data_4LEY
# 
_entry.id   4LEY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4LEY         
NDB   NA2588       
RCSB  RCSB080544   
WWPDB D_1000080544 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4LEV . unspecified 
PDB 4LEw . unspecified 
PDB 4LEz . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4LEY 
_pdbx_database_status.recvd_initial_deposition_date   2013-06-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Li, P.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Cyclic GMP-AMP Synthase Is Activated by Double-Stranded DNA-Induced Oligomerization.' 
_citation.journal_abbrev            Immunity 
_citation.journal_volume            39 
_citation.page_first                1019 
_citation.page_last                 1031 
_citation.year                      2013 
_citation.journal_id_ASTM           IUNIEH 
_citation.country                   US 
_citation.journal_id_ISSN           1074-7613 
_citation.journal_id_CSD            2048 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24332030 
_citation.pdbx_database_id_DOI      10.1016/j.immuni.2013.10.019 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, X.'        1  
primary 'Shu, C.'       2  
primary 'Yi, G.'        3  
primary 'Chaton, C.T.'  4  
primary 'Shelton, C.L.' 5  
primary 'Diao, J.'      6  
primary 'Zuo, X.'       7  
primary 'Kao, C.C.'     8  
primary 'Herr, A.B.'    9  
primary 'Li, P.'        10 
# 
_cell.entry_id           4LEY 
_cell.length_a           78.377 
_cell.length_b           145.895 
_cell.length_c           100.963 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.07 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4LEY 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cyclic GMP-AMP synthase' 42984.664 4   2.7.7.- ? 'Catalytic domain, UNP residues 142-507' ? 
2 polymer     syn '18 bp dsDNA'             5514.603  8   ?       ? ?                                        ? 
3 non-polymer syn 'ZINC ION'                65.409    4   ?       ? ?                                        ? 
4 water       nat water                     18.015    631 ?       ? ?                                        ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'cGAMP synthase, cGAS, m-cGAS, Mab-21 domain-containing protein 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSRKEPDKLKKVLDKLRLKRKDISEAAETVNKVVERLLRRMQKRESEFKGVEQLNTGSYYEHVKISAPNEFDVMFKLEVP
RIELQEYYETGAFYLVKFKRIPRGNPLSHFLEGEVLSATKMLSKFRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRNP
EEISVDIILALESKGSWPISTKEGLPIQGWLGTKVRTNLRREPFYLVPKNAKDGNSFQGETWRLSFSHTEKYILNNHGIE
KTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLECLR
TEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPIFDKL
;
;GSRKEPDKLKKVLDKLRLKRKDISEAAETVNKVVERLLRRMQKRESEFKGVEQLNTGSYYEHVKISAPNEFDVMFKLEVP
RIELQEYYETGAFYLVKFKRIPRGNPLSHFLEGEVLSATKMLSKFRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRNP
EEISVDIILALESKGSWPISTKEGLPIQGWLGTKVRTNLRREPFYLVPKNAKDGNSFQGETWRLSFSHTEKYILNNHGIE
KTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLECLR
TEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPIFDKL
;
A,B,C,D         ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DC)(DT)(DG)(DT)(DA)(DC)(DA)(DT)(DG)(DT)(DA)(DC)(DA)(DG)(DA)(DT)' ATCTGTACATGTACAGAT 
E,F,G,H,I,J,K,L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ARG n 
1 4   LYS n 
1 5   GLU n 
1 6   PRO n 
1 7   ASP n 
1 8   LYS n 
1 9   LEU n 
1 10  LYS n 
1 11  LYS n 
1 12  VAL n 
1 13  LEU n 
1 14  ASP n 
1 15  LYS n 
1 16  LEU n 
1 17  ARG n 
1 18  LEU n 
1 19  LYS n 
1 20  ARG n 
1 21  LYS n 
1 22  ASP n 
1 23  ILE n 
1 24  SER n 
1 25  GLU n 
1 26  ALA n 
1 27  ALA n 
1 28  GLU n 
1 29  THR n 
1 30  VAL n 
1 31  ASN n 
1 32  LYS n 
1 33  VAL n 
1 34  VAL n 
1 35  GLU n 
1 36  ARG n 
1 37  LEU n 
1 38  LEU n 
1 39  ARG n 
1 40  ARG n 
1 41  MET n 
1 42  GLN n 
1 43  LYS n 
1 44  ARG n 
1 45  GLU n 
1 46  SER n 
1 47  GLU n 
1 48  PHE n 
1 49  LYS n 
1 50  GLY n 
1 51  VAL n 
1 52  GLU n 
1 53  GLN n 
1 54  LEU n 
1 55  ASN n 
1 56  THR n 
1 57  GLY n 
1 58  SER n 
1 59  TYR n 
1 60  TYR n 
1 61  GLU n 
1 62  HIS n 
1 63  VAL n 
1 64  LYS n 
1 65  ILE n 
1 66  SER n 
1 67  ALA n 
1 68  PRO n 
1 69  ASN n 
1 70  GLU n 
1 71  PHE n 
1 72  ASP n 
1 73  VAL n 
1 74  MET n 
1 75  PHE n 
1 76  LYS n 
1 77  LEU n 
1 78  GLU n 
1 79  VAL n 
1 80  PRO n 
1 81  ARG n 
1 82  ILE n 
1 83  GLU n 
1 84  LEU n 
1 85  GLN n 
1 86  GLU n 
1 87  TYR n 
1 88  TYR n 
1 89  GLU n 
1 90  THR n 
1 91  GLY n 
1 92  ALA n 
1 93  PHE n 
1 94  TYR n 
1 95  LEU n 
1 96  VAL n 
1 97  LYS n 
1 98  PHE n 
1 99  LYS n 
1 100 ARG n 
1 101 ILE n 
1 102 PRO n 
1 103 ARG n 
1 104 GLY n 
1 105 ASN n 
1 106 PRO n 
1 107 LEU n 
1 108 SER n 
1 109 HIS n 
1 110 PHE n 
1 111 LEU n 
1 112 GLU n 
1 113 GLY n 
1 114 GLU n 
1 115 VAL n 
1 116 LEU n 
1 117 SER n 
1 118 ALA n 
1 119 THR n 
1 120 LYS n 
1 121 MET n 
1 122 LEU n 
1 123 SER n 
1 124 LYS n 
1 125 PHE n 
1 126 ARG n 
1 127 LYS n 
1 128 ILE n 
1 129 ILE n 
1 130 LYS n 
1 131 GLU n 
1 132 GLU n 
1 133 VAL n 
1 134 LYS n 
1 135 GLU n 
1 136 ILE n 
1 137 LYS n 
1 138 ASP n 
1 139 ILE n 
1 140 ASP n 
1 141 VAL n 
1 142 SER n 
1 143 VAL n 
1 144 GLU n 
1 145 LYS n 
1 146 GLU n 
1 147 LYS n 
1 148 PRO n 
1 149 GLY n 
1 150 SER n 
1 151 PRO n 
1 152 ALA n 
1 153 VAL n 
1 154 THR n 
1 155 LEU n 
1 156 LEU n 
1 157 ILE n 
1 158 ARG n 
1 159 ASN n 
1 160 PRO n 
1 161 GLU n 
1 162 GLU n 
1 163 ILE n 
1 164 SER n 
1 165 VAL n 
1 166 ASP n 
1 167 ILE n 
1 168 ILE n 
1 169 LEU n 
1 170 ALA n 
1 171 LEU n 
1 172 GLU n 
1 173 SER n 
1 174 LYS n 
1 175 GLY n 
1 176 SER n 
1 177 TRP n 
1 178 PRO n 
1 179 ILE n 
1 180 SER n 
1 181 THR n 
1 182 LYS n 
1 183 GLU n 
1 184 GLY n 
1 185 LEU n 
1 186 PRO n 
1 187 ILE n 
1 188 GLN n 
1 189 GLY n 
1 190 TRP n 
1 191 LEU n 
1 192 GLY n 
1 193 THR n 
1 194 LYS n 
1 195 VAL n 
1 196 ARG n 
1 197 THR n 
1 198 ASN n 
1 199 LEU n 
1 200 ARG n 
1 201 ARG n 
1 202 GLU n 
1 203 PRO n 
1 204 PHE n 
1 205 TYR n 
1 206 LEU n 
1 207 VAL n 
1 208 PRO n 
1 209 LYS n 
1 210 ASN n 
1 211 ALA n 
1 212 LYS n 
1 213 ASP n 
1 214 GLY n 
1 215 ASN n 
1 216 SER n 
1 217 PHE n 
1 218 GLN n 
1 219 GLY n 
1 220 GLU n 
1 221 THR n 
1 222 TRP n 
1 223 ARG n 
1 224 LEU n 
1 225 SER n 
1 226 PHE n 
1 227 SER n 
1 228 HIS n 
1 229 THR n 
1 230 GLU n 
1 231 LYS n 
1 232 TYR n 
1 233 ILE n 
1 234 LEU n 
1 235 ASN n 
1 236 ASN n 
1 237 HIS n 
1 238 GLY n 
1 239 ILE n 
1 240 GLU n 
1 241 LYS n 
1 242 THR n 
1 243 CYS n 
1 244 CYS n 
1 245 GLU n 
1 246 SER n 
1 247 SER n 
1 248 GLY n 
1 249 ALA n 
1 250 LYS n 
1 251 CYS n 
1 252 CYS n 
1 253 ARG n 
1 254 LYS n 
1 255 GLU n 
1 256 CYS n 
1 257 LEU n 
1 258 LYS n 
1 259 LEU n 
1 260 MET n 
1 261 LYS n 
1 262 TYR n 
1 263 LEU n 
1 264 LEU n 
1 265 GLU n 
1 266 GLN n 
1 267 LEU n 
1 268 LYS n 
1 269 LYS n 
1 270 GLU n 
1 271 PHE n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ASP n 
1 276 ALA n 
1 277 PHE n 
1 278 CYS n 
1 279 SER n 
1 280 TYR n 
1 281 HIS n 
1 282 VAL n 
1 283 LYS n 
1 284 THR n 
1 285 ALA n 
1 286 ILE n 
1 287 PHE n 
1 288 HIS n 
1 289 MET n 
1 290 TRP n 
1 291 THR n 
1 292 GLN n 
1 293 ASP n 
1 294 PRO n 
1 295 GLN n 
1 296 ASP n 
1 297 SER n 
1 298 GLN n 
1 299 TRP n 
1 300 ASP n 
1 301 PRO n 
1 302 ARG n 
1 303 ASN n 
1 304 LEU n 
1 305 SER n 
1 306 SER n 
1 307 CYS n 
1 308 PHE n 
1 309 ASP n 
1 310 LYS n 
1 311 LEU n 
1 312 LEU n 
1 313 ALA n 
1 314 PHE n 
1 315 PHE n 
1 316 LEU n 
1 317 GLU n 
1 318 CYS n 
1 319 LEU n 
1 320 ARG n 
1 321 THR n 
1 322 GLU n 
1 323 LYS n 
1 324 LEU n 
1 325 ASP n 
1 326 HIS n 
1 327 TYR n 
1 328 PHE n 
1 329 ILE n 
1 330 PRO n 
1 331 LYS n 
1 332 PHE n 
1 333 ASN n 
1 334 LEU n 
1 335 PHE n 
1 336 SER n 
1 337 GLN n 
1 338 GLU n 
1 339 LEU n 
1 340 ILE n 
1 341 ASP n 
1 342 ARG n 
1 343 LYS n 
1 344 SER n 
1 345 LYS n 
1 346 GLU n 
1 347 PHE n 
1 348 LEU n 
1 349 SER n 
1 350 LYS n 
1 351 LYS n 
1 352 ILE n 
1 353 GLU n 
1 354 TYR n 
1 355 GLU n 
1 356 ARG n 
1 357 ASN n 
1 358 ASN n 
1 359 GLY n 
1 360 PHE n 
1 361 PRO n 
1 362 ILE n 
1 363 PHE n 
1 364 ASP n 
1 365 LYS n 
1 366 LEU n 
2 1   DA  n 
2 2   DT  n 
2 3   DC  n 
2 4   DT  n 
2 5   DG  n 
2 6   DT  n 
2 7   DA  n 
2 8   DC  n 
2 9   DA  n 
2 10  DT  n 
2 11  DG  n 
2 12  DT  n 
2 13  DA  n 
2 14  DC  n 
2 15  DA  n 
2 16  DG  n 
2 17  DA  n 
2 18  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               mouse 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Mb21d1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Synthetic DNA' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CGAS_MOUSE Q8C6L5 1 
;GSRKEPDKLKKVLDKLRLKRKDISEAAETVNKVVERLLRRMQKRESEFKGVEQLNTGSYYEHVKISAPNEFDVMFKLEVP
RIELQEYYETGAFYLVKFKRIPRGNPLSHFLEGEVLSATKMLSKFRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRNP
EEISVDIILALESKGSWPISTKEGLPIQGWLGTKVRTNLRREPFYLVPKNAKDGNSFQGETWRLSFSHTEKYILNNHGIE
KTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLECLR
TEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPIFDKL
;
142 ? 
2 PDB 4LEY       4LEY   2 ATCTGTACATGTACAGAT ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4LEY A 1 ? 366 ? Q8C6L5 142 ? 507 ? 142 507 
2  1 4LEY B 1 ? 366 ? Q8C6L5 142 ? 507 ? 142 507 
3  1 4LEY C 1 ? 366 ? Q8C6L5 142 ? 507 ? 142 507 
4  1 4LEY D 1 ? 366 ? Q8C6L5 142 ? 507 ? 142 507 
5  2 4LEY E 1 ? 18  ? 4LEY   1   ? 18  ? 1   18  
6  2 4LEY F 1 ? 18  ? 4LEY   1   ? 18  ? 1   18  
7  2 4LEY G 1 ? 18  ? 4LEY   1   ? 18  ? 1   18  
8  2 4LEY H 1 ? 18  ? 4LEY   1   ? 18  ? 1   18  
9  2 4LEY I 1 ? 18  ? 4LEY   1   ? 18  ? 1   18  
10 2 4LEY J 1 ? 18  ? 4LEY   1   ? 18  ? 1   18  
11 2 4LEY K 1 ? 18  ? 4LEY   1   ? 18  ? 1   18  
12 2 4LEY L 1 ? 18  ? 4LEY   1   ? 18  ? 1   18  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.entry_id          4LEY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.67 
_exptl_crystal.density_percent_sol   53.96 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '24-36% MPD, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           153 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV++' 
_diffrn_detector.pdbx_collection_date   2013-03-31 
_diffrn_detector.details                Osmic 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Osmic 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.542 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.542 
# 
_reflns.entry_id                     4LEY 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             40.8 
_reflns.d_resolution_high            2.50 
_reflns.number_obs                   ? 
_reflns.number_all                   78350 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.107 
_reflns.pdbx_Rsym_value              0.107 
_reflns.pdbx_netI_over_sigmaI        18.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   1.000 
_reflns_shell.Rmerge_I_obs           0.716 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4LEY 
_refine.ls_number_reflns_obs                     78261 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.773 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    99.72 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1610 
_refine.ls_R_factor_R_free                       0.1911 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.55 
_refine.ls_number_reflns_R_free                  1993 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'human cGAS' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       TWIN_LSQ_F 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            . 
_refine.pdbx_overall_phase_error                 28.63 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11876 
_refine_hist.pdbx_number_atoms_nucleic_acid   2928 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             631 
_refine_hist.number_atoms_total               15439 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        40.773 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.005  ? ? 15412 ? 'X-RAY DIFFRACTION' 
f_angle_d          0.942  ? ? 21332 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 19.769 ? ? 6140  ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.056  ? ? 2316  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.006  ? ? 2208  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.5009 2.5634  5411 0.2866 97.00 0.3285 . . 145 . . . . 'X-RAY DIFFRACTION' 
. 2.5634 2.6327  5422 0.2688 97.00 0.3174 . . 143 . . . . 'X-RAY DIFFRACTION' 
. 2.6327 2.7101  5441 0.2482 97.00 0.3063 . . 146 . . . . 'X-RAY DIFFRACTION' 
. 2.7101 2.7976  5434 0.2340 97.00 0.2798 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 2.7976 2.8975  5437 0.2060 97.00 0.2450 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 2.8975 3.0134  5412 0.1952 97.00 0.2550 . . 144 . . . . 'X-RAY DIFFRACTION' 
. 3.0134 3.1504  5436 0.1805 97.00 0.2223 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 3.1504 3.3163  5403 0.1584 97.00 0.2155 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 3.3163 3.5238  5471 0.1523 97.00 0.1908 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 3.5238 3.7954  5414 0.1517 97.00 0.1789 . . 143 . . . . 'X-RAY DIFFRACTION' 
. 3.7954 4.1765  5438 0.1338 97.00 0.1706 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 4.1765 4.7789  5452 0.1142 97.00 0.1503 . . 146 . . . . 'X-RAY DIFFRACTION' 
. 4.7789 6.0133  5488 0.1211 97.00 0.1291 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 6.0133 30.5165 5507 0.1263 97.00 0.1286 . . 140 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4LEY 
_struct.title                     'Structure of mouse cGAS bound to 18 bp DNA' 
_struct.pdbx_descriptor           'Cyclic GMP-AMP synthase (E.C.2.7.7.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4LEY 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'NTase, DNA sensor, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 2 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 3 ? 
N  N N 3 ? 
O  N N 3 ? 
P  N N 3 ? 
Q  N N 4 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 4 ? 
W  N N 4 ? 
X  N N 4 ? 
Y  N N 4 ? 
Z  N N 4 ? 
AA N N 4 ? 
BA N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 9   ? ARG A 17  ? LEU A 150 ARG A 158 1 ? 9  
HELX_P HELX_P2  2  LYS A 19  ? LYS A 43  ? LYS A 160 LYS A 184 1 ? 25 
HELX_P HELX_P3  3  SER A 117 ? ILE A 136 ? SER A 258 ILE A 277 1 ? 20 
HELX_P HELX_P4  4  GLY A 192 ? ARG A 200 ? GLY A 333 ARG A 341 1 ? 9  
HELX_P HELX_P5  5  PHE A 226 ? ASN A 236 ? PHE A 367 ASN A 377 1 ? 11 
HELX_P HELX_P6  6  CYS A 252 ? PHE A 271 ? CYS A 393 PHE A 412 1 ? 20 
HELX_P HELX_P7  7  GLN A 272 ? ASP A 275 ? GLN A 413 ASP A 416 5 ? 4  
HELX_P HELX_P8  8  CYS A 278 ? ASP A 293 ? CYS A 419 ASP A 434 1 ? 16 
HELX_P HELX_P9  9  GLN A 295 ? ASP A 300 ? GLN A 436 ASP A 441 5 ? 6  
HELX_P HELX_P10 10 LEU A 304 ? GLU A 322 ? LEU A 445 GLU A 463 1 ? 19 
HELX_P HELX_P11 11 ASP A 341 ? ASN A 357 ? ASP A 482 ASN A 498 1 ? 17 
HELX_P HELX_P12 12 ASN A 358 ? GLY A 359 ? ASN A 499 GLY A 500 5 ? 2  
HELX_P HELX_P13 13 PHE A 360 ? LYS A 365 ? PHE A 501 LYS A 506 5 ? 6  
HELX_P HELX_P14 14 LEU B 9   ? ARG B 17  ? LEU B 150 ARG B 158 1 ? 9  
HELX_P HELX_P15 15 LYS B 19  ? LYS B 43  ? LYS B 160 LYS B 184 1 ? 25 
HELX_P HELX_P16 16 LEU B 107 ? LEU B 111 ? LEU B 248 LEU B 252 5 ? 5  
HELX_P HELX_P17 17 SER B 117 ? GLU B 135 ? SER B 258 GLU B 276 1 ? 19 
HELX_P HELX_P18 18 PRO B 178 ? LYS B 182 ? PRO B 319 LYS B 323 5 ? 5  
HELX_P HELX_P19 19 GLY B 192 ? ARG B 200 ? GLY B 333 ARG B 341 1 ? 9  
HELX_P HELX_P20 20 PHE B 226 ? ASN B 236 ? PHE B 367 ASN B 377 1 ? 11 
HELX_P HELX_P21 21 CYS B 252 ? PHE B 271 ? CYS B 393 PHE B 412 1 ? 20 
HELX_P HELX_P22 22 GLN B 272 ? ASP B 275 ? GLN B 413 ASP B 416 5 ? 4  
HELX_P HELX_P23 23 CYS B 278 ? ASP B 293 ? CYS B 419 ASP B 434 1 ? 16 
HELX_P HELX_P24 24 GLN B 295 ? ARG B 302 ? GLN B 436 ARG B 443 5 ? 8  
HELX_P HELX_P25 25 ASN B 303 ? GLU B 322 ? ASN B 444 GLU B 463 1 ? 20 
HELX_P HELX_P26 26 ASP B 341 ? ASN B 357 ? ASP B 482 ASN B 498 1 ? 17 
HELX_P HELX_P27 27 PHE B 360 ? LYS B 365 ? PHE B 501 LYS B 506 5 ? 6  
HELX_P HELX_P28 28 LEU C 9   ? ARG C 17  ? LEU C 150 ARG C 158 1 ? 9  
HELX_P HELX_P29 29 LYS C 19  ? ARG C 44  ? LYS C 160 ARG C 185 1 ? 26 
HELX_P HELX_P30 30 SER C 117 ? GLU C 135 ? SER C 258 GLU C 276 1 ? 19 
HELX_P HELX_P31 31 PRO C 178 ? LYS C 182 ? PRO C 319 LYS C 323 5 ? 5  
HELX_P HELX_P32 32 GLY C 192 ? ARG C 201 ? GLY C 333 ARG C 342 1 ? 10 
HELX_P HELX_P33 33 PHE C 217 ? GLY C 219 ? PHE C 358 GLY C 360 5 ? 3  
HELX_P HELX_P34 34 PHE C 226 ? ASN C 235 ? PHE C 367 ASN C 376 1 ? 10 
HELX_P HELX_P35 35 CYS C 252 ? PHE C 271 ? CYS C 393 PHE C 412 1 ? 20 
HELX_P HELX_P36 36 GLN C 272 ? ASP C 275 ? GLN C 413 ASP C 416 5 ? 4  
HELX_P HELX_P37 37 CYS C 278 ? ASP C 293 ? CYS C 419 ASP C 434 1 ? 16 
HELX_P HELX_P38 38 GLN C 295 ? ASP C 300 ? GLN C 436 ASP C 441 5 ? 6  
HELX_P HELX_P39 39 ASN C 303 ? THR C 321 ? ASN C 444 THR C 462 1 ? 19 
HELX_P HELX_P40 40 LYS C 343 ? ASN C 358 ? LYS C 484 ASN C 499 1 ? 16 
HELX_P HELX_P41 41 PHE C 360 ? LYS C 365 ? PHE C 501 LYS C 506 5 ? 6  
HELX_P HELX_P42 42 LEU D 9   ? ARG D 17  ? LEU D 150 ARG D 158 1 ? 9  
HELX_P HELX_P43 43 LYS D 19  ? GLN D 42  ? LYS D 160 GLN D 183 1 ? 24 
HELX_P HELX_P44 44 LEU D 107 ? LEU D 111 ? LEU D 248 LEU D 252 5 ? 5  
HELX_P HELX_P45 45 SER D 117 ? GLU D 135 ? SER D 258 GLU D 276 1 ? 19 
HELX_P HELX_P46 46 PRO D 178 ? LYS D 182 ? PRO D 319 LYS D 323 5 ? 5  
HELX_P HELX_P47 47 GLY D 192 ? GLU D 202 ? GLY D 333 GLU D 343 1 ? 11 
HELX_P HELX_P48 48 PHE D 217 ? GLU D 220 ? PHE D 358 GLU D 361 5 ? 4  
HELX_P HELX_P49 49 PHE D 226 ? ASN D 236 ? PHE D 367 ASN D 377 1 ? 11 
HELX_P HELX_P50 50 CYS D 252 ? PHE D 271 ? CYS D 393 PHE D 412 1 ? 20 
HELX_P HELX_P51 51 GLN D 272 ? ASP D 275 ? GLN D 413 ASP D 416 5 ? 4  
HELX_P HELX_P52 52 CYS D 278 ? ASP D 293 ? CYS D 419 ASP D 434 1 ? 16 
HELX_P HELX_P53 53 GLN D 295 ? ASP D 300 ? GLN D 436 ASP D 441 5 ? 6  
HELX_P HELX_P54 54 ASN D 303 ? THR D 321 ? ASN D 444 THR D 462 1 ? 19 
HELX_P HELX_P55 55 ASP D 341 ? ASN D 358 ? ASP D 482 ASN D 499 1 ? 18 
HELX_P HELX_P56 56 PHE D 360 ? ASP D 364 ? PHE D 501 ASP D 505 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? D HIS 237 NE2 ? ? ? 1_555 P ZN .  ZN ? ? D HIS 378 D ZN 601 1_555 ? ? ? ? ? ? ?               2.013 ? 
metalc2   metalc ? ? B HIS 237 NE2 ? ? ? 1_555 N ZN .  ZN ? ? B HIS 378 B ZN 601 1_555 ? ? ? ? ? ? ?               2.071 ? 
metalc3   metalc ? ? C HIS 237 NE2 ? ? ? 1_555 O ZN .  ZN ? ? C HIS 378 C ZN 601 1_555 ? ? ? ? ? ? ?               2.107 ? 
metalc4   metalc ? ? A HIS 237 NE2 ? ? ? 1_555 M ZN .  ZN ? ? A HIS 378 A ZN 601 1_555 ? ? ? ? ? ? ?               2.119 ? 
metalc5   metalc ? ? A CYS 244 SG  ? ? ? 1_555 M ZN .  ZN ? ? A CYS 385 A ZN 601 1_555 ? ? ? ? ? ? ?               2.267 ? 
metalc6   metalc ? ? B CYS 244 SG  ? ? ? 1_555 N ZN .  ZN ? ? B CYS 385 B ZN 601 1_555 ? ? ? ? ? ? ?               2.290 ? 
metalc7   metalc ? ? C CYS 243 SG  ? ? ? 1_555 O ZN .  ZN ? ? C CYS 384 C ZN 601 1_555 ? ? ? ? ? ? ?               2.320 ? 
metalc8   metalc ? ? B CYS 243 SG  ? ? ? 1_555 N ZN .  ZN ? ? B CYS 384 B ZN 601 1_555 ? ? ? ? ? ? ?               2.321 ? 
metalc9   metalc ? ? A CYS 251 SG  ? ? ? 1_555 M ZN .  ZN ? ? A CYS 392 A ZN 601 1_555 ? ? ? ? ? ? ?               2.346 ? 
metalc10  metalc ? ? C CYS 244 SG  ? ? ? 1_555 O ZN .  ZN ? ? C CYS 385 C ZN 601 1_555 ? ? ? ? ? ? ?               2.348 ? 
metalc11  metalc ? ? C CYS 251 SG  ? ? ? 1_555 O ZN .  ZN ? ? C CYS 392 C ZN 601 1_555 ? ? ? ? ? ? ?               2.360 ? 
metalc12  metalc ? ? D CYS 251 SG  ? ? ? 1_555 P ZN .  ZN ? ? D CYS 392 D ZN 601 1_555 ? ? ? ? ? ? ?               2.374 ? 
metalc13  metalc ? ? A CYS 243 SG  ? ? ? 1_555 M ZN .  ZN ? ? A CYS 384 A ZN 601 1_555 ? ? ? ? ? ? ?               2.378 ? 
metalc14  metalc ? ? D CYS 243 SG  ? ? ? 1_555 P ZN .  ZN ? ? D CYS 384 D ZN 601 1_555 ? ? ? ? ? ? ?               2.399 ? 
metalc15  metalc ? ? B CYS 251 SG  ? ? ? 1_555 N ZN .  ZN ? ? B CYS 392 B ZN 601 1_555 ? ? ? ? ? ? ?               2.427 ? 
metalc16  metalc ? ? D CYS 244 SG  ? ? ? 1_555 P ZN .  ZN ? ? D CYS 385 D ZN 601 1_555 ? ? ? ? ? ? ?               2.435 ? 
hydrog1   hydrog ? ? E DA  1   N1  ? ? ? 1_555 F DT 18 N3 ? ? E DA  1   F DT 18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? E DA  1   N6  ? ? ? 1_555 F DT 18 O4 ? ? E DA  1   F DT 18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? E DT  2   N3  ? ? ? 1_555 F DA 17 N1 ? ? E DT  2   F DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? E DT  2   O4  ? ? ? 1_555 F DA 17 N6 ? ? E DT  2   F DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? E DC  3   N3  ? ? ? 1_555 F DG 16 N1 ? ? E DC  3   F DG 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? E DC  3   N4  ? ? ? 1_555 F DG 16 O6 ? ? E DC  3   F DG 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? E DC  3   O2  ? ? ? 1_555 F DG 16 N2 ? ? E DC  3   F DG 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? E DT  4   N3  ? ? ? 1_555 F DA 15 N1 ? ? E DT  4   F DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? E DT  4   O4  ? ? ? 1_555 F DA 15 N6 ? ? E DT  4   F DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? E DG  5   N1  ? ? ? 1_555 F DC 14 N3 ? ? E DG  5   F DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? E DG  5   N2  ? ? ? 1_555 F DC 14 O2 ? ? E DG  5   F DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? E DG  5   O6  ? ? ? 1_555 F DC 14 N4 ? ? E DG  5   F DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? E DT  6   N3  ? ? ? 1_555 F DA 13 N1 ? ? E DT  6   F DA 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? E DT  6   O4  ? ? ? 1_555 F DA 13 N6 ? ? E DT  6   F DA 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? E DA  7   N1  ? ? ? 1_555 F DT 12 N3 ? ? E DA  7   F DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? E DA  7   N6  ? ? ? 1_555 F DT 12 O4 ? ? E DA  7   F DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? E DC  8   N3  ? ? ? 1_555 F DG 11 N1 ? ? E DC  8   F DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? E DC  8   N4  ? ? ? 1_555 F DG 11 O6 ? ? E DC  8   F DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? E DC  8   O2  ? ? ? 1_555 F DG 11 N2 ? ? E DC  8   F DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? E DA  9   N1  ? ? ? 1_555 F DT 10 N3 ? ? E DA  9   F DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? E DA  9   N6  ? ? ? 1_555 F DT 10 O4 ? ? E DA  9   F DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? E DT  10  N3  ? ? ? 1_555 F DA 9  N1 ? ? E DT  10  F DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? E DT  10  O4  ? ? ? 1_555 F DA 9  N6 ? ? E DT  10  F DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? E DG  11  N1  ? ? ? 1_555 F DC 8  N3 ? ? E DG  11  F DC 8   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog25  hydrog ? ? E DT  12  N3  ? ? ? 1_555 F DA 7  N1 ? ? E DT  12  F DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? E DT  12  O4  ? ? ? 1_555 F DA 7  N6 ? ? E DT  12  F DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? E DA  13  N1  ? ? ? 1_555 F DT 6  N3 ? ? E DA  13  F DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? E DA  13  N6  ? ? ? 1_555 F DT 6  O4 ? ? E DA  13  F DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? E DC  14  N3  ? ? ? 1_555 F DG 5  N1 ? ? E DC  14  F DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? E DC  14  N4  ? ? ? 1_555 F DG 5  O6 ? ? E DC  14  F DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? E DC  14  O2  ? ? ? 1_555 F DG 5  N2 ? ? E DC  14  F DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? E DA  15  N1  ? ? ? 1_555 F DT 4  N3 ? ? E DA  15  F DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? E DA  15  N6  ? ? ? 1_555 F DT 4  O4 ? ? E DA  15  F DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? E DG  16  N1  ? ? ? 1_555 F DC 3  N3 ? ? E DG  16  F DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? E DG  16  N2  ? ? ? 1_555 F DC 3  O2 ? ? E DG  16  F DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? E DG  16  O6  ? ? ? 1_555 F DC 3  N4 ? ? E DG  16  F DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? E DA  17  N1  ? ? ? 1_555 F DT 2  N3 ? ? E DA  17  F DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? E DA  17  N6  ? ? ? 1_555 F DT 2  O4 ? ? E DA  17  F DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? E DT  18  N3  ? ? ? 1_555 F DA 1  N1 ? ? E DT  18  F DA 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? E DT  18  O4  ? ? ? 1_555 F DA 1  N6 ? ? E DT  18  F DA 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? G DA  1   N1  ? ? ? 1_555 H DT 18 N3 ? ? G DA  1   H DT 18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? G DA  1   N6  ? ? ? 1_555 H DT 18 O4 ? ? G DA  1   H DT 18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? G DT  2   N3  ? ? ? 1_555 H DA 17 N1 ? ? G DT  2   H DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? G DT  2   O4  ? ? ? 1_555 H DA 17 N6 ? ? G DT  2   H DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? G DC  3   N3  ? ? ? 1_555 H DG 16 N1 ? ? G DC  3   H DG 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? G DC  3   N4  ? ? ? 1_555 H DG 16 O6 ? ? G DC  3   H DG 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? G DC  3   O2  ? ? ? 1_555 H DG 16 N2 ? ? G DC  3   H DG 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? G DT  4   N3  ? ? ? 1_555 H DA 15 N1 ? ? G DT  4   H DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? G DT  4   O4  ? ? ? 1_555 H DA 15 N6 ? ? G DT  4   H DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? G DG  5   N1  ? ? ? 1_555 H DC 14 N3 ? ? G DG  5   H DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? G DG  5   N2  ? ? ? 1_555 H DC 14 O2 ? ? G DG  5   H DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? G DG  5   O6  ? ? ? 1_555 H DC 14 N4 ? ? G DG  5   H DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? G DT  6   N3  ? ? ? 1_555 H DA 13 N1 ? ? G DT  6   H DA 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? G DT  6   O4  ? ? ? 1_555 H DA 13 N6 ? ? G DT  6   H DA 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? G DA  7   N1  ? ? ? 1_555 H DT 12 N3 ? ? G DA  7   H DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? G DA  7   N6  ? ? ? 1_555 H DT 12 O4 ? ? G DA  7   H DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? G DC  8   N3  ? ? ? 1_555 H DG 11 N1 ? ? G DC  8   H DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? G DC  8   N4  ? ? ? 1_555 H DG 11 O6 ? ? G DC  8   H DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? G DC  8   O2  ? ? ? 1_555 H DG 11 N2 ? ? G DC  8   H DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? G DA  9   N1  ? ? ? 1_555 H DT 10 N3 ? ? G DA  9   H DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? G DA  9   N6  ? ? ? 1_555 H DT 10 O4 ? ? G DA  9   H DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? G DT  10  N3  ? ? ? 1_555 H DA 9  N1 ? ? G DT  10  H DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? G DT  10  O4  ? ? ? 1_555 H DA 9  N6 ? ? G DT  10  H DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? G DG  11  N1  ? ? ? 1_555 H DC 8  N3 ? ? G DG  11  H DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? G DG  11  N2  ? ? ? 1_555 H DC 8  O2 ? ? G DG  11  H DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? G DG  11  O6  ? ? ? 1_555 H DC 8  N4 ? ? G DG  11  H DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? G DT  12  N3  ? ? ? 1_555 H DA 7  N1 ? ? G DT  12  H DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? G DT  12  O4  ? ? ? 1_555 H DA 7  N6 ? ? G DT  12  H DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? G DA  13  N1  ? ? ? 1_555 H DT 6  N3 ? ? G DA  13  H DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? G DA  13  N6  ? ? ? 1_555 H DT 6  O4 ? ? G DA  13  H DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? G DC  14  N3  ? ? ? 1_555 H DG 5  N1 ? ? G DC  14  H DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? G DC  14  N4  ? ? ? 1_555 H DG 5  O6 ? ? G DC  14  H DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? G DC  14  O2  ? ? ? 1_555 H DG 5  N2 ? ? G DC  14  H DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? G DA  15  N1  ? ? ? 1_555 H DT 4  N3 ? ? G DA  15  H DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? G DA  15  N6  ? ? ? 1_555 H DT 4  O4 ? ? G DA  15  H DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? G DG  16  N1  ? ? ? 1_555 H DC 3  N3 ? ? G DG  16  H DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? G DG  16  N2  ? ? ? 1_555 H DC 3  O2 ? ? G DG  16  H DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? G DG  16  O6  ? ? ? 1_555 H DC 3  N4 ? ? G DG  16  H DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? G DA  17  N1  ? ? ? 1_555 H DT 2  N3 ? ? G DA  17  H DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? G DA  17  N6  ? ? ? 1_555 H DT 2  O4 ? ? G DA  17  H DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? G DT  18  N3  ? ? ? 1_555 H DA 1  N1 ? ? G DT  18  H DA 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? G DT  18  O4  ? ? ? 1_555 H DA 1  N6 ? ? G DT  18  H DA 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? I DA  1   N1  ? ? ? 1_555 J DT 18 N3 ? ? I DA  1   J DT 18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? I DA  1   N6  ? ? ? 1_555 J DT 18 O4 ? ? I DA  1   J DT 18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? I DT  2   N3  ? ? ? 1_555 J DA 17 N1 ? ? I DT  2   J DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? I DT  2   O4  ? ? ? 1_555 J DA 17 N6 ? ? I DT  2   J DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? I DC  3   N4  ? ? ? 1_555 J DG 16 O6 ? ? I DC  3   J DG 16  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog88  hydrog ? ? I DT  4   O4  ? ? ? 1_555 J DC 14 N4 ? ? I DT  4   J DC 14  1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog89  hydrog ? ? I DT  4   O4  ? ? ? 1_555 J DA 15 N6 ? ? I DT  4   J DA 15  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog90  hydrog ? ? I DG  5   N1  ? ? ? 1_555 J DC 14 N3 ? ? I DG  5   J DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? I DG  5   N2  ? ? ? 1_555 J DC 14 O2 ? ? I DG  5   J DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DG  5   O6  ? ? ? 1_555 J DC 14 N4 ? ? I DG  5   J DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? I DT  6   N3  ? ? ? 1_555 J DA 13 N1 ? ? I DT  6   J DA 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? I DT  6   O4  ? ? ? 1_555 J DA 13 N6 ? ? I DT  6   J DA 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DA  7   N1  ? ? ? 1_555 J DT 12 N3 ? ? I DA  7   J DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? I DA  7   N6  ? ? ? 1_555 J DT 12 O4 ? ? I DA  7   J DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I DC  8   N3  ? ? ? 1_555 J DG 11 N1 ? ? I DC  8   J DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I DC  8   N4  ? ? ? 1_555 J DG 11 O6 ? ? I DC  8   J DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I DC  8   O2  ? ? ? 1_555 J DG 11 N2 ? ? I DC  8   J DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? I DA  9   N1  ? ? ? 1_555 J DT 10 N3 ? ? I DA  9   J DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? I DA  9   N6  ? ? ? 1_555 J DT 10 O4 ? ? I DA  9   J DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? I DT  10  N3  ? ? ? 1_555 J DA 9  N1 ? ? I DT  10  J DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I DT  10  O4  ? ? ? 1_555 J DA 9  N6 ? ? I DT  10  J DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I DG  11  N1  ? ? ? 1_555 J DC 8  N3 ? ? I DG  11  J DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? I DG  11  N2  ? ? ? 1_555 J DC 8  O2 ? ? I DG  11  J DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? I DG  11  O6  ? ? ? 1_555 J DC 8  N4 ? ? I DG  11  J DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DT  12  N3  ? ? ? 1_555 J DA 7  N1 ? ? I DT  12  J DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? I DT  12  O4  ? ? ? 1_555 J DA 7  N6 ? ? I DT  12  J DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? I DA  13  N1  ? ? ? 1_555 J DT 6  N3 ? ? I DA  13  J DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? I DA  13  N6  ? ? ? 1_555 J DT 6  O4 ? ? I DA  13  J DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? I DC  14  N4  ? ? ? 1_555 J DT 4  O4 ? ? I DC  14  J DT 4   1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
hydrog112 hydrog ? ? I DC  14  N3  ? ? ? 1_555 J DG 5  N1 ? ? I DC  14  J DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I DC  14  N4  ? ? ? 1_555 J DG 5  O6 ? ? I DC  14  J DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DC  14  O2  ? ? ? 1_555 J DG 5  N2 ? ? I DC  14  J DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? I DA  15  N1  ? ? ? 1_555 J DT 4  N3 ? ? I DA  15  J DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? I DA  15  N6  ? ? ? 1_555 J DT 4  O4 ? ? I DA  15  J DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? I DG  16  N1  ? ? ? 1_555 J DC 3  N3 ? ? I DG  16  J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? I DG  16  N2  ? ? ? 1_555 J DC 3  O2 ? ? I DG  16  J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? I DG  16  O6  ? ? ? 1_555 J DC 3  N4 ? ? I DG  16  J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? I DA  17  N1  ? ? ? 1_555 J DT 2  N3 ? ? I DA  17  J DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? I DA  17  N6  ? ? ? 1_555 J DT 2  O4 ? ? I DA  17  J DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? I DT  18  N3  ? ? ? 1_555 J DA 1  N1 ? ? I DT  18  J DA 1   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog123 hydrog ? ? K DA  1   N1  ? ? ? 1_555 L DT 18 N3 ? ? K DA  1   L DT 18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? K DA  1   N6  ? ? ? 1_555 L DT 18 O4 ? ? K DA  1   L DT 18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? K DT  2   N3  ? ? ? 1_555 L DA 17 N1 ? ? K DT  2   L DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? K DT  2   O4  ? ? ? 1_555 L DA 17 N6 ? ? K DT  2   L DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? K DC  3   N3  ? ? ? 1_555 L DG 16 N1 ? ? K DC  3   L DG 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? K DC  3   N4  ? ? ? 1_555 L DG 16 O6 ? ? K DC  3   L DG 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? K DC  3   O2  ? ? ? 1_555 L DG 16 N2 ? ? K DC  3   L DG 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? K DT  4   N3  ? ? ? 1_555 L DA 15 N1 ? ? K DT  4   L DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? K DT  4   O4  ? ? ? 1_555 L DA 15 N6 ? ? K DT  4   L DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? K DG  5   N1  ? ? ? 1_555 L DC 14 N3 ? ? K DG  5   L DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? K DG  5   N2  ? ? ? 1_555 L DC 14 O2 ? ? K DG  5   L DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? K DG  5   O6  ? ? ? 1_555 L DC 14 N4 ? ? K DG  5   L DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? K DT  6   N3  ? ? ? 1_555 L DA 13 N1 ? ? K DT  6   L DA 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? K DT  6   O4  ? ? ? 1_555 L DA 13 N6 ? ? K DT  6   L DA 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? K DA  7   N1  ? ? ? 1_555 L DT 12 N3 ? ? K DA  7   L DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? K DA  7   N6  ? ? ? 1_555 L DT 12 O4 ? ? K DA  7   L DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? K DC  8   N3  ? ? ? 1_555 L DG 11 N1 ? ? K DC  8   L DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? K DC  8   N4  ? ? ? 1_555 L DG 11 O6 ? ? K DC  8   L DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? K DC  8   O2  ? ? ? 1_555 L DG 11 N2 ? ? K DC  8   L DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? K DA  9   N1  ? ? ? 1_555 L DT 10 N3 ? ? K DA  9   L DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? K DA  9   N6  ? ? ? 1_555 L DT 10 O4 ? ? K DA  9   L DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? K DT  10  N3  ? ? ? 1_555 L DA 9  N1 ? ? K DT  10  L DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? K DT  10  O4  ? ? ? 1_555 L DA 9  N6 ? ? K DT  10  L DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? K DG  11  N1  ? ? ? 1_555 L DC 8  N3 ? ? K DG  11  L DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? K DG  11  N2  ? ? ? 1_555 L DC 8  O2 ? ? K DG  11  L DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? K DG  11  O6  ? ? ? 1_555 L DC 8  N4 ? ? K DG  11  L DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? K DT  12  N3  ? ? ? 1_555 L DA 7  N1 ? ? K DT  12  L DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? K DT  12  O4  ? ? ? 1_555 L DA 7  N6 ? ? K DT  12  L DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? K DA  13  N1  ? ? ? 1_555 L DT 6  N3 ? ? K DA  13  L DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? K DA  13  N6  ? ? ? 1_555 L DT 6  O4 ? ? K DA  13  L DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? K DC  14  N3  ? ? ? 1_555 L DG 5  N1 ? ? K DC  14  L DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? K DC  14  N4  ? ? ? 1_555 L DG 5  O6 ? ? K DC  14  L DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? K DC  14  O2  ? ? ? 1_555 L DG 5  N2 ? ? K DC  14  L DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? K DA  15  N1  ? ? ? 1_555 L DT 4  N3 ? ? K DA  15  L DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? K DA  15  N6  ? ? ? 1_555 L DT 4  O4 ? ? K DA  15  L DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? K DG  16  N1  ? ? ? 1_555 L DC 3  N3 ? ? K DG  16  L DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? K DG  16  N2  ? ? ? 1_555 L DC 3  O2 ? ? K DG  16  L DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? K DG  16  O6  ? ? ? 1_555 L DC 3  N4 ? ? K DG  16  L DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? K DA  17  N1  ? ? ? 1_555 L DT 2  N3 ? ? K DA  17  L DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? K DA  17  N6  ? ? ? 1_555 L DT 2  O4 ? ? K DA  17  L DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? K DT  18  N3  ? ? ? 1_555 L DA 1  N1 ? ? K DT  18  L DA 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? K DT  18  O4  ? ? ? 1_555 L DA 1  N6 ? ? K DT  18  L DA 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 5 ? 
C ? 2 ? 
D ? 7 ? 
E ? 5 ? 
F ? 7 ? 
G ? 5 ? 
H ? 2 ? 
I ? 7 ? 
J ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
F 6 7 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? parallel      
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? parallel      
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
I 5 6 ? anti-parallel 
I 6 7 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? parallel      
J 3 4 ? anti-parallel 
J 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 52  ? THR A 56  ? GLU A 193 THR A 197 
A 2 GLU A 70  ? GLU A 78  ? GLU A 211 GLU A 219 
A 3 GLU A 162 ? SER A 173 ? GLU A 303 SER A 314 
A 4 PHE A 204 ? PRO A 208 ? PHE A 345 PRO A 349 
A 5 THR A 221 ? SER A 225 ? THR A 362 SER A 366 
A 6 PHE A 93  ? PHE A 98  ? PHE A 234 PHE A 239 
A 7 ILE A 82  ? GLU A 86  ? ILE A 223 GLU A 227 
B 1 GLU A 52  ? THR A 56  ? GLU A 193 THR A 197 
B 2 GLU A 70  ? GLU A 78  ? GLU A 211 GLU A 219 
B 3 GLU A 162 ? SER A 173 ? GLU A 303 SER A 314 
B 4 ALA A 152 ? ARG A 158 ? ALA A 293 ARG A 299 
B 5 ASP A 140 ? VAL A 143 ? ASP A 281 VAL A 284 
C 1 LEU A 111 ? GLU A 112 ? LEU A 252 GLU A 253 
C 2 VAL A 115 ? LEU A 116 ? VAL A 256 LEU A 257 
D 1 GLU B 52  ? THR B 56  ? GLU B 193 THR B 197 
D 2 GLU B 70  ? GLU B 78  ? GLU B 211 GLU B 219 
D 3 GLU B 162 ? SER B 173 ? GLU B 303 SER B 314 
D 4 PHE B 204 ? PRO B 208 ? PHE B 345 PRO B 349 
D 5 THR B 221 ? SER B 225 ? THR B 362 SER B 366 
D 6 PHE B 93  ? PHE B 98  ? PHE B 234 PHE B 239 
D 7 ILE B 82  ? GLU B 86  ? ILE B 223 GLU B 227 
E 1 GLU B 52  ? THR B 56  ? GLU B 193 THR B 197 
E 2 GLU B 70  ? GLU B 78  ? GLU B 211 GLU B 219 
E 3 GLU B 162 ? SER B 173 ? GLU B 303 SER B 314 
E 4 ALA B 152 ? ARG B 158 ? ALA B 293 ARG B 299 
E 5 VAL B 141 ? VAL B 143 ? VAL B 282 VAL B 284 
F 1 GLU C 52  ? THR C 56  ? GLU C 193 THR C 197 
F 2 GLU C 70  ? GLU C 78  ? GLU C 211 GLU C 219 
F 3 ILE C 163 ? SER C 173 ? ILE C 304 SER C 314 
F 4 PHE C 204 ? PRO C 208 ? PHE C 345 PRO C 349 
F 5 THR C 221 ? SER C 225 ? THR C 362 SER C 366 
F 6 PHE C 93  ? PHE C 98  ? PHE C 234 PHE C 239 
F 7 ILE C 82  ? GLU C 86  ? ILE C 223 GLU C 227 
G 1 GLU C 52  ? THR C 56  ? GLU C 193 THR C 197 
G 2 GLU C 70  ? GLU C 78  ? GLU C 211 GLU C 219 
G 3 ILE C 163 ? SER C 173 ? ILE C 304 SER C 314 
G 4 ALA C 152 ? ILE C 157 ? ALA C 293 ILE C 298 
G 5 VAL C 141 ? VAL C 143 ? VAL C 282 VAL C 284 
H 1 LEU C 111 ? GLU C 112 ? LEU C 252 GLU C 253 
H 2 VAL C 115 ? LEU C 116 ? VAL C 256 LEU C 257 
I 1 GLU D 52  ? THR D 56  ? GLU D 193 THR D 197 
I 2 GLU D 70  ? GLU D 78  ? GLU D 211 GLU D 219 
I 3 GLU D 162 ? SER D 173 ? GLU D 303 SER D 314 
I 4 PHE D 204 ? PRO D 208 ? PHE D 345 PRO D 349 
I 5 TRP D 222 ? SER D 225 ? TRP D 363 SER D 366 
I 6 PHE D 93  ? PHE D 98  ? PHE D 234 PHE D 239 
I 7 ILE D 82  ? GLU D 86  ? ILE D 223 GLU D 227 
J 1 GLU D 52  ? THR D 56  ? GLU D 193 THR D 197 
J 2 GLU D 70  ? GLU D 78  ? GLU D 211 GLU D 219 
J 3 GLU D 162 ? SER D 173 ? GLU D 303 SER D 314 
J 4 ALA D 152 ? ARG D 158 ? ALA D 293 ARG D 299 
J 5 VAL D 141 ? VAL D 143 ? VAL D 282 VAL D 284 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 52  ? N GLU A 193 O LYS A 76  ? O LYS A 217 
A 2 3 N PHE A 75  ? N PHE A 216 O ILE A 168 ? O ILE A 309 
A 3 4 N SER A 173 ? N SER A 314 O PHE A 204 ? O PHE A 345 
A 4 5 N VAL A 207 ? N VAL A 348 O ARG A 223 ? O ARG A 364 
A 5 6 O TRP A 222 ? O TRP A 363 N TYR A 94  ? N TYR A 235 
A 6 7 O LYS A 97  ? O LYS A 238 N GLU A 83  ? N GLU A 224 
B 1 2 N GLU A 52  ? N GLU A 193 O LYS A 76  ? O LYS A 217 
B 2 3 N PHE A 75  ? N PHE A 216 O ILE A 168 ? O ILE A 309 
B 3 4 O ILE A 163 ? O ILE A 304 N ILE A 157 ? N ILE A 298 
B 4 5 O ARG A 158 ? O ARG A 299 N ASP A 140 ? N ASP A 281 
C 1 2 N GLU A 112 ? N GLU A 253 O VAL A 115 ? O VAL A 256 
D 1 2 N LEU B 54  ? N LEU B 195 O MET B 74  ? O MET B 215 
D 2 3 N VAL B 73  ? N VAL B 214 O ASP B 166 ? O ASP B 307 
D 3 4 N SER B 173 ? N SER B 314 O PHE B 204 ? O PHE B 345 
D 4 5 N VAL B 207 ? N VAL B 348 O ARG B 223 ? O ARG B 364 
D 5 6 O TRP B 222 ? O TRP B 363 N TYR B 94  ? N TYR B 235 
D 6 7 O LYS B 97  ? O LYS B 238 N GLU B 83  ? N GLU B 224 
E 1 2 N LEU B 54  ? N LEU B 195 O MET B 74  ? O MET B 215 
E 2 3 N VAL B 73  ? N VAL B 214 O ASP B 166 ? O ASP B 307 
E 3 4 O ILE B 163 ? O ILE B 304 N ILE B 157 ? N ILE B 298 
E 4 5 O LEU B 156 ? O LEU B 297 N SER B 142 ? N SER B 283 
F 1 2 N LEU C 54  ? N LEU C 195 O MET C 74  ? O MET C 215 
F 2 3 N VAL C 73  ? N VAL C 214 O ILE C 168 ? O ILE C 309 
F 3 4 N SER C 173 ? N SER C 314 O PHE C 204 ? O PHE C 345 
F 4 5 N VAL C 207 ? N VAL C 348 O ARG C 223 ? O ARG C 364 
F 5 6 O TRP C 222 ? O TRP C 363 N TYR C 94  ? N TYR C 235 
F 6 7 O LYS C 97  ? O LYS C 238 N GLU C 83  ? N GLU C 224 
G 1 2 N LEU C 54  ? N LEU C 195 O MET C 74  ? O MET C 215 
G 2 3 N VAL C 73  ? N VAL C 214 O ILE C 168 ? O ILE C 309 
G 3 4 O ILE C 163 ? O ILE C 304 N ILE C 157 ? N ILE C 298 
G 4 5 O LEU C 156 ? O LEU C 297 N SER C 142 ? N SER C 283 
H 1 2 N GLU C 112 ? N GLU C 253 O VAL C 115 ? O VAL C 256 
I 1 2 N LEU D 54  ? N LEU D 195 O MET D 74  ? O MET D 215 
I 2 3 N PHE D 75  ? N PHE D 216 O ILE D 168 ? O ILE D 309 
I 3 4 N SER D 173 ? N SER D 314 O PHE D 204 ? O PHE D 345 
I 4 5 N VAL D 207 ? N VAL D 348 O ARG D 223 ? O ARG D 364 
I 5 6 O TRP D 222 ? O TRP D 363 N TYR D 94  ? N TYR D 235 
I 6 7 O LEU D 95  ? O LEU D 236 N GLN D 85  ? N GLN D 226 
J 1 2 N LEU D 54  ? N LEU D 195 O MET D 74  ? O MET D 215 
J 2 3 N PHE D 75  ? N PHE D 216 O ILE D 168 ? O ILE D 309 
J 3 4 O ILE D 163 ? O ILE D 304 N ILE D 157 ? N ILE D 298 
J 4 5 O LEU D 156 ? O LEU D 297 N SER D 142 ? N SER D 283 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 601' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 601' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN C 601' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN D 601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS A 237 ? HIS A 378 . ? 1_555 ? 
