0018 0.0297  5   ALA A C   
40   O  O   . ALA A 24  ? 0.2610 0.2583 0.1700 0.0181  -0.0037 0.0284  5   ALA A O   
41   C  CB  . ALA A 24  ? 0.2920 0.2861 0.1812 0.0182  -0.0057 0.0363  5   ALA A CB  
42   N  N   . ARG A 25  ? 0.2584 0.2600 0.1558 0.0209  0.0036  0.0307  6   ARG A N   
43   C  CA  . ARG A 25  ? 0.2483 0.2542 0.1543 0.0207  0.0071  0.0305  6   ARG A CA  
44   C  C   . ARG A 25  ? 0.2368 0.2403 0.1453 0.0222  0.0061  0.0248  6   ARG A C   
45   O  O   . ARG A 25  ? 0.2373 0.2421 0.1550 0.0211  0.0062  0.0240  6   ARG A O   
46   C  CB  . ARG A 25  ? 0.2699 0.2816 0.1728 0.0220  0.0131  0.0334  6   ARG A CB  
47   C  CG  . ARG A 25  ? 0.2668 0.2814 0.1694 0.0194  0.0142  0.0399  6   ARG A CG  
48   C  CD  . ARG A 25  ? 0.2908 0.3115 0.1884 0.0209  0.0202  0.0428  6   ARG A CD  
49   N  NE  . ARG A 25  ? 0.2841 0.3114 0.1893 0.0215  0.0246  0.0429  6   ARG A NE  
50   C  CZ  . ARG A 25  ? 0.2795 0.3139 0.1827 0.0231  0.0304  0.0451  6   ARG A CZ  
51   N  NH1 . ARG A 25  ? 0.2917 0.3273 0.1847 0.0244  0.0329  0.0473  6   ARG A NH1 
52   N  NH2 . ARG A 25  ? 0.2996 0.3403 0.2110 0.0236  0.0337  0.0451  6   ARG A NH2 
53   N  N   . ILE A 26  ? 0.2375 0.2371 0.1375 0.0246  0.0049  0.0209  7   ILE A N   
54   C  CA  . ILE A 26  ? 0.2371 0.2330 0.1384 0.0255  0.0031  0.0155  7   ILE A CA  
55   C  C   . ILE A 26  ? 0.2306 0.2240 0.1392 0.0228  -0.0018 0.0143  7   ILE A C   
56   O  O   . ILE A 26  ? 0.2308 0.2243 0.1468 0.0221  -0.0020 0.0122  7   ILE A O   
57   C  CB  . ILE A 26  ? 0.2541 0.2453 0.1437 0.0284  0.0023  0.0116  7   ILE A CB  
58   C  CG1 . ILE A 26  ? 0.2736 0.2676 0.1571 0.0318  0.0079  0.0118  7   ILE A CG1 
59   C  CG2 . ILE A 26  ? 0.2721 0.2582 0.1628 0.0285  -0.0007 0.0063  7   ILE A CG2 
60   C  CD1 . ILE A 26  ? 0.2958 0.2854 0.1657 0.0349  0.0076  0.0089  7   ILE A CD1 
61   N  N   . GLU A 27  ? 0.2467 0.2385 0.1535 0.0215  -0.0056 0.0158  8   GLU A N   
62   C  CA  . GLU A 27  ? 0.2809 0.2714 0.1951 0.0193  -0.0101 0.0152  8   GLU A CA  
63   C  C   . GLU A 27  ? 0.2603 0.2539 0.1853 0.0176  -0.0087 0.0170  8   GLU A C   
64   O  O   . GLU A 27  ? 0.2785 0.2717 0.2105 0.0165  -0.0104 0.0148  8   GLU A O   
65   C  CB  . GLU A 27  ? 0.2896 0.2785 0.2005 0.0186  -0.0140 0.0175  8   GLU A CB  
66   C  CG  . GLU A 27  ? 0.3455 0.3307 0.2479 0.0197  -0.0177 0.0147  8   GLU A CG  
67   C  CD  . GLU A 27  ? 0.3912 0.3751 0.2912 0.0190  -0.0221 0.0173  8   GLU A CD  
68   O  OE1 . GLU A 27  ? 0.4282 0.4136 0.3327 0.0179  -0.0221 0.0214  8   GLU A OE1 
69   O  OE2 . GLU A 27  ? 0.4548 0.4358 0.3480 0.0198  -0.0257 0.0152  8   GLU A OE2 
70   N  N   . ALA A 28  ? 0.2437 0.2405 0.1700 0.0170  -0.0056 0.0213  9   ALA A N   
71   C  CA  . ALA A 28  ? 0.2658 0.2652 0.2015 0.0152  -0.0045 0.0231  9   ALA A CA  
72   C  C   . ALA A 28  ? 0.2622 0.2630 0.2024 0.0159  -0.0020 0.0203  9   ALA A C   
73   O  O   . ALA A 28  ? 0.2550 0.2558 0.2027 0.0146  -0.0031 0.0192  9   ALA A O   
74   C  CB  . ALA A 28  ? 0.2743 0.2768 0.2100 0.0142  -0.0018 0.0283  9   ALA A CB  
75   N  N   . LEU A 29  ? 0.2171 0.2188 0.1522 0.0181  0.0011  0.0190  10  LEU A N   
76   C  CA  . LEU A 29  ? 0.2243 0.2269 0.1629 0.0192  0.0034  0.0164  10  LEU A CA  
77   C  C   . LEU A 29  ? 0.2297 0.2282 0.1701 0.0189  0.0003  0.0120  10  LEU A C   
78   O  O   . LEU A 29  ? 0.2284 0.2273 0.1750 0.0183  0.0007  0.0108  10  LEU A O   
79   C  CB  . LEU A 29  ? 0.2382 0.2421 0.1701 0.0223  0.0072  0.0156  10  LEU A CB  
80   C  CG  . LEU A 29  ? 0.2352 0.2452 0.1673 0.0227  0.0115  0.0200  10  LEU A CG  
81   C  CD1 . LEU A 29  ? 0.2520 0.2629 0.1752 0.0263  0.0149  0.0190  10  LEU A CD1 
82   C  CD2 . LEU A 29  ? 0.2621 0.2765 0.2034 0.0218  0.0136  0.0213  10  LEU A CD2 
83   N  N   . GLU A 30  ? 0.2452 0.2398 0.1797 0.0192  -0.0027 0.0099  11  GLU A N   
84   C  CA  . GLU A 30  ? 0.2639 0.2548 0.1999 0.0184  -0.0061 0.0060  11  GLU A CA  
85   C  C   . GLU A 30  ? 0.2546 0.2469 0.2001 0.0159  -0.0082 0.0066  11  GLU A C   
86   O  O   . GLU A 30  ? 0.2713 0.2630 0.2216 0.0151  -0.0083 0.0045  11  GLU A O   
87   C  CB  . GLU A 30  ? 0.2615 0.2487 0.1897 0.0189  -0.0095 0.0040  11  GLU A CB  
88   C  CG  . GLU A 30  ? 0.2632 0.2477 0.1814 0.0216  -0.0077 0.0020  11  GLU A CG  
89   C  CD  . GLU A 30  ? 0.2881 0.2689 0.1971 0.0222  -0.0110 0.0005  11  GLU A CD  
90   O  OE1 . GLU A 30  ? 0.3275 0.3090 0.2367 0.0209  -0.0140 0.0025  11  GLU A OE1 
91   O  OE2 . GLU A 30  ? 0.2978 0.2745 0.1987 0.0242  -0.0108 -0.0025 11  GLU A OE2 
92   N  N   . LYS A 31  ? 0.2657 0.2597 0.2136 0.0149  -0.0094 0.0096  12  LYS A N   
93   C  CA  . LYS A 31  ? 0.2609 0.2561 0.2173 0.0131  -0.0112 0.0103  12  LYS A CA  
94   C  C   . LYS A 31  ? 0.2538 0.2512 0.2165 0.0125  -0.0082 0.0110  12  LYS A C   
95   O  O   . LYS A 31  ? 0.2426 0.2399 0.2109 0.0116  -0.0089 0.0092  12  LYS A O   
96   C  CB  . LYS A 31  ? 0.2760 0.2715 0.2324 0.0125  -0.0132 0.0136  12  LYS A CB  
97   C  CG  . LYS A 31  ? 0.3812 0.3746 0.3324 0.0130  -0.0170 0.0129  12  LYS A CG  
98   N  N   . GLU A 32  ? 0.2416 0.2411 0.2030 0.0131  -0.0050 0.0135  13  GLU A N   
99   C  CA  . GLU A 32  ? 0.2410 0.2431 0.2082 0.0126  -0.0024 0.0144  13  GLU A CA  
100  C  C   . GLU A 32  ? 0.2242 0.2254 0.1923 0.0134  -0.0012 0.0112  13  GLU A C   
101  O  O   . GLU A 32  ? 0.2397 0.2413 0.2134 0.0125  -0.0011 0.0106  13  GLU A O   
102  C  CB  . GLU A 32  ? 0.2826 0.2883 0.2486 0.0130  0.0008  0.0179  13  GLU A CB  
103  C  CG  . GLU A 32  ? 0.3353 0.3418 0.3011 0.0115  0.0000  0.0219  13  GLU A CG  
104  C  CD  . GLU A 32  ? 0.4759 0.4813 0.4481 0.0094  -0.0024 0.0227  13  GLU A CD  
105  O  OE1 . GLU A 32  ? 0.4992 0.5061 0.4771 0.0086  -0.0015 0.0226  13  GLU A OE1 
106  O  OE2 . GLU A 32  ? 0.5969 0.5999 0.5683 0.0089  -0.0054 0.0233  13  GLU A OE2 
107  N  N   . ILE A 33  ? 0.2329 0.2321 0.1947 0.0153  -0.0005 0.0091  14  ILE A N   
108  C  CA  . ILE A 33  ? 0.2717 0.2690 0.2335 0.0163  0.0003  0.0061  14  ILE A CA  
109  C  C   . ILE A 33  ? 0.2606 0.2550 0.2254 0.0145  -0.0026 0.0035  14  ILE A C   
110  O  O   . ILE A 33  ? 0.2621 0.2558 0.2304 0.0140  -0.0021 0.0023  14  ILE A O   
111  C  CB  . ILE A 33  ? 0.3300 0.3250 0.2836 0.0191  0.0017  0.0042  14  ILE A CB  
112  C  CG1 . ILE A 33  ? 0.4877 0.4809 0.4415 0.0206  0.0035  0.0021  14  ILE A CG1 
113  C  CG2 . ILE A 33  ? 0.4204 0.4109 0.3681 0.0189  -0.0013 0.0017  14  ILE A CG2 
114  C  CD1 . ILE A 33  ? 0.5806 0.5787 0.5379 0.0220  0.0071  0.0045  14  ILE A CD1 
115  N  N   . GLN A 34  ? 0.2600 0.2532 0.2236 0.0135  -0.0057 0.0029  15  GLN A N   
116  C  CA  . GLN A 34  ? 0.2841 0.2758 0.2513 0.0116  -0.0084 0.0008  15  GLN A CA  
117  C  C   . GLN A 34  ? 0.2449 0.2393 0.2201 0.0102  -0.0080 0.0019  15  GLN A C   
118  O  O   . GLN A 34  ? 0.2424 0.2362 0.2212 0.0091  -0.0082 0.0003  15  GLN A O   
119  C  CB  . GLN A 34  ? 0.2914 0.2826 0.2570 0.0109  -0.0121 0.0002  15  GLN A CB  
120  C  CG  . GLN A 34  ? 0.3201 0.3110 0.2902 0.0089  -0.0149 -0.0019 15  GLN A CG  
121  C  CD  . GLN A 34  ? 0.3702 0.3574 0.3378 0.0084  -0.0147 -0.0048 15  GLN A CD  
122  O  OE1 . GLN A 34  ? 0.4840 0.4679 0.4448 0.0092  -0.0157 -0.0064 15  GLN A OE1 
123  N  NE2 . GLN A 34  ? 0.3551 0.3426 0.3278 0.0071  -0.0137 -0.0055 15  GLN A NE2 
124  N  N   . ARG A 35  ? 0.2441 0.2409 0.2216 0.0102  -0.0075 0.0047  16  ARG A N   
125  C  CA  . ARG A 35  ? 0.2245 0.2231 0.2087 0.0090  -0.0073 0.0057  16  ARG A CA  
126  C  C   . ARG A 35  ? 0.2021 0.2009 0.1882 0.0091  -0.0048 0.0053  16  ARG A C   
127  O  O   . ARG A 35  ? 0.1926 0.1914 0.1828 0.0081  -0.0049 0.0041  16  ARG A O   
128  C  CB  . ARG A 35  ? 0.2260 0.2261 0.2114 0.0089  -0.0074 0.0089  16  ARG A CB  
129  C  CG  . ARG A 35  ? 0.2873 0.2884 0.2786 0.0079  -0.0072 0.0098  16  ARG A CG  
130  C  CD  . ARG A 35  ? 0.3442 0.3457 0.3365 0.0074  -0.0078 0.0129  16  ARG A CD  
131  N  NE  . ARG A 35  ? 0.4482 0.4502 0.4452 0.0064  -0.0072 0.0136  16  ARG A NE  
132  C  CZ  . ARG A 35  ? 0.5578 0.5614 0.5559 0.0060  -0.0051 0.0151  16  ARG A CZ  
133  N  NH1 . ARG A 35  ? 0.4760 0.4814 0.4712 0.0066  -0.0029 0.0162  16  ARG A NH1 
134  N  NH2 . ARG A 35  ? 0.6193 0.6228 0.6213 0.0049  -0.0054 0.0154  16  ARG A NH2 
135  N  N   . LEU A 36  ? 0.1909 0.1903 0.1740 0.0105  -0.0024 0.0063  17  LEU A N   
136  C  CA  . LEU A 36  ? 0.2002 0.2001 0.1852 0.0110  -0.0002 0.0060  17  LEU A CA  
137  C  C   . LEU A 36  ? 0.1991 0.1957 0.1829 0.0111  -0.0005 0.0031  17  LEU A C   
138  O  O   . LEU A 36  ? 0.2020 0.1983 0.1889 0.0105  0.0000  0.0027  17  LEU A O   
139  C  CB  . LEU A 36  ? 0.2379 0.2398 0.2202 0.0129  0.0023  0.0076  17  LEU A CB  
140  C  CG  . LEU A 36  ? 0.2599 0.2656 0.2446 0.0122  0.0031  0.0112  17  LEU A CG  
141  C  CD1 . LEU A 36  ? 0.3197 0.3283 0.3012 0.0142  0.0059  0.0127  17  LEU A CD1 
142  C  CD2 . LEU A 36  ? 0.2757 0.2833 0.2665 0.0107  0.0030  0.0124  17  LEU A CD2 
143  N  N   . ASN A 37  ? 0.2008 0.1945 0.1797 0.0116  -0.0016 0.0012  18  ASN A N   
144  C  CA  . ASN A 37  ? 0.2068 0.1966 0.1844 0.0110  -0.0025 -0.0014 18  ASN A CA  
145  C  C   . ASN A 37  ? 0.1854 0.1756 0.1682 0.0084  -0.0041 -0.0020 18  ASN A C   
146  O  O   . ASN A 37  ? 0.1963 0.1848 0.1806 0.0076  -0.0037 -0.0030 18  ASN A O   
147  C  CB  . ASN A 37  ? 0.2204 0.2067 0.1918 0.0116  -0.0041 -0.0034 18  ASN A CB  
148  C  CG  . ASN A 37  ? 0.2833 0.2674 0.2483 0.0145  -0.0021 -0.0040 18  ASN A CG  
149  O  OD1 . ASN A 37  ? 0.3154 0.3002 0.2812 0.0161  0.0002  -0.0033 18  ASN A OD1 
150  N  ND2 . ASN A 37  ? 0.3091 0.2906 0.2676 0.0155  -0.0033 -0.0054 18  ASN A ND2 
151  N  N   . ASP A 38  ? 0.1912 0.1839 0.1767 0.0074  -0.0059 -0.0014 19  ASP A N   
152  C  CA  . ASP A 38  ? 0.1946 0.1888 0.1855 0.0054  -0.0071 -0.0020 19  ASP A CA  
153  C  C   . ASP A 38  ? 0.1820 0.1778 0.1772 0.0052  -0.0053 -0.0009 19  ASP A C   
154  O  O   . ASP A 38  ? 0.1856 0.1812 0.1833 0.0038  -0.0051 -0.0019 19  ASP A O   
155  C  CB  . ASP A 38  ? 0.1896 0.1862 0.1825 0.0052  -0.0093 -0.0014 19  ASP A CB  
156  C  CG  . ASP A 38  ? 0.2153 0.2106 0.2051 0.0048  -0.0119 -0.0029 19  ASP A CG  
157  O  OD1 . ASP A 38  ? 0.2336 0.2265 0.2215 0.0039  -0.0124 -0.0048 19  ASP A OD1 
158  O  OD2 . ASP A 38  ? 0.2607 0.2573 0.2499 0.0054  -0.0136 -0.0020 19  ASP A OD2 
159  N  N   . ILE A 39  ? 0.1790 0.1762 0.1744 0.0062  -0.0041 0.0010  20  ILE A N   
160  C  CA  . ILE A 39  ? 0.1711 0.1694 0.1699 0.0059  -0.0029 0.0019  20  ILE A CA  
161  C  C   . ILE A 39  ? 0.1737 0.1700 0.1714 0.0060  -0.0014 0.0011  20  ILE A C   
162  O  O   . ILE A 39  ? 0.1663 0.1626 0.1665 0.0050  -0.0011 0.0007  20  ILE A O   
163  C  CB  . ILE A 39  ? 0.1894 0.1896 0.1887 0.0067  -0.0022 0.0044  20  ILE A CB  
164  C  CG1 . ILE A 39  ? 0.1997 0.2009 0.2006 0.0063  -0.0039 0.0054  20  ILE A CG1 
165  C  CG2 . ILE A 39  ? 0.1805 0.1815 0.1824 0.0064  -0.0010 0.0052  20  ILE A CG2 
166  C  CD1 . ILE A 39  ? 0.2088 0.2113 0.2095 0.0065  -0.0035 0.0082  20  ILE A CD1 
167  N  N   . GLU A 40  ? 0.1757 0.1703 0.1694 0.0075  -0.0006 0.0009  21  GLU A N   
168  C  CA  . GLU A 40  ? 0.1969 0.1888 0.1891 0.0080  0.0005  0.0001  21  GLU A CA  
169  C  C   . GLU A 40  ? 0.1804 0.1692 0.1724 0.0061  -0.0004 -0.0016 21  GLU A C   
170  O  O   . GLU A 40  ? 0.1984 0.1858 0.1912 0.0055  0.0001  -0.0017 21  GLU A O   
171  C  CB  . GLU A 40  ? 0.2047 0.1950 0.1922 0.0105  0.0016  0.0000  21  GLU A CB  
172  C  CG  . GLU A 40  ? 0.2215 0.2083 0.2071 0.0116  0.0025  -0.0007 21  GLU A CG  
173  C  CD  . GLU A 40  ? 0.2281 0.2170 0.2172 0.0118  0.0035  0.0008  21  GLU A CD  
174  O  OE1 . GLU A 40  ? 0.2229 0.2160 0.2155 0.0114  0.0038  0.0026  21  GLU A OE1 
175  O  OE2 . GLU A 40  ? 0.2387 0.2243 0.2265 0.0123  0.0038  0.0003  21  GLU A OE2 
176  N  N   . ALA A 41  ? 0.1947 0.1827 0.1856 0.0051  -0.0021 -0.0030 22  ALA A N   
177  C  CA  . ALA A 41  ? 0.2091 0.1949 0.2005 0.0027  -0.0032 -0.0045 22  ALA A CA  
178  C  C   . ALA A 41  ? 0.1840 0.1729 0.1807 0.0009  -0.0029 -0.0040 22  ALA A C   
179  O  O   . ALA A 41  ? 0.1769 0.1641 0.1741 -0.0006 -0.0024 -0.0044 22  ALA A O   
180  C  CB  . ALA A 41  ? 0.2191 0.2049 0.2093 0.0019  -0.0055 -0.0058 22  ALA A CB  
181  N  N   . ILE A 42  ? 0.1579 0.1508 0.1579 0.0013  -0.0030 -0.0031 23  ILE A N   
182  C  CA  . ILE A 42  ? 0.1754 0.1712 0.1799 0.0003  -0.0026 -0.0029 23  ILE A CA  
183  C  C   . ILE A 42  ? 0.1913 0.1861 0.1956 0.0005  -0.0008 -0.0021 23  ILE A C   
184  O  O   . ILE A 42  ? 0.1823 0.1774 0.1882 -0.0008 -0.0001 -0.0023 23  ILE A O   
185  C  CB  . ILE A 42  ? 0.1773 0.1766 0.1848 0.0011  -0.0035 -0.0023 23  ILE A CB  
186  C  CG1 . ILE A 42  ? 0.1884 0.1892 0.1969 0.0005  -0.0056 -0.0032 23  ILE A CG1 
187  C  CG2 . ILE A 42  ? 0.1659 0.1674 0.1771 0.0008  -0.0028 -0.0022 23  ILE A CG2 
188  C  CD1 . ILE A 42  ? 0.1802 0.1831 0.1901 0.0018  -0.0070 -0.0024 23  ILE A CD1 
189  N  N   . LYS A 43  ? 0.1754 0.1694 0.1779 0.0022  -0.0002 -0.0009 24  LYS A N   
190  C  CA  . LYS A 43  ? 0.1775 0.1706 0.1797 0.0026  0.0010  -0.0001 24  LYS A CA  
191  C  C   . LYS A 43  ? 0.1750 0.1644 0.1748 0.0017  0.0015  -0.0007 24  LYS A C   
192  O  O   . LYS A 43  ? 0.1914 0.1801 0.1915 0.0009  0.0022  -0.0003 24  LYS A O   
193  C  CB  . LYS A 43  ? 0.2039 0.1975 0.2051 0.0045  0.0014  0.0012  24  LYS A CB  
194  C  CG  . LYS A 43  ? 0.2037 0.2004 0.2072 0.0048  0.0009  0.0024  24  LYS A CG  
195  C  CD  . LYS A 43  ? 0.2061 0.2041 0.2090 0.0063  0.0016  0.0040  24  LYS A CD  
196  C  CE  . LYS A 43  ? 0.2315 0.2322 0.2367 0.0061  0.0009  0.0056  24  LYS A CE  
197  N  NZ  . LYS A 43  ? 0.2413 0.2441 0.2462 0.0073  0.0019  0.0075  24  LYS A NZ  
198  N  N   . GLN A 44  ? 0.1825 0.1688 0.1793 0.0019  0.0010  -0.0016 25  GLN A N   
199  C  CA  . GLN A 44  ? 0.1781 0.1595 0.1721 0.0009  0.0011  -0.0021 25  GLN A CA  
200  C  C   . GLN A 44  ? 0.1867 0.1684 0.1826 -0.0022 0.0009  -0.0027 25  GLN A C   
201  O  O   . GLN A 44  ? 0.1909 0.1697 0.1857 -0.0036 0.0015  -0.0023 25  GLN A O   
202  C  CB  . GLN A 44  ? 0.1935 0.1707 0.1831 0.0022  0.0005  -0.0032 25  GLN A CB  
203  C  CG  . GLN A 44  ? 0.2055 0.1828 0.1930 0.0056  0.0013  -0.0025 25  GLN A CG  
204  C  CD  . GLN A 44  ? 0.2214 0.1932 0.2037 0.0077  0.0013  -0.0036 25  GLN A CD  
205  O  OE1 . GLN A 44  ? 0.2472 0.2135 0.2268 0.0065  0.0006  -0.0045 25  GLN A OE1 
206  N  NE2 . GLN A 44  ? 0.2388 0.2120 0.2195 0.0108  0.0021  -0.0033 25  GLN A NE2 
207  N  N   . LEU A 45  ? 0.1815 0.1669 0.1805 -0.0033 0.0000  -0.0034 26  LEU A N   
208  C  CA  . LEU A 45  ? 0.1738 0.1616 0.1761 -0.0061 0.0000  -0.0038 26  LEU A CA  
209  C  C   . LEU A 45  ? 0.1775 0.1675 0.1819 -0.0065 0.0016  -0.0029 26  LEU A C   
210  O  O   . LEU A 45  ? 0.1890 0.1785 0.1937 -0.0088 0.0025  -0.0026 26  LEU A O   
211  C  CB  . LEU A 45  ? 0.1748 0.1671 0.1806 -0.0063 -0.0015 -0.0046 26  LEU A CB  
212  C  CG  . LEU A 45  ? 0.1722 0.1694 0.1831 -0.0086 -0.0014 -0.0049 26  LEU A CG  
213  C  CD1 . LEU A 45  ? 0.1958 0.1912 0.2066 -0.0119 -0.0020 -0.0054 26  LEU A CD1 
214  C  CD2 . LEU A 45  ? 0.1650 0.1667 0.1793 -0.0076 -0.0031 -0.0055 26  LEU A CD2 
215  N  N   . LYS A 46  ? 0.1776 0.1703 0.1833 -0.0046 0.0020  -0.0024 27  LYS A N   
216  C  CA  . LYS A 46  ? 0.1786 0.1730 0.1854 -0.0047 0.0034  -0.0018 27  LYS A CA  
217  C  C   . LYS A 46  ? 0.1703 0.1605 0.1734 -0.0048 0.0044  -0.0008 27  LYS A C   
218  O  O   . LYS A 46  ? 0.1890 0.1794 0.1919 -0.0061 0.0056  -0.0004 27  LYS A O   
219  C  CB  . LYS A 46  ? 0.2123 0.2091 0.2206 -0.0026 0.0031  -0.0017 27  LYS A CB  
220  C  CG  . LYS A 46  ? 0.2549 0.2534 0.2642 -0.0027 0.0043  -0.0016 27  LYS A CG  
221  C  CD  . LYS A 46  ? 0.2680 0.2705 0.2807 -0.0038 0.0050  -0.0026 27  LYS A CD  
222  C  CE  . LYS A 46  ? 0.3030 0.3074 0.3164 -0.0030 0.0061  -0.0030 27  LYS A CE  
223  N  NZ  . LYS A 46  ? 0.3205 0.3297 0.3378 -0.0030 0.0068  -0.0041 27  LYS A NZ  
224  N  N   . ALA A 47  ? 0.1766 0.1633 0.1767 -0.0033 0.0038  -0.0004 28  ALA A N   
225  C  CA  . ALA A 47  ? 0.1866 0.1689 0.1832 -0.0030 0.0044  0.0005  28  ALA A CA  
226  C  C   . ALA A 47  ? 0.2019 0.1809 0.1968 -0.0057 0.0047  0.0005  28  ALA A C   
227  O  O   . ALA A 47  ? 0.1846 0.1618 0.1777 -0.0066 0.0056  0.0016  28  ALA A O   
228  C  CB  . ALA A 47  ? 0.1794 0.1591 0.1735 -0.0005 0.0037  0.0007  28  ALA A CB  
229  N  N   . LYS A 48  ? 0.2045 0.1825 0.1997 -0.0071 0.0038  -0.0004 29  LYS A N   
230  C  CA  . LYS A 48  ? 0.2126 0.1874 0.2067 -0.0103 0.0038  -0.0003 29  LYS A CA  
231  C  C   . LYS A 48  ? 0.2165 0.1957 0.2138 -0.0129 0.0053  0.0002  29  LYS A C   
232  O  O   . LYS A 48  ? 0.1941 0.1708 0.1897 -0.0152 0.0062  0.0013  29  LYS A O   
233  C  CB  . LYS A 48  ? 0.1964 0.1699 0.1907 -0.0114 0.0020  -0.0017 29  LYS A CB  
234  C  CG  . LYS A 48  ? 0.2297 0.1999 0.2233 -0.0154 0.0015  -0.0017 29  LYS A CG  
235  C  CD  . LYS A 48  ? 0.2674 0.2361 0.2609 -0.0165 -0.0007 -0.0033 29  LYS A CD  