2  AC1 4 CYS A 243 ? CYS A 384 . ? 1_555 ? 
3  AC1 4 CYS A 244 ? CYS A 385 . ? 1_555 ? 
4  AC1 4 CYS A 251 ? CYS A 392 . ? 1_555 ? 
5  AC2 4 HIS B 237 ? HIS B 378 . ? 1_555 ? 
6  AC2 4 CYS B 243 ? CYS B 384 . ? 1_555 ? 
7  AC2 4 CYS B 244 ? CYS B 385 . ? 1_555 ? 
8  AC2 4 CYS B 251 ? CYS B 392 . ? 1_555 ? 
9  AC3 4 HIS C 237 ? HIS C 378 . ? 1_555 ? 
10 AC3 4 CYS C 243 ? CYS C 384 . ? 1_555 ? 
11 AC3 4 CYS C 244 ? CYS C 385 . ? 1_555 ? 
12 AC3 4 CYS C 251 ? CYS C 392 . ? 1_555 ? 
13 AC4 4 HIS D 237 ? HIS D 378 . ? 1_555 ? 
14 AC4 4 CYS D 243 ? CYS D 384 . ? 1_555 ? 
15 AC4 4 CYS D 244 ? CYS D 385 . ? 1_555 ? 
16 AC4 4 CYS D 251 ? CYS D 392 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4LEY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4LEY 
_atom_sites.fract_transf_matrix[1][1]   0.012759 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000016 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006854 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009905 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LYS A  1 8   ? 36.537  25.687  37.397  1.00 80.73  ? 149 LYS A N     1 
ATOM   2     C  CA    . LYS A  1 8   ? 35.332  25.643  38.218  1.00 84.11  ? 149 LYS A CA    1 
ATOM   3     C  C     . LYS A  1 8   ? 34.844  24.214  38.432  1.00 82.82  ? 149 LYS A C     1 
ATOM   4     O  O     . LYS A  1 8   ? 34.715  23.750  39.565  1.00 83.93  ? 149 LYS A O     1 
ATOM   5     C  CB    . LYS A  1 8   ? 34.222  26.491  37.595  1.00 87.59  ? 149 LYS A CB    1 
ATOM   6     C  CG    . LYS A  1 8   ? 34.377  27.981  37.843  1.00 90.03  ? 149 LYS A CG    1 
ATOM   7     C  CD    . LYS A  1 8   ? 33.149  28.744  37.387  1.00 91.89  ? 149 LYS A CD    1 
ATOM   8     C  CE    . LYS A  1 8   ? 33.134  30.150  37.965  1.00 93.43  ? 149 LYS A CE    1 
ATOM   9     N  NZ    . LYS A  1 8   ? 31.956  30.925  37.489  1.00 93.40  ? 149 LYS A NZ    1 
ATOM   10    N  N     . LEU A  1 9   ? 34.569  23.521  37.334  1.00 77.98  ? 150 LEU A N     1 
ATOM   11    C  CA    . LEU A  1 9   ? 34.093  22.149  37.399  1.00 71.26  ? 150 LEU A CA    1 
ATOM   12    C  C     . LEU A  1 9   ? 35.268  21.172  37.432  1.00 71.50  ? 150 LEU A C     1 
ATOM   13    O  O     . LEU A  1 9   ? 35.072  19.961  37.537  1.00 73.89  ? 150 LEU A O     1 
ATOM   14    C  CB    . LEU A  1 9   ? 33.184  21.854  36.206  1.00 65.63  ? 150 LEU A CB    1 
ATOM   15    C  CG    . LEU A  1 9   ? 32.022  22.826  36.007  1.00 63.39  ? 150 LEU A CG    1 
ATOM   16    C  CD1   . LEU A  1 9   ? 31.377  22.638  34.649  1.00 61.86  ? 150 LEU A CD1   1 
ATOM   17    C  CD2   . LEU A  1 9   ? 30.998  22.638  37.101  1.00 64.84  ? 150 LEU A CD2   1 
ATOM   18    N  N     . LYS A  1 10  ? 36.485  21.707  37.353  1.00 70.28  ? 151 LYS A N     1 
ATOM   19    C  CA    . LYS A  1 10  ? 37.692  20.884  37.335  1.00 68.89  ? 151 LYS A CA    1 
ATOM   20    C  C     . LYS A  1 10  ? 37.799  19.990  38.567  1.00 68.54  ? 151 LYS A C     1 
ATOM   21    O  O     . LYS A  1 10  ? 38.042  18.793  38.446  1.00 68.47  ? 151 LYS A O     1 
ATOM   22    C  CB    . LYS A  1 10  ? 38.935  21.765  37.223  1.00 66.36  ? 151 LYS A CB    1 
ATOM   23    C  CG    . LYS A  1 10  ? 38.901  22.738  36.054  1.00 63.24  ? 151 LYS A CG    1 
ATOM   24    C  CD    . LYS A  1 10  ? 40.107  23.661  36.080  1.00 60.65  ? 151 LYS A CD    1 
ATOM   25    C  CE    . LYS A  1 10  ? 39.923  24.848  35.151  1.00 57.25  ? 151 LYS A CE    1 
ATOM   26    N  NZ    . LYS A  1 10  ? 41.019  25.841  35.326  1.00 55.43  ? 151 LYS A NZ    1 
ATOM   27    N  N     . LYS A  1 11  ? 37.605  20.575  39.745  1.00 67.03  ? 152 LYS A N     1 
ATOM   28    C  CA    . LYS A  1 11  ? 37.712  19.839  41.003  1.00 68.04  ? 152 LYS A CA    1 
ATOM   29    C  C     . LYS A  1 11  ? 36.685  18.704  41.113  1.00 68.50  ? 152 LYS A C     1 
ATOM   30    O  O     . LYS A  1 11  ? 36.997  17.623  41.628  1.00 71.89  ? 152 LYS A O     1 
ATOM   31    C  CB    . LYS A  1 11  ? 37.594  20.805  42.182  1.00 70.34  ? 152 LYS A CB    1 
ATOM   32    C  CG    . LYS A  1 11  ? 38.600  21.949  42.118  1.00 73.45  ? 152 LYS A CG    1 
ATOM   33    C  CD    . LYS A  1 11  ? 38.329  23.007  43.180  1.00 76.18  ? 152 LYS A CD    1 
ATOM   34    C  CE    . LYS A  1 11  ? 39.348  24.142  43.103  1.00 76.83  ? 152 LYS A CE    1 
ATOM   35    N  NZ    . LYS A  1 11  ? 39.050  25.222  44.086  1.00 76.39  ? 152 LYS A NZ    1 
ATOM   36    N  N     . VAL A  1 12  ? 35.472  18.951  40.619  1.00 63.94  ? 153 VAL A N     1 
ATOM   37    C  CA    . VAL A  1 12  ? 34.438  17.919  40.555  1.00 58.57  ? 153 VAL A CA    1 
ATOM   38    C  C     . VAL A  1 12  ? 34.936  16.724  39.755  1.00 57.73  ? 153 VAL A C     1 
ATOM   39    O  O     . VAL A  1 12  ? 34.835  15.588  40.205  1.00 57.84  ? 153 VAL A O     1 
ATOM   40    C  CB    . VAL A  1 12  ? 33.151  18.433  39.890  1.00 56.89  ? 153 VAL A CB    1 
ATOM   41    C  CG1   . VAL A  1 12  ? 32.118  17.320  39.802  1.00 55.79  ? 153 VAL A CG1   1 
ATOM   42    C  CG2   . VAL A  1 12  ? 32.589  19.613  40.661  1.00 58.22  ? 153 VAL A CG2   1 
ATOM   43    N  N     . LEU A  1 13  ? 35.469  16.994  38.567  1.00 55.60  ? 154 LEU A N     1 
ATOM   44    C  CA    . LEU A  1 13  ? 36.025  15.954  37.708  1.00 49.59  ? 154 LEU A CA    1 
ATOM   45    C  C     . LEU A  1 13  ? 37.178  15.227  38.397  1.00 50.43  ? 154 LEU A C     1 
ATOM   46    O  O     . LEU A  1 13  ? 37.283  14.000  38.322  1.00 52.39  ? 154 LEU A O     1 
ATOM   47    C  CB    . LEU A  1 13  ? 36.486  16.559  36.382  1.00 47.60  ? 154 LEU A CB    1 
ATOM   48    C  CG    . LEU A  1 13  ? 35.371  17.032  35.453  1.00 45.85  ? 154 LEU A CG    1 
ATOM   49    C  CD1   . LEU A  1 13  ? 35.940  17.733  34.238  1.00 45.73  ? 154 LEU A CD1   1 
ATOM   50    C  CD2   . LEU A  1 13  ? 34.513  15.859  35.026  1.00 44.80  ? 154 LEU A CD2   1 
ATOM   51    N  N     . ASP A  1 14  ? 38.027  15.991  39.081  1.00 47.89  ? 155 ASP A N     1 
ATOM   52    C  CA    . ASP A  1 14  ? 39.134  15.441  39.854  1.00 48.07  ? 155 ASP A CA    1 
ATOM   53    C  C     . ASP A  1 14  ? 38.620  14.552  40.984  1.00 50.21  ? 155 ASP A C     1 
ATOM   54    O  O     . ASP A  1 14  ? 39.358  13.733  41.529  1.00 52.19  ? 155 ASP A O     1 
ATOM   55    C  CB    . ASP A  1 14  ? 39.985  16.574  40.430  1.00 52.19  ? 155 ASP A CB    1 
ATOM   56    C  CG    . ASP A  1 14  ? 40.708  17.367  39.360  1.00 57.37  ? 155 ASP A CG    1 
ATOM   57    O  OD1   . ASP A  1 14  ? 40.384  17.202  38.165  1.00 61.34  ? 155 ASP A OD1   1 
ATOM   58    O  OD2   . ASP A  1 14  ? 41.599  18.165  39.720  1.00 56.03  ? 155 ASP A OD2   1 
ATOM   59    N  N     . LYS A  1 15  ? 37.347  14.726  41.326  1.00 50.81  ? 156 LYS A N     1 
ATOM   60    C  CA    . LYS A  1 15  ? 36.691  13.953  42.377  1.00 50.79  ? 156 LYS A CA    1 
ATOM   61    C  C     . LYS A  1 15  ? 35.973  12.718  41.812  1.00 47.41  ? 156 LYS A C     1 
ATOM   62    O  O     . LYS A  1 15  ? 35.833  11.703  42.496  1.00 47.68  ? 156 LYS A O     1 
ATOM   63    C  CB    . LYS A  1 15  ? 35.705  14.858  43.117  1.00 55.11  ? 156 LYS A CB    1 
ATOM   64    C  CG    . LYS A  1 15  ? 34.834  14.186  44.159  1.00 58.33  ? 156 LYS A CG    1 
ATOM   65    C  CD    . LYS A  1 15  ? 33.626  15.066  44.433  1.00 59.75  ? 156 LYS A CD    1 
ATOM   66    C  CE    . LYS A  1 15  ? 32.920  14.693  45.718  1.00 62.36  ? 156 LYS A CE    1 
ATOM   67    N  NZ    . LYS A  1 15  ? 31.742  15.579  45.933  1.00 63.62  ? 156 LYS A NZ    1 
ATOM   68    N  N     . LEU A  1 16  ? 35.527  12.812  40.560  1.00 43.57  ? 157 LEU A N     1 
ATOM   69    C  CA    . LEU A  1 16  ? 34.881  11.696  39.875  1.00 39.84  ? 157 LEU A CA    1 
ATOM   70    C  C     . LEU A  1 16  ? 35.921  10.833  39.180  1.00 42.88  ? 157 LEU A C     1 
ATOM   71    O  O     . LEU A  1 16  ? 35.637  9.701   38.789  1.00 40.05  ? 157 LEU A O     1 
ATOM   72    C  CB    . LEU A  1 16  ? 33.885  12.205  38.835  1.00 36.13  ? 157 LEU A CB    1 
ATOM   73    C  CG    . LEU A  1 16  ? 32.856  13.223  39.308  1.00 37.76  ? 157 LEU A CG    1 
ATOM   74    C  CD1   . LEU A  1 16  ? 31.883  13.547  38.199  1.00 37.34  ? 157 LEU A CD1   1 
ATOM   75    C  CD2   . LEU A  1 16  ? 32.127  12.696  40.515  1.00 39.15  ? 157 LEU A CD2   1 
ATOM   76    N  N     . ARG A  1 17  ? 37.119  11.390  39.012  1.00 47.14  ? 158 ARG A N     1 
ATOM   77    C  CA    . ARG A  1 17  ? 38.227  10.674  38.399  1.00 44.59  ? 158 ARG A CA    1 
ATOM   78    C  C     . ARG A  1 17  ? 38.486  9.413   39.202  1.00 45.59  ? 158 ARG A C     1 
ATOM   79    O  O     . ARG A  1 17  ? 38.642  9.468   40.420  1.00 48.92  ? 158 ARG A O     1 
ATOM   80    C  CB    . ARG A  1 17  ? 39.476  11.553  38.388  1.00 45.43  ? 158 ARG A CB    1 
ATOM   81    C  CG    . ARG A  1 17  ? 40.605  11.037  37.512  1.00 47.92  ? 158 ARG A CG    1 
ATOM   82    C  CD    . ARG A  1 17  ? 41.776  12.020  37.457  1.00 47.44  ? 158 ARG A CD    1 
ATOM   83    N  NE    . ARG A  1 17  ? 41.331  13.402  37.292  1.00 45.76  ? 158 ARG A NE    1 
ATOM   84    C  CZ    . ARG A  1 17  ? 40.965  13.939  36.132  1.00 44.94  ? 158 ARG A CZ    1 
ATOM   85    N  NH1   . ARG A  1 17  ? 40.977  13.206  35.025  1.00 42.50  ? 158 ARG A NH1   1 
ATOM   86    N  NH2   . ARG A  1 17  ? 40.577  15.208  36.074  1.00 44.86  ? 158 ARG A NH2   1 
ATOM   87    N  N     . LEU A  1 18  ? 38.498  8.272   38.524  1.00 43.71  ? 159 LEU A N     1 
ATOM   88    C  CA    . LEU A  1 18  ? 38.739  7.001   39.191  1.00 39.30  ? 159 LEU A CA    1 
ATOM   89    C  C     . LEU A  1 18  ? 40.200  6.891   39.615  1.00 39.64  ? 159 LEU A C     1 
ATOM   90    O  O     . LEU A  1 18  ? 41.050  7.655   39.152  1.00 42.51  ? 159 LEU A O     1 
ATOM   91    C  CB    . LEU A  1 18  ? 38.349  5.842   38.277  1.00 36.10  ? 159 LEU A CB    1 
ATOM   92    C  CG    . LEU A  1 18  ? 36.878  5.813   37.866  1.00 32.87  ? 159 LEU A CG    1 
ATOM   93    C  CD1   . LEU A  1 18  ? 36.534  4.548   37.098  1.00 31.57  ? 159 LEU A CD1   1 
ATOM   94    C  CD2   . LEU A  1 18  ? 35.995  5.935   39.079  1.00 34.73  ? 159 LEU A CD2   1 
ATOM   95    N  N     . LYS A  1 19  ? 40.491  5.958   40.514  1.00 40.51  ? 160 LYS A N     1 
ATOM   96    C  CA    . LYS A  1 19  ? 41.866  5.741   40.948  1.00 43.70  ? 160 LYS A CA    1 
ATOM   97    C  C     . LYS A  1 19  ? 42.394  4.388   40.492  1.00 43.76  ? 160 LYS A C     1 
ATOM   98    O  O     . LYS A  1 19  ? 41.667  3.391   40.515  1.00 46.61  ? 160 LYS A O     1 
ATOM   99    C  CB    . LYS A  1 19  ? 41.982  5.874   42.464  1.00 44.38  ? 160 LYS A CB    1 
ATOM   100   C  CG    . LYS A  1 19  ? 41.647  7.256   42.971  1.00 43.26  ? 160 LYS A CG    1 
ATOM   101   C  CD    . LYS A  1 19  ? 42.105  7.428   44.395  1.00 49.11  ? 160 LYS A CD    1 
ATOM   102   C  CE    . LYS A  1 19  ? 41.639  8.759   44.950  1.00 54.27  ? 160 LYS A CE    1 
ATOM   103   N  NZ    . LYS A  1 19  ? 42.190  8.988   46.315  1.00 57.40  ? 160 LYS A NZ    1 
ATOM   104   N  N     . ARG A  1 20  ? 43.662  4.363   40.091  1.00 42.04  ? 161 ARG A N     1 
ATOM   105   C  CA    . ARG A  1 20  ? 44.276  3.166   39.529  1.00 40.44  ? 161 ARG A CA    1 
ATOM   106   C  C     . ARG A  1 20  ? 44.239  1.977   40.487  1.00 41.24  ? 161 ARG A C     1 
ATOM   107   O  O     . ARG A  1 20  ? 44.029  0.843   40.062  1.00 43.81  ? 161 ARG A O     1 
ATOM   108   C  CB    . ARG A  1 20  ? 45.717  3.450   39.118  1.00 43.12  ? 161 ARG A CB    1 
ATOM   109   C  CG    . ARG A  1 20  ? 46.361  2.304   38.364  1.00 45.57  ? 161 ARG A CG    1 
ATOM   110   C  CD    . ARG A  1 20  ? 46.550  2.653   36.907  1.00 46.62  ? 161 ARG A CD    1 
ATOM   111   N  NE    . ARG A  1 20  ? 47.827  3.318   36.693  1.00 47.98  ? 161 ARG A NE    1 
ATOM   112   C  CZ    . ARG A  1 20  ? 48.124  4.042   35.622  1.00 48.88  ? 161 ARG A CZ    1 
ATOM   113   N  NH1   . ARG A  1 20  ? 47.230  4.214   34.659  1.00 48.39  ? 161 ARG A NH1   1 
ATOM   114   N  NH2   . ARG A  1 20  ? 49.317  4.602   35.521  1.00 50.01  ? 161 ARG A NH2   1 
ATOM   115   N  N     . LYS A  1 21  ? 44.440  2.237   41.773  1.00 40.75  ? 162 LYS A N     1 
ATOM   116   C  CA    . LYS A  1 21  ? 44.403  1.174   42.769  1.00 43.23  ? 162 LYS A CA    1 
ATOM   117   C  C     . LYS A  1 21  ? 43.030  0.526   42.802  1.00 40.78  ? 162 LYS A C     1 
ATOM   118   O  O     . LYS A  1 21  ? 42.914  -0.704  42.805  1.00 40.73  ? 162 LYS A O     1 
ATOM   119   C  CB    . LYS A  1 21  ? 44.758  1.720   44.149  1.00 50.63  ? 162 LYS A CB    1 
ATOM   120   C  CG    . LYS A  1 21  ? 46.252  1.814   44.408  1.00 56.78  ? 162 LYS A CG    1 
ATOM   121   C  CD    . LYS A  1 21  ? 46.537  2.585   45.690  1.00 64.06  ? 162 LYS A CD    1 
ATOM   122   C  CE    . LYS A  1 21  ? 48.036  2.734   45.924  1.00 67.81  ? 162 LYS A CE    1 
ATOM   123   N  NZ    . LYS A  1 21  ? 48.350  3.755   46.971  1.00 68.11  ? 162 LYS A NZ    1 
ATOM   124   N  N     . ASP A  1 22  ? 41.996  1.363   42.812  1.00 39.37  ? 163 ASP A N     1 
ATOM   125   C  CA    . ASP A  1 22  ? 40.616  0.894   42.823  1.00 41.41  ? 163 ASP A CA    1 
ATOM   126   C  C     . ASP A  1 22  ? 40.279  0.121   41.546  1.00 39.95  ? 163 ASP A C     1 
ATOM   127   O  O     . ASP A  1 22  ? 39.635  -0.931  41.592  1.00 40.53  ? 163 ASP A O     1 
ATOM   128   C  CB    . ASP A  1 22  ? 39.662  2.080   42.986  1.00 43.37  ? 163 ASP A CB    1 
ATOM   129   C  CG    . ASP A  1 22  ? 39.992  2.936   44.197  1.00 45.89  ? 163 ASP A CG    1 
ATOM   130   O  OD1   . ASP A  1 22  ? 40.626  2.421   45.141  1.00 44.40  ? 163 ASP A OD1   1 
ATOM   131   O  OD2   . ASP A  1 22  ? 39.609  4.127   44.209  1.00 48.37  ? 163 ASP A OD2   1 
ATOM   132   N  N     . ILE A  1 23  ? 40.726  0.653   40.411  1.00 38.38  ? 164 ILE A N     1 
ATOM   133   C  CA    . ILE A  1 23  ? 40.491  0.047   39.103  1.00 35.19  ? 164 ILE A CA    1 
ATOM   134   C  C     . ILE A  1 23  ? 41.134  -1.336  39.004  1.00 38.38  ? 164 ILE A C     1 
ATOM   135   O  O     . ILE A  1 23  ? 40.491  -2.302  38.592  1.00 41.50  ? 164 ILE A O     1 
ATOM   136   C  CB    . ILE A  1 23  ? 41.002  0.973   37.971  1.00 29.97  ? 164 ILE A CB    1 
ATOM   137   C  CG1   . ILE A  1 23  ? 40.118  2.217   37.861  1.00 28.48  ? 164 ILE A CG1   1 
ATOM   138   C  CG2   . ILE A  1 23  ? 41.063  0.246   36.634  1.00 23.65  ? 164 ILE A CG2   1 
ATOM   139   C  CD1   . ILE A  1 23  ? 40.740  3.340   37.051  1.00 33.65  ? 164 ILE A CD1   1 
ATOM   140   N  N     . SER A  1 24  ? 42.403  -1.422  39.388  1.00 39.61  ? 165 SER A N     1 
ATOM   141   C  CA    . SER A  1 24  ? 43.126  -2.687  39.413  1.00 38.54  ? 165 SER A CA    1 
ATOM   142   C  C     . SER A  1 24  ? 42.438  -3.680  40.347  1.00 36.50  ? 165 SER A C     1 
ATOM   143   O  O     . SER A  1 24  ? 42.014  -4.759  39.910  1.00 37.18  ? 165 SER A O     1 
ATOM   144   C  CB    . SER A  1 24  ? 44.570  -2.449  39.855  1.00 40.85  ? 165 SER A CB    1 
ATOM   145   O  OG    . SER A  1 24  ? 45.319  -3.646  39.838  1.00 41.75  ? 165 SER A OG    1 
ATOM   146   N  N     . GLU A  1 25  ? 42.310  -3.294  41.618  1.00 36.90  ? 166 GLU A N     1 
ATOM   147   C  CA    . GLU A  1 25  ? 41.686  -4.131  42.643  1.00 39.12  ? 166 GLU A CA    1 
ATOM   148   C  C     . GLU A  1 25  ? 40.329  -4.688  42.223  1.00 40.30  ? 166 GLU A C     1 
ATOM   149   O  O     . GLU A  1 25  ? 40.027  -5.850  42.480  1.00 44.96  ? 166 GLU A O     1 
ATOM   150   C  CB    . GLU A  1 25  ? 41.531  -3.357  43.954  1.00 43.13  ? 166 GLU A CB    1 
ATOM   151   C  CG    . GLU A  1 25  ? 42.801  -3.210  44.788  1.00 45.49  ? 166 GLU A CG    1 
ATOM   152   C  CD    . GLU A  1 25  ? 42.563  -2.389  46.045  1.00 51.13  ? 166 GLU A CD    1 
ATOM   153   O  OE1   . GLU A  1 25  ? 41.393  -2.277  46.474  1.00 51.56  ? 166 GLU A OE1   1 
ATOM   154   O  OE2   . GLU A  1 25  ? 43.545  -1.855  46.602  1.00 53.24  ? 166 GLU A OE2   1 
ATOM   155   N  N     . ALA A  1 26  ? 39.510  -3.858  41.583  1.00 39.06  ? 167 ALA A N     1 
ATOM   156   C  CA    . ALA A  1 26  ? 38.185  -4.299  41.144  1.00 31.21  ? 167 ALA A CA    1 
ATOM   157   C  C     . ALA A  1 26  ? 38.264  -5.217  39.925  1.00 29.07  ? 167 ALA A C     1 
ATOM   158   O  O     . ALA A  1 26  ? 37.645  -6.283  39.892  1.00 32.93  ? 167 ALA A O     1 
ATOM   159   C  CB    . ALA A  1 26  ? 37.296  -3.105  40.858  1.00 26.67  ? 167 ALA A CB    1 
ATOM   160   N  N     . ALA A  1 27  ? 39.031  -4.798  38.924  1.00 29.84  ? 168 ALA A N     1 
ATOM   161   C  CA    . ALA A  1 27  ? 39.138  -5.551  37.677  1.00 27.66  ? 168 ALA A CA    1 
ATOM   162   C  C     . ALA A  1 27  ? 39.717  -6.957  37.848  1.00 29.72  ? 168 ALA A C     1 
ATOM   163   O  O     . ALA A  1 27  ? 39.361  -7.857  37.087  1.00 27.84  ? 168 ALA A O     1 
ATOM   164   C  CB    . ALA A  1 27  ? 39.925  -4.773  36.656  1.00 23.49  ? 168 ALA A CB    1 
ATOM   165   N  N     . GLU A  1 28  ? 40.614  -7.146  38.818  1.00 36.00  ? 169 GLU A N     1 
ATOM   166   C  CA    . GLU A  1 28  ? 41.131  -8.490  39.098  1.00 41.81  ? 169 GLU A CA    1 
ATOM   167   C  C     . GLU A  1 28  ? 39.967  -9.441  39.359  1.00 46.24  ? 169 GLU A C     1 
ATOM   168   O  O     . GLU A  1 28  ? 39.761  -10.437 38.654  1.00 51.37  ? 169 GLU A O     1 
ATOM   169   C  CB    . GLU A  1 28  ? 42.018  -8.491  40.344  1.00 43.07  ? 169 GLU A CB    1 
ATOM   170   C  CG    . GLU A  1 28  ? 43.203  -7.550  40.314  1.00 43.31  ? 169 GLU A CG    1 
ATOM   171   C  CD    . GLU A  1 28  ? 43.905  -7.477  41.656  1.00 45.93  ? 169 GLU A CD    1 
ATOM   172   O  OE1   . GLU A  1 28  ? 45.143  -7.339  41.669  1.00 45.43  ? 169 GLU A OE1   1 
ATOM   173   O  OE2   . GLU A  1 28  ? 43.217  -7.540  42.697  1.00 46.03  ? 169 GLU A OE2   1 
ATOM   174   N  N     . THR A  1 29  ? 39.210  -9.103  40.393  1.00 45.63  ? 170 THR A N     1 
ATOM   175   C  CA    . THR A  1 29  ? 38.091  -9.902  40.858  1.00 43.78  ? 170 THR A CA    1 
ATOM   176   C  C     . THR A  1 29  ? 37.024  -10.072 39.774  1.00 43.95  ? 170 THR A C     1 
ATOM   177   O  O     . THR A  1 29  ? 36.609  -11.203 39.464  1.00 49.57  ? 170 THR A O     1 
ATOM   178   C  CB    . THR A  1 29  ? 37.483  -9.250  42.098  1.00 45.30  ? 170 THR A CB    1 
ATOM   179   O  OG1   . THR A  1 29  ? 38.528  -8.949  43.033  1.00 47.55  ? 170 THR A OG1   1 
ATOM   180   C  CG2   . THR A  1 29  ? 36.489  -10.170 42.744  1.00 48.00  ? 170 THR A CG2   1 
ATOM   181   N  N     . VAL A  1 30  ? 36.592  -8.949  39.201  1.00 39.19  ? 171 VAL A N     1 
ATOM   182   C  CA    . VAL A  1 30  ? 35.567  -8.956  38.158  1.00 34.67  ? 171 VAL A CA    1 
ATOM   183   C  C     . VAL A  1 30  ? 35.962  -9.872  36.998  1.00 37.18  ? 171 VAL A C     1 
ATOM   184   O  O     . VAL A  1 30  ? 35.154  -10.682 36.529  1.00 41.23  ? 171 VAL A O     1 
ATOM   185   C  CB    . VAL A  1 30  ? 35.276  -7.532  37.655  1.00 28.05  ? 171 VAL A CB    1 
ATOM   186   C  CG1   . VAL A  1 30  ? 34.398  -7.558  36.414  1.00 23.87  ? 171 VAL A CG1   1 
ATOM   187   C  CG2   . VAL A  1 30  ? 34.610  -6.728  38.753  1.00 29.31  ? 171 VAL A CG2   1 
ATOM   188   N  N     . ASN A  1 31  ? 37.212  -9.760  36.559  1.00 34.71  ? 172 ASN A N     1 
ATOM   189   C  CA    . ASN A  1 31  ? 37.714  -10.623 35.500  1.00 31.00  ? 172 ASN A CA    1 
ATOM   190   C  C     . ASN A  1 31  ? 37.755  -12.100 35.883  1.00 27.95  ? 172 ASN A C     1 
ATOM   191   O  O     . ASN A  1 31  ? 37.424  -12.953 35.059  1.00 30.22  ? 172 ASN A O     1 
ATOM   192   C  CB    . ASN A  1 31  ? 39.082  -10.147 35.017  1.00 33.75  ? 172 ASN A CB    1 
ATOM   193   C  CG    . ASN A  1 31  ? 39.017  -8.800  34.323  1.00 37.09  ? 172 ASN A CG    1 
ATOM   194   O  OD1   . ASN A  1 31  ? 38.043  -8.481  33.642  1.00 36.23  ? 172 ASN A OD1   1 
ATOM   195   N  ND2   . ASN A  1 31  ? 40.057  -8.000  34.497  1.00 40.79  ? 172 ASN A ND2   1 
ATOM   196   N  N     . LYS A  1 32  ? 38.157  -12.406 37.118  1.00 27.47  ? 173 LYS A N     1 
ATOM   197   C  CA    . LYS A  1 32  ? 38.122  -13.797 37.584  1.00 27.45  ? 173 LYS A CA    1 
ATOM   198   C  C     . LYS A  1 32  ? 36.710  -14.379 37.476  1.00 31.46  ? 173 LYS A C     1 
ATOM   199   O  O     . LYS A  1 32  ? 36.492  -15.425 36.838  1.00 37.82  ? 173 LYS A O     1 
ATOM   200   C  CB    . LYS A  1 32  ? 38.607  -13.914 39.030  1.00 31.35  ? 173 LYS A CB    1 
ATOM   201   C  CG    . LYS A  1 32  ? 40.104  -13.692 39.241  1.00 35.82  ? 173 LYS A CG    1 
ATOM   202   C  CD    . LYS A  1 32  ? 40.452  -13.800 40.727  1.00 40.42  ? 173 LYS A CD    1 
ATOM   203   C  CE    . LYS A  1 32  ? 41.896  -13.408 41.003  1.00 46.24  ? 173 LYS A CE    1 
ATOM   204   N  NZ    . LYS A  1 32  ? 42.200  -13.448 42.464  1.00 50.01  ? 173 LYS A NZ    1 
ATOM   205   N  N     . VAL A  1 33  ? 35.752  -13.689 38.094  1.00 32.63  ? 174 VAL A N     1 
ATOM   206   C  CA    . VAL A  1 33  ? 34.359  -14.144 38.111  1.00 31.87  ? 174 VAL A CA    1 
ATOM   207   C  C     . VAL A  1 33  ? 33.804  -14.319 36.701  1.00 29.87  ? 174 VAL A C     1 
ATOM   208   O  O     . VAL A  1 33  ? 33.343  -15.406 36.337  1.00 35.65  ? 174 VAL A O     1 
ATOM   209   C  CB    . VAL A  1 33  ? 33.468  -13.174 38.903  1.00 32.96  ? 174 VAL A CB    1 
ATOM   210   C  CG1   . VAL A  1 33  ? 32.032  -13.664 38.940  1.00 34.24  ? 174 VAL A CG1   1 
ATOM   211   C  CG2   . VAL A  1 33  ? 33.997  -13.026 40.309  1.00 25.19  ? 174 VAL A CG2   1 
ATOM   212   N  N     . VAL A  1 34  ? 33.869  -13.250 35.912  1.00 27.47  ? 175 VAL A N     1 
ATOM   213   C  CA    . VAL A  1 34  ? 33.371  -13.273 34.537  1.00 29.17  ? 175 VAL A CA    1 
ATOM   214   C  C     . VAL A  1 34  ? 34.001  -14.381 33.693  1.00 36.98  ? 175 VAL A C     1 
ATOM   215   O  O     . VAL A  1 34  ? 33.302  -15.057 32.941  1.00 36.94  ? 175 VAL A O     1 
ATOM   216   C  CB    . VAL A  1 34  ? 33.567  -11.919 33.845  1.00 21.80  ? 175 VAL A CB    1 
ATOM   217   C  CG1   . VAL A  1 34  ? 33.214  -12.015 32.384  1.00 19.49  ? 175 VAL A CG1   1 
ATOM   218   C  CG2   . VAL A  1 34  ? 32.705  -10.875 34.502  1.00 23.43  ? 175 VAL A CG2   1 
ATOM   219   N  N     . GLU A  1 35  ? 35.313  -14.570 33.816  1.00 39.41  ? 176 GLU A N     1 
ATOM   220   C  CA    . GLU A  1 35  ? 35.977  -15.628 33.065  1.00 40.65  ? 176 GLU A CA    1 
ATOM   221   C  C     . GLU A  1 35  ? 35.444  -16.990 33.485  1.00 42.19  ? 176 GLU A C     1 
ATOM   222   O  O     . GLU A  1 35  ? 35.239  -17.875 32.647  1.00 46.23  ? 176 GLU A O     1 
ATOM   223   C  CB    . GLU A  1 35  ? 37.485  -15.572 33.270  1.00 45.41  ? 176 GLU A CB    1 
ATOM   224   C  CG    . GLU A  1 35  ? 38.243  -16.616 32.480  1.00 50.44  ? 176 GLU A CG    1 
ATOM   225   C  CD    . GLU A  1 35  ? 39.715  -16.630 32.818  1.00 59.03  ? 176 GLU A CD    1 
ATOM   226   O  OE1   . GLU A  1 35  ? 40.276  -17.733 32.972  1.00 63.50  ? 176 GLU A OE1   1 
ATOM   227   O  OE2   . GLU A  1 35  ? 40.311  -15.539 32.922  1.00 63.79  ? 176 GLU A OE2   1 
ATOM   228   N  N     . ARG A  1 36  ? 35.209  -17.147 34.785  1.00 36.76  ? 177 ARG A N     1 
ATOM   229   C  CA    . ARG A  1 36  ? 34.671  -18.399 35.301  1.00 33.70  ? 177 ARG A CA    1 
ATOM   230   C  C     . ARG A  1 36  ? 33.290  -18.704 34.723  1.00 35.02  ? 177 ARG A C     1 
ATOM   231   O  O     . ARG A  1 36  ? 33.035  -19.816 34.243  1.00 38.49  ? 177 ARG A O     1 
ATOM   232   C  CB    . ARG A  1 36  ? 34.611  -18.358 36.827  1.00 34.73  ? 177 ARG A CB    1 
ATOM   233   C  CG    . ARG A  1 36  ? 34.131  -19.652 37.441  1.00 33.63  ? 177 ARG A CG    1 
ATOM   234   C  CD    . ARG A  1 36  ? 34.822  -19.929 38.748  1.00 36.42  ? 177 ARG A CD    1 
ATOM   235   N  NE    . ARG A  1 36  ? 34.569  -21.290 39.203  1.00 40.45  ? 177 ARG A NE    1 
ATOM   236   C  CZ    . ARG A  1 36  ? 35.047  -21.797 40.332  1.00 41.33  ? 177 ARG A CZ    1 
ATOM   237   N  NH1   . ARG A  1 36  ? 35.803  -21.053 41.127  1.00 41.99  ? 177 ARG A NH1   1 
ATOM   238   N  NH2   . ARG A  1 36  ? 34.770  -23.048 40.665  1.00 41.44  ? 177 ARG A NH2   1 
ATOM   239   N  N     . LEU A  1 37  ? 32.408  -17.709 34.769  1.00 32.73  ? 178 LEU A N     1 
ATOM   240   C  CA    . LEU A  1 37  ? 31.063  -17.842 34.217  1.00 26.31  ? 178 LEU A CA    1 
ATOM   241   C  C     . LEU A  1 37  ? 31.095  -18.115 32.715  1.00 27.72  ? 178 LEU A C     1 
ATOM   242   O  O     . LEU A  1 37  ? 30.315  -18.919 32.208  1.00 29.18  ? 178 LEU A O     1 
ATOM   243   C  CB    . LEU A  1 37  ? 30.252  -16.577 34.500  1.00 22.54  ? 178 LEU A CB    1 
ATOM   244   C  CG    . LEU A  1 37  ? 30.050  -16.226 35.969  1.00 25.61  ? 178 LEU A CG    1 
ATOM   245   C  CD1   . LEU A  1 37  ? 29.356  -14.883 36.120  1.00 23.15  ? 178 LEU A CD1   1 
ATOM   246   C  CD2   . LEU A  1 37  ? 29.257  -17.323 36.670  1.00 29.16  ? 178 LEU A CD2   1 
ATOM   247   N  N     . LEU A  1 38  ? 31.999  -17.438 32.012  1.00 30.55  ? 179 LEU A N     1 
ATOM   248   C  CA    . LEU A  1 38  ? 32.135  -17.597 30.571  1.00 30.15  ? 179 LEU A CA    1 
ATOM   249   C  C     . LEU A  1 38  ? 32.517  -19.033 30.262  1.00 30.95  ? 179 LEU A C     1 
ATOM   250   O  O     . LEU A  1 38  ? 31.941  -19.648 29.366  1.00 28.90  ? 179 LEU A O     1 
ATOM   251   C  CB    . LEU A  1 38  ? 33.184  -16.632 30.011  1.00 29.92  ? 179 LEU A CB    1 
ATOM   252   C  CG    . LEU A  1 38  ? 33.210  -16.479 28.487  1.00 30.14  ? 179 LEU A CG    1 
ATOM   253   C  CD1   . LEU A  1 38  ? 31.966  -15.763 28.003  1.00 25.57  ? 179 LEU A CD1   1 
ATOM   254   C  CD2   . LEU A  1 38  ? 34.451  -15.748 28.015  1.00 32.29  ? 179 LEU A CD2   1 
ATOM   255   N  N     . ARG A  1 39  ? 33.479  -19.560 31.021  1.00 31.89  ? 180 ARG A N     1 
ATOM   256   C  CA    . ARG A  1 39  ? 33.883  -20.958 30.905  1.00 36.09  ? 180 ARG A CA    1 
ATOM   257   C  C     . ARG A  1 39  ? 32.721  -21.915 31.130  1.00 41.41  ? 180 ARG A C     1 
ATOM   258   O  O     . ARG A  1 39  ? 32.434  -22.763 30.284  1.00 44.02  ? 180 ARG A O     1 
ATOM   259   C  CB    . ARG A  1 39  ? 34.966  -21.280 31.924  1.00 40.47  ? 180 ARG A CB    1 
ATOM   260   C  CG    . ARG A  1 39  ? 36.373  -20.979 31.475  1.00 45.89  ? 180 ARG A CG    1 
ATOM   261   C  CD    . ARG A  1 39  ? 37.338  -21.880 32.217  1.00 51.68  ? 180 ARG A CD    1 
ATOM   262   N  NE    . ARG A  1 39  ? 38.692  -21.339 32.235  1.00 60.11  ? 180 ARG A NE    1 
ATOM   263   C  CZ    . ARG A  1 39  ? 39.760  -22.018 32.642  1.00 64.41  ? 180 ARG A CZ    1 
ATOM   264   N  NH1   . ARG A  1 39  ? 39.636  -23.272 33.053  1.00 64.80  ? 180 ARG A NH1   1 
ATOM   265   N  NH2   . ARG A  1 39  ? 40.956  -21.444 32.634  1.00 64.70  ? 180 ARG A NH2   1 
ATOM   266   N  N     . ARG A  1 40  ? 32.079  -21.787 32.289  1.00 43.72  ? 181 ARG A N     1 
ATOM   267   C  CA    . ARG A  1 40  ? 30.934  -22.618 32.649  1.00 41.75  ? 181 ARG A CA    1 
ATOM   268   C  C     . ARG A  1 40  ? 29.898  -22.646 31.532  1.00 45.53  ? 181 ARG A C     1 
ATOM   269   O  O     . ARG A  1 40  ? 29.497  -23.713 31.062  1.00 47.40  ? 181 ARG A O     1 
ATOM   270   C  CB    . ARG A  1 40  ? 30.295  -22.079 33.930  1.00 41.69  ? 181 ARG A CB    1 
ATOM   271   C  CG    . ARG A  1 40  ? 28.951  -22.697 34.278  1.00 44.58  ? 181 ARG A CG    1 
ATOM   272   C  CD    . ARG A  1 40  ? 29.072  -24.197 34.510  1.00 46.15  ? 181 ARG A CD    1 
ATOM   273   N  NE    . ARG A  1 40  ? 27.816  -24.794 34.954  1.00 48.11  ? 181 ARG A NE    1 
ATOM   274   C  CZ    . ARG A  1 40  ? 26.846  -25.202 34.139  1.00 49.35  ? 181 ARG A CZ    1 
ATOM   275   N  NH1   . ARG A  1 40  ? 26.970  -25.072 32.823  1.00 52.42  ? 181 ARG A NH1   1 
ATOM   276   N  NH2   . ARG A  1 40  ? 25.740  -25.729 34.644  1.00 45.20  ? 181 ARG A NH2   1 
ATOM   277   N  N     . MET A  1 41  ? 29.494  -21.455 31.103  1.00 48.67  ? 182 MET A N     1 
ATOM   278   C  CA    . MET A  1 41  ? 28.457  -21.281 30.096  1.00 48.32  ? 182 MET A CA    1 
ATOM   279   C  C     . MET A  1 41  ? 28.884  -21.855 28.754  1.00 55.20  ? 182 MET A C     1 
ATOM   280   O  O     . MET A  1 41  ? 28.065  -22.365 27.991  1.00 55.55  ? 182 MET A O     1 
ATOM   281   C  CB    . MET A  1 41  ? 28.169  -19.789 29.931  1.00 40.97  ? 182 MET A CB    1 
ATOM   282   C  CG    . MET A  1 41  ? 26.746  -19.457 29.573  1.00 35.99  ? 182 MET A CG    1 
ATOM   283   S  SD    . MET A  1 41  ? 25.626  -19.677 30.965  1.00 36.57  ? 182 MET A SD    1 
ATOM   284   C  CE    . MET A  1 41  ? 26.178  -18.366 32.042  1.00 21.80  ? 182 MET A CE    1 
ATOM   285   N  N     . GLN A  1 42  ? 30.175  -21.768 28.466  1.00 62.04  ? 183 GLN A N     1 
ATOM   286   C  CA    . GLN A  1 42  ? 30.663  -22.102 27.143  1.00 68.55  ? 183 GLN A CA    1 
ATOM   287   C  C     . GLN A  1 42  ? 31.194  -23.520 27.100  1.00 72.90  ? 183 GLN A C     1 
ATOM   288   O  O     . GLN A  1 42  ? 30.671  -24.356 26.364  1.00 74.08  ? 183 GLN A O     1 
ATOM   289   C  CB    . GLN A  1 42  ? 31.752  -21.117 26.734  1.00 71.45  ? 183 GLN A CB    1 
ATOM   290   C  CG    . GLN A  1 42  ? 31.869  -20.881 25.249  1.00 77.61  ? 183 GLN A CG    1 
ATOM   291   C  CD    . GLN A  1 42  ? 32.584  -19.583 24.952  1.00 87.61  ? 183 GLN A CD    1 
ATOM   292   O  OE1   . GLN A  1 42  ? 32.506  -18.632 25.731  1.00 90.98  ? 183 GLN A OE1   1 
ATOM   293   N  NE2   . GLN A  1 42  ? 33.289  -19.532 23.828  1.00 90.88  ? 183 GLN A NE2   1 
ATOM   294   N  N     . LYS A  1 43  ? 32.225  -23.784 27.897  1.00 82.06  ? 184 LYS A N     1 
ATOM   295   C  CA    . LYS A  1 43  ? 32.927  -25.063 27.858  1.00 85.99  ? 184 LYS A CA    1 
ATOM   296   C  C     . LYS A  1 43  ? 32.009  -26.278 28.004  1.00 87.39  ? 184 LYS A C     1 
ATOM   297   O  O     . LYS A  1 43  ? 31.753  -26.983 27.026  1.00 86.85  ? 184 LYS A O     1 
ATOM   298   C  CB    . LYS A  1 43  ? 34.044  -25.104 28.902  1.00 87.81  ? 184 LYS A CB    1 
ATOM   299   C  CG    . LYS A  1 43  ? 34.844  -26.391 28.869  1.00 90.38  ? 184 LYS A CG    1 
ATOM   300   C  CD    . LYS A  1 43  ? 36.055  -26.326 29.772  1.00 91.59  ? 184 LYS A CD    1 
ATOM   301   C  CE    . LYS A  1 43  ? 36.906  -27.573 29.609  1.00 92.58  ? 184 LYS A CE    1 
ATOM   302   N  NZ    . LYS A  1 43  ? 38.139  -27.504 30.439  1.00 93.18  ? 184 LYS A NZ    1 
ATOM   303   N  N     . ARG A  1 44  ? 31.512  -26.521 29.213  1.00 89.57  ? 185 ARG A N     1 
ATOM   304   C  CA    . ARG A  1 44  ? 30.643  -27.670 29.439  1.00 92.05  ? 185 ARG A CA    1 
ATOM   305   C  C     . ARG A  1 44  ? 29.312  -27.504 28.714  1.00 90.22  ? 185 ARG A C     1 
ATOM   306   O  O     . ARG A  1 44  ? 29.036  -26.450 28.139  1.00 88.93  ? 185 ARG A O     1 
ATOM   307   C  CB    . ARG A  1 44  ? 30.431  -27.916 30.933  1.00 96.40  ? 185 ARG A CB    1 
ATOM   308   C  CG    . ARG A  1 44  ? 29.461  -26.970 31.608  1.00 100.33 ? 185 ARG A CG    1 
ATOM   309   C  CD    . ARG A  1 44  ? 29.323  -27.318 33.082  1.00 104.28 ? 185 ARG A CD    1 
ATOM   310   N  NE    . ARG A  1 44  ? 29.033  -28.732 33.295  1.00 106.67 ? 185 ARG A NE    1 
ATOM   311   C  CZ    . ARG A  1 44  ? 28.933  -29.303 34.492  1.00 108.09 ? 185 ARG A CZ    1 
ATOM   312   N  NH1   . ARG A  1 44  ? 29.097  -28.583 35.593  1.00 108.10 ? 185 ARG A NH1   1 
ATOM   313   N  NH2   . ARG A  1 44  ? 28.672  -30.599 34.589  1.00 108.79 ? 185 ARG A NH2   1 
ATOM   314   N  N     . GLU A  1 45  ? 28.491  -28.549 28.748  1.00 89.75  ? 186 GLU A N     1 
ATOM   315   C  CA    . GLU A  1 45  ? 27.283  -28.598 27.932  1.00 86.70  ? 186 GLU A CA    1 
ATOM   316   C  C     . GLU A  1 45  ? 26.182  -27.652 28.393  1.00 81.30  ? 186 GLU A C     1 
ATOM   317   O  O     . GLU A  1 45  ? 25.365  -27.996 29.248  1.00 81.18  ? 186 GLU A O     1 
ATOM   318   C  CB    . GLU A  1 45  ? 26.749  -30.027 27.841  1.00 86.59  ? 186 GLU A CB    1 
ATOM   319   C  CG    . GLU A  1 45  ? 26.229  -30.380 26.463  1.00 87.43  ? 186 GLU A CG    1 
ATOM   320   C  CD    . GLU A  1 45  ? 27.227  -30.041 25.373  1.00 88.48  ? 186 GLU A CD    1 
ATOM   321   O  OE1   . GLU A  1 45  ? 26.824  -29.405 24.377  1.00 88.96  ? 186 GLU A OE1   1 
ATOM   322   O  OE2   . GLU A  1 45  ? 28.414  -30.414 25.509  1.00 87.24  ? 186 GLU A OE2   1 
ATOM   323   N  N     . SER A  1 46  ? 26.169  -26.460 27.808  1.00 75.95  ? 187 SER A N     1 
ATOM   324   C  CA    . SER A  1 46  ? 25.090  -25.513 28.026  1.00 70.97  ? 187 SER A CA    1 
ATOM   325   C  C     . SER A  1 46  ? 24.282  -25.353 26.749  1.00 65.72  ? 187 SER A C     1 
ATOM   326   O  O     . SER A  1 46  ? 24.702  -25.780 25.673  1.00 65.52  ? 187 SER A O     1 
ATOM   327   C  CB    . SER A  1 46  ? 25.646  -24.150 28.429  1.00 70.85  ? 187 SER A CB    1 
ATOM   328   O  OG    . SER A  1 46  ? 26.690  -24.275 29.374  1.00 72.02  ? 187 SER A OG    1 
ATOM   329   N  N     . GLU A  1 47  ? 23.119  -24.726 26.883  1.00 60.30  ? 188 GLU A N     1 
ATOM   330   C  CA    . GLU A  1 47  ? 22.332  -24.303 25.737  1.00 56.65  ? 188 GLU A CA    1 
ATOM   331   C  C     . GLU A  1 47  ? 22.955  -23.016 25.224  1.00 52.46  ? 188 GLU A C     1 
ATOM   332   O  O     . GLU A  1 47  ? 22.632  -22.538 24.133  1.00 48.04  ? 188 GLU A O     1 
ATOM   333   C  CB    . GLU A  1 47  ? 20.889  -24.043 26.163  1.00 54.58  ? 188 GLU A CB    1 
ATOM   334   C  CG    . GLU A  1 47  ? 20.583  -24.512 27.577  1.00 55.50  ? 188 GLU A CG    1 
ATOM   335   C  CD    . GLU A  1 47  ? 19.401  -25.450 27.623  1.00 58.15  ? 188 GLU A CD    1 
ATOM   336   O  OE1   . GLU A  1 47  ? 18.673  -25.534 26.611  1.00 60.55  ? 188 GLU A OE1   1 
ATOM   337   O  OE2   . GLU A  1 47  ? 19.201  -26.105 28.666  1.00 58.62  ? 188 GLU A OE2   1 
ATOM   338   N  N     . PHE A  1 48  ? 23.855  -22.466 26.034  1.00 52.00  ? 189 PHE A N     1 
ATOM   339   C  CA    . PHE A  1 48  ? 24.517  -21.210 25.737  1.00 51.64  ? 189 PHE A CA    1 
ATOM   340   C  C     . PHE A  1 48  ? 25.967  -21.431 25.325  1.00 55.18  ? 189 PHE A C     1 
ATOM   341   O  O     . PHE A  1 48  ? 26.810  -20.554 25.510  1.00 59.84  ? 189 PHE A O     1 
ATOM   342   C  CB    . PHE A  1 48  ? 24.482  -20.297 26.963  1.00 45.83  ? 189 PHE A CB    1 
ATOM   343   C  CG    . PHE A  1 48  ? 23.101  -20.046 27.503  1.00 38.40  ? 189 PHE A CG    1 
ATOM   344   C  CD1   . PHE A  1 48  ? 22.295  -19.066 26.947  1.00 35.45  ? 189 PHE A CD1   1 
ATOM   345   C  CD2   . PHE A  1 48  ? 22.619  -20.773 28.582  1.00 36.40  ? 189 PHE A CD2   1 
ATOM   346   C  CE1   . PHE A  1 48  ? 21.027  -18.826 27.445  1.00 36.64  ? 189 PHE A CE1   1 
ATOM   347   C  CE2   . PHE A  1 48  ? 21.356  -20.537 29.085  1.00 36.47  ? 189 PHE A CE2   1 
ATOM   348   C  CZ    . PHE A  1 48  ? 20.559  -19.562 28.516  1.00 36.54  ? 189 PHE A CZ    1 
ATOM   349   N  N     . LYS A  1 49  ? 26.267  -22.603 24.777  1.00 54.69  ? 190 LYS A N     1 
ATOM   350   C  CA    . LYS A  1 49  ? 27.616  -22.856 24.298  1.00 56.56  ? 190 LYS A CA    1 
ATOM   351   C  C     . LYS A  1 49  ? 27.876  -22.007 23.064  1.00 58.28  ? 190 LYS A C     1 
ATOM   352   O  O     . LYS A  1 49  ? 27.007  -21.870 22.201  1.00 61.50  ? 190 LYS A O     1 
ATOM   353   C  CB    . LYS A  1 49  ? 27.834  -24.337 23.989  1.00 60.13  ? 190 LYS A CB    1 
ATOM   354   C  CG    . LYS A  1 49  ? 29.218  -24.632 23.423  1.00 62.75  ? 190 LYS A CG    1 
ATOM   355   C  CD    . LYS A  1 49  ? 29.628  -26.075 23.645  1.00 63.72  ? 190 LYS A CD    1 
ATOM   356   C  CE    . LYS A  1 49  ? 31.078  -26.275 23.243  1.00 65.82  ? 190 LYS A CE    1 
ATOM   357   N  NZ    . LYS A  1 49  ? 31.583  -27.622 23.603  1.00 67.38  ? 190 LYS A NZ    1 
ATOM   358   N  N     . GLY A  1 50  ? 29.064  -21.418 22.991  1.00 56.54  ? 191 GLY A N     1 
ATOM   359   C  CA    . GLY A  1 50  ? 29.405  -20.551 21.880  1.00 55.23  ? 191 GLY A CA    1 
ATOM   360   C  C     . GLY A  1 50  ? 29.063  -19.108 22.178  1.00 53.76  ? 191 GLY A C     1 
ATOM   361   O  O     . GLY A  1 50  ? 29.281  -18.225 21.345  1.00 54.03  ? 191 GLY A O     1 
ATOM   362   N  N     . VAL A  1 51  ? 28.513  -18.872 23.368  1.00 52.31  ? 192 VAL A N     1 
ATOM   363   C  CA    . VAL A  1 51  ? 28.222  -17.515 23.807  1.00 47.14  ? 192 VAL A CA    1 
ATOM   364   C  C     . VAL A  1 51  ? 29.534  -16.745 23.936  1.00 44.03  ? 192 VAL A C     1 
ATOM   365   O  O     . VAL A  1 51  ? 30.575  -17.328 24.248  1.00 44.50  ? 192 VAL A O     1 
ATOM   366   C  CB    . VAL A  1 51  ? 27.427  -17.496 25.125  1.00 45.21  ? 192 VAL A CB    1 
ATOM   367   C  CG1   . VAL A  1 51  ? 28.334  -17.736 26.317  1.00 43.48  ? 192 VAL A CG1   1 
ATOM   368   C  CG2   . VAL A  1 51  ? 26.701  -16.184 25.279  1.00 45.13  ? 192 VAL A CG2   1 
ATOM   369   N  N     . GLU A  1 52  ? 29.492  -15.443 23.672  1.00 41.53  ? 193 GLU A N     1 
ATOM   370   C  CA    . GLU A  1 52  ? 30.713  -14.651 23.574  1.00 39.43  ? 193 GLU A CA    1 
ATOM   371   C  C     . GLU A  1 52  ? 30.647  -13.396 24.431  1.00 38.62  ? 193 GLU A C     1 
ATOM   372   O  O     . GLU A  1 52  ? 29.591  -12.784 24.574  1.00 39.72  ? 193 GLU A O     1 
ATOM   373   C  CB    . GLU A  1 52  ? 31.000  -14.300 22.109  1.00 38.27  ? 193 GLU A CB    1 
ATOM   374   C  CG    . GLU A  1 52  ? 31.435  -15.501 21.274  1.00 39.24  ? 193 GLU A CG    1 
ATOM   375   C  CD    . GLU A  1 52  ? 31.343  -15.255 19.783  1.00 44.00  ? 193 GLU A CD    1 
ATOM   376   O  OE1   . GLU A  1 52  ? 30.617  -14.326 19.371  1.00 46.18  ? 193 GLU A OE1   1 
ATOM   377   O  OE2   . GLU A  1 52  ? 31.992  -16.001 19.020  1.00 45.22  ? 193 GLU A OE2   1 
ATOM   378   N  N     . GLN A  1 53  ? 31.783  -13.014 24.999  1.00 38.65  ? 194 GLN A N     1 
ATOM   379   C  CA    . GLN A  1 53  ? 31.831  -11.870 25.897  1.00 38.34  ? 194 GLN A CA    1 
ATOM   380   C  C     . GLN A  1 53  ? 31.986  -10.557 25.139  1.00 42.65  ? 194 GLN A C     1 
ATOM   381   O  O     . GLN A  1 53  ? 32.710  -10.482 24.144  1.00 44.28  ? 194 GLN A O     1 
ATOM   382   C  CB    . GLN A  1 53  ? 32.974  -12.023 26.900  1.00 35.58  ? 194 GLN A CB    1 
ATOM   383   C  CG    . GLN A  1 53  ? 33.056  -10.886 27.908  1.00 36.33  ? 194 GLN A CG    1 
ATOM   384   C  CD    . GLN A  1 53  ? 34.282  -10.970 28.787  1.00 38.63  ? 194 GLN A CD    1 
ATOM   385   O  OE1   . GLN A  1 53  ? 35.033  -11.942 28.738  1.00 35.73  ? 194 GLN A OE1   1 
ATOM   386   N  NE2   . GLN A  1 53  ? 34.491  -9.945  29.599  1.00 42.08  ? 194 GLN A NE2   1 
ATOM   387   N  N     . LEU A  1 54  ? 31.293  -9.525  25.609  1.00 46.32  ? 195 LEU A N     1 
ATOM   388   C  CA    . LEU A  1 54  ? 31.437  -8.188  25.054  1.00 45.76  ? 195 LEU A CA    1 
ATOM   389   C  C     . LEU A  1 54  ? 31.282  -7.173  26.179  1.00 42.93  ? 195 LEU A C     1 
ATOM   390   O  O     . LEU A  1 54  ? 30.183  -6.964  26.683  1.00 42.37  ? 195 LEU A O     1 
ATOM   391   C  CB    . LEU A  1 54  ? 30.398  -7.948  23.959  1.00 49.47  ? 195 LEU A CB    1 
ATOM   392   C  CG    . LEU A  1 54  ? 30.866  -7.173  22.727  1.00 55.33  ? 195 LEU A CG    1 
ATOM   393   C  CD1   . LEU A  1 54  ? 29.775  -7.131  21.673  1.00 57.77  ? 195 LEU A CD1   1 
ATOM   394   C  CD2   . LEU A  1 54  ? 31.290  -5.767  23.105  1.00 58.32  ? 195 LEU A CD2   1 
ATOM   395   N  N     . ASN A  1 55  ? 32.388  -6.552  26.578  1.00 41.66  ? 196 ASN A N     1 
ATOM   396   C  CA    . ASN A  1 55  ? 32.358  -5.583  27.667  1.00 36.85  ? 196 ASN A CA    1 
ATOM   397   C  C     . ASN A  1 55  ? 31.787  -4.242  27.221  1.00 32.25  ? 196 ASN A C     1 
ATOM   398   O  O     . ASN A  1 55  ? 32.230  -3.676  26.226  1.00 35.30  ? 196 ASN A O     1 
ATOM   399   C  CB    . ASN A  1 55  ? 33.755  -5.406  28.254  1.00 35.24  ? 196 ASN A CB    1 
ATOM   400   C  CG    . ASN A  1 55  ? 34.298  -6.689  28.838  1.00 30.77  ? 196 ASN A CG    1 
ATOM   401   O  OD1   . ASN A  1 55  ? 33.551  -7.490  29.393  1.00 31.85  ? 196 ASN A OD1   1 
ATOM   402   N  ND2   . ASN A  1 55  ? 35.602  -6.893  28.715  1.00 20.77  ? 196 ASN A ND2   1 
ATOM   403   N  N     . THR A  1 56  ? 30.805  -3.743  27.966  1.00 30.51  ? 197 THR A N     1 
ATOM   404   C  CA    . THR A  1 56  ? 30.076  -2.544  27.569  1.00 32.49  ? 197 THR A CA    1 
ATOM   405   C  C     . THR A  1 56  ? 29.839  -1.637  28.765  1.00 35.18  ? 197 THR A C     1 
ATOM   406   O  O     . THR A  1 56  ? 30.215  -1.971  29.887  1.00 39.64  ? 197 THR A O     1 
ATOM   407   C  CB    . THR A  1 56  ? 28.714  -2.896  26.939  1.00 29.69  ? 197 THR A CB    1 
ATOM   408   O  OG1   . THR A  1 56  ? 28.038  -3.852  27.761  1.00 29.25  ? 197 THR A OG1   1 
ATOM   409   C  CG2   . THR A  1 56  ? 28.898  -3.490  25.568  1.00 31.29  ? 197 THR A CG2   1 
ATOM   410   N  N     . GLY A  1 57  ? 29.223  -0.486  28.524  1.00 31.40  ? 198 GLY A N     1 
ATOM   411   C  CA    . GLY A  1 57  ? 28.827  0.389   29.612  1.00 30.96  ? 198 GLY A CA    1 
ATOM   412   C  C     . GLY A  1 57  ? 29.840  1.459   29.965  1.00 31.78  ? 198 GLY A C     1 
ATOM   413   O  O     . GLY A  1 57  ? 30.856  1.606   29.288  1.00 34.12  ? 198 GLY A O     1 
ATOM   414   N  N     . SER A  1 58  ? 29.570  2.186   31.045  1.00 32.12  ? 199 SER A N     1 
ATOM   415   C  CA    . SER A  1 58  ? 30.354  3.358   31.410  1.00 33.49  ? 199 SER A CA    1 
ATOM   416   C  C     . SER A  1 58  ? 31.835  3.090   31.677  1.00 33.39  ? 199 SER A C     1 
ATOM   417   O  O     . SER A  1 58  ? 32.686  3.872   31.256  1.00 36.09  ? 199 SER A O     1 
ATOM   418   C  CB    . SER A  1 58  ? 29.722  4.059   32.609  1.00 39.99  ? 199 SER A CB    1 
ATOM   419   O  OG    . SER A  1 58  ? 28.398  4.463   32.323  1.00 45.72  ? 199 SER A OG    1 
ATOM   420   N  N     . TYR A  1 59  ? 32.138  2.001   32.375  1.00 33.31  ? 200 TYR A N     1 
ATOM   421   C  CA    . TYR A  1 59  ? 33.520  1.675   32.727  1.00 33.59  ? 200 TYR A CA    1 
ATOM   422   C  C     . TYR A  1 59  ? 34.392  1.423   31.501  1.00 37.11  ? 200 TYR A C     1 
ATOM   423   O  O     . TYR A  1 59  ? 35.548  1.851   31.456  1.00 40.07  ? 200 TYR A O     1 
ATOM   424   C  CB    . TYR A  1 59  ? 33.561  0.464   33.661  1.00 31.52  ? 200 TYR A CB    1 
ATOM   425   C  CG    . TYR A  1 59  ? 34.950  -0.076  33.909  1.00 26.55  ? 200 TYR A CG    1 
ATOM   426   C  CD1   . TYR A  1 59  ? 35.794  0.523   34.825  1.00 25.24  ? 200 TYR A CD1   1 
ATOM   427   C  CD2   . TYR A  1 59  ? 35.407  -1.196  33.236  1.00 22.59  ? 200 TYR A CD2   1 
ATOM   428   C  CE1   . TYR A  1 59  ? 37.054  0.027   35.055  1.00 23.86  ? 200 TYR A CE1   1 
ATOM   429   C  CE2   . TYR A  1 59  ? 36.667  -1.691  33.454  1.00 23.48  ? 200 TYR A CE2   1 
ATOM   430   C  CZ    . TYR A  1 59  ? 37.484  -1.077  34.366  1.00 26.61  ? 200 TYR A CZ    1 
ATOM   431   O  OH    . TYR A  1 59  ? 38.742  -1.577  34.589  1.00 35.17  ? 200 TYR A OH    1 
ATOM   432   N  N     . TYR A  1 60  ? 33.832  0.731   30.513  1.00 34.51  ? 201 TYR A N     1 
ATOM   433   C  CA    . TYR A  1 60  ? 34.550  0.431   29.281  1.00 31.24  ? 201 TYR A CA    1 
ATOM   434   C  C     . TYR A  1 60  ? 34.417  1.542   28.232  1.00 33.90  ? 201 TYR A C     1 
ATOM   435   O  O     . TYR A  1 60  ? 35.071  1.499   27.188  1.00 38.40  ? 201 TYR A O     1 
ATOM   436   C  CB    . TYR A  1 60  ? 34.098  -0.924  28.728  1.00 30.76  ? 201 TYR A CB    1 
ATOM   437   C  CG    . TYR A  1 60  ? 34.303  -2.048  29.718  1.00 29.34  ? 201 TYR A CG    1 
ATOM   438   C  CD1   . TYR A  1 60  ? 35.532  -2.671  29.842  1.00 30.35  ? 201 TYR A CD1   1 
ATOM   439   C  CD2   . TYR A  1 60  ? 33.274  -2.472  30.541  1.00 29.97  ? 201 TYR A CD2   1 
ATOM   440   C  CE1   . TYR A  1 60  ? 35.727  -3.689  30.754  1.00 29.91  ? 201 TYR A CE1   1 
ATOM   441   C  CE2   . TYR A  1 60  ? 33.461  -3.491  31.453  1.00 26.17  ? 201 TYR A CE2   1 
ATOM   442   C  CZ    . TYR A  1 60  ? 34.688  -4.094  31.554  1.00 30.38  ? 201 TYR A CZ    1 
ATOM   443   O  OH    . TYR A  1 60  ? 34.889  -5.110  32.460  1.00 35.09  ? 201 TYR A OH    1 
ATOM   444   N  N     . GLU A  1 61  ? 33.578  2.535   28.518  1.00 33.17  ? 202 GLU A N     1 
ATOM   445   C  CA    . GLU A  1 61  ? 33.503  3.734   27.691  1.00 30.76  ? 202 GLU A CA    1 
ATOM   446   C  C     . GLU A  1 61  ? 34.330  4.857   28.321  1.00 30.90  ? 202 GLU A C     1 
ATOM   447   O  O     . GLU A  1 61  ? 34.425  5.951   27.755  1.00 31.51  ? 202 GLU A O     1 
ATOM   448   C  CB    . GLU A  1 61  ? 32.055  4.198   27.534  1.00 30.35  ? 202 GLU A CB    1 
ATOM   449   C  CG    . GLU A  1 61  ? 31.174  3.304   26.670  1.00 29.42  ? 202 GLU A CG    1 
ATOM   450   C  CD    . GLU A  1 61  ? 29.706  3.637   26.837  1.00 32.40  ? 202 GLU A CD    1 
ATOM   451   O  OE1   . GLU A  1 61  ? 29.383  4.416   27.756  1.00 34.66  ? 202 GLU A OE1   1 
ATOM   452   O  OE2   . GLU A  1 61  ? 28.877  3.120   26.061  1.00 31.54  ? 202 GLU A OE2   1 
ATOM   453   N  N     . HIS A  1 62  ? 34.915  4.578   29.488  1.00 29.85  ? 203 HIS A N     1 
ATOM   454   C  CA    . HIS A  1 62  ? 35.722  5.544   30.238  1.00 31.91  ? 203 HIS A CA    1 
ATOM   455   C  C     . HIS A  1 62  ? 34.908  6.706   30.775  1.00 35.90  ? 203 HIS A C     1 
ATOM   456   O  O     . HIS A  1 62  ? 35.425  7.810   30.939  1.00 38.91  ? 203 HIS A O     1 
ATOM   457   C  CB    . HIS A  1 62  ? 36.884  6.081   29.403  1.00 31.81  ? 203 HIS A CB    1 
ATOM   458   C  CG    . HIS A  1 62  ? 37.824  5.022   28.922  1.00 33.58  ? 203 HIS A CG    1 
ATOM   459   N  ND1   . HIS A  1 62  ? 38.748  4.419   29.748  1.00 31.99  ? 203 HIS A ND1   1 
ATOM   460   C  CD2   . HIS A  1 62  ? 37.992  4.470   27.698  1.00 34.65  ? 203 HIS A CD2   1 
ATOM   461   C  CE1   . HIS A  1 62  ? 39.440  3.533   29.052  1.00 36.09  ? 203 HIS A CE1   1 
ATOM   462   N  NE2   . HIS A  1 62  ? 39.002  3.546   27.806  1.00 36.67  ? 203 HIS A NE2   1 
ATOM   463   N  N     . VAL A  1 63  ? 33.635  6.457   31.053  1.00 34.74  ? 204 VAL A N     1 
ATOM   464   C  CA    . VAL A  1 63  ? 32.776  7.497   31.599  1.00 32.94  ? 204 VAL A CA    1 
ATOM   465   C  C     . VAL A  1 63  ? 32.187  7.101   32.956  1.00 30.41  ? 204 VAL A C     1 
ATOM   466   O  O     . VAL A  1 63  ? 31.256  7.736   33.448  1.00 28.88  ? 204 VAL A O     1 
ATOM   467   C  CB    . VAL A  1 63  ? 31.691  7.939   30.586  1.00 28.41  ? 204 VAL A CB    1 
ATOM   468   C  CG1   . VAL A  1 63  ? 32.318  8.775   29.493  1.00 23.28  ? 204 VAL A CG1   1 
ATOM   469   C  CG2   . VAL A  1 63  ? 31.000  6.733   29.983  1.00 25.93  ? 204 VAL A CG2   1 
ATOM   470   N  N     . LYS A  1 64  ? 32.756  6.058   33.559  1.00 32.02  ? 205 LYS A N     1 
ATOM   471   C  CA    . LYS A  1 64  ? 32.400  5.658   34.919  1.00 30.75  ? 205 LYS A CA    1 
ATOM   472   C  C     . LYS A  1 64  ? 32.988  6.651   35.919  1.00 34.25  ? 205 LYS A C     1 
ATOM   473   O  O     . LYS A  1 64  ? 34.163  7.014   35.828  1.00 34.58  ? 205 LYS A O     1 
ATOM   474   C  CB    . LYS A  1 64  ? 32.911  4.248   35.214  1.00 29.36  ? 205 LYS A CB    1 
ATOM   475   C  CG    . LYS A  1 64  ? 32.414  3.664   36.522  1.00 27.85  ? 205 LYS A CG    1 
ATOM   476   C  CD    . LYS A  1 64  ? 30.904  3.566   36.513  1.00 32.87  ? 205 LYS A CD    1 
ATOM   477   C  CE    . LYS A  1 64  ? 30.358  3.183   37.880  1.00 35.65  ? 205 LYS A CE    1 
ATOM   478   N  NZ    . LYS A  1 64  ? 30.890  4.026   38.986  1.00 35.42  ? 205 LYS A NZ    1 
ATOM   479   N  N     . ILE A  1 65  ? 32.163  7.091   36.864  1.00 37.10  ? 206 ILE A N     1 
ATOM   480   C  CA    . ILE A  1 65  ? 32.533  8.160   37.786  1.00 37.87  ? 206 ILE A CA    1 
ATOM   481   C  C     . ILE A  1 65  ? 32.638  7.663   39.224  1.00 46.79  ? 206 ILE A C     1 
ATOM   482   O  O     . ILE A  1 65  ? 32.138  6.581   39.554  1.00 52.22  ? 206 ILE A O     1 
ATOM   483   C  CB    . ILE A  1 65  ? 31.489  9.284   37.759  1.00 31.33  ? 206 ILE A CB    1 
ATOM   484   C  CG1   . ILE A  1 65  ? 30.123  8.748   38.190  1.00 24.95  ? 206 ILE A CG1   1 
ATOM   485   C  CG2   . ILE A  1 65  ? 31.389  9.894   36.370  1.00 32.37  ? 206 ILE A CG2   1 
ATOM   486   C  CD1   . ILE A  1 65  ? 29.037  9.786   38.191  1.00 20.81  ? 206 ILE A CD1   1 
ATOM   487   N  N     . SER A  1 66  ? 33.288  8.463   40.068  1.00 44.27  ? 207 SER A N     1 
ATOM   488   C  CA    . SER A  1 66  ? 33.393  8.188   41.501  1.00 41.13  ? 207 SER A CA    1 
ATOM   489   C  C     . SER A  1 66  ? 34.110  6.875   41.838  1.00 40.46  ? 207 SER A C     1 
ATOM   490   O  O     . SER A  1 66  ? 35.170  6.888   42.475  1.00 40.57  ? 207 SER A O     1 
ATOM   491   C  CB    . SER A  1 66  ? 32.009  8.222   42.162  1.00 41.77  ? 207 SER A CB    1 
ATOM   492   O  OG    . SER A  1 66  ? 31.367  9.462   41.938  1.00 43.09  ? 207 SER A OG    1 
ATOM   493   N  N     . ALA A  1 67  ? 33.534  5.749   41.416  1.00 34.68  ? 208 ALA A N     1 
ATOM   494   C  CA    . ALA A  1 67  ? 34.068  4.438   41.778  1.00 31.38  ? 208 ALA A CA    1 
ATOM   495   C  C     . ALA A  1 67  ? 33.939  3.401   40.669  1.00 33.02  ? 208 ALA A C     1 
ATOM   496   O  O     . ALA A  1 67  ? 32.977  3.427   39.900  1.00 35.63  ? 208 ALA A O     1 
ATOM   497   C  CB    . ALA A  1 67  ? 33.391  3.925   43.043  1.00 27.29  ? 208 ALA A CB    1 
ATOM   498   N  N     . PRO A  1 68  ? 34.909  2.473   40.598  1.00 32.29  ? 209 PRO A N     1 
ATOM   499   C  CA    . PRO A  1 68  ? 34.820  1.319   39.696  1.00 34.97  ? 209 PRO A CA    1 
ATOM   500   C  C     . PRO A  1 68  ? 33.922  0.258   40.314  1.00 36.37  ? 209 PRO A C     1 
ATOM   501   O  O     . PRO A  1 68  ? 34.403  -0.827  40.658  1.00 36.12  ? 209 PRO A O     1 
ATOM   502   C  CB    . PRO A  1 68  ? 36.263  0.792   39.644  1.00 34.84  ? 209 PRO A CB    1 
ATOM   503   C  CG    . PRO A  1 68  ? 37.104  1.782   40.426  1.00 33.88  ? 209 PRO A CG    1 
ATOM   504   C  CD    . PRO A  1 68  ? 36.180  2.494   41.343  1.00 30.15  ? 209 PRO A CD    1 
ATOM   505   N  N     . ASN A  1 69  ? 32.634  0.569   40.443  1.00 38.08  ? 210 ASN A N     1 
ATOM   506   C  CA    . ASN A  1 69  ? 31.700  -0.288  41.166  1.00 35.70  ? 210 ASN A CA    1 
ATOM   507   C  C     . ASN A  1 69  ? 30.558  -0.843  40.307  1.00 36.27  ? 210 ASN A C     1 
ATOM   508   O  O     . ASN A  1 69  ? 29.657  -1.515  40.825  1.00 31.71  ? 210 ASN A O     1 
ATOM   509   C  CB    . ASN A  1 69  ? 31.131  0.461   42.376  1.00 34.89  ? 210 ASN A CB    1 
ATOM   510   C  CG    . ASN A  1 69  ? 30.574  1.830   42.010  1.00 38.37  ? 210 ASN A CG    1 
ATOM   511   O  OD1   . ASN A  1 69  ? 30.526  2.204   40.839  1.00 43.20  ? 210 ASN A OD1   1 
ATOM   512   N  ND2   . ASN A  1 69  ? 30.147  2.581   43.015  1.00 36.40  ? 210 ASN A ND2   1 
ATOM   513   N  N     . GLU A  1 70  ? 30.592  -0.558  39.005  1.00 40.30  ? 211 GLU A N     1 
ATOM   514   C  CA    . GLU A  1 70  ? 29.588  -1.072  38.077  1.00 44.64  ? 211 GLU A CA    1 
ATOM   515   C  C     . GLU A  1 70  ? 30.247  -1.584  36.806  1.00 40.45  ? 211 GLU A C     1 
ATOM   516   O  O     . GLU A  1 70  ? 30.910  -0.821  36.102  1.00 39.22  ? 211 GLU A O     1 
ATOM   517   C  CB    . GLU A  1 70  ? 28.581  0.021   37.712  1.00 53.82  ? 211 GLU A CB    1 
ATOM   518   C  CG    . GLU A  1 70  ? 27.379  0.115   38.633  1.00 60.32  ? 211 GLU A CG    1 
ATOM   519   C  CD    . GLU A  1 70  ? 26.292  1.018   38.078  1.00 64.42  ? 211 GLU A CD    1 
ATOM   520   O  OE1   . GLU A  1 70  ? 26.330  2.236   38.352  1.00 65.86  ? 211 GLU A OE1   1 
ATOM   521   O  OE2   . GLU A  1 70  ? 25.402  0.509   37.366  1.00 65.34  ? 211 GLU A OE2   1 
ATOM   522   N  N     . PHE A  1 71  ? 30.052  -2.865  36.504  1.00 38.87  ? 212 PHE A N     1 
ATOM   523   C  CA    . PHE A  1 71  ? 30.615  -3.455  35.294  1.00 33.97  ? 212 PHE A CA    1 
ATOM   524   C  C     . PHE A  1 71  ? 29.532  -4.110  34.442  1.00 33.69  ? 212 PHE A C     1 
ATOM   525   O  O     . PHE A  1 71  ? 28.848  -5.025  34.903  1.00 36.75  ? 212 PHE A O     1 
ATOM   526   C  CB    . PHE A  1 71  ? 31.678  -4.500  35.651  1.00 33.43  ? 212 PHE A CB    1 
ATOM   527   C  CG    . PHE A  1 71  ? 32.915  -3.931  36.290  1.00 32.43  ? 212 PHE A CG    1 
ATOM   528   C  CD1   . PHE A  1 71  ? 34.029  -3.625  35.521  1.00 30.47  ? 212 PHE A CD1   1 
ATOM   529   C  CD2   . PHE A  1 71  ? 32.977  -3.726  37.664  1.00 31.28  ? 212 PHE A CD2   1 
ATOM   530   C  CE1   . PHE A  1 71  ? 35.178  -3.112  36.113  1.00 29.53  ? 212 PHE A CE1   1 
ATOM   531   C  CE2   . PHE A  1 71  ? 34.122  -3.213  38.256  1.00 26.69  ? 212 PHE A CE2   1 
ATOM   532   C  CZ    . PHE A  1 71  ? 35.220  -2.906  37.477  1.00 25.86  ? 212 PHE A CZ    1 
ATOM   533   N  N     . ASP A  1 72  ? 29.378  -3.646  33.203  1.00 35.52  ? 213 ASP A N     1 
ATOM   534   C  CA    . ASP A  1 72  ? 28.426  -4.253  32.273  1.00 28.46  ? 213 ASP A CA    1 
ATOM   535   C  C     . ASP A  1 72  ? 29.134  -5.216  31.322  1.00 27.75  ? 213 ASP A C     1 
ATOM   536   O  O     . ASP A  1 72  ? 30.058  -4.826  30.594  1.00 27.62  ? 213 ASP A O     1 
ATOM   537   C  CB    . ASP A  1 72  ? 27.692  -3.184  31.468  1.00 31.40  ? 213 ASP A CB    1 
ATOM   538   C  CG    . ASP A  1 72  ? 26.815  -2.306  32.323  1.00 32.25  ? 213 ASP A CG    1 
ATOM   539   O  OD1   . ASP A  1 72  ? 25.958  -1.597  31.761  1.00 32.99  ? 213 ASP A OD1   1 
ATOM   540   O  OD2   . ASP A  1 72  ? 26.981  -2.321  33.555  1.00 35.90  ? 213 ASP A OD2   1 
ATOM   541   N  N     . VAL A  1 73  ? 28.697  -6.474  31.339  1.00 31.63  ? 214 VAL A N     1 
ATOM   542   C  CA    . VAL A  1 73  ? 29.276  -7.517  30.495  1.00 27.89  ? 214 VAL A CA    1 
ATOM   543   C  C     . VAL A  1 73  ? 28.172  -8.219  29.717  1.00 27.45  ? 214 VAL A C     1 
ATOM   544   O  O     . VAL A  1 73  ? 27.181  -8.646  30.299  1.00 29.20  ? 214 VAL A O     1 
ATOM   545   C  CB    . VAL A  1 73  ? 29.993  -8.577  31.333  1.00 25.61  ? 214 VAL A CB    1 
ATOM   546   C  CG1   . VAL A  1 73  ? 30.746  -9.532  30.436  1.00 21.87  ? 214 VAL A CG1   1 
ATOM   547   C  CG2   . VAL A  1 73  ? 30.940  -7.921  32.305  1.00 31.56  ? 214 VAL A CG2   1 
ATOM   548   N  N     . MET A  1 74  ? 28.345  -8.341  28.406  1.00 29.64  ? 215 MET A N     1 
ATOM   549   C  CA    . MET A  1 74  ? 27.362  -9.005  27.553  1.00 29.89  ? 215 MET A CA    1 
ATOM   550   C  C     . MET A  1 74  ? 27.781  -10.434 27.230  1.00 31.75  ? 215 MET A C     1 
ATOM   551   O  O     . MET A  1 74  ? 28.910  -10.680 26.799  1.00 29.19  ? 215 MET A O     1 
ATOM   552   C  CB    . MET A  1 74  ? 27.188  -8.247  26.235  1.00 33.50  ? 215 MET A CB    1 
ATOM   553   C  CG    . MET A  1 74  ? 26.031  -7.253  26.190  1.00 34.64  ? 215 MET A CG    1 
ATOM   554   S  SD    . MET A  1 74  ? 25.863  -6.532  24.534  1.00 60.22  ? 215 MET A SD    1 
ATOM   555   C  CE    . MET A  1 74  ? 24.417  -5.489  24.749  1.00 118.82 ? 215 MET A CE    1 
ATOM   556   N  N     . PHE A  1 75  ? 26.873  -11.378 27.440  1.00 35.18  ? 216 PHE A N     1 
ATOM   557   C  CA    . PHE A  1 75  ? 27.059  -12.719 26.915  1.00 34.41  ? 216 PHE A CA    1 
ATOM   558   C  C     . PHE A  1 75  ? 26.139  -12.831 25.708  1.00 31.06  ? 216 PHE A C     1 
ATOM   559   O  O     . PHE A  1 75  ? 24.926  -13.007 25.850  1.00 31.48  ? 216 PHE A O     1 
ATOM   560   C  CB    . PHE A  1 75  ? 26.753  -13.783 27.976  1.00 34.25  ? 216 PHE A CB    1 
ATOM   561   C  CG    . PHE A  1 75  ? 27.838  -13.934 29.026  1.00 31.76  ? 216 PHE A CG    1 
ATOM   562   C  CD1   . PHE A  1 75  ? 28.869  -13.005 29.126  1.00 25.57  ? 216 PHE A CD1   1 
ATOM   563   C  CD2   . PHE A  1 75  ? 27.832  -15.014 29.901  1.00 28.96  ? 216 PHE A CD2   1 
ATOM   564   C  CE1   . PHE A  1 75  ? 29.866  -13.141 30.083  1.00 23.52  ? 216 PHE A CE1   1 
ATOM   565   C  CE2   . PHE A  1 75  ? 28.825  -15.155 30.858  1.00 25.11  ? 216 PHE A CE2   1 
ATOM   566   C  CZ    . PHE A  1 75  ? 29.843  -14.215 30.948  1.00 24.74  ? 216 PHE A CZ    1 
ATOM   567   N  N     . LYS A  1 76  ? 26.725  -12.686 24.521  1.00 30.98  ? 217 LYS A N     1 
ATOM   568   C  CA    . LYS A  1 76  ? 25.964  -12.631 23.278  1.00 35.21  ? 217 LYS A CA    1 
ATOM   569   C  C     . LYS A  1 76  ? 26.004  -13.963 22.529  1.00 35.90  ? 217 LYS A C     1 
ATOM   570   O  O     . LYS A  1 76  ? 27.054  -14.588 22.399  1.00 35.61  ? 217 LYS A O     1 
ATOM   571   C  CB    . LYS A  1 76  ? 26.489  -11.503 22.388  1.00 36.15  ? 217 LYS A CB    1 
ATOM   572   C  CG    . LYS A  1 76  ? 27.959  -11.647 22.062  1.00 40.05  ? 217 LYS A CG    1 
ATOM   573   C  CD    . LYS A  1 76  ? 28.462  -10.531 21.187  1.00 43.84  ? 217 LYS A CD    1 
ATOM   574   C  CE    . LYS A  1 76  ? 29.666  -11.000 20.389  1.00 49.24  ? 217 LYS A CE    1 
ATOM   575   N  NZ    . LYS A  1 76  ? 29.316  -12.164 19.528  1.00 50.77  ? 217 LYS A NZ    1 
ATOM   576   N  N     . LEU A  1 77  ? 24.846  -14.387 22.036  1.00 39.14  ? 218 LEU A N     1 
ATOM   577   C  CA    . LEU A  1 77  ? 24.700  -15.678 21.376  1.00 43.38  ? 218 LEU A CA    1 
ATOM   578   C  C     . LEU A  1 77  ? 24.036  -15.475 20.021  1.00 45.74  ? 218 LEU A C     1 
ATOM   579   O  O     . LEU A  1 77  ? 22.923  -14.952 19.944  1.00 45.16  ? 218 LEU A O     1 
ATOM   580   C  CB    . LEU A  1 77  ? 23.857  -16.614 22.244  1.00 43.29  ? 218 LEU A CB    1 
ATOM   581   C  CG    . LEU A  1 77  ? 23.611  -18.029 21.725  1.00 39.96  ? 218 LEU A CG    1 
ATOM   582   C  CD1   . LEU A  1 77  ? 24.911  -18.790 21.675  1.00 39.36  ? 218 LEU A CD1   1 
ATOM   583   C  CD2   . LEU A  1 77  ? 22.596  -18.752 22.591  1.00 37.65  ? 218 LEU A CD2   1 
ATOM   584   N  N     . GLU A  1 78  ? 24.721  -15.879 18.956  1.00 47.87  ? 219 GLU A N     1 
ATOM   585   C  CA    . GLU A  1 78  ? 24.217  -15.663 17.605  1.00 51.37  ? 219 GLU A CA    1 
ATOM   586   C  C     . GLU A  1 78  ? 23.080  -16.619 17.254  1.00 55.45  ? 219 GLU A C     1 
ATOM   587   O  O     . GLU A  1 78  ? 23.224  -17.836 17.374  1.00 57.60  ? 219 GLU A O     1 
ATOM   588   C  CB    . GLU A  1 78  ? 25.348  -15.809 16.589  1.00 54.51  ? 219 GLU A CB    1 
ATOM   589   C  CG    . GLU A  1 78  ? 24.913  -15.597 15.148  1.00 58.86  ? 219 GLU A CG    1 
ATOM   590   C  CD    . GLU A  1 78  ? 25.947  -16.075 14.151  1.00 65.66  ? 219 GLU A CD    1 
ATOM   591   O  OE1   . GLU A  1 78  ? 27.077  -16.403 14.570  1.00 66.32  ? 219 GLU A OE1   1 
ATOM   592   O  OE2   . GLU A  1 78  ? 25.624  -16.129 12.945  1.00 69.12  ? 219 GLU A OE2   1 
ATOM   593   N  N     . VAL A  1 79  ? 21.953  -16.057 16.823  1.00 58.67  ? 220 VAL A N     1 
ATOM   594   C  CA    . VAL A  1 79  ? 20.803  -16.842 16.378  1.00 62.09  ? 220 VAL A CA    1 
ATOM   595   C  C     . VAL A  1 79  ? 20.548  -16.583 14.886  1.00 65.20  ? 220 VAL A C     1 
ATOM   596   O  O     . VAL A  1 79  ? 19.924  -15.587 14.522  1.00 66.34  ? 220 VAL A O     1 
ATOM   597   C  CB    . VAL A  1 79  ? 19.545  -16.535 17.219  1.00 63.42  ? 220 VAL A CB    1 
ATOM   598   C  CG1   . VAL A  1 79  ? 18.386  -17.416 16.790  1.00 64.18  ? 220 VAL A CG1   1 
ATOM   599   C  CG2   . VAL A  1 79  ? 19.830  -16.751 18.694  1.00 63.18  ? 220 VAL A CG2   1 
ATOM   600   N  N     . PRO A  1 80  ? 21.047  -17.491 14.025  1.00 65.33  ? 221 PRO A N     1 
ATOM   601   C  CA    . PRO A  1 80  ? 21.090  -17.443 12.555  1.00 66.71  ? 221 PRO A CA    1 
ATOM   602   C  C     . PRO A  1 80  ? 19.776  -17.090 11.854  1.00 72.04  ? 221 PRO A C     1 
ATOM   603   O  O     . PRO A  1 80  ? 19.471  -15.908 11.697  1.00 73.78  ? 221 PRO A O     1 
ATOM   604   C  CB    . PRO A  1 80  ? 21.493  -18.867 12.182  1.00 65.90  ? 221 PRO A CB    1 
ATOM   605   C  CG    . PRO A  1 80  ? 22.312  -19.327 13.322  1.00 65.29  ? 221 PRO A CG    1 
ATOM   606   C  CD    . PRO A  1 80  ? 21.700  -18.708 14.544  1.00 65.32  ? 221 PRO A CD    1 
ATOM   607   N  N     . ARG A  1 81  ? 19.040  -18.104 11.399  1.00 74.61  ? 222 ARG A N     1 
ATOM   608   C  CA    . ARG A  1 81  ? 17.788  -17.893 10.674  1.00 74.32  ? 222 ARG A CA    1 
ATOM   609   C  C     . ARG A  1 81  ? 16.693  -17.433 11.621  1.00 72.56  ? 222 ARG A C     1 
ATOM   610   O  O     . ARG A  1 81  ? 15.981  -18.253 12.204  1.00 76.19  ? 222 ARG A O     1 
ATOM   611   C  CB    . ARG A  1 81  ? 17.349  -19.183 9.981   1.00 76.57  ? 222 ARG A CB    1 
ATOM   612   C  CG    . ARG A  1 81  ? 18.365  -19.742 9.003   1.00 78.17  ? 222 ARG A CG    1 
ATOM   613   C  CD    . ARG A  1 81  ? 18.002  -21.161 8.606   1.00 80.61  ? 222 ARG A CD    1 
ATOM   614   N  NE    . ARG A  1 81  ? 18.714  -21.587 7.407   1.00 81.70  ? 222 ARG A NE    1 
ATOM   615   C  CZ    . ARG A  1 81  ? 18.218  -21.506 6.177   1.00 80.53  ? 222 ARG A CZ    1 
ATOM   616   N  NH1   . ARG A  1 81  ? 17.000  -21.016 5.978   1.00 80.10  ? 222 ARG A NH1   1 
ATOM   617   N  NH2   . ARG A  1 81  ? 18.938  -21.916 5.143   1.00 78.58  ? 222 ARG A NH2   1 
ATOM   618   N  N     . ILE A  1 82  ? 16.548  -16.120 11.756  1.00 68.19  ? 223 ILE A N     1 
ATOM   619   C  CA    . ILE A  1 82  ? 15.650  -15.553 12.751  1.00 65.09  ? 223 ILE A CA    1 
ATOM   620   C  C     . ILE A  1 82  ? 14.636  -14.600 12.121  1.00 64.11  ? 223 ILE A C     1 
ATOM   621   O  O     . ILE A  1 82  ? 15.003  -13.583 11.528  1.00 65.38  ? 223 ILE A O     1 
ATOM   622   C  CB    . ILE A  1 82  ? 16.464  -14.850 13.861  1.00 65.54  ? 223 ILE A CB    1 
ATOM   623   C  CG1   . ILE A  1 82  ? 15.567  -14.048 14.796  1.00 63.26  ? 223 ILE A CG1   1 
ATOM   624   C  CG2   . ILE A  1 82  ? 17.516  -13.936 13.266  1.00 68.10  ? 223 ILE A CG2   1 
ATOM   625   C  CD1   . ILE A  1 82  ? 16.359  -13.246 15.801  1.00 61.59  ? 223 ILE A CD1   1 
ATOM   626   N  N     . GLU A  1 83  ? 13.358  -14.948 12.235  1.00 60.66  ? 224 GLU A N     1 
ATOM   627   C  CA    . GLU A  1 83  ? 12.288  -14.083 11.757  1.00 56.72  ? 224 GLU A CA    1 
ATOM   628   C  C     . GLU A  1 83  ? 11.953  -13.096 12.867  1.00 50.48  ? 224 GLU A C     1 
ATOM   629   O  O     . GLU A  1 83  ? 11.690  -13.498 13.997  1.00 50.24  ? 224 GLU A O     1 
ATOM   630   C  CB    . GLU A  1 83  ? 11.054  -14.912 11.404  1.00 60.23  ? 224 GLU A CB    1 
ATOM   631   C  CG    . GLU A  1 83  ? 10.054  -14.215 10.489  1.00 63.96  ? 224 GLU A CG    1 
ATOM   632   C  CD    . GLU A  1 83  ? 10.366  -14.415 9.020   1.00 69.92  ? 224 GLU A CD    1 
ATOM   633   O  OE1   . GLU A  1 83  ? 11.054  -15.401 8.686   1.00 73.21  ? 224 GLU A OE1   1 
ATOM   634   O  OE2   . GLU A  1 83  ? 9.921   -13.589 8.197   1.00 71.62  ? 224 GLU A OE2   1 
ATOM   635   N  N     . LEU A  1 84  ? 11.969  -11.806 12.550  1.00 45.90  ? 225 LEU A N     1 
ATOM   636   C  CA    . LEU A  1 84  ? 11.737  -10.773 13.555  1.00 43.46  ? 225 LEU A CA    1 
ATOM   637   C  C     . LEU A  1 84  ? 10.410  -10.063 13.311  1.00 45.68  ? 225 LEU A C     1 
ATOM   638   O  O     . LEU A  1 84  ? 10.118  -9.655  12.186  1.00 49.88  ? 225 LEU A O     1 
ATOM   639   C  CB    . LEU A  1 84  ? 12.873  -9.753  13.529  1.00 43.83  ? 225 LEU A CB    1 
ATOM   640   C  CG    . LEU A  1 84  ? 13.379  -9.257  14.882  1.00 43.34  ? 225 LEU A CG    1 
ATOM   641   C  CD1   . LEU A  1 84  ? 14.258  -10.308 15.518  1.00 42.15  ? 225 LEU A CD1   1 
ATOM   642   C  CD2   . LEU A  1 84  ? 14.131  -7.953  14.738  1.00 43.30  ? 225 LEU A CD2   1 
ATOM   643   N  N     . GLN A  1 85  ? 9.609   -9.903  14.360  1.00 44.98  ? 226 GLN A N     1 
ATOM   644   C  CA    . GLN A  1 85  ? 8.299   -9.278  14.201  1.00 41.41  ? 226 GLN A CA    1 
ATOM   645   C  C     . GLN A  1 85  ? 8.086   -8.134  15.185  1.00 40.36  ? 226 GLN A C     1 
ATOM   646   O  O     . GLN A  1 85  ? 7.997   -8.365  16.381  1.00 35.02  ? 226 GLN A O     1 
ATOM   647   C  CB    . GLN A  1 85  ? 7.202   -10.320 14.390  1.00 47.35  ? 226 GLN A CB    1 
ATOM   648   C  CG    . GLN A  1 85  ? 5.797   -9.776  14.190  1.00 51.99  ? 226 GLN A CG    1 
ATOM   649   C  CD    . GLN A  1 85  ? 4.754   -10.621 14.882  1.00 51.95  ? 226 GLN A CD    1 
ATOM   650   O  OE1   . GLN A  1 85  ? 5.082   -11.589 15.566  1.00 54.64  ? 226 GLN A OE1   1 
ATOM   651   N  NE2   . GLN A  1 85  ? 3.492   -10.256 14.717  1.00 49.71  ? 226 GLN A NE2   1 
ATOM   652   N  N     . GLU A  1 86  ? 7.986   -6.907  14.679  1.00 46.28  ? 227 GLU A N     1 
ATOM   653   C  CA    . GLU A  1 86  ? 7.819   -5.729  15.537  1.00 48.15  ? 227 GLU A CA    1 
ATOM   654   C  C     . GLU A  1 86  ? 6.627   -5.869  16.478  1.00 51.60  ? 227 GLU A C     1 
ATOM   655   O  O     . GLU A  1 86  ? 5.597   -6.432  16.108  1.00 54.93  ? 227 GLU A O     1 
ATOM   656   C  CB    . GLU A  1 86  ? 7.675   -4.457  14.694  1.00 49.61  ? 227 GLU A CB    1 
ATOM   657   C  CG    . GLU A  1 86  ? 7.660   -3.172  15.517  1.00 50.60  ? 227 GLU A CG    1 
ATOM   658   C  CD    . GLU A  1 86  ? 7.654   -1.925  14.662  1.00 53.83  ? 227 GLU A CD    1 
ATOM   659   O  OE1   . GLU A  1 86  ? 7.070   -1.955  13.561  1.00 56.69  ? 227 GLU A OE1   1 
ATOM   660   O  OE2   . GLU A  1 86  ? 8.234   -0.911  15.096  1.00 52.47  ? 227 GLU A OE2   1 
ATOM   661   N  N     . TYR A  1 87  ? 6.779   -5.366  17.700  1.00 52.59  ? 228 TYR A N     1 
ATOM   662   C  CA    . TYR A  1 87  ? 5.709   -5.414  18.685  1.00 52.74  ? 228 TYR A CA    1 
ATOM   663   C  C     . TYR A  1 87  ? 4.932   -4.103  18.732  1.00 55.56  ? 228 TYR A C     1 
ATOM   664   O  O     . TYR A  1 87  ? 5.354   -3.146  19.381  1.00 53.73  ? 228 TYR A O     1 
ATOM   665   C  CB    . TYR A  1 87  ? 6.269   -5.726  20.073  1.00 53.60  ? 228 TYR A CB    1 
ATOM   666   C  CG    . TYR A  1 87  ? 5.197   -5.889  21.125  1.00 56.52  ? 228 TYR A CG    1 
ATOM   667   C  CD1   . TYR A  1 87  ? 4.580   -7.112  21.324  1.00 56.90  ? 228 TYR A CD1   1 
ATOM   668   C  CD2   . TYR A  1 87  ? 4.796   -4.819  21.912  1.00 58.94  ? 228 TYR A CD2   1 
ATOM   669   C  CE1   . TYR A  1 87  ? 3.596   -7.266  22.277  1.00 58.98  ? 228 TYR A CE1   1 
ATOM   670   C  CE2   . TYR A  1 87  ? 3.811   -4.963  22.865  1.00 59.60  ? 228 TYR A CE2   1 
ATOM   671   C  CZ    . TYR A  1 87  ? 3.216   -6.188  23.045  1.00 60.67  ? 228 TYR A CZ    1 
ATOM   672   O  OH    . TYR A  1 87  ? 2.235   -6.338  23.997  1.00 61.38  ? 228 TYR A OH    1 
ATOM   673   N  N     . TYR A  1 88  ? 3.794   -4.081  18.045  1.00 62.36  ? 229 TYR A N     1 
ATOM   674   C  CA    . TYR A  1 88  ? 2.867   -2.945  18.059  1.00 70.00  ? 229 TYR A CA    1 
ATOM   675   C  C     . TYR A  1 88  ? 3.501   -1.612  17.650  1.00 71.27  ? 229 TYR A C     1 
ATOM   676   O  O     . TYR A  1 88  ? 3.319   -0.603  18.336  1.00 72.53  ? 229 TYR A O     1 
ATOM   677   C  CB    . TYR A  1 88  ? 2.191   -2.802  19.430  1.00 75.02  ? 229 TYR A CB    1 
ATOM   678   C  CG    . TYR A  1 88  ? 1.328   -3.982  19.840  1.00 80.72  ? 229 TYR A CG    1 
ATOM   679   C  CD1   . TYR A  1 88  ? 1.068   -5.024  18.959  1.00 81.63  ? 229 TYR A CD1   1 
ATOM   680   C  CD2   . TYR A  1 88  ? 0.767   -4.045  21.109  1.00 83.66  ? 229 TYR A CD2   1 
ATOM   681   C  CE1   . TYR A  1 88  ? 0.285   -6.096  19.331  1.00 82.86  ? 229 TYR A CE1   1 
ATOM   682   C  CE2   . TYR A  1 88  ? -0.024  -5.116  21.490  1.00 84.86  ? 229 TYR A CE2   1 
ATOM   683   C  CZ    . TYR A  1 88  ? -0.260  -6.138  20.596  1.00 83.72  ? 229 TYR A CZ    1 
ATOM   684   O  OH    . TYR A  1 88  ? -1.043  -7.209  20.962  1.00 82.82  ? 229 TYR A OH    1 
ATOM   685   N  N     . GLU A  1 89  ? 4.245   -1.621  16.544  1.00 69.43  ? 230 GLU A N     1 
ATOM   686   C  CA    . GLU A  1 89  ? 4.834   -0.405  15.968  1.00 69.40  ? 230 GLU A CA    1 
ATOM   687   C  C     . GLU A  1 89  ? 5.630   0.430   16.980  1.00 66.35  ? 230 GLU A C     1 
ATOM   688   O  O     . GLU A  1 89  ? 5.759   1.647   16.839  1.00 66.40  ? 230 GLU A O     1 
ATOM   689   C  CB    . GLU A  1 89  ? 3.751   0.445   15.288  1.00 71.72  ? 230 GLU A CB    1 
ATOM   690   C  CG    . GLU A  1 89  ? 2.813   -0.363  14.387  1.00 73.48  ? 230 GLU A CG    1 
ATOM   691   C  CD    . GLU A  1 89  ? 1.950   0.508   13.488  1.00 74.73  ? 230 GLU A CD    1 
ATOM   692   O  OE1   . GLU A  1 89  ? 1.230   -0.053  12.635  1.00 74.35  ? 230 GLU A OE1   1 
ATOM   693   O  OE2   . GLU A  1 89  ? 1.994   1.749   13.629  1.00 75.61  ? 230 GLU A OE2   1 
ATOM   694   N  N     . THR A  1 90  ? 6.162   -0.243  17.996  1.00 62.04  ? 231 THR A N     1 
ATOM   695   C  CA    . THR A  1 90  ? 6.896   0.407   19.075  1.00 56.53  ? 231 THR A CA    1 
ATOM   696   C  C     . THR A  1 90  ? 8.247   0.923   18.615  1.00 51.03  ? 231 THR A C     1 
ATOM   697   O  O     . THR A  1 90  ? 8.724   1.952   19.098  1.00 51.25  ? 231 THR A O     1 
ATOM   698   C  CB    . THR A  1 90  ? 7.126   -0.565  20.238  1.00 57.56  ? 231 THR A CB    1 
ATOM   699   O  OG1   . THR A  1 90  ? 7.267   -1.895  19.722  1.00 57.15  ? 231 THR A OG1   1 
ATOM   700   C  CG2   . THR A  1 90  ? 5.953   -0.528  21.202  1.00 56.23  ? 231 THR A CG2   1 
ATOM   701   N  N     . GLY A  1 91  ? 8.866   0.193   17.691  1.00 47.35  ? 232 GLY A N     1 
ATOM   702   C  CA    . GLY A  1 91  ? 10.180  0.543   17.186  1.00 43.90  ? 232 GLY A CA    1 
ATOM   703   C  C     . GLY A  1 91  ? 11.289  -0.231  17.871  1.00 44.82  ? 232 GLY A C     1 
ATOM   704   O  O     . GLY A  1 91  ? 12.194  -0.748  17.218  1.00 41.47  ? 232 GLY A O     1 
ATOM   705   N  N     . ALA A  1 92  ? 11.209  -0.318  19.195  1.00 46.97  ? 233 ALA A N     1 
ATOM   706   C  CA    . ALA A  1 92  ? 12.271  -0.915  19.992  1.00 45.23  ? 233 ALA A CA    1 
ATOM   707   C  C     . ALA A  1 92  ? 11.988  -2.360  20.371  1.00 45.28  ? 233 ALA A C     1 
ATOM   708   O  O     . ALA A  1 92  ? 12.917  -3.128  20.628  1.00 43.40  ? 233 ALA A O     1 
ATOM   709   C  CB    . ALA A  1 92  ? 12.501  -0.094  21.239  1.00 44.39  ? 233 ALA A CB    1 
ATOM   710   N  N     . PHE A  1 93  ? 10.712  -2.728  20.427  1.00 47.63  ? 234 PHE A N     1 
ATOM   711   C  CA    . PHE A  1 93  ? 10.353  -4.049  20.928  1.00 46.35  ? 234 PHE A CA    1 
ATOM   712   C  C     . PHE A  1 93  ? 9.934   -5.018  19.829  1.00 42.22  ? 234 PHE A C     1 
ATOM   713   O  O     . PHE A  1 93  ? 9.185   -4.656  18.920  1.00 40.55  ? 234 PHE A O     1 
ATOM   714   C  CB    . PHE A  1 93  ? 9.282   -3.929  22.006  1.00 50.60  ? 234 PHE A CB    1 
ATOM   715   C  CG    . PHE A  1 93  ? 9.668   -3.015  23.127  1.00 54.07  ? 234 PHE A CG    1 
ATOM   716   C  CD1   . PHE A  1 93  ? 10.783  -3.290  23.909  1.00 54.85  ? 234 PHE A CD1   1 
ATOM   717   C  CD2   . PHE A  1 93  ? 8.926   -1.878  23.398  1.00 56.64  ? 234 PHE A CD2   1 
ATOM   718   C  CE1   . PHE A  1 93  ? 11.148  -2.444  24.944  1.00 56.40  ? 234 PHE A CE1   1 
ATOM   719   C  CE2   . PHE A  1 93  ? 9.283   -1.033  24.431  1.00 58.83  ? 234 PHE A CE2   1 
ATOM   720   C  CZ    . PHE A  1 93  ? 10.396  -1.317  25.204  1.00 57.40  ? 234 PHE A CZ    1 
ATOM   721   N  N     . TYR A  1 94  ? 10.433  -6.249  19.921  1.00 40.30  ? 235 TYR A N     1 
ATOM   722   C  CA    . TYR A  1 94  ? 10.230  -7.242  18.868  1.00 38.90  ? 235 TYR A CA    1 
ATOM   723   C  C     . TYR A  1 94  ? 9.887   -8.621  19.420  1.00 40.76  ? 235 TYR A C     1 
ATOM   724   O  O     . TYR A  1 94  ? 9.968   -8.855  20.623  1.00 41.86  ? 235 TYR A O     1 
ATOM   725   C  CB    . TYR A  1 94  ? 11.469  -7.331  17.966  1.00 34.19  ? 235 TYR A CB    1 
ATOM   726   C  CG    . TYR A  1 94  ? 11.709  -6.083  17.153  1.00 34.00  ? 235 TYR A CG    1 
ATOM   727   C  CD1   . TYR A  1 94  ? 11.285  -5.995  15.838  1.00 36.50  ? 235 TYR A CD1   1 
ATOM   728   C  CD2   . TYR A  1 94  ? 12.352  -4.989  17.705  1.00 33.95  ? 235 TYR A CD2   1 
ATOM   729   C  CE1   . TYR A  1 94  ? 11.493  -4.850  15.099  1.00 35.95  ? 235 TYR A CE1   1 
ATOM   730   C  CE2   . TYR A  1 94  ? 12.557  -3.844  16.977  1.00 31.58  ? 235 TYR A CE2   1 
ATOM   731   C  CZ    . TYR A  1 94  ? 12.131  -3.780  15.677  1.00 35.13  ? 235 TYR A CZ    1 
ATOM   732   O  OH    . TYR A  1 94  ? 12.344  -2.632  14.952  1.00 39.68  ? 235 TYR A OH    1 
ATOM   733   N  N     . LEU A  1 95  ? 9.487   -9.521  18.526  1.00 43.93  ? 236 LEU A N     1 
ATOM   734   C  CA    . LEU A  1 95  ? 9.270   -10.925 18.852  1.00 44.29  ? 236 LEU A CA    1 
ATOM   735   C  C     . LEU A  1 95  ? 10.210  -11.723 17.967  1.00 41.17  ? 236 LEU A C     1 
ATOM   736   O  O     . LEU A  1 95  ? 10.405  -11.376 16.791  1.00 37.63  ? 236 LEU A O     1 
ATOM   737   C  CB    . LEU A  1 95  ? 7.824   -11.342 18.579  1.00 49.19  ? 236 LEU A CB    1 
ATOM   738   C  CG    . LEU A  1 95  ? 6.831   -11.360 19.746  1.00 51.29  ? 236 LEU A CG    1 
ATOM   739   C  CD1   . LEU A  1 95  ? 6.793   -10.019 20.452  1.00 51.34  ? 236 LEU A CD1   1 
ATOM   740   C  CD2   . LEU A  1 95  ? 5.439   -11.744 19.271  1.00 49.64  ? 236 LEU A CD2   1 
ATOM   741   N  N     . VAL A  1 96  ? 10.793  -12.778 18.532  1.00 43.51  ? 237 VAL A N     1 
ATOM   742   C  CA    . VAL A  1 96  ? 11.783  -13.588 17.828  1.00 45.68  ? 237 VAL A CA    1 
ATOM   743   C  C     . VAL A  1 96  ? 11.254  -14.974 17.495  1.00 53.42  ? 237 VAL A C     1 
ATOM   744   O  O     . VAL A  1 96  ? 10.988  -15.785 18.387  1.00 55.09  ? 237 VAL A O     1 
ATOM   745   C  CB    . VAL A  1 96  ? 13.063  -13.750 18.654  1.00 42.88  ? 237 VAL A CB    1 
ATOM   746   C  CG1   . VAL A  1 96  ? 13.985  -14.781 18.019  1.00 40.31  ? 237 VAL A CG1   1 
ATOM   747   C  CG2   . VAL A  1 96  ? 13.766  -12.419 18.792  1.00 42.78  ? 237 VAL A CG2   1 
ATOM   748   N  N     . LYS A  1 97  ? 11.114  -15.246 16.203  1.00 59.75  ? 238 LYS A N     1 
ATOM   749   C  CA    . LYS A  1 97  ? 10.697  -16.559 15.744  1.00 68.37  ? 238 LYS A CA    1 
ATOM   750   C  C     . LYS A  1 97  ? 11.845  -17.221 15.016  1.00 75.28  ? 238 LYS A C     1 
ATOM   751   O  O     . LYS A  1 97  ? 12.779  -16.556 14.569  1.00 74.80  ? 238 LYS A O     1 
ATOM   752   C  CB    . LYS A  1 97  ? 9.502   -16.446 14.803  1.00 71.27  ? 238 LYS A CB    1 
ATOM   753   C  CG    . LYS A  1 97  ? 8.362   -15.628 15.364  1.00 74.82  ? 238 LYS A CG    1 
ATOM   754   C  CD    . LYS A  1 97  ? 7.346   -15.296 14.290  1.00 78.01  ? 238 LYS A CD    1 
ATOM   755   C  CE    . LYS A  1 97  ? 6.353   -14.275 14.804  1.00 79.79  ? 238 LYS A CE    1 
ATOM   756   N  NZ    . LYS A  1 97  ? 5.443   -13.785 13.738  1.00 79.76  ? 238 LYS A NZ    1 
ATOM   757   N  N     . PHE A  1 98  ? 11.772  -18.539 14.900  1.00 82.32  ? 239 PHE A N     1 
ATOM   758   C  CA    . PHE A  1 98  ? 12.750  -19.268 14.115  1.00 86.87  ? 239 PHE A CA    1 
ATOM   759   C  C     . PHE A  1 98  ? 12.186  -19.575 12.740  1.00 89.04  ? 239 PHE A C     1 
ATOM   760   O  O     . PHE A  1 98  ? 11.063  -20.066 12.614  1.00 90.04  ? 239 PHE A O     1 
ATOM   761   C  CB    . PHE A  1 98  ? 13.178  -20.543 14.833  1.00 89.04  ? 239 PHE A CB    1 
ATOM   762   C  CG    . PHE A  1 98  ? 14.098  -20.296 15.991  1.00 89.35  ? 239 PHE A CG    1 
ATOM   763   C  CD1   . PHE A  1 98  ? 15.463  -20.492 15.857  1.00 89.86  ? 239 PHE A CD1   1 
ATOM   764   C  CD2   . PHE A  1 98  ? 13.602  -19.854 17.209  1.00 88.29  ? 239 PHE A CD2   1 
ATOM   765   C  CE1   . PHE A  1 98  ? 16.316  -20.263 16.920  1.00 89.48  ? 239 PHE A CE1   1 
ATOM   766   C  CE2   . PHE A  1 98  ? 14.450  -19.621 18.276  1.00 87.24  ? 239 PHE A CE2   1 
ATOM   767   C  CZ    . PHE A  1 98  ? 15.807  -19.826 18.130  1.00 88.19  ? 239 PHE A CZ    1 
ATOM   768   N  N     . LYS A  1 99  ? 12.977  -19.262 11.719  1.00 100.01 ? 240 LYS A N     1 
ATOM   769   C  CA    . LYS A  1 99  ? 12.597  -19.443 10.328  1.00 104.91 ? 240 LYS A CA    1 
ATOM   770   C  C     . LYS A  1 99  ? 12.445  -20.923 10.006  1.00 111.96 ? 240 LYS A C     1 
ATOM   771   O  O     . LYS A  1 99  ? 11.486  -21.569 10.429  1.00 113.64 ? 240 LYS A O     1 
ATOM   772   C  CB    . LYS A  1 99  ? 13.677  -18.836 9.441   1.00 103.33 ? 240 LYS A CB    1 
ATOM   773   C  CG    . LYS A  1 99  ? 13.187  -18.257 8.130   1.00 101.97 ? 240 LYS A CG    1 
ATOM   774   C  CD    . LYS A  1 99  ? 14.363  -17.658 7.389   1.00 101.15 ? 240 LYS A CD    1 
ATOM   775   C  CE    . LYS A  1 99  ? 13.916  -16.656 6.352   1.00 101.36 ? 240 LYS A CE    1 
ATOM   776   N  NZ    . LYS A  1 99  ? 15.072  -15.856 5.869   1.00 101.34 ? 240 LYS A NZ    1 
ATOM   777   N  N     . ARG A  1 100 ? 13.395  -21.460 9.249   1.00 116.27 ? 241 ARG A N     1 
ATOM   778   C  CA    . ARG A  1 100 ? 13.381  -22.880 8.934   1.00 120.11 ? 241 ARG A CA    1 
ATOM   779   C  C     . ARG A  1 100 ? 14.431  -23.633 9.733   1.00 121.70 ? 241 ARG A C     1 
ATOM   780   O  O     . ARG A  1 100 ? 15.462  -24.043 9.196   1.00 121.79 ? 241 ARG A O     1 
ATOM   781   C  CB    . ARG A  1 100 ? 13.573  -23.113 7.440   1.00 122.57 ? 241 ARG A CB    1 
ATOM   782   C  CG    . ARG A  1 100 ? 12.364  -22.738 6.608   1.00 124.55 ? 241 ARG A CG    1 
ATOM   783   C  CD    . ARG A  1 100 ? 12.603  -23.063 5.153   1.00 126.07 ? 241 ARG A CD    1 
ATOM   784   N  NE    . ARG A  1 100 ? 11.446  -22.759 4.320   1.00 126.99 ? 241 ARG A NE    1 
ATOM   785   C  CZ    . ARG A  1 100 ? 11.428  -22.910 3.001   1.00 127.65 ? 241 ARG A CZ    1 
ATOM   786   N  NH1   . ARG A  1 100 ? 12.507  -23.358 2.373   1.00 127.89 ? 241 ARG A NH1   1 
ATOM   787   N  NH2   . ARG A  1 100 ? 10.337  -22.613 2.309   1.00 127.81 ? 241 ARG A NH2   1 
ATOM   788   N  N     . ILE A  1 101 ? 14.154  -23.787 11.024  1.00 123.09 ? 242 ILE A N     1 
ATOM   789   C  CA    . ILE A  1 101 ? 14.949  -24.616 11.919  1.00 124.08 ? 242 ILE A CA    1 
ATOM   790   C  C     . ILE A  1 101 ? 15.187  -25.983 11.280  1.00 126.32 ? 242 ILE A C     1 
ATOM   791   O  O     . ILE A  1 101 ? 14.245  -26.741 11.047  1.00 126.95 ? 242 ILE A O     1 
ATOM   792   C  CB    . ILE A  1 101 ? 14.236  -24.765 13.284  1.00 121.96 ? 242 ILE A CB    1 
ATOM   793   C  CG1   . ILE A  1 101 ? 14.745  -25.989 14.048  1.00 121.08 ? 242 ILE A CG1   1 
ATOM   794   C  CG2   . ILE A  1 101 ? 12.725  -24.849 13.091  1.00 120.88 ? 242 ILE A CG2   1 
ATOM   795   C  CD1   . ILE A  1 101 ? 13.867  -26.373 15.226  1.00 120.51 ? 242 ILE A CD1   1 
ATOM   796   N  N     . PRO A  1 102 ? 16.452  -26.289 10.955  1.00 127.04 ? 243 PRO A N     1 
ATOM   797   C  CA    . PRO A  1 102 ? 16.725  -27.563 10.282  1.00 127.22 ? 243 PRO A CA    1 
ATOM   798   C  C     . PRO A  1 102 ? 16.727  -28.776 11.215  1.00 126.47 ? 243 PRO A C     1 
ATOM   799   O  O     . PRO A  1 102 ? 16.344  -29.862 10.780  1.00 126.91 ? 243 PRO A O     1 
ATOM   800   C  CB    . PRO A  1 102 ? 18.116  -27.347 9.677   1.00 127.49 ? 243 PRO A CB    1 
ATOM   801   C  CG    . PRO A  1 102 ? 18.753  -26.329 10.552  1.00 127.20 ? 243 PRO A CG    1 
ATOM   802   C  CD    . PRO A  1 102 ? 17.644  -25.423 11.013  1.00 127.07 ? 243 PRO A CD    1 
ATOM   803   N  N     . ARG A  1 103 ? 17.140  -28.607 12.468  1.00 124.23 ? 244 ARG A N     1 
ATOM   804   C  CA    . ARG A  1 103 ? 17.289  -29.758 13.358  1.00 120.48 ? 244 ARG A CA    1 
ATOM   805   C  C     . ARG A  1 103 ? 16.581  -29.588 14.702  1.00 115.87 ? 244 ARG A C     1 
ATOM   806   O  O     . ARG A  1 103 ? 15.473  -29.058 14.775  1.00 115.25 ? 244 ARG A O     1 
ATOM   807   C  CB    . ARG A  1 103 ? 18.772  -30.059 13.588  1.00 120.12 ? 244 ARG A CB    1 
ATOM   808   C  CG    . ARG A  1 103 ? 19.092  -31.542 13.741  1.00 120.20 ? 244 ARG A CG    1 
ATOM   809   C  CD    . ARG A  1 103 ? 20.459  -31.741 14.370  1.00 120.07 ? 244 ARG A CD    1 
ATOM   810   N  NE    . ARG A  1 103 ? 20.748  -33.149 14.626  1.00 120.27 ? 244 ARG A NE    1 
ATOM   811   C  CZ    . ARG A  1 103 ? 21.832  -33.583 15.261  1.00 119.75 ? 244 ARG A CZ    1 
ATOM   812   N  NH1   . ARG A  1 103 ? 22.729  -32.715 15.709  1.00 119.35 ? 244 ARG A NH1   1 
ATOM   813   N  NH2   . ARG A  1 103 ? 22.019  -34.882 15.452  1.00 119.09 ? 244 ARG A NH2   1 
ATOM   814   N  N     . GLY A  1 104 ? 17.234  -30.057 15.761  1.00 111.71 ? 245 GLY A N     1 
ATOM   815   C  CA    . GLY A  1 104 ? 16.698  -29.970 17.104  1.00 107.58 ? 245 GLY A CA    1 
ATOM   816   C  C     . GLY A  1 104 ? 16.793  -28.572 17.679  1.00 103.07 ? 245 GLY A C     1 
ATOM   817   O  O     . GLY A  1 104 ? 15.893  -28.142 18.393  1.00 103.93 ? 245 GLY A O     1 
ATOM   818   N  N     . ASN A  1 105 ? 17.883  -27.875 17.363  1.00 97.09  ? 246 ASN A N     1 
ATOM   819   C  CA    . ASN A  1 105 ? 18.134  -26.506 17.831  1.00 91.62  ? 246 ASN A CA    1 
ATOM   820   C  C     . ASN A  1 105 ? 18.329  -26.411 19.346  1.00 88.60  ? 246 ASN A C     1 
ATOM   821   O  O     . ASN A  1 105 ? 17.448  -26.792 20.118  1.00 89.96  ? 246 ASN A O     1 
ATOM   822   C  CB    . ASN A  1 105 ? 17.031  -25.549 17.359  1.00 89.73  ? 246 ASN A CB    1 
ATOM   823   C  CG    . ASN A  1 105 ? 17.306  -24.105 17.736  1.00 86.59  ? 246 ASN A CG    1 
ATOM   824   O  OD1   . ASN A  1 105 ? 18.403  -23.591 17.521  1.00 85.45  ? 246 ASN A OD1   1 
ATOM   825   N  ND2   . ASN A  1 105 ? 16.304  -23.443 18.302  1.00 84.54  ? 246 ASN A ND2   1 
ATOM   826   N  N     . PRO A  1 106 ? 19.492  -25.893 19.776  1.00 83.91  ? 247 PRO A N     1 