236  C  CE  . LYS A 48  ? 0.3503 0.3167 0.3443 -0.0212 -0.0016 -0.0032 29  LYS A CE  
237  N  NZ  . LYS A 48  ? 0.3861 0.3521 0.3806 -0.0226 -0.0043 -0.0050 29  LYS A NZ  
238  N  N   . TYR A 49  ? 0.1942 0.1801 0.1960 -0.0124 0.0056  -0.0004 30  TYR A N   
239  C  CA  . TYR A 49  ? 0.1983 0.1892 0.2033 -0.0141 0.0073  -0.0001 30  TYR A CA  
240  C  C   . TYR A 49  ? 0.2009 0.1900 0.2027 -0.0137 0.0090  0.0011  30  TYR A C   
241  O  O   . TYR A 49  ? 0.1933 0.1826 0.1946 -0.0162 0.0106  0.0021  30  TYR A O   
242  C  CB  . TYR A 49  ? 0.1952 0.1925 0.2048 -0.0125 0.0072  -0.0013 30  TYR A CB  
243  C  CG  . TYR A 49  ? 0.1964 0.1992 0.2090 -0.0130 0.0092  -0.0013 30  TYR A CG  
244  C  CD1 . TYR A 49  ? 0.1942 0.1971 0.2050 -0.0111 0.0104  -0.0011 30  TYR A CD1 
245  C  CD2 . TYR A 49  ? 0.1920 0.1999 0.2091 -0.0154 0.0099  -0.0016 30  TYR A CD2 
246  C  CE1 . TYR A 49  ? 0.2387 0.2462 0.2514 -0.0112 0.0125  -0.0014 30  TYR A CE1 
247  C  CE2 . TYR A 49  ? 0.2162 0.2296 0.2360 -0.0155 0.0122  -0.0016 30  TYR A CE2 
248  C  CZ  . TYR A 49  ? 0.2408 0.2537 0.2579 -0.0133 0.0136  -0.0016 30  TYR A CZ  
249  O  OH  . TYR A 49  ? 0.2990 0.3171 0.3180 -0.0129 0.0161  -0.0020 30  TYR A OH  
250  N  N   . PHE A 50  ? 0.2056 0.1933 0.2053 -0.0108 0.0086  0.0012  31  PHE A N   
251  C  CA  . PHE A 50  ? 0.2038 0.1899 0.2003 -0.0103 0.0097  0.0024  31  PHE A CA  
252  C  C   . PHE A 50  ? 0.2210 0.2010 0.2129 -0.0117 0.0099  0.0040  31  PHE A C   
253  O  O   . PHE A 50  ? 0.2033 0.1825 0.1928 -0.0131 0.0113  0.0052  31  PHE A O   
254  C  CB  . PHE A 50  ? 0.2041 0.1899 0.1996 -0.0072 0.0087  0.0023  31  PHE A CB  
255  C  CG  . PHE A 50  ? 0.2176 0.2082 0.2165 -0.0059 0.0086  0.0011  31  PHE A CG  
256  C  CD1 . PHE A 50  ? 0.2357 0.2302 0.2364 -0.0065 0.0100  0.0004  31  PHE A CD1 
257  C  CD2 . PHE A 50  ? 0.2271 0.2182 0.2273 -0.0038 0.0070  0.0008  31  PHE A CD2 
258  C  CE1 . PHE A 50  ? 0.2789 0.2766 0.2822 -0.0048 0.0096  -0.0007 31  PHE A CE1 
259  C  CE2 . PHE A 50  ? 0.2845 0.2789 0.2874 -0.0027 0.0066  0.0000  31  PHE A CE2 
260  C  CZ  . PHE A 50  ? 0.2535 0.2507 0.2578 -0.0031 0.0077  -0.0009 31  PHE A CZ  
261  N  N   . ARG A 51  ? 0.2141 0.1895 0.2043 -0.0112 0.0084  0.0039  32  ARG A N   
262  C  CA  . ARG A 51  ? 0.2258 0.1942 0.2114 -0.0122 0.0081  0.0053  32  ARG A CA  
263  C  C   . ARG A 51  ? 0.2095 0.1771 0.1951 -0.0164 0.0091  0.0061  32  ARG A C   
264  O  O   . ARG A 51  ? 0.2425 0.2065 0.2245 -0.0180 0.0100  0.0080  32  ARG A O   
265  C  CB  . ARG A 51  ? 0.2393 0.2030 0.2232 -0.0102 0.0063  0.0046  32  ARG A CB  
266  C  CG  . ARG A 51  ? 0.2872 0.2426 0.2661 -0.0108 0.0056  0.0056  32  ARG A CG  
267  C  CD  . ARG A 51  ? 0.2696 0.2209 0.2465 -0.0076 0.0040  0.0045  32  ARG A CD  
268  N  NE  . ARG A 51  ? 0.2641 0.2173 0.2433 -0.0078 0.0032  0.0026  32  ARG A NE  
269  C  CZ  . ARG A 51  ? 0.3022 0.2521 0.2807 -0.0105 0.0022  0.0017  32  ARG A CZ  
270  N  NH1 . ARG A 51  ? 0.3091 0.2536 0.2851 -0.0137 0.0021  0.0027  32  ARG A NH1 
271  N  NH2 . ARG A 51  ? 0.3045 0.2563 0.2845 -0.0102 0.0012  -0.0001 32  ARG A NH2 
272  N  N   . CYS A 52  ? 0.2142 0.1856 0.2040 -0.0185 0.0090  0.0050  33  CYS A N   
273  C  CA  . CYS A 52  ? 0.2104 0.1826 0.2016 -0.0230 0.0100  0.0059  33  CYS A CA  
274  C  C   . CYS A 52  ? 0.2191 0.1970 0.2118 -0.0243 0.0128  0.0069  33  CYS A C   
275  O  O   . CYS A 52  ? 0.2264 0.2030 0.2176 -0.0277 0.0142  0.0087  33  CYS A O   
276  C  CB  . CYS A 52  ? 0.2194 0.1948 0.2152 -0.0248 0.0088  0.0043  33  CYS A CB  
277  S  SG  . CYS A 52  ? 0.2713 0.2387 0.2638 -0.0242 0.0056  0.0031  33  CYS A SG  
278  N  N   . LEU A 53  ? 0.1981 0.1819 0.1933 -0.0216 0.0135  0.0057  34  LEU A N   
279  C  CA  . LEU A 53  ? 0.1979 0.1869 0.1940 -0.0219 0.0162  0.0062  34  LEU A CA  
280  C  C   . LEU A 53  ? 0.2159 0.2001 0.2056 -0.0221 0.0172  0.0082  34  LEU A C   
281  O  O   . LEU A 53  ? 0.2224 0.2077 0.2108 -0.0247 0.0195  0.0098  34  LEU A O   
282  C  CB  . LEU A 53  ? 0.2054 0.1994 0.2041 -0.0184 0.0161  0.0043  34  LEU A CB  
283  C  CG  . LEU A 53  ? 0.2334 0.2323 0.2322 -0.0175 0.0186  0.0040  34  LEU A CG  
284  C  CD1 . LEU A 53  ? 0.2693 0.2749 0.2727 -0.0202 0.0210  0.0041  34  LEU A CD1 
285  C  CD2 . LEU A 53  ? 0.2329 0.2344 0.2335 -0.0139 0.0177  0.0021  34  LEU A CD2 
286  N  N   . ASP A 54  ? 0.2098 0.1891 0.1957 -0.0192 0.0156  0.0083  35  ASP A N   
287  C  CA  . ASP A 54  ? 0.2008 0.1755 0.1806 -0.0188 0.0160  0.0102  35  ASP A CA  
288  C  C   . ASP A 54  ? 0.2411 0.2087 0.2168 -0.0214 0.0156  0.0124  35  ASP A C   
289  O  O   . ASP A 54  ? 0.2466 0.2113 0.2175 -0.0228 0.0168  0.0146  35  ASP A O   
290  C  CB  . ASP A 54  ? 0.2315 0.2044 0.2095 -0.0148 0.0141  0.0096  35  ASP A CB  
291  C  CG  . ASP A 54  ? 0.2349 0.2137 0.2156 -0.0127 0.0144  0.0078  35  ASP A CG  
292  O  OD1 . ASP A 54  ? 0.2154 0.1987 0.1972 -0.0137 0.0166  0.0073  35  ASP A OD1 
293  O  OD2 . ASP A 54  ? 0.2342 0.2130 0.2161 -0.0101 0.0126  0.0068  35  ASP A OD2 
294  N  N   . GLY A 55  ? 0.2247 0.1888 0.2017 -0.0222 0.0139  0.0119  36  GLY A N   
295  C  CA  . GLY A 55  ? 0.2286 0.1852 0.2018 -0.0251 0.0134  0.0138  36  GLY A CA  
296  C  C   . GLY A 55  ? 0.2384 0.1976 0.2137 -0.0303 0.0152  0.0151  36  GLY A C   
297  O  O   . GLY A 55  ? 0.2531 0.2058 0.2249 -0.0334 0.0149  0.0171  36  GLY A O   
298  N  N   . LYS A 56  ? 0.2382 0.2068 0.2190 -0.0312 0.0172  0.0140  37  LYS A N   
299  C  CA  . LYS A 56  ? 0.2308 0.2041 0.2152 -0.0360 0.0193  0.0151  37  LYS A CA  
300  C  C   . LYS A 56  ? 0.2688 0.2388 0.2554 -0.0396 0.0172  0.0150  37  LYS A C   
301  O  O   . LYS A 56  ? 0.2923 0.2613 0.2790 -0.0446 0.0180  0.0172  37  LYS A O   
302  C  CB  . LYS A 56  ? 0.2616 0.2335 0.2414 -0.0387 0.0219  0.0183  37  LYS A CB  
303  C  CG  . LYS A 56  ? 0.2635 0.2381 0.2401 -0.0352 0.0237  0.0182  37  LYS A CG  
304  C  CD  . LYS A 56  ? 0.2653 0.2387 0.2366 -0.0378 0.0265  0.0213  37  LYS A CD  
305  C  CE  . LYS A 56  ? 0.2588 0.2324 0.2252 -0.0339 0.0272  0.0210  37  LYS A CE  
306  N  NZ  . LYS A 56  ? 0.2712 0.2539 0.2417 -0.0314 0.0289  0.0184  37  LYS A NZ  
307  N  N   . LEU A 57  ? 0.2392 0.2073 0.2271 -0.0371 0.0145  0.0127  38  LEU A N   
308  C  CA  . LEU A 57  ? 0.2838 0.2482 0.2731 -0.0396 0.0119  0.0119  38  LEU A CA  
309  C  C   . LEU A 57  ? 0.2545 0.2287 0.2517 -0.0410 0.0121  0.0103  38  LEU A C   
310  O  O   . LEU A 57  ? 0.2575 0.2342 0.2573 -0.0381 0.0104  0.0079  38  LEU A O   
311  C  CB  . LEU A 57  ? 0.2772 0.2343 0.2627 -0.0357 0.0090  0.0102  38  LEU A CB  
312  C  CG  . LEU A 57  ? 0.3187 0.2667 0.2969 -0.0333 0.0086  0.0116  38  LEU A CG  
313  C  CD1 . LEU A 57  ? 0.3757 0.3186 0.3514 -0.0288 0.0061  0.0096  38  LEU A CD1 
314  C  CD2 . LEU A 57  ? 0.4012 0.3412 0.3751 -0.0377 0.0083  0.0142  38  LEU A CD2 
315  N  N   . TRP A 58  ? 0.2589 0.2393 0.2603 -0.0453 0.0142  0.0118  39  TRP A N   
316  C  CA  . TRP A 58  ? 0.2428 0.2347 0.2523 -0.0456 0.0152  0.0105  39  TRP A CA  
317  C  C   . TRP A 58  ? 0.2602 0.2531 0.2740 -0.0473 0.0120  0.0088  39  TRP A C   
318  O  O   . TRP A 58  ? 0.2445 0.2438 0.2631 -0.0447 0.0113  0.0067  39  TRP A O   
319  C  CB  . TRP A 58  ? 0.2617 0.2613 0.2747 -0.0494 0.0189  0.0127  39  TRP A CB  
320  C  CG  . TRP A 58  ? 0.2685 0.2674 0.2766 -0.0477 0.0221  0.0143  39  TRP A CG  
321  C  CD1 . TRP A 58  ? 0.3068 0.3030 0.3109 -0.0512 0.0243  0.0175  39  TRP A CD1 
322  C  CD2 . TRP A 58  ? 0.2618 0.2626 0.2680 -0.0423 0.0232  0.0129  39  TRP A CD2 
323  N  NE1 . TRP A 58  ? 0.2984 0.2947 0.2979 -0.0480 0.0267  0.0179  39  TRP A NE1 
324  C  CE2 . TRP A 58  ? 0.2876 0.2866 0.2883 -0.0426 0.0259  0.0150  39  TRP A CE2 
325  C  CE3 . TRP A 58  ? 0.2546 0.2580 0.2628 -0.0373 0.0218  0.0101  39  TRP A CE3 
326  C  CZ2 . TRP A 58  ? 0.2733 0.2733 0.2707 -0.0381 0.0272  0.0142  39  TRP A CZ2 
327  C  CZ3 . TRP A 58  ? 0.2715 0.2755 0.2766 -0.0331 0.0232  0.0094  39  TRP A CZ3 
328  C  CH2 . TRP A 58  ? 0.2789 0.2811 0.2786 -0.0336 0.0257  0.0113  39  TRP A CH2 
329  N  N   . ASP A 59  ? 0.2781 0.2636 0.2895 -0.0514 0.0098  0.0096  40  ASP A N   
330  C  CA  . ASP A 59  ? 0.3013 0.2859 0.3154 -0.0530 0.0061  0.0078  40  ASP A CA  
331  C  C   . ASP A 59  ? 0.2907 0.2717 0.3020 -0.0477 0.0037  0.0050  40  ASP A C   
332  O  O   . ASP A 59  ? 0.2869 0.2727 0.3024 -0.0468 0.0018  0.0031  40  ASP A O   
333  C  CB  . ASP A 59  ? 0.3563 0.3315 0.3668 -0.0582 0.0038  0.0090  40  ASP A CB  
334  C  CG  . ASP A 59  ? 0.4434 0.4233 0.4582 -0.0647 0.0057  0.0119  40  ASP A CG  
335  O  OD1 . ASP A 59  ? 0.4174 0.4097 0.4398 -0.0655 0.0081  0.0122  40  ASP A OD1 
336  O  OD2 . ASP A 59  ? 0.5682 0.5394 0.5787 -0.0690 0.0047  0.0138  40  ASP A OD2 
337  N  N   . GLU A 60  ? 0.2732 0.2460 0.2774 -0.0441 0.0037  0.0050  41  GLU A N   
338  C  CA  . GLU A 60  ? 0.2665 0.2369 0.2682 -0.0388 0.0022  0.0028  41  GLU A CA  
339  C  C   . GLU A 60  ? 0.2310 0.2106 0.2372 -0.0351 0.0036  0.0019  41  GLU A C   
340  O  O   . GLU A 60  ? 0.2488 0.2308 0.2567 -0.0327 0.0019  0.0000  41  GLU A O   
341  C  CB  . GLU A 60  ? 0.2909 0.2514 0.2848 -0.0358 0.0020  0.0033  41  GLU A CB  
342  C  CG  . GLU A 60  ? 0.4207 0.3778 0.4117 -0.0312 0.0000  0.0011  41  GLU A CG  
343  C  CD  . GLU A 60  ? 0.6305 0.5775 0.6141 -0.0283 -0.0004 0.0013  41  GLU A CD  
344  O  OE1 . GLU A 60  ? 0.5689 0.5109 0.5493 -0.0297 0.0003  0.0033  41  GLU A OE1 
345  O  OE2 . GLU A 60  ? 0.8371 0.7815 0.8182 -0.0245 -0.0017 -0.0003 41  GLU A OE2 
346  N  N   . LEU A 61  ? 0.2409 0.2257 0.2488 -0.0346 0.0067  0.0031  42  LEU A N   
347  C  CA  . LEU A 61  ? 0.2514 0.2444 0.2635 -0.0313 0.0079  0.0021  42  LEU A CA  
348  C  C   . LEU A 61  ? 0.2373 0.2382 0.2564 -0.0324 0.0067  0.0008  42  LEU A C   
349  O  O   . LEU A 61  ? 0.1914 0.1959 0.2128 -0.0292 0.0058  -0.0006 42  LEU A O   
350  C  CB  . LEU A 61  ? 0.2471 0.2445 0.2598 -0.0312 0.0113  0.0035  42  LEU A CB  
351  C  CG  . LEU A 61  ? 0.2615 0.2652 0.2769 -0.0271 0.0123  0.0022  42  LEU A CG  
352  C  CD1 . LEU A 61  ? 0.3242 0.3268 0.3357 -0.0257 0.0148  0.0033  42  LEU A CD1 
353  C  CD2 . LEU A 61  ? 0.2890 0.3028 0.3119 -0.0279 0.0133  0.0015  42  LEU A CD2 
354  N  N   . GLU A 62  ? 0.2248 0.2285 0.2476 -0.0371 0.0066  0.0016  43  GLU A N   
355  C  CA  . GLU A 62  ? 0.2181 0.2299 0.2483 -0.0385 0.0052  0.0006  43  GLU A CA  
356  C  C   . GLU A 62  ? 0.2173 0.2262 0.2464 -0.0367 0.0014  -0.0014 43  GLU A C   
357  O  O   . GLU A 62  ? 0.2251 0.2406 0.2592 -0.0352 0.0003  -0.0025 43  GLU A O   
358  C  CB  . GLU A 62  ? 0.2676 0.2818 0.3015 -0.0448 0.0052  0.0020  43  GLU A CB  
359  C  CG  . GLU A 62  ? 0.3424 0.3674 0.3855 -0.0464 0.0044  0.0014  43  GLU A CG  
360  C  CD  . GLU A 62  ? 0.3999 0.4284 0.4475 -0.0531 0.0046  0.0033  43  GLU A CD  
361  O  OE1 . GLU A 62  ? 0.4513 0.4768 0.4961 -0.0558 0.0071  0.0055  43  GLU A OE1 
362  O  OE2 . GLU A 62  ? 0.5482 0.5824 0.6021 -0.0556 0.0021  0.0027  43  GLU A OE2 
363  N  N   . THR A 63  ? 0.2154 0.2143 0.2377 -0.0363 -0.0004 -0.0018 44  THR A N   
364  C  CA  . THR A 63  ? 0.2511 0.2464 0.2710 -0.0344 -0.0037 -0.0038 44  THR A CA  
365  C  C   . THR A 63  ? 0.2468 0.2441 0.2660 -0.0290 -0.0035 -0.0047 44  THR A C   
366  O  O   . THR A 63  ? 0.2601 0.2568 0.2785 -0.0273 -0.0059 -0.0061 44  THR A O   
367  C  CB  . THR A 63  ? 0.2710 0.2548 0.2831 -0.0349 -0.0055 -0.0042 44  THR A CB  
368  O  OG1 . THR A 63  ? 0.2652 0.2436 0.2718 -0.0313 -0.0037 -0.0036 44  THR A OG1 
369  C  CG2 . THR A 63  ? 0.2938 0.2737 0.3057 -0.0405 -0.0063 -0.0031 44  THR A CG2 
370  N  N   . THR A 64  ? 0.2270 0.2264 0.2463 -0.0265 -0.0006 -0.0038 45  THR A N   
371  C  CA  . THR A 64  ? 0.2140 0.2158 0.2334 -0.0220 -0.0004 -0.0044 45  THR A CA  
372  C  C   . THR A 64  ? 0.2053 0.2160 0.2314 -0.0211 -0.0005 -0.0050 45  THR A C   
373  O  O   . THR A 64  ? 0.2068 0.2189 0.2331 -0.0177 -0.0009 -0.0055 45  THR A O   
374  C  CB  . THR A 64  ? 0.1906 0.1901 0.2068 -0.0196 0.0020  -0.0034 45  THR A CB  
375  O  OG1 . THR A 64  ? 0.2038 0.2087 0.2235 -0.0207 0.0045  -0.0026 45  THR A OG1 
376  C  CG2 . THR A 64  ? 0.2049 0.1958 0.2147 -0.0200 0.0020  -0.0027 45  THR A CG2 
377  N  N   . LEU A 65  ? 0.2052 0.2221 0.2370 -0.0240 0.0000  -0.0047 46  LEU A N   
378  C  CA  . LEU A 65  ? 0.2041 0.2302 0.2430 -0.0229 0.0003  -0.0052 46  LEU A CA  
379  C  C   . LEU A 65  ? 0.1926 0.2216 0.2350 -0.0239 -0.0031 -0.0061 46  LEU A C   
380  O  O   . LEU A 65  ? 0.2157 0.2419 0.2571 -0.0274 -0.0051 -0.0062 46  LEU A O   
381  C  CB  . LEU A 65  ? 0.2010 0.2335 0.2445 -0.0254 0.0033  -0.0042 46  LEU A CB  
382  C  CG  . LEU A 65  ? 0.2080 0.2375 0.2474 -0.0250 0.0067  -0.0030 46  LEU A CG  
383  C  CD1 . LEU A 65  ? 0.2293 0.2658 0.2731 -0.0276 0.0099  -0.0019 46  LEU A CD1 
384  C  CD2 . LEU A 65  ? 0.2423 0.2707 0.2793 -0.0202 0.0075  -0.0037 46  LEU A CD2 
385  N  N   . SER A 66  ? 0.2117 0.2458 0.2577 -0.0209 -0.0041 -0.0069 47  SER A N   
386  C  CA  . SER A 66  ? 0.2287 0.2656 0.2776 -0.0213 -0.0079 -0.0077 47  SER A CA  
387  C  C   . SER A 66  ? 0.2616 0.3043 0.3167 -0.0258 -0.0089 -0.0075 47  SER A C   
388  O  O   . SER A 66  ? 0.2454 0.2950 0.3061 -0.0270 -0.0063 -0.0068 47  SER A O   
389  C  CB  . SER A 66  ? 0.2595 0.3015 0.3120 -0.0172 -0.0086 -0.0082 47  SER A CB  
390  O  OG  . SER A 66  ? 0.2965 0.3415 0.3519 -0.0176 -0.0125 -0.0089 47  SER A OG  
391  N  N   . PRO A 67  ? 0.2510 0.2910 0.3048 -0.0283 -0.0127 -0.0082 48  PRO A N   
392  C  CA  . PRO A 67  ? 0.3032 0.3493 0.3637 -0.0330 -0.0144 -0.0080 48  PRO A CA  
393  C  C   . PRO A 67  ? 0.3472 0.4040 0.4163 -0.0315 -0.0162 -0.0084 48  PRO A C   
394  O  O   . PRO A 67  ? 0.4120 0.4761 0.4883 -0.0351 -0.0174 -0.0081 48  PRO A O   
395  C  CB  . PRO A 67  ? 0.3038 0.3415 0.3584 -0.0357 -0.0182 -0.0089 48  PRO A CB  
396  C  CG  . PRO A 67  ? 0.3003 0.3316 0.3478 -0.0312 -0.0195 -0.0099 48  PRO A CG  
397  C  CD  . PRO A 67  ? 0.2674 0.2985 0.3134 -0.0273 -0.0154 -0.0091 48  PRO A CD  
398  N  N   . ASN A 68  ? 0.3678 0.4254 0.4363 -0.0263 -0.0166 -0.0090 49  ASN A N   
399  C  CA  . ASN A 68  ? 0.4027 0.4696 0.4788 -0.0238 -0.0184 -0.0093 49  ASN A CA  
400  C  C   . ASN A 68  ? 0.4691 0.5457 0.5531 -0.0230 -0.0145 -0.0087 49  ASN A C   
401  O  O   . ASN A 68  ? 0.4489 0.5249 0.5314 -0.0191 -0.0116 -0.0088 49  ASN A O   
402  C  CB  . ASN A 68  ? 0.3975 0.4602 0.4689 -0.0186 -0.0198 -0.0098 49  ASN A CB  
403  C  CG  . ASN A 68  ? 0.5087 0.5793 0.5867 -0.0153 -0.0221 -0.0101 49  ASN A CG  
404  O  OD1 . ASN A 68  ? 0.4911 0.5716 0.5781 -0.0162 -0.0223 -0.0100 49  ASN A OD1 
405  N  ND2 . ASN A 68  ? 0.5515 0.6177 0.6250 -0.0113 -0.0238 -0.0102 49  ASN A ND2 
406  N  N   A ILE A 69  ? 0.5825 0.6679 0.6746 -0.0267 -0.0144 -0.0082 50  ILE A N   
407  N  N   B ILE A 69  ? 0.5984 0.6839 0.6906 -0.0267 -0.0146 -0.0082 50  ILE A N   
408  C  CA  A ILE A 69  ? 0.6339 0.7293 0.7334 -0.0260 -0.0102 -0.0076 50  ILE A CA  
409  C  CA  B ILE A 69  ? 0.6652 0.7611 0.7653 -0.0264 -0.0106 -0.0076 50  ILE A CA  
410  C  C   A ILE A 69  ? 0.6153 0.7200 0.7222 -0.0209 -0.0107 -0.0083 50  ILE A C   
411  C  C   B ILE A 69  ? 0.6186 0.7230 0.7251 -0.0208 -0.0107 -0.0083 50  ILE A C   
412  O  O   A ILE A 69  ? 0.6512 0.7659 0.7655 -0.0201 -0.0076 -0.0081 50  ILE A O   
413  O  O   B ILE A 69  ? 0.6053 0.7184 0.7181 -0.0195 -0.0071 -0.0081 50  ILE A O   
414  C  CB  A ILE A 69  ? 0.6491 0.7509 0.7547 -0.0322 -0.0090 -0.0063 50  ILE A CB  
415  C  CB  B ILE A 69  ? 0.7256 0.8294 0.8333 -0.0324 -0.0107 -0.0065 50  ILE A CB  
416  C  CG1 A ILE A 69  ? 0.6039 0.6961 0.7016 -0.0361 -0.0068 -0.0053 50  ILE A CG1 
417  C  CG1 B ILE A 69  ? 0.6667 0.7755 0.7800 -0.0340 -0.0162 -0.0070 50  ILE A CG1 
418  C  CG2 A ILE A 69  ? 0.6722 0.7867 0.7868 -0.0310 -0.0048 -0.0057 50  ILE A CG2 
419  C  CG2 B ILE A 69  ? 0.7741 0.8694 0.8754 -0.0377 -0.0095 -0.0055 50  ILE A CG2 
420  C  CD1 A ILE A 69  ? 0.6544 0.7513 0.7569 -0.0427 -0.0055 -0.0036 50  ILE A CD1 
421  C  CD1 B ILE A 69  ? 0.6935 0.8132 0.8168 -0.0395 -0.0165 -0.0058 50  ILE A CD1 
422  N  N   . GLU A 70  ? 0.5679 0.6694 0.6725 -0.0173 -0.0146 -0.0092 51  GLU A N   
423  C  CA  . GLU A 70  ? 0.6913 0.7970 0.7991 -0.0110 -0.0146 -0.0099 51  GLU A CA  
424  C  C   . GLU A 70  ? 0.6599 0.7595 0.7616 -0.0075 -0.0105 -0.0102 51  GLU A C   
425  O  O   . GLU A 70  ? 0.6383 0.7417 0.7428 -0.0028 -0.0089 -0.0108 51  GLU A O   
426  C  CB  . GLU A 70  ? 0.7779 0.8799 0.8833 -0.0082 -0.0198 -0.0104 51  GLU A CB  
427  C  CG  . GLU A 70  ? 0.8713 0.9774 0.9807 -0.0113 -0.0248 -0.0103 51  GLU A CG  
428  C  CD  . GLU A 70  ? 1.0555 1.1760 1.1775 -0.0116 -0.0254 -0.0102 51  GLU A CD  
429  O  OE1 . GLU A 70  ? 1.1418 1.2693 1.2694 -0.0073 -0.0228 -0.0105 51  GLU A OE1 
430  O  OE2 . GLU A 70  ? 1.0560 1.1810 1.1824 -0.0161 -0.0285 -0.0099 51  GLU A OE2 
431  N  N   . THR A 71  ? 0.6559 0.7458 0.7491 -0.0097 -0.0091 -0.0098 52  THR A N   
432  C  CA  . THR A 71  ? 0.7176 0.8021 0.8052 -0.0078 -0.0052 -0.0098 52  THR A CA  
433  C  C   . THR A 71  ? 0.5932 0.6855 0.6858 -0.0077 -0.0005 -0.0097 52  THR A C   
434  O  O   . THR A 71  ? 0.5155 0.6135 0.6124 -0.0120 0.0009  -0.0089 52  THR A O   
435  C  CB  . THR A 71  ? 0.6326 0.7071 0.7117 -0.0112 -0.0045 -0.0091 52  THR A CB  
436  O  OG1 . THR A 71  ? 0.6793 0.7469 0.7533 -0.0113 -0.0083 -0.0092 52  THR A OG1 
437  C  CG2 . THR A 71  ? 0.6471 0.7160 0.7202 -0.0090 -0.0011 -0.0090 52  THR A CG2 
438  N  N   . SER A 72  ? 0.6677 0.7602 0.7595 -0.0029 0.0015  -0.0106 53  SER A N   
439  C  CA  . SER A 72  ? 0.6181 0.7136 0.7100 -0.0026 0.0065  -0.0107 53  SER A CA  
440  C  C   . SER A 72  ? 0.4410 0.5253 0.5229 -0.0034 0.0077  -0.0102 53  SER A C   
441  O  O   . SER A 72  ? 0.4945 0.5711 0.5709 -0.0005 0.0061  -0.0108 53  SER A O   
442  C  CB  . SER A 72  ? 0.6796 0.7808 0.7753 0.0032  0.0082  -0.0122 53  SER A CB  
443  O  OG  . SER A 72  ? 0.5408 0.6341 0.6292 0.0066  0.0096  -0.0131 53  SER A OG  
444  N  N   . TYR A 73  ? 0.3302 0.4137 0.4100 -0.0076 0.0104  -0.0090 54  TYR A N   
445  C  CA  . TYR A 73  ? 0.2766 0.3501 0.3475 -0.0088 0.0113  -0.0084 54  TYR A CA  
446  C  C   . TYR A 73  ? 0.2518 0.3253 0.3200 -0.0056 0.0149  -0.0091 54  TYR A C   
447  O  O   . TYR A 73  ? 0.2905 0.3690 0.3602 -0.0069 0.0186  -0.0086 54  TYR A O   
448  C  CB  . TYR A 73  ? 0.3024 0.3743 0.3719 -0.0145 0.0123  -0.0067 54  TYR A CB  
449  C  CG  . TYR A 73  ? 0.3066 0.3782 0.3785 -0.0178 0.0085  -0.0063 54  TYR A CG  
450  C  CD1 . TYR A 73  ? 0.3352 0.4163 0.4156 -0.0199 0.0078  -0.0062 54  TYR A CD1 
451  C  CD2 . TYR A 73  ? 0.2724 0.3348 0.3382 -0.0183 0.0056  -0.0063 54  TYR A CD2 
452  C  CE1 . TYR A 73  ? 0.3268 0.4075 0.4092 -0.0229 0.0038  -0.0061 54  TYR A CE1 
453  C  CE2 . TYR A 73  ? 0.3043 0.3658 0.3713 -0.0210 0.0019  -0.0064 54  TYR A CE2 
454  C  CZ  . TYR A 73  ? 0.3307 0.4013 0.4060 -0.0234 0.0008  -0.0063 54  TYR A CZ  
455  O  OH  . TYR A 73  ? 0.3459 0.4157 0.4224 -0.0262 -0.0031 -0.0065 54  TYR A OH  
456  N  N   . SER A 74  ? 0.2452 0.3128 0.3090 -0.0016 0.0137  -0.0102 55  SER A N   
457  C  CA  . SER A 74  ? 0.2186 0.2857 0.2797 0.0018  0.0163  -0.0113 55  SER A CA  
458  C  C   . SER A 74  ? 0.2280 0.2848 0.2809 0.0029  0.0153  -0.0114 55  SER A C   
459  O  O   . SER A 74  ? 0.2159 0.2669 0.2664 0.0025  0.0122  -0.0108 55  SER A O   
460  C  CB  . SER A 74  ? 0.2338 0.3058 0.2998 0.0067  0.0156  -0.0131 55  SER A CB  
461  O  OG  . SER A 74  ? 0.2585 0.3307 0.3221 0.0103  0.0184  -0.0146 55  SER A OG  
462  N  N   . ASP A 75  ? 0.1938 0.2487 0.2423 0.0043  0.0179  -0.0119 56  ASP A N   
463  C  CA  . ASP A 75  ? 0.1971 0.2434 0.2387 0.0061  0.0168  -0.0123 56  ASP A CA  
464  C  C   . ASP A 75  ? 0.2199 0.2661 0.2611 0.0109  0.0169  -0.0145 56  ASP A C   
465  O  O   . ASP A 75  ? 0.2143 0.2541 0.2497 0.0123  0.0164  -0.0151 56  ASP A O   
466  C  CB  . ASP A 75  ? 0.2284 0.2704 0.2638 0.0036  0.0187  -0.0112 56  ASP A CB  
467  C  CG  . ASP A 75  ? 0.2513 0.2974 0.2856 0.0041  0.0228  -0.0117 56  ASP A CG  
468  O  OD1 . ASP A 75  ? 0.2218 0.2747 0.2606 0.0065  0.0245  -0.0131 56  ASP A OD1 
469  O  OD2 . ASP A 75  ? 0.2906 0.3331 0.3193 0.0023  0.0244  -0.0106 56  ASP A OD2 
470  N  N   . GLY A 76  ? 0.2253 0.2785 0.2727 0.0135  0.0173  -0.0158 57  GLY A N   
471  C  CA  . GLY A 76  ? 0.2064 0.2595 0.2534 0.0186  0.0175  -0.0182 57  GLY A CA  
472  C  C   . GLY A 76  ? 0.2327 0.2907 0.2790 0.0200  0.0220  -0.0194 57  GLY A C   
473  O  O   . GLY A 76  ? 0.2351 0.2948 0.2822 0.0246  0.0228  -0.0217 57  GLY A O   
474  N  N   . LYS A 77  ? 0.2183 0.2778 0.2625 0.0162  0.0249  -0.0179 58  LYS A N   
475  C  CA  . LYS A 77  ? 0.2155 0.2794 0.2578 0.0170  0.0296  -0.0186 58  LYS A CA  
476  C  C   . LYS A 77  ? 0.2135 0.2870 0.2617 0.0134  0.0327  -0.0168 58  LYS A C   
477  O  O   . LYS A 77  ? 0.2311 0.3136 0.2837 0.0150  0.0360  -0.0175 58  LYS A O   
478  C  CB  . LYS A 77  ? 0.2787 0.3343 0.3113 0.0159  0.0302  -0.0183 58  LYS A CB  
479  C  CG  . LYS A 77  ? 0.3611 0.4095 0.3876 0.0202  0.0287  -0.0208 58  LYS A CG  
480  C  CD  . LYS A 77  ? 0.3859 0.4267 0.4116 0.0206  0.0238  -0.0208 58  LYS A CD  
481  C  CE  . LYS A 77  ? 0.4186 0.4511 0.4373 0.0237  0.0222  -0.0229 58  LYS A CE  
482  N  NZ  . LYS A 77  ? 0.4449 0.4701 0.4627 0.0232  0.0175  -0.0222 58  LYS A NZ  
483  N  N   . LEU A 78  ? 0.2138 0.2850 0.2616 0.0082  0.0315  -0.0143 59  LEU A N   
484  C  CA  . LEU A 78  ? 0.2527 0.3310 0.3056 0.0037  0.0335  -0.0121 59  LEU A CA  
485  C  C   . LEU A 78  ? 0.2219 0.3034 0.2822 0.0025  0.0300  -0.0118 59  LEU A C   
486  O  O   . LEU A 78  ? 0.2501 0.3250 0.3086 0.0030  0.0260  -0.0119 59  LEU A O   
487  C  CB  . LEU A 78  ? 0.2873 0.3592 0.3338 -0.0009 0.0340  -0.0097 59  LEU A CB  
488  C  CG  . LEU A 78  ? 0.3528 0.4216 0.3914 0.0000  0.0372  -0.0099 59  LEU A CG  
489  C  CD1 . LEU A 78  ? 0.4310 0.4920 0.4628 -0.0040 0.0368  -0.0075 59  LEU A CD1 
490  C  CD2 . LEU A 78  ? 0.4114 0.4901 0.4530 0.0002  0.0424  -0.0098 59  LEU A CD2 
491  N  N   . VAL A 79  ? 0.2367 0.3286 0.3052 0.0009  0.0315  -0.0111 60  VAL A N   
492  C  CA  . VAL A 79  ? 0.2525 0.3482 0.3283 -0.0002 0.0280  -0.0108 60  VAL A CA  
493  C  C   . VAL A 79  ? 0.2416 0.3445 0.3230 -0.0060 0.0293  -0.0086 60  VAL A C   
494  O  O   . VAL A 79  ? 0.2447 0.3563 0.3297 -0.0070 0.0335  -0.0079 60  VAL A O   
495  C  CB  . VAL A 79  ? 0.3657 0.4676 0.4478 0.0052  0.0268  -0.0130 60  VAL A CB  
496  C  CG1 . VAL A 79  ? 0.3699 0.4806 0.4551 0.0085  0.0314  -0.0142 60  VAL A CG1 
497  C  CG2 . VAL A 79  ? 0.3507 0.4588 0.4413 0.0035  0.0235  -0.0124 60  VAL A CG2 
498  N  N   . PHE A 80  ? 0.2298 0.3290 0.3117 -0.0097 0.0256  -0.0075 61  PHE A N   
499  C  CA  . PHE A 80  ? 0.2557 0.3599 0.3426 -0.0157 0.0256  -0.0055 61  PHE A CA  
500  C  C   . PHE A 80  ? 0.2809 0.3875 0.3738 -0.0166 0.0208  -0.0058 61  PHE A C   
501  O  O   . PHE A 80  ? 0.2488 0.3510 0.3402 -0.0131 0.0173  -0.0072 61  PHE A O   
502  C  CB  . PHE A 80  ? 0.2277 0.3227 0.3070 -0.0205 0.0259  -0.0035 61  PHE A CB  
503  C  CG  . PHE A 80  ? 0.2727 0.3639 0.3449 -0.0193 0.0299  -0.0032 61  PHE A CG  
504  C  CD1 . PHE A 80  ? 0.3448 0.4431 0.4187 -0.0214 0.0346  -0.0017 61  PHE A CD1 
505  C  CD2 . PHE A 80  ? 0.2837 0.3652 0.3477 -0.0159 0.0289  -0.0043 61  PHE A CD2 
506  C  CE1 . PHE A 80  ? 0.3671 0.4620 0.4338 -0.0200 0.0382  -0.0015 61  PHE A CE1 
507  C  CE2 . PHE A 80  ? 0.3164 0.3946 0.3736 -0.0148 0.0321  -0.0040 61  PHE A CE2 
508  C  CZ  . PHE A 80  ? 0.3203 0.4049 0.3785 -0.0167 0.0367  -0.0027 61  PHE A CZ  
509  N  N   . HIS A 81  ? 0.2820 0.3952 0.3813 -0.0217 0.0204  -0.0043 62  HIS A N   
510  C  CA  . HIS A 81  ? 0.3093 0.4268 0.4154 -0.0226 0.0158  -0.0047 62  HIS A CA  
511  C  C   . HIS A 81  ? 0.3277 0.4383 0.4311 -0.0281 0.0120  -0.0037 62  HIS A C   
512  O  O   . HIS A 81  ? 0.3249 0.4379 0.4326 -0.0291 0.0078  -0.0042 62  HIS A O   
513  C  CB  . HIS A 81  ? 0.3714 0.5045 0.4893 -0.0228 0.0176  -0.0044 62  HIS A CB  
514  C  CG  . HIS A 81  ? 0.5586 0.6980 0.6788 -0.0163 0.0209  -0.0060 62  HIS A CG  
515  N  ND1 . HIS A 81  ? 0.6430 0.7816 0.7638 -0.0101 0.0184  -0.0081 62  HIS A ND1 
516  C  CD2 . HIS A 81  ? 0.6785 0.8233 0.7991 -0.0149 0.0265  -0.0058 62  HIS A CD2 
517  C  CE1 . HIS A 81  ? 0.7218 0.8653 0.8438 -0.0050 0.0221  -0.0094 62  HIS A CE1 
518  N  NE2 . HIS A 81  ? 0.7867 0.9341 0.9084 -0.0077 0.0271  -0.0081 62  HIS A NE2 
519  N  N   . SER A 82  ? 0.2930 0.3946 0.3887 -0.0314 0.0133  -0.0025 63  SER A N   
520  C  CA  . SER A 82  ? 0.3028 0.3951 0.3937 -0.0357 0.0098  -0.0019 63  SER A CA  
521  C  C   . SER A 82  ? 0.2538 0.3337 0.3339 -0.0356 0.0110  -0.0014 63  SER A C   
522  O  O   . SER A 82  ? 0.2689 0.3488 0.3462 -0.0342 0.0150  -0.0008 63  SER A O   
523  C  CB  . SER A 82  ? 0.2606 0.3581 0.3571 -0.0426 0.0096  0.0000  63  SER A CB  
524  O  OG  . SER A 82  ? 0.2672 0.3648 0.3618 -0.0457 0.0141  0.0019  63  SER A OG  
525  N  N   . PRO A 83  ? 0.2736 0.3431 0.3475 -0.0372 0.0076  -0.0016 64  PRO A N   
526  C  CA  . PRO A 83  ? 0.2861 0.3445 0.3506 -0.0376 0.0087  -0.0008 64  PRO A CA  
527  C  C   . PRO A 83  ? 0.2835 0.3419 0.3470 -0.0419 0.0121  0.0014  64  PRO A C   
528  O  O   . PRO A 83  ? 0.2854 0.3388 0.3428 -0.0405 0.0147  0.0021  64  PRO A O   
529  C  CB  . PRO A 83  ? 0.2961 0.3455 0.3561 -0.0391 0.0043  -0.0014 64  PRO A CB  
530  C  CG  . PRO A 83  ? 0.3075 0.3617 0.3721 -0.0368 0.0010  -0.0031 64  PRO A CG  
531  C  CD  . PRO A 83  ? 0.2852 0.3525 0.3598 -0.0378 0.0025  -0.0027 64  PRO A CD  
532  N  N   . LYS A 84  ? 0.2714 0.3355 0.3409 -0.0473 0.0119  0.0028  65  LYS A N   
533  C  CA  . LYS A 84  ? 0.2610 0.3256 0.3299 -0.0521 0.0152  0.0054  65  LYS A CA  
534  C  C   . LYS A 84  ? 0.2716 0.3438 0.3421 -0.0497 0.0205  0.0061  65  LYS A C   
535  O  O   . LYS A 84  ? 0.2854 0.3540 0.3507 -0.0512 0.0237  0.0080  65  LYS A O   
536  C  CB  . LYS A 84  ? 0.3467 0.4171 0.4228 -0.0588 0.0139  0.0069  65  LYS A CB  
537  C  CG  . LYS A 84  ? 0.4904 0.5596 0.5649 -0.0645 0.0170  0.0102  65  LYS A CG  
538  C  CD  . LYS A 84  ? 0.6926 0.7648 0.7730 -0.0721 0.0148  0.0118  65  LYS A CD  
539  C  CE  . LYS A 84  ? 0.8098 0.8675 0.8824 -0.0763 0.0113  0.0126  65  LYS A CE  
540  N  NZ  . LYS A 84  ? 0.8710 0.9316 0.9492 -0.0845 0.0098  0.0147  65  LYS A NZ  
541  N  N   . GLU A 85  ? 0.2957 0.3785 0.3733 -0.0461 0.0215  0.0047  66  GLU A N   
542  C  CA  . GLU A 85  ? 0.2875 0.3773 0.3661 -0.0428 0.0264  0.0047  66  GLU A CA  
543  C  C   . GLU A 85  ? 0.2228 0.3032 0.2916 -0.0383 0.0274  0.0038  66  GLU A C   
544  O  O   . GLU A 85  ? 0.2370 0.3177 0.3021 -0.0377 0.0314  0.0047  66  GLU A O   
545  C  CB  . GLU A 85  ? 0.2863 0.3882 0.3739 -0.0387 0.0267  0.0028  66  GLU A CB  
546  C  CG  . GLU A 85  ? 0.3983 0.5136 0.4972 -0.0426 0.0275  0.0040  66  GLU A CG  
547  C  CD  . GLU A 85  ? 0.4127 0.5405 0.5205 -0.0376 0.0283  0.0022  66  GLU A CD  
548  O  OE1 . GLU A 85  ? 0.3145 0.4398 0.4190 -0.0312 0.0285  0.0000  66  GLU A OE1 
549  O  OE2 . GLU A 85  ? 0.3577 0.4981 0.4760 -0.0401 0.0288  0.0031  66  GLU A OE2 
550  N  N   . VAL A 86  ? 0.2329 0.3054 0.2977 -0.0353 0.0237  0.0021  67  VAL A N   
551  C  CA  . VAL A 86  ? 0.2368 0.3005 0.2929 -0.0314 0.0241  0.0014  67  VAL A CA  
552  C  C   . VAL A 86  ? 0.2562 0.3116 0.3048 -0.0348 0.0253  0.0036  67  VAL A C   
553  O  O   . VAL A 86  ? 0.2506 0.3041 0.2942 -0.0332 0.0282  0.0041  67  VAL A O   
554  C  CB  . VAL A 86  ? 0.2142 0.2713 0.2677 -0.0282 0.0199  -0.0003 67  VAL A CB  
555  C  CG1 . VAL A 86  ? 0.2312 0.2794 0.2761 -0.0251 0.0203  -0.0006 67  VAL A CG1 
556  C  CG2 . VAL A 86  ? 0.2426 0.3067 0.3023 -0.0243 0.0186  -0.0023 67  VAL A CG2 
557  N  N   . THR A 87  ? 0.2916 0.3418 0.3392 -0.0393 0.0230  0.0049  68  THR A N   
558  C  CA  . THR A 87  ? 0.3135 0.3545 0.3535 -0.0421 0.0237  0.0071  68  THR A CA  
559  C  C   . THR A 87  ? 0.3052 0.3507 0.3458 -0.0460 0.0278  0.0097  68  THR A C   
560  O  O   . THR A 87  ? 0.3670 0.4063 0.4004 -0.0464 0.0296  0.0114  68  THR A O   
561  C  CB  . THR A 87  ? 0.3275 0.3597 0.3650 -0.0452 0.0197  0.0074  68  THR A CB  
562  O  OG1 . THR A 87  ? 0.3403 0.3783 0.3848 -0.0499 0.0186  0.0079  68  THR A OG1 
563  C  CG2 . THR A 87  ? 0.3313 0.3584 0.3665 -0.0410 0.0162  0.0049  68  THR A CG2 
564  N  N   . GLU A 88  ? 0.2983 0.3550 0.3474 -0.0486 0.0296  0.0103  69  GLU A N   
565  C  CA  . GLU A 88  ? 0.3271 0.3902 0.3774 -0.0515 0.0343  0.0128  69  GLU A CA  
566  C  C   . GLU A 88  ? 0.3080 0.3733 0.3543 -0.0467 0.0382  0.0121  69  GLU A C   
567  O  O   . GLU A 88  ? 0.3512 0.4145 0.3921 -0.0483 0.0414  0.0143  69  GLU A O   
568  C  CB  . GLU A 88  ? 0.4034 0.4798 0.4648 -0.0549 0.0356  0.0134  69  GLU A CB  
569  C  CG  . GLU A 88  ? 0.5708 0.6445 0.6349 -0.0617 0.0325  0.0152  69  GLU A CG  
570  C  CD  . GLU A 88  ? 0.6947 0.7821 0.7709 -0.0651 0.0327  0.0157  69  GLU A CD  
571  O  OE1 . GLU A 88  ? 0.7098 0.8073 0.7931 -0.0610 0.0330  0.0135  69  GLU A OE1 
572  O  OE2 . GLU A 88  ? 0.7445 0.8322 0.8233 -0.0721 0.0322  0.0183  69  GLU A OE2 
573  N  N   . TYR A 89  ? 0.2637 0.3327 0.3123 -0.0410 0.0377  0.0091  70  TYR A N   
574  C  CA  . TYR A 89  ? 0.2751 0.3445 0.3190 -0.0360 0.0405  0.0078  70  TYR A CA  
575  C  C   . TYR A 89  ? 0.2600 0.3168 0.2931 -0.0351 0.0395  0.0085  70  TYR A C   
576  O  O   . TYR A 89  ? 0.2879 0.3433 0.3150 -0.0348 0.0425  0.0096  70  TYR A O   
577  C  CB  . TYR A 89  ? 0.2869 0.3606 0.3348 -0.0300 0.0393  0.0044  70  TYR A CB  
578  C  CG  . TYR A 89  ? 0.3209 0.3915 0.3621 -0.0248 0.0410  0.0028  70  TYR A CG  
579  C  CD1 . TYR A 89  ? 0.3483 0.4261 0.3896 -0.0230 0.0457  0.0025  70  TYR A CD1 
580  C  CD2 . TYR A 89  ? 0.3533 0.4138 0.3878 -0.0220 0.0380  0.0016  70  TYR A CD2 
581  C  CE1 . TYR A 89  ? 0.3546 0.4288 0.3889 -0.0184 0.0469  0.0008  70  TYR A CE1 
582  C  CE2 . TYR A 89  ? 0.3728 0.4302 0.4012 -0.0178 0.0391  0.0002  70  TYR A CE2 
583  C  CZ  . TYR A 89  ? 0.3860 0.4497 0.4139 -0.0161 0.0434  -0.0002 70  TYR A CZ  
584  O  OH  . TYR A 89  ? 0.4793 0.5389 0.5003 -0.0121 0.0440  -0.0019 70  TYR A OH  
585  N  N   . LEU A 90  ? 0.2585 0.3069 0.2891 -0.0344 0.0352  0.0077  71  LEU A N   
586  C  CA  . LEU A 90  ? 0.2557 0.2932 0.2771 -0.0328 0.0338  0.0080  71  LEU A CA  
587  C  C   . LEU A 90  ? 0.2871 0.3189 0.3025 -0.0369 0.0352  0.0113  71  LEU A C   
588  O  O   . LEU A 90  ? 0.2992 0.3261 0.3072 -0.0355 0.0363  0.0121  71  LEU A O   
589  C  CB  . LEU A 90  ? 0.2640 0.2946 0.2846 -0.0311 0.0292  0.0066  71  LEU A CB  
590  C  CG  . LEU A 90  ? 0.3029 0.3364 0.3269 -0.0264 0.0274  0.0037  71  LEU A CG  
591  C  CD1 . LEU A 90  ? 0.2891 0.3162 0.3123 -0.0258 0.0233  0.0029  71  LEU A CD1 
592  C  CD2 . LEU A 90  ? 0.3164 0.3492 0.3364 -0.0220 0.0286  0.0024  71  LEU A CD2 
593  N  N   . ALA A 91  ? 0.3007 0.3329 0.3192 -0.0422 0.0349  0.0133  72  ALA A N   
594  C  CA  . ALA A 91  ? 0.3212 0.3475 0.3342 -0.0467 0.0360  0.0167  72  ALA A CA  
595  C  C   . ALA A 91  ? 0.3682 0.3995 0.3786 -0.0472 0.0410  0.0185  72  ALA A C   
596  O  O   . ALA A 91  ? 0.3640 0.3883 0.3662 -0.0480 0.0418  0.0207  72  ALA A O   
597  C  CB  . ALA A 91  ? 0.3388 0.3652 0.3564 -0.0527 0.0346  0.0184  72  ALA A CB  
598  N  N   . ALA A 92  ? 0.3491 0.3923 0.3660 -0.0464 0.0441  0.0175  73  ALA A N   
599  C  CA  . ALA A 92  ? 0.3966 0.4458 0.4111 -0.0460 0.0493  0.0187  73  ALA A CA  
600  C  C   . ALA A 92  ? 0.3961 0.4419 0.4035 -0.0401 0.0498  0.0166  73  ALA A C   
601  O  O   . ALA A 92  ? 0.3700 0.4132 0.3698 -0.0402 0.0523  0.0183  73  ALA A O   
602  C  CB  . ALA A 92  ? 0.4304 0.4942 0.4548 -0.0465 0.0526  0.0181  73  ALA A CB  
603  N  N   . ALA A 93  ? 0.3447 0.3902 0.3542 -0.0352 0.0471  0.0131  74  ALA A N   
604  C  CA  . ALA A 93  ? 0.3538 0.3962 0.3574 -0.0298 0.0469  0.0108  74  ALA A CA  
605  C  C   . ALA A 93  ? 0.3410 0.3716 0.3355 -0.0291 0.0442  0.0117  74  ALA A C   
606  O  O   . ALA A 93  ? 0.3683 0.3960 0.3560 -0.0261 0.0448  0.0110  74  ALA A O   
607  C  CB  . ALA A 93  ? 0.3852 0.4310 0.3943 -0.0252 0.0448  0.0071  74  ALA A CB  
608  N  N   A MSE A 94  ? 0.3098 0.3336 0.3040 -0.0319 0.0411  0.0132  75  MSE A N   
609  N  N   B MSE A 94  ? 0.3174 0.3411 0.3118 -0.0315 0.0408  0.0130  75  MSE A N   
610  C  CA  A MSE A 94  ? 0.3044 0.3173 0.2912 -0.0309 0.0380  0.0140  75  MSE A CA  
611  C  CA  B MSE A 94  ? 0.3012 0.3140 0.2879 -0.0307 0.0379  0.0139  75  MSE A CA  
612  C  C   A MSE A 94  ? 0.2685 0.2756 0.2515 -0.0357 0.0381  0.0177  75  MSE A C   
613  C  C   B MSE A 94  ? 0.2876 0.2948 0.2706 -0.0356 0.0382  0.0176  75  MSE A C   
614  O  O   A MSE A 94  ? 0.2697 0.2706 0.2530 -0.0374 0.0351  0.0184  75  MSE A O   
615  O  O   B MSE A 94  ? 0.2943 0.2956 0.2779 -0.0372 0.0351  0.0182  75  MSE A O   
616  C  CB  A MSE A 94  ? 0.3144 0.3243 0.3044 -0.0285 0.0339  0.0118  75  MSE A CB  
617  C  CB  B MSE A 94  ? 0.2969 0.3055 0.2860 -0.0286 0.0335  0.0120  75  MSE A CB  
618  C  CG  A MSE A 94  ? 0.3597 0.3753 0.3532 -0.0242 0.0340  0.0085  75  MSE A CG  
619  C  CG  B MSE A 94  ? 0.2926 0.3053 0.2850 -0.0239 0.0327  0.0086  75  MSE A CG  
620  SE SE  A MSE A 94  ? 0.2954 0.3066 0.2917 -0.0215 0.0289  0.0064  75  MSE A SE  
621  SE SE  B MSE A 94  ? 0.2787 0.2839 0.2630 -0.0193 0.0303  0.0076  75  MSE A SE  
622  C  CE  A MSE A 94  ? 0.3474 0.3490 0.3344 -0.0190 0.0268  0.0071  75  MSE A CE  
623  C  CE  B MSE A 94  ? 0.3206 0.3311 0.3120 -0.0152 0.0285  0.0036  75  MSE A CE  
624  N  N   . PRO A 95  ? 0.2906 0.2991 0.2693 -0.0379 0.0418  0.0202  76  PRO A N   
625  C  CA  . PRO A 95  ? 0.2968 0.3000 0.2720 -0.0431 0.0422  0.0242  76  PRO A CA  
626  C  C   . PRO A 95  ? 0.2788 0.2696 0.2455 -0.0421 0.0389  0.0256  76  PRO A C   
627  O  O   . PRO A 95  ? 0.2847 0.2722 0.2485 -0.0374 0.0367  0.0236  76  PRO A O   
628  C  CB  . PRO A 95  ? 0.3277 0.3367 0.3003 -0.0450 0.0473  0.0263  76  PRO A CB  
629  C  CG  . PRO A 95  ? 0.3141 0.3252 0.2830 -0.0394 0.0482  0.0236  76  PRO A CG  