ATOM   827   C  CA    . PRO A  1 106 ? 19.848  -25.813 21.199  1.00 80.00  ? 247 PRO A CA    1 
ATOM   828   C  C     . PRO A  1 106 ? 18.921  -24.901 22.011  1.00 77.03  ? 247 PRO A C     1 
ATOM   829   O  O     . PRO A  1 106 ? 19.041  -24.865 23.236  1.00 78.43  ? 247 PRO A O     1 
ATOM   830   C  CB    . PRO A  1 106 ? 21.267  -25.230 21.175  1.00 79.49  ? 247 PRO A CB    1 
ATOM   831   C  CG    . PRO A  1 106 ? 21.781  -25.507 19.797  1.00 80.53  ? 247 PRO A CG    1 
ATOM   832   C  CD    . PRO A  1 106 ? 20.583  -25.422 18.906  1.00 82.72  ? 247 PRO A CD    1 
ATOM   833   N  N     . LEU A  1 107 ? 18.016  -24.187 21.345  1.00 74.79  ? 248 LEU A N     1 
ATOM   834   C  CA    . LEU A  1 107 ? 17.092  -23.287 22.032  1.00 75.36  ? 248 LEU A CA    1 
ATOM   835   C  C     . LEU A  1 107 ? 15.642  -23.764 21.952  1.00 78.37  ? 248 LEU A C     1 
ATOM   836   O  O     . LEU A  1 107 ? 14.716  -22.978 22.151  1.00 80.68  ? 248 LEU A O     1 
ATOM   837   C  CB    . LEU A  1 107 ? 17.194  -21.872 21.459  1.00 72.85  ? 248 LEU A CB    1 
ATOM   838   C  CG    . LEU A  1 107 ? 18.551  -21.175 21.569  1.00 70.41  ? 248 LEU A CG    1 
ATOM   839   C  CD1   . LEU A  1 107 ? 18.489  -19.752 21.030  1.00 67.85  ? 248 LEU A CD1   1 
ATOM   840   C  CD2   . LEU A  1 107 ? 19.039  -21.186 23.004  1.00 71.24  ? 248 LEU A CD2   1 
ATOM   841   N  N     . SER A  1 108 ? 15.450  -25.049 21.674  1.00 77.46  ? 249 SER A N     1 
ATOM   842   C  CA    . SER A  1 108 ? 14.111  -25.599 21.481  1.00 75.97  ? 249 SER A CA    1 
ATOM   843   C  C     . SER A  1 108 ? 13.304  -25.696 22.773  1.00 73.41  ? 249 SER A C     1 
ATOM   844   O  O     . SER A  1 108 ? 12.076  -25.784 22.741  1.00 74.72  ? 249 SER A O     1 
ATOM   845   C  CB    . SER A  1 108 ? 14.196  -26.966 20.808  1.00 78.08  ? 249 SER A CB    1 
ATOM   846   O  OG    . SER A  1 108 ? 14.654  -26.835 19.475  1.00 79.30  ? 249 SER A OG    1 
ATOM   847   N  N     . HIS A  1 109 ? 13.996  -25.678 23.906  1.00 68.97  ? 250 HIS A N     1 
ATOM   848   C  CA    . HIS A  1 109 ? 13.339  -25.753 25.202  1.00 66.82  ? 250 HIS A CA    1 
ATOM   849   C  C     . HIS A  1 109 ? 12.888  -24.368 25.643  1.00 60.86  ? 250 HIS A C     1 
ATOM   850   O  O     . HIS A  1 109 ? 12.130  -24.227 26.603  1.00 60.56  ? 250 HIS A O     1 
ATOM   851   C  CB    . HIS A  1 109 ? 14.283  -26.355 26.243  1.00 71.23  ? 250 HIS A CB    1 
ATOM   852   C  CG    . HIS A  1 109 ? 14.822  -27.698 25.861  1.00 77.28  ? 250 HIS A CG    1 
ATOM   853   N  ND1   . HIS A  1 109 ? 15.670  -27.883 24.790  1.00 80.78  ? 250 HIS A ND1   1 
ATOM   854   C  CD2   . HIS A  1 109 ? 14.632  -28.923 26.407  1.00 78.24  ? 250 HIS A CD2   1 
ATOM   855   C  CE1   . HIS A  1 109 ? 15.977  -29.163 24.691  1.00 81.38  ? 250 HIS A CE1   1 
ATOM   856   N  NE2   . HIS A  1 109 ? 15.361  -29.816 25.660  1.00 80.07  ? 250 HIS A NE2   1 
ATOM   857   N  N     . PHE A  1 110 ? 13.366  -23.349 24.935  1.00 55.54  ? 251 PHE A N     1 
ATOM   858   C  CA    . PHE A  1 110 ? 13.034  -21.967 25.254  1.00 49.24  ? 251 PHE A CA    1 
ATOM   859   C  C     . PHE A  1 110 ? 11.919  -21.451 24.351  1.00 45.61  ? 251 PHE A C     1 
ATOM   860   O  O     . PHE A  1 110 ? 11.478  -20.310 24.476  1.00 41.93  ? 251 PHE A O     1 
ATOM   861   C  CB    . PHE A  1 110 ? 14.282  -21.087 25.161  1.00 47.96  ? 251 PHE A CB    1 
ATOM   862   C  CG    . PHE A  1 110 ? 15.382  -21.512 26.091  1.00 46.07  ? 251 PHE A CG    1 
ATOM   863   C  CD1   . PHE A  1 110 ? 15.075  -22.086 27.317  1.00 42.00  ? 251 PHE A CD1   1 
ATOM   864   C  CD2   . PHE A  1 110 ? 16.716  -21.357 25.742  1.00 48.64  ? 251 PHE A CD2   1 
ATOM   865   C  CE1   . PHE A  1 110 ? 16.074  -22.492 28.183  1.00 39.84  ? 251 PHE A CE1   1 
ATOM   866   C  CE2   . PHE A  1 110 ? 17.725  -21.761 26.607  1.00 46.59  ? 251 PHE A CE2   1 
ATOM   867   C  CZ    . PHE A  1 110 ? 17.401  -22.329 27.826  1.00 41.90  ? 251 PHE A CZ    1 
ATOM   868   N  N     . LEU A  1 111 ? 11.455  -22.311 23.451  1.00 49.04  ? 252 LEU A N     1 
ATOM   869   C  CA    . LEU A  1 111 ? 10.340  -21.969 22.577  1.00 54.43  ? 252 LEU A CA    1 
ATOM   870   C  C     . LEU A  1 111 ? 9.021   -21.982 23.345  1.00 64.12  ? 252 LEU A C     1 
ATOM   871   O  O     . LEU A  1 111 ? 8.760   -22.890 24.137  1.00 66.84  ? 252 LEU A O     1 
ATOM   872   C  CB    . LEU A  1 111 ? 10.289  -22.914 21.376  1.00 51.59  ? 252 LEU A CB    1 
ATOM   873   C  CG    . LEU A  1 111 ? 11.380  -22.668 20.334  1.00 49.40  ? 252 LEU A CG    1 
ATOM   874   C  CD1   . LEU A  1 111 ? 11.497  -23.832 19.358  1.00 49.00  ? 252 LEU A CD1   1 
ATOM   875   C  CD2   . LEU A  1 111 ? 11.111  -21.369 19.591  1.00 47.49  ? 252 LEU A CD2   1 
ATOM   876   N  N     . GLU A  1 112 ? 8.201   -20.962 23.114  1.00 70.56  ? 253 GLU A N     1 
ATOM   877   C  CA    . GLU A  1 112 ? 6.956   -20.794 23.851  1.00 76.03  ? 253 GLU A CA    1 
ATOM   878   C  C     . GLU A  1 112 ? 5.802   -20.564 22.879  1.00 80.90  ? 253 GLU A C     1 
ATOM   879   O  O     . GLU A  1 112 ? 5.502   -19.424 22.510  1.00 80.68  ? 253 GLU A O     1 
ATOM   880   C  CB    . GLU A  1 112 ? 7.084   -19.623 24.829  1.00 77.86  ? 253 GLU A CB    1 
ATOM   881   C  CG    . GLU A  1 112 ? 6.352   -19.820 26.143  1.00 80.50  ? 253 GLU A CG    1 
ATOM   882   C  CD    . GLU A  1 112 ? 4.893   -19.462 26.040  1.00 84.08  ? 253 GLU A CD    1 
ATOM   883   O  OE1   . GLU A  1 112 ? 4.517   -18.794 25.056  1.00 85.79  ? 253 GLU A OE1   1 
ATOM   884   O  OE2   . GLU A  1 112 ? 4.120   -19.832 26.948  1.00 83.91  ? 253 GLU A OE2   1 
ATOM   885   N  N     . GLY A  1 113 ? 5.173   -21.659 22.456  1.00 84.37  ? 254 GLY A N     1 
ATOM   886   C  CA    . GLY A  1 113 ? 4.062   -21.604 21.524  1.00 86.77  ? 254 GLY A CA    1 
ATOM   887   C  C     . GLY A  1 113 ? 4.502   -21.677 20.074  1.00 88.67  ? 254 GLY A C     1 
ATOM   888   O  O     . GLY A  1 113 ? 3.997   -22.494 19.300  1.00 92.31  ? 254 GLY A O     1 
ATOM   889   N  N     . GLU A  1 114 ? 5.454   -20.819 19.718  1.00 85.15  ? 255 GLU A N     1 
ATOM   890   C  CA    . GLU A  1 114 ? 5.917   -20.669 18.343  1.00 82.64  ? 255 GLU A CA    1 
ATOM   891   C  C     . GLU A  1 114 ? 7.090   -19.697 18.337  1.00 78.20  ? 255 GLU A C     1 
ATOM   892   O  O     . GLU A  1 114 ? 7.937   -19.718 17.442  1.00 79.02  ? 255 GLU A O     1 
ATOM   893   C  CB    . GLU A  1 114 ? 4.784   -20.132 17.460  1.00 86.50  ? 255 GLU A CB    1 
ATOM   894   C  CG    . GLU A  1 114 ? 4.049   -18.934 18.056  1.00 90.16  ? 255 GLU A CG    1 
ATOM   895   C  CD    . GLU A  1 114 ? 2.719   -18.655 17.380  1.00 93.85  ? 255 GLU A CD    1 
ATOM   896   O  OE1   . GLU A  1 114 ? 2.236   -19.523 16.624  1.00 94.84  ? 255 GLU A OE1   1 
ATOM   897   O  OE2   . GLU A  1 114 ? 2.153   -17.564 17.610  1.00 95.15  ? 255 GLU A OE2   1 
ATOM   898   N  N     . VAL A  1 115 ? 7.129   -18.859 19.368  1.00 71.59  ? 256 VAL A N     1 
ATOM   899   C  CA    . VAL A  1 115 ? 8.104   -17.785 19.501  1.00 65.21  ? 256 VAL A CA    1 
ATOM   900   C  C     . VAL A  1 115 ? 9.161   -18.169 20.540  1.00 62.33  ? 256 VAL A C     1 
ATOM   901   O  O     . VAL A  1 115 ? 8.910   -19.021 21.393  1.00 62.77  ? 256 VAL A O     1 
ATOM   902   C  CB    . VAL A  1 115 ? 7.387   -16.488 19.929  1.00 62.87  ? 256 VAL A CB    1 
ATOM   903   C  CG1   . VAL A  1 115 ? 8.328   -15.305 19.939  1.00 63.26  ? 256 VAL A CG1   1 
ATOM   904   C  CG2   . VAL A  1 115 ? 6.236   -16.205 18.995  1.00 61.54  ? 256 VAL A CG2   1 
ATOM   905   N  N     . LEU A  1 116 ? 10.344  -17.561 20.455  1.00 56.48  ? 257 LEU A N     1 
ATOM   906   C  CA    . LEU A  1 116 ? 11.391  -17.752 21.458  1.00 50.25  ? 257 LEU A CA    1 
ATOM   907   C  C     . LEU A  1 116 ? 11.087  -16.947 22.720  1.00 53.03  ? 257 LEU A C     1 
ATOM   908   O  O     . LEU A  1 116 ? 10.869  -15.735 22.651  1.00 57.01  ? 257 LEU A O     1 
ATOM   909   C  CB    . LEU A  1 116 ? 12.749  -17.336 20.890  1.00 43.04  ? 257 LEU A CB    1 
ATOM   910   C  CG    . LEU A  1 116 ? 13.986  -17.550 21.764  1.00 35.31  ? 257 LEU A CG    1 
ATOM   911   C  CD1   . LEU A  1 116 ? 14.180  -19.025 22.057  1.00 31.35  ? 257 LEU A CD1   1 
ATOM   912   C  CD2   . LEU A  1 116 ? 15.224  -16.973 21.106  1.00 32.19  ? 257 LEU A CD2   1 
ATOM   913   N  N     . SER A  1 117 ? 11.080  -17.617 23.871  1.00 51.41  ? 258 SER A N     1 
ATOM   914   C  CA    . SER A  1 117 ? 10.766  -16.953 25.138  1.00 50.82  ? 258 SER A CA    1 
ATOM   915   C  C     . SER A  1 117 ? 11.994  -16.390 25.842  1.00 50.43  ? 258 SER A C     1 
ATOM   916   O  O     . SER A  1 117 ? 12.936  -17.118 26.150  1.00 48.91  ? 258 SER A O     1 
ATOM   917   C  CB    . SER A  1 117 ? 10.034  -17.902 26.086  1.00 50.34  ? 258 SER A CB    1 
ATOM   918   O  OG    . SER A  1 117 ? 9.876   -17.309 27.362  1.00 50.48  ? 258 SER A OG    1 
ATOM   919   N  N     . ALA A  1 118 ? 11.963  -15.091 26.113  1.00 41.03  ? 259 ALA A N     1 
ATOM   920   C  CA    . ALA A  1 118 ? 13.043  -14.427 26.823  1.00 36.11  ? 259 ALA A CA    1 
ATOM   921   C  C     . ALA A  1 118 ? 13.101  -14.876 28.278  1.00 37.30  ? 259 ALA A C     1 
ATOM   922   O  O     . ALA A  1 118 ? 14.180  -15.053 28.837  1.00 38.60  ? 259 ALA A O     1 
ATOM   923   C  CB    . ALA A  1 118 ? 12.871  -12.922 26.738  1.00 34.82  ? 259 ALA A CB    1 
ATOM   924   N  N     . THR A  1 119 ? 11.927  -15.056 28.878  1.00 41.47  ? 260 THR A N     1 
ATOM   925   C  CA    . THR A  1 119 ? 11.798  -15.408 30.295  1.00 43.55  ? 260 THR A CA    1 
ATOM   926   C  C     . THR A  1 119 ? 12.388  -16.783 30.668  1.00 43.53  ? 260 THR A C     1 
ATOM   927   O  O     . THR A  1 119 ? 13.121  -16.901 31.661  1.00 46.02  ? 260 THR A O     1 
ATOM   928   C  CB    . THR A  1 119 ? 10.325  -15.296 30.750  1.00 46.37  ? 260 THR A CB    1 
ATOM   929   O  OG1   . THR A  1 119 ? 9.980   -13.913 30.913  1.00 48.88  ? 260 THR A OG1   1 
ATOM   930   C  CG2   . THR A  1 119 ? 10.100  -16.016 32.063  1.00 46.77  ? 260 THR A CG2   1 
ATOM   931   N  N     . LYS A  1 120 ? 12.065  -17.810 29.882  1.00 40.60  ? 261 LYS A N     1 
ATOM   932   C  CA    . LYS A  1 120 ? 12.627  -19.148 30.073  1.00 38.36  ? 261 LYS A CA    1 
ATOM   933   C  C     . LYS A  1 120 ? 14.140  -19.133 29.941  1.00 39.17  ? 261 LYS A C     1 
ATOM   934   O  O     . LYS A  1 120 ? 14.870  -19.637 30.801  1.00 41.80  ? 261 LYS A O     1 
ATOM   935   C  CB    . LYS A  1 120 ? 12.084  -20.104 29.013  1.00 35.19  ? 261 LYS A CB    1 
ATOM   936   C  CG    . LYS A  1 120 ? 10.621  -20.482 29.153  1.00 31.55  ? 261 LYS A CG    1 
ATOM   937   C  CD    . LYS A  1 120 ? 10.274  -21.549 28.129  1.00 29.82  ? 261 LYS A CD    1 
ATOM   938   C  CE    . LYS A  1 120 ? 8.835   -22.010 28.270  1.00 30.14  ? 261 LYS A CE    1 
ATOM   939   N  NZ    . LYS A  1 120 ? 8.455   -22.990 27.210  1.00 30.99  ? 261 LYS A NZ    1 
ATOM   940   N  N     . MET A  1 121 ? 14.589  -18.575 28.825  1.00 40.41  ? 262 MET A N     1 
ATOM   941   C  CA    . MET A  1 121 ? 15.998  -18.468 28.493  1.00 39.98  ? 262 MET A CA    1 
ATOM   942   C  C     . MET A  1 121 ? 16.745  -17.807 29.645  1.00 44.35  ? 262 MET A C     1 
ATOM   943   O  O     . MET A  1 121 ? 17.738  -18.340 30.150  1.00 46.87  ? 262 MET A O     1 
ATOM   944   C  CB    . MET A  1 121 ? 16.127  -17.632 27.222  1.00 36.97  ? 262 MET A CB    1 
ATOM   945   C  CG    . MET A  1 121 ? 17.372  -17.880 26.410  1.00 40.79  ? 262 MET A CG    1 
ATOM   946   S  SD    . MET A  1 121 ? 17.194  -17.179 24.765  1.00 49.37  ? 262 MET A SD    1 
ATOM   947   C  CE    . MET A  1 121 ? 18.726  -17.737 24.019  1.00 42.33  ? 262 MET A CE    1 
ATOM   948   N  N     . LEU A  1 122 ? 16.228  -16.660 30.079  1.00 45.38  ? 263 LEU A N     1 
ATOM   949   C  CA    . LEU A  1 122 ? 16.830  -15.874 31.152  1.00 40.71  ? 263 LEU A CA    1 
ATOM   950   C  C     . LEU A  1 122 ? 16.821  -16.623 32.481  1.00 40.39  ? 263 LEU A C     1 
ATOM   951   O  O     . LEU A  1 122 ? 17.735  -16.463 33.292  1.00 44.82  ? 263 LEU A O     1 
ATOM   952   C  CB    . LEU A  1 122 ? 16.106  -14.531 31.291  1.00 39.79  ? 263 LEU A CB    1 
ATOM   953   C  CG    . LEU A  1 122 ? 16.688  -13.476 32.233  1.00 41.53  ? 263 LEU A CG    1 
ATOM   954   C  CD1   . LEU A  1 122 ? 18.001  -12.941 31.708  1.00 37.11  ? 263 LEU A CD1   1 
ATOM   955   C  CD2   . LEU A  1 122 ? 15.707  -12.338 32.456  1.00 45.08  ? 263 LEU A CD2   1 
ATOM   956   N  N     . SER A  1 123 ? 15.797  -17.443 32.703  1.00 40.33  ? 264 SER A N     1 
ATOM   957   C  CA    . SER A  1 123 ? 15.721  -18.243 33.925  1.00 43.01  ? 264 SER A CA    1 
ATOM   958   C  C     . SER A  1 123 ? 16.754  -19.369 33.972  1.00 43.37  ? 264 SER A C     1 
ATOM   959   O  O     . SER A  1 123 ? 17.371  -19.606 35.015  1.00 45.81  ? 264 SER A O     1 
ATOM   960   C  CB    . SER A  1 123 ? 14.313  -18.794 34.124  1.00 47.02  ? 264 SER A CB    1 
ATOM   961   O  OG    . SER A  1 123 ? 13.432  -17.766 34.530  1.00 50.19  ? 264 SER A OG    1 
ATOM   962   N  N     . LYS A  1 124 ? 16.939  -20.057 32.848  1.00 42.95  ? 265 LYS A N     1 
ATOM   963   C  CA    . LYS A  1 124 ? 17.982  -21.077 32.746  1.00 40.85  ? 265 LYS A CA    1 
ATOM   964   C  C     . LYS A  1 124 ? 19.373  -20.450 32.901  1.00 40.21  ? 265 LYS A C     1 
ATOM   965   O  O     . LYS A  1 124 ? 20.225  -20.959 33.644  1.00 46.13  ? 265 LYS A O     1 
ATOM   966   C  CB    . LYS A  1 124 ? 17.871  -21.809 31.410  1.00 39.03  ? 265 LYS A CB    1 
ATOM   967   C  CG    . LYS A  1 124 ? 18.869  -22.939 31.220  1.00 35.87  ? 265 LYS A CG    1 
ATOM   968   C  CD    . LYS A  1 124 ? 18.778  -23.940 32.350  1.00 36.62  ? 265 LYS A CD    1 
ATOM   969   C  CE    . LYS A  1 124 ? 19.381  -25.278 31.957  1.00 39.18  ? 265 LYS A CE    1 
ATOM   970   N  NZ    . LYS A  1 124 ? 18.605  -25.943 30.878  1.00 41.57  ? 265 LYS A NZ    1 
ATOM   971   N  N     . PHE A  1 125 ? 19.577  -19.338 32.199  1.00 32.19  ? 266 PHE A N     1 
ATOM   972   C  CA    . PHE A  1 125 ? 20.799  -18.547 32.279  1.00 27.27  ? 266 PHE A CA    1 
ATOM   973   C  C     . PHE A  1 125 ? 21.125  -18.242 33.732  1.00 28.07  ? 266 PHE A C     1 
ATOM   974   O  O     . PHE A  1 125 ? 22.248  -18.480 34.210  1.00 28.66  ? 266 PHE A O     1 
ATOM   975   C  CB    . PHE A  1 125 ? 20.563  -17.244 31.522  1.00 25.05  ? 266 PHE A CB    1 
ATOM   976   C  CG    . PHE A  1 125 ? 21.812  -16.479 31.205  1.00 28.52  ? 266 PHE A CG    1 
ATOM   977   C  CD1   . PHE A  1 125 ? 22.747  -16.986 30.318  1.00 24.82  ? 266 PHE A CD1   1 
ATOM   978   C  CD2   . PHE A  1 125 ? 22.030  -15.223 31.759  1.00 31.51  ? 266 PHE A CD2   1 
ATOM   979   C  CE1   . PHE A  1 125 ? 23.886  -16.270 30.013  1.00 25.17  ? 266 PHE A CE1   1 
ATOM   980   C  CE2   . PHE A  1 125 ? 23.171  -14.503 31.457  1.00 29.82  ? 266 PHE A CE2   1 
ATOM   981   C  CZ    . PHE A  1 125 ? 24.098  -15.027 30.585  1.00 28.28  ? 266 PHE A CZ    1 
ATOM   982   N  N     . ARG A  1 126 ? 20.114  -17.729 34.429  1.00 33.36  ? 267 ARG A N     1 
ATOM   983   C  CA    . ARG A  1 126 ? 20.223  -17.351 35.831  1.00 34.09  ? 267 ARG A CA    1 
ATOM   984   C  C     . ARG A  1 126 ? 20.560  -18.551 36.707  1.00 37.39  ? 267 ARG A C     1 
ATOM   985   O  O     . ARG A  1 126 ? 21.353  -18.440 37.647  1.00 39.40  ? 267 ARG A O     1 
ATOM   986   C  CB    . ARG A  1 126 ? 18.914  -16.707 36.301  1.00 34.22  ? 267 ARG A CB    1 
ATOM   987   C  CG    . ARG A  1 126 ? 19.003  -16.032 37.658  1.00 34.63  ? 267 ARG A CG    1 
ATOM   988   C  CD    . ARG A  1 126 ? 17.752  -15.226 37.996  1.00 34.42  ? 267 ARG A CD    1 
ATOM   989   N  NE    . ARG A  1 126 ? 17.990  -14.396 39.173  1.00 37.73  ? 267 ARG A NE    1 
ATOM   990   C  CZ    . ARG A  1 126 ? 18.335  -13.113 39.123  1.00 36.51  ? 267 ARG A CZ    1 
ATOM   991   N  NH1   . ARG A  1 126 ? 18.464  -12.500 37.953  1.00 30.32  ? 267 ARG A NH1   1 
ATOM   992   N  NH2   . ARG A  1 126 ? 18.545  -12.438 40.243  1.00 37.90  ? 267 ARG A NH2   1 
ATOM   993   N  N     . LYS A  1 127 ? 19.958  -19.694 36.390  1.00 38.98  ? 268 LYS A N     1 
ATOM   994   C  CA    . LYS A  1 127 ? 20.179  -20.918 37.155  1.00 40.07  ? 268 LYS A CA    1 
ATOM   995   C  C     . LYS A  1 127 ? 21.639  -21.369 37.059  1.00 38.14  ? 268 LYS A C     1 
ATOM   996   O  O     . LYS A  1 127 ? 22.278  -21.667 38.080  1.00 37.91  ? 268 LYS A O     1 
ATOM   997   C  CB    . LYS A  1 127 ? 19.237  -22.022 36.662  1.00 42.52  ? 268 LYS A CB    1 
ATOM   998   C  CG    . LYS A  1 127 ? 19.047  -23.162 37.652  1.00 45.45  ? 268 LYS A CG    1 
ATOM   999   C  CD    . LYS A  1 127 ? 18.209  -24.291 37.069  1.00 48.71  ? 268 LYS A CD    1 
ATOM   1000  C  CE    . LYS A  1 127 ? 18.047  -25.433 38.073  1.00 53.87  ? 268 LYS A CE    1 
ATOM   1001  N  NZ    . LYS A  1 127 ? 19.353  -25.903 38.619  1.00 54.46  ? 268 LYS A NZ    1 
ATOM   1002  N  N     . ILE A  1 128 ? 22.162  -21.402 35.833  1.00 37.07  ? 269 ILE A N     1 
ATOM   1003  C  CA    . ILE A  1 128 ? 23.561  -21.772 35.599  1.00 33.50  ? 269 ILE A CA    1 
ATOM   1004  C  C     . ILE A  1 128 ? 24.533  -20.810 36.286  1.00 33.01  ? 269 ILE A C     1 
ATOM   1005  O  O     . ILE A  1 128 ? 25.498  -21.238 36.928  1.00 32.51  ? 269 ILE A O     1 
ATOM   1006  C  CB    . ILE A  1 128 ? 23.890  -21.832 34.098  1.00 34.78  ? 269 ILE A CB    1 
ATOM   1007  C  CG1   . ILE A  1 128 ? 22.989  -22.830 33.382  1.00 32.11  ? 269 ILE A CG1   1 
ATOM   1008  C  CG2   . ILE A  1 128 ? 25.343  -22.207 33.882  1.00 40.14  ? 269 ILE A CG2   1 
ATOM   1009  C  CD1   . ILE A  1 128 ? 23.284  -22.950 31.904  1.00 33.09  ? 269 ILE A CD1   1 
ATOM   1010  N  N     . ILE A  1 129 ? 24.280  -19.511 36.141  1.00 37.30  ? 270 ILE A N     1 
ATOM   1011  C  CA    . ILE A  1 129 ? 25.087  -18.518 36.843  1.00 38.09  ? 270 ILE A CA    1 
ATOM   1012  C  C     . ILE A  1 129 ? 25.082  -18.730 38.364  1.00 40.90  ? 270 ILE A C     1 
ATOM   1013  O  O     . ILE A  1 129 ? 26.137  -18.700 38.984  1.00 51.73  ? 270 ILE A O     1 
ATOM   1014  C  CB    . ILE A  1 129 ? 24.659  -17.083 36.498  1.00 37.40  ? 270 ILE A CB    1 
ATOM   1015  C  CG1   . ILE A  1 129 ? 24.949  -16.787 35.029  1.00 38.43  ? 270 ILE A CG1   1 
ATOM   1016  C  CG2   . ILE A  1 129 ? 25.378  -16.081 37.381  1.00 33.87  ? 270 ILE A CG2   1 
ATOM   1017  C  CD1   . ILE A  1 129 ? 24.666  -15.354 34.619  1.00 39.93  ? 270 ILE A CD1   1 
ATOM   1018  N  N     . LYS A  1 130 ? 23.909  -18.948 38.957  1.00 39.01  ? 271 LYS A N     1 
ATOM   1019  C  CA    . LYS A  1 130 ? 23.809  -19.208 40.398  1.00 42.96  ? 271 LYS A CA    1 
ATOM   1020  C  C     . LYS A  1 130 ? 24.642  -20.416 40.808  1.00 44.33  ? 271 LYS A C     1 
ATOM   1021  O  O     . LYS A  1 130 ? 25.453  -20.346 41.745  1.00 46.11  ? 271 LYS A O     1 
ATOM   1022  C  CB    . LYS A  1 130 ? 22.358  -19.467 40.800  1.00 45.23  ? 271 LYS A CB    1 
ATOM   1023  C  CG    . LYS A  1 130 ? 21.525  -18.222 41.102  1.00 45.73  ? 271 LYS A CG    1 
ATOM   1024  C  CD    . LYS A  1 130 ? 20.089  -18.613 41.443  1.00 41.05  ? 271 LYS A CD    1 
ATOM   1025  C  CE    . LYS A  1 130 ? 19.241  -17.398 41.753  1.00 39.58  ? 271 LYS A CE    1 
ATOM   1026  N  NZ    . LYS A  1 130 ? 17.796  -17.743 41.872  1.00 40.61  ? 271 LYS A NZ    1 
ATOM   1027  N  N     . GLU A  1 131 ? 24.421  -21.525 40.104  1.00 44.15  ? 272 GLU A N     1 
ATOM   1028  C  CA    . GLU A  1 131 ? 25.154  -22.761 40.358  1.00 41.49  ? 272 GLU A CA    1 
ATOM   1029  C  C     . GLU A  1 131 ? 26.665  -22.565 40.307  1.00 40.71  ? 272 GLU A C     1 
ATOM   1030  O  O     . GLU A  1 131 ? 27.379  -23.028 41.195  1.00 45.54  ? 272 GLU A O     1 
ATOM   1031  C  CB    . GLU A  1 131 ? 24.749  -23.842 39.359  1.00 41.26  ? 272 GLU A CB    1 
ATOM   1032  C  CG    . GLU A  1 131 ? 23.386  -24.476 39.591  1.00 41.24  ? 272 GLU A CG    1 
ATOM   1033  C  CD    . GLU A  1 131 ? 23.190  -25.706 38.721  1.00 42.78  ? 272 GLU A CD    1 
ATOM   1034  O  OE1   . GLU A  1 131 ? 24.201  -26.226 38.203  1.00 44.87  ? 272 GLU A OE1   1 
ATOM   1035  O  OE2   . GLU A  1 131 ? 22.037  -26.154 38.555  1.00 41.14  ? 272 GLU A OE2   1 
ATOM   1036  N  N     . GLU A  1 132 ? 27.156  -21.878 39.277  1.00 39.53  ? 273 GLU A N     1 
ATOM   1037  C  CA    . GLU A  1 132 ? 28.600  -21.647 39.160  1.00 37.67  ? 273 GLU A CA    1 
ATOM   1038  C  C     . GLU A  1 132 ? 29.130  -20.681 40.223  1.00 37.14  ? 273 GLU A C     1 
ATOM   1039  O  O     . GLU A  1 132 ? 30.238  -20.852 40.730  1.00 40.31  ? 273 GLU A O     1 
ATOM   1040  C  CB    . GLU A  1 132 ? 28.967  -21.156 37.758  1.00 38.62  ? 273 GLU A CB    1 
ATOM   1041  C  CG    . GLU A  1 132 ? 30.467  -21.031 37.514  1.00 43.36  ? 273 GLU A CG    1 
ATOM   1042  C  CD    . GLU A  1 132 ? 31.198  -22.356 37.622  1.00 47.33  ? 273 GLU A CD    1 
ATOM   1043  O  OE1   . GLU A  1 132 ? 30.559  -23.406 37.412  1.00 48.93  ? 273 GLU A OE1   1 
ATOM   1044  O  OE2   . GLU A  1 132 ? 32.415  -22.348 37.910  1.00 48.38  ? 273 GLU A OE2   1 
ATOM   1045  N  N     . VAL A  1 133 ? 28.326  -19.679 40.564  1.00 37.31  ? 274 VAL A N     1 
ATOM   1046  C  CA    . VAL A  1 133 ? 28.687  -18.693 41.582  1.00 38.95  ? 274 VAL A CA    1 
ATOM   1047  C  C     . VAL A  1 133 ? 28.853  -19.354 42.951  1.00 44.52  ? 274 VAL A C     1 
ATOM   1048  O  O     . VAL A  1 133 ? 29.722  -18.964 43.736  1.00 49.36  ? 274 VAL A O     1 
ATOM   1049  C  CB    . VAL A  1 133 ? 27.658  -17.529 41.621  1.00 28.47  ? 274 VAL A CB    1 
ATOM   1050  C  CG1   . VAL A  1 133 ? 27.685  -16.794 42.945  1.00 27.41  ? 274 VAL A CG1   1 
ATOM   1051  C  CG2   . VAL A  1 133 ? 27.922  -16.555 40.486  1.00 26.03  ? 274 VAL A CG2   1 
ATOM   1052  N  N     . LYS A  1 134 ? 28.029  -20.366 43.222  1.00 46.50  ? 275 LYS A N     1 
ATOM   1053  C  CA    . LYS A  1 134 ? 28.149  -21.149 44.451  1.00 47.62  ? 275 LYS A CA    1 
ATOM   1054  C  C     . LYS A  1 134 ? 29.528  -21.785 44.619  1.00 45.51  ? 275 LYS A C     1 
ATOM   1055  O  O     . LYS A  1 134 ? 29.971  -22.015 45.746  1.00 48.45  ? 275 LYS A O     1 
ATOM   1056  C  CB    . LYS A  1 134 ? 27.113  -22.266 44.472  1.00 53.50  ? 275 LYS A CB    1 
ATOM   1057  C  CG    . LYS A  1 134 ? 25.701  -21.843 44.813  1.00 57.91  ? 275 LYS A CG    1 
ATOM   1058  C  CD    . LYS A  1 134 ? 24.818  -23.076 44.933  1.00 61.25  ? 275 LYS A CD    1 
ATOM   1059  C  CE    . LYS A  1 134 ? 23.380  -22.711 45.255  1.00 68.19  ? 275 LYS A CE    1 
ATOM   1060  N  NZ    . LYS A  1 134 ? 22.554  -23.925 45.538  1.00 72.53  ? 275 LYS A NZ    1 
ATOM   1061  N  N     . GLU A  1 135 ? 30.190  -22.086 43.502  1.00 39.04  ? 276 GLU A N     1 
ATOM   1062  C  CA    . GLU A  1 135 ? 31.469  -22.799 43.529  1.00 36.48  ? 276 GLU A CA    1 
ATOM   1063  C  C     . GLU A  1 135 ? 32.677  -21.878 43.657  1.00 36.42  ? 276 GLU A C     1 
ATOM   1064  O  O     . GLU A  1 135 ? 33.786  -22.336 43.925  1.00 36.60  ? 276 GLU A O     1 
ATOM   1065  C  CB    . GLU A  1 135 ? 31.623  -23.685 42.293  1.00 36.18  ? 276 GLU A CB    1 
ATOM   1066  C  CG    . GLU A  1 135 ? 30.544  -24.750 42.150  1.00 39.88  ? 276 GLU A CG    1 
ATOM   1067  C  CD    . GLU A  1 135 ? 30.424  -25.646 43.373  1.00 45.56  ? 276 GLU A CD    1 
ATOM   1068  O  OE1   . GLU A  1 135 ? 31.461  -25.940 44.006  1.00 48.16  ? 276 GLU A OE1   1 
ATOM   1069  O  OE2   . GLU A  1 135 ? 29.287  -26.055 43.701  1.00 44.94  ? 276 GLU A OE2   1 
ATOM   1070  N  N     . ILE A  1 136 ? 32.459  -20.582 43.465  1.00 37.07  ? 277 ILE A N     1 
ATOM   1071  C  CA    . ILE A  1 136 ? 33.515  -19.600 43.650  1.00 38.11  ? 277 ILE A CA    1 
ATOM   1072  C  C     . ILE A  1 136 ? 33.795  -19.436 45.144  1.00 46.01  ? 277 ILE A C     1 
ATOM   1073  O  O     . ILE A  1 136 ? 32.960  -18.903 45.878  1.00 48.65  ? 277 ILE A O     1 
ATOM   1074  C  CB    . ILE A  1 136 ? 33.130  -18.249 43.025  1.00 37.47  ? 277 ILE A CB    1 
ATOM   1075  C  CG1   . ILE A  1 136 ? 32.911  -18.406 41.519  1.00 34.44  ? 277 ILE A CG1   1 
ATOM   1076  C  CG2   . ILE A  1 136 ? 34.209  -17.226 43.285  1.00 39.03  ? 277 ILE A CG2   1 
ATOM   1077  C  CD1   . ILE A  1 136 ? 32.504  -17.124 40.806  1.00 28.51  ? 277 ILE A CD1   1 
ATOM   1078  N  N     . LYS A  1 137 ? 34.966  -19.896 45.589  1.00 49.64  ? 278 LYS A N     1 
ATOM   1079  C  CA    . LYS A  1 137 ? 35.303  -19.909 47.014  1.00 46.59  ? 278 LYS A CA    1 
ATOM   1080  C  C     . LYS A  1 137 ? 36.314  -18.832 47.412  1.00 43.64  ? 278 LYS A C     1 
ATOM   1081  O  O     . LYS A  1 137 ? 36.470  -18.533 48.598  1.00 44.81  ? 278 LYS A O     1 
ATOM   1082  C  CB    . LYS A  1 137 ? 35.835  -21.286 47.420  1.00 44.78  ? 278 LYS A CB    1 
ATOM   1083  C  CG    . LYS A  1 137 ? 34.901  -22.447 47.109  1.00 43.74  ? 278 LYS A CG    1 
ATOM   1084  C  CD    . LYS A  1 137 ? 33.604  -22.342 47.898  1.00 43.36  ? 278 LYS A CD    1 
ATOM   1085  C  CE    . LYS A  1 137 ? 32.634  -23.448 47.518  1.00 42.11  ? 278 LYS A CE    1 
ATOM   1086  N  NZ    . LYS A  1 137 ? 31.409  -23.405 48.360  1.00 43.45  ? 278 LYS A NZ    1 
ATOM   1087  N  N     . ASP A  1 138 ? 36.990  -18.249 46.424  1.00 43.02  ? 279 ASP A N     1 
ATOM   1088  C  CA    . ASP A  1 138 ? 38.041  -17.266 46.694  1.00 42.45  ? 279 ASP A CA    1 
ATOM   1089  C  C     . ASP A  1 138 ? 37.548  -15.817 46.657  1.00 40.57  ? 279 ASP A C     1 
ATOM   1090  O  O     . ASP A  1 138 ? 38.313  -14.883 46.919  1.00 39.64  ? 279 ASP A O     1 
ATOM   1091  C  CB    . ASP A  1 138 ? 39.226  -17.458 45.737  1.00 39.77  ? 279 ASP A CB    1 
ATOM   1092  C  CG    . ASP A  1 138 ? 38.795  -17.595 44.288  1.00 38.03  ? 279 ASP A CG    1 
ATOM   1093  O  OD1   . ASP A  1 138 ? 37.586  -17.782 44.035  1.00 37.06  ? 279 ASP A OD1   1 
ATOM   1094  O  OD2   . ASP A  1 138 ? 39.669  -17.536 43.400  1.00 37.31  ? 279 ASP A OD2   1 
ATOM   1095  N  N     . ILE A  1 139 ? 36.270  -15.637 46.342  1.00 39.18  ? 280 ILE A N     1 
ATOM   1096  C  CA    . ILE A  1 139 ? 35.675  -14.308 46.261  1.00 38.02  ? 280 ILE A CA    1 
ATOM   1097  C  C     . ILE A  1 139 ? 34.280  -14.309 46.897  1.00 38.68  ? 280 ILE A C     1 
ATOM   1098  O  O     . ILE A  1 139 ? 33.536  -15.284 46.758  1.00 40.20  ? 280 ILE A O     1 
ATOM   1099  C  CB    . ILE A  1 139 ? 35.598  -13.834 44.790  1.00 38.67  ? 280 ILE A CB    1 
ATOM   1100  C  CG1   . ILE A  1 139 ? 37.004  -13.640 44.214  1.00 32.30  ? 280 ILE A CG1   1 
ATOM   1101  C  CG2   . ILE A  1 139 ? 34.820  -12.537 44.679  1.00 39.34  ? 280 ILE A CG2   1 
ATOM   1102  C  CD1   . ILE A  1 139 ? 37.083  -13.736 42.709  1.00 27.81  ? 280 ILE A CD1   1 
ATOM   1103  N  N     . ASP A  1 140 ? 33.941  -13.231 47.605  1.00 38.92  ? 281 ASP A N     1 
ATOM   1104  C  CA    . ASP A  1 140 ? 32.609  -13.059 48.179  1.00 39.19  ? 281 ASP A CA    1 
ATOM   1105  C  C     . ASP A  1 140 ? 31.667  -12.552 47.089  1.00 38.31  ? 281 ASP A C     1 
ATOM   1106  O  O     . ASP A  1 140 ? 31.597  -11.347 46.833  1.00 37.90  ? 281 ASP A O     1 
ATOM   1107  C  CB    . ASP A  1 140 ? 32.671  -12.069 49.353  1.00 41.85  ? 281 ASP A CB    1 
ATOM   1108  C  CG    . ASP A  1 140 ? 31.421  -12.089 50.225  1.00 43.36  ? 281 ASP A CG    1 
ATOM   1109  O  OD1   . ASP A  1 140 ? 30.308  -12.328 49.712  1.00 44.59  ? 281 ASP A OD1   1 
ATOM   1110  O  OD2   . ASP A  1 140 ? 31.559  -11.842 51.438  1.00 45.04  ? 281 ASP A OD2   1 
ATOM   1111  N  N     . VAL A  1 141 ? 30.955  -13.472 46.439  1.00 38.26  ? 282 VAL A N     1 
ATOM   1112  C  CA    . VAL A  1 141 ? 30.040  -13.098 45.362  1.00 36.38  ? 282 VAL A CA    1 
ATOM   1113  C  C     . VAL A  1 141 ? 28.668  -13.762 45.510  1.00 39.35  ? 282 VAL A C     1 
ATOM   1114  O  O     . VAL A  1 141 ? 28.568  -14.973 45.721  1.00 39.01  ? 282 VAL A O     1 
ATOM   1115  C  CB    . VAL A  1 141 ? 30.656  -13.371 43.959  1.00 45.01  ? 282 VAL A CB    1 
ATOM   1116  C  CG1   . VAL A  1 141 ? 31.032  -14.837 43.799  1.00 47.62  ? 282 VAL A CG1   1 
ATOM   1117  C  CG2   . VAL A  1 141 ? 29.712  -12.925 42.849  1.00 42.38  ? 282 VAL A CG2   1 
ATOM   1118  N  N     . SER A  1 142 ? 27.614  -12.951 45.429  1.00 42.06  ? 283 SER A N     1 
ATOM   1119  C  CA    . SER A  1 142 ? 26.248  -13.463 45.473  1.00 39.09  ? 283 SER A CA    1 
ATOM   1120  C  C     . SER A  1 142 ? 25.505  -13.004 44.226  1.00 39.02  ? 283 SER A C     1 
ATOM   1121  O  O     . SER A  1 142 ? 26.042  -12.238 43.426  1.00 40.38  ? 283 SER A O     1 
ATOM   1122  C  CB    . SER A  1 142 ? 25.523  -12.981 46.730  1.00 36.81  ? 283 SER A CB    1 
ATOM   1123  O  OG    . SER A  1 142 ? 25.124  -11.628 46.614  1.00 38.73  ? 283 SER A OG    1 
ATOM   1124  N  N     . VAL A  1 143 ? 24.276  -13.478 44.051  1.00 39.15  ? 284 VAL A N     1 
ATOM   1125  C  CA    . VAL A  1 143 ? 23.470  -13.077 42.901  1.00 37.44  ? 284 VAL A CA    1 
ATOM   1126  C  C     . VAL A  1 143 ? 22.325  -12.169 43.341  1.00 36.41  ? 284 VAL A C     1 
ATOM   1127  O  O     . VAL A  1 143 ? 21.541  -12.535 44.218  1.00 35.66  ? 284 VAL A O     1 
ATOM   1128  C  CB    . VAL A  1 143 ? 22.903  -14.294 42.167  1.00 33.91  ? 284 VAL A CB    1 
ATOM   1129  C  CG1   . VAL A  1 143 ? 22.223  -13.861 40.888  1.00 35.20  ? 284 VAL A CG1   1 
ATOM   1130  C  CG2   . VAL A  1 143 ? 24.011  -15.282 41.868  1.00 30.15  ? 284 VAL A CG2   1 
ATOM   1131  N  N     . GLU A  1 144 ? 22.232  -10.987 42.738  1.00 37.68  ? 285 GLU A N     1 
ATOM   1132  C  CA    . GLU A  1 144 ? 21.206  -10.022 43.118  1.00 40.02  ? 285 GLU A CA    1 
ATOM   1133  C  C     . GLU A  1 144 ? 19.810  -10.515 42.733  1.00 41.55  ? 285 GLU A C     1 
ATOM   1134  O  O     . GLU A  1 144 ? 19.644  -11.183 41.711  1.00 43.97  ? 285 GLU A O     1 
ATOM   1135  C  CB    . GLU A  1 144 ? 21.482  -8.675  42.453  1.00 41.21  ? 285 GLU A CB    1 
ATOM   1136  C  CG    . GLU A  1 144 ? 20.852  -7.482  43.163  1.00 42.62  ? 285 GLU A CG    1 
ATOM   1137  C  CD    . GLU A  1 144 ? 20.737  -6.264  42.267  1.00 47.36  ? 285 GLU A CD    1 
ATOM   1138  O  OE1   . GLU A  1 144 ? 20.611  -6.432  41.036  1.00 49.44  ? 285 GLU A OE1   1 
ATOM   1139  O  OE2   . GLU A  1 144 ? 20.764  -5.137  42.797  1.00 48.79  ? 285 GLU A OE2   1 
ATOM   1140  N  N     . LYS A  1 145 ? 18.818  -10.186 43.558  1.00 40.33  ? 286 LYS A N     1 
ATOM   1141  C  CA    . LYS A  1 145 ? 17.426  -10.548 43.303  1.00 40.04  ? 286 LYS A CA    1 
ATOM   1142  C  C     . LYS A  1 145 ? 16.965  -9.964  41.972  1.00 44.56  ? 286 LYS A C     1 
ATOM   1143  O  O     . LYS A  1 145 ? 17.379  -8.869  41.595  1.00 45.20  ? 286 LYS A O     1 
ATOM   1144  C  CB    . LYS A  1 145 ? 16.546  -10.036 44.444  1.00 35.04  ? 286 LYS A CB    1 
ATOM   1145  C  CG    . LYS A  1 145 ? 15.049  -10.277 44.277  1.00 34.53  ? 286 LYS A CG    1 
ATOM   1146  C  CD    . LYS A  1 145 ? 14.283  -9.595  45.411  1.00 38.12  ? 286 LYS A CD    1 
ATOM   1147  C  CE    . LYS A  1 145 ? 12.778  -9.780  45.275  1.00 43.99  ? 286 LYS A CE    1 
ATOM   1148  N  NZ    . LYS A  1 145 ? 12.023  -9.101  46.369  1.00 47.40  ? 286 LYS A NZ    1 
ATOM   1149  N  N     . GLU A  1 146 ? 16.116  -10.698 41.259  1.00 45.52  ? 287 GLU A N     1 
ATOM   1150  C  CA    . GLU A  1 146 ? 15.708  -10.298 39.917  1.00 46.34  ? 287 GLU A CA    1 
ATOM   1151  C  C     . GLU A  1 146 ? 14.930  -8.988  39.908  1.00 48.99  ? 287 GLU A C     1 
ATOM   1152  O  O     . GLU A  1 146 ? 13.876  -8.877  40.534  1.00 54.14  ? 287 GLU A O     1 
ATOM   1153  C  CB    . GLU A  1 146 ? 14.873  -11.396 39.259  1.00 46.01  ? 287 GLU A CB    1 
ATOM   1154  C  CG    . GLU A  1 146 ? 14.508  -11.106 37.814  1.00 47.98  ? 287 GLU A CG    1 
ATOM   1155  C  CD    . GLU A  1 146 ? 13.677  -12.210 37.197  1.00 54.14  ? 287 GLU A CD    1 
ATOM   1156  O  OE1   . GLU A  1 146 ? 12.734  -12.688 37.860  1.00 60.59  ? 287 GLU A OE1   1 
ATOM   1157  O  OE2   . GLU A  1 146 ? 13.967  -12.598 36.048  1.00 53.08  ? 287 GLU A OE2   1 
ATOM   1158  N  N     . LYS A  1 147 ? 15.457  -8.002  39.190  1.00 45.96  ? 288 LYS A N     1 
ATOM   1159  C  CA    . LYS A  1 147 ? 14.778  -6.724  39.038  1.00 47.17  ? 288 LYS A CA    1 
ATOM   1160  C  C     . LYS A  1 147 ? 13.919  -6.732  37.780  1.00 47.71  ? 288 LYS A C     1 
ATOM   1161  O  O     . LYS A  1 147 ? 14.376  -7.146  36.714  1.00 47.05  ? 288 LYS A O     1 
ATOM   1162  C  CB    . LYS A  1 147 ? 15.783  -5.571  38.983  1.00 47.73  ? 288 LYS A CB    1 
ATOM   1163  C  CG    . LYS A  1 147 ? 16.506  -5.314  40.298  1.00 54.17  ? 288 LYS A CG    1 
ATOM   1164  C  CD    . LYS A  1 147 ? 17.353  -4.045  40.223  1.00 59.85  ? 288 LYS A CD    1 
ATOM   1165  C  CE    . LYS A  1 147 ? 18.011  -3.728  41.564  1.00 63.01  ? 288 LYS A CE    1 
ATOM   1166  N  NZ    . LYS A  1 147 ? 18.819  -2.474  41.519  1.00 63.90  ? 288 LYS A NZ    1 
ATOM   1167  N  N     . PRO A  1 148 ? 12.663  -6.274  37.902  1.00 45.21  ? 289 PRO A N     1 
ATOM   1168  C  CA    . PRO A  1 148 ? 11.791  -6.197  36.727  1.00 41.02  ? 289 PRO A CA    1 
ATOM   1169  C  C     . PRO A  1 148 ? 12.342  -5.180  35.745  1.00 39.47  ? 289 PRO A C     1 
ATOM   1170  O  O     . PRO A  1 148 ? 12.910  -4.170  36.162  1.00 41.82  ? 289 PRO A O     1 
ATOM   1171  C  CB    . PRO A  1 148 ? 10.460  -5.709  37.307  1.00 39.69  ? 289 PRO A CB    1 
ATOM   1172  C  CG    . PRO A  1 148 ? 10.821  -5.006  38.574  1.00 41.99  ? 289 PRO A CG    1 
ATOM   1173  C  CD    . PRO A  1 148 ? 12.007  -5.759  39.118  1.00 44.84  ? 289 PRO A CD    1 
ATOM   1174  N  N     . GLY A  1 149 ? 12.197  -5.451  34.455  1.00 35.91  ? 290 GLY A N     1 
ATOM   1175  C  CA    . GLY A  1 149 ? 12.761  -4.572  33.451  1.00 37.03  ? 290 GLY A CA    1 
ATOM   1176  C  C     . GLY A  1 149 ? 14.189  -4.932  33.086  1.00 37.85  ? 290 GLY A C     1 
ATOM   1177  O  O     . GLY A  1 149 ? 14.639  -4.641  31.976  1.00 38.75  ? 290 GLY A O     1 
ATOM   1178  N  N     . SER A  1 150 ? 14.899  -5.570  34.013  1.00 37.98  ? 291 SER A N     1 
ATOM   1179  C  CA    . SER A  1 150 ? 16.305  -5.911  33.802  1.00 37.14  ? 291 SER A CA    1 
ATOM   1180  C  C     . SER A  1 150 ? 16.481  -7.075  32.840  1.00 35.23  ? 291 SER A C     1 
ATOM   1181  O  O     . SER A  1 150 ? 15.716  -8.033  32.873  1.00 33.95  ? 291 SER A O     1 
ATOM   1182  C  CB    . SER A  1 150 ? 16.979  -6.245  35.127  1.00 35.81  ? 291 SER A CB    1 
ATOM   1183  O  OG    . SER A  1 150 ? 18.359  -6.481  34.943  1.00 34.04  ? 291 SER A OG    1 
ATOM   1184  N  N     . PRO A  1 151 ? 17.488  -6.977  31.960  1.00 36.99  ? 292 PRO A N     1 
ATOM   1185  C  CA    . PRO A  1 151 ? 17.845  -8.029  31.011  1.00 38.51  ? 292 PRO A CA    1 
ATOM   1186  C  C     . PRO A  1 151 ? 19.082  -8.763  31.490  1.00 36.49  ? 292 PRO A C     1 
ATOM   1187  O  O     . PRO A  1 151 ? 19.644  -9.568  30.746  1.00 39.55  ? 292 PRO A O     1 
ATOM   1188  C  CB    . PRO A  1 151 ? 18.214  -7.226  29.771  1.00 39.64  ? 292 PRO A CB    1 
ATOM   1189  C  CG    . PRO A  1 151 ? 18.905  -6.011  30.350  1.00 38.67  ? 292 PRO A CG    1 
ATOM   1190  C  CD    . PRO A  1 151 ? 18.208  -5.722  31.666  1.00 37.32  ? 292 PRO A CD    1 
ATOM   1191  N  N     . ALA A  1 152 ? 19.497  -8.490  32.722  1.00 34.02  ? 293 ALA A N     1 
ATOM   1192  C  CA    . ALA A  1 152 ? 20.767  -8.998  33.225  1.00 30.04  ? 293 ALA A CA    1 
ATOM   1193  C  C     . ALA A  1 152 ? 20.606  -9.875  34.457  1.00 33.94  ? 293 ALA A C     1 
ATOM   1194  O  O     . ALA A  1 152 ? 19.593  -9.818  35.157  1.00 36.62  ? 293 ALA A O     1 
ATOM   1195  C  CB    . ALA A  1 152 ? 21.703  -7.845  33.537  1.00 26.78  ? 293 ALA A CB    1 
ATOM   1196  N  N     . VAL A  1 153 ? 21.621  -10.693 34.709  1.00 34.15  ? 294 VAL A N     1 
ATOM   1197  C  CA    . VAL A  1 153 ? 21.780  -11.357 35.992  1.00 31.82  ? 294 VAL A CA    1 
ATOM   1198  C  C     . VAL A  1 153 ? 22.867  -10.569 36.719  1.00 30.49  ? 294 VAL A C     1 
ATOM   1199  O  O     . VAL A  1 153 ? 24.024  -10.554 36.288  1.00 33.15  ? 294 VAL A O     1 
ATOM   1200  C  CB    . VAL A  1 153 ? 22.191  -12.831 35.819  1.00 28.29  ? 294 VAL A CB    1 
ATOM   1201  C  CG1   . VAL A  1 153 ? 22.348  -13.510 37.165  1.00 27.93  ? 294 VAL A CG1   1 
ATOM   1202  C  CG2   . VAL A  1 153 ? 21.163  -13.571 34.981  1.00 21.99  ? 294 VAL A CG2   1 
ATOM   1203  N  N     . THR A  1 154 ? 22.483  -9.885  37.795  1.00 27.73  ? 295 THR A N     1 
ATOM   1204  C  CA    . THR A  1 154 ? 23.396  -8.995  38.514  1.00 24.51  ? 295 THR A CA    1 
ATOM   1205  C  C     . THR A  1 154 ? 24.077  -9.689  39.693  1.00 30.75  ? 295 THR A C     1 
ATOM   1206  O  O     . THR A  1 154 ? 23.420  -10.323 40.520  1.00 35.27  ? 295 THR A O     1 
ATOM   1207  C  CB    . THR A  1 154 ? 22.667  -7.743  39.020  1.00 23.39  ? 295 THR A CB    1 
ATOM   1208  O  OG1   . THR A  1 154 ? 22.049  -7.066  37.918  1.00 25.08  ? 295 THR A OG1   1 
ATOM   1209  C  CG2   . THR A  1 154 ? 23.633  -6.795  39.706  1.00 22.75  ? 295 THR A CG2   1 
ATOM   1210  N  N     . LEU A  1 155 ? 25.398  -9.557  39.767  1.00 33.76  ? 296 LEU A N     1 
ATOM   1211  C  CA    . LEU A  1 155 ? 26.174  -10.165 40.835  1.00 30.76  ? 296 LEU A CA    1 
ATOM   1212  C  C     . LEU A  1 155 ? 26.652  -9.093  41.803  1.00 36.25  ? 296 LEU A C     1 
ATOM   1213  O  O     . LEU A  1 155 ? 27.067  -8.003  41.382  1.00 40.01  ? 296 LEU A O     1 
ATOM   1214  C  CB    . LEU A  1 155 ? 27.388  -10.886 40.260  1.00 31.86  ? 296 LEU A CB    1 
ATOM   1215  C  CG    . LEU A  1 155 ? 27.272  -11.596 38.912  1.00 31.66  ? 296 LEU A CG    1 
ATOM   1216  C  CD1   . LEU A  1 155 ? 28.622  -12.108 38.477  1.00 30.81  ? 296 LEU A CD1   1 
ATOM   1217  C  CD2   . LEU A  1 155 ? 26.294  -12.738 38.993  1.00 33.20  ? 296 LEU A CD2   1 
ATOM   1218  N  N     . LEU A  1 156 ? 26.593  -9.405  43.097  1.00 39.30  ? 297 LEU A N     1 
ATOM   1219  C  CA    . LEU A  1 156 ? 27.154  -8.539  44.129  1.00 40.16  ? 297 LEU A CA    1 
ATOM   1220  C  C     . LEU A  1 156 ? 28.484  -9.105  44.606  1.00 37.82  ? 297 LEU A C     1 
ATOM   1221  O  O     . LEU A  1 156 ? 28.537  -10.192 45.190  1.00 40.11  ? 297 LEU A O     1 
ATOM   1222  C  CB    . LEU A  1 156 ? 26.209  -8.411  45.325  1.00 47.12  ? 297 LEU A CB    1 
ATOM   1223  C  CG    . LEU A  1 156 ? 24.834  -7.768  45.145  1.00 52.23  ? 297 LEU A CG    1 
ATOM   1224  C  CD1   . LEU A  1 156 ? 23.758  -8.811  45.309  1.00 52.53  ? 297 LEU A CD1   1 
ATOM   1225  C  CD2   . LEU A  1 156 ? 24.618  -6.646  46.148  1.00 53.78  ? 297 LEU A CD2   1 
ATOM   1226  N  N     . ILE A  1 157 ? 29.555  -8.359  44.356  1.00 36.80  ? 298 ILE A N     1 
ATOM   1227  C  CA    . ILE A  1 157 ? 30.891  -8.755  44.773  1.00 35.09  ? 298 ILE A CA    1 
ATOM   1228  C  C     . ILE A  1 157 ? 31.321  -7.936  45.977  1.00 40.92  ? 298 ILE A C     1 
ATOM   1229  O  O     . ILE A  1 157 ? 31.169  -6.712  45.994  1.00 43.58  ? 298 ILE A O     1 
ATOM   1230  C  CB    . ILE A  1 157 ? 31.921  -8.562  43.639  1.00 29.31  ? 298 ILE A CB    1 
ATOM   1231  C  CG1   . ILE A  1 157 ? 31.594  -9.472  42.458  1.00 27.63  ? 298 ILE A CG1   1 
ATOM   1232  C  CG2   . ILE A  1 157 ? 33.333  -8.840  44.135  1.00 31.39  ? 298 ILE A CG2   1 
ATOM   1233  C  CD1   . ILE A  1 157 ? 32.549  -9.327  41.285  1.00 29.45  ? 298 ILE A CD1   1 
ATOM   1234  N  N     . ARG A  1 158 ? 31.848  -8.618  46.987  1.00 44.47  ? 299 ARG A N     1 
ATOM   1235  C  CA    . ARG A  1 158 ? 32.444  -7.936  48.124  1.00 48.95  ? 299 ARG A CA    1 
ATOM   1236  C  C     . ARG A  1 158 ? 33.955  -8.128  48.097  1.00 47.68  ? 299 ARG A C     1 
ATOM   1237  O  O     . ARG A  1 158 ? 34.498  -9.055  48.702  1.00 45.72  ? 299 ARG A O     1 
ATOM   1238  C  CB    . ARG A  1 158 ? 31.822  -8.413  49.436  1.00 52.38  ? 299 ARG A CB    1 
ATOM   1239  C  CG    . ARG A  1 158 ? 30.348  -8.045  49.551  1.00 52.83  ? 299 ARG A CG    1 
ATOM   1240  C  CD    . ARG A  1 158 ? 29.751  -8.507  50.861  1.00 56.64  ? 299 ARG A CD    1 
ATOM   1241  N  NE    . ARG A  1 158 ? 28.387  -8.018  51.027  1.00 62.02  ? 299 ARG A NE    1 
ATOM   1242  C  CZ    . ARG A  1 158 ? 27.652  -8.203  52.119  1.00 67.17  ? 299 ARG A CZ    1 
ATOM   1243  N  NH1   . ARG A  1 158 ? 28.150  -8.869  53.151  1.00 68.20  ? 299 ARG A NH1   1 
ATOM   1244  N  NH2   . ARG A  1 158 ? 26.418  -7.719  52.181  1.00 69.35  ? 299 ARG A NH2   1 
ATOM   1245  N  N     . ASN A  1 159 ? 34.614  -7.239  47.363  1.00 50.31  ? 300 ASN A N     1 