630  C  CD  . PRO A 95  ? 0.3133 0.3280 0.2895 -0.0359 0.0457  0.0196  76  PRO A CD  
631  N  N   . LYS A 96  ? 0.3030 0.2870 0.2658 -0.0464 0.0387  0.0292  77  LYS A N   
632  C  CA  . LYS A 96  ? 0.3265 0.2985 0.2814 -0.0455 0.0355  0.0309  77  LYS A CA  
633  C  C   . LYS A 96  ? 0.3053 0.2750 0.2523 -0.0417 0.0358  0.0311  77  LYS A C   
634  O  O   . LYS A 96  ? 0.3676 0.3300 0.3103 -0.0386 0.0325  0.0307  77  LYS A O   
635  C  CB  . LYS A 96  ? 0.4350 0.4001 0.3862 -0.0511 0.0356  0.0352  77  LYS A CB  
636  C  CG  . LYS A 96  ? 0.5973 0.5615 0.5550 -0.0548 0.0338  0.0350  77  LYS A CG  
637  C  CD  . LYS A 96  ? 0.7075 0.6622 0.6639 -0.0522 0.0290  0.0333  77  LYS A CD  
638  C  CE  . LYS A 96  ? 0.7735 0.7156 0.7231 -0.0551 0.0269  0.0367  77  LYS A CE  
639  N  NZ  . LYS A 96  ? 0.7722 0.7052 0.7202 -0.0517 0.0224  0.0349  77  LYS A NZ  
640  N  N   . GLU A 97  ? 0.2884 0.2648 0.2336 -0.0418 0.0398  0.0314  78  GLU A N   
641  C  CA  . GLU A 97  ? 0.3229 0.2973 0.2599 -0.0385 0.0402  0.0314  78  GLU A CA  
642  C  C   . GLU A 97  ? 0.3153 0.2917 0.2540 -0.0330 0.0380  0.0272  78  GLU A C   
643  O  O   . GLU A 97  ? 0.3540 0.3282 0.2860 -0.0301 0.0375  0.0269  78  GLU A O   
644  C  CB  . GLU A 97  ? 0.3656 0.3468 0.2995 -0.0397 0.0454  0.0325  78  GLU A CB  
645  C  CG  . GLU A 97  ? 0.5319 0.5159 0.4663 -0.0455 0.0492  0.0363  78  GLU A CG  
646  C  CD  . GLU A 97  ? 0.5193 0.5135 0.4648 -0.0474 0.0514  0.0347  78  GLU A CD  
647  O  OE1 . GLU A 97  ? 0.5721 0.5765 0.5213 -0.0458 0.0549  0.0326  78  GLU A OE1 
648  O  OE2 . GLU A 97  ? 0.4358 0.4273 0.3862 -0.0504 0.0491  0.0354  78  GLU A OE2 
649  N  N   . GLU A 98  ? 0.2976 0.2782 0.2449 -0.0317 0.0367  0.0242  79  GLU A N   
650  C  CA  . GLU A 98  ? 0.3061 0.2884 0.2555 -0.0269 0.0345  0.0206  79  GLU A CA  
651  C  C   . GLU A 98  ? 0.2972 0.2736 0.2484 -0.0253 0.0300  0.0199  79  GLU A C   
652  O  O   . GLU A 98  ? 0.3138 0.2910 0.2711 -0.0267 0.0291  0.0193  79  GLU A O   
653  C  CB  . GLU A 98  ? 0.2965 0.2884 0.2538 -0.0260 0.0366  0.0176  79  GLU A CB  
654  C  CG  . GLU A 98  ? 0.3438 0.3370 0.3031 -0.0213 0.0343  0.0139  79  GLU A CG  
655  C  CD  . GLU A 98  ? 0.5238 0.5256 0.4906 -0.0200 0.0359  0.0110  79  GLU A CD  
656  O  OE1 . GLU A 98  ? 0.4921 0.5007 0.4622 -0.0220 0.0396  0.0115  79  GLU A OE1 
657  O  OE2 . GLU A 98  ? 0.5544 0.5564 0.5240 -0.0168 0.0335  0.0083  79  GLU A OE2 
658  N  N   . ILE A 99  ? 0.2645 0.2355 0.2106 -0.0224 0.0272  0.0199  80  ILE A N   
659  C  CA  . ILE A 99  ? 0.2630 0.2302 0.2114 -0.0200 0.0232  0.0188  80  ILE A CA  
660  C  C   . ILE A 99  ? 0.2468 0.2199 0.2007 -0.0172 0.0226  0.0153  80  ILE A C   
661  O  O   . ILE A 99  ? 0.2604 0.2361 0.2121 -0.0153 0.0233  0.0139  80  ILE A O   
662  C  CB  . ILE A 99  ? 0.2855 0.2461 0.2271 -0.0177 0.0204  0.0202  80  ILE A CB  
663  C  CG1 . ILE A 99  ? 0.3189 0.2726 0.2539 -0.0202 0.0207  0.0240  80  ILE A CG1 
664  C  CG2 . ILE A 99  ? 0.3077 0.2663 0.2526 -0.0148 0.0167  0.0189  80  ILE A CG2 
665  C  CD1 . ILE A 99  ? 0.3458 0.2938 0.2733 -0.0179 0.0182  0.0256  80  ILE A CD1 
666  N  N   . SER A 100 ? 0.2311 0.2055 0.1914 -0.0168 0.0212  0.0138  81  SER A N   
667  C  CA  . SER A 100 ? 0.2023 0.1813 0.1677 -0.0141 0.0202  0.0108  81  SER A CA  
668  C  C   . SER A 100 ? 0.2202 0.1961 0.1875 -0.0121 0.0168  0.0103  81  SER A C   
669  O  O   . SER A 100 ? 0.2229 0.1946 0.1900 -0.0128 0.0156  0.0116  81  SER A O   
670  C  CB  . SER A 100 ? 0.2189 0.2044 0.1911 -0.0154 0.0221  0.0093  81  SER A CB  
671  O  OG  . SER A 100 ? 0.2298 0.2139 0.2053 -0.0176 0.0214  0.0100  81  SER A OG  
672  N  N   A MSE A 101 ? 0.2129 0.1909 0.1818 -0.0094 0.0153  0.0085  82  MSE A N   
673  N  N   B MSE A 101 ? 0.2064 0.1842 0.1750 -0.0094 0.0153  0.0086  82  MSE A N   
674  C  CA  A MSE A 101 ? 0.2207 0.1978 0.1926 -0.0074 0.0125  0.0079  82  MSE A CA  
675  C  CA  B MSE A 101 ? 0.2110 0.1882 0.1830 -0.0074 0.0125  0.0078  82  MSE A CA  
676  C  C   A MSE A 101 ? 0.2245 0.2063 0.2012 -0.0061 0.0122  0.0055  82  MSE A C   
677  C  C   B MSE A 101 ? 0.2111 0.1933 0.1879 -0.0063 0.0125  0.0055  82  MSE A C   
678  O  O   A MSE A 101 ? 0.2216 0.2045 0.1970 -0.0048 0.0118  0.0045  82  MSE A O   
679  O  O   B MSE A 101 ? 0.2158 0.1996 0.1913 -0.0052 0.0127  0.0043  82  MSE A O   
680  C  CB  A MSE A 101 ? 0.2428 0.2160 0.2105 -0.0056 0.0101  0.0091  82  MSE A CB  
681  C  CB  B MSE A 101 ? 0.2248 0.1988 0.1933 -0.0054 0.0100  0.0087  82  MSE A CB  
682  C  CG  A MSE A 101 ? 0.2421 0.2096 0.2061 -0.0063 0.0096  0.0115  82  MSE A CG  
683  C  CG  B MSE A 101 ? 0.2317 0.2002 0.1954 -0.0060 0.0097  0.0112  82  MSE A CG  
684  SE SE  A MSE A 101 ? 0.2420 0.2051 0.2000 -0.0040 0.0067  0.0134  82  MSE A SE  
685  SE SE  B MSE A 101 ? 0.2410 0.2060 0.2032 -0.0029 0.0058  0.0125  82  MSE A SE  
686  C  CE  A MSE A 101 ? 0.2313 0.1981 0.1961 -0.0011 0.0041  0.0119  82  MSE A CE  
687  C  CE  B MSE A 101 ? 0.2957 0.2636 0.2560 -0.0017 0.0046  0.0113  82  MSE A CE  
688  N  N   . HIS A 102 ? 0.2171 0.2011 0.1988 -0.0065 0.0122  0.0047  83  HIS A N   
689  C  CA  . HIS A 102 ? 0.2234 0.2113 0.2099 -0.0051 0.0115  0.0028  83  HIS A CA  
690  C  C   . HIS A 102 ? 0.2312 0.2177 0.2194 -0.0038 0.0092  0.0030  83  HIS A C   
691  O  O   . HIS A 102 ? 0.2325 0.2178 0.2220 -0.0043 0.0089  0.0034  83  HIS A O   
692  C  CB  . HIS A 102 ? 0.2103 0.2021 0.2011 -0.0065 0.0131  0.0019  83  HIS A CB  
693  C  CG  . HIS A 102 ? 0.2448 0.2395 0.2349 -0.0077 0.0158  0.0017  83  HIS A CG  
694  N  ND1 . HIS A 102 ? 0.2475 0.2409 0.2349 -0.0102 0.0177  0.0034  83  HIS A ND1 
695  C  CD2 . HIS A 102 ? 0.2723 0.2713 0.2641 -0.0067 0.0172  0.0000  83  HIS A CD2 
696  C  CE1 . HIS A 102 ? 0.2758 0.2733 0.2632 -0.0108 0.0203  0.0029  83  HIS A CE1 
697  N  NE2 . HIS A 102 ? 0.2811 0.2822 0.2713 -0.0084 0.0202  0.0007  83  HIS A NE2 
698  N  N   . MSE A 103 ? 0.2142 0.2007 0.2022 -0.0021 0.0075  0.0027  84  MSE A N   
699  C  CA  . MSE A 103 ? 0.2060 0.1918 0.1954 -0.0008 0.0054  0.0034  84  MSE A CA  
700  C  C   . MSE A 103 ? 0.2050 0.1937 0.1985 0.0000  0.0045  0.0023  84  MSE A C   
701  O  O   . MSE A 103 ? 0.1998 0.1893 0.1934 0.0004  0.0038  0.0015  84  MSE A O   
702  C  CB  . MSE A 103 ? 0.2181 0.2019 0.2044 0.0000  0.0039  0.0045  84  MSE A CB  
703  C  CG  . MSE A 103 ? 0.2517 0.2319 0.2336 -0.0005 0.0046  0.0060  84  MSE A CG  
704  SE SE  . MSE A 103 ? 0.2126 0.1904 0.1895 0.0004  0.0025  0.0074  84  MSE A SE  
705  C  CE  . MSE A 103 ? 0.2660 0.2450 0.2401 -0.0005 0.0041  0.0055  84  MSE A CE  
706  N  N   . GLY A 104 ? 0.1871 0.1768 0.1834 0.0000  0.0045  0.0023  85  GLY A N   
707  C  CA  . GLY A 104 ? 0.1818 0.1738 0.1816 0.0006  0.0035  0.0016  85  GLY A CA  
708  C  C   . GLY A 104 ? 0.1977 0.1899 0.1983 0.0016  0.0019  0.0028  85  GLY A C   
709  O  O   . GLY A 104 ? 0.2401 0.2313 0.2397 0.0022  0.0017  0.0040  85  GLY A O   
710  N  N   . HIS A 105 ? 0.1951 0.1886 0.1976 0.0018  0.0007  0.0025  86  HIS A N   
711  C  CA  . HIS A 105 ? 0.1739 0.1684 0.1780 0.0023  -0.0008 0.0039  86  HIS A CA  
712  C  C   . HIS A 105 ? 0.2043 0.2002 0.2113 0.0022  -0.0014 0.0038  86  HIS A C   
713  O  O   . HIS A 105 ? 0.1766 0.1724 0.1841 0.0022  -0.0013 0.0024  86  HIS A O   
714  C  CB  . HIS A 105 ? 0.1841 0.1779 0.1874 0.0020  -0.0025 0.0041  86  HIS A CB  
715  C  CG  . HIS A 105 ? 0.1771 0.1690 0.1769 0.0020  -0.0022 0.0041  86  HIS A CG  
716  N  ND1 . HIS A 105 ? 0.1950 0.1853 0.1919 0.0017  -0.0010 0.0028  86  HIS A ND1 
717  C  CD2 . HIS A 105 ? 0.1986 0.1902 0.1972 0.0024  -0.0031 0.0055  86  HIS A CD2 
718  C  CE1 . HIS A 105 ? 0.2230 0.2117 0.2166 0.0017  -0.0011 0.0034  86  HIS A CE1 
719  N  NE2 . HIS A 105 ? 0.2167 0.2059 0.2112 0.0022  -0.0025 0.0050  86  HIS A NE2 
720  N  N   . THR A 106 ? 0.1801 0.1777 0.1888 0.0024  -0.0022 0.0055  87  THR A N   
721  C  CA  . THR A 106 ? 0.1999 0.1985 0.2108 0.0021  -0.0032 0.0062  87  THR A CA  
722  C  C   . THR A 106 ? 0.1869 0.1851 0.1982 0.0023  -0.0030 0.0050  87  THR A C   
723  O  O   . THR A 106 ? 0.1839 0.1810 0.1958 0.0021  -0.0040 0.0042  87  THR A O   
724  C  CB  . THR A 106 ? 0.2175 0.2153 0.2290 0.0011  -0.0053 0.0067  87  THR A CB  
725  O  OG1 . THR A 106 ? 0.2089 0.2042 0.2184 0.0011  -0.0057 0.0048  87  THR A OG1 
726  C  CG2 . THR A 106 ? 0.2224 0.2221 0.2348 0.0008  -0.0060 0.0085  87  THR A CG2 
727  N  N   . PRO A 107 ? 0.1837 0.1827 0.1947 0.0027  -0.0017 0.0047  88  PRO A N   
728  C  CA  . PRO A 107 ? 0.1871 0.1862 0.1988 0.0029  -0.0018 0.0037  88  PRO A CA  
729  C  C   . PRO A 107 ? 0.1988 0.1985 0.2118 0.0030  -0.0031 0.0050  88  PRO A C   
730  O  O   . PRO A 107 ? 0.1849 0.1856 0.1980 0.0028  -0.0033 0.0069  88  PRO A O   
731  C  CB  . PRO A 107 ? 0.1851 0.1845 0.1955 0.0032  -0.0006 0.0034  88  PRO A CB  
732  C  CG  . PRO A 107 ? 0.1981 0.1977 0.2075 0.0037  -0.0001 0.0048  88  PRO A CG  
733  C  CD  . PRO A 107 ? 0.1936 0.1928 0.2032 0.0033  -0.0005 0.0052  88  PRO A CD  
734  N  N   . GLU A 108 ? 0.1816 0.1808 0.1954 0.0033  -0.0040 0.0040  89  GLU A N   
735  C  CA  . GLU A 108 ? 0.1675 0.1665 0.1820 0.0034  -0.0054 0.0051  89  GLU A CA  
736  C  C   . GLU A 108 ? 0.1812 0.1811 0.1958 0.0041  -0.0054 0.0040  89  GLU A C   
737  O  O   . GLU A 108 ? 0.2024 0.2024 0.2185 0.0047  -0.0059 0.0024  89  GLU A O   
738  C  CB  . GLU A 108 ? 0.1898 0.1866 0.2051 0.0034  -0.0071 0.0051  89  GLU A CB  
739  C  CG  . GLU A 108 ? 0.2024 0.1981 0.2176 0.0024  -0.0077 0.0061  89  GLU A CG  
740  C  CD  . GLU A 108 ? 0.2244 0.2167 0.2397 0.0025  -0.0096 0.0051  89  GLU A CD  
741  O  OE1 . GLU A 108 ? 0.2329 0.2230 0.2485 0.0024  -0.0113 0.0061  89  GLU A OE1 
742  O  OE2 . GLU A 108 ? 0.2270 0.2183 0.2414 0.0028  -0.0093 0.0033  89  GLU A OE2 
743  N  N   . ILE A 109 ? 0.1884 0.1893 0.2016 0.0041  -0.0048 0.0046  90  ILE A N   
744  C  CA  . ILE A 109 ? 0.1897 0.1913 0.2026 0.0045  -0.0052 0.0035  90  ILE A CA  
745  C  C   . ILE A 109 ? 0.1965 0.1980 0.2089 0.0050  -0.0069 0.0049  90  ILE A C   
746  O  O   . ILE A 109 ? 0.2066 0.2079 0.2171 0.0049  -0.0066 0.0068  90  ILE A O   
747  C  CB  . ILE A 109 ? 0.1837 0.1854 0.1944 0.0043  -0.0040 0.0030  90  ILE A CB  
748  C  CG1 . ILE A 109 ? 0.2011 0.2022 0.2116 0.0038  -0.0024 0.0023  90  ILE A CG1 
749  C  CG2 . ILE A 109 ? 0.1842 0.1865 0.1947 0.0042  -0.0050 0.0017  90  ILE A CG2 
750  C  CD1 . ILE A 109 ? 0.2175 0.2191 0.2301 0.0032  -0.0023 0.0008  90  ILE A CD1 
751  N  N   . THR A 110 ? 0.1882 0.1900 0.2023 0.0056  -0.0084 0.0039  91  THR A N   
752  C  CA  . THR A 110 ? 0.1884 0.1897 0.2017 0.0063  -0.0104 0.0050  91  THR A CA  
753  C  C   . THR A 110 ? 0.2072 0.2102 0.2203 0.0066  -0.0112 0.0037  91  THR A C   
754  O  O   . THR A 110 ? 0.1836 0.1885 0.1997 0.0067  -0.0115 0.0018  91  THR A O   
755  C  CB  . THR A 110 ? 0.2451 0.2451 0.2606 0.0073  -0.0121 0.0051  91  THR A CB  
756  O  OG1 . THR A 110 ? 0.2628 0.2608 0.2784 0.0067  -0.0116 0.0060  91  THR A OG1 
757  C  CG2 . THR A 110 ? 0.2379 0.2367 0.2521 0.0079  -0.0143 0.0069  91  THR A CG2 
758  N  N   . ILE A 111 ? 0.1950 0.1975 0.2046 0.0066  -0.0116 0.0047  92  ILE A N   
759  C  CA  . ILE A 111 ? 0.2076 0.2111 0.2164 0.0067  -0.0132 0.0035  92  ILE A CA  
760  C  C   . ILE A 111 ? 0.2137 0.2174 0.2238 0.0079  -0.0160 0.0042  92  ILE A C   
761  O  O   . ILE A 111 ? 0.2646 0.2665 0.2723 0.0084  -0.0168 0.0064  92  ILE A O   
762  C  CB  . ILE A 111 ? 0.2113 0.2137 0.2149 0.0066  -0.0127 0.0039  92  ILE A CB  
763  C  CG1 . ILE A 111 ? 0.1995 0.2012 0.2016 0.0061  -0.0100 0.0035  92  ILE A CG1 
764  C  CG2 . ILE A 111 ? 0.2345 0.2374 0.2369 0.0064  -0.0147 0.0022  92  ILE A CG2 
765  C  CD1 . ILE A 111 ? 0.1897 0.1917 0.1941 0.0051  -0.0091 0.0014  92  ILE A CD1 
766  N  N   . ASP A 112 ? 0.1894 0.1955 0.2034 0.0083  -0.0174 0.0025  93  ASP A N   
767  C  CA  . ASP A 112 ? 0.2152 0.2218 0.2316 0.0100  -0.0201 0.0030  93  ASP A CA  
768  C  C   . ASP A 112 ? 0.2138 0.2212 0.2284 0.0104  -0.0229 0.0032  93  ASP A C   
769  O  O   . ASP A 112 ? 0.2484 0.2548 0.2628 0.0119  -0.0253 0.0044  93  ASP A O   
770  C  CB  . ASP A 112 ? 0.2127 0.2225 0.2350 0.0108  -0.0199 0.0010  93  ASP A CB  
771  C  CG  . ASP A 112 ? 0.2649 0.2735 0.2884 0.0107  -0.0176 0.0007  93  ASP A CG  
772  O  OD1 . ASP A 112 ? 0.2591 0.2640 0.2802 0.0109  -0.0175 0.0023  93  ASP A OD1 
773  O  OD2 . ASP A 112 ? 0.2689 0.2801 0.2954 0.0103  -0.0160 -0.0010 93  ASP A OD2 
774  N  N   . SER A 113 ? 0.2168 0.2253 0.2298 0.0091  -0.0228 0.0019  94  SER A N   
775  C  CA  . SER A 113 ? 0.2264 0.2353 0.2368 0.0092  -0.0257 0.0018  94  SER A CA  
776  C  C   . SER A 113 ? 0.2365 0.2442 0.2426 0.0076  -0.0247 0.0007  94  SER A C   
777  O  O   . SER A 113 ? 0.2515 0.2577 0.2563 0.0068  -0.0218 0.0004  94  SER A O   
778  C  CB  . SER A 113 ? 0.2163 0.2295 0.2325 0.0099  -0.0285 0.0005  94  SER A CB  
779  O  OG  . SER A 113 ? 0.2044 0.2211 0.2246 0.0082  -0.0278 -0.0016 94  SER A OG  
780  N  N   . GLU A 114 ? 0.2325 0.2404 0.2362 0.0072  -0.0274 -0.0001 95  GLU A N   
781  C  CA  . GLU A 114 ? 0.2299 0.2359 0.2292 0.0057  -0.0270 -0.0017 95  GLU A CA  
782  C  C   . GLU A 114 ? 0.2343 0.2419 0.2379 0.0037  -0.0257 -0.0037 95  GLU A C   
783  O  O   . GLU A 114 ? 0.2447 0.2495 0.2447 0.0026  -0.0245 -0.0049 95  GLU A O   
784  C  CB  . GLU A 114 ? 0.2325 0.2378 0.2276 0.0057  -0.0308 -0.0023 95  GLU A CB  
785  C  CG  . GLU A 114 ? 0.2102 0.2195 0.2106 0.0045  -0.0342 -0.0040 95  GLU A CG  
786  C  CD  . GLU A 114 ? 0.2231 0.2366 0.2296 0.0061  -0.0366 -0.0029 95  GLU A CD  
787  O  OE1 . GLU A 114 ? 0.2415 0.2546 0.2493 0.0079  -0.0352 -0.0011 95  GLU A OE1 
788  O  OE2 . GLU A 114 ? 0.2449 0.2619 0.2548 0.0057  -0.0401 -0.0038 95  GLU A OE2 
789  N  N   . ASN A 115 ? 0.2118 0.2237 0.2229 0.0034  -0.0258 -0.0042 96  ASN A N   
790  C  CA  . ASN A 115 ? 0.2045 0.2186 0.2200 0.0012  -0.0247 -0.0058 96  ASN A CA  
791  C  C   . ASN A 115 ? 0.2013 0.2189 0.2232 0.0015  -0.0224 -0.0056 96  ASN A C   
792  O  O   . ASN A 115 ? 0.1951 0.2162 0.2218 -0.0001 -0.0218 -0.0067 96  ASN A O   
793  C  CB  . ASN A 115 ? 0.2395 0.2565 0.2574 -0.0005 -0.0281 -0.0072 96  ASN A CB  
794  C  CG  . ASN A 115 ? 0.2833 0.3052 0.3061 0.0009  -0.0311 -0.0068 96  ASN A CG  
795  O  OD1 . ASN A 115 ? 0.2262 0.2492 0.2512 0.0032  -0.0304 -0.0056 96  ASN A OD1 
796  N  ND2 . ASN A 115 ? 0.2941 0.3183 0.3180 -0.0002 -0.0348 -0.0077 96  ASN A ND2 
797  N  N   . THR A 116 ? 0.1735 0.1900 0.1951 0.0036  -0.0211 -0.0043 97  THR A N   
798  C  CA  . THR A 116 ? 0.1780 0.1965 0.2041 0.0043  -0.0190 -0.0043 97  THR A CA  
799  C  C   . THR A 116 ? 0.1866 0.2011 0.2092 0.0051  -0.0168 -0.0030 97  THR A C   
800  O  O   . THR A 116 ? 0.1915 0.2028 0.2095 0.0059  -0.0174 -0.0016 97  THR A O   
801  C  CB  . THR A 116 ? 0.1839 0.2063 0.2153 0.0065  -0.0208 -0.0043 97  THR A CB  
802  O  OG1 . THR A 116 ? 0.1886 0.2080 0.2168 0.0085  -0.0227 -0.0027 97  THR A OG1 
803  C  CG2 . THR A 116 ? 0.2004 0.2281 0.2365 0.0057  -0.0231 -0.0054 97  THR A CG2 
804  N  N   . ALA A 117 ? 0.1786 0.1936 0.2033 0.0049  -0.0144 -0.0034 98  ALA A N   
805  C  CA  . ALA A 117 ? 0.1747 0.1864 0.1968 0.0055  -0.0126 -0.0022 98  ALA A CA  
806  C  C   . ALA A 117 ? 0.1882 0.2009 0.2133 0.0058  -0.0109 -0.0029 98  ALA A C   
807  O  O   . ALA A 117 ? 0.1841 0.2005 0.2130 0.0054  -0.0102 -0.0043 98  ALA A O   
808  C  CB  . ALA A 117 ? 0.1984 0.2072 0.2161 0.0041  -0.0110 -0.0019 98  ALA A CB  
809  N  N   . THR A 118 ? 0.1810 0.1909 0.2043 0.0064  -0.0100 -0.0019 99  THR A N   
810  C  CA  . THR A 118 ? 0.1968 0.2066 0.2217 0.0070  -0.0087 -0.0025 99  THR A CA  
811  C  C   . THR A 118 ? 0.2021 0.2093 0.2239 0.0059  -0.0070 -0.0017 99  THR A C   
812  O  O   . THR A 118 ? 0.2221 0.2271 0.2411 0.0056  -0.0073 -0.0002 99  THR A O   
813  C  CB  . THR A 118 ? 0.1997 0.2079 0.2254 0.0090  -0.0103 -0.0021 99  THR A CB  
814  O  OG1 . THR A 118 ? 0.2019 0.2128 0.2307 0.0105  -0.0121 -0.0028 99  THR A OG1 
815  C  CG2 . THR A 118 ? 0.2469 0.2541 0.2732 0.0098  -0.0091 -0.0032 99  THR A CG2 
816  N  N   . GLY A 119 ? 0.1810 0.1884 0.2031 0.0054  -0.0052 -0.0026 100 GLY A N   
817  C  CA  . GLY A 119 ? 0.1767 0.1817 0.1961 0.0046  -0.0039 -0.0018 100 GLY A CA  
818  C  C   . GLY A 119 ? 0.1923 0.1965 0.2117 0.0050  -0.0031 -0.0024 100 GLY A C   
819  O  O   . GLY A 119 ? 0.2091 0.2151 0.2296 0.0049  -0.0018 -0.0038 100 GLY A O   
820  N  N   . ARG A 120 ? 0.1674 0.1690 0.1854 0.0052  -0.0039 -0.0014 101 ARG A N   
821  C  CA  . ARG A 120 ? 0.1817 0.1817 0.1986 0.0053  -0.0035 -0.0020 101 ARG A CA  
822  C  C   . ARG A 120 ? 0.1885 0.1880 0.2033 0.0041  -0.0022 -0.0013 101 ARG A C   
823  O  O   . ARG A 120 ? 0.2043 0.2035 0.2182 0.0035  -0.0023 0.0001  101 ARG A O   
824  C  CB  . ARG A 120 ? 0.2023 0.1994 0.2188 0.0058  -0.0054 -0.0013 101 ARG A CB  
825  C  CG  . ARG A 120 ? 0.2184 0.2148 0.2365 0.0073  -0.0071 -0.0018 101 ARG A CG  
826  C  CD  . ARG A 120 ? 0.2570 0.2492 0.2739 0.0073  -0.0091 -0.0011 101 ARG A CD  