ATOM   1246  C  CA    . ASN A  1 159 ? 36.053  -7.259  47.167  1.00 49.91  ? 300 ASN A CA    1 
ATOM   1247  C  C     . ASN A  1 159 ? 36.593  -6.239  48.141  1.00 56.57  ? 300 ASN A C     1 
ATOM   1248  O  O     . ASN A  1 159 ? 37.254  -5.294  47.732  1.00 59.34  ? 300 ASN A O     1 
ATOM   1249  C  CB    . ASN A  1 159 ? 36.336  -6.805  45.733  1.00 45.40  ? 300 ASN A CB    1 
ATOM   1250  C  CG    . ASN A  1 159 ? 37.729  -7.150  45.260  1.00 41.00  ? 300 ASN A CG    1 
ATOM   1251  O  OD1   . ASN A  1 159 ? 38.485  -6.279  44.843  1.00 42.40  ? 300 ASN A OD1   1 
ATOM   1252  N  ND2   . ASN A  1 159 ? 38.068  -8.428  45.298  1.00 38.50  ? 300 ASN A ND2   1 
ATOM   1253  N  N     . PRO A  1 160 ? 36.419  -6.496  49.446  1.00 61.65  ? 301 PRO A N     1 
ATOM   1254  C  CA    . PRO A  1 160 ? 36.021  -5.528  50.467  1.00 57.58  ? 301 PRO A CA    1 
ATOM   1255  C  C     . PRO A  1 160 ? 34.978  -4.494  50.014  1.00 56.95  ? 301 PRO A C     1 
ATOM   1256  O  O     . PRO A  1 160 ? 33.904  -4.459  50.612  1.00 54.26  ? 301 PRO A O     1 
ATOM   1257  C  CB    . PRO A  1 160 ? 37.360  -4.923  50.875  1.00 56.52  ? 301 PRO A CB    1 
ATOM   1258  C  CG    . PRO A  1 160 ? 38.346  -6.158  50.721  1.00 70.67  ? 301 PRO A CG    1 
ATOM   1259  C  CD    . PRO A  1 160 ? 37.565  -7.256  49.961  1.00 67.94  ? 301 PRO A CD    1 
ATOM   1260  N  N     . GLU A  1 161 ? 35.263  -3.690  48.995  1.00 56.59  ? 302 GLU A N     1 
ATOM   1261  C  CA    . GLU A  1 161 ? 34.266  -2.756  48.480  1.00 52.88  ? 302 GLU A CA    1 
ATOM   1262  C  C     . GLU A  1 161 ? 33.163  -3.483  47.711  1.00 45.99  ? 302 GLU A C     1 
ATOM   1263  O  O     . GLU A  1 161 ? 33.362  -4.604  47.228  1.00 45.20  ? 302 GLU A O     1 
ATOM   1264  C  CB    . GLU A  1 161 ? 34.917  -1.678  47.608  1.00 57.51  ? 302 GLU A CB    1 
ATOM   1265  C  CG    . GLU A  1 161 ? 35.548  -2.183  46.318  1.00 63.98  ? 302 GLU A CG    1 
ATOM   1266  C  CD    . GLU A  1 161 ? 36.944  -2.740  46.518  1.00 65.86  ? 302 GLU A CD    1 
ATOM   1267  O  OE1   . GLU A  1 161 ? 37.490  -3.339  45.567  1.00 63.01  ? 302 GLU A OE1   1 
ATOM   1268  O  OE2   . GLU A  1 161 ? 37.497  -2.582  47.628  1.00 67.44  ? 302 GLU A OE2   1 
ATOM   1269  N  N     . GLU A  1 162 ? 31.994  -2.856  47.626  1.00 42.34  ? 303 GLU A N     1 
ATOM   1270  C  CA    . GLU A  1 162 ? 30.878  -3.433  46.884  1.00 44.55  ? 303 GLU A CA    1 
ATOM   1271  C  C     . GLU A  1 162 ? 30.981  -3.118  45.401  1.00 45.15  ? 303 GLU A C     1 
ATOM   1272  O  O     . GLU A  1 162 ? 30.990  -1.951  45.003  1.00 47.13  ? 303 GLU A O     1 
ATOM   1273  C  CB    . GLU A  1 162 ? 29.547  -2.906  47.403  1.00 47.44  ? 303 GLU A CB    1 
ATOM   1274  C  CG    . GLU A  1 162 ? 29.192  -3.355  48.804  1.00 49.77  ? 303 GLU A CG    1 
ATOM   1275  C  CD    . GLU A  1 162 ? 27.825  -2.868  49.215  1.00 50.83  ? 303 GLU A CD    1 
ATOM   1276  O  OE1   . GLU A  1 162 ? 27.670  -1.650  49.428  1.00 50.38  ? 303 GLU A OE1   1 
ATOM   1277  O  OE2   . GLU A  1 162 ? 26.902  -3.699  49.311  1.00 53.45  ? 303 GLU A OE2   1 
ATOM   1278  N  N     . ILE A  1 163 ? 31.039  -4.167  44.588  1.00 39.58  ? 304 ILE A N     1 
ATOM   1279  C  CA    . ILE A  1 163 ? 31.080  -4.022  43.141  1.00 32.70  ? 304 ILE A CA    1 
ATOM   1280  C  C     . ILE A  1 163 ? 29.875  -4.739  42.545  1.00 32.86  ? 304 ILE A C     1 
ATOM   1281  O  O     . ILE A  1 163 ? 29.555  -5.851  42.952  1.00 33.13  ? 304 ILE A O     1 
ATOM   1282  C  CB    . ILE A  1 163 ? 32.369  -4.633  42.581  1.00 29.88  ? 304 ILE A CB    1 
ATOM   1283  C  CG1   . ILE A  1 163 ? 33.587  -3.972  43.220  1.00 26.54  ? 304 ILE A CG1   1 
ATOM   1284  C  CG2   . ILE A  1 163 ? 32.433  -4.493  41.076  1.00 29.75  ? 304 ILE A CG2   1 
ATOM   1285  C  CD1   . ILE A  1 163 ? 34.851  -4.772  43.052  1.00 21.44  ? 304 ILE A CD1   1 
ATOM   1286  N  N     . SER A  1 164 ? 29.198  -4.102  41.594  1.00 35.78  ? 305 SER A N     1 
ATOM   1287  C  CA    . SER A  1 164 ? 28.042  -4.716  40.943  1.00 36.69  ? 305 SER A CA    1 
ATOM   1288  C  C     . SER A  1 164 ? 28.388  -5.122  39.511  1.00 34.24  ? 305 SER A C     1 
ATOM   1289  O  O     . SER A  1 164 ? 28.999  -4.341  38.773  1.00 34.95  ? 305 SER A O     1 
ATOM   1290  C  CB    . SER A  1 164 ? 26.849  -3.755  40.956  1.00 40.37  ? 305 SER A CB    1 
ATOM   1291  O  OG    . SER A  1 164 ? 25.780  -4.232  40.158  1.00 45.50  ? 305 SER A OG    1 
ATOM   1292  N  N     . VAL A  1 165 ? 28.014  -6.342  39.121  1.00 34.03  ? 306 VAL A N     1 
ATOM   1293  C  CA    . VAL A  1 165 ? 28.297  -6.825  37.762  1.00 33.00  ? 306 VAL A CA    1 
ATOM   1294  C  C     . VAL A  1 165 ? 27.041  -7.296  37.023  1.00 33.93  ? 306 VAL A C     1 
ATOM   1295  O  O     . VAL A  1 165 ? 26.447  -8.311  37.385  1.00 37.08  ? 306 VAL A O     1 
ATOM   1296  C  CB    . VAL A  1 165 ? 29.314  -7.981  37.772  1.00 29.48  ? 306 VAL A CB    1 
ATOM   1297  C  CG1   . VAL A  1 165 ? 29.661  -8.396  36.345  1.00 25.30  ? 306 VAL A CG1   1 
ATOM   1298  C  CG2   . VAL A  1 165 ? 30.562  -7.583  38.527  1.00 26.40  ? 306 VAL A CG2   1 
ATOM   1299  N  N     . ASP A  1 166 ? 26.643  -6.565  35.986  1.00 31.78  ? 307 ASP A N     1 
ATOM   1300  C  CA    . ASP A  1 166 ? 25.494  -6.960  35.179  1.00 29.22  ? 307 ASP A CA    1 
ATOM   1301  C  C     . ASP A  1 166 ? 25.910  -7.902  34.060  1.00 32.77  ? 307 ASP A C     1 
ATOM   1302  O  O     . ASP A  1 166 ? 26.614  -7.497  33.123  1.00 34.34  ? 307 ASP A O     1 
ATOM   1303  C  CB    . ASP A  1 166 ? 24.817  -5.736  34.568  1.00 30.29  ? 307 ASP A CB    1 
ATOM   1304  C  CG    . ASP A  1 166 ? 24.100  -4.886  35.594  1.00 36.46  ? 307 ASP A CG    1 
ATOM   1305  O  OD1   . ASP A  1 166 ? 24.361  -5.047  36.803  1.00 37.82  ? 307 ASP A OD1   1 
ATOM   1306  O  OD2   . ASP A  1 166 ? 23.281  -4.040  35.180  1.00 38.89  ? 307 ASP A OD2   1 
ATOM   1307  N  N     . ILE A  1 167 ? 25.485  -9.161  34.159  1.00 31.71  ? 308 ILE A N     1 
ATOM   1308  C  CA    . ILE A  1 167 ? 25.695  -10.111 33.070  1.00 28.23  ? 308 ILE A CA    1 
ATOM   1309  C  C     . ILE A  1 167 ? 24.457  -10.114 32.184  1.00 28.32  ? 308 ILE A C     1 
ATOM   1310  O  O     . ILE A  1 167 ? 23.475  -10.792 32.483  1.00 33.43  ? 308 ILE A O     1 
ATOM   1311  C  CB    . ILE A  1 167 ? 25.977  -11.539 33.576  1.00 31.18  ? 308 ILE A CB    1 
ATOM   1312  C  CG1   . ILE A  1 167 ? 27.154  -11.540 34.548  1.00 26.58  ? 308 ILE A CG1   1 
ATOM   1313  C  CG2   . ILE A  1 167 ? 26.255  -12.472 32.405  1.00 35.89  ? 308 ILE A CG2   1 
ATOM   1314  C  CD1   . ILE A  1 167 ? 28.493  -11.244 33.900  1.00 21.07  ? 308 ILE A CD1   1 
ATOM   1315  N  N     . ILE A  1 168 ? 24.512  -9.345  31.100  1.00 27.11  ? 309 ILE A N     1 
ATOM   1316  C  CA    . ILE A  1 168 ? 23.391  -9.186  30.177  1.00 25.47  ? 309 ILE A CA    1 
ATOM   1317  C  C     . ILE A  1 168 ? 23.337  -10.307 29.141  1.00 27.47  ? 309 ILE A C     1 
ATOM   1318  O  O     . ILE A  1 168 ? 24.286  -10.508 28.383  1.00 28.96  ? 309 ILE A O     1 
ATOM   1319  C  CB    . ILE A  1 168 ? 23.488  -7.837  29.438  1.00 24.60  ? 309 ILE A CB    1 
ATOM   1320  C  CG1   . ILE A  1 168 ? 23.752  -6.699  30.426  1.00 26.30  ? 309 ILE A CG1   1 
ATOM   1321  C  CG2   . ILE A  1 168 ? 22.231  -7.574  28.644  1.00 25.73  ? 309 ILE A CG2   1 
ATOM   1322  C  CD1   . ILE A  1 168 ? 24.523  -5.534  29.834  1.00 25.58  ? 309 ILE A CD1   1 
ATOM   1323  N  N     . LEU A  1 169 ? 22.221  -11.031 29.110  1.00 34.82  ? 310 LEU A N     1 
ATOM   1324  C  CA    . LEU A  1 169 ? 21.996  -12.057 28.092  1.00 34.21  ? 310 LEU A CA    1 
ATOM   1325  C  C     . LEU A  1 169 ? 21.584  -11.408 26.777  1.00 35.94  ? 310 LEU A C     1 
ATOM   1326  O  O     . LEU A  1 169 ? 20.635  -10.621 26.744  1.00 36.40  ? 310 LEU A O     1 
ATOM   1327  C  CB    . LEU A  1 169 ? 20.910  -13.034 28.549  1.00 31.39  ? 310 LEU A CB    1 
ATOM   1328  C  CG    . LEU A  1 169 ? 20.418  -14.087 27.553  1.00 29.25  ? 310 LEU A CG    1 
ATOM   1329  C  CD1   . LEU A  1 169 ? 21.537  -15.023 27.156  1.00 30.41  ? 310 LEU A CD1   1 
ATOM   1330  C  CD2   . LEU A  1 169 ? 19.254  -14.867 28.137  1.00 27.07  ? 310 LEU A CD2   1 
ATOM   1331  N  N     . ALA A  1 170 ? 22.289  -11.726 25.694  1.00 36.53  ? 311 ALA A N     1 
ATOM   1332  C  CA    . ALA A  1 170 ? 21.966  -11.107 24.407  1.00 36.18  ? 311 ALA A CA    1 
ATOM   1333  C  C     . ALA A  1 170 ? 21.902  -12.083 23.237  1.00 36.96  ? 311 ALA A C     1 
ATOM   1334  O  O     . ALA A  1 170 ? 22.582  -13.108 23.225  1.00 32.76  ? 311 ALA A O     1 
ATOM   1335  C  CB    . ALA A  1 170 ? 22.932  -9.970  24.100  1.00 30.55  ? 311 ALA A CB    1 
ATOM   1336  N  N     . LEU A  1 171 ? 21.069  -11.737 22.259  1.00 38.75  ? 312 LEU A N     1 
ATOM   1337  C  CA    . LEU A  1 171 ? 20.983  -12.445 20.992  1.00 36.71  ? 312 LEU A CA    1 
ATOM   1338  C  C     . LEU A  1 171 ? 21.646  -11.577 19.943  1.00 35.85  ? 312 LEU A C     1 
ATOM   1339  O  O     . LEU A  1 171 ? 21.289  -10.409 19.785  1.00 39.65  ? 312 LEU A O     1 
ATOM   1340  C  CB    . LEU A  1 171 ? 19.525  -12.669 20.594  1.00 35.24  ? 312 LEU A CB    1 
ATOM   1341  C  CG    . LEU A  1 171 ? 18.636  -13.520 21.495  1.00 41.21  ? 312 LEU A CG    1 
ATOM   1342  C  CD1   . LEU A  1 171 ? 17.270  -13.762 20.857  1.00 43.58  ? 312 LEU A CD1   1 
ATOM   1343  C  CD2   . LEU A  1 171 ? 19.324  -14.829 21.794  1.00 43.26  ? 312 LEU A CD2   1 
ATOM   1344  N  N     . GLU A  1 172 ? 22.610  -12.139 19.227  1.00 31.51  ? 313 GLU A N     1 
ATOM   1345  C  CA    . GLU A  1 172 ? 23.283  -11.397 18.174  1.00 28.22  ? 313 GLU A CA    1 
ATOM   1346  C  C     . GLU A  1 172 ? 22.723  -11.781 16.815  1.00 33.96  ? 313 GLU A C     1 
ATOM   1347  O  O     . GLU A  1 172 ? 22.682  -12.963 16.466  1.00 35.46  ? 313 GLU A O     1 
ATOM   1348  C  CB    . GLU A  1 172 ? 24.785  -11.673 18.207  1.00 27.01  ? 313 GLU A CB    1 
ATOM   1349  C  CG    . GLU A  1 172 ? 25.529  -11.239 16.957  1.00 27.95  ? 313 GLU A CG    1 
ATOM   1350  C  CD    . GLU A  1 172 ? 27.024  -11.456 17.064  1.00 32.77  ? 313 GLU A CD    1 
ATOM   1351  O  OE1   . GLU A  1 172 ? 27.555  -12.331 16.349  1.00 30.86  ? 313 GLU A OE1   1 
ATOM   1352  O  OE2   . GLU A  1 172 ? 27.670  -10.738 17.852  1.00 36.48  ? 313 GLU A OE2   1 
ATOM   1353  N  N     . SER A  1 173 ? 22.282  -10.791 16.045  1.00 36.10  ? 314 SER A N     1 
ATOM   1354  C  CA    . SER A  1 173 ? 21.901  -11.061 14.661  1.00 36.55  ? 314 SER A CA    1 
ATOM   1355  C  C     . SER A  1 173 ? 22.873  -10.344 13.728  1.00 35.13  ? 314 SER A C     1 
ATOM   1356  O  O     . SER A  1 173 ? 23.129  -9.150  13.895  1.00 32.23  ? 314 SER A O     1 
ATOM   1357  C  CB    . SER A  1 173 ? 20.458  -10.637 14.392  1.00 40.64  ? 314 SER A CB    1 
ATOM   1358  O  OG    . SER A  1 173 ? 20.017  -11.082 13.119  1.00 43.38  ? 314 SER A OG    1 
ATOM   1359  N  N     . LYS A  1 174 ? 23.422  -11.083 12.764  1.00 36.58  ? 315 LYS A N     1 
ATOM   1360  C  CA    . LYS A  1 174 ? 24.417  -10.542 11.838  1.00 33.07  ? 315 LYS A CA    1 
ATOM   1361  C  C     . LYS A  1 174 ? 23.800  -9.863  10.620  1.00 30.15  ? 315 LYS A C     1 
ATOM   1362  O  O     . LYS A  1 174 ? 24.493  -9.167  9.876   1.00 34.54  ? 315 LYS A O     1 
ATOM   1363  C  CB    . LYS A  1 174 ? 25.376  -11.639 11.382  1.00 33.21  ? 315 LYS A CB    1 
ATOM   1364  C  CG    . LYS A  1 174 ? 26.306  -12.127 12.473  1.00 35.13  ? 315 LYS A CG    1 
ATOM   1365  C  CD    . LYS A  1 174 ? 27.338  -13.101 11.930  1.00 38.25  ? 315 LYS A CD    1 
ATOM   1366  C  CE    . LYS A  1 174 ? 28.314  -13.522 13.023  1.00 40.34  ? 315 LYS A CE    1 
ATOM   1367  N  NZ    . LYS A  1 174 ? 29.304  -14.506 12.518  1.00 41.28  ? 315 LYS A NZ    1 
ATOM   1368  N  N     . GLY A  1 175 ? 22.501  -10.062 10.418  1.00 25.99  ? 316 GLY A N     1 
ATOM   1369  C  CA    . GLY A  1 175 ? 21.806  -9.433  9.309   1.00 25.54  ? 316 GLY A CA    1 
ATOM   1370  C  C     . GLY A  1 175 ? 21.714  -7.928  9.456   1.00 30.53  ? 316 GLY A C     1 
ATOM   1371  O  O     . GLY A  1 175 ? 22.184  -7.368  10.444  1.00 30.22  ? 316 GLY A O     1 
ATOM   1372  N  N     . SER A  1 176 ? 21.115  -7.268  8.468   1.00 39.61  ? 317 SER A N     1 
ATOM   1373  C  CA    . SER A  1 176 ? 20.931  -5.820  8.522   1.00 45.44  ? 317 SER A CA    1 
ATOM   1374  C  C     . SER A  1 176 ? 19.987  -5.400  9.657   1.00 48.91  ? 317 SER A C     1 
ATOM   1375  O  O     . SER A  1 176 ? 19.081  -6.145  10.040  1.00 50.32  ? 317 SER A O     1 
ATOM   1376  C  CB    . SER A  1 176 ? 20.420  -5.292  7.181   1.00 45.36  ? 317 SER A CB    1 
ATOM   1377  O  OG    . SER A  1 176 ? 19.155  -5.836  6.859   1.00 47.84  ? 317 SER A OG    1 
ATOM   1378  N  N     . TRP A  1 177 ? 20.223  -4.204  10.191  1.00 44.27  ? 318 TRP A N     1 
ATOM   1379  C  CA    . TRP A  1 177 ? 19.448  -3.662  11.301  1.00 38.82  ? 318 TRP A CA    1 
ATOM   1380  C  C     . TRP A  1 177 ? 17.987  -3.466  10.915  1.00 42.82  ? 318 TRP A C     1 
ATOM   1381  O  O     . TRP A  1 177 ? 17.683  -3.226  9.745   1.00 50.07  ? 318 TRP A O     1 
ATOM   1382  C  CB    . TRP A  1 177 ? 20.039  -2.323  11.754  1.00 37.53  ? 318 TRP A CB    1 
ATOM   1383  C  CG    . TRP A  1 177 ? 21.430  -2.425  12.324  1.00 36.37  ? 318 TRP A CG    1 
ATOM   1384  C  CD1   . TRP A  1 177 ? 22.252  -3.516  12.293  1.00 35.59  ? 318 TRP A CD1   1 
ATOM   1385  C  CD2   . TRP A  1 177 ? 22.162  -1.394  13.011  1.00 30.98  ? 318 TRP A CD2   1 
ATOM   1386  N  NE1   . TRP A  1 177 ? 23.442  -3.228  12.909  1.00 30.49  ? 318 TRP A NE1   1 
ATOM   1387  C  CE2   . TRP A  1 177 ? 23.412  -1.936  13.360  1.00 27.44  ? 318 TRP A CE2   1 
ATOM   1388  C  CE3   . TRP A  1 177 ? 21.879  -0.071  13.361  1.00 31.93  ? 318 TRP A CE3   1 
ATOM   1389  C  CZ2   . TRP A  1 177 ? 24.379  -1.198  14.049  1.00 30.12  ? 318 TRP A CZ2   1 
ATOM   1390  C  CZ3   . TRP A  1 177 ? 22.843  0.658   14.039  1.00 32.78  ? 318 TRP A CZ3   1 
ATOM   1391  C  CH2   . TRP A  1 177 ? 24.074  0.094   14.376  1.00 33.15  ? 318 TRP A CH2   1 
ATOM   1392  N  N     . PRO A  1 178 ? 17.072  -3.585  11.897  1.00 42.27  ? 319 PRO A N     1 
ATOM   1393  C  CA    . PRO A  1 178 ? 15.641  -3.343  11.667  1.00 44.29  ? 319 PRO A CA    1 
ATOM   1394  C  C     . PRO A  1 178 ? 15.373  -2.015  10.955  1.00 43.21  ? 319 PRO A C     1 
ATOM   1395  O  O     . PRO A  1 178 ? 16.161  -1.076  11.070  1.00 43.45  ? 319 PRO A O     1 
ATOM   1396  C  CB    . PRO A  1 178 ? 15.069  -3.309  13.086  1.00 41.78  ? 319 PRO A CB    1 
ATOM   1397  C  CG    . PRO A  1 178 ? 15.950  -4.242  13.851  1.00 38.58  ? 319 PRO A CG    1 
ATOM   1398  C  CD    . PRO A  1 178 ? 17.334  -4.040  13.277  1.00 38.10  ? 319 PRO A CD    1 
ATOM   1399  N  N     . ILE A  1 179 ? 14.262  -1.948  10.231  1.00 42.73  ? 320 ILE A N     1 
ATOM   1400  C  CA    . ILE A  1 179 ? 13.960  -0.805  9.380   1.00 46.62  ? 320 ILE A CA    1 
ATOM   1401  C  C     . ILE A  1 179 ? 13.548  0.437   10.170  1.00 45.62  ? 320 ILE A C     1 
ATOM   1402  O  O     . ILE A  1 179 ? 13.370  1.513   9.601   1.00 46.89  ? 320 ILE A O     1 
ATOM   1403  C  CB    . ILE A  1 179 ? 12.861  -1.158  8.364   1.00 53.75  ? 320 ILE A CB    1 
ATOM   1404  C  CG1   . ILE A  1 179 ? 11.593  -1.601  9.097   1.00 58.44  ? 320 ILE A CG1   1 
ATOM   1405  C  CG2   . ILE A  1 179 ? 13.346  -2.253  7.410   1.00 54.61  ? 320 ILE A CG2   1 
ATOM   1406  C  CD1   . ILE A  1 179 ? 10.533  -2.188  8.190   1.00 61.54  ? 320 ILE A CD1   1 
ATOM   1407  N  N     . SER A  1 180 ? 13.403  0.285   11.481  1.00 46.53  ? 321 SER A N     1 
ATOM   1408  C  CA    . SER A  1 180 ? 13.088  1.410   12.350  1.00 45.85  ? 321 SER A CA    1 
ATOM   1409  C  C     . SER A  1 180 ? 14.366  2.108   12.799  1.00 50.41  ? 321 SER A C     1 
ATOM   1410  O  O     . SER A  1 180 ? 14.322  3.149   13.458  1.00 53.20  ? 321 SER A O     1 
ATOM   1411  C  CB    . SER A  1 180 ? 12.290  0.935   13.558  1.00 42.20  ? 321 SER A CB    1 
ATOM   1412  O  OG    . SER A  1 180 ? 12.908  -0.188  14.157  1.00 44.38  ? 321 SER A OG    1 
ATOM   1413  N  N     . THR A  1 181 ? 15.503  1.525   12.430  1.00 51.46  ? 322 THR A N     1 
ATOM   1414  C  CA    . THR A  1 181 ? 16.807  2.105   12.723  1.00 49.70  ? 322 THR A CA    1 
ATOM   1415  C  C     . THR A  1 181 ? 17.339  2.874   11.521  1.00 51.73  ? 322 THR A C     1 
ATOM   1416  O  O     . THR A  1 181 ? 18.375  3.527   11.608  1.00 54.00  ? 322 THR A O     1 
ATOM   1417  C  CB    . THR A  1 181 ? 17.831  1.021   13.078  1.00 45.42  ? 322 THR A CB    1 
ATOM   1418  O  OG1   . THR A  1 181 ? 17.909  0.075   12.005  1.00 48.14  ? 322 THR A OG1   1 
ATOM   1419  C  CG2   . THR A  1 181 ? 17.432  0.301   14.346  1.00 44.02  ? 322 THR A CG2   1 
ATOM   1420  N  N     . LYS A  1 182 ? 16.617  2.779   10.408  1.00 51.41  ? 323 LYS A N     1 
ATOM   1421  C  CA    . LYS A  1 182 ? 17.027  3.352   9.128   1.00 48.10  ? 323 LYS A CA    1 
ATOM   1422  C  C     . LYS A  1 182 ? 17.408  4.827   9.235   1.00 40.74  ? 323 LYS A C     1 
ATOM   1423  O  O     . LYS A  1 182 ? 18.506  5.218   8.838   1.00 35.58  ? 323 LYS A O     1 
ATOM   1424  C  CB    . LYS A  1 182 ? 15.905  3.172   8.103   1.00 53.97  ? 323 LYS A CB    1 
ATOM   1425  C  CG    . LYS A  1 182 ? 16.367  3.057   6.653   1.00 60.21  ? 323 LYS A CG    1 
ATOM   1426  C  CD    . LYS A  1 182 ? 17.112  1.753   6.402   1.00 61.16  ? 323 LYS A CD    1 
ATOM   1427  C  CE    . LYS A  1 182 ? 17.514  1.626   4.938   1.00 61.18  ? 323 LYS A CE    1 
ATOM   1428  N  NZ    . LYS A  1 182 ? 18.372  0.436   4.682   1.00 60.94  ? 323 LYS A NZ    1 
ATOM   1429  N  N     . GLU A  1 183 ? 16.501  5.637   9.776   1.00 41.11  ? 324 GLU A N     1 
ATOM   1430  C  CA    . GLU A  1 183 ? 16.772  7.055   9.982   1.00 41.44  ? 324 GLU A CA    1 
ATOM   1431  C  C     . GLU A  1 183 ? 17.480  7.290   11.314  1.00 38.77  ? 324 GLU A C     1 
ATOM   1432  O  O     . GLU A  1 183 ? 17.815  8.424   11.659  1.00 37.17  ? 324 GLU A O     1 
ATOM   1433  C  CB    . GLU A  1 183 ? 15.478  7.871   9.938   1.00 46.93  ? 324 GLU A CB    1 
ATOM   1434  C  CG    . GLU A  1 183 ? 14.601  7.616   8.717   1.00 52.68  ? 324 GLU A CG    1 
ATOM   1435  C  CD    . GLU A  1 183 ? 15.323  7.849   7.409   1.00 59.00  ? 324 GLU A CD    1 
ATOM   1436  O  OE1   . GLU A  1 183 ? 16.053  8.855   7.292   1.00 61.29  ? 324 GLU A OE1   1 
ATOM   1437  O  OE2   . GLU A  1 183 ? 15.162  7.020   6.492   1.00 63.12  ? 324 GLU A OE2   1 
ATOM   1438  N  N     . GLY A  1 184 ? 17.708  6.216   12.065  1.00 38.19  ? 325 GLY A N     1 
ATOM   1439  C  CA    . GLY A  1 184 ? 18.428  6.314   13.322  1.00 34.27  ? 325 GLY A CA    1 
ATOM   1440  C  C     . GLY A  1 184 ? 19.912  6.527   13.091  1.00 35.43  ? 325 GLY A C     1 
ATOM   1441  O  O     . GLY A  1 184 ? 20.367  6.496   11.950  1.00 38.24  ? 325 GLY A O     1 
ATOM   1442  N  N     . LEU A  1 185 ? 20.661  6.734   14.170  1.00 34.85  ? 326 LEU A N     1 
ATOM   1443  C  CA    . LEU A  1 185 ? 22.102  6.992   14.094  1.00 36.41  ? 326 LEU A CA    1 
ATOM   1444  C  C     . LEU A  1 185 ? 22.463  8.133   13.130  1.00 35.78  ? 326 LEU A C     1 
ATOM   1445  O  O     . LEU A  1 185 ? 23.127  7.907   12.123  1.00 35.12  ? 326 LEU A O     1 
ATOM   1446  C  CB    . LEU A  1 185 ? 22.862  5.706   13.731  1.00 34.58  ? 326 LEU A CB    1 
ATOM   1447  C  CG    . LEU A  1 185 ? 24.373  5.666   13.973  1.00 32.13  ? 326 LEU A CG    1 
ATOM   1448  C  CD1   . LEU A  1 185 ? 24.672  5.834   15.440  1.00 34.27  ? 326 LEU A CD1   1 
ATOM   1449  C  CD2   . LEU A  1 185 ? 24.972  4.379   13.456  1.00 31.01  ? 326 LEU A CD2   1 
ATOM   1450  N  N     . PRO A  1 186 ? 22.033  9.367   13.446  1.00 40.40  ? 327 PRO A N     1 
ATOM   1451  C  CA    . PRO A  1 186 ? 22.299  10.509  12.562  1.00 43.02  ? 327 PRO A CA    1 
ATOM   1452  C  C     . PRO A  1 186 ? 23.678  11.132  12.806  1.00 39.84  ? 327 PRO A C     1 
ATOM   1453  O  O     . PRO A  1 186 ? 23.781  12.203  13.413  1.00 39.02  ? 327 PRO A O     1 
ATOM   1454  C  CB    . PRO A  1 186 ? 21.190  11.493  12.939  1.00 43.15  ? 327 PRO A CB    1 
ATOM   1455  C  CG    . PRO A  1 186 ? 20.935  11.214  14.392  1.00 42.30  ? 327 PRO A CG    1 
ATOM   1456  C  CD    . PRO A  1 186 ? 21.209  9.749   14.609  1.00 40.90  ? 327 PRO A CD    1 
ATOM   1457  N  N     . ILE A  1 187 ? 24.722  10.476  12.307  1.00 38.17  ? 328 ILE A N     1 
ATOM   1458  C  CA    . ILE A  1 187 ? 26.094  10.910  12.555  1.00 34.32  ? 328 ILE A CA    1 
ATOM   1459  C  C     . ILE A  1 187 ? 26.824  11.392  11.290  1.00 34.68  ? 328 ILE A C     1 
ATOM   1460  O  O     . ILE A  1 187 ? 28.027  11.653  11.332  1.00 36.83  ? 328 ILE A O     1 
ATOM   1461  C  CB    . ILE A  1 187 ? 26.916  9.778   13.209  1.00 33.03  ? 328 ILE A CB    1 
ATOM   1462  C  CG1   . ILE A  1 187 ? 26.935  8.535   12.314  1.00 36.01  ? 328 ILE A CG1   1 
ATOM   1463  C  CG2   . ILE A  1 187 ? 26.364  9.432   14.579  1.00 32.27  ? 328 ILE A CG2   1 
ATOM   1464  C  CD1   . ILE A  1 187 ? 27.948  7.485   12.753  1.00 35.50  ? 328 ILE A CD1   1 
ATOM   1465  N  N     . GLN A  1 188 ? 26.092  11.527  10.183  1.00 34.09  ? 329 GLN A N     1 
ATOM   1466  C  CA    . GLN A  1 188 ? 26.687  11.850  8.878   1.00 35.36  ? 329 GLN A CA    1 
ATOM   1467  C  C     . GLN A  1 188 ? 27.526  13.132  8.819   1.00 40.92  ? 329 GLN A C     1 
ATOM   1468  O  O     . GLN A  1 188 ? 28.603  13.144  8.223   1.00 42.26  ? 329 GLN A O     1 
ATOM   1469  C  CB    . GLN A  1 188 ? 25.613  11.895  7.790   1.00 33.14  ? 329 GLN A CB    1 
ATOM   1470  C  CG    . GLN A  1 188 ? 24.926  10.559  7.513   1.00 32.97  ? 329 GLN A CG    1 
ATOM   1471  C  CD    . GLN A  1 188 ? 23.744  10.311  8.427   1.00 35.52  ? 329 GLN A CD    1 
ATOM   1472  O  OE1   . GLN A  1 188 ? 23.622  10.928  9.485   1.00 36.90  ? 329 GLN A OE1   1 
ATOM   1473  N  NE2   . GLN A  1 188 ? 22.865  9.404   8.022   1.00 36.37  ? 329 GLN A NE2   1 
ATOM   1474  N  N     . GLY A  1 189 ? 27.040  14.211  9.425   1.00 44.80  ? 330 GLY A N     1 
ATOM   1475  C  CA    . GLY A  1 189 ? 27.784  15.459  9.420   1.00 44.63  ? 330 GLY A CA    1 
ATOM   1476  C  C     . GLY A  1 189 ? 28.733  15.567  10.599  1.00 44.20  ? 330 GLY A C     1 
ATOM   1477  O  O     . GLY A  1 189 ? 29.268  16.641  10.879  1.00 46.82  ? 330 GLY A O     1 
ATOM   1478  N  N     . TRP A  1 190 ? 28.953  14.446  11.279  1.00 41.14  ? 331 TRP A N     1 
ATOM   1479  C  CA    . TRP A  1 190 ? 29.755  14.419  12.495  1.00 38.71  ? 331 TRP A CA    1 
ATOM   1480  C  C     . TRP A  1 190 ? 30.848  13.358  12.396  1.00 39.07  ? 331 TRP A C     1 
ATOM   1481  O  O     . TRP A  1 190 ? 32.031  13.683  12.275  1.00 42.53  ? 331 TRP A O     1 
ATOM   1482  C  CB    . TRP A  1 190 ? 28.848  14.140  13.694  1.00 37.74  ? 331 TRP A CB    1 
ATOM   1483  C  CG    . TRP A  1 190 ? 29.570  13.982  14.995  1.00 32.57  ? 331 TRP A CG    1 
ATOM   1484  C  CD1   . TRP A  1 190 ? 30.726  14.597  15.374  1.00 28.75  ? 331 TRP A CD1   1 
ATOM   1485  C  CD2   . TRP A  1 190 ? 29.182  13.144  16.093  1.00 30.55  ? 331 TRP A CD2   1 
ATOM   1486  N  NE1   . TRP A  1 190 ? 31.081  14.192  16.640  1.00 32.32  ? 331 TRP A NE1   1 
ATOM   1487  C  CE2   . TRP A  1 190 ? 30.146  13.300  17.104  1.00 31.35  ? 331 TRP A CE2   1 
ATOM   1488  C  CE3   . TRP A  1 190 ? 28.109  12.274  16.317  1.00 27.40  ? 331 TRP A CE3   1 
ATOM   1489  C  CZ2   . TRP A  1 190 ? 30.071  12.621  18.323  1.00 30.73  ? 331 TRP A CZ2   1 
ATOM   1490  C  CZ3   . TRP A  1 190 ? 28.038  11.600  17.527  1.00 26.99  ? 331 TRP A CZ3   1 
ATOM   1491  C  CH2   . TRP A  1 190 ? 29.011  11.773  18.510  1.00 25.04  ? 331 TRP A CH2   1 
ATOM   1492  N  N     . LEU A  1 191 ? 30.448  12.091  12.456  1.00 35.25  ? 332 LEU A N     1 
ATOM   1493  C  CA    . LEU A  1 191 ? 31.394  10.987  12.345  1.00 30.77  ? 332 LEU A CA    1 
ATOM   1494  C  C     . LEU A  1 191 ? 31.570  10.557  10.892  1.00 29.08  ? 332 LEU A C     1 
ATOM   1495  O  O     . LEU A  1 191 ? 32.555  9.899   10.543  1.00 32.39  ? 332 LEU A O     1 
ATOM   1496  C  CB    . LEU A  1 191 ? 30.945  9.804   13.199  1.00 24.89  ? 332 LEU A CB    1 
ATOM   1497  C  CG    . LEU A  1 191 ? 30.758  10.138  14.672  1.00 23.36  ? 332 LEU A CG    1 
ATOM   1498  C  CD1   . LEU A  1 191 ? 30.447  8.901   15.505  1.00 21.98  ? 332 LEU A CD1   1 
ATOM   1499  C  CD2   . LEU A  1 191 ? 31.996  10.833  15.190  1.00 21.92  ? 332 LEU A CD2   1 
ATOM   1500  N  N     . GLY A  1 192 ? 30.609  10.928  10.049  1.00 25.98  ? 333 GLY A N     1 
ATOM   1501  C  CA    . GLY A  1 192 ? 30.704  10.647  8.628   1.00 27.48  ? 333 GLY A CA    1 
ATOM   1502  C  C     . GLY A  1 192 ? 29.765  9.568   8.122   1.00 26.67  ? 333 GLY A C     1 
ATOM   1503  O  O     . GLY A  1 192 ? 29.062  8.934   8.901   1.00 24.47  ? 333 GLY A O     1 
ATOM   1504  N  N     . THR A  1 193 ? 29.775  9.355   6.808   1.00 32.29  ? 334 THR A N     1 
ATOM   1505  C  CA    . THR A  1 193 ? 28.932  8.354   6.162   1.00 34.29  ? 334 THR A CA    1 
ATOM   1506  C  C     . THR A  1 193 ? 29.600  6.979   6.068   1.00 35.83  ? 334 THR A C     1 
ATOM   1507  O  O     . THR A  1 193 ? 28.916  5.956   6.096   1.00 39.24  ? 334 THR A O     1 
ATOM   1508  C  CB    . THR A  1 193 ? 28.511  8.805   4.750   1.00 39.69  ? 334 THR A CB    1 
ATOM   1509  O  OG1   . THR A  1 193 ? 29.676  9.124   3.977   1.00 44.47  ? 334 THR A OG1   1 
ATOM   1510  C  CG2   . THR A  1 193 ? 27.607  10.025  4.821   1.00 37.01  ? 334 THR A CG2   1 
ATOM   1511  N  N     . LYS A  1 194 ? 30.926  6.955   5.946   1.00 30.68  ? 335 LYS A N     1 
ATOM   1512  C  CA    . LYS A  1 194 ? 31.668  5.697   5.908   1.00 28.21  ? 335 LYS A CA    1 
ATOM   1513  C  C     . LYS A  1 194 ? 31.672  5.009   7.272   1.00 29.42  ? 335 LYS A C     1 
ATOM   1514  O  O     . LYS A  1 194 ? 31.581  3.779   7.360   1.00 32.11  ? 335 LYS A O     1 
ATOM   1515  C  CB    . LYS A  1 194 ? 33.109  5.923   5.446   1.00 31.11  ? 335 LYS A CB    1 
ATOM   1516  C  CG    . LYS A  1 194 ? 33.264  6.266   3.966   1.00 30.51  ? 335 LYS A CG    1 
ATOM   1517  C  CD    . LYS A  1 194 ? 34.733  6.297   3.545   1.00 24.60  ? 335 LYS A CD    1 
ATOM   1518  C  CE    . LYS A  1 194 ? 35.526  7.361   4.290   1.00 20.89  ? 335 LYS A CE    1 
ATOM   1519  N  NZ    . LYS A  1 194 ? 35.064  8.746   3.997   1.00 19.42  ? 335 LYS A NZ    1 
ATOM   1520  N  N     . VAL A  1 195 ? 31.787  5.809   8.331   1.00 28.03  ? 336 VAL A N     1 
ATOM   1521  C  CA    . VAL A  1 195 ? 31.720  5.292   9.698   1.00 29.12  ? 336 VAL A CA    1 
ATOM   1522  C  C     . VAL A  1 195 ? 30.337  4.727   9.980   1.00 36.11  ? 336 VAL A C     1 
ATOM   1523  O  O     . VAL A  1 195 ? 30.209  3.617   10.494  1.00 43.17  ? 336 VAL A O     1 
ATOM   1524  C  CB    . VAL A  1 195 ? 32.076  6.368   10.744  1.00 25.57  ? 336 VAL A CB    1 
ATOM   1525  C  CG1   . VAL A  1 195 ? 31.548  5.987   12.111  1.00 28.45  ? 336 VAL A CG1   1 
ATOM   1526  C  CG2   . VAL A  1 195 ? 33.574  6.560   10.817  1.00 21.76  ? 336 VAL A CG2   1 
ATOM   1527  N  N     . ARG A  1 196 ? 29.305  5.489   9.632   1.00 38.74  ? 337 ARG A N     1 
ATOM   1528  C  CA    . ARG A  1 196 ? 27.926  5.040   9.791   1.00 39.65  ? 337 ARG A CA    1 
ATOM   1529  C  C     . ARG A  1 196 ? 27.628  3.776   8.980   1.00 41.34  ? 337 ARG A C     1 
ATOM   1530  O  O     . ARG A  1 196 ? 26.991  2.850   9.477   1.00 43.59  ? 337 ARG A O     1 
ATOM   1531  C  CB    . ARG A  1 196 ? 26.955  6.157   9.405   1.00 41.23  ? 337 ARG A CB    1 
ATOM   1532  C  CG    . ARG A  1 196 ? 25.502  5.752   9.520   1.00 41.04  ? 337 ARG A CG    1 
ATOM   1533  C  CD    . ARG A  1 196 ? 24.573  6.937   9.432   1.00 40.60  ? 337 ARG A CD    1 
ATOM   1534  N  NE    . ARG A  1 196 ? 23.259  6.597   9.962   1.00 42.67  ? 337 ARG A NE    1 
ATOM   1535  C  CZ    . ARG A  1 196 ? 22.287  6.049   9.241   1.00 43.19  ? 337 ARG A CZ    1 
ATOM   1536  N  NH1   . ARG A  1 196 ? 22.483  5.776   7.956   1.00 43.35  ? 337 ARG A NH1   1 
ATOM   1537  N  NH2   . ARG A  1 196 ? 21.119  5.772   9.801   1.00 41.35  ? 337 ARG A NH2   1 
ATOM   1538  N  N     . THR A  1 197 ? 28.097  3.738   7.737   1.00 44.11  ? 338 THR A N     1 
ATOM   1539  C  CA    . THR A  1 197 ? 27.909  2.572   6.872   1.00 43.42  ? 338 THR A CA    1 
ATOM   1540  C  C     . THR A  1 197 ? 28.609  1.333   7.433   1.00 40.72  ? 338 THR A C     1 
ATOM   1541  O  O     . THR A  1 197 ? 28.052  0.232   7.419   1.00 41.92  ? 338 THR A O     1 
ATOM   1542  C  CB    . THR A  1 197 ? 28.394  2.853   5.434   1.00 41.33  ? 338 THR A CB    1 
ATOM   1543  O  OG1   . THR A  1 197 ? 27.461  3.720   4.774   1.00 41.12  ? 338 THR A OG1   1 
ATOM   1544  C  CG2   . THR A  1 197 ? 28.507  1.569   4.641   1.00 39.81  ? 338 THR A CG2   1 
ATOM   1545  N  N     . ASN A  1 198 ? 29.827  1.511   7.929   1.00 38.98  ? 339 ASN A N     1 
ATOM   1546  C  CA    . ASN A  1 198 ? 30.546  0.395   8.525   1.00 38.27  ? 339 ASN A CA    1 
ATOM   1547  C  C     . ASN A  1 198 ? 29.965  -0.068  9.868   1.00 37.14  ? 339 ASN A C     1 
ATOM   1548  O  O     . ASN A  1 198 ? 30.058  -1.244  10.208  1.00 40.46  ? 339 ASN A O     1 
ATOM   1549  C  CB    . ASN A  1 198 ? 32.037  0.720   8.658   1.00 37.24  ? 339 ASN A CB    1 
ATOM   1550  C  CG    . ASN A  1 198 ? 32.768  0.686   7.326   1.00 34.96  ? 339 ASN A CG    1 
ATOM   1551  O  OD1   . ASN A  1 198 ? 33.365  1.676   6.909   1.00 40.63  ? 339 ASN A OD1   1 
ATOM   1552  N  ND2   . ASN A  1 198 ? 32.737  -0.459  6.661   1.00 28.72  ? 339 ASN A ND2   1 
ATOM   1553  N  N     . LEU A  1 199 ? 29.365  0.851   10.620  1.00 34.09  ? 340 LEU A N     1 
ATOM   1554  C  CA    . LEU A  1 199 ? 28.784  0.527   11.924  1.00 28.84  ? 340 LEU A CA    1 
ATOM   1555  C  C     . LEU A  1 199 ? 27.501  -0.287  11.783  1.00 24.55  ? 340 LEU A C     1 
ATOM   1556  O  O     . LEU A  1 199 ? 27.252  -1.202  12.567  1.00 28.48  ? 340 LEU A O     1 
ATOM   1557  C  CB    . LEU A  1 199 ? 28.507  1.799   12.730  1.00 30.31  ? 340 LEU A CB    1 
ATOM   1558  C  CG    . LEU A  1 199 ? 29.693  2.492   13.395  1.00 29.49  ? 340 LEU A CG    1 
ATOM   1559  C  CD1   . LEU A  1 199 ? 29.254  3.733   14.150  1.00 31.58  ? 340 LEU A CD1   1 
ATOM   1560  C  CD2   . LEU A  1 199 ? 30.389  1.543   14.332  1.00 27.89  ? 340 LEU A CD2   1 
ATOM   1561  N  N     . ARG A  1 200 ? 26.691  0.049   10.782  1.00 22.41  ? 341 ARG A N     1 
ATOM   1562  C  CA    . ARG A  1 200 ? 25.442  -0.661  10.528  1.00 25.33  ? 341 ARG A CA    1 
ATOM   1563  C  C     . ARG A  1 200 ? 25.683  -2.005  9.836   1.00 33.82  ? 341 ARG A C     1 
ATOM   1564  O  O     . ARG A  1 200 ? 24.742  -2.766  9.601   1.00 38.23  ? 341 ARG A O     1 
ATOM   1565  C  CB    . ARG A  1 200 ? 24.486  0.210   9.710   1.00 22.57  ? 341 ARG A CB    1 
ATOM   1566  C  CG    . ARG A  1 200 ? 24.002  1.456   10.450  1.00 25.17  ? 341 ARG A CG    1 
ATOM   1567  C  CD    . ARG A  1 200 ? 23.096  2.325   9.586   1.00 28.63  ? 341 ARG A CD    1 
ATOM   1568  N  NE    . ARG A  1 200 ? 21.989  1.565   9.010   1.00 35.30  ? 341 ARG A NE    1 
ATOM   1569  C  CZ    . ARG A  1 200 ? 20.807  1.398   9.598   1.00 35.60  ? 341 ARG A CZ    1 
ATOM   1570  N  NH1   . ARG A  1 200 ? 20.565  1.933   10.786  1.00 36.98  ? 341 ARG A NH1   1 
ATOM   1571  N  NH2   . ARG A  1 200 ? 19.862  0.691   8.998   1.00 36.10  ? 341 ARG A NH2   1 
ATOM   1572  N  N     . ARG A  1 201 ? 26.944  -2.295  9.521   1.00 35.29  ? 342 ARG A N     1 
ATOM   1573  C  CA    . ARG A  1 201 ? 27.332  -3.602  8.997   1.00 33.56  ? 342 ARG A CA    1 
ATOM   1574  C  C     . ARG A  1 201 ? 27.658  -4.544  10.140  1.00 33.49  ? 342 ARG A C     1 
ATOM   1575  O  O     . ARG A  1 201 ? 27.822  -5.749  9.941   1.00 36.35  ? 342 ARG A O     1 
ATOM   1576  C  CB    . ARG A  1 201 ? 28.551  -3.485  8.086   1.00 32.71  ? 342 ARG A CB    1 
ATOM   1577  C  CG    . ARG A  1 201 ? 28.226  -3.171  6.641   1.00 27.18  ? 342 ARG A CG    1 
ATOM   1578  C  CD    . ARG A  1 201 ? 29.491  -2.972  5.856   1.00 26.35  ? 342 ARG A CD    1 
ATOM   1579  N  NE    . ARG A  1 201 ? 29.206  -2.484  4.517   1.00 31.86  ? 342 ARG A NE    1 
ATOM   1580  C  CZ    . ARG A  1 201 ? 30.084  -1.843  3.761   1.00 33.87  ? 342 ARG A CZ    1 
ATOM   1581  N  NH1   . ARG A  1 201 ? 31.302  -1.610  4.222   1.00 37.26  ? 342 ARG A NH1   1 
ATOM   1582  N  NH2   . ARG A  1 201 ? 29.742  -1.428  2.552   1.00 33.01  ? 342 ARG A NH2   1 
ATOM   1583  N  N     . GLU A  1 202 ? 27.761  -3.983  11.338  1.00 33.48  ? 343 GLU A N     1 
ATOM   1584  C  CA    . GLU A  1 202 ? 27.966  -4.773  12.541  1.00 34.62  ? 343 GLU A CA    1 
ATOM   1585  C  C     . GLU A  1 202 ? 26.678  -5.511  12.882  1.00 33.37  ? 343 GLU A C     1 
ATOM   1586  O  O     . GLU A  1 202 ? 25.608  -5.163  12.373  1.00 34.41  ? 343 GLU A O     1 
ATOM   1587  C  CB    . GLU A  1 202 ? 28.365  -3.862  13.703  1.00 36.87  ? 343 GLU A CB    1 
ATOM   1588  C  CG    . GLU A  1 202 ? 29.697  -3.149  13.523  1.00 36.11  ? 343 GLU A CG    1 
ATOM   1589  C  CD    . GLU A  1 202 ? 30.869  -4.077  13.691  1.00 44.19  ? 343 GLU A CD    1 
ATOM   1590  O  OE1   . GLU A  1 202 ? 30.966  -4.719  14.754  1.00 49.06  ? 343 GLU A OE1   1 
ATOM   1591  O  OE2   . GLU A  1 202 ? 31.697  -4.172  12.764  1.00 50.04  ? 343 GLU A OE2   1 
ATOM   1592  N  N     . PRO A  1 203 ? 26.773  -6.546  13.734  1.00 31.92  ? 344 PRO A N     1 
ATOM   1593  C  CA    . PRO A  1 203 ? 25.535  -7.207  14.157  1.00 30.37  ? 344 PRO A CA    1 
ATOM   1594  C  C     . PRO A  1 203 ? 24.707  -6.295  15.056  1.00 32.64  ? 344 PRO A C     1 
ATOM   1595  O  O     . PRO A  1 203 ? 25.259  -5.335  15.601  1.00 36.67  ? 344 PRO A O     1 
ATOM   1596  C  CB    . PRO A  1 203 ? 26.039  -8.401  14.970  1.00 28.26  ? 344 PRO A CB    1 
ATOM   1597  C  CG    . PRO A  1 203 ? 27.469  -8.598  14.572  1.00 24.55  ? 344 PRO A CG    1 
ATOM   1598  C  CD    . PRO A  1 203 ? 27.975  -7.235  14.244  1.00 26.72  ? 344 PRO A CD    1 
ATOM   1599  N  N     . PHE A  1 204 ? 23.412  -6.573  15.199  1.00 26.82  ? 345 PHE A N     1 
ATOM   1600  C  CA    . PHE A  1 204 ? 22.589  -5.848  16.166  1.00 25.91  ? 345 PHE A CA    1 
ATOM   1601  C  C     . PHE A  1 204 ? 22.146  -6.798  17.269  1.00 28.04  ? 345 PHE A C     1 
ATOM   1602  O  O     . PHE A  1 204 ? 22.089  -8.019  17.057  1.00 26.68  ? 345 PHE A O     1 
ATOM   1603  C  CB    . PHE A  1 204 ? 21.379  -5.177  15.505  1.00 30.74  ? 345 PHE A CB    1 
ATOM   1604  C  CG    . PHE A  1 204 ? 20.370  -6.142  14.939  1.00 30.90  ? 345 PHE A CG    1 
ATOM   1605  C  CD1   . PHE A  1 204 ? 20.523  -6.643  13.658  1.00 25.78  ? 345 PHE A CD1   1 
ATOM   1606  C  CD2   . PHE A  1 204 ? 19.259  -6.528  15.679  1.00 30.35  ? 345 PHE A CD2   1 
ATOM   1607  C  CE1   . PHE A  1 204 ? 19.609  -7.516  13.131  1.00 18.97  ? 345 PHE A CE1   1 
ATOM   1608  C  CE2   . PHE A  1 204 ? 18.335  -7.410  15.152  1.00 29.76  ? 345 PHE A CE2   1 
ATOM   1609  C  CZ    . PHE A  1 204 ? 18.511  -7.901  13.875  1.00 28.04  ? 345 PHE A CZ    1 
ATOM   1610  N  N     . TYR A  1 205 ? 21.832  -6.260  18.446  1.00 32.68  ? 346 TYR A N     1 
ATOM   1611  C  CA    . TYR A  1 205 ? 21.577  -7.162  19.563  1.00 34.66  ? 346 TYR A CA    1 
ATOM   1612  C  C     . TYR A  1 205 ? 20.160  -7.128  20.118  1.00 35.10  ? 346 TYR A C     1 
ATOM   1613  O  O     . TYR A  1 205 ? 19.398  -6.205  19.846  1.00 36.71  ? 346 TYR A O     1 
ATOM   1614  C  CB    . TYR A  1 205 ? 22.638  -6.977  20.645  1.00 37.67  ? 346 TYR A CB    1 
ATOM   1615  C  CG    . TYR A  1 205 ? 24.021  -7.292  20.121  1.00 42.60  ? 346 TYR A CG    1 
ATOM   1616  C  CD1   . TYR A  1 205 ? 24.766  -6.334  19.452  1.00 44.31  ? 346 TYR A CD1   1 
ATOM   1617  C  CD2   . TYR A  1 205 ? 24.569  -8.554  20.268  1.00 43.57  ? 346 TYR A CD2   1 
ATOM   1618  C  CE1   . TYR A  1 205 ? 26.021  -6.622  18.957  1.00 44.97  ? 346 TYR A CE1   1 
ATOM   1619  C  CE2   . TYR A  1 205 ? 25.824  -8.846  19.779  1.00 44.20  ? 346 TYR A CE2   1 
ATOM   1620  C  CZ    . TYR A  1 205 ? 26.546  -7.878  19.124  1.00 43.67  ? 346 TYR A CZ    1 
ATOM   1621  O  OH    . TYR A  1 205 ? 27.800  -8.167  18.636  1.00 43.26  ? 346 TYR A OH    1 
ATOM   1622  N  N     . LEU A  1 206 ? 19.809  -8.168  20.871  1.00 34.79  ? 347 LEU A N     1 
ATOM   1623  C  CA    . LEU A  1 206 ? 18.486  -8.288  21.471  1.00 32.28  ? 347 LEU A CA    1 
ATOM   1624  C  C     . LEU A  1 206 ? 18.607  -8.743  22.919  1.00 32.82  ? 347 LEU A C     1 
ATOM   1625  O  O     . LEU A  1 206 ? 19.300  -9.709  23.223  1.00 32.59  ? 347 LEU A O     1 
ATOM   1626  C  CB    . LEU A  1 206 ? 17.627  -9.279  20.689  1.00 32.58  ? 347 LEU A CB    1 
ATOM   1627  C  CG    . LEU A  1 206 ? 17.098  -8.826  19.331  1.00 30.84  ? 347 LEU A CG    1 
ATOM   1628  C  CD1   . LEU A  1 206 ? 16.661  -10.023 18.503  1.00 30.63  ? 347 LEU A CD1   1 
ATOM   1629  C  CD2   . LEU A  1 206 ? 15.942  -7.861  19.516  1.00 26.89  ? 347 LEU A CD2   1 
ATOM   1630  N  N     . VAL A  1 207 ? 17.929  -8.034  23.811  1.00 32.38  ? 348 VAL A N     1 
ATOM   1631  C  CA    . VAL A  1 207 ? 17.940  -8.358  25.230  1.00 34.60  ? 348 VAL A CA    1 
ATOM   1632  C  C     . VAL A  1 207 ? 16.517  -8.683  25.680  1.00 37.91  ? 348 VAL A C     1 
ATOM   1633  O  O     . VAL A  1 207 ? 15.559  -8.345  24.990  1.00 43.27  ? 348 VAL A O     1 
ATOM   1634  C  CB    . VAL A  1 207 ? 18.497  -7.187  26.054  1.00 33.36  ? 348 VAL A CB    1 
ATOM   1635  C  CG1   . VAL A  1 207 ? 19.997  -7.091  25.885  1.00 36.93  ? 348 VAL A CG1   1 
ATOM   1636  C  CG2   . VAL A  1 207 ? 17.840  -5.888  25.628  1.00 27.18  ? 348 VAL A CG2   1 
ATOM   1637  N  N     . PRO A  1 208 ? 16.369  -9.378  26.817  1.00 34.52  ? 349 PRO A N     1 
ATOM   1638  C  CA    . PRO A  1 208 ? 15.008  -9.521  27.342  1.00 36.43  ? 349 PRO A CA    1 
ATOM   1639  C  C     . PRO A  1 208 ? 14.472  -8.169  27.793  1.00 40.16  ? 349 PRO A C     1 
ATOM   1640  O  O     . PRO A  1 208 ? 15.190  -7.439  28.479  1.00 47.10  ? 349 PRO A O     1 
ATOM   1641  C  CB    . PRO A  1 208 ? 15.203  -10.413 28.571  1.00 34.83  ? 349 PRO A CB    1 
ATOM   1642  C  CG    . PRO A  1 208 ? 16.436  -11.185 28.282  1.00 33.89  ? 349 PRO A CG    1 
ATOM   1643  C  CD    . PRO A  1 208 ? 17.330  -10.250 27.519  1.00 32.34  ? 349 PRO A CD    1 
ATOM   1644  N  N     . LYS A  1 209 ? 13.246  -7.832  27.409  1.00 35.75  ? 350 LYS A N     1 
ATOM   1645  C  CA    . LYS A  1 209 ? 12.607  -6.650  27.955  1.00 32.87  ? 350 LYS A CA    1 
ATOM   1646  C  C     . LYS A  1 209 ? 12.366  -6.891  29.438  1.00 35.55  ? 350 LYS A C     1 
ATOM   1647  O  O     . LYS A  1 209 ? 12.674  -6.040  30.270  1.00 39.09  ? 350 LYS A O     1 
ATOM   1648  C  CB    . LYS A  1 209 ? 11.289  -6.369  27.243  1.00 33.63  ? 350 LYS A CB    1 
ATOM   1649  C  CG    . LYS A  1 209 ? 10.588  -5.113  27.746  1.00 37.88  ? 350 LYS A CG    1 
ATOM   1650  C  CD    . LYS A  1 209 ? 9.312   -4.839  26.969  1.00 41.93  ? 350 LYS A CD    1 
ATOM   1651  C  CE    . LYS A  1 209 ? 8.613   -3.599  27.504  1.00 49.94  ? 350 LYS A CE    1 
ATOM   1652  N  NZ    . LYS A  1 209 ? 7.371   -3.269  26.749  1.00 54.08  ? 350 LYS A NZ    1 
ATOM   1653  N  N     . ASN A  1 210 ? 11.825  -8.068  29.748  1.00 32.92  ? 351 ASN A N     1 
ATOM   1654  C  CA    . ASN A  1 210 ? 11.565  -8.499  31.119  1.00 36.34  ? 351 ASN A CA    1 
ATOM   1655  C  C     . ASN A  1 210 ? 10.696  -7.528  31.908  1.00 38.65  ? 351 ASN A C     1 
ATOM   1656  O  O     . ASN A  1 210 ? 10.982  -7.214  33.063  1.00 42.29  ? 351 ASN A O     1 
ATOM   1657  C  CB    . ASN A  1 210 ? 12.870  -8.787  31.867  1.00 39.64  ? 351 ASN A CB    1 
ATOM   1658  C  CG    . ASN A  1 210 ? 12.699  -9.820  32.969  1.00 39.59  ? 351 ASN A CG    1 
ATOM   1659  O  OD1   . ASN A  1 210 ? 11.932  -10.774 32.832  1.00 41.55  ? 351 ASN A OD1   1 
ATOM   1660  N  ND2   . ASN A  1 210 ? 13.419  -9.637  34.065  1.00 38.64  ? 351 ASN A ND2   1 
ATOM   1661  N  N     . ALA A  1 211 ? 9.633   -7.055  31.269  1.00 35.88  ? 352 ALA A N     1 
ATOM   1662  C  CA    . ALA A  1 211 ? 8.632   -6.254  31.949  1.00 35.36  ? 352 ALA A CA    1 
ATOM   1663  C  C     . ALA A  1 211 ? 7.688   -7.184  32.701  1.00 44.72  ? 352 ALA A C     1 
ATOM   1664  O  O     . ALA A  1 211 ? 7.376   -8.280  32.229  1.00 47.26  ? 352 ALA A O     1 
ATOM   1665  C  CB    . ALA A  1 211 ? 7.875   -5.412  30.955  1.00 31.50  ? 352 ALA A CB    1 
ATOM   1666  N  N     . LYS A  1 212 ? 7.241   -6.756  33.875  1.00 51.23  ? 353 LYS A N     1 
ATOM   1667  C  CA    . LYS A  1 212 ? 6.402   -7.607  34.706  1.00 54.57  ? 353 LYS A CA    1 
ATOM   1668  C  C     . LYS A  1 212 ? 5.030   -6.988  34.918  1.00 59.20  ? 353 LYS A C     1 
ATOM   1669  O  O     . LYS A  1 212 ? 4.413   -7.182  35.966  1.00 64.48  ? 353 LYS A O     1 
ATOM   1670  C  CB    . LYS A  1 212 ? 7.073   -7.865  36.055  1.00 54.02  ? 353 LYS A CB    1 
ATOM   1671  C  CG    . LYS A  1 212 ? 8.499   -8.393  35.964  1.00 52.89  ? 353 LYS A CG    1 
ATOM   1672  C  CD    . LYS A  1 212 ? 8.558   -9.778  35.343  1.00 52.30  ? 353 LYS A CD    1 
ATOM   1673  C  CE    . LYS A  1 212 ? 9.920   -10.416 35.583  1.00 52.07  ? 353 LYS A CE    1 
ATOM   1674  N  NZ    . LYS A  1 212 ? 9.922   -11.873 35.269  1.00 52.36  ? 353 LYS A NZ    1 
ATOM   1675  N  N     . ASP A  1 213 ? 4.555   -6.245  33.922  1.00 60.28  ? 354 ASP A N     1 
ATOM   1676  C  CA    . ASP A  1 213 ? 3.244   -5.610  34.005  1.00 62.61  ? 354 ASP A CA    1 
ATOM   1677  C  C     . ASP A  1 213 ? 2.106   -6.594  33.726  1.00 62.91  ? 354 ASP A C     1 
ATOM   1678  O  O     . ASP A  1 213 ? 0.930   -6.251  33.865  1.00 66.37  ? 354 ASP A O     1 
ATOM   1679  C  CB    . ASP A  1 213 ? 3.159   -4.403  33.064  1.00 65.60  ? 354 ASP A CB    1 
ATOM   1680  C  CG    . ASP A  1 213 ? 3.993   -4.578  31.805  1.00 68.26  ? 354 ASP A CG    1 
ATOM   1681  O  OD1   . ASP A  1 213 ? 4.021   -5.696  31.250  1.00 69.85  ? 354 ASP A OD1   1 
ATOM   1682  O  OD2   . ASP A  1 213 ? 4.619   -3.591  31.366  1.00 68.40  ? 354 ASP A OD2   1 
ATOM   1683  N  N     . GLY A  1 214 ? 2.456   -7.816  33.339  1.00 60.68  ? 355 GLY A N     1 
ATOM   1684  C  CA    . GLY A  1 214 ? 1.458   -8.845  33.106  1.00 60.18  ? 355 GLY A CA    1 
ATOM   1685  C  C     . GLY A  1 214 ? 0.800   -8.757  31.742  1.00 60.92  ? 355 GLY A C     1 
ATOM   1686  O  O     . GLY A  1 214 ? -0.025  -9.607  31.392  1.00 58.77  ? 355 GLY A O     1 
ATOM   1687  N  N     . ASN A  1 215 ? 1.170   -7.735  30.972  1.00 60.50  ? 356 ASN A N     1 
ATOM   1688  C  CA    . ASN A  1 215 ? 0.610   -7.525  29.640  1.00 57.38  ? 356 ASN A CA    1 
ATOM   1689  C  C     . ASN A  1 215 ? 0.866   -8.706  28.716  1.00 51.27  ? 356 ASN A C     1 
ATOM   1690  O  O     . ASN A  1 215 ? 1.736   -9.522  28.987  1.00 50.31  ? 356 ASN A O     1 
ATOM   1691  C  CB    . ASN A  1 215 ? 1.169   -6.241  29.030  1.00 58.84  ? 356 ASN A CB    1 
ATOM   1692  C  CG    . ASN A  1 215 ? 0.601   -4.992  29.681  1.00 62.06  ? 356 ASN A CG    1 
ATOM   1693  O  OD1   . ASN A  1 215 ? -0.162  -5.073  30.644  1.00 62.71  ? 356 ASN A OD1   1 
ATOM   1694  N  ND2   . ASN A  1 215 ? 0.974   -3.828  29.160  1.00 63.89  ? 356 ASN A ND2   1 
ATOM   1695  N  N     . SER A  1 216 ? 0.100   -8.795  27.633  1.00 48.26  ? 357 SER A N     1 
ATOM   1696  C  CA    . SER A  1 216 ? 0.211   -9.905  26.689  1.00 43.64  ? 357 SER A CA    1 
ATOM   1697  C  C     . SER A  1 216 ? 1.632   -10.059 26.150  1.00 44.35  ? 357 SER A C     1 
ATOM   1698  O  O     . SER A  1 216 ? 2.356   -9.072  26.036  1.00 46.89  ? 357 SER A O     1 
ATOM   1699  C  CB    . SER A  1 216 ? -0.776  -9.705  25.544  1.00 38.10  ? 357 SER A CB    1 
ATOM   1700  O  OG    . SER A  1 216 ? -2.054  -9.363  26.046  1.00 31.56  ? 357 SER A OG    1 
ATOM   1701  N  N     . PHE A  1 217 ? 2.018   -11.298 25.842  1.00 45.46  ? 358 PHE A N     1 
ATOM   1702  C  CA    . PHE A  1 217 ? 3.376   -11.644 25.399  1.00 45.18  ? 358 PHE A CA    1 
ATOM   1703  C  C     . PHE A  1 217 ? 4.426   -11.495 26.500  1.00 52.84  ? 358 PHE A C     1 
ATOM   1704  O  O     . PHE A  1 217 ? 4.851   -12.498 27.072  1.00 59.32  ? 358 PHE A O     1 
ATOM   1705  C  CB    . PHE A  1 217 ? 3.762   -10.908 24.114  1.00 38.81  ? 358 PHE A CB    1 
ATOM   1706  C  CG    . PHE A  1 217 ? 2.856   -11.215 22.966  1.00 35.60  ? 358 PHE A CG    1 
ATOM   1707  C  CD1   . PHE A  1 217 ? 2.973   -12.415 22.280  1.00 36.21  ? 358 PHE A CD1   1 
ATOM   1708  C  CD2   . PHE A  1 217 ? 1.869   -10.320 22.588  1.00 36.03  ? 358 PHE A CD2   1 
ATOM   1709  C  CE1   . PHE A  1 217 ? 2.130   -12.714 21.230  1.00 35.07  ? 358 PHE A CE1   1 
ATOM   1710  C  CE2   . PHE A  1 217 ? 1.024   -10.608 21.533  1.00 36.98  ? 358 PHE A CE2   1 
ATOM   1711  C  CZ    . PHE A  1 217 ? 1.156   -11.809 20.854  1.00 37.06  ? 358 PHE A CZ    1 
ATOM   1712  N  N     . GLN A  1 218 ? 4.857   -10.266 26.779  1.00 55.05  ? 359 GLN A N     1 
ATOM   1713  C  CA    . GLN A  1 218 ? 5.621   -9.969  27.997  1.00 52.94  ? 359 GLN A CA    1 
ATOM   1714  C  C     . GLN A  1 218 ? 6.882   -10.808 28.195  1.00 50.65  ? 359 GLN A C     1 
ATOM   1715  O  O     . GLN A  1 218 ? 7.994   -10.279 28.221  1.00 50.47  ? 359 GLN A O     1 
ATOM   1716  C  CB    . GLN A  1 218 ? 4.708   -10.111 29.213  1.00 53.82  ? 359 GLN A CB    1 
ATOM   1717  C  CG    . GLN A  1 218 ? 5.394   -10.016 30.558  1.00 58.23  ? 359 GLN A CG    1 
ATOM   1718  C  CD    . GLN A  1 218 ? 4.454   -10.361 31.694  1.00 65.38  ? 359 GLN A CD    1 
ATOM   1719  O  OE1   . GLN A  1 218 ? 3.491   -11.104 31.510  1.00 66.49  ? 359 GLN A OE1   1 
ATOM   1720  N  NE2   . GLN A  1 218 ? 4.726   -9.821  32.874  1.00 69.30  ? 359 GLN A NE2   1 
ATOM   1721  N  N     . GLY A  1 219 ? 6.702   -12.115 28.351  1.00 51.24  ? 360 GLY A N     1 
ATOM   1722  C  CA    . GLY A  1 219 ? 7.821   -13.018 28.537  1.00 51.16  ? 360 GLY A CA    1 
ATOM   1723  C  C     . GLY A  1 219 ? 8.486   -13.439 27.238  1.00 50.05  ? 360 GLY A C     1 
ATOM   1724  O  O     . GLY A  1 219 ? 9.510   -14.128 27.258  1.00 55.46  ? 360 GLY A O     1 
ATOM   1725  N  N     . GLU A  1 220 ? 7.914   -13.037 26.107  1.00 41.41  ? 361 GLU A N     1 
ATOM   1726  C  CA    . GLU A  1 220 ? 8.515   -13.364 24.818  1.00 42.84  ? 361 GLU A CA    1 
ATOM   1727  C  C     . GLU A  1 220 ? 9.004   -12.120 24.079  1.00 43.17  ? 361 GLU A C     1 
ATOM   1728  O  O     . GLU A  1 220 ? 9.466   -12.207 22.937  1.00 44.13  ? 361 GLU A O     1 
ATOM   1729  C  CB    . GLU A  1 220 ? 7.540   -14.147 23.935  1.00 41.67  ? 361 GLU A CB    1 
ATOM   1730  C  CG    . GLU A  1 220 ? 7.049   -15.460 24.519  1.00 38.74  ? 361 GLU A CG    1 
ATOM   1731  C  CD    . GLU A  1 220 ? 5.869   -15.277 25.446  1.00 40.81  ? 361 GLU A CD    1 
ATOM   1732  O  OE1   . GLU A  1 220 ? 5.907   -15.818 26.568  1.00 46.11  ? 361 GLU A OE1   1 
ATOM   1733  O  OE2   . GLU A  1 220 ? 4.896   -14.602 25.051  1.00 38.78  ? 361 GLU A OE2   1 
ATOM   1734  N  N     . THR A  1 221 ? 8.916   -10.972 24.745  1.00 42.39  ? 362 THR A N     1 
ATOM   1735  C  CA    . THR A  1 221 ? 9.244   -9.689  24.125  1.00 41.38  ? 362 THR A CA    1 
ATOM   1736  C  C     . THR A  1 221 ? 10.724  -9.315  24.278  1.00 39.68  ? 362 THR A C     1 
ATOM   1737  O  O     . THR A  1 221 ? 11.266  -9.301  25.385  1.00 36.09  ? 362 THR A O     1 
ATOM   1738  C  CB    . THR A  1 221 ? 8.348   -8.554  24.676  1.00 40.55  ? 362 THR A CB    1 
ATOM   1739  O  OG1   . THR A  1 221 ? 6.969   -8.937  24.573  1.00 40.58  ? 362 THR A OG1   1 
ATOM   1740  C  CG2   . THR A  1 221 ? 8.572   -7.270  23.900  1.00 39.80  ? 362 THR A CG2   1 
ATOM   1741  N  N     . TRP A  1 222 ? 11.372  -9.011  23.156  1.00 44.17  ? 363 TRP A N     1 
ATOM   1742  C  CA    . TRP A  1 222 ? 12.773  -8.598  23.169  1.00 41.83  ? 363 TRP A CA    1 
ATOM   1743  C  C     . TRP A  1 222 ? 12.919  -7.106  22.897  1.00 40.66  ? 363 TRP A C     1 
ATOM   1744  O  O     . TRP A  1 222 ? 11.994  -6.462  22.388  1.00 46.65  ? 363 TRP A O     1 
ATOM   1745  C  CB    . TRP A  1 222 ? 13.583  -9.404  22.154  1.00 38.15  ? 363 TRP A CB    1 
ATOM   1746  C  CG    . TRP A  1 222 ? 13.560  -10.872 22.429  1.00 38.97  ? 363 TRP A CG    1 
ATOM   1747  C  CD1   . TRP A  1 222 ? 12.581  -11.757 22.078  1.00 44.15  ? 363 TRP A CD1   1 
ATOM   1748  C  CD2   . TRP A  1 222 ? 14.558  -11.633 23.120  1.00 35.41  ? 363 TRP A CD2   1 
ATOM   1749  N  NE1   . TRP A  1 222 ? 12.909  -13.021 22.511  1.00 45.19  ? 363 TRP A NE1   1 
ATOM   1750  C  CE2   . TRP A  1 222 ? 14.120  -12.970 23.152  1.00 40.82  ? 363 TRP A CE2   1 
ATOM   1751  C  CE3   . TRP A  1 222 ? 15.778  -11.311 23.715  1.00 35.55  ? 363 TRP A CE3   1 
ATOM   1752  C  CZ2   . TRP A  1 222 ? 14.865  -13.985 23.757  1.00 41.68  ? 363 TRP A CZ2   1 
ATOM   1753  C  CZ3   . TRP A  1 222 ? 16.513  -12.318 24.314  1.00 37.32  ? 363 TRP A CZ3   1 
ATOM   1754  C  CH2   . TRP A  1 222 ? 16.057  -13.636 24.332  1.00 39.88  ? 363 TRP A CH2   1 
ATOM   1755  N  N     . ARG A  1 223 ? 14.087  -6.571  23.242  1.00 34.52  ? 364 ARG A N     1 
ATOM   1756  C  CA    . ARG A  1 223 ? 14.393  -5.157  23.071  1.00 37.17  ? 364 ARG A CA    1 
ATOM   1757  C  C     . ARG A  1 223 ? 15.726  -5.018  22.341  1.00 38.08  ? 364 ARG A C     1 
ATOM   1758  O  O     . ARG A  1 223 ? 16.650  -5.793  22.583  1.00 34.70  ? 364 ARG A O     1 
ATOM   1759  C  CB    . ARG A  1 223 ? 14.472  -4.473  24.438  1.00 39.73  ? 364 ARG A CB    1 
ATOM   1760  C  CG    . ARG A  1 223 ? 14.612  -2.955  24.390  1.00 44.81  ? 364 ARG A CG    1 
ATOM   1761  C  CD    . ARG A  1 223 ? 14.949  -2.391  25.766  1.00 52.04  ? 364 ARG A CD    1 
ATOM   1762  N  NE    . ARG A  1 223 ? 16.345  -2.621  26.136  1.00 56.26  ? 364 ARG A NE    1 
ATOM   1763  C  CZ    . ARG A  1 223 ? 16.764  -2.865  27.375  1.00 60.35  ? 364 ARG A CZ    1 
ATOM   1764  N  NH1   . ARG A  1 223 ? 15.896  -2.919  28.375  1.00 61.82  ? 364 ARG A NH1   1 
ATOM   1765  N  NH2   . ARG A  1 223 ? 18.054  -3.062  27.617  1.00 61.34  ? 364 ARG A NH2   1 
ATOM   1766  N  N     . LEU A  1 224 ? 15.828  -4.038  21.447  1.00 39.12  ? 365 LEU A N     1 
ATOM   1767  C  CA    . LEU A  1 224 ? 17.055  -3.841  20.680  1.00 38.52  ? 365 LEU A CA    1 
ATOM   1768  C  C     . LEU A  1 224 ? 18.186  -3.274  21.534  1.00 38.02  ? 365 LEU A C     1 
ATOM   1769  O  O     . LEU A  1 224 ? 17.950  -2.457  22.430  1.00 38.44  ? 365 LEU A O     1 
ATOM   1770  C  CB    . LEU A  1 224 ? 16.800  -2.934  19.477  1.00 40.78  ? 365 LEU A CB    1 
ATOM   1771  C  CG    . LEU A  1 224 ? 15.989  -3.533  18.330  1.00 40.66  ? 365 LEU A CG    1 
ATOM   1772  C  CD1   . LEU A  1 224 ? 15.758  -2.506  17.236  1.00 38.64  ? 365 LEU A CD1   1 
ATOM   1773  C  CD2   . LEU A  1 224 ? 16.694  -4.745  17.767  1.00 43.05  ? 365 LEU A CD2   1 
ATOM   1774  N  N     . SER A  1 225 ? 19.411  -3.723  21.263  1.00 35.49  ? 366 SER A N     1 
ATOM   1775  C  CA    . SER A  1 225 ? 20.592  -3.188  21.936  1.00 34.47  ? 366 SER A CA    1 
ATOM   1776  C  C     . SER A  1 225 ? 21.744  -2.884  20.974  1.00 33.46  ? 366 SER A C     1 
ATOM   1777  O  O     . SER A  1 225 ? 22.035  -3.653  20.028  1.00 30.65  ? 366 SER A O     1 
ATOM   1778  C  CB    . SER A  1 225 ? 21.060  -4.102  23.070  1.00 35.75  ? 366 SER A CB    1 
ATOM   1779  O  OG    . SER A  1 225 ? 21.969  -3.417  23.913  1.00 39.95  ? 366 SER A OG    1 
ATOM   1780  N  N     . PHE A  1 226 ? 22.383  -1.748  21.252  1.00 36.05  ? 367 PHE A N     1 
ATOM   1781  C  CA    . PHE A  1 226 ? 23.467  -1.205  20.453  1.00 37.81  ? 367 PHE A CA    1 
ATOM   1782  C  C     . PHE A  1 226 ? 24.576  -0.699  21.371  1.00 36.66  ? 367 PHE A C     1 
ATOM   1783  O  O     . PHE A  1 226 ? 25.188  0.328   21.096  1.00 38.40  ? 367 PHE A O     1 
ATOM   1784  C  CB    . PHE A  1 226 ? 22.954  -0.037  19.606  1.00 38.46  ? 367 PHE A CB    1 
ATOM   1785  C  CG    . PHE A  1 226 ? 21.916  -0.424  18.596  1.00 39.87  ? 367 PHE A CG    1 
ATOM   1786  C  CD1   . PHE A  1 226 ? 22.278  -1.095  17.439  1.00 40.21  ? 367 PHE A CD1   1 
ATOM   1787  C  CD2   . PHE A  1 226 ? 20.581  -0.106  18.795  1.00 45.29  ? 367 PHE A CD2   1 
ATOM   1788  C  CE1   . PHE A  1 226 ? 21.326  -1.452  16.500  1.00 42.25  ? 367 PHE A CE1   1 
ATOM   1789  C  CE2   . PHE A  1 226 ? 19.622  -0.458  17.860  1.00 48.20  ? 367 PHE A CE2   1 
ATOM   1790  C  CZ    . PHE A  1 226 ? 19.997  -1.131  16.710  1.00 46.88  ? 367 PHE A CZ    1 
ATOM   1791  N  N     . SER A  1 227 ? 24.826  -1.414  22.464  1.00 37.05  ? 368 SER A N     1 
ATOM   1792  C  CA    . SER A  1 227 ? 25.829  -1.002  23.441  1.00 34.79  ? 368 SER A CA    1 
ATOM   1793  C  C     . SER A  1 227 ? 27.225  -1.018  22.839  1.00 35.14  ? 368 SER A C     1 
ATOM   1794  O  O     . SER A  1 227 ? 28.103  -0.251  23.253  1.00 40.15  ? 368 SER A O     1 
ATOM   1795  C  CB    . SER A  1 227 ? 25.781  -1.906  24.672  1.00 35.10  ? 368 SER A CB    1 
ATOM   1796  O  OG    . SER A  1 227 ? 24.494  -1.915  25.253  1.00 33.28  ? 368 SER A OG    1 
ATOM   1797  N  N     . HIS A  1 228 ? 27.417  -1.893  21.857  1.00 30.98  ? 369 HIS A N     1 
ATOM   1798  C  CA    . HIS A  1 228 ? 28.676  -1.971  21.127  1.00 33.12  ? 369 HIS A CA    1 
ATOM   1799  C  C     . HIS A  1 228 ? 28.916  -0.730  20.264  1.00 38.63  ? 369 HIS A C     1 
ATOM   1800  O  O     . HIS A  1 228 ? 29.992  -0.119  20.318  1.00 41.45  ? 369 HIS A O     1 
ATOM   1801  C  CB    . HIS A  1 228 ? 28.740  -3.252  20.283  1.00 32.78  ? 369 HIS A CB    1 
ATOM   1802  C  CG    . HIS A  1 228 ? 27.684  -3.352  19.225  1.00 33.97  ? 369 HIS A CG    1 
ATOM   1803  N  ND1   . HIS A  1 228 ? 26.393  -2.889  19.402  1.00 35.00  ? 369 HIS A ND1   1 
ATOM   1804  C  CD2   . HIS A  1 228 ? 27.722  -3.870  17.976  1.00 33.01  ? 369 HIS A CD2   1 
ATOM   1805  C  CE1   . HIS A  1 228 ? 25.692  -3.114  18.309  1.00 30.43  ? 369 HIS A CE1   1 
ATOM   1806  N  NE2   . HIS A  1 228 ? 26.475  -3.711  17.425  1.00 29.90  ? 369 HIS A NE2   1 
ATOM   1807  N  N     . THR A  1 229 ? 27.903  -0.358  19.485  1.00 39.81  ? 370 THR A N     1 
ATOM   1808  C  CA    . THR A  1 229 ? 27.959  0.825   18.634  1.00 39.96  ? 370 THR A CA    1 
ATOM   1809  C  C     . THR A  1 229 ? 28.250  2.056   19.485  1.00 40.26  ? 370 THR A C     1 
ATOM   1810  O  O     . THR A  1 229 ? 29.074  2.897   19.120  1.00 43.23  ? 370 THR A O     1 
ATOM   1811  C  CB    . THR A  1 229 ? 26.631  1.034   17.875  1.00 37.12  ? 370 THR A CB    1 
ATOM   1812  O  OG1   . THR A  1 229 ? 26.242  -0.180  17.220  1.00 30.61  ? 370 THR A OG1   1 
ATOM   1813  C  CG2   . THR A  1 229 ? 26.777  2.121   16.841  1.00 39.70  ? 370 THR A CG2   1 
ATOM   1814  N  N     . GLU A  1 230 ? 27.570  2.146   20.625  1.00 38.65  ? 371 GLU A N     1 
ATOM   1815  C  CA    . GLU A  1 230 ? 27.750  3.259   21.551  1.00 36.85  ? 371 GLU A CA    1 
ATOM   1816  C  C     . GLU A  1 230 ? 29.157  3.287   22.138  1.00 39.08  ? 371 GLU A C     1 
ATOM   1817  O  O     . GLU A  1 230 ? 29.741  4.354   22.305  1.00 39.97  ? 371 GLU A O     1 
ATOM   1818  C  CB    . GLU A  1 230 ? 26.723  3.176   22.683  1.00 32.05  ? 371 GLU A CB    1 
ATOM   1819  C  CG    . GLU A  1 230 ? 25.276  3.311   22.241  1.00 27.91  ? 371 GLU A CG    1 
ATOM   1820  C  CD    . GLU A  1 230 ? 24.315  2.918   23.338  1.00 28.53  ? 371 GLU A CD    1 
ATOM   1821  O  OE1   . GLU A  1 230 ? 24.759  2.820   24.500  1.00 25.87  ? 371 GLU A OE1   1 
ATOM   1822  O  OE2   . GLU A  1 230 ? 23.123  2.700   23.040  1.00 31.99  ? 371 GLU A OE2   1 
ATOM   1823  N  N     . LYS A  1 231 ? 29.684  2.114   22.480  1.00 38.12  ? 372 LYS A N     1 
ATOM   1824  C  CA    . LYS A  1 231 ? 31.055  2.011   22.979  1.00 34.51  ? 372 LYS A CA    1 
ATOM   1825  C  C     . LYS A  1 231 ? 32.047  2.542   21.942  1.00 31.93  ? 372 LYS A C     1 
ATOM   1826  O  O     . LYS A  1 231 ? 32.930  3.345   22.271  1.00 32.55  ? 372 LYS A O     1 
ATOM   1827  C  CB    . LYS A  1 231 ? 31.375  0.561   23.340  1.00 32.57  ? 372 LYS A CB    1 
ATOM   1828  C  CG    . LYS A  1 231 ? 32.793  0.323   23.826  1.00 32.38  ? 372 LYS A CG    1 
ATOM   1829  C  CD    . LYS A  1 231 ? 33.069  -1.171  23.898  1.00 31.63  ? 372 LYS A CD    1 
ATOM   1830  C  CE    . LYS A  1 231 ? 34.464  -1.460  24.397  1.00 26.13  ? 372 LYS A CE    1 
ATOM   1831  N  NZ    . LYS A  1 231 ? 34.687  -2.925  24.420  1.00 23.64  ? 372 LYS A NZ    1 
ATOM   1832  N  N     . TYR A  1 232 ? 31.885  2.109   20.690  1.00 35.50  ? 373 TYR A N     1 
ATOM   1833  C  CA    . TYR A  1 232 ? 32.699  2.623   19.583  1.00 33.96  ? 373 TYR A CA    1 
ATOM   1834  C  C     . TYR A  1 232 ? 32.595  4.141   19.485  1.00 33.57  ? 373 TYR A C     1 
ATOM   1835  O  O     . TYR A  1 232 ? 33.611  4.823   19.391  1.00 36.72  ? 373 TYR A O     1 
ATOM   1836  C  CB    . TYR A  1 232 ? 32.282  1.994   18.245  1.00 33.44  ? 373 TYR A CB    1 
ATOM   1837  C  CG    . TYR A  1 232 ? 33.090  2.470   17.044  1.00 35.33  ? 373 TYR A CG    1 
ATOM   1838  C  CD1   . TYR A  1 232 ? 32.758  3.640   16.371  1.00 36.40  ? 373 TYR A CD1   1 
ATOM   1839  C  CD2   . TYR A  1 232 ? 34.172  1.741   16.575  1.00 35.24  ? 373 TYR A CD2   1 
ATOM   1840  C  CE1   . TYR A  1 232 ? 33.487  4.074   15.277  1.00 31.55  ? 373 TYR A CE1   1 
ATOM   1841  C  CE2   . TYR A  1 232 ? 34.904  2.168   15.478  1.00 32.44  ? 373 TYR A CE2   1 
ATOM   1842  C  CZ    . TYR A  1 232 ? 34.555  3.333   14.835  1.00 33.15  ? 373 TYR A CZ    1 
ATOM   1843  O  OH    . TYR A  1 232 ? 35.278  3.767   13.747  1.00 39.04  ? 373 TYR A OH    1 
ATOM   1844  N  N     . ILE A  1 233 ? 31.366  4.656   19.483  1.00 32.20  ? 374 ILE A N     1 
ATOM   1845  C  CA    . ILE A  1 233 ? 31.121  6.093   19.373  1.00 31.02  ? 374 ILE A CA    1 
ATOM   1846  C  C     . ILE A  1 233 ? 31.803  6.871   20.500  1.00 33.09  ? 374 ILE A C     1 
ATOM   1847  O  O     . ILE A  1 233 ? 32.365  7.940   20.267  1.00 41.01  ? 374 ILE A O     1 
ATOM   1848  C  CB    . ILE A  1 233 ? 29.605  6.408   19.359  1.00 34.88  ? 374 ILE A CB    1 
ATOM   1849  C  CG1   . ILE A  1 233 ? 28.946  5.895   18.079  1.00 33.76  ? 374 ILE A CG1   1 
ATOM   1850  C  CG2   . ILE A  1 233 ? 29.353  7.898   19.486  1.00 36.79  ? 374 ILE A CG2   1 
ATOM   1851  C  CD1   . ILE A  1 233 ? 27.430  6.090   18.044  1.00 31.25  ? 374 ILE A CD1   1 
ATOM   1852  N  N     . LEU A  1 234 ? 31.753  6.336   21.717  1.00 28.97  ? 375 LEU A N     1 
ATOM   1853  C  CA    . LEU A  1 234 ? 32.391  6.980   22.860  1.00 27.83  ? 375 LEU A CA    1 
ATOM   1854  C  C     . LEU A  1 234 ? 33.910  6.964   22.724  1.00 32.30  ? 375 LEU A C     1 
ATOM   1855  O  O     . LEU A  1 234 ? 34.589  7.893   23.172  1.00 32.52  ? 375 LEU A O     1 
ATOM   1856  C  CB    . LEU A  1 234 ? 31.984  6.299   24.164  1.00 28.33  ? 375 LEU A CB    1 
ATOM   1857  C  CG    . LEU A  1 234 ? 30.899  6.939   25.032  1.00 29.86  ? 375 LEU A CG    1 
ATOM   1858  C  CD1   . LEU A  1 234 ? 31.330  8.309   25.494  1.00 24.15  ? 375 LEU A CD1   1 
ATOM   1859  C  CD2   . LEU A  1 234 ? 29.576  7.026   24.295  1.00 30.48  ? 375 LEU A CD2   1 
ATOM   1860  N  N     . ASN A  1 235 ? 34.440  5.907   22.110  1.00 34.84  ? 376 ASN A N     1 
ATOM   1861  C  CA    . ASN A  1 235 ? 35.880  5.791   21.918  1.00 31.58  ? 376 ASN A CA    1 
ATOM   1862  C  C     . ASN A  1 235 ? 36.374  6.513   20.670  1.00 32.59  ? 376 ASN A C     1 
ATOM   1863  O  O     . ASN A  1 235 ? 37.563  6.801   20.547  1.00 32.84  ? 376 ASN A O     1 
ATOM   1864  C  CB    . ASN A  1 235 ? 36.295  4.321   21.874  1.00 36.32  ? 376 ASN A CB    1 
ATOM   1865  C  CG    . ASN A  1 235 ? 36.097  3.619   23.203  1.00 42.47  ? 376 ASN A CG    1 
ATOM   1866  O  OD1   . ASN A  1 235 ? 36.247  4.222   24.266  1.00 40.37  ? 376 ASN A OD1   1 
ATOM   1867  N  ND2   . ASN A  1 235 ? 35.763  2.334   23.149  1.00 46.20  ? 376 ASN A ND2   1 
ATOM   1868  N  N     . ASN A  1 236 ? 35.459  6.784   19.742  1.00 27.72  ? 377 ASN A N     1 
ATOM   1869  C  CA    . ASN A  1 236 ? 35.772  7.519   18.519  1.00 27.63  ? 377 ASN A CA    1 
ATOM   1870  C  C     . ASN A  1 236 ? 34.783  8.667   18.336  1.00 28.61  ? 377 ASN A C     1 
ATOM   1871  O  O     . ASN A  1 236 ? 33.926  8.617   17.460  1.00 30.60  ? 377 ASN A O     1 
ATOM   1872  C  CB    . ASN A  1 236 ? 35.700  6.593   17.301  1.00 25.53  ? 377 ASN A CB    1 
ATOM   1873  C  CG    . ASN A  1 236 ? 36.622  5.401   17.411  1.00 24.64  ? 377 ASN A CG    1 
ATOM   1874  O  OD1   . ASN A  1 236 ? 37.757  5.435   16.944  1.00 28.88  ? 377 ASN A OD1   1 
ATOM   1875  N  ND2   . ASN A  1 236 ? 36.129  4.328   18.012  1.00 20.53  ? 377 ASN A ND2   1 
ATOM   1876  N  N     . HIS A  1 237 ? 34.923  9.706   19.151  1.00 33.29  ? 378 HIS A N     1 
ATOM   1877  C  CA    . HIS A  1 237 ? 33.890  10.728  19.285  1.00 37.09  ? 378 HIS A CA    1 
ATOM   1878  C  C     . HIS A  1 237 ? 34.122  12.034  18.515  1.00 43.58  ? 378 HIS A C     1 
ATOM   1879  O  O     . HIS A  1 237 ? 33.180  12.800  18.295  1.00 50.11  ? 378 HIS A O     1 
ATOM   1880  C  CB    . HIS A  1 237 ? 33.665  11.039  20.767  1.00 39.31  ? 378 HIS A CB    1 
ATOM   1881  C  CG    . HIS A  1 237 ? 34.900  11.482  21.487  1.00 41.06  ? 378 HIS A CG    1 
ATOM   1882  N  ND1   . HIS A  1 237 ? 35.505  10.716  22.466  1.00 42.32  ? 378 HIS A ND1   1 
ATOM   1883  C  CD2   . HIS A  1 237 ? 35.643  12.607  21.382  1.00 41.76  ? 378 HIS A CD2   1 
ATOM   1884  C  CE1   . HIS A  1 237 ? 36.568  11.358  22.926  1.00 42.70  ? 378 HIS A CE1   1 
ATOM   1885  N  NE2   . HIS A  1 237 ? 36.671  12.506  22.283  1.00 41.88  ? 378 HIS A NE2   1 
ATOM   1886  N  N     . GLY A  1 238 ? 35.359  12.295  18.103  1.00 41.25  ? 379 GLY A N     1 
ATOM   1887  C  CA    . GLY A  1 238 ? 35.667  13.543  17.423  1.00 40.36  ? 379 GLY A CA    1 
ATOM   1888  C  C     . GLY A  1 238 ? 35.264  13.591  15.959  1.00 40.61  ? 379 GLY A C     1 
ATOM   1889  O  O     . GLY A  1 238 ? 34.966  12.560  15.352  1.00 40.13  ? 379 GLY A O     1 
ATOM   1890  N  N     . ILE A  1 239 ? 35.243  14.796  15.395  1.00 39.31  ? 380 ILE A N     1 
ATOM   1891  C  CA    . ILE A  1 239 ? 35.045  14.962  13.961  1.00 39.91  ? 380 ILE A CA    1 
ATOM   1892  C  C     . ILE A  1 239 ? 36.404  14.864  13.301  1.00 38.69  ? 380 ILE A C     1 
ATOM   1893  O  O     . ILE A  1 239 ? 36.520  14.520  12.123  1.00 42.67  ? 380 ILE A O     1 
ATOM   1894  C  CB    . ILE A  1 239 ? 34.370  16.315  13.615  1.00 38.63  ? 380 ILE A CB    1 
ATOM   1895  C  CG1   . ILE A  1 239 ? 34.076  16.406  12.118  1.00 32.43  ? 380 ILE A CG1   1 
ATOM   1896  C  CG2   . ILE A  1 239 ? 35.223  17.495  14.054  1.00 38.70  ? 380 ILE A CG2   1 
ATOM   1897  C  CD1   . ILE A  1 239 ? 33.396  17.690  11.713  1.00 34.35  ? 380 ILE A CD1   1 
ATOM   1898  N  N     . GLU A  1 240 ? 37.434  15.176  14.082  1.00 36.53  ? 381 GLU A N     1 
ATOM   1899  C  CA    . GLU A  1 240 ? 38.810  14.959  13.670  1.00 34.99  ? 381 GLU A CA    1 
ATOM   1900  C  C     . GLU A  1 240 ? 39.286  13.665  14.314  1.00 35.01  ? 381 GLU A C     1 
ATOM   1901  O  O     . GLU A  1 240 ? 39.061  13.442  15.506  1.00 32.91  ? 381 GLU A O     1 
ATOM   1902  C  CB    . GLU A  1 240 ? 39.702  16.115  14.121  1.00 36.78  ? 381 GLU A CB    1 
ATOM   1903  C  CG    . GLU A  1 240 ? 39.370  17.467  13.501  1.00 39.16  ? 381 GLU A CG    1 
ATOM   1904  C  CD    . GLU A  1 240 ? 40.343  18.549  13.929  1.00 44.51  ? 381 GLU A CD    1 
ATOM   1905  O  OE1   . GLU A  1 240 ? 41.183  18.279  14.813  1.00 48.07  ? 381 GLU A OE1   1 
ATOM   1906  O  OE2   . GLU A  1 240 ? 40.274  19.668  13.382  1.00 46.22  ? 381 GLU A OE2   1 
ATOM   1907  N  N     . LYS A  1 241 ? 39.949  12.822  13.531  1.00 36.47  ? 382 LYS A N     1 
ATOM   1908  C  CA    . LYS A  1 241 ? 40.382  11.510  13.999  1.00 33.66  ? 382 LYS A CA    1 
ATOM   1909  C  C     . LYS A  1 241 ? 41.349  11.577  15.188  1.00 35.17  ? 382 LYS A C     1 
ATOM   1910  O  O     . LYS A  1 241 ? 41.421  10.646  15.986  1.00 32.69  ? 382 LYS A O     1 
ATOM   1911  C  CB    . LYS A  1 241 ? 41.008  10.734  12.842  1.00 29.35  ? 382 LYS A CB    1 
ATOM   1912  C  CG    . LYS A  1 241 ? 40.068  10.533  11.657  1.00 29.42  ? 382 LYS A CG    1 
ATOM   1913  C  CD    . LYS A  1 241 ? 40.814  10.623  10.335  1.00 29.58  ? 382 LYS A CD    1 
ATOM   1914  C  CE    . LYS A  1 241 ? 39.874  10.413  9.156   1.00 29.85  ? 382 LYS A CE    1 
ATOM   1915  N  NZ    . LYS A  1 241 ? 40.548  10.642  7.847   1.00 31.93  ? 382 LYS A NZ    1 
ATOM   1916  N  N     . THR A  1 242 ? 42.071  12.687  15.313  1.00 38.37  ? 383 THR A N     1 
ATOM   1917  C  CA    . THR A  1 242 ? 43.085  12.833  16.357  1.00 37.16  ? 383 THR A CA    1 
ATOM   1918  C  C     . THR A  1 242 ? 42.555  13.404  17.669  1.00 35.28  ? 383 THR A C     1 
ATOM   1919  O  O     . THR A  1 242 ? 43.338  13.774  18.538  1.00 36.77  ? 383 THR A O     1 
ATOM   1920  C  CB    . THR A  1 242 ? 44.229  13.749  15.895  1.00 37.02  ? 383 THR A CB    1 
ATOM   1921  O  OG1   . THR A  1 242 ? 43.723  15.072  15.690  1.00 41.05  ? 383 THR A OG1   1 
ATOM   1922  C  CG2   . THR A  1 242 ? 44.839  13.234  14.606  1.00 32.44  ? 383 THR A CG2   1 
ATOM   1923  N  N     . CYS A  1 243 ? 41.238  13.477  17.817  1.00 36.64  ? 384 CYS A N     1 
ATOM   1924  C  CA    . CYS A  1 243 ? 40.640  14.046  19.023  1.00 32.94  ? 384 CYS A CA    1 
ATOM   1925  C  C     . CYS A  1 243 ? 40.981  13.213  20.256  1.00 40.10  ? 384 CYS A C     1 
ATOM   1926  O  O     . CYS A  1 243 ? 40.846  11.988  20.237  1.00 41.33  ? 384 CYS A O     1 
ATOM   1927  C  CB    . CYS A  1 243 ? 39.127  14.155  18.855  1.00 26.32  ? 384 CYS A CB    1 
ATOM   1928  S  SG    . CYS A  1 243 ? 38.259  15.089  20.146  1.00 51.56  ? 384 CYS A SG    1 
ATOM   1929  N  N     . CYS A  1 244 ? 41.444  13.887  21.311  1.00 42.62  ? 385 CYS A N     1 
ATOM   1930  C  CA    . CYS A  1 244 ? 41.826  13.244  22.577  1.00 41.23  ? 385 CYS A CA    1 
ATOM   1931  C  C     . CYS A  1 244 ? 43.015  12.274  22.472  1.00 39.71  ? 385 CYS A C     1 
ATOM   1932  O  O     . CYS A  1 244 ? 43.410  11.668  23.472  1.00 40.43  ? 385 CYS A O     1 
ATOM   1933  C  CB    . CYS A  1 244 ? 40.630  12.540  23.233  1.00 41.52  ? 385 CYS A CB    1 
ATOM   1934  S  SG    . CYS A  1 244 ? 39.382  13.644  23.933  1.00 34.01  ? 385 CYS A SG    1 
ATOM   1935  N  N     . GLU A  1 245 ? 43.586  12.135  21.278  1.00 36.81  ? 386 GLU A N     1 
ATOM   1936  C  CA    . GLU A  1 245 ? 44.751  11.272  21.086  1.00 36.46  ? 386 GLU A CA    1 
ATOM   1937  C  C     . GLU A  1 245 ? 46.053  11.964  21.501  1.00 39.45  ? 386 GLU A C     1 
ATOM   1938  O  O     . GLU A  1 245 ? 46.070  13.168  21.756  1.00 39.46  ? 386 GLU A O     1 
ATOM   1939  C  CB    . GLU A  1 245 ? 44.865  10.836  19.628  1.00 34.26  ? 386 GLU A CB    1 
ATOM   1940  C  CG    . GLU A  1 245 ? 43.861  9.785   19.172  1.00 27.17  ? 386 GLU A CG    1 
ATOM   1941  C  CD    . GLU A  1 245 ? 44.104  9.388   17.730  1.00 21.23  ? 386 GLU A CD    1 
ATOM   1942  O  OE1   . GLU A  1 245 ? 44.887  10.087  17.065  1.00 26.54  ? 386 GLU A OE1   1 
ATOM   1943  O  OE2   . GLU A  1 245 ? 43.524  8.393   17.258  1.00 18.95  ? 386 GLU A OE2   1 
ATOM   1944  N  N     . SER A  1 246 ? 47.145  11.203  21.532  1.00 40.63  ? 387 SER A N     1 
ATOM   1945  C  CA    . SER A  1 246 ? 48.436  11.721  21.981  1.00 50.16  ? 387 SER A CA    1 
ATOM   1946  C  C     . SER A  1 246 ? 49.089  12.661  20.965  1.00 56.88  ? 387 SER A C     1 
ATOM   1947  O  O     . SER A  1 246 ? 50.183  13.177  21.200  1.00 62.55  ? 387 SER A O     1 
ATOM   1948  C  CB    . SER A  1 246 ? 49.391  10.572  22.297  1.00 53.92  ? 387 SER A CB    1 
ATOM   1949  O  OG    . SER A  1 246 ? 49.753  9.881   21.116  1.00 57.21  ? 387 SER A OG    1 
ATOM   1950  N  N     . SER A  1 247 ? 48.421  12.874  19.836  1.00 56.20  ? 388 SER A N     1 
ATOM   1951  C  CA    . SER A  1 247 ? 48.885  13.832  18.844  1.00 50.74  ? 388 SER A CA    1 
ATOM   1952  C  C     . SER A  1 247 ? 47.721  14.702  18.405  1.00 49.32  ? 388 SER A C     1 
ATOM   1953  O  O     . SER A  1 247 ? 47.687  15.193  17.276  1.00 50.74  ? 388 SER A O     1 
ATOM   1954  C  CB    . SER A  1 247 ? 49.513  13.120  17.647  1.00 47.20  ? 388 SER A CB    1 
ATOM   1955  O  OG    . SER A  1 247 ? 50.752  12.535  17.997  1.00 45.20  ? 388 SER A OG    1 
ATOM   1956  N  N     . GLY A  1 248 ? 46.767  14.895  19.309  1.00 48.67  ? 389 GLY A N     1 
ATOM   1957  C  CA    . GLY A  1 248 ? 45.598  15.692  18.999  1.00 46.13  ? 389 GLY A CA    1 
ATOM   1958  C  C     . GLY A  1 248 ? 45.105  16.527  20.162  1.00 46.50  ? 389 GLY A C     1 
ATOM   1959  O  O     . GLY A  1 248 ? 45.759  16.623  21.203  1.00 47.33  ? 389 GLY A O     1 
ATOM   1960  N  N     . ALA A  1 249 ? 43.940  17.138  19.982  1.00 43.63  ? 390 ALA A N     1 
ATOM   1961  C  CA    . ALA A  1 249 ? 43.397  18.023  20.998  1.00 44.85  ? 390 ALA A CA    1 
ATOM   1962  C  C     . ALA A  1 249 ? 42.281  17.346  21.782  1.00 48.77  ? 390 ALA A C     1 
ATOM   1963  O  O     . ALA A  1 249 ? 41.381  16.728  21.203  1.00 49.08  ? 390 ALA A O     1 
ATOM   1964  C  CB    . ALA A  1 249 ? 42.903  19.313  20.369  1.00 42.77  ? 390 ALA A CB    1 
ATOM   1965  N  N     . LYS A  1 250 ? 42.347  17.471  23.104  1.00 48.77  ? 391 LYS A N     1 
ATOM   1966  C  CA    . LYS A  1 250 ? 41.318  16.931  23.976  1.00 43.09  ? 391 LYS A CA    1 
ATOM   1967  C  C     . LYS A  1 250 ? 40.043  17.762  23.873  1.00 43.47  ? 391 LYS A C     1 
ATOM   1968  O  O     . LYS A  1 250 ? 40.098  18.979  23.717  1.00 46.88  ? 391 LYS A O     1 
ATOM   1969  C  CB    . LYS A  1 250 ? 41.814  16.889  25.421  1.00 43.96  ? 391 LYS A CB    1 
ATOM   1970  C  CG    . LYS A  1 250 ? 42.871  15.823  25.696  1.00 49.72  ? 391 LYS A CG    1 
ATOM   1971  C  CD    . LYS A  1 250 ? 42.826  15.377  27.159  1.00 55.41  ? 391 LYS A CD    1 
ATOM   1972  C  CE    . LYS A  1 250 ? 43.398  13.971  27.346  1.00 60.09  ? 391 LYS A CE    1 
ATOM   1973  N  NZ    . LYS A  1 250 ? 43.358  13.521  28.774  1.00 61.00  ? 391 LYS A NZ    1 
ATOM   1974  N  N     . CYS A  1 251 ? 38.895  17.096  23.935  1.00 40.99  ? 392 CYS A N     1 
ATOM   1975  C  CA    . CYS A  1 251 ? 37.614  17.785  23.957  1.00 38.69  ? 392 CYS A CA    1 
ATOM   1976  C  C     . CYS A  1 251 ? 37.002  17.625  25.342  1.00 44.24  ? 392 CYS A C     1 
ATOM   1977  O  O     . CYS A  1 251 ? 37.515  16.870  26.169  1.00 46.24  ? 392 CYS A O     1 
ATOM   1978  C  CB    . CYS A  1 251 ? 36.679  17.221  22.894  1.00 35.08  ? 392 CYS A CB    1 
ATOM   1979  S  SG    . CYS A  1 251 ? 36.136  15.538  23.204  1.00 44.68  ? 392 CYS A SG    1 
ATOM   1980  N  N     . CYS A  1 252 ? 35.909  18.328  25.605  1.00 44.51  ? 393 CYS A N     1 
ATOM   1981  C  CA    . CYS A  1 252 ? 35.281  18.243  26.914  1.00 42.60  ? 393 CYS A CA    1 
ATOM   1982  C  C     . CYS A  1 252 ? 34.030  17.373  26.881  1.00 43.11  ? 393 CYS A C     1 
ATOM   1983  O  O     . CYS A  1 252 ? 33.200  17.442  27.785  1.00 49.98  ? 393 CYS A O     1 
ATOM   1984  C  CB    . CYS A  1 252 ? 34.928  19.635  27.432  1.00 41.74  ? 393 CYS A CB    1 
ATOM   1985  S  SG    . CYS A  1 252 ? 33.617  20.456  26.513  1.00 61.57  ? 393 CYS A SG    1 
ATOM   1986  N  N     . ARG A  1 253 ? 33.901  16.559  25.838  1.00 37.36  ? 394 ARG A N     1 
ATOM   1987  C  CA    . ARG A  1 253 ? 32.714  15.731  25.642  1.00 33.54  ? 394 ARG A CA    1 
ATOM   1988  C  C     . ARG A  1 253 ? 32.480  14.729  26.775  1.00 36.11  ? 394 ARG A C     1 
ATOM   1989  O  O     . ARG A  1 253 ? 31.446  14.767  27.454  1.00 40.71  ? 394 ARG A O     1 
ATOM   1990  C  CB    . ARG A  1 253 ? 32.814  14.987  24.311  1.00 26.68  ? 394 ARG A CB    1 
ATOM   1991  C  CG    . ARG A  1 253 ? 32.625  15.854  23.079  1.00 27.88  ? 394 ARG A CG    1 
ATOM   1992  C  CD    . ARG A  1 253 ? 32.800  15.026  21.816  1.00 33.31  ? 394 ARG A CD    1 
ATOM   1993  N  NE    . ARG A  1 253 ? 32.351  15.707  20.604  1.00 37.00  ? 394 ARG A NE    1 
ATOM   1994  C  CZ    . ARG A  1 253 ? 33.161  16.187  19.664  1.00 35.22  ? 394 ARG A CZ    1 
ATOM   1995  N  NH1   . ARG A  1 253 ? 34.474  16.072  19.789  1.00 30.30  ? 394 ARG A NH1   1 
ATOM   1996  N  NH2   . ARG A  1 253 ? 32.656  16.785  18.595  1.00 38.55  ? 394 ARG A NH2   1 
ATOM   1997  N  N     . LYS A  1 254 ? 33.442  13.831  26.965  1.00 35.45  ? 395 LYS A N     1 
ATOM   1998  C  CA    . LYS A  1 254 ? 33.351  12.803  27.994  1.00 35.25  ? 395 LYS A CA    1 
ATOM   1999  C  C     . LYS A  1 254 ? 33.216  13.399  29.384  1.00 36.49  ? 395 LYS A C     1 
ATOM   2000  O  O     . LYS A  1 254 ? 32.542  12.837  30.240  1.00 41.31  ? 395 LYS A O     1 
ATOM   2001  C  CB    . LYS A  1 254 ? 34.585  11.905  27.959  1.00 35.13  ? 395 LYS A CB    1 
ATOM   2002  C  CG    . LYS A  1 254 ? 34.494  10.734  26.995  1.00 29.80  ? 395 LYS A CG    1 
ATOM   2003  C  CD    . LYS A  1 254 ? 35.622  9.752   27.259  1.00 28.59  ? 395 LYS A CD    1 
ATOM   2004  C  CE    . LYS A  1 254 ? 35.827  8.832   26.078  1.00 31.70  ? 395 LYS A CE    1 
ATOM   2005  N  NZ    . LYS A  1 254 ? 36.888  7.822   26.332  1.00 32.77  ? 395 LYS A NZ    1 
ATOM   2006  N  N     . GLU A  1 255 ? 33.871  14.533  29.605  1.00 38.13  ? 396 GLU A N     1 
ATOM   2007  C  CA    . GLU A  1 255 ? 33.840  15.189  30.907  1.00 43.65  ? 396 GLU A CA    1 
ATOM   2008  C  C     . GLU A  1 255 ? 32.443  15.710  31.193  1.00 43.73  ? 396 GLU A C     1 
ATOM   2009  O  O     . GLU A  1 255 ? 31.933  15.552  32.302  1.00 45.74  ? 396 GLU A O     1 
ATOM   2010  C  CB    . GLU A  1 255 ? 34.842  16.342  30.960  1.00 48.46  ? 396 GLU A CB    1 
ATOM   2011  C  CG    . GLU A  1 255 ? 35.806  16.396  29.791  1.00 51.88  ? 396 GLU A CG    1 
ATOM   2012  C  CD    . GLU A  1 255 ? 36.750  15.220  29.739  1.00 54.07  ? 396 GLU A CD    1 
ATOM   2013  O  OE1   . GLU A  1 255 ? 37.459  14.983  30.733  1.00 58.88  ? 396 GLU A OE1   1 
ATOM   2014  O  OE2   . GLU A  1 255 ? 36.783  14.531  28.701  1.00 53.31  ? 396 GLU A OE2   1 
ATOM   2015  N  N     . CYS A  1 256 ? 31.834  16.329  30.182  1.00 40.03  ? 397 CYS A N     1 
ATOM   2016  C  CA    . CYS A  1 256 ? 30.460  16.803  30.276  1.00 39.00  ? 397 CYS A CA    1 
ATOM   2017  C  C     . CYS A  1 256 ? 29.517  15.645  30.550  1.00 43.56  ? 397 CYS A C     1 
ATOM   2018  O  O     . CYS A  1 256 ? 28.613  15.754  31.389  1.00 50.42  ? 397 CYS A O     1 
ATOM   2019  C  CB    . CYS A  1 256 ? 30.052  17.506  28.987  1.00 38.43  ? 397 CYS A CB    1 
ATOM   2020  S  SG    . CYS A  1 256 ? 30.770  19.144  28.775  1.00 54.32  ? 397 CYS A SG    1 
ATOM   2021  N  N     . LEU A  1 257 ? 29.732  14.534  29.848  1.00 41.99  ? 398 LEU A N     1 
ATOM   2022  C  CA    . LEU A  1 257 ? 28.947  13.328  30.102  1.00 40.91  ? 398 LEU A CA    1 
ATOM   2023  C  C     . LEU A  1 257 ? 29.058  12.902  31.566  1.00 40.05  ? 398 LEU A C     1 
ATOM   2024  O  O     . LEU A  1 257 ? 28.041  12.635  32.217  1.00 40.97  ? 398 LEU A O     1 
ATOM   2025  C  CB    . LEU A  1 257 ? 29.372  12.183  29.181  1.00 37.74  ? 398 LEU A CB    1 
ATOM   2026  C  CG    . LEU A  1 257 ? 28.561  10.897  29.365  1.00 38.54  ? 398 LEU A CG    1 
ATOM   2027  C  CD1   . LEU A  1 257 ? 27.082  11.190  29.222  1.00 41.04  ? 398 LEU A CD1   1 
ATOM   2028  C  CD2   . LEU A  1 257 ? 28.974  9.820   28.383  1.00 36.70  ? 398 LEU A CD2   1 
ATOM   2029  N  N     . LYS A  1 258 ? 30.290  12.854  32.076  1.00 36.36  ? 399 LYS A N     1 
ATOM   2030  C  CA    . LYS A  1 258 ? 30.538  12.539  33.480  1.00 36.77  ? 399 LYS A CA    1 
ATOM   2031  C  C     . LYS A  1 258 ? 29.772  13.462  34.429  1.00 43.89  ? 399 LYS A C     1 
ATOM   2032  O  O     . LYS A  1 258 ? 29.061  12.991  35.307  1.00 46.94  ? 399 LYS A O     1 
ATOM   2033  C  CB    . LYS A  1 258 ? 32.031  12.617  33.796  1.00 37.47  ? 399 LYS A CB    1 
ATOM   2034  C  CG    . LYS A  1 258 ? 32.872  11.470  33.237  1.00 40.47  ? 399 LYS A CG    1 
ATOM   2035  C  CD    . LYS A  1 258 ? 34.341  11.658  33.610  1.00 39.80  ? 399 LYS A CD    1 
ATOM   2036  C  CE    . LYS A  1 258 ? 35.140  10.388  33.369  1.00 39.18  ? 399 LYS A CE    1 
ATOM   2037  N  NZ    . LYS A  1 258 ? 36.445  10.423  34.086  1.00 41.09  ? 399 LYS A NZ    1 
ATOM   2038  N  N     . LEU A  1 259 ? 29.940  14.772  34.256  1.00 47.24  ? 400 LEU A N     1 
ATOM   2039  C  CA    . LEU A  1 259 ? 29.271  15.769  35.093  1.00 47.17  ? 400 LEU A CA    1 
ATOM   2040  C  C     . LEU A  1 259 ? 27.757  15.581  35.107  1.00 48.66  ? 400 LEU A C     1 
ATOM   2041  O  O     . LEU A  1 259 ? 27.123  15.615  36.165  1.00 51.06  ? 400 LEU A O     1 
ATOM   2042  C  CB    . LEU A  1 259 ? 29.619  17.179  34.615  1.00 47.83  ? 400 LEU A CB    1 
ATOM   2043  C  CG    . LEU A  1 259 ? 31.078  17.598  34.791  1.00 45.92  ? 400 LEU A CG    1 
ATOM   2044  C  CD1   . LEU A  1 259 ? 31.336  18.984  34.214  1.00 43.07  ? 400 LEU A CD1   1 
ATOM   2045  C  CD2   . LEU A  1 259 ? 31.463  17.557  36.254  1.00 46.01  ? 400 LEU A CD2   1 
ATOM   2046  N  N     . MET A  1 260 ? 27.189  15.374  33.925  1.00 47.01  ? 401 MET A N     1 
ATOM   2047  C  CA    . MET A  1 260 ? 25.763  15.105  33.793  1.00 44.85  ? 401 MET A CA    1 
ATOM   2048  C  C     . MET A  1 260 ? 25.342  13.865  34.589  1.00 44.07  ? 401 MET A C     1 
ATOM   2049  O  O     . MET A  1 260 ? 24.442  13.928  35.443  1.00 44.31  ? 401 MET A O     1 
ATOM   2050  C  CB    . MET A  1 260 ? 25.423  14.920  32.318  1.00 45.23  ? 401 MET A CB    1 
ATOM   2051  C  CG    . MET A  1 260 ? 24.019  15.331  31.966  1.00 47.18  ? 401 MET A CG    1 
ATOM   2052  S  SD    . MET A  1 260 ? 23.672  16.951  32.665  1.00 72.76  ? 401 MET A SD    1 
ATOM   2053  C  CE    . MET A  1 260 ? 21.952  17.168  32.202  1.00 58.32  ? 401 MET A CE    1 
ATOM   2054  N  N     . LYS A  1 261 ? 26.006  12.744  34.311  1.00 44.29  ? 402 LYS A N     1 
ATOM   2055  C  CA    . LYS A  1 261 ? 25.738  11.491  35.007  1.00 41.38  ? 402 LYS A CA    1 
ATOM   2056  C  C     . LYS A  1 261 ? 25.835  11.652  36.517  1.00 44.47  ? 402 LYS A C     1 
ATOM   2057  O  O     . LYS A  1 261 ? 25.044  11.072  37.255  1.00 47.84  ? 402 LYS A O     1 
ATOM   2058  C  CB    . LYS A  1 261 ? 26.713  10.404  34.552  1.00 37.97  ? 402 LYS A CB    1 
ATOM   2059  C  CG    . LYS A  1 261 ? 26.433  9.828   33.173  1.00 36.87  ? 402 LYS A CG    1 
ATOM   2060  C  CD    . LYS A  1 261 ? 27.668  9.131   32.609  1.00 35.48  ? 402 LYS A CD    1 
ATOM   2061  C  CE    . LYS A  1 261 ? 28.120  7.962   33.467  1.00 36.45  ? 402 LYS A CE    1 
ATOM   2062  N  NZ    . LYS A  1 261 ? 27.239  6.771   33.328  1.00 41.28  ? 402 LYS A NZ    1 
ATOM   2063  N  N     . TYR A  1 262 ? 26.803  12.441  36.970  1.00 44.67  ? 403 TYR A N     1 
ATOM   2064  C  CA    . TYR A  1 262 ? 27.015  12.647  38.398  1.00 46.38  ? 403 TYR A CA    1 
ATOM   2065  C  C     . TYR A  1 262 ? 25.872  13.441  39.008  1.00 43.25  ? 403 TYR A C     1 
ATOM   2066  O  O     . TYR A  1 262 ? 25.324  13.044  40.036  1.00 39.25  ? 403 TYR A O     1 
ATOM   2067  C  CB    . TYR A  1 262 ? 28.358  13.334  38.654  1.00 50.02  ? 403 TYR A CB    1 
ATOM   2068  C  CG    . TYR A  1 262 ? 28.666  13.566  40.115  1.00 52.12  ? 403 TYR A CG    1 
ATOM   2069  C  CD1   . TYR A  1 262 ? 28.662  12.516  41.022  1.00 52.41  ? 403 TYR A CD1   1 
ATOM   2070  C  CD2   . TYR A  1 262 ? 28.980  14.832  40.585  1.00 54.49  ? 403 TYR A CD2   1 
ATOM   2071  C  CE1   . TYR A  1 262 ? 28.949  12.724  42.359  1.00 52.74  ? 403 TYR A CE1   1 
ATOM   2072  C  CE2   . TYR A  1 262 ? 29.268  15.049  41.923  1.00 55.49  ? 403 TYR A CE2   1 
ATOM   2073  C  CZ    . TYR A  1 262 ? 29.249  13.990  42.803  1.00 56.34  ? 403 TYR A CZ    1 
ATOM   2074  O  OH    . TYR A  1 262 ? 29.533  14.200  44.132  1.00 60.55  ? 403 TYR A OH    1 
ATOM   2075  N  N     . LEU A  1 263 ? 25.518  14.556  38.369  1.00 44.61  ? 404 LEU A N     1 
ATOM   2076  C  CA    . LEU A  1 263 ? 24.374  15.358  38.798  1.00 44.64  ? 404 LEU A CA    1 
ATOM   2077  C  C     . LEU A  1 263 ? 23.155  14.466  38.970  1.00 44.50  ? 404 LEU A C     1 
ATOM   2078  O  O     . LEU A  1 263 ? 22.510  14.470  40.025  1.00 48.46  ? 404 LEU A O     1 
ATOM   2079  C  CB    . LEU A  1 263 ? 24.064  16.463  37.782  1.00 44.91  ? 404 LEU A CB    1 
ATOM   2080  C  CG    . LEU A  1 263 ? 22.785  17.266  38.046  1.00 46.73  ? 404 LEU A CG    1 
ATOM   2081  C  CD1   . LEU A  1 263 ? 22.977  18.212  39.213  1.00 50.45  ? 404 LEU A CD1   1 