827  N  NE  . ARG A 120 ? 0.2872 0.2772 0.3050 0.0091  -0.0110 -0.0017 101 ARG A NE  
828  C  CZ  . ARG A 120 ? 0.3597 0.3476 0.3772 0.0110  -0.0115 -0.0039 101 ARG A CZ  
829  N  NH1 . ARG A 120 ? 0.3287 0.3168 0.3450 0.0114  -0.0100 -0.0058 101 ARG A NH1 
830  N  NH2 . ARG A 120 ? 0.4379 0.4233 0.4562 0.0129  -0.0136 -0.0041 101 ARG A NH2 
831  N  N   . TRP A 121 ? 0.1725 0.1719 0.1862 0.0040  -0.0009 -0.0024 102 TRP A N   
832  C  CA  . TRP A 121 ? 0.1811 0.1795 0.1924 0.0031  0.0000  -0.0017 102 TRP A CA  
833  C  C   . TRP A 121 ? 0.1776 0.1742 0.1867 0.0034  -0.0001 -0.0025 102 TRP A C   
834  O  O   . TRP A 121 ? 0.1874 0.1844 0.1967 0.0043  0.0002  -0.0041 102 TRP A O   
835  C  CB  . TRP A 121 ? 0.1878 0.1875 0.1987 0.0022  0.0018  -0.0021 102 TRP A CB  
836  C  CG  . TRP A 121 ? 0.1666 0.1670 0.1784 0.0017  0.0017  -0.0015 102 TRP A CG  
837  C  CD1 . TRP A 121 ? 0.1711 0.1735 0.1853 0.0018  0.0013  -0.0022 102 TRP A CD1 
838  C  CD2 . TRP A 121 ? 0.1616 0.1605 0.1716 0.0014  0.0017  -0.0003 102 TRP A CD2 
839  N  NE1 . TRP A 121 ? 0.1790 0.1808 0.1924 0.0013  0.0009  -0.0015 102 TRP A NE1 
840  C  CE2 . TRP A 121 ? 0.1817 0.1813 0.1925 0.0013  0.0013  -0.0005 102 TRP A CE2 
841  C  CE3 . TRP A 121 ? 0.1584 0.1554 0.1661 0.0015  0.0019  0.0007  102 TRP A CE3 
842  C  CZ2 . TRP A 121 ? 0.1711 0.1691 0.1799 0.0014  0.0014  0.0001  102 TRP A CZ2 
843  C  CZ3 . TRP A 121 ? 0.1823 0.1783 0.1887 0.0018  0.0020  0.0015  102 TRP A CZ3 
844  C  CH2 . TRP A 121 ? 0.1742 0.1704 0.1809 0.0018  0.0019  0.0011  102 TRP A CH2 
845  N  N   . TYR A 122 ? 0.1658 0.1609 0.1729 0.0028  -0.0006 -0.0014 103 TYR A N   
846  C  CA  . TYR A 122 ? 0.1889 0.1819 0.1932 0.0029  -0.0012 -0.0020 103 TYR A CA  
847  C  C   . TYR A 122 ? 0.1777 0.1706 0.1793 0.0024  0.0005  -0.0018 103 TYR A C   
848  O  O   . TYR A 122 ? 0.1854 0.1781 0.1864 0.0018  0.0006  -0.0002 103 TYR A O   
849  C  CB  . TYR A 122 ? 0.2263 0.2179 0.2306 0.0024  -0.0035 -0.0005 103 TYR A CB  
850  C  CG  . TYR A 122 ? 0.2199 0.2088 0.2214 0.0023  -0.0051 -0.0012 103 TYR A CG  
851  C  CD1 . TYR A 122 ? 0.2901 0.2778 0.2877 0.0026  -0.0040 -0.0024 103 TYR A CD1 
852  C  CD2 . TYR A 122 ? 0.2366 0.2238 0.2388 0.0017  -0.0078 -0.0007 103 TYR A CD2 
853  C  CE1 . TYR A 122 ? 0.2811 0.2659 0.2753 0.0026  -0.0058 -0.0032 103 TYR A CE1 
854  C  CE2 . TYR A 122 ? 0.2534 0.2375 0.2526 0.0014  -0.0098 -0.0016 103 TYR A CE2 
855  C  CZ  . TYR A 122 ? 0.2713 0.2542 0.2664 0.0020  -0.0088 -0.0030 103 TYR A CZ  
856  O  OH  . TYR A 122 ? 0.2726 0.2520 0.2639 0.0019  -0.0110 -0.0041 103 TYR A OH  
857  N  N   . LEU A 123 ? 0.1799 0.1731 0.1797 0.0026  0.0021  -0.0032 104 LEU A N   
858  C  CA  . LEU A 123 ? 0.1792 0.1723 0.1763 0.0018  0.0041  -0.0028 104 LEU A CA  
859  C  C   . LEU A 123 ? 0.2035 0.1941 0.1958 0.0019  0.0037  -0.0029 104 LEU A C   
860  O  O   . LEU A 123 ? 0.2114 0.2011 0.2023 0.0029  0.0031  -0.0045 104 LEU A O   
861  C  CB  . LEU A 123 ? 0.2343 0.2302 0.2325 0.0017  0.0066  -0.0041 104 LEU A CB  
862  C  CG  . LEU A 123 ? 0.2976 0.2956 0.2986 0.0004  0.0077  -0.0034 104 LEU A CG  
863  C  CD1 . LEU A 123 ? 0.3187 0.3146 0.3167 -0.0010 0.0086  -0.0017 104 LEU A CD1 
864  C  CD2 . LEU A 123 ? 0.3507 0.3490 0.3550 0.0009  0.0059  -0.0031 104 LEU A CD2 
865  N  N   . GLU A 124 ? 0.2041 0.1932 0.1936 0.0012  0.0038  -0.0014 105 GLU A N   
866  C  CA  . GLU A 124 ? 0.2050 0.1919 0.1890 0.0011  0.0041  -0.0013 105 GLU A CA  
867  C  C   . GLU A 124 ? 0.1895 0.1768 0.1717 0.0000  0.0070  -0.0005 105 GLU A C   
868  O  O   . GLU A 124 ? 0.2173 0.2045 0.2009 -0.0008 0.0074  0.0007  105 GLU A O   
869  C  CB  . GLU A 124 ? 0.2246 0.2093 0.2066 0.0011  0.0017  0.0002  105 GLU A CB  
870  C  CG  . GLU A 124 ? 0.2876 0.2698 0.2635 0.0011  0.0015  0.0001  105 GLU A CG  
871  C  CD  . GLU A 124 ? 0.3661 0.3462 0.3394 0.0012  -0.0008 0.0018  105 GLU A CD  
872  O  OE1 . GLU A 124 ? 0.2824 0.2633 0.2589 0.0013  -0.0022 0.0035  105 GLU A OE1 
873  O  OE2 . GLU A 124 ? 0.3449 0.3228 0.3125 0.0013  -0.0013 0.0016  105 GLU A OE2 
874  N  N   . ASP A 125 ? 0.2136 0.2010 0.1920 0.0000  0.0089  -0.0014 106 ASP A N   
875  C  CA  . ASP A 125 ? 0.2347 0.2226 0.2109 -0.0015 0.0117  -0.0002 106 ASP A CA  
876  C  C   . ASP A 125 ? 0.2403 0.2252 0.2093 -0.0016 0.0119  0.0005  106 ASP A C   
877  O  O   . ASP A 125 ? 0.2399 0.2237 0.2056 -0.0003 0.0109  -0.0008 106 ASP A O   
878  C  CB  . ASP A 125 ? 0.2805 0.2728 0.2595 -0.0018 0.0146  -0.0016 106 ASP A CB  
879  C  CG  . ASP A 125 ? 0.3682 0.3617 0.3457 0.0001  0.0152  -0.0040 106 ASP A CG  
880  O  OD1 . ASP A 125 ? 0.3778 0.3705 0.3570 0.0017  0.0129  -0.0054 106 ASP A OD1 
881  O  OD2 . ASP A 125 ? 0.4203 0.4157 0.3950 0.0001  0.0180  -0.0045 106 ASP A OD2 
882  N  N   . ASN A 126 ? 0.2358 0.2185 0.2020 -0.0031 0.0127  0.0028  107 ASN A N   
883  C  CA  . ASN A 126 ? 0.2511 0.2308 0.2099 -0.0035 0.0132  0.0041  107 ASN A CA  
884  C  C   . ASN A 126 ? 0.2456 0.2260 0.2032 -0.0059 0.0166  0.0057  107 ASN A C   
885  O  O   . ASN A 126 ? 0.2713 0.2515 0.2324 -0.0074 0.0169  0.0069  107 ASN A O   
886  C  CB  . ASN A 126 ? 0.2593 0.2347 0.2154 -0.0031 0.0102  0.0060  107 ASN A CB  
887  C  CG  . ASN A 126 ? 0.3203 0.2953 0.2779 -0.0013 0.0065  0.0050  107 ASN A CG  
888  O  OD1 . ASN A 126 ? 0.3718 0.3486 0.3310 -0.0004 0.0059  0.0028  107 ASN A OD1 
889  N  ND2 . ASN A 126 ? 0.3815 0.3543 0.3387 -0.0009 0.0040  0.0068  107 ASN A ND2 
890  N  N   . LEU A 127 ? 0.2451 0.2264 0.1980 -0.0063 0.0192  0.0056  108 LEU A N   
891  C  CA  . LEU A 127 ? 0.2596 0.2422 0.2111 -0.0090 0.0228  0.0075  108 LEU A CA  
892  C  C   . LEU A 127 ? 0.2429 0.2216 0.1852 -0.0094 0.0233  0.0094  108 LEU A C   
893  O  O   . LEU A 127 ? 0.2574 0.2352 0.1947 -0.0074 0.0226  0.0081  108 LEU A O   
894  C  CB  . LEU A 127 ? 0.2593 0.2487 0.2145 -0.0091 0.0264  0.0057  108 LEU A CB  
895  C  CG  . LEU A 127 ? 0.2950 0.2889 0.2586 -0.0078 0.0257  0.0032  108 LEU A CG  
896  C  CD1 . LEU A 127 ? 0.3119 0.3125 0.2778 -0.0075 0.0295  0.0017  108 LEU A CD1 
897  C  CD2 . LEU A 127 ? 0.3404 0.3340 0.3097 -0.0096 0.0244  0.0044  108 LEU A CD2 
898  N  N   . ILE A 128 ? 0.2432 0.2189 0.1829 -0.0120 0.0243  0.0126  109 ILE A N   
899  C  CA  . ILE A 128 ? 0.2633 0.2349 0.1938 -0.0129 0.0251  0.0152  109 ILE A CA  
900  C  C   . ILE A 128 ? 0.2805 0.2536 0.2102 -0.0166 0.0292  0.0177  109 ILE A C   
901  O  O   . ILE A 128 ? 0.2915 0.2638 0.2254 -0.0191 0.0292  0.0192  109 ILE A O   
902  C  CB  . ILE A 128 ? 0.2958 0.2602 0.2227 -0.0124 0.0211  0.0174  109 ILE A CB  
903  C  CG1 . ILE A 128 ? 0.2964 0.2601 0.2245 -0.0091 0.0171  0.0152  109 ILE A CG1 
904  C  CG2 . ILE A 128 ? 0.3289 0.2884 0.2460 -0.0135 0.0218  0.0205  109 ILE A CG2 
905  C  CD1 . ILE A 128 ? 0.3913 0.3500 0.3190 -0.0080 0.0131  0.0170  109 ILE A CD1 
906  N  N   . PHE A 129 ? 0.2828 0.2582 0.2070 -0.0171 0.0325  0.0181  110 PHE A N   
907  C  CA  . PHE A 129 ? 0.2956 0.2728 0.2182 -0.0209 0.0367  0.0211  110 PHE A CA  
908  C  C   . PHE A 129 ? 0.3188 0.2883 0.2315 -0.0223 0.0359  0.0249  110 PHE A C   
909  O  O   . PHE A 129 ? 0.3101 0.2770 0.2148 -0.0202 0.0351  0.0248  110 PHE A O   
910  C  CB  . PHE A 129 ? 0.3285 0.3137 0.2512 -0.0205 0.0414  0.0194  110 PHE A CB  
911  C  CG  . PHE A 129 ? 0.3604 0.3533 0.2933 -0.0195 0.0425  0.0163  110 PHE A CG  
912  C  CD1 . PHE A 129 ? 0.3889 0.3830 0.3241 -0.0154 0.0404  0.0123  110 PHE A CD1 
913  C  CD2 . PHE A 129 ? 0.3975 0.3959 0.3377 -0.0229 0.0452  0.0175  110 PHE A CD2 
914  C  CE1 . PHE A 129 ? 0.4248 0.4254 0.3692 -0.0144 0.0410  0.0096  110 PHE A CE1 
915  C  CE2 . PHE A 129 ? 0.4455 0.4511 0.3951 -0.0218 0.0457  0.0147  110 PHE A CE2 
916  C  CZ  . PHE A 129 ? 0.4212 0.4278 0.3727 -0.0174 0.0437  0.0108  110 PHE A CZ  
917  N  N   . THR A 130 ? 0.3359 0.3015 0.2488 -0.0259 0.0359  0.0284  111 THR A N   
918  C  CA  . THR A 130 ? 0.3569 0.3138 0.2607 -0.0270 0.0344  0.0324  111 THR A CA  
919  C  C   . THR A 130 ? 0.3942 0.3515 0.2918 -0.0307 0.0387  0.0360  111 THR A C   
920  O  O   . THR A 130 ? 0.4503 0.4009 0.3384 -0.0311 0.0379  0.0391  111 THR A O   
921  C  CB  . THR A 130 ? 0.3568 0.3067 0.2632 -0.0282 0.0310  0.0343  111 THR A CB  
922  O  OG1 . THR A 130 ? 0.3647 0.3175 0.2775 -0.0322 0.0333  0.0350  111 THR A OG1 
923  C  CG2 . THR A 130 ? 0.3564 0.3056 0.2679 -0.0244 0.0268  0.0312  111 THR A CG2 
924  N  N   . ASP A 131 ? 0.3897 0.3548 0.2928 -0.0335 0.0432  0.0358  112 ASP A N   
925  C  CA  . ASP A 131 ? 0.4392 0.4059 0.3380 -0.0379 0.0479  0.0398  112 ASP A CA  
926  C  C   . ASP A 131 ? 0.4256 0.4042 0.3309 -0.0384 0.0528  0.0377  112 ASP A C   
927  O  O   . ASP A 131 ? 0.4360 0.4201 0.3489 -0.0356 0.0521  0.0335  112 ASP A O   
928  C  CB  . ASP A 131 ? 0.4757 0.4369 0.3761 -0.0430 0.0472  0.0439  112 ASP A CB  
929  C  CG  . ASP A 131 ? 0.6155 0.5644 0.5099 -0.0420 0.0420  0.0459  112 ASP A CG  
930  O  OD1 . ASP A 131 ? 0.5823 0.5249 0.4665 -0.0427 0.0420  0.0495  112 ASP A OD1 
931  O  OD2 . ASP A 131 ? 0.5379 0.4834 0.4374 -0.0401 0.0379  0.0439  112 ASP A OD2 
932  N  N   . GLY A 132 ? 0.5002 0.4831 0.4024 -0.0419 0.0580  0.0407  113 GLY A N   
933  C  CA  . GLY A 132 ? 0.4650 0.4604 0.3736 -0.0423 0.0633  0.0390  113 GLY A CA  
934  C  C   . GLY A 132 ? 0.5019 0.5021 0.4057 -0.0374 0.0656  0.0356  113 GLY A C   
935  O  O   . GLY A 132 ? 0.4495 0.4432 0.3430 -0.0346 0.0638  0.0354  113 GLY A O   
936  N  N   . LYS A 133 ? 0.4979 0.5094 0.4092 -0.0361 0.0694  0.0328  114 LYS A N   
937  C  CA  . LYS A 133 ? 0.5790 0.5963 0.4866 -0.0315 0.0726  0.0293  114 LYS A CA  
938  C  C   . LYS A 133 ? 0.5852 0.5971 0.4899 -0.0258 0.0679  0.0248  114 LYS A C   
939  O  O   . LYS A 133 ? 0.5211 0.5322 0.4175 -0.0221 0.0688  0.0226  114 LYS A O   
940  C  CB  . LYS A 133 ? 0.6040 0.6345 0.5223 -0.0311 0.0770  0.0271  114 LYS A CB  
941  N  N   . TYR A 134 ? 0.4901 0.4984 0.4016 -0.0252 0.0628  0.0233  115 TYR A N   
942  C  CA  . TYR A 134 ? 0.4716 0.4751 0.3816 -0.0205 0.0580  0.0194  115 TYR A CA  
943  C  C   . TYR A 134 ? 0.4232 0.4157 0.3268 -0.0208 0.0529  0.0213  115 TYR A C   
944  O  O   . TYR A 134 ? 0.3447 0.3333 0.2496 -0.0179 0.0482  0.0188  115 TYR A O   
945  C  CB  . TYR A 134 ? 0.4593 0.4669 0.3813 -0.0190 0.0560  0.0161  115 TYR A CB  
946  C  CG  . TYR A 134 ? 0.6162 0.6350 0.5458 -0.0182 0.0605  0.0140  115 TYR A CG  
947  C  CD1 . TYR A 134 ? 0.6657 0.6886 0.5913 -0.0141 0.0634  0.0109  115 TYR A CD1 
948  C  CD2 . TYR A 134 ? 0.6998 0.7250 0.6403 -0.0211 0.0616  0.0149  115 TYR A CD2 
949  C  CE1 . TYR A 134 ? 0.7579 0.7915 0.6908 -0.0127 0.0676  0.0088  115 TYR A CE1 
950  C  CE2 . TYR A 134 ? 0.8219 0.8580 0.7699 -0.0201 0.0655  0.0131  115 TYR A CE2 
951  C  CZ  . TYR A 134 ? 0.8341 0.8746 0.7785 -0.0157 0.0686  0.0100  115 TYR A CZ  
952  O  OH  . TYR A 134 ? 0.9567 1.0084 0.9089 -0.0141 0.0724  0.0081  115 TYR A OH  
953  N  N   . LYS A 135 ? 0.4053 0.3929 0.3018 -0.0241 0.0536  0.0259  116 LYS A N   
954  C  CA  . LYS A 135 ? 0.3916 0.3688 0.2814 -0.0240 0.0487  0.0281  116 LYS A CA  
955  C  C   . LYS A 135 ? 0.3781 0.3517 0.2622 -0.0193 0.0450  0.0249  116 LYS A C   
956  O  O   . LYS A 135 ? 0.3676 0.3435 0.2453 -0.0172 0.0473  0.0231  116 LYS A O   
957  C  CB  . LYS A 135 ? 0.4363 0.4087 0.3163 -0.0273 0.0506  0.0332  116 LYS A CB  
958  C  CG  . LYS A 135 ? 0.5128 0.4744 0.3866 -0.0272 0.0454  0.0358  116 LYS A CG  
959  C  CD  . LYS A 135 ? 0.5920 0.5484 0.4573 -0.0312 0.0472  0.0415  116 LYS A CD  
960  C  CE  . LYS A 135 ? 0.6764 0.6218 0.5361 -0.0307 0.0418  0.0442  116 LYS A CE  
961  N  NZ  . LYS A 135 ? 0.7743 0.7133 0.6249 -0.0344 0.0431  0.0501  116 LYS A NZ  
962  N  N   . ASN A 136 ? 0.3547 0.3229 0.2413 -0.0178 0.0394  0.0242  117 ASN A N   
963  C  CA  . ASN A 136 ? 0.3420 0.3063 0.2245 -0.0140 0.0349  0.0216  117 ASN A CA  
964  C  C   . ASN A 136 ? 0.3268 0.2959 0.2150 -0.0107 0.0343  0.0165  117 ASN A C   
965  O  O   . ASN A 136 ? 0.3366 0.3026 0.2224 -0.0080 0.0302  0.0142  117 ASN A O   
966  C  CB  . ASN A 136 ? 0.3842 0.3438 0.2536 -0.0132 0.0345  0.0230  117 ASN A CB  
967  C  CG  . ASN A 136 ? 0.5012 0.4540 0.3645 -0.0157 0.0333  0.0281  117 ASN A CG  
968  O  OD1 . ASN A 136 ? 0.5405 0.4891 0.4079 -0.0161 0.0296  0.0297  117 ASN A OD1 
969  N  ND2 . ASN A 136 ? 0.5563 0.5079 0.4097 -0.0172 0.0365  0.0309  117 ASN A ND2 
970  N  N   . VAL A 137 ? 0.3257 0.3020 0.2218 -0.0112 0.0378  0.0148  118 VAL A N   
971  C  CA  . VAL A 137 ? 0.3019 0.2820 0.2043 -0.0082 0.0368  0.0102  118 VAL A CA  
972  C  C   . VAL A 137 ? 0.2767 0.2541 0.1863 -0.0079 0.0320  0.0099  118 VAL A C   
973  O  O   . VAL A 137 ? 0.3017 0.2786 0.2162 -0.0104 0.0317  0.0123  118 VAL A O   
974  C  CB  . VAL A 137 ? 0.3182 0.3071 0.2278 -0.0084 0.0417  0.0086  118 VAL A CB  
975  C  CG1 . VAL A 137 ? 0.3328 0.3246 0.2502 -0.0055 0.0397  0.0045  118 VAL A CG1 
976  C  CG2 . VAL A 137 ? 0.3402 0.3326 0.2425 -0.0076 0.0466  0.0082  118 VAL A CG2 
977  N  N   . GLY A 138 ? 0.2706 0.2463 0.1805 -0.0050 0.0283  0.0069  119 GLY A N   
978  C  CA  . GLY A 138 ? 0.2612 0.2364 0.1793 -0.0044 0.0244  0.0060  119 GLY A CA  
979  C  C   . GLY A 138 ? 0.2510 0.2303 0.1746 -0.0022 0.0247  0.0021  119 GLY A C   
980  O  O   . GLY A 138 ? 0.2534 0.2334 0.1726 -0.0001 0.0258  -0.0004 119 GLY A O   
981  N  N   . ILE A 139 ? 0.2529 0.2346 0.1857 -0.0025 0.0237  0.0016  120 ILE A N   
982  C  CA  . ILE A 139 ? 0.2519 0.2368 0.1906 -0.0004 0.0232  -0.0016 120 ILE A CA  
983  C  C   . ILE A 139 ? 0.2362 0.2190 0.1803 -0.0002 0.0189  -0.0015 120 ILE A C   
984  O  O   . ILE A 139 ? 0.2600 0.2428 0.2081 -0.0020 0.0185  0.0006  120 ILE A O   
985  C  CB  . ILE A 139 ? 0.2720 0.2637 0.2173 -0.0010 0.0272  -0.0022 120 ILE A CB  
986  C  CG1 . ILE A 139 ? 0.2972 0.2923 0.2379 -0.0013 0.0320  -0.0020 120 ILE A CG1 
987  C  CG2 . ILE A 139 ? 0.2782 0.2725 0.2295 0.0015  0.0261  -0.0055 120 ILE A CG2 
988  C  CD1 . ILE A 139 ? 0.3075 0.3101 0.2553 -0.0028 0.0360  -0.0015 120 ILE A CD1 
989  N  N   . ASN A 140 ? 0.2352 0.2163 0.1793 0.0017  0.0158  -0.0038 121 ASN A N   
990  C  CA  . ASN A 140 ? 0.2260 0.2061 0.1758 0.0019  0.0121  -0.0038 121 ASN A CA  
991  C  C   . ASN A 140 ? 0.2130 0.1950 0.1674 0.0036  0.0117  -0.0067 121 ASN A C   
992  O  O   . ASN A 140 ? 0.2428 0.2247 0.1939 0.0054  0.0126  -0.0092 121 ASN A O   
993  C  CB  . ASN A 140 ? 0.2315 0.2069 0.1771 0.0023  0.0078  -0.0035 121 ASN A CB  
994  C  CG  . ASN A 140 ? 0.2739 0.2467 0.2146 0.0012  0.0072  -0.0005 121 ASN A CG  
995  O  OD1 . ASN A 140 ? 0.3026 0.2760 0.2452 -0.0001 0.0088  0.0016  121 ASN A OD1 
996  N  ND2 . ASN A 140 ? 0.3153 0.2844 0.2494 0.0018  0.0045  -0.0006 121 ASN A ND2 
997  N  N   . GLY A 141 ? 0.1999 0.1833 0.1613 0.0034  0.0102  -0.0064 122 GLY A N   
998  C  CA  . GLY A 141 ? 0.2193 0.2038 0.1849 0.0049  0.0093  -0.0087 122 GLY A CA  
999  C  C   . GLY A 141 ? 0.2301 0.2149 0.2019 0.0044  0.0067  -0.0078 122 GLY A C   
1000 O  O   . GLY A 141 ? 0.2140 0.1984 0.1873 0.0030  0.0058  -0.0054 122 GLY A O   
1001 N  N   . GLY A 142 ? 0.2048 0.1901 0.1801 0.0057  0.0058  -0.0096 123 GLY A N   
1002 C  CA  . GLY A 142 ? 0.1939 0.1798 0.1750 0.0053  0.0038  -0.0087 123 GLY A CA  
1003 C  C   . GLY A 142 ? 0.2026 0.1910 0.1878 0.0068  0.0048  -0.0104 123 GLY A C   
1004 O  O   . GLY A 142 ? 0.2277 0.2161 0.2110 0.0086  0.0059  -0.0127 123 GLY A O   
1005 N  N   . ALA A 143 ? 0.2045 0.1949 0.1951 0.0062  0.0042  -0.0094 124 ALA A N   
1006 C  CA  . ALA A 143 ? 0.2046 0.1975 0.1996 0.0076  0.0047  -0.0107 124 ALA A CA  
1007 C  C   . ALA A 143 ? 0.2069 0.1998 0.2062 0.0071  0.0026  -0.0094 124 ALA A C   
1008 O  O   . ALA A 143 ? 0.1846 0.1776 0.1846 0.0055  0.0020  -0.0073 124 ALA A O   
1009 C  CB  . ALA A 143 ? 0.2150 0.2129 0.2121 0.0074  0.0081  -0.0109 124 ALA A CB  
1010 N  N   . PHE A 144 ? 0.1838 0.1766 0.1856 0.0087  0.0014  -0.0105 125 PHE A N   
1011 C  CA  . PHE A 144 ? 0.1751 0.1685 0.1809 0.0084  -0.0001 -0.0093 125 PHE A CA  
1012 C  C   . PHE A 144 ? 0.1951 0.1933 0.2048 0.0090  0.0016  -0.0098 125 PHE A C   
1013 O  O   . PHE A 144 ? 0.2082 0.2079 0.2191 0.0111  0.0023  -0.0117 125 PHE A O   
1014 C  CB  . PHE A 144 ? 0.1878 0.1774 0.1936 0.0096  -0.0029 -0.0099 125 PHE A CB  
1015 C  CG  . PHE A 144 ? 0.1897 0.1746 0.1921 0.0087  -0.0051 -0.0095 125 PHE A CG  
1016 C  CD1 . PHE A 144 ? 0.2366 0.2216 0.2392 0.0065  -0.0061 -0.0071 125 PHE A CD1 
1017 C  CD2 . PHE A 144 ? 0.2162 0.1968 0.2154 0.0101  -0.0066 -0.0116 125 PHE A CD2 
1018 C  CE1 . PHE A 144 ? 0.2461 0.2277 0.2466 0.0054  -0.0085 -0.0065 125 PHE A CE1 
1019 C  CE2 . PHE A 144 ? 0.2456 0.2217 0.2419 0.0088  -0.0093 -0.0112 125 PHE A CE2 
1020 C  CZ  . PHE A 144 ? 0.2339 0.2111 0.2312 0.0063  -0.0102 -0.0085 125 PHE A CZ  
1021 N  N   . TYR A 145 ? 0.1881 0.1886 0.1998 0.0073  0.0021  -0.0082 126 TYR A N   
1022 C  CA  . TYR A 145 ? 0.1756 0.1806 0.1912 0.0073  0.0032  -0.0084 126 TYR A CA  
1023 C  C   . TYR A 145 ? 0.1785 0.1833 0.1967 0.0076  0.0010  -0.0076 126 TYR A C   