ATOM   2082  C  CD2   . LEU A  1 263 ? 22.305  18.026  36.817  1.00 46.23  ? 404 LEU A CD2   1 
ATOM   2083  N  N     . LEU A  1 264 ? 22.859  13.681  37.938  1.00 41.72  ? 405 LEU A N     1 
ATOM   2084  C  CA    . LEU A  1 264 ? 21.699  12.802  37.987  1.00 38.70  ? 405 LEU A CA    1 
ATOM   2085  C  C     . LEU A  1 264 ? 21.801  11.752  39.092  1.00 44.42  ? 405 LEU A C     1 
ATOM   2086  O  O     . LEU A  1 264 ? 20.804  11.451  39.739  1.00 45.43  ? 405 LEU A O     1 
ATOM   2087  C  CB    . LEU A  1 264 ? 21.452  12.134  36.637  1.00 35.42  ? 405 LEU A CB    1 
ATOM   2088  C  CG    . LEU A  1 264 ? 20.200  11.260  36.597  1.00 35.63  ? 405 LEU A CG    1 
ATOM   2089  C  CD1   . LEU A  1 264 ? 18.978  12.059  37.014  1.00 36.46  ? 405 LEU A CD1   1 
ATOM   2090  C  CD2   . LEU A  1 264 ? 19.995  10.669  35.224  1.00 36.46  ? 405 LEU A CD2   1 
ATOM   2091  N  N     . GLU A  1 265 ? 22.996  11.206  39.311  1.00 46.04  ? 406 GLU A N     1 
ATOM   2092  C  CA    . GLU A  1 265 ? 23.195  10.220  40.377  1.00 43.40  ? 406 GLU A CA    1 
ATOM   2093  C  C     . GLU A  1 265 ? 22.894  10.807  41.755  1.00 45.54  ? 406 GLU A C     1 
ATOM   2094  O  O     . GLU A  1 265 ? 22.132  10.226  42.539  1.00 49.55  ? 406 GLU A O     1 
ATOM   2095  C  CB    . GLU A  1 265 ? 24.622  9.668   40.358  1.00 45.03  ? 406 GLU A CB    1 
ATOM   2096  C  CG    . GLU A  1 265 ? 24.917  8.685   39.226  1.00 51.78  ? 406 GLU A CG    1 
ATOM   2097  C  CD    . GLU A  1 265 ? 26.296  8.058   39.350  1.00 58.50  ? 406 GLU A CD    1 
ATOM   2098  O  OE1   . GLU A  1 265 ? 26.934  8.236   40.410  1.00 60.77  ? 406 GLU A OE1   1 
ATOM   2099  O  OE2   . GLU A  1 265 ? 26.740  7.391   38.391  1.00 59.85  ? 406 GLU A OE2   1 
ATOM   2100  N  N     . GLN A  1 266 ? 23.506  11.952  42.046  1.00 43.60  ? 407 GLN A N     1 
ATOM   2101  C  CA    . GLN A  1 266 ? 23.277  12.653  43.305  1.00 44.39  ? 407 GLN A CA    1 
ATOM   2102  C  C     . GLN A  1 266 ? 21.789  12.928  43.503  1.00 46.43  ? 407 GLN A C     1 
ATOM   2103  O  O     . GLN A  1 266 ? 21.200  12.552  44.530  1.00 49.90  ? 407 GLN A O     1 
ATOM   2104  C  CB    . GLN A  1 266 ? 24.048  13.975  43.318  1.00 44.84  ? 407 GLN A CB    1 
ATOM   2105  C  CG    . GLN A  1 266 ? 25.560  13.842  43.224  1.00 43.42  ? 407 GLN A CG    1 
ATOM   2106  C  CD    . GLN A  1 266 ? 26.202  13.476  44.545  1.00 48.04  ? 407 GLN A CD    1 
ATOM   2107  O  OE1   . GLN A  1 266 ? 26.350  12.301  44.872  1.00 48.51  ? 407 GLN A OE1   1 
ATOM   2108  N  NE2   . GLN A  1 266 ? 26.594  14.486  45.310  1.00 53.42  ? 407 GLN A NE2   1 
ATOM   2109  N  N     . LEU A  1 267 ? 21.185  13.574  42.507  1.00 45.04  ? 408 LEU A N     1 
ATOM   2110  C  CA    . LEU A  1 267 ? 19.757  13.881  42.550  1.00 43.06  ? 408 LEU A CA    1 
ATOM   2111  C  C     . LEU A  1 267 ? 18.910  12.641  42.816  1.00 43.71  ? 408 LEU A C     1 
ATOM   2112  O  O     . LEU A  1 267 ? 17.986  12.671  43.627  1.00 44.70  ? 408 LEU A O     1 
ATOM   2113  C  CB    . LEU A  1 267 ? 19.304  14.531  41.243  1.00 42.16  ? 408 LEU A CB    1 
ATOM   2114  C  CG    . LEU A  1 267 ? 19.620  16.006  41.014  1.00 41.67  ? 408 LEU A CG    1 
ATOM   2115  C  CD1   . LEU A  1 267 ? 18.856  16.537  39.815  1.00 42.99  ? 408 LEU A CD1   1 
ATOM   2116  C  CD2   . LEU A  1 267 ? 19.287  16.812  42.244  1.00 39.43  ? 408 LEU A CD2   1 
ATOM   2117  N  N     . LYS A  1 268 ? 19.245  11.549  42.139  1.00 45.04  ? 409 LYS A N     1 
ATOM   2118  C  CA    . LYS A  1 268 ? 18.439  10.337  42.170  1.00 42.19  ? 409 LYS A CA    1 
ATOM   2119  C  C     . LYS A  1 268 ? 18.556  9.620   43.506  1.00 43.70  ? 409 LYS A C     1 
ATOM   2120  O  O     . LYS A  1 268 ? 17.604  8.977   43.953  1.00 44.83  ? 409 LYS A O     1 
ATOM   2121  C  CB    . LYS A  1 268 ? 18.826  9.411   41.017  1.00 41.62  ? 409 LYS A CB    1 
ATOM   2122  C  CG    . LYS A  1 268 ? 17.891  8.236   40.853  1.00 48.87  ? 409 LYS A CG    1 
ATOM   2123  C  CD    . LYS A  1 268 ? 18.092  7.535   39.522  1.00 50.62  ? 409 LYS A CD    1 
ATOM   2124  C  CE    . LYS A  1 268 ? 17.264  6.268   39.488  1.00 52.30  ? 409 LYS A CE    1 
ATOM   2125  N  NZ    . LYS A  1 268 ? 17.310  5.606   38.162  1.00 52.90  ? 409 LYS A NZ    1 
ATOM   2126  N  N     . LYS A  1 269 ? 19.716  9.736   44.146  1.00 46.09  ? 410 LYS A N     1 
ATOM   2127  C  CA    . LYS A  1 269 ? 19.888  9.148   45.469  1.00 48.43  ? 410 LYS A CA    1 
ATOM   2128  C  C     . LYS A  1 269 ? 19.327  10.052  46.571  1.00 52.16  ? 410 LYS A C     1 
ATOM   2129  O  O     . LYS A  1 269 ? 19.116  9.603   47.699  1.00 50.01  ? 410 LYS A O     1 
ATOM   2130  C  CB    . LYS A  1 269 ? 21.355  8.787   45.737  1.00 51.58  ? 410 LYS A CB    1 
ATOM   2131  C  CG    . LYS A  1 269 ? 22.287  9.972   45.958  1.00 53.19  ? 410 LYS A CG    1 
ATOM   2132  C  CD    . LYS A  1 269 ? 23.639  9.500   46.488  1.00 51.07  ? 410 LYS A CD    1 
ATOM   2133  C  CE    . LYS A  1 269 ? 24.463  10.670  47.001  1.00 52.83  ? 410 LYS A CE    1 
ATOM   2134  N  NZ    . LYS A  1 269 ? 25.667  10.214  47.742  1.00 54.94  ? 410 LYS A NZ    1 
ATOM   2135  N  N     . GLU A  1 270 ? 19.081  11.319  46.248  1.00 56.33  ? 411 GLU A N     1 
ATOM   2136  C  CA    . GLU A  1 270 ? 18.459  12.216  47.219  1.00 57.71  ? 411 GLU A CA    1 
ATOM   2137  C  C     . GLU A  1 270 ? 16.930  12.204  47.124  1.00 57.05  ? 411 GLU A C     1 
ATOM   2138  O  O     . GLU A  1 270 ? 16.240  12.521  48.094  1.00 56.57  ? 411 GLU A O     1 
ATOM   2139  C  CB    . GLU A  1 270 ? 18.998  13.638  47.051  1.00 63.91  ? 411 GLU A CB    1 
ATOM   2140  C  CG    . GLU A  1 270 ? 18.714  14.566  48.226  1.00 69.00  ? 411 GLU A CG    1 
ATOM   2141  C  CD    . GLU A  1 270 ? 19.781  15.634  48.401  1.00 75.61  ? 411 GLU A CD    1 
ATOM   2142  O  OE1   . GLU A  1 270 ? 20.872  15.497  47.806  1.00 76.57  ? 411 GLU A OE1   1 
ATOM   2143  O  OE2   . GLU A  1 270 ? 19.531  16.607  49.142  1.00 78.90  ? 411 GLU A OE2   1 
ATOM   2144  N  N     . PHE A  1 271 ? 16.402  11.830  45.962  1.00 58.76  ? 412 PHE A N     1 
ATOM   2145  C  CA    . PHE A  1 271 ? 14.960  11.883  45.738  1.00 57.99  ? 412 PHE A CA    1 
ATOM   2146  C  C     . PHE A  1 271 ? 14.390  10.633  45.058  1.00 60.05  ? 412 PHE A C     1 
ATOM   2147  O  O     . PHE A  1 271 ? 14.881  10.191  44.019  1.00 60.89  ? 412 PHE A O     1 
ATOM   2148  C  CB    . PHE A  1 271 ? 14.593  13.143  44.946  1.00 57.10  ? 412 PHE A CB    1 
ATOM   2149  C  CG    . PHE A  1 271 ? 14.966  14.423  45.639  1.00 55.72  ? 412 PHE A CG    1 
ATOM   2150  C  CD1   . PHE A  1 271 ? 14.208  14.903  46.697  1.00 54.01  ? 412 PHE A CD1   1 
ATOM   2151  C  CD2   . PHE A  1 271 ? 16.077  15.147  45.234  1.00 54.10  ? 412 PHE A CD2   1 
ATOM   2152  C  CE1   . PHE A  1 271 ? 14.554  16.082  47.339  1.00 53.24  ? 412 PHE A CE1   1 
ATOM   2153  C  CE2   . PHE A  1 271 ? 16.426  16.326  45.873  1.00 51.67  ? 412 PHE A CE2   1 
ATOM   2154  C  CZ    . PHE A  1 271 ? 15.664  16.792  46.925  1.00 50.58  ? 412 PHE A CZ    1 
ATOM   2155  N  N     . GLN A  1 272 ? 13.340  10.083  45.661  1.00 62.89  ? 413 GLN A N     1 
ATOM   2156  C  CA    . GLN A  1 272 ? 12.641  8.905   45.159  1.00 63.04  ? 413 GLN A CA    1 
ATOM   2157  C  C     . GLN A  1 272 ? 11.791  9.270   43.941  1.00 60.96  ? 413 GLN A C     1 
ATOM   2158  O  O     . GLN A  1 272 ? 11.408  8.405   43.150  1.00 61.37  ? 413 GLN A O     1 
ATOM   2159  C  CB    . GLN A  1 272 ? 11.767  8.337   46.286  1.00 69.85  ? 413 GLN A CB    1 
ATOM   2160  C  CG    . GLN A  1 272 ? 10.879  7.144   45.938  1.00 74.42  ? 413 GLN A CG    1 
ATOM   2161  C  CD    . GLN A  1 272 ? 9.879   6.837   47.042  1.00 77.73  ? 413 GLN A CD    1 
ATOM   2162  O  OE1   . GLN A  1 272 ? 10.081  7.208   48.199  1.00 78.21  ? 413 GLN A OE1   1 
ATOM   2163  N  NE2   . GLN A  1 272 ? 8.791   6.163   46.686  1.00 79.15  ? 413 GLN A NE2   1 
ATOM   2164  N  N     . GLU A  1 273 ? 11.517  10.562  43.784  1.00 60.46  ? 414 GLU A N     1 
ATOM   2165  C  CA    . GLU A  1 273 ? 10.687  11.054  42.689  1.00 60.33  ? 414 GLU A CA    1 
ATOM   2166  C  C     . GLU A  1 273 ? 11.401  10.945  41.341  1.00 58.37  ? 414 GLU A C     1 
ATOM   2167  O  O     . GLU A  1 273 ? 10.797  11.184  40.292  1.00 61.99  ? 414 GLU A O     1 
ATOM   2168  C  CB    . GLU A  1 273 ? 10.265  12.509  42.943  1.00 62.01  ? 414 GLU A CB    1 
ATOM   2169  C  CG    . GLU A  1 273 ? 9.450   12.742  44.222  1.00 63.92  ? 414 GLU A CG    1 
ATOM   2170  C  CD    . GLU A  1 273 ? 10.301  12.755  45.484  1.00 63.34  ? 414 GLU A CD    1 
ATOM   2171  O  OE1   . GLU A  1 273 ? 10.297  13.778  46.200  1.00 64.62  ? 414 GLU A OE1   1 
ATOM   2172  O  OE2   . GLU A  1 273 ? 10.966  11.739  45.768  1.00 59.79  ? 414 GLU A OE2   1 
ATOM   2173  N  N     . LEU A  1 274 ? 12.680  10.578  41.371  1.00 51.13  ? 415 LEU A N     1 
ATOM   2174  C  CA    . LEU A  1 274 ? 13.476  10.466  40.155  1.00 46.16  ? 415 LEU A CA    1 
ATOM   2175  C  C     . LEU A  1 274 ? 13.810  9.013   39.825  1.00 46.00  ? 415 LEU A C     1 
ATOM   2176  O  O     . LEU A  1 274 ? 14.770  8.748   39.102  1.00 46.12  ? 415 LEU A O     1 
ATOM   2177  C  CB    . LEU A  1 274 ? 14.774  11.262  40.291  1.00 40.45  ? 415 LEU A CB    1 
ATOM   2178  C  CG    . LEU A  1 274 ? 14.675  12.711  40.758  1.00 35.01  ? 415 LEU A CG    1 
ATOM   2179  C  CD1   . LEU A  1 274 ? 16.027  13.373  40.667  1.00 27.56  ? 415 LEU A CD1   1 
ATOM   2180  C  CD2   . LEU A  1 274 ? 13.652  13.473  39.942  1.00 39.00  ? 415 LEU A CD2   1 
ATOM   2181  N  N     . ASP A  1 275 ? 13.021  8.077   40.349  1.00 49.81  ? 416 ASP A N     1 
ATOM   2182  C  CA    . ASP A  1 275 ? 13.284  6.653   40.148  1.00 51.56  ? 416 ASP A CA    1 
ATOM   2183  C  C     . ASP A  1 275 ? 13.151  6.226   38.682  1.00 49.13  ? 416 ASP A C     1 
ATOM   2184  O  O     . ASP A  1 275 ? 13.812  5.287   38.241  1.00 48.15  ? 416 ASP A O     1 
ATOM   2185  C  CB    . ASP A  1 275 ? 12.379  5.799   41.048  1.00 55.04  ? 416 ASP A CB    1 
ATOM   2186  C  CG    . ASP A  1 275 ? 12.926  5.649   42.458  1.00 56.68  ? 416 ASP A CG    1 
ATOM   2187  O  OD1   . ASP A  1 275 ? 14.151  5.806   42.642  1.00 58.21  ? 416 ASP A OD1   1 
ATOM   2188  O  OD2   . ASP A  1 275 ? 12.131  5.363   43.380  1.00 55.90  ? 416 ASP A OD2   1 
ATOM   2189  N  N     . ALA A  1 276 ? 12.310  6.927   37.926  1.00 45.98  ? 417 ALA A N     1 
ATOM   2190  C  CA    . ALA A  1 276 ? 12.075  6.588   36.522  1.00 44.63  ? 417 ALA A CA    1 
ATOM   2191  C  C     . ALA A  1 276 ? 13.233  7.002   35.614  1.00 48.24  ? 417 ALA A C     1 
ATOM   2192  O  O     . ALA A  1 276 ? 13.336  6.538   34.477  1.00 47.83  ? 417 ALA A O     1 
ATOM   2193  C  CB    . ALA A  1 276 ? 10.781  7.218   36.037  1.00 42.13  ? 417 ALA A CB    1 
ATOM   2194  N  N     . PHE A  1 277 ? 14.098  7.877   36.115  1.00 49.61  ? 418 PHE A N     1 
ATOM   2195  C  CA    . PHE A  1 277 ? 15.199  8.399   35.318  1.00 47.37  ? 418 PHE A CA    1 
ATOM   2196  C  C     . PHE A  1 277 ? 16.453  7.533   35.440  1.00 45.32  ? 418 PHE A C     1 
ATOM   2197  O  O     . PHE A  1 277 ? 16.713  6.964   36.500  1.00 42.28  ? 418 PHE A O     1 
ATOM   2198  C  CB    . PHE A  1 277 ? 15.498  9.837   35.738  1.00 49.97  ? 418 PHE A CB    1 
ATOM   2199  C  CG    . PHE A  1 277 ? 14.341  10.778  35.539  1.00 57.16  ? 418 PHE A CG    1 
ATOM   2200  C  CD1   . PHE A  1 277 ? 14.022  11.245  34.271  1.00 60.33  ? 418 PHE A CD1   1 
ATOM   2201  C  CD2   . PHE A  1 277 ? 13.579  11.203  36.617  1.00 58.33  ? 418 PHE A CD2   1 
ATOM   2202  C  CE1   . PHE A  1 277 ? 12.958  12.116  34.081  1.00 62.39  ? 418 PHE A CE1   1 
ATOM   2203  C  CE2   . PHE A  1 277 ? 12.516  12.074  36.434  1.00 61.20  ? 418 PHE A CE2   1 
ATOM   2204  C  CZ    . PHE A  1 277 ? 12.206  12.530  35.164  1.00 62.59  ? 418 PHE A CZ    1 
ATOM   2205  N  N     . CYS A  1 278 ? 17.220  7.437   34.352  1.00 43.55  ? 419 CYS A N     1 
ATOM   2206  C  CA    . CYS A  1 278 ? 18.481  6.692   34.349  1.00 40.40  ? 419 CYS A CA    1 
ATOM   2207  C  C     . CYS A  1 278 ? 19.557  7.397   33.517  1.00 45.62  ? 419 CYS A C     1 
ATOM   2208  O  O     . CYS A  1 278 ? 19.278  8.382   32.832  1.00 50.00  ? 419 CYS A O     1 
ATOM   2209  C  CB    . CYS A  1 278 ? 18.270  5.254   33.860  1.00 35.81  ? 419 CYS A CB    1 
ATOM   2210  S  SG    . CYS A  1 278 ? 17.729  5.087   32.150  1.00 45.08  ? 419 CYS A SG    1 
ATOM   2211  N  N     . SER A  1 279 ? 20.784  6.886   33.580  1.00 44.72  ? 420 SER A N     1 
ATOM   2212  C  CA    . SER A  1 279 ? 21.923  7.517   32.916  1.00 39.14  ? 420 SER A CA    1 
ATOM   2213  C  C     . SER A  1 279 ? 21.846  7.442   31.390  1.00 38.56  ? 420 SER A C     1 
ATOM   2214  O  O     . SER A  1 279 ? 22.478  8.238   30.683  1.00 39.30  ? 420 SER A O     1 
ATOM   2215  C  CB    . SER A  1 279 ? 23.230  6.903   33.420  1.00 34.44  ? 420 SER A CB    1 
ATOM   2216  O  OG    . SER A  1 279 ? 23.162  5.490   33.428  1.00 35.63  ? 420 SER A OG    1 
ATOM   2217  N  N     . TYR A  1 280 ? 21.053  6.503   30.883  1.00 36.31  ? 421 TYR A N     1 
ATOM   2218  C  CA    . TYR A  1 280 ? 20.892  6.356   29.442  1.00 34.57  ? 421 TYR A CA    1 
ATOM   2219  C  C     . TYR A  1 280 ? 20.123  7.527   28.825  1.00 40.59  ? 421 TYR A C     1 
ATOM   2220  O  O     . TYR A  1 280 ? 20.270  7.814   27.632  1.00 44.64  ? 421 TYR A O     1 
ATOM   2221  C  CB    . TYR A  1 280 ? 20.204  5.034   29.105  1.00 35.55  ? 421 TYR A CB    1 
ATOM   2222  C  CG    . TYR A  1 280 ? 20.293  4.684   27.638  1.00 38.75  ? 421 TYR A CG    1 
ATOM   2223  C  CD1   . TYR A  1 280 ? 21.473  4.202   27.094  1.00 38.40  ? 421 TYR A CD1   1 
ATOM   2224  C  CD2   . TYR A  1 280 ? 19.205  4.848   26.796  1.00 39.01  ? 421 TYR A CD2   1 
ATOM   2225  C  CE1   . TYR A  1 280 ? 21.564  3.892   25.758  1.00 38.22  ? 421 TYR A CE1   1 
ATOM   2226  C  CE2   . TYR A  1 280 ? 19.289  4.535   25.454  1.00 39.04  ? 421 TYR A CE2   1 
ATOM   2227  C  CZ    . TYR A  1 280 ? 20.471  4.060   24.945  1.00 39.03  ? 421 TYR A CZ    1 
ATOM   2228  O  OH    . TYR A  1 280 ? 20.560  3.750   23.611  1.00 43.03  ? 421 TYR A OH    1 
ATOM   2229  N  N     . HIS A  1 281 ? 19.306  8.195   29.637  1.00 41.41  ? 422 HIS A N     1 
ATOM   2230  C  CA    . HIS A  1 281 ? 18.588  9.384   29.191  1.00 41.10  ? 422 HIS A CA    1 
ATOM   2231  C  C     . HIS A  1 281 ? 19.575  10.505  28.876  1.00 38.56  ? 422 HIS A C     1 
ATOM   2232  O  O     . HIS A  1 281 ? 19.471  11.169  27.839  1.00 45.76  ? 422 HIS A O     1 
ATOM   2233  C  CB    . HIS A  1 281 ? 17.600  9.856   30.266  1.00 45.02  ? 422 HIS A CB    1 
ATOM   2234  C  CG    . HIS A  1 281 ? 16.464  8.912   30.518  1.00 44.75  ? 422 HIS A CG    1 
ATOM   2235  N  ND1   . HIS A  1 281 ? 15.898  8.754   31.768  1.00 44.59  ? 422 HIS A ND1   1 
ATOM   2236  C  CD2   . HIS A  1 281 ? 15.773  8.094   29.690  1.00 43.78  ? 422 HIS A CD2   1 
ATOM   2237  C  CE1   . HIS A  1 281 ? 14.920  7.872   31.697  1.00 42.67  ? 422 HIS A CE1   1 
ATOM   2238  N  NE2   . HIS A  1 281 ? 14.823  7.453   30.447  1.00 42.07  ? 422 HIS A NE2   1 
ATOM   2239  N  N     . VAL A  1 282 ? 20.530  10.715  29.779  1.00 34.14  ? 423 VAL A N     1 
ATOM   2240  C  CA    . VAL A  1 282 ? 21.566  11.727  29.578  1.00 35.48  ? 423 VAL A CA    1 
ATOM   2241  C  C     . VAL A  1 282 ? 22.583  11.314  28.506  1.00 37.81  ? 423 VAL A C     1 
ATOM   2242  O  O     . VAL A  1 282 ? 23.185  12.172  27.849  1.00 43.49  ? 423 VAL A O     1 
ATOM   2243  C  CB    . VAL A  1 282 ? 22.273  12.110  30.908  1.00 52.34  ? 423 VAL A CB    1 
ATOM   2244  C  CG1   . VAL A  1 282 ? 21.386  11.782  32.084  1.00 48.68  ? 423 VAL A CG1   1 
ATOM   2245  C  CG2   . VAL A  1 282 ? 23.608  11.400  31.053  1.00 54.74  ? 423 VAL A CG2   1 
ATOM   2246  N  N     . LYS A  1 283 ? 22.764  10.005  28.324  1.00 34.37  ? 424 LYS A N     1 
ATOM   2247  C  CA    . LYS A  1 283 ? 23.643  9.495   27.274  1.00 31.26  ? 424 LYS A CA    1 
ATOM   2248  C  C     . LYS A  1 283 ? 23.043  9.778   25.889  1.00 34.42  ? 424 LYS A C     1 
ATOM   2249  O  O     . LYS A  1 283 ? 23.720  10.294  24.990  1.00 40.37  ? 424 LYS A O     1 
ATOM   2250  C  CB    . LYS A  1 283 ? 23.875  7.996   27.477  1.00 28.99  ? 424 LYS A CB    1 
ATOM   2251  C  CG    . LYS A  1 283 ? 25.071  7.418   26.719  1.00 25.75  ? 424 LYS A CG    1 
ATOM   2252  C  CD    . LYS A  1 283 ? 25.271  5.950   27.067  1.00 25.58  ? 424 LYS A CD    1 
ATOM   2253  C  CE    . LYS A  1 283 ? 26.236  5.276   26.106  1.00 29.41  ? 424 LYS A CE    1 
ATOM   2254  N  NZ    . LYS A  1 283 ? 26.299  3.803   26.308  1.00 27.68  ? 424 LYS A NZ    1 
ATOM   2255  N  N     . THR A  1 284 ? 21.762  9.452   25.734  1.00 34.90  ? 425 THR A N     1 
ATOM   2256  C  CA    . THR A  1 284 ? 21.003  9.790   24.528  1.00 35.27  ? 425 THR A CA    1 
ATOM   2257  C  C     . THR A  1 284 ? 21.039  11.295  24.274  1.00 37.73  ? 425 THR A C     1 
ATOM   2258  O  O     . THR A  1 284 ? 21.341  11.749  23.161  1.00 42.06  ? 425 THR A O     1 
ATOM   2259  C  CB    . THR A  1 284 ? 19.538  9.353   24.660  1.00 35.22  ? 425 THR A CB    1 
ATOM   2260  O  OG1   . THR A  1 284 ? 19.471  7.935   24.847  1.00 30.06  ? 425 THR A OG1   1 
ATOM   2261  C  CG2   . THR A  1 284 ? 18.765  9.719   23.420  1.00 40.20  ? 425 THR A CG2   1 
ATOM   2262  N  N     . ALA A  1 285 ? 20.732  12.064  25.315  1.00 38.18  ? 426 ALA A N     1 
ATOM   2263  C  CA    . ALA A  1 285 ? 20.778  13.518  25.221  1.00 44.57  ? 426 ALA A CA    1 
ATOM   2264  C  C     . ALA A  1 285 ? 22.127  14.050  24.710  1.00 50.26  ? 426 ALA A C     1 
ATOM   2265  O  O     . ALA A  1 285 ? 22.164  14.916  23.831  1.00 54.85  ? 426 ALA A O     1 
ATOM   2266  C  CB    . ALA A  1 285 ? 20.427  14.137  26.551  1.00 45.91  ? 426 ALA A CB    1 
ATOM   2267  N  N     . ILE A  1 286 ? 23.232  13.541  25.252  1.00 51.61  ? 427 ILE A N     1 
ATOM   2268  C  CA    . ILE A  1 286 ? 24.552  14.001  24.806  1.00 50.44  ? 427 ILE A CA    1 
ATOM   2269  C  C     . ILE A  1 286 ? 24.920  13.501  23.402  1.00 46.63  ? 427 ILE A C     1 
ATOM   2270  O  O     . ILE A  1 286 ? 25.710  14.145  22.708  1.00 45.22  ? 427 ILE A O     1 
ATOM   2271  C  CB    . ILE A  1 286 ? 25.666  13.678  25.832  1.00 49.35  ? 427 ILE A CB    1 
ATOM   2272  C  CG1   . ILE A  1 286 ? 26.781  14.724  25.753  1.00 50.34  ? 427 ILE A CG1   1 
ATOM   2273  C  CG2   . ILE A  1 286 ? 26.211  12.279  25.625  1.00 46.41  ? 427 ILE A CG2   1 
ATOM   2274  C  CD1   . ILE A  1 286 ? 27.814  14.608  26.855  1.00 49.79  ? 427 ILE A CD1   1 
ATOM   2275  N  N     . PHE A  1 287 ? 24.355  12.368  22.985  1.00 47.05  ? 428 PHE A N     1 
ATOM   2276  C  CA    . PHE A  1 287 ? 24.478  11.951  21.589  1.00 45.95  ? 428 PHE A CA    1 
ATOM   2277  C  C     . PHE A  1 287 ? 23.838  13.007  20.693  1.00 46.30  ? 428 PHE A C     1 
ATOM   2278  O  O     . PHE A  1 287 ? 24.456  13.482  19.737  1.00 51.27  ? 428 PHE A O     1 
ATOM   2279  C  CB    . PHE A  1 287 ? 23.801  10.601  21.360  1.00 49.06  ? 428 PHE A CB    1 
ATOM   2280  C  CG    . PHE A  1 287 ? 24.587  9.425   21.873  1.00 52.06  ? 428 PHE A CG    1 
ATOM   2281  C  CD1   . PHE A  1 287 ? 25.969  9.480   21.970  1.00 53.29  ? 428 PHE A CD1   1 
ATOM   2282  C  CD2   . PHE A  1 287 ? 23.940  8.262   22.253  1.00 56.61  ? 428 PHE A CD2   1 
ATOM   2283  C  CE1   . PHE A  1 287 ? 26.692  8.394   22.442  1.00 54.25  ? 428 PHE A CE1   1 
ATOM   2284  C  CE2   . PHE A  1 287 ? 24.655  7.175   22.726  1.00 58.80  ? 428 PHE A CE2   1 
ATOM   2285  C  CZ    . PHE A  1 287 ? 26.033  7.242   22.819  1.00 56.08  ? 428 PHE A CZ    1 
ATOM   2286  N  N     . HIS A  1 288 ? 22.600  13.376  21.017  1.00 43.75  ? 429 HIS A N     1 
ATOM   2287  C  CA    . HIS A  1 288 ? 21.875  14.393  20.257  1.00 41.13  ? 429 HIS A CA    1 
ATOM   2288  C  C     . HIS A  1 288 ? 22.588  15.752  20.260  1.00 39.88  ? 429 HIS A C     1 
ATOM   2289  O  O     . HIS A  1 288 ? 22.570  16.480  19.259  1.00 40.88  ? 429 HIS A O     1 
ATOM   2290  C  CB    . HIS A  1 288 ? 20.440  14.528  20.786  1.00 42.44  ? 429 HIS A CB    1 
ATOM   2291  C  CG    . HIS A  1 288 ? 19.559  13.363  20.453  1.00 39.54  ? 429 HIS A CG    1 
ATOM   2292  N  ND1   . HIS A  1 288 ? 19.255  13.011  19.156  1.00 40.67  ? 429 HIS A ND1   1 
ATOM   2293  C  CD2   . HIS A  1 288 ? 18.909  12.480  21.247  1.00 36.76  ? 429 HIS A CD2   1 
ATOM   2294  C  CE1   . HIS A  1 288 ? 18.462  11.954  19.165  1.00 39.98  ? 429 HIS A CE1   1 
ATOM   2295  N  NE2   . HIS A  1 288 ? 18.236  11.612  20.420  1.00 37.81  ? 429 HIS A NE2   1 
ATOM   2296  N  N     . MET A  1 289 ? 23.223  16.082  21.380  1.00 39.77  ? 430 MET A N     1 
ATOM   2297  C  CA    . MET A  1 289 ? 24.008  17.310  21.476  1.00 38.99  ? 430 MET A CA    1 
ATOM   2298  C  C     . MET A  1 289 ? 25.278  17.261  20.628  1.00 37.94  ? 430 MET A C     1 
ATOM   2299  O  O     . MET A  1 289 ? 25.700  18.277  20.077  1.00 45.98  ? 430 MET A O     1 
ATOM   2300  C  CB    . MET A  1 289 ? 24.367  17.611  22.929  1.00 42.98  ? 430 MET A CB    1 
ATOM   2301  C  CG    . MET A  1 289 ? 23.401  18.548  23.644  1.00 46.57  ? 430 MET A CG    1 
ATOM   2302  S  SD    . MET A  1 289 ? 23.382  20.215  22.948  1.00 72.99  ? 430 MET A SD    1 
ATOM   2303  C  CE    . MET A  1 289 ? 21.856  20.165  22.018  1.00 31.78  ? 430 MET A CE    1 
ATOM   2304  N  N     . TRP A  1 290 ? 25.885  16.081  20.530  1.00 35.37  ? 431 TRP A N     1 
ATOM   2305  C  CA    . TRP A  1 290 ? 27.057  15.874  19.678  1.00 36.27  ? 431 TRP A CA    1 
ATOM   2306  C  C     . TRP A  1 290 ? 26.704  15.918  18.192  1.00 39.89  ? 431 TRP A C     1 
ATOM   2307  O  O     . TRP A  1 290 ? 27.510  16.347  17.365  1.00 39.93  ? 431 TRP A O     1 
ATOM   2308  C  CB    . TRP A  1 290 ? 27.720  14.540  20.005  1.00 35.30  ? 431 TRP A CB    1 
ATOM   2309  C  CG    . TRP A  1 290 ? 28.361  14.501  21.354  1.00 36.52  ? 431 TRP A CG    1 
ATOM   2310  C  CD1   . TRP A  1 290 ? 28.762  15.567  22.098  1.00 36.21  ? 431 TRP A CD1   1 
ATOM   2311  C  CD2   . TRP A  1 290 ? 28.670  13.329  22.125  1.00 34.61  ? 431 TRP A CD2   1 
ATOM   2312  N  NE1   . TRP A  1 290 ? 29.302  15.133  23.288  1.00 35.67  ? 431 TRP A NE1   1 
ATOM   2313  C  CE2   . TRP A  1 290 ? 29.258  13.765  23.327  1.00 35.22  ? 431 TRP A CE2   1 
ATOM   2314  C  CE3   . TRP A  1 290 ? 28.504  11.959  21.917  1.00 31.53  ? 431 TRP A CE3   1 
ATOM   2315  C  CZ2   . TRP A  1 290 ? 29.681  12.872  24.317  1.00 37.82  ? 431 TRP A CZ2   1 
ATOM   2316  C  CZ3   . TRP A  1 290 ? 28.924  11.079  22.896  1.00 34.98  ? 431 TRP A CZ3   1 
ATOM   2317  C  CH2   . TRP A  1 290 ? 29.504  11.537  24.080  1.00 39.69  ? 431 TRP A CH2   1 
ATOM   2318  N  N     . THR A  1 291 ? 25.501  15.463  17.857  1.00 42.33  ? 432 THR A N     1 
ATOM   2319  C  CA    . THR A  1 291 ? 25.018  15.536  16.483  1.00 45.16  ? 432 THR A CA    1 
ATOM   2320  C  C     . THR A  1 291 ? 24.669  16.980  16.127  1.00 48.51  ? 432 THR A C     1 
ATOM   2321  O  O     . THR A  1 291 ? 24.893  17.431  15.000  1.00 47.12  ? 432 THR A O     1 
ATOM   2322  C  CB    . THR A  1 291 ? 23.807  14.617  16.274  1.00 46.30  ? 432 THR A CB    1 
ATOM   2323  O  OG1   . THR A  1 291 ? 24.238  13.253  16.311  1.00 47.24  ? 432 THR A OG1   1 
ATOM   2324  C  CG2   . THR A  1 291 ? 23.153  14.883  14.936  1.00 46.59  ? 432 THR A CG2   1 
ATOM   2325  N  N     . GLN A  1 292 ? 24.126  17.702  17.101  1.00 52.35  ? 433 GLN A N     1 
ATOM   2326  C  CA    . GLN A  1 292 ? 23.815  19.110  16.910  1.00 55.85  ? 433 GLN A CA    1 
ATOM   2327  C  C     . GLN A  1 292 ? 25.091  19.931  16.772  1.00 56.54  ? 433 GLN A C     1 
ATOM   2328  O  O     . GLN A  1 292 ? 25.182  20.811  15.914  1.00 60.12  ? 433 GLN A O     1 
ATOM   2329  C  CB    . GLN A  1 292 ? 22.975  19.635  18.072  1.00 60.50  ? 433 GLN A CB    1 
ATOM   2330  C  CG    . GLN A  1 292 ? 22.703  21.134  18.005  1.00 61.96  ? 433 GLN A CG    1 
ATOM   2331  C  CD    . GLN A  1 292 ? 21.661  21.588  19.005  1.00 63.16  ? 433 GLN A CD    1 
ATOM   2332  O  OE1   . GLN A  1 292 ? 20.614  20.960  19.154  1.00 63.28  ? 433 GLN A OE1   1 
ATOM   2333  N  NE2   . GLN A  1 292 ? 21.944  22.685  19.698  1.00 63.28  ? 433 GLN A NE2   1 
ATOM   2334  N  N     . ASP A  1 293 ? 26.077  19.636  17.617  1.00 54.74  ? 434 ASP A N     1 
ATOM   2335  C  CA    . ASP A  1 293 ? 27.361  20.336  17.575  1.00 54.62  ? 434 ASP A CA    1 
ATOM   2336  C  C     . ASP A  1 293 ? 28.530  19.392  17.273  1.00 48.21  ? 434 ASP A C     1 
ATOM   2337  O  O     . ASP A  1 293 ? 29.268  19.016  18.187  1.00 43.56  ? 434 ASP A O     1 
ATOM   2338  C  CB    . ASP A  1 293 ? 27.628  21.063  18.899  1.00 58.54  ? 434 ASP A CB    1 
ATOM   2339  C  CG    . ASP A  1 293 ? 26.534  22.054  19.266  1.00 58.83  ? 434 ASP A CG    1 
ATOM   2340  O  OD1   . ASP A  1 293 ? 26.468  22.447  20.451  1.00 56.36  ? 434 ASP A OD1   1 
ATOM   2341  O  OD2   . ASP A  1 293 ? 25.745  22.443  18.384  1.00 60.94  ? 434 ASP A OD2   1 
ATOM   2342  N  N     . PRO A  1 294 ? 28.713  19.026  15.985  1.00 46.28  ? 435 PRO A N     1 
ATOM   2343  C  CA    . PRO A  1 294 ? 29.748  18.080  15.545  1.00 38.82  ? 435 PRO A CA    1 
ATOM   2344  C  C     . PRO A  1 294 ? 31.170  18.583  15.750  1.00 37.47  ? 435 PRO A C     1 
ATOM   2345  O  O     . PRO A  1 294 ? 32.051  17.781  16.060  1.00 35.47  ? 435 PRO A O     1 
ATOM   2346  C  CB    . PRO A  1 294 ? 29.485  17.943  14.040  1.00 38.21  ? 435 PRO A CB    1 
ATOM   2347  C  CG    . PRO A  1 294 ? 28.085  18.371  13.845  1.00 43.40  ? 435 PRO A CG    1 
ATOM   2348  C  CD    . PRO A  1 294 ? 27.860  19.450  14.861  1.00 46.66  ? 435 PRO A CD    1 
ATOM   2349  N  N     . GLN A  1 295 ? 31.394  19.882  15.568  1.00 44.64  ? 436 GLN A N     1 
ATOM   2350  C  CA    . GLN A  1 295 ? 32.752  20.425  15.616  1.00 49.81  ? 436 GLN A CA    1 
ATOM   2351  C  C     . GLN A  1 295 ? 33.426  20.281  16.977  1.00 51.04  ? 436 GLN A C     1 
ATOM   2352  O  O     . GLN A  1 295 ? 32.846  20.630  18.004  1.00 54.07  ? 436 GLN A O     1 
ATOM   2353  C  CB    . GLN A  1 295 ? 32.768  21.889  15.178  1.00 51.68  ? 436 GLN A CB    1 
ATOM   2354  C  CG    . GLN A  1 295 ? 32.346  22.100  13.735  1.00 54.65  ? 436 GLN A CG    1 
ATOM   2355  C  CD    . GLN A  1 295 ? 33.279  21.431  12.753  1.00 56.65  ? 436 GLN A CD    1 
ATOM   2356  O  OE1   . GLN A  1 295 ? 34.442  21.173  13.058  1.00 56.28  ? 436 GLN A OE1   1 
ATOM   2357  N  NE2   . GLN A  1 295 ? 32.772  21.145  11.562  1.00 58.09  ? 436 GLN A NE2   1 
ATOM   2358  N  N     . ASP A  1 296 ? 34.658  19.778  16.966  1.00 47.62  ? 437 ASP A N     1 
ATOM   2359  C  CA    . ASP A  1 296 ? 35.417  19.558  18.188  1.00 49.36  ? 437 ASP A CA    1 
ATOM   2360  C  C     . ASP A  1 296 ? 35.715  20.865  18.919  1.00 53.81  ? 437 ASP A C     1 
ATOM   2361  O  O     . ASP A  1 296 ? 35.846  20.885  20.145  1.00 53.25  ? 437 ASP A O     1 
ATOM   2362  C  CB    . ASP A  1 296 ? 36.721  18.821  17.876  1.00 49.02  ? 437 ASP A CB    1 
ATOM   2363  C  CG    . ASP A  1 296 ? 36.490  17.413  17.357  1.00 47.34  ? 437 ASP A CG    1 
ATOM   2364  O  OD1   . ASP A  1 296 ? 35.506  16.770  17.776  1.00 50.28  ? 437 ASP A OD1   1 
ATOM   2365  O  OD2   . ASP A  1 296 ? 37.298  16.950  16.529  1.00 41.59  ? 437 ASP A OD2   1 
ATOM   2366  N  N     . SER A  1 297 ? 35.817  21.952  18.160  1.00 57.32  ? 438 SER A N     1 
ATOM   2367  C  CA    . SER A  1 297 ? 36.054  23.277  18.726  1.00 55.23  ? 438 SER A CA    1 
ATOM   2368  C  C     . SER A  1 297 ? 34.867  23.735  19.568  1.00 59.99  ? 438 SER A C     1 
ATOM   2369  O  O     . SER A  1 297 ? 35.005  24.600  20.433  1.00 63.19  ? 438 SER A O     1 
ATOM   2370  C  CB    . SER A  1 297 ? 36.329  24.287  17.612  1.00 48.88  ? 438 SER A CB    1 
ATOM   2371  O  OG    . SER A  1 297 ? 35.271  24.308  16.671  1.00 46.32  ? 438 SER A OG    1 
ATOM   2372  N  N     . GLN A  1 298 ? 33.704  23.140  19.316  1.00 59.72  ? 439 GLN A N     1 
ATOM   2373  C  CA    . GLN A  1 298 ? 32.508  23.425  20.095  1.00 60.87  ? 439 GLN A CA    1 
ATOM   2374  C  C     . GLN A  1 298 ? 32.545  22.662  21.416  1.00 59.61  ? 439 GLN A C     1 
ATOM   2375  O  O     . GLN A  1 298 ? 31.605  22.737  22.201  1.00 62.40  ? 439 GLN A O     1 
ATOM   2376  C  CB    . GLN A  1 298 ? 31.250  23.027  19.317  1.00 62.57  ? 439 GLN A CB    1 
ATOM   2377  C  CG    . GLN A  1 298 ? 31.194  23.529  17.879  1.00 63.64  ? 439 GLN A CG    1 
ATOM   2378  C  CD    . GLN A  1 298 ? 29.919  23.124  17.160  1.00 64.65  ? 439 GLN A CD    1 
ATOM   2379  O  OE1   . GLN A  1 298 ? 29.908  22.182  16.370  1.00 65.16  ? 439 GLN A OE1   1 
ATOM   2380  N  NE2   . GLN A  1 298 ? 28.839  23.844  17.425  1.00 66.46  ? 439 GLN A NE2   1 
ATOM   2381  N  N     . TRP A  1 299 ? 33.627  21.924  21.649  1.00 55.74  ? 440 TRP A N     1 
ATOM   2382  C  CA    . TRP A  1 299 ? 33.778  21.121  22.859  1.00 54.82  ? 440 TRP A CA    1 
ATOM   2383  C  C     . TRP A  1 299 ? 35.176  21.268  23.444  1.00 53.81  ? 440 TRP A C     1 
ATOM   2384  O  O     . TRP A  1 299 ? 35.749  20.314  23.964  1.00 52.70  ? 440 TRP A O     1 
ATOM   2385  C  CB    . TRP A  1 299 ? 33.477  19.649  22.564  1.00 51.75  ? 440 TRP A CB    1 
ATOM   2386  C  CG    . TRP A  1 299 ? 32.067  19.421  22.136  1.00 48.19  ? 440 TRP A CG    1 
ATOM   2387  C  CD1   . TRP A  1 299 ? 31.590  19.396  20.858  1.00 49.40  ? 440 TRP A CD1   1 
ATOM   2388  C  CD2   . TRP A  1 299 ? 30.941  19.199  22.990  1.00 48.14  ? 440 TRP A CD2   1 
ATOM   2389  N  NE1   . TRP A  1 299 ? 30.234  19.171  20.865  1.00 50.83  ? 440 TRP A NE1   1 
ATOM   2390  C  CE2   . TRP A  1 299 ? 29.811  19.045  22.162  1.00 50.09  ? 440 TRP A CE2   1 
ATOM   2391  C  CE3   . TRP A  1 299 ? 30.776  19.114  24.375  1.00 48.51  ? 440 TRP A CE3   1 
ATOM   2392  C  CZ2   . TRP A  1 299 ? 28.534  18.810  22.678  1.00 50.06  ? 440 TRP A CZ2   1 
ATOM   2393  C  CZ3   . TRP A  1 299 ? 29.509  18.879  24.884  1.00 47.43  ? 440 TRP A CZ3   1 
ATOM   2394  C  CH2   . TRP A  1 299 ? 28.407  18.730  24.040  1.00 48.70  ? 440 TRP A CH2   1 
ATOM   2395  N  N     . ASP A  1 300 ? 35.716  22.476  23.351  1.00 56.01  ? 441 ASP A N     1 
ATOM   2396  C  CA    . ASP A  1 300 ? 37.023  22.791  23.907  1.00 56.86  ? 441 ASP A CA    1 
ATOM   2397  C  C     . ASP A  1 300 ? 36.909  22.848  25.429  1.00 57.36  ? 441 ASP A C     1 
ATOM   2398  O  O     . ASP A  1 300 ? 35.952  23.414  25.961  1.00 56.65  ? 441 ASP A O     1 
ATOM   2399  C  CB    . ASP A  1 300 ? 37.487  24.146  23.355  1.00 58.35  ? 441 ASP A CB    1 
ATOM   2400  C  CG    . ASP A  1 300 ? 38.949  24.456  23.657  1.00 57.69  ? 441 ASP A CG    1 
ATOM   2401  O  OD1   . ASP A  1 300 ? 39.439  24.144  24.761  1.00 56.18  ? 441 ASP A OD1   1 
ATOM   2402  O  OD2   . ASP A  1 300 ? 39.613  25.046  22.782  1.00 60.47  ? 441 ASP A OD2   1 
ATOM   2403  N  N     . PRO A  1 301 ? 37.880  22.246  26.139  1.00 59.62  ? 442 PRO A N     1 
ATOM   2404  C  CA    . PRO A  1 301 ? 38.029  22.406  27.592  1.00 65.93  ? 442 PRO A CA    1 
ATOM   2405  C  C     . PRO A  1 301 ? 38.116  23.878  28.015  1.00 78.94  ? 442 PRO A C     1 
ATOM   2406  O  O     . PRO A  1 301 ? 38.050  24.173  29.211  1.00 83.90  ? 442 PRO A O     1 
ATOM   2407  C  CB    . PRO A  1 301 ? 39.350  21.674  27.898  1.00 59.08  ? 442 PRO A CB    1 
ATOM   2408  C  CG    . PRO A  1 301 ? 39.954  21.315  26.555  1.00 55.02  ? 442 PRO A CG    1 
ATOM   2409  C  CD    . PRO A  1 301 ? 38.803  21.231  25.609  1.00 56.77  ? 442 PRO A CD    1 
ATOM   2410  N  N     . ARG A  1 302 ? 38.285  24.764  27.032  1.00 84.60  ? 443 ARG A N     1 
ATOM   2411  C  CA    . ARG A  1 302 ? 38.163  26.215  27.182  1.00 89.35  ? 443 ARG A CA    1 
ATOM   2412  C  C     . ARG A  1 302 ? 37.017  26.606  28.100  1.00 89.14  ? 443 ARG A C     1 
ATOM   2413  O  O     . ARG A  1 302 ? 37.184  27.412  29.017  1.00 90.40  ? 443 ARG A O     1 
ATOM   2414  C  CB    . ARG A  1 302 ? 37.935  26.840  25.798  1.00 93.55  ? 443 ARG A CB    1 
ATOM   2415  C  CG    . ARG A  1 302 ? 36.928  27.991  25.745  1.00 97.46  ? 443 ARG A CG    1 
ATOM   2416  C  CD    . ARG A  1 302 ? 36.112  27.974  24.450  1.00 99.59  ? 443 ARG A CD    1 
ATOM   2417  N  NE    . ARG A  1 302 ? 35.451  26.689  24.217  1.00 99.68  ? 443 ARG A NE    1 
ATOM   2418  C  CZ    . ARG A  1 302 ? 34.686  26.414  23.163  1.00 100.32 ? 443 ARG A CZ    1 
ATOM   2419  N  NH1   . ARG A  1 302 ? 34.466  27.336  22.236  1.00 103.22 ? 443 ARG A NH1   1 
ATOM   2420  N  NH2   . ARG A  1 302 ? 34.130  25.215  23.039  1.00 97.49  ? 443 ARG A NH2   1 
ATOM   2421  N  N     . ASN A  1 303 ? 35.853  26.017  27.849  1.00 88.15  ? 444 ASN A N     1 
ATOM   2422  C  CA    . ASN A  1 303 ? 34.656  26.376  28.581  1.00 91.55  ? 444 ASN A CA    1 
ATOM   2423  C  C     . ASN A  1 303 ? 34.293  25.361  29.659  1.00 87.69  ? 444 ASN A C     1 
ATOM   2424  O  O     . ASN A  1 303 ? 34.221  25.706  30.843  1.00 89.38  ? 444 ASN A O     1 
ATOM   2425  C  CB    . ASN A  1 303 ? 33.484  26.576  27.617  1.00 95.74  ? 444 ASN A CB    1 
ATOM   2426  C  CG    . ASN A  1 303 ? 33.273  25.388  26.698  1.00 97.43  ? 444 ASN A CG    1 
ATOM   2427  O  OD1   . ASN A  1 303 ? 33.925  25.268  25.667  1.00 98.82  ? 444 ASN A OD1   1 
ATOM   2428  N  ND2   . ASN A  1 303 ? 32.359  24.504  27.070  1.00 97.72  ? 444 ASN A ND2   1 
ATOM   2429  N  N     . LEU A  1 304 ? 34.081  24.111  29.247  1.00 79.71  ? 445 LEU A N     1 
ATOM   2430  C  CA    . LEU A  1 304 ? 33.465  23.081  30.084  1.00 72.53  ? 445 LEU A CA    1 
ATOM   2431  C  C     . LEU A  1 304 ? 32.148  23.586  30.673  1.00 72.99  ? 445 LEU A C     1 
ATOM   2432  O  O     . LEU A  1 304 ? 31.087  23.020  30.407  1.00 72.62  ? 445 LEU A O     1 
ATOM   2433  C  CB    . LEU A  1 304 ? 34.425  22.593  31.170  1.00 70.05  ? 445 LEU A CB    1 
ATOM   2434  C  CG    . LEU A  1 304 ? 33.984  21.372  31.981  1.00 67.76  ? 445 LEU A CG    1 
ATOM   2435  C  CD1   . LEU A  1 304 ? 33.627  20.206  31.074  1.00 65.36  ? 445 LEU A CD1   1 
ATOM   2436  C  CD2   . LEU A  1 304 ? 35.067  20.973  32.973  1.00 66.25  ? 445 LEU A CD2   1 
ATOM   2437  N  N     . SER A  1 305 ? 32.234  24.655  31.462  1.00 71.60  ? 446 SER A N     1 
ATOM   2438  C  CA    . SER A  1 305 ? 31.076  25.398  31.942  1.00 70.29  ? 446 SER A CA    1 
ATOM   2439  C  C     . SER A  1 305 ? 30.014  25.627  30.867  1.00 67.22  ? 446 SER A C     1 
ATOM   2440  O  O     . SER A  1 305 ? 28.847  25.308  31.075  1.00 69.76  ? 446 SER A O     1 
ATOM   2441  C  CB    . SER A  1 305 ? 31.522  26.748  32.513  1.00 73.01  ? 446 SER A CB    1 
ATOM   2442  O  OG    . SER A  1 305 ? 32.416  26.585  33.600  1.00 73.08  ? 446 SER A OG    1 
ATOM   2443  N  N     . SER A  1 306 ? 30.414  26.172  29.722  1.00 62.85  ? 447 SER A N     1 
ATOM   2444  C  CA    . SER A  1 306 ? 29.450  26.536  28.687  1.00 62.56  ? 447 SER A CA    1 
ATOM   2445  C  C     . SER A  1 306 ? 28.795  25.335  28.006  1.00 60.67  ? 447 SER A C     1 
ATOM   2446  O  O     . SER A  1 306 ? 27.581  25.319  27.809  1.00 60.29  ? 447 SER A O     1 
ATOM   2447  C  CB    . SER A  1 306 ? 30.092  27.445  27.640  1.00 63.88  ? 447 SER A CB    1 
ATOM   2448  O  OG    . SER A  1 306 ? 29.253  27.577  26.507  1.00 64.28  ? 447 SER A OG    1 
ATOM   2449  N  N     . CYS A  1 307 ? 29.598  24.345  27.630  1.00 58.75  ? 448 CYS A N     1 
ATOM   2450  C  CA    . CYS A  1 307 ? 29.070  23.148  26.984  1.00 59.62  ? 448 CYS A CA    1 
ATOM   2451  C  C     . CYS A  1 307 ? 28.212  22.349  27.949  1.00 58.06  ? 448 CYS A C     1 
ATOM   2452  O  O     . CYS A  1 307 ? 27.184  21.791  27.563  1.00 58.72  ? 448 CYS A O     1 
ATOM   2453  C  CB    . CYS A  1 307 ? 30.196  22.262  26.460  1.00 59.01  ? 448 CYS A CB    1 
ATOM   2454  S  SG    . CYS A  1 307 ? 31.200  23.020  25.185  1.00 64.05  ? 448 CYS A SG    1 
ATOM   2455  N  N     . PHE A  1 308 ? 28.647  22.291  29.204  1.00 55.14  ? 449 PHE A N     1 
ATOM   2456  C  CA    . PHE A  1 308 ? 27.875  21.639  30.250  1.00 53.21  ? 449 PHE A CA    1 
ATOM   2457  C  C     . PHE A  1 308 ? 26.525  22.327  30.399  1.00 51.16  ? 449 PHE A C     1 
ATOM   2458  O  O     . PHE A  1 308 ? 25.490  21.670  30.397  1.00 48.65  ? 449 PHE A O     1 
ATOM   2459  C  CB    . PHE A  1 308 ? 28.632  21.685  31.574  1.00 53.98  ? 449 PHE A CB    1 
ATOM   2460  C  CG    . PHE A  1 308 ? 27.989  20.894  32.666  1.00 51.65  ? 449 PHE A CG    1 
ATOM   2461  C  CD1   . PHE A  1 308 ? 27.349  19.699  32.387  1.00 48.06  ? 449 PHE A CD1   1 
ATOM   2462  C  CD2   . PHE A  1 308 ? 28.025  21.346  33.976  1.00 53.41  ? 449 PHE A CD2   1 
ATOM   2463  C  CE1   . PHE A  1 308 ? 26.752  18.965  33.396  1.00 50.15  ? 449 PHE A CE1   1 
ATOM   2464  C  CE2   . PHE A  1 308 ? 27.431  20.618  34.995  1.00 53.76  ? 449 PHE A CE2   1 
ATOM   2465  C  CZ    . PHE A  1 308 ? 26.793  19.428  34.704  1.00 52.30  ? 449 PHE A CZ    1 
ATOM   2466  N  N     . ASP A  1 309 ? 26.550  23.653  30.515  1.00 53.85  ? 450 ASP A N     1 
ATOM   2467  C  CA    . ASP A  1 309 ? 25.341  24.463  30.640  1.00 58.25  ? 450 ASP A CA    1 
ATOM   2468  C  C     . ASP A  1 309 ? 24.422  24.275  29.432  1.00 60.84  ? 450 ASP A C     1 
ATOM   2469  O  O     . ASP A  1 309 ? 23.194  24.294  29.560  1.00 60.13  ? 450 ASP A O     1 
ATOM   2470  C  CB    . ASP A  1 309 ? 25.727  25.937  30.789  1.00 59.74  ? 450 ASP A CB    1 
ATOM   2471  C  CG    . ASP A  1 309 ? 24.574  26.804  31.252  1.00 60.25  ? 450 ASP A CG    1 
ATOM   2472  O  OD1   . ASP A  1 309 ? 23.850  27.346  30.391  1.00 57.94  ? 450 ASP A OD1   1 
ATOM   2473  O  OD2   . ASP A  1 309 ? 24.400  26.957  32.479  1.00 62.58  ? 450 ASP A OD2   1 
ATOM   2474  N  N     . LYS A  1 310 ? 25.027  24.083  28.264  1.00 64.46  ? 451 LYS A N     1 
ATOM   2475  C  CA    . LYS A  1 310 ? 24.282  23.872  27.028  1.00 67.34  ? 451 LYS A CA    1 
ATOM   2476  C  C     . LYS A  1 310 ? 23.592  22.510  27.044  1.00 64.04  ? 451 LYS A C     1 
ATOM   2477  O  O     . LYS A  1 310 ? 22.431  22.383  26.643  1.00 65.69  ? 451 LYS A O     1 
ATOM   2478  C  CB    . LYS A  1 310 ? 25.213  23.996  25.821  1.00 70.24  ? 451 LYS A CB    1 
ATOM   2479  C  CG    . LYS A  1 310 ? 24.498  24.039  24.477  1.00 75.65  ? 451 LYS A CG    1 
ATOM   2480  C  CD    . LYS A  1 310 ? 25.442  24.485  23.363  1.00 79.63  ? 451 LYS A CD    1 
ATOM   2481  C  CE    . LYS A  1 310 ? 24.685  24.776  22.074  1.00 81.00  ? 451 LYS A CE    1 
ATOM   2482  N  NZ    . LYS A  1 310 ? 25.587  25.278  21.004  1.00 80.69  ? 451 LYS A NZ    1 
ATOM   2483  N  N     . LEU A  1 311 ? 24.307  21.497  27.525  1.00 59.10  ? 452 LEU A N     1 
ATOM   2484  C  CA    . LEU A  1 311 ? 23.736  20.166  27.686  1.00 56.28  ? 452 LEU A CA    1 
ATOM   2485  C  C     . LEU A  1 311 ? 22.567  20.211  28.670  1.00 56.89  ? 452 LEU A C     1 
ATOM   2486  O  O     . LEU A  1 311 ? 21.483  19.695  28.377  1.00 59.50  ? 452 LEU A O     1 
ATOM   2487  C  CB    . LEU A  1 311 ? 24.805  19.175  28.147  1.00 57.56  ? 452 LEU A CB    1 
ATOM   2488  C  CG    . LEU A  1 311 ? 24.351  17.737  28.393  1.00 57.76  ? 452 LEU A CG    1 
ATOM   2489  C  CD1   . LEU A  1 311 ? 23.684  17.168  27.154  1.00 57.93  ? 452 LEU A CD1   1 
ATOM   2490  C  CD2   . LEU A  1 311 ? 25.517  16.861  28.826  1.00 56.98  ? 452 LEU A CD2   1 
ATOM   2491  N  N     . LEU A  1 312 ? 22.808  20.824  29.831  1.00 52.99  ? 453 LEU A N     1 
ATOM   2492  C  CA    . LEU A  1 312 ? 21.772  21.137  30.814  1.00 49.73  ? 453 LEU A CA    1 
ATOM   2493  C  C     . LEU A  1 312 ? 20.531  21.671  30.116  1.00 51.11  ? 453 LEU A C     1 
ATOM   2494  O  O     . LEU A  1 312 ? 19.453  21.091  30.218  1.00 53.86  ? 453 LEU A O     1 
ATOM   2495  C  CB    . LEU A  1 312 ? 22.285  22.198  31.795  1.00 51.72  ? 453 LEU A CB    1 
ATOM   2496  C  CG    . LEU A  1 312 ? 22.861  21.829  33.166  1.00 51.87  ? 453 LEU A CG    1 
ATOM   2497  C  CD1   . LEU A  1 312 ? 23.615  20.519  33.132  1.00 50.67  ? 453 LEU A CD1   1 
ATOM   2498  C  CD2   . LEU A  1 312 ? 23.773  22.942  33.671  1.00 52.51  ? 453 LEU A CD2   1 
ATOM   2499  N  N     . ALA A  1 313 ? 20.710  22.772  29.391  1.00 52.05  ? 454 ALA A N     1 
ATOM   2500  C  CA    . ALA A  1 313 ? 19.636  23.413  28.636  1.00 52.17  ? 454 ALA A CA    1 