1024 O  O   . TYR A 145 ? 0.1796 0.1817 0.1965 0.0069  -0.0005 -0.0061 126 TYR A O   
1025 C  CB  . TYR A 145 ? 0.1885 0.1951 0.2038 0.0049  0.0049  -0.0073 126 TYR A CB  
1026 C  CG  . TYR A 145 ? 0.1812 0.1899 0.1953 0.0044  0.0077  -0.0080 126 TYR A CG  
1027 C  CD1 . TYR A 145 ? 0.2061 0.2121 0.2157 0.0043  0.0084  -0.0080 126 TYR A CD1 
1028 C  CD2 . TYR A 145 ? 0.1920 0.2059 0.2098 0.0040  0.0095  -0.0086 126 TYR A CD2 
1029 C  CE1 . TYR A 145 ? 0.2060 0.2139 0.2138 0.0038  0.0112  -0.0084 126 TYR A CE1 
1030 C  CE2 . TYR A 145 ? 0.1753 0.1918 0.1921 0.0033  0.0124  -0.0089 126 TYR A CE2 
1031 C  CZ  . TYR A 145 ? 0.2052 0.2185 0.2167 0.0033  0.0133  -0.0087 126 TYR A CZ  
1032 O  OH  . TYR A 145 ? 0.2234 0.2391 0.2332 0.0026  0.0164  -0.0088 126 TYR A OH  
1033 N  N   . THR A 146 ? 0.1793 0.1875 0.2012 0.0089  0.0008  -0.0085 127 THR A N   
1034 C  CA  . THR A 146 ? 0.2038 0.2125 0.2280 0.0091  -0.0010 -0.0077 127 THR A CA  
1035 C  C   . THR A 146 ? 0.1973 0.2111 0.2249 0.0082  -0.0002 -0.0079 127 THR A C   
1036 O  O   . THR A 146 ? 0.1881 0.2061 0.2193 0.0095  0.0004  -0.0092 127 THR A O   
1037 C  CB  . THR A 146 ? 0.2444 0.2514 0.2697 0.0117  -0.0031 -0.0083 127 THR A CB  
1038 O  OG1 . THR A 146 ? 0.2327 0.2344 0.2545 0.0119  -0.0042 -0.0081 127 THR A OG1 
1039 C  CG2 . THR A 146 ? 0.2324 0.2394 0.2592 0.0117  -0.0053 -0.0070 127 THR A CG2 
1040 N  N   . ASP A 147 ? 0.2024 0.2158 0.2291 0.0061  -0.0003 -0.0067 128 ASP A N   
1041 C  CA  . ASP A 147 ? 0.1863 0.2034 0.2155 0.0044  0.0000  -0.0068 128 ASP A CA  
1042 C  C   . ASP A 147 ? 0.1852 0.2036 0.2166 0.0052  -0.0024 -0.0066 128 ASP A C   
1043 O  O   . ASP A 147 ? 0.1787 0.1940 0.2083 0.0062  -0.0042 -0.0057 128 ASP A O   
1044 C  CB  . ASP A 147 ? 0.1775 0.1920 0.2035 0.0021  0.0005  -0.0057 128 ASP A CB  
1045 C  CG  . ASP A 147 ? 0.2114 0.2243 0.2348 0.0009  0.0027  -0.0055 128 ASP A CG  
1046 O  OD1 . ASP A 147 ? 0.2151 0.2294 0.2388 0.0015  0.0042  -0.0062 128 ASP A OD1 
1047 O  OD2 . ASP A 147 ? 0.2291 0.2390 0.2495 -0.0003 0.0028  -0.0046 128 ASP A OD2 
1048 N  N   . LYS A 148 ? 0.1740 0.1970 0.2091 0.0043  -0.0025 -0.0072 129 LYS A N   
1049 C  CA  . LYS A 148 ? 0.1770 0.2015 0.2139 0.0046  -0.0052 -0.0070 129 LYS A CA  
1050 C  C   . LYS A 148 ? 0.1791 0.2039 0.2153 0.0015  -0.0053 -0.0068 129 LYS A C   
1051 O  O   . LYS A 148 ? 0.1723 0.1996 0.2102 -0.0004 -0.0035 -0.0073 129 LYS A O   
1052 C  CB  . LYS A 148 ? 0.2008 0.2309 0.2434 0.0064  -0.0061 -0.0080 129 LYS A CB  
1053 C  CG  . LYS A 148 ? 0.2347 0.2639 0.2778 0.0098  -0.0062 -0.0086 129 LYS A CG  
1054 C  CD  . LYS A 148 ? 0.2572 0.2811 0.2971 0.0112  -0.0087 -0.0074 129 LYS A CD  
1055 C  CE  . LYS A 148 ? 0.3107 0.3316 0.3499 0.0141  -0.0091 -0.0078 129 LYS A CE  
1056 N  NZ  . LYS A 148 ? 0.3557 0.3719 0.3923 0.0149  -0.0119 -0.0062 129 LYS A NZ  
1057 N  N   . TYR A 149 ? 0.1619 0.1839 0.1952 0.0013  -0.0073 -0.0063 130 TYR A N   
1058 C  CA  . TYR A 149 ? 0.1770 0.1975 0.2082 -0.0011 -0.0079 -0.0063 130 TYR A CA  
1059 C  C   . TYR A 149 ? 0.1905 0.2129 0.2230 -0.0011 -0.0110 -0.0067 130 TYR A C   
1060 O  O   . TYR A 149 ? 0.1842 0.2073 0.2173 0.0010  -0.0128 -0.0063 130 TYR A O   
1061 C  CB  . TYR A 149 ? 0.1973 0.2119 0.2223 -0.0012 -0.0073 -0.0055 130 TYR A CB  
1062 C  CG  . TYR A 149 ? 0.1862 0.1985 0.2095 -0.0007 -0.0049 -0.0049 130 TYR A CG  
1063 C  CD1 . TYR A 149 ? 0.1902 0.2017 0.2129 -0.0024 -0.0029 -0.0051 130 TYR A CD1 
1064 C  CD2 . TYR A 149 ? 0.1881 0.1989 0.2102 0.0011  -0.0049 -0.0041 130 TYR A CD2 
1065 C  CE1 . TYR A 149 ? 0.1876 0.1971 0.2083 -0.0019 -0.0011 -0.0045 130 TYR A CE1 
1066 C  CE2 . TYR A 149 ? 0.2033 0.2122 0.2239 0.0014  -0.0032 -0.0036 130 TYR A CE2 
1067 C  CZ  . TYR A 149 ? 0.1832 0.1915 0.2030 0.0000  -0.0014 -0.0038 130 TYR A CZ  
1068 O  OH  . TYR A 149 ? 0.1987 0.2051 0.2167 0.0003  0.0000  -0.0033 130 TYR A OH  
1069 N  N   . GLU A 150 ? 0.1893 0.2119 0.2217 -0.0037 -0.0118 -0.0073 131 GLU A N   
1070 C  CA  . GLU A 150 ? 0.2183 0.2418 0.2507 -0.0040 -0.0152 -0.0077 131 GLU A CA  
1071 C  C   . GLU A 150 ? 0.2090 0.2277 0.2363 -0.0062 -0.0160 -0.0082 131 GLU A C   
1072 O  O   . GLU A 150 ? 0.1887 0.2050 0.2146 -0.0082 -0.0143 -0.0083 131 GLU A O   
1073 C  CB  . GLU A 150 ? 0.3072 0.3379 0.3469 -0.0047 -0.0166 -0.0083 131 GLU A CB  
1074 C  CG  . GLU A 150 ? 0.3349 0.3687 0.3782 -0.0083 -0.0159 -0.0088 131 GLU A CG  
1075 C  CD  . GLU A 150 ? 0.4284 0.4709 0.4800 -0.0087 -0.0175 -0.0093 131 GLU A CD  
1076 O  OE1 . GLU A 150 ? 0.5040 0.5485 0.5569 -0.0076 -0.0210 -0.0095 131 GLU A OE1 
1077 O  OE2 . GLU A 150 ? 0.3267 0.3745 0.3835 -0.0100 -0.0151 -0.0093 131 GLU A OE2 
1078 N  N   . LYS A 151 ? 0.2112 0.2279 0.2350 -0.0056 -0.0189 -0.0084 132 LYS A N   
1079 C  CA  . LYS A 151 ? 0.2199 0.2311 0.2374 -0.0069 -0.0200 -0.0092 132 LYS A CA  
1080 C  C   . LYS A 151 ? 0.2405 0.2540 0.2601 -0.0092 -0.0236 -0.0103 132 LYS A C   
1081 O  O   . LYS A 151 ? 0.2207 0.2378 0.2426 -0.0082 -0.0263 -0.0103 132 LYS A O   
1082 C  CB  . LYS A 151 ? 0.2152 0.2222 0.2260 -0.0043 -0.0203 -0.0085 132 LYS A CB  
1083 C  CG  . LYS A 151 ? 0.2349 0.2355 0.2383 -0.0048 -0.0203 -0.0095 132 LYS A CG  
1084 C  CD  . LYS A 151 ? 0.2608 0.2584 0.2577 -0.0019 -0.0201 -0.0087 132 LYS A CD  
1085 C  CE  . LYS A 151 ? 0.3113 0.3027 0.3010 -0.0015 -0.0190 -0.0096 132 LYS A CE  
1086 N  NZ  . LYS A 151 ? 0.3066 0.2964 0.2904 0.0012  -0.0183 -0.0086 132 LYS A NZ  
1087 N  N   . ILE A 152 ? 0.2502 0.2615 0.2693 -0.0125 -0.0238 -0.0113 133 ILE A N   
1088 C  CA  . ILE A 152 ? 0.2917 0.3050 0.3133 -0.0156 -0.0273 -0.0124 133 ILE A CA  
1089 C  C   . ILE A 152 ? 0.3207 0.3258 0.3345 -0.0173 -0.0287 -0.0138 133 ILE A C   
1090 O  O   . ILE A 152 ? 0.3061 0.3063 0.3170 -0.0181 -0.0263 -0.0138 133 ILE A O   
1091 C  CB  . ILE A 152 ? 0.3126 0.3323 0.3427 -0.0187 -0.0263 -0.0121 133 ILE A CB  
1092 C  CG1 . ILE A 152 ? 0.3215 0.3494 0.3589 -0.0164 -0.0250 -0.0112 133 ILE A CG1 
1093 C  CG2 . ILE A 152 ? 0.3737 0.3953 0.4065 -0.0228 -0.0301 -0.0131 133 ILE A CG2 
1094 C  CD1 . ILE A 152 ? 0.3707 0.4050 0.4157 -0.0185 -0.0224 -0.0107 133 ILE A CD1 
1095 N  N   . ASP A 153 ? 0.3716 0.3747 0.3815 -0.0174 -0.0326 -0.0150 134 ASP A N   
1096 C  CA  . ASP A 153 ? 0.3847 0.3791 0.3861 -0.0185 -0.0344 -0.0167 134 ASP A CA  
1097 C  C   . ASP A 153 ? 0.3927 0.3799 0.3868 -0.0160 -0.0311 -0.0167 134 ASP A C   
1098 O  O   . ASP A 153 ? 0.4810 0.4619 0.4714 -0.0177 -0.0307 -0.0177 134 ASP A O   
1099 C  CB  . ASP A 153 ? 0.5386 0.5323 0.5429 -0.0236 -0.0365 -0.0178 134 ASP A CB  
1100 C  CG  . ASP A 153 ? 0.6301 0.6319 0.6423 -0.0262 -0.0402 -0.0178 134 ASP A CG  
1101 O  OD1 . ASP A 153 ? 0.6714 0.6767 0.6839 -0.0241 -0.0427 -0.0178 134 ASP A OD1 
1102 O  OD2 . ASP A 153 ? 0.6016 0.6068 0.6201 -0.0305 -0.0407 -0.0176 134 ASP A OD2 
1103 N  N   . GLY A 154 ? 0.4064 0.3948 0.3990 -0.0122 -0.0287 -0.0154 135 GLY A N   
1104 C  CA  . GLY A 154 ? 0.3578 0.3407 0.3439 -0.0093 -0.0256 -0.0152 135 GLY A CA  
1105 C  C   . GLY A 154 ? 0.3519 0.3351 0.3410 -0.0092 -0.0217 -0.0139 135 GLY A C   
1106 O  O   . GLY A 154 ? 0.3816 0.3613 0.3663 -0.0067 -0.0192 -0.0135 135 GLY A O   
1107 N  N   . GLN A 155 ? 0.3102 0.2980 0.3066 -0.0117 -0.0211 -0.0132 136 GLN A N   
1108 C  CA  . GLN A 155 ? 0.2883 0.2761 0.2871 -0.0120 -0.0178 -0.0122 136 GLN A CA  
1109 C  C   . GLN A 155 ? 0.2186 0.2137 0.2242 -0.0112 -0.0162 -0.0107 136 GLN A C   
1110 O  O   . GLN A 155 ? 0.2354 0.2363 0.2465 -0.0122 -0.0178 -0.0107 136 GLN A O   
1111 C  CB  . GLN A 155 ? 0.3189 0.3047 0.3193 -0.0162 -0.0184 -0.0127 136 GLN A CB  
1112 C  CG  . GLN A 155 ? 0.3883 0.3744 0.3912 -0.0172 -0.0152 -0.0114 136 GLN A CG  
1113 C  CD  . GLN A 155 ? 0.5811 0.5608 0.5780 -0.0148 -0.0131 -0.0111 136 GLN A CD  
1114 O  OE1 . GLN A 155 ? 0.6356 0.6085 0.6260 -0.0138 -0.0141 -0.0123 136 GLN A OE1 
1115 N  NE2 . GLN A 155 ? 0.5942 0.5761 0.5932 -0.0136 -0.0102 -0.0096 136 GLN A NE2 
1116 N  N   . TRP A 156 ? 0.2146 0.2092 0.2198 -0.0093 -0.0132 -0.0095 137 TRP A N   
1117 C  CA  . TRP A 156 ? 0.2156 0.2158 0.2263 -0.0085 -0.0115 -0.0083 137 TRP A CA  
1118 C  C   . TRP A 156 ? 0.2126 0.2151 0.2275 -0.0110 -0.0098 -0.0081 137 TRP A C   
1119 O  O   . TRP A 156 ? 0.2144 0.2127 0.2268 -0.0126 -0.0088 -0.0081 137 TRP A O   
1120 C  CB  . TRP A 156 ? 0.2190 0.2177 0.2271 -0.0055 -0.0094 -0.0072 137 TRP A CB  
1121 C  CG  . TRP A 156 ? 0.1935 0.1921 0.1991 -0.0031 -0.0106 -0.0068 137 TRP A CG  
1122 C  CD1 . TRP A 156 ? 0.1979 0.1926 0.1975 -0.0017 -0.0108 -0.0068 137 TRP A CD1 
1123 C  CD2 . TRP A 156 ? 0.1994 0.2021 0.2082 -0.0019 -0.0118 -0.0061 137 TRP A CD2 
1124 N  NE1 . TRP A 156 ? 0.2096 0.2058 0.2083 0.0000  -0.0119 -0.0060 137 TRP A NE1 
1125 C  CE2 . TRP A 156 ? 0.2073 0.2079 0.2114 0.0000  -0.0127 -0.0055 137 TRP A CE2 
1126 C  CE3 . TRP A 156 ? 0.1787 0.1863 0.1935 -0.0019 -0.0122 -0.0059 137 TRP A CE3 
1127 C  CZ2 . TRP A 156 ? 0.2101 0.2131 0.2153 0.0013  -0.0141 -0.0044 137 TRP A CZ2 
1128 C  CZ3 . TRP A 156 ? 0.1751 0.1846 0.1910 0.0000  -0.0137 -0.0052 137 TRP A CZ3 
1129 C  CH2 . TRP A 156 ? 0.1891 0.1961 0.2001 0.0014  -0.0148 -0.0043 137 TRP A CH2 
1130 N  N   . TYR A 157 ? 0.1903 0.1993 0.2114 -0.0110 -0.0094 -0.0078 138 TYR A N   
1131 C  CA  . TYR A 157 ? 0.1798 0.1925 0.2054 -0.0130 -0.0074 -0.0075 138 TYR A CA  
1132 C  C   . TYR A 157 ? 0.2051 0.2220 0.2339 -0.0105 -0.0056 -0.0070 138 TYR A C   
1133 O  O   . TYR A 157 ? 0.1842 0.2027 0.2139 -0.0080 -0.0067 -0.0071 138 TYR A O   
1134 C  CB  . TYR A 157 ? 0.1896 0.2074 0.2206 -0.0160 -0.0090 -0.0080 138 TYR A CB  
1135 C  CG  . TYR A 157 ? 0.2028 0.2162 0.2308 -0.0190 -0.0113 -0.0087 138 TYR A CG  
1136 C  CD1 . TYR A 157 ? 0.2092 0.2191 0.2358 -0.0224 -0.0103 -0.0083 138 TYR A CD1 
1137 C  CD2 . TYR A 157 ? 0.2336 0.2455 0.2596 -0.0185 -0.0147 -0.0097 138 TYR A CD2 
1138 C  CE1 . TYR A 157 ? 0.2327 0.2375 0.2562 -0.0252 -0.0128 -0.0091 138 TYR A CE1 
1139 C  CE2 . TYR A 157 ? 0.2460 0.2530 0.2684 -0.0212 -0.0172 -0.0107 138 TYR A CE2 
1140 C  CZ  . TYR A 157 ? 0.2750 0.2782 0.2963 -0.0246 -0.0162 -0.0104 138 TYR A CZ  
1141 O  OH  . TYR A 157 ? 0.3118 0.3088 0.3290 -0.0273 -0.0189 -0.0115 138 TYR A OH  
1142 N  N   . ILE A 158 ? 0.1824 0.2009 0.2128 -0.0114 -0.0029 -0.0065 139 ILE A N   
1143 C  CA  . ILE A 158 ? 0.1931 0.2154 0.2262 -0.0093 -0.0011 -0.0065 139 ILE A CA  
1144 C  C   . ILE A 158 ? 0.1914 0.2217 0.2316 -0.0100 -0.0011 -0.0070 139 ILE A C   
1145 O  O   . ILE A 158 ? 0.2246 0.2576 0.2674 -0.0132 -0.0005 -0.0068 139 ILE A O   
1146 C  CB  . ILE A 158 ? 0.1958 0.2157 0.2262 -0.0098 0.0017  -0.0057 139 ILE A CB  
1147 C  CG1 . ILE A 158 ? 0.2103 0.2231 0.2345 -0.0093 0.0016  -0.0051 139 ILE A CG1 
1148 C  CG2 . ILE A 158 ? 0.2514 0.2743 0.2835 -0.0074 0.0033  -0.0060 139 ILE A CG2 
1149 C  CD1 . ILE A 158 ? 0.2249 0.2348 0.2460 -0.0102 0.0039  -0.0042 139 ILE A CD1 
1150 N  N   A LYS A 159 ? 0.2008 0.2348 0.2442 -0.0070 -0.0018 -0.0075 140 LYS A N   
1151 N  N   B LYS A 159 ? 0.1997 0.2338 0.2432 -0.0070 -0.0018 -0.0076 140 LYS A N   
1152 C  CA  A LYS A 159 ? 0.2238 0.2660 0.2744 -0.0065 -0.0020 -0.0082 140 LYS A CA  
1153 C  CA  B LYS A 159 ? 0.2177 0.2602 0.2684 -0.0067 -0.0016 -0.0082 140 LYS A CA  
1154 C  C   A LYS A 159 ? 0.2460 0.2919 0.2988 -0.0047 0.0010  -0.0085 140 LYS A C   
1155 C  C   B LYS A 159 ? 0.2269 0.2721 0.2788 -0.0051 0.0017  -0.0084 140 LYS A C   
1156 O  O   A LYS A 159 ? 0.2540 0.3066 0.3118 -0.0058 0.0028  -0.0087 140 LYS A O   
1157 O  O   B LYS A 159 ? 0.1993 0.2496 0.2546 -0.0069 0.0041  -0.0083 140 LYS A O   
1158 C  CB  A LYS A 159 ? 0.2487 0.2922 0.3011 -0.0038 -0.0053 -0.0086 140 LYS A CB  
1159 C  CB  B LYS A 159 ? 0.2490 0.2938 0.3024 -0.0037 -0.0044 -0.0087 140 LYS A CB  
1160 C  CG  A LYS A 159 ? 0.2805 0.3328 0.3408 -0.0029 -0.0061 -0.0093 140 LYS A CG  
1161 C  CG  B LYS A 159 ? 0.2914 0.3330 0.3423 -0.0044 -0.0080 -0.0085 140 LYS A CG  
1162 C  CD  A LYS A 159 ? 0.2879 0.3404 0.3491 0.0003  -0.0094 -0.0095 140 LYS A CD  
1163 C  CD  B LYS A 159 ? 0.3326 0.3764 0.3859 -0.0012 -0.0108 -0.0088 140 LYS A CD  
1164 N  N   A GLU A 160 ? 0.2289 0.2704 0.2777 -0.0019 0.0016  -0.0087 141 GLU A N   
1165 N  N   B GLU A 160 ? 0.2125 0.2540 0.2612 -0.0019 0.0018  -0.0087 141 GLU A N   
1166 C  CA  A GLU A 160 ? 0.2270 0.2706 0.2764 0.0002  0.0043  -0.0093 141 GLU A CA  
1167 C  CA  B GLU A 160 ? 0.2167 0.2604 0.2662 0.0004  0.0043  -0.0094 141 GLU A CA  
1168 C  C   A GLU A 160 ? 0.2047 0.2416 0.2487 0.0026  0.0041  -0.0094 141 GLU A C   
1169 C  C   B GLU A 160 ? 0.1989 0.2356 0.2426 0.0023  0.0043  -0.0093 141 GLU A C   
1170 O  O   A GLU A 160 ? 0.2021 0.2338 0.2427 0.0027  0.0020  -0.0087 141 GLU A O   
1171 O  O   B GLU A 160 ? 0.1752 0.2064 0.2150 0.0019  0.0026  -0.0085 141 GLU A O   
1172 C  CB  A GLU A 160 ? 0.2238 0.2750 0.2800 0.0027  0.0042  -0.0105 141 GLU A CB  
1173 C  CB  B GLU A 160 ? 0.2284 0.2784 0.2840 0.0035  0.0034  -0.0106 141 GLU A CB  
1174 C  CG  A GLU A 160 ? 0.2301 0.2800 0.2871 0.0062  0.0010  -0.0110 141 GLU A CG  
1175 C  CG  B GLU A 160 ? 0.2192 0.2652 0.2733 0.0066  0.0003  -0.0107 141 GLU A CG  
1176 C  CD  A GLU A 160 ? 0.2667 0.3245 0.3307 0.0092  0.0009  -0.0122 141 GLU A CD  
1177 C  CD  B GLU A 160 ? 0.2758 0.3266 0.3350 0.0105  -0.0006 -0.0119 141 GLU A CD  
1178 O  OE1 A GLU A 160 ? 0.3781 0.4395 0.4438 0.0110  0.0037  -0.0132 141 GLU A OE1 
1179 O  OE1 B GLU A 160 ? 0.3192 0.3745 0.3812 0.0124  0.0018  -0.0130 141 GLU A OE1 
1180 O  OE2 A GLU A 160 ? 0.2193 0.2799 0.2870 0.0099  -0.0020 -0.0121 141 GLU A OE2 
1181 O  OE2 B GLU A 160 ? 0.2965 0.3465 0.3566 0.0119  -0.0039 -0.0116 141 GLU A OE2 
1182 N  N   . THR A 161 ? 0.1850 0.2223 0.2280 0.0043  0.0063  -0.0102 142 THR A N   
1183 C  CA  . THR A 161 ? 0.1996 0.2306 0.2374 0.0061  0.0060  -0.0103 142 THR A CA  
1184 C  C   . THR A 161 ? 0.1877 0.2201 0.2260 0.0093  0.0072  -0.0119 142 THR A C   
1185 O  O   . THR A 161 ? 0.1848 0.2236 0.2274 0.0103  0.0089  -0.0129 142 THR A O   
1186 C  CB  . THR A 161 ? 0.2267 0.2531 0.2592 0.0036  0.0072  -0.0091 142 THR A CB  
1187 O  OG1 . THR A 161 ? 0.2123 0.2328 0.2405 0.0049  0.0060  -0.0089 142 THR A OG1 
1188 C  CG2 . THR A 161 ? 0.2286 0.2573 0.2603 0.0027  0.0105  -0.0094 142 THR A CG2 
1189 N  N   . GLY A 162 ? 0.1911 0.2176 0.2251 0.0110  0.0062  -0.0122 143 GLY A N   
1190 C  CA  . GLY A 162 ? 0.1963 0.2219 0.2285 0.0138  0.0074  -0.0140 143 GLY A CA  
1191 C  C   . GLY A 162 ? 0.2151 0.2338 0.2411 0.0132  0.0069  -0.0136 143 GLY A C   
1192 O  O   . GLY A 162 ? 0.2165 0.2313 0.2405 0.0115  0.0051  -0.0120 143 GLY A O   
1193 N  N   . TYR A 163 ? 0.2064 0.2238 0.2292 0.0149  0.0084  -0.0152 144 TYR A N   
1194 C  CA  . TYR A 163 ? 0.1793 0.1904 0.1962 0.0142  0.0076  -0.0149 144 TYR A CA  
1195 C  C   . TYR A 163 ? 0.1809 0.1885 0.1940 0.0172  0.0074  -0.0172 144 TYR A C   
1196 O  O   . TYR A 163 ? 0.2127 0.2235 0.2271 0.0199  0.0092  -0.0192 144 TYR A O   
1197 C  CB  . TYR A 163 ? 0.1857 0.1974 0.1998 0.0113  0.0097  -0.0136 144 TYR A CB  
1198 C  CG  . TYR A 163 ? 0.1997 0.2156 0.2131 0.0116  0.0134  -0.0145 144 TYR A CG  
1199 C  CD1 . TYR A 163 ? 0.2070 0.2297 0.2252 0.0105  0.0156  -0.0141 144 TYR A CD1 
1200 C  CD2 . TYR A 163 ? 0.2517 0.2651 0.2596 0.0129  0.0146  -0.0158 144 TYR A CD2 
1201 C  CE1 . TYR A 163 ? 0.2059 0.2333 0.2237 0.0104  0.0193  -0.0145 144 TYR A CE1 
1202 C  CE2 . TYR A 163 ? 0.2498 0.2673 0.2565 0.0131  0.0183  -0.0165 144 TYR A CE2 
1203 C  CZ  . TYR A 163 ? 0.2540 0.2789 0.2659 0.0118  0.0209  -0.0157 144 TYR A CZ  
1204 O  OH  . TYR A 163 ? 0.2891 0.3187 0.3000 0.0118  0.0249  -0.0160 144 TYR A OH  
1205 N  N   . VAL A 164 ? 0.1916 0.1927 0.2002 0.0166  0.0052  -0.0169 145 VAL A N   
1206 C  CA  . VAL A 164 ? 0.2075 0.2039 0.2109 0.0184  0.0047  -0.0189 145 VAL A CA  
1207 C  C   . VAL A 164 ? 0.2331 0.2277 0.2315 0.0162  0.0055  -0.0180 145 VAL A C   
1208 O  O   . VAL A 164 ? 0.2276 0.2202 0.2254 0.0136  0.0040  -0.0159 145 VAL A O   
1209 C  CB  . VAL A 164 ? 0.2744 0.2640 0.2766 0.0192  0.0006  -0.0191 145 VAL A CB  
1210 C  CG1 . VAL A 164 ? 0.3083 0.2918 0.3042 0.0205  -0.0004 -0.0212 145 VAL A CG1 
1211 C  CG2 . VAL A 164 ? 0.3364 0.3271 0.3430 0.0217  -0.0004 -0.0199 145 VAL A CG2 
1212 N  N   . ARG A 165 ? 0.2317 0.2270 0.2261 0.0174  0.0080  -0.0197 146 ARG A N   
1213 C  CA  . ARG A 165 ? 0.2520 0.2453 0.2407 0.0156  0.0087  -0.0189 146 ARG A CA  
1214 C  C   . ARG A 165 ? 0.2583 0.2442 0.2419 0.0159  0.0052  -0.0199 146 ARG A C   
1215 O  O   . ARG A 165 ? 0.2662 0.2488 0.2466 0.0186  0.0045  -0.0226 146 ARG A O   
1216 C  CB  . ARG A 165 ? 0.2996 0.2967 0.2856 0.0168  0.0129  -0.0203 146 ARG A CB  
1217 C  CG  . ARG A 165 ? 0.3523 0.3492 0.3335 0.0145  0.0146  -0.0186 146 ARG A CG  
1218 C  CD  . ARG A 165 ? 0.3789 0.3801 0.3645 0.0114  0.0161  -0.0158 146 ARG A CD  
1219 N  NE  . ARG A 165 ? 0.4072 0.4085 0.3883 0.0093  0.0182  -0.0141 146 ARG A NE  
1220 C  CZ  . ARG A 165 ? 0.3629 0.3615 0.3423 0.0067  0.0169  -0.0116 146 ARG A CZ  
1221 N  NH1 . ARG A 165 ? 0.3382 0.3344 0.3203 0.0059  0.0137  -0.0104 146 ARG A NH1 
1222 N  NH2 . ARG A 165 ? 0.3471 0.3455 0.3221 0.0051  0.0190  -0.0100 146 ARG A NH2 
1223 N  N   . ILE A 166 ? 0.2366 0.2199 0.2193 0.0133  0.0028  -0.0176 147 ILE A N   
1224 C  CA  . ILE A 166 ? 0.2492 0.2262 0.2277 0.0130  -0.0008 -0.0181 147 ILE A CA  
1225 C  C   . ILE A 166 ? 0.2594 0.2340 0.2303 0.0139  0.0000  -0.0200 147 ILE A C   
1226 O  O   . ILE A 166 ? 0.2364 0.2059 0.2028 0.0157  -0.0017 -0.0226 147 ILE A O   
1227 C  CB  . ILE A 166 ? 0.2647 0.2412 0.2447 0.0100  -0.0030 -0.0151 147 ILE A CB  
1228 C  CG1 . ILE A 166 ? 0.2630 0.2420 0.2497 0.0091  -0.0036 -0.0132 147 ILE A CG1 
1229 C  CG2 . ILE A 166 ? 0.2685 0.2395 0.2447 0.0092  -0.0070 -0.0154 147 ILE A CG2 
1230 C  CD1 . ILE A 166 ? 0.2489 0.2293 0.2375 0.0067  -0.0044 -0.0102 147 ILE A CD1 
1231 N  N   . PHE A 167 ? 0.2391 0.2167 0.2082 0.0127  0.0027  -0.0185 148 PHE A N   
1232 C  CA  . PHE A 167 ? 0.2779 0.2543 0.2397 0.0136  0.0044  -0.0199 148 PHE A CA  
1233 C  C   . PHE A 167 ? 0.2577 0.2387 0.2192 0.0121  0.0083  -0.0178 148 PHE A C   
1234 O  O   . PHE A 167 ? 0.2390 0.2229 0.2053 0.0101  0.0088  -0.0153 148 PHE A O   
1235 C  CB  . PHE A 167 ? 0.3685 0.3388 0.3240 0.0127  0.0006  -0.0200 148 PHE A CB  
1236 C  CG  . PHE A 167 ? 0.3625 0.3334 0.3163 0.0102  0.0003  -0.0170 148 PHE A CG  
1237 C  CD1 . PHE A 167 ? 0.4574 0.4303 0.4170 0.0081  -0.0007 -0.0141 148 PHE A CD1 
1238 C  CD2 . PHE A 167 ? 0.4401 0.4090 0.3860 0.0103  0.0011  -0.0173 148 PHE A CD2 
1239 C  CE1 . PHE A 167 ? 0.4052 0.3782 0.3630 0.0064  -0.0011 -0.0115 148 PHE A CE1 
1240 C  CE2 . PHE A 167 ? 0.4001 0.3691 0.3442 0.0083  0.0005  -0.0144 148 PHE A CE2 
1241 C  CZ  . PHE A 167 ? 0.4520 0.4230 0.4022 0.0065  -0.0005 -0.0116 148 PHE A CZ  
1242 N  N   . GLU A 168 ? 0.2443 0.2254 0.1995 0.0132  0.0109  -0.0190 149 GLU A N   
1243 C  CA  . GLU A 168 ? 0.2490 0.2335 0.2024 0.0116  0.0145  -0.0169 149 GLU A CA  
1244 C  C   . GLU A 168 ? 0.2458 0.2268 0.1893 0.0123  0.0150  -0.0178 149 GLU A C   
1245 O  O   . GLU A 168 ? 0.2734 0.2522 0.2124 0.0150  0.0149  -0.0210 149 GLU A O   
1246 C  CB  . GLU A 168 ? 0.2689 0.2603 0.2271 0.0122  0.0190  -0.0172 149 GLU A CB  
1247 C  CG  . GLU A 168 ? 0.2818 0.2767 0.2393 0.0095  0.0224  -0.0144 149 GLU A CG  
1248 C  CD  . GLU A 168 ? 0.3749 0.3775 0.3385 0.0094  0.0266  -0.0143 149 GLU A CD  
1249 O  OE1 . GLU A 168 ? 0.3936 0.3990 0.3650 0.0089  0.0257  -0.0139 149 GLU A OE1 
1250 O  OE2 . GLU A 168 ? 0.4298 0.4361 0.3908 0.0099  0.0306  -0.0146 149 GLU A OE2 
1251 N  N   . GLU A 169 ? 0.2425 0.2225 0.1821 0.0100  0.0151  -0.0151 150 GLU A N   
1252 C  CA  . GLU A 169 ? 0.2433 0.2201 0.1728 0.0104  0.0156  -0.0154 150 GLU A CA  
1253 C  C   . GLU A 169 ? 0.2556 0.2355 0.1831 0.0084  0.0196  -0.0124 150 GLU A C   
1254 O  O   . GLU A 169 ? 0.2536 0.2350 0.1859 0.0060  0.0197  -0.0094 150 GLU A O   
1255 C  CB  . GLU A 169 ? 0.2612 0.2319 0.1862 0.0097  0.0104  -0.0149 150 GLU A CB  
1256 C  CG  . GLU A 169 ? 0.2867 0.2573 0.2152 0.0071  0.0085  -0.0111 150 GLU A CG  
1257 C  CD  . GLU A 169 ? 0.3116 0.2774 0.2368 0.0065  0.0032  -0.0104 150 GLU A CD  
1258 O  OE1 . GLU A 169 ? 0.3091 0.2710 0.2283 0.0077  0.0007  -0.0127 150 GLU A OE1 
1259 O  OE2 . GLU A 169 ? 0.3160 0.2822 0.2446 0.0049  0.0016  -0.0074 150 GLU A OE2 
1260 N  N   . HIS A 170 ? 0.2646 0.2451 0.1848 0.0095  0.0230  -0.0133 151 HIS A N   
1261 C  CA  . HIS A 170 ? 0.2498 0.2325 0.1662 0.0075  0.0269  -0.0104 151 HIS A CA  
1262 C  C   . HIS A 170 ? 0.2569 0.2340 0.1616 0.0077  0.0255  -0.0099 151 HIS A C   
1263 O  O   . HIS A 170 ? 0.2794 0.2532 0.1775 0.0102  0.0241  -0.0131 151 HIS A O   
1264 C  CB  . HIS A 170 ? 0.2800 0.2695 0.1975 0.0085  0.0329  -0.0115 151 HIS A CB  
1265 C  CG  . HIS A 170 ? 0.2953 0.2912 0.2240 0.0083  0.0345  -0.0117 151 HIS A CG  
1266 N  ND1 . HIS A 170 ? 0.3106 0.3139 0.2434 0.0069  0.0396  -0.0103 151 HIS A ND1 
1267 C  CD2 . HIS A 170 ? 0.3035 0.2999 0.2403 0.0092  0.0318  -0.0132 151 HIS A CD2 
1268 C  CE1 . HIS A 170 ? 0.3151 0.3231 0.2580 0.0069  0.0395  -0.0109 151 HIS A CE1 
1269 N  NE2 . HIS A 170 ? 0.3194 0.3231 0.2645 0.0085  0.0349  -0.0127 151 HIS A NE2 
1270 N  N   . PHE A 171 ? 0.2593 0.2349 0.1608 0.0050  0.0258  -0.0060 152 PHE A N   
1271 C  CA  . PHE A 171 ? 0.2908 0.2608 0.1813 0.0050  0.0238  -0.0050 152 PHE A CA  
1272 C  C   . PHE A 171 ? 0.2985 0.2685 0.1855 0.0021  0.0264  -0.0004 152 PHE A C   
1273 O  O   . PHE A 171 ? 0.3006 0.2740 0.1946 0.0000  0.0285  0.0017  152 PHE A O   
1274 C  CB  . PHE A 171 ? 0.3049 0.2696 0.1957 0.0052  0.0172  -0.0051 152 PHE A CB  
1275 C  CG  . PHE A 171 ? 0.2804 0.2460 0.1805 0.0033  0.0151  -0.0026 152 PHE A CG  
1276 C  CD1 . PHE A 171 ? 0.3078 0.2714 0.2066 0.0013  0.0144  0.0014  152 PHE A CD1 
1277 C  CD2 . PHE A 171 ? 0.2811 0.2493 0.1909 0.0038  0.0141  -0.0042 152 PHE A CD2 
1278 C  CE1 . PHE A 171 ? 0.3292 0.2934 0.2360 0.0000  0.0128  0.0033  152 PHE A CE1 
1279 C  CE2 . PHE A 171 ? 0.2889 0.2582 0.2066 0.0023  0.0126  -0.0021 152 PHE A CE2 
1280 C  CZ  . PHE A 171 ? 0.3079 0.2751 0.2240 0.0006  0.0120  0.0015  152 PHE A CZ  
1281 N  N   . MSE A 172 ? 0.3075 0.2732 0.1832 0.0022  0.0260  0.0006  153 MSE A N   
1282 C  CA  . MSE A 172 ? 0.3359 0.3000 0.2067 -0.0005 0.0278  0.0053  153 MSE A CA  
1283 C  C   . MSE A 172 ? 0.3581 0.3162 0.2276 -0.0011 0.0220  0.0076  153 MSE A C   
1284 O  O   . MSE A 172 ? 0.3959 0.3501 0.2608 0.0006  0.0175  0.0060  153 MSE A O   
1285 C  CB  . MSE A 172 ? 0.3518 0.3149 0.2101 0.0000  0.0309  0.0057  153 MSE A CB  
1286 C  CG  . MSE A 172 ? 0.4080 0.3779 0.2672 0.0008  0.0373  0.0037  153 MSE A CG  
1287 SE SE  . MSE A 172 ? 0.3864 0.3642 0.2568 -0.0031 0.0429  0.0073  153 MSE A SE  
1288 C  CE  . MSE A 172 ? 0.5022 0.4743 0.3638 -0.0073 0.0432  0.0140  153 MSE A CE  
1289 N  N   . ARG A 173 ? 0.3267 0.2843 0.2007 -0.0035 0.0220  0.0113  154 ARG A N   
1290 C  CA  . ARG A 173 ? 0.3392 0.2916 0.2126 -0.0037 0.0170  0.0138  154 ARG A CA  
1291 C  C   . ARG A 173 ? 0.3634 0.3106 0.2250 -0.0044 0.0165  0.0170  154 ARG A C   
1292 O  O   . ARG A 173 ? 0.3853 0.3330 0.2415 -0.0060 0.0210  0.0191  154 ARG A O   
1293 C  CB  . ARG A 173 ? 0.3111 0.2643 0.1934 -0.0056 0.0173  0.0163  154 ARG A CB  
1294 C  CG  . ARG A 173 ? 0.3103 0.2679 0.2041 -0.0050 0.0168  0.0136  154 ARG A CG  
1295 C  CD  . ARG A 173 ? 0.2917 0.2508 0.1928 -0.0073 0.0188  0.0156  154 ARG A CD  
1296 N  NE  . ARG A 173 ? 0.3104 0.2639 0.2087 -0.0083 0.0165  0.0194  154 ARG A NE  
1297 C  CZ  . ARG A 173 ? 0.2897 0.2404 0.1912 -0.0070 0.0122  0.0199  154 ARG A CZ  
1298 N  NH1 . ARG A 173 ? 0.3018 0.2549 0.2095 -0.0051 0.0094  0.0173  154 ARG A NH1 
1299 N  NH2 . ARG A 173 ? 0.3043 0.2495 0.2023 -0.0075 0.0105  0.0234  154 ARG A NH2 
1300 N  N   . ASP A 174 ? 0.3532 0.2956 0.2110 -0.0031 0.0111  0.0178  155 ASP A N   
1301 C  CA  . ASP A 174 ? 0.3758 0.3126 0.2225 -0.0035 0.0096  0.0212  155 ASP A CA  
1302 C  C   . ASP A 174 ? 0.3916 0.3263 0.2388 -0.0061 0.0118  0.0259  155 ASP A C   
1303 O  O   . ASP A 174 ? 0.3276 0.2617 0.1827 -0.0064 0.0099  0.0271  155 ASP A O   
1304 C  CB  . ASP A 174 ? 0.4258 0.3589 0.2712 -0.0016 0.0026  0.0210  155 ASP A CB  
1305 C  CG  . ASP A 174 ? 0.4759 0.4031 0.3094 -0.0014 0.0001  0.0242  155 ASP A CG  
1306 O  OD1 . ASP A 174 ? 0.4529 0.3778 0.2792 -0.0030 0.0035  0.0274  155 ASP A OD1 
1307 O  OD2 . ASP A 174 ? 0.5644 0.4893 0.3955 0.0002  -0.0055 0.0236  155 ASP A OD2 
1308 N  N   . PRO A 175 ? 0.4290 0.3621 0.2673 -0.0079 0.0157  0.0287  156 PRO A N   
1309 C  CA  . PRO A 175 ? 0.4518 0.3822 0.2909 -0.0108 0.0175  0.0334  156 PRO A CA  
1310 C  C   . PRO A 175 ? 0.3978 0.3207 0.2336 -0.0102 0.0123  0.0368  156 PRO A C   
1311 O  O   . PRO A 175 ? 0.4168 0.3364 0.2546 -0.0121 0.0127  0.0403  156 PRO A O   
1312 C  CB  . PRO A 175 ? 0.5083 0.4390 0.3379 -0.0131 0.0230  0.0355  156 PRO A CB  
1313 C  CG  . PRO A 175 ? 0.5368 0.4668 0.3567 -0.0105 0.0216  0.0332  156 PRO A CG  
1314 C  CD  . PRO A 175 ? 0.4920 0.4256 0.3195 -0.0077 0.0189  0.0280  156 PRO A CD  
1315 N  N   . LYS A 176 ? 0.3863 0.3068 0.2180 -0.0074 0.0071  0.0357  157 LYS A N   
1316 C  CA  . LYS A 176 ? 0.4073 0.3220 0.2376 -0.0059 0.0014  0.0385  157 LYS A CA  
1317 C  C   . LYS A 176 ? 0.3570 0.2732 0.1995 -0.0047 -0.0014 0.0376  157 LYS A C   
1318 O  O   . LYS A 176 ? 0.3549 0.2667 0.1977 -0.0034 -0.0052 0.0402  157 LYS A O   
1319 C  CB  . LYS A 176 ? 0.4742 0.3867 0.2964 -0.0035 -0.0034 0.0377  157 LYS A CB  
1320 C  CG  . LYS A 176 ? 0.5786 0.4884 0.3866 -0.0042 -0.0012 0.0388  157 LYS A CG  
1321 C  CD  . LYS A 176 ? 0.7121 0.6186 0.5114 -0.0018 -0.0071 0.0383  157 LYS A CD  
1322 C  CE  . LYS A 176 ? 0.8484 0.7592 0.6517 0.0000  -0.0096 0.0329  157 LYS A CE  
1323 N  NZ  . LYS A 176 ? 0.9340 0.8482 0.7337 -0.0004 -0.0044 0.0294  157 LYS A NZ  
1324 N  N   . ILE A 177 ? 0.3346 0.2570 0.1869 -0.0047 0.0003  0.0339  158 ILE A N   
1325 C  CA  . ILE A 177 ? 0.3235 0.2477 0.1873 -0.0037 -0.0015 0.0331  158 ILE A CA  
1326 C  C   . ILE A 177 ? 0.3449 0.2647 0.2094 -0.0055 0.0000  0.0367  158 ILE A C   
1327 O  O   . ILE A 177 ? 0.3551 0.2739 0.2159 -0.0084 0.0043  0.0385  158 ILE A O   
1328 C  CB  . ILE A 177 ? 0.3205 0.2517 0.1938 -0.0040 0.0008  0.0290  158 ILE A CB  
1329 C  CG1 . ILE A 177 ? 0.3161 0.2502 0.1888 -0.0020 -0.0017 0.0254  158 ILE A CG1 
1330 C  CG2 . ILE A 177 ? 0.3407 0.2735 0.2247 -0.0035 -0.0001 0.0286  158 ILE A CG2 
1331 C  CD1 . ILE A 177 ? 0.3391 0.2790 0.2181 -0.0023 0.0012  0.0215  158 ILE A CD1 
1332 N  N   . HIS A 178 ? 0.3156 0.2328 0.1846 -0.0037 -0.0034 0.0379  159 HIS A N   
1333 C  CA  . HIS A 178 ? 0.3155 0.2274 0.1852 -0.0049 -0.0027 0.0409  159 HIS A CA  
1334 C  C   . HIS A 178 ? 0.3145 0.2300 0.1949 -0.0052 -0.0012 0.0387  159 HIS A C   
1335 O  O   . HIS A 178 ? 0.2934 0.2111 0.1805 -0.0025 -0.0040 0.0370  159 HIS A O   
1336 C  CB  . HIS A 178 ? 0.3421 0.2478 0.2088 -0.0020 -0.0077 0.0437  159 HIS A CB  
1337 C  CG  . HIS A 178 ? 0.3679 0.2660 0.2328 -0.0029 -0.0073 0.0471  159 HIS A CG  
1338 N  ND1 . HIS A 178 ? 0.3914 0.2828 0.2529 -0.0002 -0.0115 0.0499  159 HIS A ND1 
1339 C  CD2 . HIS A 178 ? 0.3756 0.2713 0.2413 -0.0064 -0.0036 0.0482  159 HIS A CD2 
1340 C  CE1 . HIS A 178 ? 0.4261 0.3104 0.2858 -0.0018 -0.0104 0.0526  159 HIS A CE1 
1341 N  NE2 . HIS A 178 ? 0.3916 0.2783 0.2539 -0.0058 -0.0057 0.0516  159 HIS A NE2 
1342 N  N   . ILE A 179 ? 0.3077 0.2242 0.1898 -0.0086 0.0031  0.0387  160 ILE A N   
1343 C  CA  . ILE A 179 ? 0.2935 0.2121 0.1847 -0.0092 0.0043  0.0372  160 ILE A CA  
1344 C  C   . ILE A 179 ? 0.3082 0.2186 0.1977 -0.0093 0.0026  0.0402  160 ILE A C   
1345 O  O   . ILE A 179 ? 0.3194 0.2243 0.2033 -0.0123 0.0044  0.0433  160 ILE A O   
1346 C  CB  . ILE A 179 ? 0.3084 0.2319 0.2027 -0.0129 0.0092  0.0359  160 ILE A CB  
1347 C  CG1 . ILE A 179 ? 0.3582 0.2893 0.2538 -0.0121 0.0107  0.0326  160 ILE A CG1 
1348 C  CG2 . ILE A 179 ? 0.3256 0.2505 0.2287 -0.0136 0.0098  0.0345  160 ILE A CG2 
1349 C  CD1 . ILE A 179 ? 0.3857 0.3224 0.2836 -0.0151 0.0157  0.0316  160 ILE A CD1 
1350 N  N   . THR A 180 ? 0.3022 0.2115 0.1962 -0.0059 -0.0006 0.0394  161 THR A N   
1351 C  CA  . THR A 180 ? 0.3230 0.2240 0.2153 -0.0046 -0.0029 0.0418  161 THR A CA  
1352 C  C   . THR A 180 ? 0.3206 0.2201 0.2183 -0.0062 -0.0014 0.0408  161 THR A C   
1353 O  O   . THR A 180 ? 0.3694 0.2605 0.2640 -0.0066 -0.0023 0.0430  161 THR A O   
1354 C  CB  . THR A 180 ? 0.3404 0.2412 0.2344 0.0004  -0.0074 0.0415  161 THR A CB  
1355 O  OG1 . THR A 180 ? 0.3326 0.2412 0.2357 0.0023  -0.0076 0.0379  161 THR A OG1 
1356 C  CG2 . THR A 180 ? 0.3425 0.2434 0.2300 0.0017  -0.0097 0.0430  161 THR A CG2 
1357 N  N   . SER A 181 ? 0.3361 0.2430 0.2413 -0.0071 0.0006  0.0375  162 SER A N   
1358 C  CA  . SER A 181 ? 0.3516 0.2578 0.2619 -0.0088 0.0020  0.0363  162 SER A CA  
1359 C  C   . SER A 181 ? 0.3277 0.2414 0.2422 -0.0123 0.0057  0.0343  162 SER A C   
1360 O  O   . SER A 181 ? 0.2960 0.2170 0.2126 -0.0116 0.0066  0.0324  162 SER A O   
1361 C  CB  . SER A 181 ? 0.3556 0.2637 0.2724 -0.0049 -0.0001 0.0337  162 SER A CB  
1362 O  OG  . SER A 181 ? 0.4241 0.3254 0.3380 -0.0013 -0.0033 0.0353  162 SER A OG  
1363 N  N   . ASN A 182 ? 0.3273 0.2390 0.2431 -0.0161 0.0076  0.0348  163 ASN A N   
1364 C  CA  . ASN A 182 ? 0.3032 0.2224 0.2240 -0.0193 0.0110  0.0331  163 ASN A CA  
1365 C  C   . ASN A 182 ? 0.3085 0.2247 0.2326 -0.0223 0.0114  0.0330  163 ASN A C   
1366 O  O   . ASN A 182 ? 0.3228 0.2323 0.2425 -0.0257 0.0118  0.0360  163 ASN A O   
1367 C  CB  . ASN A 182 ? 0.3043 0.2259 0.2203 -0.0225 0.0141  0.0350  163 ASN A CB  
1368 C  CG  . ASN A 182 ? 0.2951 0.2250 0.2166 -0.0257 0.0179  0.0335  163 ASN A CG  
1369 O  OD1 . ASN A 182 ? 0.3132 0.2465 0.2419 -0.0261 0.0180  0.0312  163 ASN A OD1 
1370 N  ND2 . ASN A 182 ? 0.3250 0.2588 0.2432 -0.0276 0.0211  0.0345  163 ASN A ND2 
1371 N  N   . MSE A 183 ? 0.3101 0.2306 0.2413 -0.0212 0.0110  0.0298  164 MSE A N   
1372 C  CA  . MSE A 183 ? 0.3104 0.2274 0.2443 -0.0236 0.0106  0.0294  164 MSE A CA  
1373 C  C   . MSE A 183 ? 0.3150 0.2339 0.2499 -0.0295 0.0134  0.0307  164 MSE A C   
1374 O  O   . MSE A 183 ? 0.3231 0.2367 0.2581 -0.0326 0.0128  0.0315  164 MSE A O   
1375 C  CB  . MSE A 183 ? 0.2982 0.2196 0.2389 -0.0212 0.0096  0.0258  164 MSE A CB  
1376 C  CG  . MSE A 183 ? 0.2680 0.2001 0.2146 -0.0221 0.0119  0.0236  164 MSE A CG  
1377 SE SE  . MSE A 183 ? 0.2278 0.1650 0.1825 -0.0197 0.0106  0.0196  164 MSE A SE  
1378 C  CE  . MSE A 183 ? 0.3414 0.2732 0.2972 -0.0240 0.0101  0.0196  164 MSE A CE  
1379 N  N   . HIS A 184 ? 0.2891 0.2153 0.2244 -0.0311 0.0164  0.0312  165 HIS A N   
1380 C  CA  . HIS A 184 ? 0.2897 0.2203 0.2272 -0.0364 0.0197  0.0324  165 HIS A CA  
1381 C  C   . HIS A 184 ? 0.3666 0.2910 0.2969 -0.0402 0.0209  0.0368  165 HIS A C   
1382 O  O   . HIS A 184 ? 0.4486 0.3763 0.3805 -0.0452 0.0237  0.0385  165 HIS A O   
1383 C  CB  . HIS A 184 ? 0.3003 0.2424 0.2422 -0.0358 0.0227  0.0304  165 HIS A CB  
1384 C  CG  . HIS A 184 ? 0.2919 0.2392 0.2399 -0.0320 0.0212  0.0264  165 HIS A CG  
1385 N  ND1 . HIS A 184 ? 0.3074 0.2560 0.2616 -0.0326 0.0200  0.0245  165 HIS A ND1 
1386 C  CD2 . HIS A 184 ? 0.3182 0.2687 0.2666 -0.0275 0.0204  0.0243  165 HIS A CD2 
1387 C  CE1 . HIS A 184 ? 0.2964 0.2490 0.2543 -0.0286 0.0188  0.0215  165 HIS A CE1 
1388 N  NE2 . HIS A 184 ? 0.2982 0.2522 0.2531 -0.0257 0.0190  0.0214  165 HIS A NE2 
1389 N  N   . LYS A 185 ? 0.3580 0.2740 0.2808 -0.0378 0.0187  0.0388  166 LYS A N   
1390 C  CA  . LYS A 185 ? 0.4757 0.3828 0.3906 -0.0411 0.0189  0.0434  166 LYS A CA  
1391 C  C   . LYS A 185 ? 0.5702 0.4650 0.4821 -0.0408 0.0152  0.0445  166 LYS A C   
1392 O  O   . LYS A 185 ? 0.6358 0.5225 0.5425 -0.0448 0.0151  0.0482  166 LYS A O   
1393 C  CB  . LYS A 185 ? 0.5023 0.4082 0.4098 -0.0383 0.0189  0.0451  166 LYS A CB  
1394 C  CG  . LYS A 185 ? 0.5898 0.5060 0.4979 -0.0389 0.0227  0.0444  166 LYS A CG  
1395 C  CD  . LYS A 185 ? 0.6763 0.5900 0.5756 -0.0364 0.0224  0.0463  166 LYS A CD  
1396 C  CE  . LYS A 185 ? 0.6863 0.6093 0.5848 -0.0368 0.0263  0.0455  166 LYS A CE  
1397 N  NZ  . LYS A 185 ? 0.7470 0.6739 0.6457 -0.0424 0.0310  0.0479  166 LYS A NZ  
1398 N  N   . GLU A 186 ? 0.7008 0.5938 0.6153 -0.0360 0.0121  0.0415  167 GLU A N   
1399 C  CA  . GLU A 186 ? 0.9022 0.7834 0.8132 -0.0340 0.0084  0.0420  167 GLU A CA  
1400 C  C   . GLU A 186 ? 0.9595 0.8387 0.8752 -0.0364 0.0076  0.0400  167 GLU A C   
1401 O  O   . GLU A 186 ? 0.9656 0.8493 0.8870 -0.0335 0.0068  0.0363  167 GLU A O   
1402 C  CB  . GLU A 186 ? 0.9126 0.7938 0.8236 -0.0268 0.0057  0.0400  167 GLU A CB  
1403 C  CG  . GLU A 186 ? 0.9169 0.7943 0.8207 -0.0241 0.0046  0.0428  167 GLU A CG  
1404 C  CD  . GLU A 186 ? 0.9001 0.7865 0.8062 -0.0201 0.0047  0.0409  167 GLU A CD  
1405 O  OE1 . GLU A 186 ? 0.6990 0.5896 0.6104 -0.0160 0.0033  0.0377  167 GLU A OE1 
1406 O  OE2 . GLU A 186 ? 0.9319 0.8212 0.8342 -0.0212 0.0062  0.0426  167 GLU A OE2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MSE 1   -18 ?   ?   ?   A . n 
A 1 2   GLY 2   -17 ?   ?   ?   A . n 
A 1 3   SER 3   -16 ?   ?   ?   A . n 
A 1 4   ASP 4   -15 ?   ?   ?   A . n 
A 1 5   LYS 5   -14 ?   ?   ?   A . n 
A 1 6   ILE 6   -13 ?   ?   ?   A . n 
A 1 7   HIS 7   -12 ?   ?   ?   A . n 
A 1 8   HIS 8   -11 ?   ?   ?   A . n 
A 1 9   HIS 9   -10 ?   ?   ?   A . n 
A 1 10  HIS 10  -9  ?   ?   ?   A . n 
A 1 11  HIS 11  -8  ?   ?   ?   A . n 
A 1 12  HIS 12  -7  ?   ?   ?   A . n 
A 1 13  GLU 13  -6  ?   ?   ?   A . n 
A 1 14  ASN 14  -5  ?   ?   ?   A . n 
A 1 15  LEU 15  -4  ?   ?   ?   A . n 
A 1 16  TYR 16  -3  ?   ?   ?   A . n 
A 1 17  PHE 17  -2  ?   ?   ?   A . n 
A 1 18  GLN 18  -1  ?   ?   ?   A . n 
A 1 19  GLY 19  0   0   GLY GLY A . n 
A 1 20  MSE 20  1   1   MSE MSE A . n 
A 1 21  THR 21  2   2   THR THR A . n 
A 1 22  LEU 22  3   3   LEU LEU A . n 
A 1 23  GLU 23  4   4   GLU GLU A . n 
A 1 24  ALA 24  5   5   ALA ALA A . n 
A 1 25  ARG 25  6   6   ARG ARG A . n 
A 1 26  ILE 26  7   7   ILE ILE A . n 
A 1 27  GLU 27  8   8   GLU GLU A . n 
A 1 28  ALA 28  9   9   ALA ALA A . n 
A 1 29  LEU 29  10  10  LEU LEU A . n 
A 1 30  GLU 30  11  11  GLU GLU A . n 
A 1 31  LYS 31  12  12  LYS LYS A . n 
A 1 32  GLU 32  13  13  GLU GLU A . n 
A 1 33  ILE 33  14  14  ILE ILE A . n 
A 1 34  GLN 34  15  15  GLN GLN A . n 
A 1 35  ARG 35  16  16  ARG ARG A . n 
A 1 36  LEU 36  17  17  LEU LEU A . n 
A 1 37  ASN 37  18  18  ASN ASN A . n 
A 1 38  ASP 38  19  19  ASP ASP A . n 
A 1 39  ILE 39  20  20  ILE ILE A . n 
A 1 40  GLU 40  21  21  GLU GLU A . n 
A 1 41  ALA 41  22  22  ALA ALA A . n 
A 1 42  ILE 42  23  23  ILE ILE A . n 
A 1 43  LYS 43  24  24  LYS LYS A . n 
A 1 44  GLN 44  25  25  GLN GLN A . n 
A 1 45  LEU 45  26  26  LEU LEU A . n 
A 1 46  LYS 46  27  27  LYS LYS A . n 
A 1 47  ALA 47  28  28  ALA ALA A . n 
A 1 48  LYS 48  29  29  LYS LYS A . n 
A 1 49  TYR 49  30  30  TYR TYR A . n 
A 1 50  PHE 50  31  31  PHE PHE A . n 
A 1 51  ARG 51  32  32  ARG ARG A . n 
A 1 52  CYS 52  33  33  CYS CYS A . n 
A 1 53  LEU 53  34  34  LEU LEU A . n 
A 1 54  ASP 54  35  35  ASP ASP A . n 
A 1 55  GLY 55  36  36  GLY GLY A . n 
A 1 56  LYS 56  37  37  LYS LYS A . n 
A 1 57  LEU 57  38  38  LEU LEU A . n 
A 1 58  TRP 58  39  39  TRP TRP A . n 
A 1 59  ASP 59  40  40  ASP ASP A . n 
A 1 60  GLU 60  41  41  GLU GLU A . n 
A 1 61  LEU 61  42  42  LEU LEU A . n 
A 1 62  GLU 62  43  43  GLU GLU A . n 
A 1 63  THR 63  44  44  THR THR A . n 
A 1 64  THR 64  45  45  THR THR A . n 
A 1 65  LEU 65  46  46  LEU LEU A . n 
A 1 66  SER 66  47  47  SER SER A . n 
A 1 67  PRO 67  48  48  PRO PRO A . n 
A 1 68  ASN 68  49  49  ASN ASN A . n 
A 1 69  ILE 69  50  50  ILE ILE A . n 
A 1 70  GLU 70  51  51  GLU GLU A . n 
A 1 71  THR 71  52  52  THR THR A . n 
A 1 72  SER 72  53  53  SER SER A . n 
A 1 73  TYR 73  54  54  TYR TYR A . n 
A 1 74  SER 74  55  55  SER SER A . n 
A 1 75  ASP 75  56  56  ASP ASP A . n 
A 1 76  GLY 76  57  57  GLY GLY A . n 
A 1 77  LYS 77  58  58  LYS LYS A . n 
A 1 78  LEU 78  59  59  LEU LEU A . n 
A 1 79  VAL 79  60  60  VAL VAL A . n 
A 1 80  PHE 80  61  61  PHE PHE A . n 
A 1 81  HIS 81  62  62  HIS HIS A . n 
A 1 82  SER 82  63  63  SER SER A . n 
A 1 83  PRO 83  64  64  PRO PRO A . n 
A 1 84  LYS 84  65  65  LYS LYS A . n 
A 1 85  GLU 85  66  66  GLU GLU A . n 
A 1 86  VAL 86  67  67  VAL VAL A . n 
A 1 87  THR 87  68  68  THR THR A . n 
A 1 88  GLU 88  69  69  GLU GLU A . n 
A 1 89  TYR 89  70  70  TYR TYR A . n 
A 1 90  LEU 90  71  71  LEU LEU A . n 
A 1 91  ALA 91  72  72  ALA ALA A . n 
A 1 92  ALA 92  73  73  ALA ALA A . n 
A 1 93  ALA 93  74  74  ALA ALA A . n 
A 1 94  MSE 94  75  75  MSE MSE A . n 
A 1 95  PRO 95  76  76  PRO PRO A . n 
A 1 96  LYS 96  77  77  LYS LYS A . n 
A 1 97  GLU 97  78  78  GLU GLU A . n 
A 1 98  GLU 98  79  79  GLU GLU A . n 
A 1 99  ILE 99  80  80  ILE ILE A . n 
A 1 100 SER 100 81  81  SER SER A . n 
A 1 101 MSE 101 82  82  MSE MSE A . n 
A 1 102 HIS 102 83  83  HIS HIS A . n 
A 1 103 MSE 103 84  84  MSE MSE A . n 
A 1 104 GLY 104 85  85  GLY GLY A . n 
A 1 105 HIS 105 86  86  HIS HIS A . n 
A 1 106 THR 106 87  87  THR THR A . n 
A 1 107 PRO 107 88  88  PRO PRO A . n 
A 1 108 GLU 108 89  89  GLU GLU A . n 
A 1 109 ILE 109 90  90  ILE ILE A . n 
A 1 110 THR 110 91  91  THR THR A . n 
A 1 111 ILE 111 92  92  ILE ILE A . n 
A 1 112 ASP 112 93  93  ASP ASP A . n 
A 1 113 SER 113 94  94  SER SER A . n 
A 1 114 GLU 114 95  95  GLU GLU A . n 
A 1 115 ASN 115 96  96  ASN ASN A . n 
A 1 116 THR 116 97  97  THR THR A . n 
A 1 117 ALA 117 98  98  ALA ALA A . n 
A 1 118 THR 118 99  99  THR THR A . n 
A 1 119 GLY 119 100 100 GLY GLY A . n 
A 1 120 ARG 120 101 101 ARG ARG A . n 
A 1 121 TRP 121 102 102 TRP TRP A . n 
A 1 122 TYR 122 103 103 TYR TYR A . n 
A 1 123 LEU 123 104 104 LEU LEU A . n 
A 1 124 GLU 124 105 105 GLU GLU A . n 
A 1 125 ASP 125 106 106 ASP ASP A . n 
A 1 126 ASN 126 107 107 ASN ASN A . n 
A 1 127 LEU 127 108 108 LEU LEU A . n 
A 1 128 ILE 128 109 109 ILE ILE A . n 
A 1 129 PHE 129 110 110 PHE PHE A . n 
A 1 130 THR 130 111 111 THR THR A . n 
A 1 131 ASP 131 112 112 ASP ASP A . n 
A 1 132 GLY 132 113 113 GLY GLY A . n 
A 1 133 LYS 133 114 114 LYS LYS A . n 
A 1 134 TYR 134 115 115 TYR TYR A . n 
A 1 135 LYS 135 116 116 LYS LYS A . n 
A 1 136 ASN 136 117 117 ASN ASN A . n 
A 1 137 VAL 137 118 118 VAL VAL A . n 
A 1 138 GLY 138 119 119 GLY GLY A . n 
A 1 139 ILE 139 120 120 ILE ILE A . n 
A 1 140 ASN 140 121 121 ASN ASN A . n 
A 1 141 GLY 141 122 122 GLY GLY A . n 
A 1 142 GLY 142 123 123 GLY GLY A . n 
A 1 143 ALA 143 124 124 ALA ALA A . n 
A 1 144 PHE 144 125 125 PHE PHE A . n 
A 1 145 TYR 145 126 126 TYR TYR A . n 
A 1 146 THR 146 127 127 THR THR A . n 
A 1 147 ASP 147 128 128 ASP ASP A . n 
A 1 148 LYS 148 129 129 LYS LYS A . n 
A 1 149 TYR 149 130 130 TYR TYR A . n 
A 1 150 GLU 150 131 131 GLU GLU A . n 
A 1 151 LYS 151 132 132 LYS LYS A . n 
A 1 152 ILE 152 133 133 ILE ILE A . n 
A 1 153 ASP 153 134 134 ASP ASP A . n 
A 1 154 GLY 154 135 135 GLY GLY A . n 
A 1 155 GLN 155 136 136 GLN GLN A . n 
A 1 156 TRP 156 137 137 TRP TRP A . n 
A 1 157 TYR 157 138 138 TYR TYR A . n 
A 1 158 ILE 158 139 139 ILE ILE A . n 
A 1 159 LYS 159 140 140 LYS LYS A . n 
A 1 160 GLU 160 141 141 GLU GLU A . n 
A 1 161 THR 161 142 142 THR THR A . n 
A 1 162 GLY 162 143 143 GLY GLY A . n 
A 1 163 TYR 163 144 144 TYR TYR A . n 
A 1 164 VAL 164 145 145 VAL VAL A . n 
A 1 165 ARG 165 146 146 ARG ARG A . n 
A 1 166 ILE 166 147 147 ILE ILE A . n 
A 1 167 PHE 167 148 148 PHE PHE A . n 
A 1 168 GLU 168 149 149 GLU GLU A . n 
A 1 169 GLU 169 150 150 GLU GLU A . n 
A 1 170 HIS 170 151 151 HIS HIS A . n 
A 1 171 PHE 171 152 152 PHE PHE A . n 
A 1 172 MSE 172 153 153 MSE MSE A . n 
A 1 173 ARG 173 154 154 ARG ARG A . n 
A 1 174 ASP 174 155 155 ASP ASP A . n 
A 1 175 PRO 175 156 156 PRO PRO A . n 
A 1 176 LYS 176 157 157 LYS LYS A . n 
A 1 177 ILE 177 158 158 ILE ILE A . n 
A 1 178 HIS 178 159 159 HIS HIS A . n 
A 1 179 ILE 179 160 160 ILE ILE A . n 
A 1 180 THR 180 161 161 THR THR A . n 
A 1 181 SER 181 162 162 SER SER A . n 
A 1 182 ASN 182 163 163 ASN ASN A . n 
A 1 183 MSE 183 164 164 MSE MSE A . n 
A 1 184 HIS 184 165 165 HIS HIS A . n 
A 1 185 LYS 185 166 166 LYS LYS A . n 
A 1 186 GLU 186 167 167 GLU GLU A . n 
A 1 187 LYS 187 168 ?   ?   ?   A . n 
# 
_pdbx_SG_project.project_name          PSI:Biology 
_pdbx_SG_project.full_name_of_center   'Joint Center for Structural Genomics' 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.initial_of_center     JCSG 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NI  1   201 201 NI  NI  A . 
C 3 NA  1   202 202 NA  NA  A . 
D 4 PGE 1   203 203 PGE PGE A . 
E 5 1PE 1   204 204 1PE 1PE A . 
F 6 HOH 1   301 205 HOH HOH A . 
F 6 HOH 2   302 206 HOH HOH A . 
F 6 HOH 3   303 207 HOH HOH A . 
F 6 HOH 4   304 208 HOH HOH A . 
F 6 HOH 5   305 209 HOH HOH A . 
F 6 HOH 6   306 210 HOH HOH A . 
F 6 HOH 7   307 211 HOH HOH A . 
F 6 HOH 8   308 212 HOH HOH A . 
F 6 HOH 9   309 213 HOH HOH A . 
F 6 HOH 10  310 214 HOH HOH A . 
F 6 HOH 11  311 215 HOH HOH A . 
F 6 HOH 12  312 216 HOH HOH A . 
F 6 HOH 13  313 217 HOH HOH A . 
F 6 HOH 14  314 218 HOH HOH A . 
F 6 HOH 15  315 219 HOH HOH A . 
F 6 HOH 16  316 220 HOH HOH A . 
F 6 HOH 17  317 221 HOH HOH A . 
F 6 HOH 18  318 222 HOH HOH A . 
F 6 HOH 19  319 223 HOH HOH A . 
F 6 HOH 20  320 224 HOH HOH A . 
F 6 HOH 21  321 225 HOH HOH A . 
F 6 HOH 22  322 226 HOH HOH A . 
F 6 HOH 23  323 227 HOH HOH A . 
F 6 HOH 24  324 228 HOH HOH A . 
F 6 HOH 25  325 229 HOH HOH A . 
F 6 HOH 26  326 230 HOH HOH A . 
F 6 HOH 27  327 231 HOH HOH A . 
F 6 HOH 28  328 232 HOH HOH A . 
F 6 HOH 29  329 233 HOH HOH A . 
F 6 HOH 30  330 234 HOH HOH A . 
F 6 HOH 31  331 235 HOH HOH A . 
F 6 HOH 32  332 236 HOH HOH A . 
F 6 HOH 33  333 237 HOH HOH A . 
F 6 HOH 34  334 238 HOH HOH A . 
F 6 HOH 35  335 239 HOH HOH A . 
F 6 HOH 36  336 240 HOH HOH A . 
F 6 HOH 37  337 241 HOH HOH A . 
F 6 HOH 38  338 242 HOH HOH A . 
F 6 HOH 39  339 243 HOH HOH A . 
F 6 HOH 40  340 244 HOH HOH A . 
F 6 HOH 41  341 245 HOH HOH A . 
F 6 HOH 42  342 246 HOH HOH A . 
F 6 HOH 43  343 247 HOH HOH A . 
F 6 HOH 44  344 248 HOH HOH A . 
F 6 HOH 45  345 249 HOH HOH A . 
F 6 HOH 46  346 250 HOH HOH A . 
F 6 HOH 47  347 251 HOH HOH A . 
F 6 HOH 48  348 252 HOH HOH A . 
F 6 HOH 49  349 253 HOH HOH A . 
F 6 HOH 50  350 254 HOH HOH A . 
F 6 HOH 51  351 255 HOH HOH A . 
F 6 HOH 52  352 256 HOH HOH A . 
F 6 HOH 53  353 257 HOH HOH A . 
F 6 HOH 54  354 258 HOH HOH A . 
F 6 HOH 55  355 259 HOH HOH A . 
F 6 HOH 56  356 260 HOH HOH A . 
F 6 HOH 57  357 261 HOH HOH A . 
F 6 HOH 58  358 262 HOH HOH A . 
F 6 HOH 59  359 263 HOH HOH A . 
F 6 HOH 60  360 264 HOH HOH A . 
F 6 HOH 61  361 265 HOH HOH A . 
F 6 HOH 62  362 266 HOH HOH A . 
F 6 HOH 63  363 267 HOH HOH A . 
F 6 HOH 64  364 268 HOH HOH A . 
F 6 HOH 65  365 269 HOH HOH A . 
F 6 HOH 66  366 270 HOH HOH A . 
F 6 HOH 67  367 271 HOH HOH A . 
F 6 HOH 68  368 272 HOH HOH A . 
F 6 HOH 69  369 273 HOH HOH A . 
F 6 HOH 70  370 274 HOH HOH A . 
F 6 HOH 71  371 275 HOH HOH A . 
F 6 HOH 72  372 276 HOH HOH A . 
F 6 HOH 73  373 277 HOH HOH A . 
F 6 HOH 74  374 278 HOH HOH A . 
F 6 HOH 75  375 279 HOH HOH A . 
F 6 HOH 76  376 280 HOH HOH A . 
F 6 HOH 77  377 281 HOH HOH A . 
F 6 HOH 78  378 282 HOH HOH A . 
F 6 HOH 79  379 283 HOH HOH A . 
F 6 HOH 80  380 284 HOH HOH A . 
F 6 HOH 81  381 285 HOH HOH A . 
F 6 HOH 82  382 286 HOH HOH A . 
F 6 HOH 83  383 287 HOH HOH A . 
F 6 HOH 84  384 288 HOH HOH A . 
F 6 HOH 85  385 289 HOH HOH A . 
F 6 HOH 86  386 290 HOH HOH A . 
F 6 HOH 87  387 291 HOH HOH A . 
F 6 HOH 88  388 292 HOH HOH A . 
F 6 HOH 89  389 293 HOH HOH A . 
F 6 HOH 90  390 294 HOH HOH A . 
F 6 HOH 91  391 295 HOH HOH A . 
F 6 HOH 92  392 296 HOH HOH A . 
F 6 HOH 93  393 297 HOH HOH A . 
F 6 HOH 94  394 298 HOH HOH A . 
F 6 HOH 95  395 299 HOH HOH A . 
F 6 HOH 96  396 300 HOH HOH A . 
F 6 HOH 97  397 301 HOH HOH A . 
F 6 HOH 98  398 302 HOH HOH A . 
F 6 HOH 99  399 303 HOH HOH A . 
F 6 HOH 100 400 304 HOH HOH A . 
F 6 HOH 101 401 305 HOH HOH A . 
F 6 HOH 102 402 306 HOH HOH A . 
F 6 HOH 103 403 307 HOH HOH A . 
F 6 HOH 104 404 308 HOH HOH A . 
F 6 HOH 105 405 309 HOH HOH A . 
F 6 HOH 106 406 310 HOH HOH A . 
F 6 HOH 107 407 311 HOH HOH A . 
F 6 HOH 108 408 312 HOH HOH A . 
F 6 HOH 109 409 313 HOH HOH A . 
F 6 HOH 110 410 314 HOH HOH A . 
F 6 HOH 111 411 315 HOH HOH A . 
F 6 HOH 112 412 316 HOH HOH A . 
F 6 HOH 113 413 317 HOH HOH A . 
F 6 HOH 114 414 318 HOH HOH A . 
F 6 HOH 115 415 319 HOH HOH A . 
F 6 HOH 116 416 320 HOH HOH A . 
F 6 HOH 117 417 321 HOH HOH A . 
F 6 HOH 118 418 322 HOH HOH A . 
F 6 HOH 119 419 323 HOH HOH A . 
F 6 HOH 120 420 324 HOH HOH A . 
F 6 HOH 121 421 325 HOH HOH A . 
F 6 HOH 122 422 326 HOH HOH A . 
F 6 HOH 123 423 327 HOH HOH A . 
F 6 HOH 124 424 328 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 20  A MSE 1   ? MET SELENOMETHIONINE 
2 A MSE 94  A MSE 75  ? MET SELENOMETHIONINE 
3 A MSE 101 A MSE 82  ? MET SELENOMETHIONINE 
4 A MSE 103 A MSE 84  ? MET SELENOMETHIONINE 
5 A MSE 172 A MSE 153 ? MET SELENOMETHIONINE 
6 A MSE 183 A MSE 164 ? MET SELENOMETHIONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 10990 ? 
1 MORE         -94   ? 
1 'SSA (A^2)'  22650 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 29.4525000000  0.8660254038  
-0.5000000000 0.0000000000 51.0132264099 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_565 -x+y,-x+1,z  -0.5000000000 0.8660254038  0.0000000000 -29.4525000000 -0.8660254038 
-0.5000000000 0.0000000000 51.0132264099 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A NI  201 ? B NI  . 
2 1 A NA  202 ? C NA  . 
3 1 A HOH 421 ? F HOH . 
4 1 A HOH 422 ? F HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O ? F HOH . ? A HOH 321 ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 105 ? A HIS 86  ? 1_555 87.2 ? 
2 O ? F HOH . ? A HOH 350 ? 1_555 NA ? C NA . ? A NA 202 ? 1_555 OE1 ? A GLU 124 ? A GLU 105 ? 1_555 91.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-08-21 
2 'Structure model' 1 1 2017-11-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_software.classification' 
2 2 'Structure model' '_software.name'           
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         12.9580 
_pdbx_refine_tls.origin_y         35.8940 
_pdbx_refine_tls.origin_z         5.2550 
_pdbx_refine_tls.T[1][1]          0.0248 
_pdbx_refine_tls.T[2][2]          0.0283 
_pdbx_refine_tls.T[3][3]          0.0363 
_pdbx_refine_tls.T[1][2]          -0.0073 
_pdbx_refine_tls.T[1][3]          0.0089 
_pdbx_refine_tls.T[2][3]          -0.0021 
_pdbx_refine_tls.L[1][1]          0.3613 
_pdbx_refine_tls.L[2][2]          0.4674 
_pdbx_refine_tls.L[3][3]          0.5996 
_pdbx_refine_tls.L[1][2]          -0.0481 
_pdbx_refine_tls.L[1][3]          0.1564 
_pdbx_refine_tls.L[2][3]          -0.0771 
_pdbx_refine_tls.S[1][1]          0.0007 
_pdbx_refine_tls.S[2][2]          0.0131 
_pdbx_refine_tls.S[3][3]          -0.0137 
_pdbx_refine_tls.S[1][2]          0.0389 
_pdbx_refine_tls.S[1][3]          0.0171 
_pdbx_refine_tls.S[2][3]          -0.0779 
_pdbx_refine_tls.S[2][1]          -0.0366 
_pdbx_refine_tls.S[3][1]          -0.0611 
_pdbx_refine_tls.S[3][2]          0.0930 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     0 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     167 
_pdbx_refine_tls_group.selection_details   ? 
_pdbx_refine_tls_group.beg_label_asym_id   . 
_pdbx_refine_tls_group.beg_label_seq_id    . 
_pdbx_refine_tls_group.end_label_asym_id   . 
_pdbx_refine_tls_group.end_label_seq_id    . 
_pdbx_refine_tls_group.selection           ? 
# 
_phasing.method   SAD 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 MolProbity  3beta29  ?               package 'D.C. & J.S. Richardson lab' molprobity@kinemage.biochem.duke.edu 'model building'  
http://kinemage.biochem.duke.edu/molprobity/ ?          ? 
2 PDB_EXTRACT 3.10     'June 10, 2010' package PDB                          deposit@deposit.rcsb.org             'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
3 SHELX       .        ?               package 'George M. Sheldrick'        gsheldr@shelx.uni-ac.gwdg.de         phasing           
http://shelx.uni-ac.gwdg.de/SHELX/           Fortran_77 ? 
4 SHARP       .        ?               package 'Eric de La Fortelle'        sharp-develop@globalphasing.com      phasing           
http://www.globalphasing.com/sharp/          ?          ? 
5 SCALA       3.3.15   ?               package 'Phil Evans'                 pre@mrc-lmb.cam.ac.uk                'data scaling'    
?                                            ?          ? 
6 REFMAC      5.7.0032 ?               program 'Garib N. Murshudov'         garib@ysbl.york.ac.uk                refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
7 MOSFLM      .        ?               ?       ?                            ?                                    'data reduction'  
?                                            ?          ? 
8 SHELXD      .        ?               ?       ?                            ?                                    phasing           
?                                            ?          ? 
# 
_pdbx_entry_details.entry_id             4L8P 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
'THIS CONSTRUCT (RESIDUES 1-168) WAS EXPRESSED WITH AN N-TERMINAL PURIFICATION TAG MGSDKIHHHHHHENLYFQG.' 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 58 ? ? -122.32 -52.29  
2 1 MSE A 75 ? B -118.14 70.70   
3 1 SER A 94 ? ? -160.14 -167.69 
4 1 ASN A 96 ? ? -144.33 20.86   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 12  ? CD ? A LYS 31  CD 
2 1 Y 1 A LYS 12  ? CE ? A LYS 31  CE 
3 1 Y 1 A LYS 12  ? NZ ? A LYS 31  NZ 
4 1 Y 1 A LYS 114 ? CG ? A LYS 133 CG 
5 1 Y 1 A LYS 114 ? CD ? A LYS 133 CD 
6 1 Y 1 A LYS 114 ? CE ? A LYS 133 CE 
7 1 Y 1 A LYS 114 ? NZ ? A LYS 133 NZ 
8 1 Y 1 A LYS 140 ? CE ? A LYS 159 CE 
9 1 Y 1 A LYS 140 ? NZ ? A LYS 159 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MSE -18 ? A MSE 1   
2  1 Y 1 A GLY -17 ? A GLY 2   
3  1 Y 1 A SER -16 ? A SER 3   
4  1 Y 1 A ASP -15 ? A ASP 4   
5  1 Y 1 A LYS -14 ? A LYS 5   
6  1 Y 1 A ILE -13 ? A ILE 6   
7  1 Y 1 A HIS -12 ? A HIS 7   
8  1 Y 1 A HIS -11 ? A HIS 8   
9  1 Y 1 A HIS -10 ? A HIS 9   
10 1 Y 1 A HIS -9  ? A HIS 10  
11 1 Y 1 A HIS -8  ? A HIS 11  
12 1 Y 1 A HIS -7  ? A HIS 12  
13 1 Y 1 A GLU -6  ? A GLU 13  
14 1 Y 1 A ASN -5  ? A ASN 14  
15 1 Y 1 A LEU -4  ? A LEU 15  
16 1 Y 1 A TYR -3  ? A TYR 16  
17 1 Y 1 A PHE -2  ? A PHE 17  
18 1 Y 1 A GLN -1  ? A GLN 18  
19 1 Y 1 A LYS 168 ? A LYS 187 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'NICKEL (II) ION'      NI  
3 'SODIUM ION'           NA  
4 'TRIETHYLENE GLYCOL'   PGE 
5 'PENTAETHYLENE GLYCOL' 1PE 
6 water                  HOH 
#