ATOM   2501  C  C     . ALA A  1 313 ? 18.867  22.459  27.713  1.00 54.45  ? 454 ALA A C     1 
ATOM   2502  O  O     . ALA A  1 313 ? 17.631  22.401  27.759  1.00 56.33  ? 454 ALA A O     1 
ATOM   2503  C  CB    . ALA A  1 313 ? 20.193  24.583  27.846  1.00 53.42  ? 454 ALA A CB    1 
ATOM   2504  N  N     . PHE A  1 314 ? 19.592  21.723  26.871  1.00 57.00  ? 455 PHE A N     1 
ATOM   2505  C  CA    . PHE A  1 314 ? 18.960  20.768  25.962  1.00 59.21  ? 455 PHE A CA    1 
ATOM   2506  C  C     . PHE A  1 314 ? 18.121  19.727  26.698  1.00 60.38  ? 455 PHE A C     1 
ATOM   2507  O  O     . PHE A  1 314 ? 17.010  19.401  26.276  1.00 62.15  ? 455 PHE A O     1 
ATOM   2508  C  CB    . PHE A  1 314 ? 19.996  20.059  25.090  1.00 59.11  ? 455 PHE A CB    1 
ATOM   2509  C  CG    . PHE A  1 314 ? 19.408  18.982  24.214  1.00 61.32  ? 455 PHE A CG    1 
ATOM   2510  C  CD1   . PHE A  1 314 ? 18.592  19.312  23.140  1.00 63.93  ? 455 PHE A CD1   1 
ATOM   2511  C  CD2   . PHE A  1 314 ? 19.666  17.642  24.466  1.00 58.65  ? 455 PHE A CD2   1 
ATOM   2512  C  CE1   . PHE A  1 314 ? 18.045  18.325  22.334  1.00 61.18  ? 455 PHE A CE1   1 
ATOM   2513  C  CE2   . PHE A  1 314 ? 19.121  16.651  23.663  1.00 57.14  ? 455 PHE A CE2   1 
ATOM   2514  C  CZ    . PHE A  1 314 ? 18.309  16.996  22.597  1.00 57.77  ? 455 PHE A CZ    1 
ATOM   2515  N  N     . PHE A  1 315 ? 18.663  19.205  27.794  1.00 57.01  ? 456 PHE A N     1 
ATOM   2516  C  CA    . PHE A  1 315 ? 17.987  18.164  28.558  1.00 51.81  ? 456 PHE A CA    1 
ATOM   2517  C  C     . PHE A  1 315 ? 16.745  18.721  29.257  1.00 51.54  ? 456 PHE A C     1 
ATOM   2518  O  O     . PHE A  1 315 ? 15.726  18.028  29.397  1.00 45.76  ? 456 PHE A O     1 
ATOM   2519  C  CB    . PHE A  1 315 ? 18.953  17.547  29.567  1.00 50.30  ? 456 PHE A CB    1 
ATOM   2520  C  CG    . PHE A  1 315 ? 18.442  16.286  30.201  1.00 50.51  ? 456 PHE A CG    1 
ATOM   2521  C  CD1   . PHE A  1 315 ? 18.321  15.120  29.458  1.00 47.63  ? 456 PHE A CD1   1 
ATOM   2522  C  CD2   . PHE A  1 315 ? 18.089  16.262  31.539  1.00 46.80  ? 456 PHE A CD2   1 
ATOM   2523  C  CE1   . PHE A  1 315 ? 17.847  13.961  30.036  1.00 43.89  ? 456 PHE A CE1   1 
ATOM   2524  C  CE2   . PHE A  1 315 ? 17.614  15.102  32.123  1.00 44.17  ? 456 PHE A CE2   1 
ATOM   2525  C  CZ    . PHE A  1 315 ? 17.493  13.952  31.369  1.00 43.19  ? 456 PHE A CZ    1 
ATOM   2526  N  N     . LEU A  1 316 ? 16.849  19.974  29.696  1.00 53.86  ? 457 LEU A N     1 
ATOM   2527  C  CA    . LEU A  1 316 ? 15.707  20.713  30.212  1.00 54.19  ? 457 LEU A CA    1 
ATOM   2528  C  C     . LEU A  1 316 ? 14.619  20.670  29.158  1.00 57.97  ? 457 LEU A C     1 
ATOM   2529  O  O     . LEU A  1 316 ? 13.521  20.184  29.414  1.00 60.47  ? 457 LEU A O     1 
ATOM   2530  C  CB    . LEU A  1 316 ? 16.084  22.168  30.492  1.00 54.76  ? 457 LEU A CB    1 
ATOM   2531  C  CG    . LEU A  1 316 ? 16.342  22.669  31.912  1.00 55.34  ? 457 LEU A CG    1 
ATOM   2532  C  CD1   . LEU A  1 316 ? 17.402  21.844  32.576  1.00 55.59  ? 457 LEU A CD1   1 
ATOM   2533  C  CD2   . LEU A  1 316 ? 16.766  24.124  31.882  1.00 56.76  ? 457 LEU A CD2   1 
ATOM   2534  N  N     . GLU A  1 317 ? 14.943  21.158  27.962  1.00 59.88  ? 458 GLU A N     1 
ATOM   2535  C  CA    . GLU A  1 317 ? 13.974  21.196  26.870  1.00 61.28  ? 458 GLU A CA    1 
ATOM   2536  C  C     . GLU A  1 317 ? 13.358  19.821  26.590  1.00 58.76  ? 458 GLU A C     1 
ATOM   2537  O  O     . GLU A  1 317 ? 12.147  19.711  26.382  1.00 61.99  ? 458 GLU A O     1 
ATOM   2538  C  CB    . GLU A  1 317 ? 14.616  21.772  25.606  1.00 62.43  ? 458 GLU A CB    1 
ATOM   2539  C  CG    . GLU A  1 317 ? 13.639  22.472  24.672  1.00 66.90  ? 458 GLU A CG    1 
ATOM   2540  C  CD    . GLU A  1 317 ? 13.147  23.806  25.214  1.00 72.89  ? 458 GLU A CD    1 
ATOM   2541  O  OE1   . GLU A  1 317 ? 13.777  24.348  26.145  1.00 75.40  ? 458 GLU A OE1   1 
ATOM   2542  O  OE2   . GLU A  1 317 ? 12.129  24.316  24.702  1.00 74.08  ? 458 GLU A OE2   1 
ATOM   2543  N  N     . CYS A  1 318 ? 14.190  18.782  26.611  1.00 53.82  ? 459 CYS A N     1 
ATOM   2544  C  CA    . CYS A  1 318 ? 13.717  17.406  26.469  1.00 51.37  ? 459 CYS A CA    1 
ATOM   2545  C  C     . CYS A  1 318 ? 12.663  17.066  27.511  1.00 52.34  ? 459 CYS A C     1 
ATOM   2546  O  O     . CYS A  1 318 ? 11.655  16.423  27.205  1.00 50.23  ? 459 CYS A O     1 
ATOM   2547  C  CB    . CYS A  1 318 ? 14.875  16.427  26.623  1.00 50.54  ? 459 CYS A CB    1 
ATOM   2548  S  SG    . CYS A  1 318 ? 16.095  16.483  25.316  1.00 50.22  ? 459 CYS A SG    1 
ATOM   2549  N  N     . LEU A  1 319 ? 12.912  17.491  28.747  1.00 54.78  ? 460 LEU A N     1 
ATOM   2550  C  CA    . LEU A  1 319 ? 11.971  17.267  29.838  1.00 56.30  ? 460 LEU A CA    1 
ATOM   2551  C  C     . LEU A  1 319 ? 10.657  18.001  29.599  1.00 61.66  ? 460 LEU A C     1 
ATOM   2552  O  O     . LEU A  1 319 ? 9.581   17.401  29.649  1.00 61.17  ? 460 LEU A O     1 
ATOM   2553  C  CB    . LEU A  1 319 ? 12.576  17.725  31.168  1.00 53.45  ? 460 LEU A CB    1 
ATOM   2554  C  CG    . LEU A  1 319 ? 13.691  16.889  31.793  1.00 46.03  ? 460 LEU A CG    1 
ATOM   2555  C  CD1   . LEU A  1 319 ? 14.429  17.695  32.849  1.00 44.99  ? 460 LEU A CD1   1 
ATOM   2556  C  CD2   . LEU A  1 319 ? 13.122  15.620  32.397  1.00 39.45  ? 460 LEU A CD2   1 
ATOM   2557  N  N     . ARG A  1 320 ? 10.760  19.303  29.343  1.00 65.68  ? 461 ARG A N     1 
ATOM   2558  C  CA    . ARG A  1 320 ? 9.595   20.164  29.191  1.00 70.19  ? 461 ARG A CA    1 
ATOM   2559  C  C     . ARG A  1 320 ? 8.695   19.722  28.038  1.00 70.02  ? 461 ARG A C     1 
ATOM   2560  O  O     . ARG A  1 320 ? 7.472   19.681  28.187  1.00 68.74  ? 461 ARG A O     1 
ATOM   2561  C  CB    . ARG A  1 320 ? 10.021  21.625  28.998  1.00 74.75  ? 461 ARG A CB    1 
ATOM   2562  C  CG    . ARG A  1 320 ? 11.152  22.081  29.918  1.00 76.96  ? 461 ARG A CG    1 
ATOM   2563  C  CD    . ARG A  1 320 ? 11.023  23.548  30.320  1.00 82.08  ? 461 ARG A CD    1 
ATOM   2564  N  NE    . ARG A  1 320 ? 10.439  23.692  31.652  1.00 84.27  ? 461 ARG A NE    1 
ATOM   2565  C  CZ    . ARG A  1 320 ? 11.090  24.147  32.720  1.00 84.94  ? 461 ARG A CZ    1 
ATOM   2566  N  NH1   . ARG A  1 320 ? 12.358  24.529  32.627  1.00 85.46  ? 461 ARG A NH1   1 
ATOM   2567  N  NH2   . ARG A  1 320 ? 10.467  24.229  33.886  1.00 84.69  ? 461 ARG A NH2   1 
ATOM   2568  N  N     . THR A  1 321 ? 9.293   19.389  26.895  1.00 68.55  ? 462 THR A N     1 
ATOM   2569  C  CA    . THR A  1 321 ? 8.508   18.951  25.742  1.00 68.71  ? 462 THR A CA    1 
ATOM   2570  C  C     . THR A  1 321 ? 8.073   17.501  25.883  1.00 67.85  ? 462 THR A C     1 
ATOM   2571  O  O     . THR A  1 321 ? 7.260   17.015  25.098  1.00 66.27  ? 462 THR A O     1 
ATOM   2572  C  CB    . THR A  1 321 ? 9.275   19.101  24.414  1.00 70.79  ? 462 THR A CB    1 
ATOM   2573  O  OG1   . THR A  1 321 ? 8.390   18.835  23.318  1.00 71.85  ? 462 THR A OG1   1 
ATOM   2574  C  CG2   . THR A  1 321 ? 10.435  18.128  24.351  1.00 71.36  ? 462 THR A CG2   1 
ATOM   2575  N  N     . GLU A  1 322 ? 8.618   16.823  26.890  1.00 68.32  ? 463 GLU A N     1 
ATOM   2576  C  CA    . GLU A  1 322 ? 8.376   15.401  27.091  1.00 65.66  ? 463 GLU A CA    1 
ATOM   2577  C  C     . GLU A  1 322 ? 8.725   14.621  25.832  1.00 61.45  ? 463 GLU A C     1 
ATOM   2578  O  O     . GLU A  1 322 ? 7.938   13.794  25.360  1.00 60.06  ? 463 GLU A O     1 
ATOM   2579  C  CB    . GLU A  1 322 ? 6.927   15.144  27.507  1.00 70.31  ? 463 GLU A CB    1 
ATOM   2580  C  CG    . GLU A  1 322 ? 6.540   15.837  28.795  1.00 76.77  ? 463 GLU A CG    1 
ATOM   2581  C  CD    . GLU A  1 322 ? 5.044   15.879  29.001  1.00 82.70  ? 463 GLU A CD    1 
ATOM   2582  O  OE1   . GLU A  1 322 ? 4.513   16.968  29.305  1.00 85.65  ? 463 GLU A OE1   1 
ATOM   2583  O  OE2   . GLU A  1 322 ? 4.398   14.823  28.860  1.00 83.87  ? 463 GLU A OE2   1 
ATOM   2584  N  N     . LYS A  1 323 ? 9.901   14.910  25.280  1.00 59.30  ? 464 LYS A N     1 
ATOM   2585  C  CA    . LYS A  1 323 ? 10.399  14.159  24.135  1.00 56.18  ? 464 LYS A CA    1 
ATOM   2586  C  C     . LYS A  1 323 ? 11.900  13.923  24.219  1.00 51.76  ? 464 LYS A C     1 
ATOM   2587  O  O     . LYS A  1 323 ? 12.679  14.833  24.534  1.00 53.51  ? 464 LYS A O     1 
ATOM   2588  C  CB    . LYS A  1 323 ? 10.038  14.838  22.809  1.00 56.46  ? 464 LYS A CB    1 
ATOM   2589  C  CG    . LYS A  1 323 ? 9.979   13.862  21.636  1.00 52.78  ? 464 LYS A CG    1 
ATOM   2590  C  CD    . LYS A  1 323 ? 9.628   14.554  20.331  1.00 51.63  ? 464 LYS A CD    1 
ATOM   2591  C  CE    . LYS A  1 323 ? 10.856  14.752  19.465  1.00 54.03  ? 464 LYS A CE    1 
ATOM   2592  N  NZ    . LYS A  1 323 ? 11.895  15.574  20.143  1.00 56.50  ? 464 LYS A NZ    1 
ATOM   2593  N  N     . LEU A  1 324 ? 12.285  12.682  23.945  1.00 46.22  ? 465 LEU A N     1 
ATOM   2594  C  CA    . LEU A  1 324 ? 13.683  12.287  23.870  1.00 40.00  ? 465 LEU A CA    1 
ATOM   2595  C  C     . LEU A  1 324 ? 13.764  11.054  22.983  1.00 37.84  ? 465 LEU A C     1 
ATOM   2596  O  O     . LEU A  1 324 ? 13.612  9.927   23.465  1.00 36.87  ? 465 LEU A O     1 
ATOM   2597  C  CB    . LEU A  1 324 ? 14.231  11.976  25.263  1.00 38.82  ? 465 LEU A CB    1 
ATOM   2598  C  CG    . LEU A  1 324 ? 15.683  11.503  25.351  1.00 37.02  ? 465 LEU A CG    1 
ATOM   2599  C  CD1   . LEU A  1 324 ? 16.615  12.525  24.740  1.00 35.50  ? 465 LEU A CD1   1 
ATOM   2600  C  CD2   . LEU A  1 324 ? 16.066  11.229  26.793  1.00 37.55  ? 465 LEU A CD2   1 
ATOM   2601  N  N     . ASP A  1 325 ? 13.976  11.264  21.685  1.00 39.23  ? 466 ASP A N     1 
ATOM   2602  C  CA    . ASP A  1 325 ? 14.028  10.151  20.742  1.00 41.45  ? 466 ASP A CA    1 
ATOM   2603  C  C     . ASP A  1 325 ? 15.243  9.268   20.990  1.00 46.86  ? 466 ASP A C     1 
ATOM   2604  O  O     . ASP A  1 325 ? 16.329  9.763   21.291  1.00 52.80  ? 466 ASP A O     1 
ATOM   2605  C  CB    . ASP A  1 325 ? 14.061  10.661  19.302  1.00 43.47  ? 466 ASP A CB    1 
ATOM   2606  C  CG    . ASP A  1 325 ? 12.794  11.396  18.911  1.00 47.82  ? 466 ASP A CG    1 
ATOM   2607  O  OD1   . ASP A  1 325 ? 11.718  11.073  19.462  1.00 43.45  ? 466 ASP A OD1   1 
ATOM   2608  O  OD2   . ASP A  1 325 ? 12.876  12.295  18.043  1.00 49.45  ? 466 ASP A OD2   1 
ATOM   2609  N  N     . HIS A  1 326 ? 15.054  7.958   20.871  1.00 47.89  ? 467 HIS A N     1 
ATOM   2610  C  CA    . HIS A  1 326 ? 16.165  7.012   20.923  1.00 47.84  ? 467 HIS A CA    1 
ATOM   2611  C  C     . HIS A  1 326 ? 17.089  7.287   19.740  1.00 50.38  ? 467 HIS A C     1 
ATOM   2612  O  O     . HIS A  1 326 ? 16.621  7.481   18.618  1.00 53.43  ? 467 HIS A O     1 
ATOM   2613  C  CB    . HIS A  1 326 ? 15.628  5.582   20.859  1.00 47.47  ? 467 HIS A CB    1 
ATOM   2614  C  CG    . HIS A  1 326 ? 16.627  4.531   21.234  1.00 44.86  ? 467 HIS A CG    1 
ATOM   2615  N  ND1   . HIS A  1 326 ? 17.617  4.103   20.378  1.00 45.21  ? 467 HIS A ND1   1 
ATOM   2616  C  CD2   . HIS A  1 326 ? 16.767  3.801   22.365  1.00 43.13  ? 467 HIS A CD2   1 
ATOM   2617  C  CE1   . HIS A  1 326 ? 18.333  3.163   20.970  1.00 42.83  ? 467 HIS A CE1   1 
ATOM   2618  N  NE2   . HIS A  1 326 ? 17.837  2.961   22.176  1.00 40.73  ? 467 HIS A NE2   1 
ATOM   2619  N  N     . TYR A  1 327 ? 18.396  7.304   19.991  1.00 50.29  ? 468 TYR A N     1 
ATOM   2620  C  CA    . TYR A  1 327 ? 19.370  7.743   18.995  1.00 48.69  ? 468 TYR A CA    1 
ATOM   2621  C  C     . TYR A  1 327 ? 19.505  6.769   17.832  1.00 47.56  ? 468 TYR A C     1 
ATOM   2622  O  O     . TYR A  1 327 ? 20.113  7.094   16.811  1.00 51.85  ? 468 TYR A O     1 
ATOM   2623  C  CB    . TYR A  1 327 ? 20.730  7.960   19.664  1.00 49.07  ? 468 TYR A CB    1 
ATOM   2624  C  CG    . TYR A  1 327 ? 21.680  8.837   18.879  1.00 50.84  ? 468 TYR A CG    1 
ATOM   2625  C  CD1   . TYR A  1 327 ? 21.408  10.184  18.679  1.00 54.93  ? 468 TYR A CD1   1 
ATOM   2626  C  CD2   . TYR A  1 327 ? 22.857  8.324   18.357  1.00 49.67  ? 468 TYR A CD2   1 
ATOM   2627  C  CE1   . TYR A  1 327 ? 22.279  10.991  17.967  1.00 55.57  ? 468 TYR A CE1   1 
ATOM   2628  C  CE2   . TYR A  1 327 ? 23.730  9.120   17.648  1.00 52.25  ? 468 TYR A CE2   1 
ATOM   2629  C  CZ    . TYR A  1 327 ? 23.435  10.449  17.456  1.00 54.54  ? 468 TYR A CZ    1 
ATOM   2630  O  OH    . TYR A  1 327 ? 24.311  11.233  16.747  1.00 54.27  ? 468 TYR A OH    1 
ATOM   2631  N  N     . PHE A  1 328 ? 18.928  5.582   17.991  1.00 44.45  ? 469 PHE A N     1 
ATOM   2632  C  CA    . PHE A  1 328 ? 18.985  4.551   16.966  1.00 43.93  ? 469 PHE A CA    1 
ATOM   2633  C  C     . PHE A  1 328 ? 17.585  4.230   16.468  1.00 44.38  ? 469 PHE A C     1 
ATOM   2634  O  O     . PHE A  1 328 ? 17.416  3.639   15.403  1.00 45.21  ? 469 PHE A O     1 
ATOM   2635  C  CB    . PHE A  1 328 ? 19.619  3.282   17.533  1.00 44.58  ? 469 PHE A CB    1 
ATOM   2636  C  CG    . PHE A  1 328 ? 21.084  3.414   17.832  1.00 39.62  ? 469 PHE A CG    1 
ATOM   2637  C  CD1   . PHE A  1 328 ? 21.524  4.075   18.971  1.00 38.42  ? 469 PHE A CD1   1 
ATOM   2638  C  CD2   . PHE A  1 328 ? 22.023  2.860   16.981  1.00 36.34  ? 469 PHE A CD2   1 
ATOM   2639  C  CE1   . PHE A  1 328 ? 22.874  4.193   19.244  1.00 36.32  ? 469 PHE A CE1   1 
ATOM   2640  C  CE2   . PHE A  1 328 ? 23.377  2.973   17.250  1.00 36.12  ? 469 PHE A CE2   1 
ATOM   2641  C  CZ    . PHE A  1 328 ? 23.801  3.640   18.383  1.00 34.50  ? 469 PHE A CZ    1 
ATOM   2642  N  N     . ILE A  1 329 ? 16.590  4.608   17.266  1.00 44.06  ? 470 ILE A N     1 
ATOM   2643  C  CA    . ILE A  1 329 ? 15.186  4.363   16.959  1.00 43.81  ? 470 ILE A CA    1 
ATOM   2644  C  C     . ILE A  1 329 ? 14.400  5.644   17.232  1.00 46.37  ? 470 ILE A C     1 
ATOM   2645  O  O     . ILE A  1 329 ? 13.863  5.814   18.319  1.00 50.33  ? 470 ILE A O     1 
ATOM   2646  C  CB    . ILE A  1 329 ? 14.626  3.212   17.834  1.00 32.48  ? 470 ILE A CB    1 
ATOM   2647  C  CG1   . ILE A  1 329 ? 15.567  2.005   17.809  1.00 27.53  ? 470 ILE A CG1   1 
ATOM   2648  C  CG2   . ILE A  1 329 ? 13.239  2.791   17.375  1.00 36.18  ? 470 ILE A CG2   1 
ATOM   2649  C  CD1   . ILE A  1 329 ? 15.300  0.978   18.890  1.00 26.96  ? 470 ILE A CD1   1 
ATOM   2650  N  N     . PRO A  1 330 ? 14.343  6.560   16.247  1.00 49.39  ? 471 PRO A N     1 
ATOM   2651  C  CA    . PRO A  1 330 ? 13.722  7.877   16.455  1.00 54.72  ? 471 PRO A CA    1 
ATOM   2652  C  C     . PRO A  1 330 ? 12.208  7.872   16.716  1.00 59.80  ? 471 PRO A C     1 
ATOM   2653  O  O     . PRO A  1 330 ? 11.695  8.888   17.194  1.00 61.30  ? 471 PRO A O     1 
ATOM   2654  C  CB    . PRO A  1 330 ? 14.027  8.618   15.149  1.00 54.12  ? 471 PRO A CB    1 
ATOM   2655  C  CG    . PRO A  1 330 ? 15.234  7.946   14.602  1.00 51.54  ? 471 PRO A CG    1 
ATOM   2656  C  CD    . PRO A  1 330 ? 15.068  6.498   14.965  1.00 48.27  ? 471 PRO A CD    1 
ATOM   2657  N  N     . LYS A  1 331 ? 11.507  6.781   16.405  1.00 62.46  ? 472 LYS A N     1 
ATOM   2658  C  CA    . LYS A  1 331 ? 10.084  6.696   16.743  1.00 64.73  ? 472 LYS A CA    1 
ATOM   2659  C  C     . LYS A  1 331 ? 9.876   6.078   18.126  1.00 68.02  ? 472 LYS A C     1 
ATOM   2660  O  O     . LYS A  1 331 ? 8.800   5.563   18.444  1.00 71.81  ? 472 LYS A O     1 
ATOM   2661  C  CB    . LYS A  1 331 ? 9.278   5.950   15.669  1.00 63.55  ? 472 LYS A CB    1 
ATOM   2662  C  CG    . LYS A  1 331 ? 9.402   4.428   15.670  1.00 62.29  ? 472 LYS A CG    1 
ATOM   2663  C  CD    . LYS A  1 331 ? 8.303   3.809   14.814  1.00 63.23  ? 472 LYS A CD    1 
ATOM   2664  C  CE    . LYS A  1 331 ? 8.523   2.321   14.598  1.00 61.46  ? 472 LYS A CE    1 
ATOM   2665  N  NZ    . LYS A  1 331 ? 7.417   1.706   13.811  1.00 61.25  ? 472 LYS A NZ    1 
ATOM   2666  N  N     . PHE A  1 332 ? 10.915  6.159   18.948  1.00 65.86  ? 473 PHE A N     1 
ATOM   2667  C  CA    . PHE A  1 332 ? 10.870  5.670   20.314  1.00 63.67  ? 473 PHE A CA    1 
ATOM   2668  C  C     . PHE A  1 332 ? 11.168  6.836   21.249  1.00 63.35  ? 473 PHE A C     1 
ATOM   2669  O  O     . PHE A  1 332 ? 12.333  7.185   21.455  1.00 63.36  ? 473 PHE A O     1 
ATOM   2670  C  CB    . PHE A  1 332 ? 11.920  4.575   20.489  1.00 61.88  ? 473 PHE A CB    1 
ATOM   2671  C  CG    . PHE A  1 332 ? 11.877  3.890   21.823  1.00 63.29  ? 473 PHE A CG    1 
ATOM   2672  C  CD1   . PHE A  1 332 ? 10.754  3.966   22.632  1.00 65.77  ? 473 PHE A CD1   1 
ATOM   2673  C  CD2   . PHE A  1 332 ? 12.969  3.165   22.268  1.00 63.09  ? 473 PHE A CD2   1 
ATOM   2674  C  CE1   . PHE A  1 332 ? 10.723  3.331   23.859  1.00 64.52  ? 473 PHE A CE1   1 
ATOM   2675  C  CE2   . PHE A  1 332 ? 12.945  2.527   23.494  1.00 62.51  ? 473 PHE A CE2   1 
ATOM   2676  C  CZ    . PHE A  1 332 ? 11.821  2.610   24.289  1.00 62.16  ? 473 PHE A CZ    1 
ATOM   2677  N  N     . ASN A  1 333 ? 10.121  7.442   21.805  1.00 62.26  ? 474 ASN A N     1 
ATOM   2678  C  CA    . ASN A  1 333 ? 10.304  8.519   22.773  1.00 60.97  ? 474 ASN A CA    1 
ATOM   2679  C  C     . ASN A  1 333 ? 10.536  7.977   24.176  1.00 58.94  ? 474 ASN A C     1 
ATOM   2680  O  O     . ASN A  1 333 ? 9.692   7.277   24.733  1.00 59.14  ? 474 ASN A O     1 
ATOM   2681  C  CB    . ASN A  1 333 ? 9.120   9.483   22.765  1.00 61.85  ? 474 ASN A CB    1 
ATOM   2682  C  CG    . ASN A  1 333 ? 9.402   10.755  23.551  1.00 63.08  ? 474 ASN A CG    1 
ATOM   2683  O  OD1   . ASN A  1 333 ? 10.527  10.987  23.995  1.00 59.45  ? 474 ASN A OD1   1 
ATOM   2684  N  ND2   . ASN A  1 333 ? 8.381   11.588  23.717  1.00 66.51  ? 474 ASN A ND2   1 
ATOM   2685  N  N     . LEU A  1 334 ? 11.693  8.310   24.735  1.00 58.33  ? 475 LEU A N     1 
ATOM   2686  C  CA    . LEU A  1 334 ? 12.084  7.833   26.053  1.00 56.34  ? 475 LEU A CA    1 
ATOM   2687  C  C     . LEU A  1 334 ? 11.449  8.700   27.134  1.00 53.21  ? 475 LEU A C     1 
ATOM   2688  O  O     . LEU A  1 334 ? 11.459  8.344   28.314  1.00 52.49  ? 475 LEU A O     1 
ATOM   2689  C  CB    . LEU A  1 334 ? 13.610  7.852   26.184  1.00 59.57  ? 475 LEU A CB    1 
ATOM   2690  C  CG    . LEU A  1 334 ? 14.437  6.649   25.703  1.00 60.10  ? 475 LEU A CG    1 
ATOM   2691  C  CD1   . LEU A  1 334 ? 13.782  5.917   24.544  1.00 60.18  ? 475 LEU A CD1   1 
ATOM   2692  C  CD2   . LEU A  1 334 ? 15.840  7.086   25.311  1.00 60.46  ? 475 LEU A CD2   1 
ATOM   2693  N  N     . PHE A  1 335 ? 10.899  9.839   26.719  1.00 53.06  ? 476 PHE A N     1 
ATOM   2694  C  CA    . PHE A  1 335 ? 10.251  10.768  27.638  1.00 54.23  ? 476 PHE A CA    1 
ATOM   2695  C  C     . PHE A  1 335 ? 8.759   10.895  27.351  1.00 61.93  ? 476 PHE A C     1 
ATOM   2696  O  O     . PHE A  1 335 ? 8.172   11.961  27.532  1.00 69.26  ? 476 PHE A O     1 
ATOM   2697  C  CB    . PHE A  1 335 ? 10.916  12.148  27.580  1.00 52.02  ? 476 PHE A CB    1 
ATOM   2698  C  CG    . PHE A  1 335 ? 12.121  12.278  28.464  1.00 55.47  ? 476 PHE A CG    1 
ATOM   2699  C  CD1   . PHE A  1 335 ? 12.599  11.183  29.168  1.00 57.06  ? 476 PHE A CD1   1 
ATOM   2700  C  CD2   . PHE A  1 335 ? 12.767  13.496  28.607  1.00 59.47  ? 476 PHE A CD2   1 
ATOM   2701  C  CE1   . PHE A  1 335 ? 13.706  11.292  29.989  1.00 58.36  ? 476 PHE A CE1   1 
ATOM   2702  C  CE2   . PHE A  1 335 ? 13.877  13.616  29.429  1.00 61.65  ? 476 PHE A CE2   1 
ATOM   2703  C  CZ    . PHE A  1 335 ? 14.346  12.510  30.120  1.00 60.74  ? 476 PHE A CZ    1 
ATOM   2704  N  N     . SER A  1 336 ? 8.143   9.805   26.908  1.00 57.54  ? 477 SER A N     1 
ATOM   2705  C  CA    . SER A  1 336 ? 6.705   9.796   26.680  1.00 57.71  ? 477 SER A CA    1 
ATOM   2706  C  C     . SER A  1 336 ? 5.949   9.876   28.005  1.00 61.84  ? 477 SER A C     1 
ATOM   2707  O  O     . SER A  1 336 ? 6.512   9.597   29.063  1.00 61.55  ? 477 SER A O     1 
ATOM   2708  C  CB    . SER A  1 336 ? 6.302   8.536   25.921  1.00 54.53  ? 477 SER A CB    1 
ATOM   2709  O  OG    . SER A  1 336 ? 6.938   7.396   26.466  1.00 53.15  ? 477 SER A OG    1 
ATOM   2710  N  N     . GLN A  1 337 ? 4.681   10.274  27.950  1.00 66.98  ? 478 GLN A N     1 
ATOM   2711  C  CA    . GLN A  1 337 ? 3.842   10.254  29.141  1.00 70.32  ? 478 GLN A CA    1 
ATOM   2712  C  C     . GLN A  1 337 ? 3.579   8.815   29.555  1.00 72.15  ? 478 GLN A C     1 
ATOM   2713  O  O     . GLN A  1 337 ? 3.328   8.532   30.729  1.00 73.00  ? 478 GLN A O     1 
ATOM   2714  C  CB    . GLN A  1 337 ? 2.521   10.977  28.898  1.00 73.51  ? 478 GLN A CB    1 
ATOM   2715  C  CG    . GLN A  1 337 ? 2.521   12.433  29.323  1.00 76.71  ? 478 GLN A CG    1 
ATOM   2716  C  CD    . GLN A  1 337 ? 1.172   13.095  29.133  1.00 78.76  ? 478 GLN A CD    1 
ATOM   2717  O  OE1   . GLN A  1 337 ? 0.216   12.466  28.680  1.00 80.88  ? 478 GLN A OE1   1 
ATOM   2718  N  NE2   . GLN A  1 337 ? 1.089   14.374  29.475  1.00 77.21  ? 478 GLN A NE2   1 
ATOM   2719  N  N     . GLU A  1 338 ? 3.632   7.916   28.576  1.00 72.04  ? 479 GLU A N     1 
ATOM   2720  C  CA    . GLU A  1 338 ? 3.493   6.486   28.816  1.00 73.08  ? 479 GLU A CA    1 
ATOM   2721  C  C     . GLU A  1 338 ? 4.549   6.008   29.804  1.00 72.74  ? 479 GLU A C     1 
ATOM   2722  O  O     . GLU A  1 338 ? 4.238   5.350   30.798  1.00 75.39  ? 479 GLU A O     1 
ATOM   2723  C  CB    . GLU A  1 338 ? 3.646   5.707   27.507  1.00 73.26  ? 479 GLU A CB    1 
ATOM   2724  C  CG    . GLU A  1 338 ? 2.603   6.007   26.438  1.00 77.62  ? 479 GLU A CG    1 
ATOM   2725  C  CD    . GLU A  1 338 ? 2.931   7.239   25.613  1.00 82.32  ? 479 GLU A CD    1 
ATOM   2726  O  OE1   . GLU A  1 338 ? 2.951   8.353   26.176  1.00 85.17  ? 479 GLU A OE1   1 
ATOM   2727  O  OE2   . GLU A  1 338 ? 3.165   7.093   24.395  1.00 83.56  ? 479 GLU A OE2   1 
ATOM   2728  N  N     . LEU A  1 339 ? 5.800   6.354   29.517  1.00 68.57  ? 480 LEU A N     1 
ATOM   2729  C  CA    . LEU A  1 339 ? 6.935   5.929   30.324  1.00 64.77  ? 480 LEU A CA    1 
ATOM   2730  C  C     . LEU A  1 339 ? 7.117   6.794   31.567  1.00 66.40  ? 480 LEU A C     1 
ATOM   2731  O  O     . LEU A  1 339 ? 7.314   6.273   32.667  1.00 68.92  ? 480 LEU A O     1 
ATOM   2732  C  CB    . LEU A  1 339 ? 8.216   5.950   29.488  1.00 62.81  ? 480 LEU A CB    1 
ATOM   2733  C  CG    . LEU A  1 339 ? 8.240   5.043   28.257  1.00 62.75  ? 480 LEU A CG    1 
ATOM   2734  C  CD1   . LEU A  1 339 ? 9.562   5.147   27.505  1.00 63.64  ? 480 LEU A CD1   1 
ATOM   2735  C  CD2   . LEU A  1 339 ? 7.974   3.612   28.665  1.00 59.62  ? 480 LEU A CD2   1 
ATOM   2736  N  N     . ILE A  1 340 ? 7.062   8.112   31.392  1.00 66.39  ? 481 ILE A N     1 
ATOM   2737  C  CA    . ILE A  1 340 ? 7.287   9.031   32.506  1.00 67.08  ? 481 ILE A CA    1 
ATOM   2738  C  C     . ILE A  1 340 ? 6.166   10.065  32.642  1.00 71.09  ? 481 ILE A C     1 
ATOM   2739  O  O     . ILE A  1 340 ? 5.765   10.695  31.660  1.00 74.61  ? 481 ILE A O     1 
ATOM   2740  C  CB    . ILE A  1 340 ? 8.645   9.753   32.371  1.00 66.49  ? 481 ILE A CB    1 
ATOM   2741  C  CG1   . ILE A  1 340 ? 9.737   8.765   31.955  1.00 65.22  ? 481 ILE A CG1   1 
ATOM   2742  C  CG2   . ILE A  1 340 ? 9.022   10.442  33.675  1.00 65.73  ? 481 ILE A CG2   1 
ATOM   2743  C  CD1   . ILE A  1 340 ? 11.100  9.388   31.774  1.00 65.82  ? 481 ILE A CD1   1 
ATOM   2744  N  N     . ASP A  1 341 ? 5.669   10.230  33.866  1.00 70.64  ? 482 ASP A N     1 
ATOM   2745  C  CA    . ASP A  1 341 ? 4.652   11.230  34.166  1.00 72.30  ? 482 ASP A CA    1 
ATOM   2746  C  C     . ASP A  1 341 ? 5.261   12.629  34.126  1.00 68.68  ? 482 ASP A C     1 
ATOM   2747  O  O     . ASP A  1 341 ? 6.429   12.812  34.469  1.00 66.16  ? 482 ASP A O     1 
ATOM   2748  C  CB    . ASP A  1 341 ? 4.044   10.951  35.540  1.00 78.79  ? 482 ASP A CB    1 
ATOM   2749  C  CG    . ASP A  1 341 ? 2.997   11.977  35.943  1.00 86.42  ? 482 ASP A CG    1 
ATOM   2750  O  OD1   . ASP A  1 341 ? 2.318   12.535  35.054  1.00 89.47  ? 482 ASP A OD1   1 
ATOM   2751  O  OD2   . ASP A  1 341 ? 2.854   12.217  37.159  1.00 87.83  ? 482 ASP A OD2   1 
ATOM   2752  N  N     . ARG A  1 342 ? 4.469   13.611  33.704  1.00 74.12  ? 483 ARG A N     1 
ATOM   2753  C  CA    . ARG A  1 342 ? 4.956   14.981  33.569  1.00 75.66  ? 483 ARG A CA    1 
ATOM   2754  C  C     . ARG A  1 342 ? 5.295   15.622  34.912  1.00 73.96  ? 483 ARG A C     1 
ATOM   2755  O  O     . ARG A  1 342 ? 6.079   16.568  34.975  1.00 74.01  ? 483 ARG A O     1 
ATOM   2756  C  CB    . ARG A  1 342 ? 3.949   15.841  32.807  1.00 79.09  ? 483 ARG A CB    1 
ATOM   2757  C  CG    . ARG A  1 342 ? 2.529   15.318  32.865  1.00 84.30  ? 483 ARG A CG    1 
ATOM   2758  C  CD    . ARG A  1 342 ? 1.530   16.459  32.840  1.00 90.40  ? 483 ARG A CD    1 
ATOM   2759  N  NE    . ARG A  1 342 ? 0.147   15.993  32.762  1.00 94.10  ? 483 ARG A NE    1 
ATOM   2760  C  CZ    . ARG A  1 342 ? -0.910  16.767  32.986  1.00 96.56  ? 483 ARG A CZ    1 
ATOM   2761  N  NH1   . ARG A  1 342 ? -0.737  18.038  33.313  1.00 97.99  ? 483 ARG A NH1   1 
ATOM   2762  N  NH2   . ARG A  1 342 ? -2.136  16.270  32.893  1.00 96.73  ? 483 ARG A NH2   1 
ATOM   2763  N  N     . LYS A  1 343 ? 4.706   15.105  35.985  1.00 72.99  ? 484 LYS A N     1 
ATOM   2764  C  CA    . LYS A  1 343 ? 5.028   15.581  37.324  1.00 72.91  ? 484 LYS A CA    1 
ATOM   2765  C  C     . LYS A  1 343 ? 6.486   15.284  37.641  1.00 69.72  ? 484 LYS A C     1 
ATOM   2766  O  O     . LYS A  1 343 ? 7.209   16.146  38.141  1.00 71.28  ? 484 LYS A O     1 
ATOM   2767  C  CB    . LYS A  1 343 ? 4.138   14.905  38.362  1.00 77.16  ? 484 LYS A CB    1 
ATOM   2768  C  CG    . LYS A  1 343 ? 2.659   15.237  38.253  1.00 79.71  ? 484 LYS A CG    1 
ATOM   2769  C  CD    . LYS A  1 343 ? 1.877   14.448  39.294  1.00 80.48  ? 484 LYS A CD    1 
ATOM   2770  C  CE    . LYS A  1 343 ? 0.419   14.871  39.371  1.00 78.70  ? 484 LYS A CE    1 
ATOM   2771  N  NZ    . LYS A  1 343 ? -0.276  14.171  40.492  1.00 74.68  ? 484 LYS A NZ    1 
ATOM   2772  N  N     . SER A  1 344 ? 6.905   14.055  37.347  1.00 66.06  ? 485 SER A N     1 
ATOM   2773  C  CA    . SER A  1 344 ? 8.284   13.625  37.553  1.00 61.88  ? 485 SER A CA    1 
ATOM   2774  C  C     . SER A  1 344 ? 9.243   14.507  36.768  1.00 58.91  ? 485 SER A C     1 
ATOM   2775  O  O     . SER A  1 344 ? 10.261  14.970  37.292  1.00 59.13  ? 485 SER A O     1 
ATOM   2776  C  CB    . SER A  1 344 ? 8.463   12.177  37.093  1.00 58.94  ? 485 SER A CB    1 
ATOM   2777  O  OG    . SER A  1 344 ? 7.446   11.335  37.604  1.00 56.97  ? 485 SER A OG    1 
ATOM   2778  N  N     . LYS A  1 345 ? 8.898   14.736  35.506  1.00 57.76  ? 486 LYS A N     1 
ATOM   2779  C  CA    . LYS A  1 345 ? 9.739   15.495  34.590  1.00 55.80  ? 486 LYS A CA    1 
ATOM   2780  C  C     . LYS A  1 345 ? 9.870   16.967  34.987  1.00 56.89  ? 486 LYS A C     1 
ATOM   2781  O  O     . LYS A  1 345 ? 10.964  17.529  34.939  1.00 56.73  ? 486 LYS A O     1 
ATOM   2782  C  CB    . LYS A  1 345 ? 9.224   15.341  33.156  1.00 54.37  ? 486 LYS A CB    1 
ATOM   2783  C  CG    . LYS A  1 345 ? 9.494   13.952  32.578  1.00 54.77  ? 486 LYS A CG    1 
ATOM   2784  C  CD    . LYS A  1 345 ? 8.838   13.731  31.220  1.00 53.98  ? 486 LYS A CD    1 
ATOM   2785  C  CE    . LYS A  1 345 ? 7.356   13.467  31.363  1.00 53.35  ? 486 LYS A CE    1 
ATOM   2786  N  NZ    . LYS A  1 345 ? 6.846   12.535  30.323  1.00 51.76  ? 486 LYS A NZ    1 
ATOM   2787  N  N     . GLU A  1 346 ? 8.759   17.579  35.387  1.00 58.97  ? 487 GLU A N     1 
ATOM   2788  C  CA    . GLU A  1 346 ? 8.775   18.951  35.885  1.00 61.37  ? 487 GLU A CA    1 
ATOM   2789  C  C     . GLU A  1 346 ? 9.542   19.052  37.205  1.00 60.02  ? 487 GLU A C     1 
ATOM   2790  O  O     . GLU A  1 346 ? 10.210  20.049  37.466  1.00 64.25  ? 487 GLU A O     1 
ATOM   2791  C  CB    . GLU A  1 346 ? 7.349   19.475  36.059  1.00 65.11  ? 487 GLU A CB    1 
ATOM   2792  C  CG    . GLU A  1 346 ? 6.586   19.649  34.751  1.00 72.11  ? 487 GLU A CG    1 
ATOM   2793  C  CD    . GLU A  1 346 ? 5.102   19.882  34.970  1.00 79.26  ? 487 GLU A CD    1 
ATOM   2794  O  OE1   . GLU A  1 346 ? 4.707   20.175  36.120  1.00 79.62  ? 487 GLU A OE1   1 
ATOM   2795  O  OE2   . GLU A  1 346 ? 4.332   19.768  33.992  1.00 82.69  ? 487 GLU A OE2   1 
ATOM   2796  N  N     . PHE A  1 347 ? 9.438   18.014  38.030  1.00 53.14  ? 488 PHE A N     1 
ATOM   2797  C  CA    . PHE A  1 347 ? 10.155  17.943  39.301  1.00 49.70  ? 488 PHE A CA    1 
ATOM   2798  C  C     . PHE A  1 347 ? 11.657  17.970  39.050  1.00 54.24  ? 488 PHE A C     1 
ATOM   2799  O  O     . PHE A  1 347 ? 12.387  18.795  39.617  1.00 60.29  ? 488 PHE A O     1 
ATOM   2800  C  CB    . PHE A  1 347 ? 9.765   16.655  40.024  1.00 47.56  ? 488 PHE A CB    1 
ATOM   2801  C  CG    . PHE A  1 347 ? 10.372  16.500  41.393  1.00 46.97  ? 488 PHE A CG    1 
ATOM   2802  C  CD1   . PHE A  1 347 ? 9.763   17.059  42.505  1.00 45.66  ? 488 PHE A CD1   1 
ATOM   2803  C  CD2   . PHE A  1 347 ? 11.529  15.757  41.574  1.00 47.93  ? 488 PHE A CD2   1 
ATOM   2804  C  CE1   . PHE A  1 347 ? 10.309  16.901  43.763  1.00 46.18  ? 488 PHE A CE1   1 
ATOM   2805  C  CE2   . PHE A  1 347 ? 12.078  15.598  42.832  1.00 41.73  ? 488 PHE A CE2   1 
ATOM   2806  C  CZ    . PHE A  1 347 ? 11.466  16.168  43.924  1.00 45.66  ? 488 PHE A CZ    1 
ATOM   2807  N  N     . LEU A  1 348 ? 12.110  17.059  38.191  1.00 52.25  ? 489 LEU A N     1 
ATOM   2808  C  CA    . LEU A  1 348 ? 13.503  17.029  37.770  1.00 50.12  ? 489 LEU A CA    1 
ATOM   2809  C  C     . LEU A  1 348 ? 13.928  18.366  37.172  1.00 54.91  ? 489 LEU A C     1 
ATOM   2810  O  O     . LEU A  1 348 ? 15.019  18.850  37.452  1.00 57.49  ? 489 LEU A O     1 
ATOM   2811  C  CB    . LEU A  1 348 ? 13.734  15.905  36.761  1.00 47.82  ? 489 LEU A CB    1 
ATOM   2812  C  CG    . LEU A  1 348 ? 15.180  15.699  36.312  1.00 45.29  ? 489 LEU A CG    1 
ATOM   2813  C  CD1   . LEU A  1 348 ? 16.031  15.251  37.478  1.00 45.19  ? 489 LEU A CD1   1 
ATOM   2814  C  CD2   . LEU A  1 348 ? 15.252  14.691  35.188  1.00 43.56  ? 489 LEU A CD2   1 
ATOM   2815  N  N     . SER A  1 349 ? 13.058  18.956  36.354  1.00 56.97  ? 490 SER A N     1 
ATOM   2816  C  CA    . SER A  1 349 ? 13.313  20.264  35.753  1.00 58.26  ? 490 SER A CA    1 
ATOM   2817  C  C     . SER A  1 349 ? 13.610  21.317  36.818  1.00 57.71  ? 490 SER A C     1 
ATOM   2818  O  O     . SER A  1 349 ? 14.556  22.101  36.696  1.00 57.13  ? 490 SER A O     1 
ATOM   2819  C  CB    . SER A  1 349 ? 12.104  20.714  34.932  1.00 59.92  ? 490 SER A CB    1 
ATOM   2820  O  OG    . SER A  1 349 ? 11.579  19.657  34.153  1.00 60.23  ? 490 SER A OG    1 
ATOM   2821  N  N     . LYS A  1 350 ? 12.785  21.321  37.859  1.00 58.22  ? 491 LYS A N     1 
ATOM   2822  C  CA    . LYS A  1 350 ? 12.935  22.246  38.974  1.00 61.98  ? 491 LYS A CA    1 
ATOM   2823  C  C     . LYS A  1 350 ? 14.256  22.023  39.701  1.00 62.08  ? 491 LYS A C     1 
ATOM   2824  O  O     . LYS A  1 350 ? 14.987  22.979  39.979  1.00 66.11  ? 491 LYS A O     1 
ATOM   2825  C  CB    . LYS A  1 350 ? 11.775  22.086  39.961  1.00 66.22  ? 491 LYS A CB    1 
ATOM   2826  C  CG    . LYS A  1 350 ? 10.692  23.168  39.881  1.00 71.06  ? 491 LYS A CG    1 
ATOM   2827  C  CD    . LYS A  1 350 ? 9.736   22.950  38.712  1.00 75.73  ? 491 LYS A CD    1 
ATOM   2828  C  CE    . LYS A  1 350 ? 8.527   23.887  38.792  1.00 78.91  ? 491 LYS A CE    1 
ATOM   2829  N  NZ    . LYS A  1 350 ? 7.529   23.634  37.708  1.00 80.23  ? 491 LYS A NZ    1 
ATOM   2830  N  N     . LYS A  1 351 ? 14.555  20.763  40.012  1.00 56.48  ? 492 LYS A N     1 
ATOM   2831  C  CA    . LYS A  1 351 ? 15.798  20.427  40.707  1.00 53.29  ? 492 LYS A CA    1 
ATOM   2832  C  C     . LYS A  1 351 ? 17.030  20.880  39.922  1.00 52.48  ? 492 LYS A C     1 
ATOM   2833  O  O     . LYS A  1 351 ? 17.930  21.546  40.462  1.00 51.55  ? 492 LYS A O     1 
ATOM   2834  C  CB    . LYS A  1 351 ? 15.875  18.923  40.967  1.00 51.02  ? 492 LYS A CB    1 
ATOM   2835  C  CG    . LYS A  1 351 ? 14.829  18.405  41.939  1.00 49.11  ? 492 LYS A CG    1 
ATOM   2836  C  CD    . LYS A  1 351 ? 14.916  19.128  43.277  1.00 48.46  ? 492 LYS A CD    1 
ATOM   2837  C  CE    . LYS A  1 351 ? 13.920  18.561  44.268  1.00 48.46  ? 492 LYS A CE    1 
ATOM   2838  N  NZ    . LYS A  1 351 ? 14.027  19.216  45.591  1.00 51.72  ? 492 LYS A NZ    1 
ATOM   2839  N  N     . ILE A  1 352 ? 17.053  20.518  38.642  1.00 55.29  ? 493 ILE A N     1 
ATOM   2840  C  CA    . ILE A  1 352 ? 18.143  20.894  37.761  1.00 57.28  ? 493 ILE A CA    1 
ATOM   2841  C  C     . ILE A  1 352 ? 18.274  22.404  37.711  1.00 59.86  ? 493 ILE A C     1 
ATOM   2842  O  O     . ILE A  1 352 ? 19.377  22.925  37.822  1.00 64.15  ? 493 ILE A O     1 
ATOM   2843  C  CB    . ILE A  1 352 ? 17.952  20.369  36.331  1.00 56.33  ? 493 ILE A CB    1 
ATOM   2844  C  CG1   . ILE A  1 352 ? 17.917  18.843  36.314  1.00 56.01  ? 493 ILE A CG1   1 
ATOM   2845  C  CG2   . ILE A  1 352 ? 19.084  20.844  35.448  1.00 54.77  ? 493 ILE A CG2   1 
ATOM   2846  C  CD1   . ILE A  1 352 ? 17.589  18.257  34.952  1.00 53.46  ? 493 ILE A CD1   1 
ATOM   2847  N  N     . GLU A  1 353 ? 17.156  23.107  37.550  1.00 56.74  ? 494 GLU A N     1 
ATOM   2848  C  CA    . GLU A  1 353 ? 17.209  24.562  37.478  1.00 58.46  ? 494 GLU A CA    1 
ATOM   2849  C  C     . GLU A  1 353 ? 17.803  25.183  38.740  1.00 61.95  ? 494 GLU A C     1 
ATOM   2850  O  O     . GLU A  1 353 ? 18.696  26.041  38.661  1.00 63.52  ? 494 GLU A O     1 
ATOM   2851  C  CB    . GLU A  1 353 ? 15.831  25.156  37.170  1.00 59.99  ? 494 GLU A CB    1 
ATOM   2852  C  CG    . GLU A  1 353 ? 15.451  25.154  35.686  1.00 60.81  ? 494 GLU A CG    1 
ATOM   2853  C  CD    . GLU A  1 353 ? 16.258  26.140  34.850  1.00 62.39  ? 494 GLU A CD    1 
ATOM   2854  O  OE1   . GLU A  1 353 ? 17.325  26.596  35.307  1.00 61.41  ? 494 GLU A OE1   1 
ATOM   2855  O  OE2   . GLU A  1 353 ? 15.821  26.467  33.727  1.00 64.63  ? 494 GLU A OE2   1 
ATOM   2856  N  N     . TYR A  1 354 ? 17.322  24.733  39.897  1.00 62.12  ? 495 TYR A N     1 
ATOM   2857  C  CA    . TYR A  1 354 ? 17.857  25.192  41.172  1.00 62.31  ? 495 TYR A CA    1 
ATOM   2858  C  C     . TYR A  1 354 ? 19.366  25.016  41.218  1.00 64.45  ? 495 TYR A C     1 
ATOM   2859  O  O     . TYR A  1 354 ? 20.102  25.984  41.440  1.00 66.47  ? 495 TYR A O     1 
ATOM   2860  C  CB    . TYR A  1 354 ? 17.217  24.446  42.344  1.00 62.71  ? 495 TYR A CB    1 
ATOM   2861  C  CG    . TYR A  1 354 ? 17.820  24.831  43.673  1.00 63.29  ? 495 TYR A CG    1 
ATOM   2862  C  CD1   . TYR A  1 354 ? 17.458  26.012  44.301  1.00 64.42  ? 495 TYR A CD1   1 
ATOM   2863  C  CD2   . TYR A  1 354 ? 18.764  24.027  44.292  1.00 63.52  ? 495 TYR A CD2   1 
ATOM   2864  C  CE1   . TYR A  1 354 ? 18.014  26.380  45.510  1.00 63.61  ? 495 TYR A CE1   1 
ATOM   2865  C  CE2   . TYR A  1 354 ? 19.327  24.389  45.500  1.00 62.28  ? 495 TYR A CE2   1 
ATOM   2866  C  CZ    . TYR A  1 354 ? 18.946  25.564  46.105  1.00 61.96  ? 495 TYR A CZ    1 
ATOM   2867  O  OH    . TYR A  1 354 ? 19.504  25.923  47.309  1.00 62.40  ? 495 TYR A OH    1 
ATOM   2868  N  N     . GLU A  1 355 ? 19.819  23.783  40.997  1.00 65.84  ? 496 GLU A N     1 
ATOM   2869  C  CA    . GLU A  1 355 ? 21.249  23.483  41.008  1.00 64.35  ? 496 GLU A CA    1 
ATOM   2870  C  C     . GLU A  1 355 ? 22.023  24.362  40.027  1.00 61.00  ? 496 GLU A C     1 
ATOM   2871  O  O     . GLU A  1 355 ? 23.138  24.797  40.316  1.00 58.16  ? 496 GLU A O     1 
ATOM   2872  C  CB    . GLU A  1 355 ? 21.483  22.006  40.682  1.00 63.47  ? 496 GLU A CB    1 
ATOM   2873  C  CG    . GLU A  1 355 ? 20.931  21.042  41.719  1.00 62.04  ? 496 GLU A CG    1 
ATOM   2874  C  CD    . GLU A  1 355 ? 21.742  21.041  42.991  1.00 61.65  ? 496 GLU A CD    1 
ATOM   2875  O  OE1   . GLU A  1 355 ? 22.967  21.245  42.908  1.00 63.20  ? 496 GLU A OE1   1 
ATOM   2876  O  OE2   . GLU A  1 355 ? 21.159  20.838  44.072  1.00 62.87  ? 496 GLU A OE2   1 
ATOM   2877  N  N     . ARG A  1 356 ? 21.405  24.629  38.879  1.00 61.14  ? 497 ARG A N     1 
ATOM   2878  C  CA    . ARG A  1 356 ? 22.025  25.381  37.796  1.00 63.78  ? 497 ARG A CA    1 
ATOM   2879  C  C     . ARG A  1 356 ? 22.310  26.809  38.214  1.00 67.13  ? 497 ARG A C     1 
ATOM   2880  O  O     . ARG A  1 356 ? 23.463  27.245  38.205  1.00 69.57  ? 497 ARG A O     1 
ATOM   2881  C  CB    . ARG A  1 356 ? 21.129  25.369  36.553  1.00 64.50  ? 497 ARG A CB    1 
ATOM   2882  C  CG    . ARG A  1 356 ? 21.661  26.178  35.370  1.00 66.34  ? 497 ARG A CG    1 
ATOM   2883  C  CD    . ARG A  1 356 ? 20.778  26.008  34.137  1.00 67.44  ? 497 ARG A CD    1 
ATOM   2884  N  NE    . ARG A  1 356 ? 21.281  26.758  32.988  1.00 70.35  ? 497 ARG A NE    1 
ATOM   2885  C  CZ    . ARG A  1 356 ? 20.725  26.750  31.778  1.00 70.28  ? 497 ARG A CZ    1 
ATOM   2886  N  NH1   . ARG A  1 356 ? 19.637  26.027  31.542  1.00 69.43  ? 497 ARG A NH1   1 
ATOM   2887  N  NH2   . ARG A  1 356 ? 21.259  27.467  30.799  1.00 67.83  ? 497 ARG A NH2   1 
ATOM   2888  N  N     . ASN A  1 357 ? 21.263  27.541  38.583  1.00 67.93  ? 498 ASN A N     1 
ATOM   2889  C  CA    . ASN A  1 357 ? 21.467  28.927  38.988  1.00 67.32  ? 498 ASN A CA    1 
ATOM   2890  C  C     . ASN A  1 357 ? 21.756  29.132  40.478  1.00 63.64  ? 498 ASN A C     1 
ATOM   2891  O  O     . ASN A  1 357 ? 21.619  30.243  40.994  1.00 67.91  ? 498 ASN A O     1 
ATOM   2892  C  CB    . ASN A  1 357 ? 20.318  29.822  38.512  1.00 71.92  ? 498 ASN A CB    1 
ATOM   2893  C  CG    . ASN A  1 357 ? 19.030  29.060  38.309  1.00 74.70  ? 498 ASN A CG    1 
ATOM   2894  O  OD1   . ASN A  1 357 ? 18.851  28.387  37.293  1.00 73.43  ? 498 ASN A OD1   1 
ATOM   2895  N  ND2   . ASN A  1 357 ? 18.117  29.171  39.267  1.00 76.30  ? 498 ASN A ND2   1 
ATOM   2896  N  N     . ASN A  1 358 ? 22.170  28.071  41.165  1.00 60.08  ? 499 ASN A N     1 
ATOM   2897  C  CA    . ASN A  1 358 ? 22.647  28.217  42.538  1.00 60.02  ? 499 ASN A CA    1 
ATOM   2898  C  C     . ASN A  1 358 ? 24.083  27.743  42.764  1.00 62.16  ? 499 ASN A C     1 
ATOM   2899  O  O     . ASN A  1 358 ? 24.542  27.671  43.902  1.00 62.67  ? 499 ASN A O     1 
ATOM   2900  C  CB    . ASN A  1 358 ? 21.698  27.547  43.537  1.00 58.11  ? 499 ASN A CB    1 
ATOM   2901  C  CG    . ASN A  1 358 ? 20.494  28.408  43.861  1.00 62.12  ? 499 ASN A CG    1 
ATOM   2902  O  OD1   . ASN A  1 358 ? 19.427  28.258  43.265  1.00 65.50  ? 499 ASN A OD1   1 
ATOM   2903  N  ND2   . ASN A  1 358 ? 20.661  29.322  44.808  1.00 61.06  ? 499 ASN A ND2   1 
ATOM   2904  N  N     . GLY A  1 359 ? 24.789  27.425  41.685  1.00 63.38  ? 500 GLY A N     1 
ATOM   2905  C  CA    . GLY A  1 359 ? 26.193  27.078  41.788  1.00 63.03  ? 500 GLY A CA    1 
ATOM   2906  C  C     . GLY A  1 359 ? 26.444  25.634  42.174  1.00 62.83  ? 500 GLY A C     1 
ATOM   2907  O  O     . GLY A  1 359 ? 27.459  25.326  42.803  1.00 64.44  ? 500 GLY A O     1 
ATOM   2908  N  N     . PHE A  1 360 ? 25.513  24.760  41.794  1.00 60.12  ? 501 PHE A N     1 
ATOM   2909  C  CA    . PHE A  1 360 ? 25.633  23.317  42.002  1.00 56.33  ? 501 PHE A CA    1 
ATOM   2910  C  C     . PHE A  1 360 ? 26.162  22.922  43.384  1.00 54.50  ? 501 PHE A C     1 
ATOM   2911  O  O     . PHE A  1 360 ? 27.292  22.449  43.501  1.00 54.34  ? 501 PHE A O     1 
ATOM   2912  C  CB    . PHE A  1 360 ? 26.517  22.690  40.915  1.00 56.45  ? 501 PHE A CB    1 
ATOM   2913  C  CG    . PHE A  1 360 ? 26.044  22.947  39.504  1.00 53.20  ? 501 PHE A CG    1 
ATOM   2914  C  CD1   . PHE A  1 360 ? 25.034  22.178  38.944  1.00 48.79  ? 501 PHE A CD1   1 
ATOM   2915  C  CD2   . PHE A  1 360 ? 26.635  23.936  38.728  1.00 53.54  ? 501 PHE A CD2   1 
ATOM   2916  C  CE1   . PHE A  1 360 ? 24.607  22.405  37.645  1.00 45.52  ? 501 PHE A CE1   1 
ATOM   2917  C  CE2   . PHE A  1 360 ? 26.213  24.168  37.429  1.00 51.35  ? 501 PHE A CE2   1 
ATOM   2918  C  CZ    . PHE A  1 360 ? 25.198  23.400  36.889  1.00 48.40  ? 501 PHE A CZ    1 
ATOM   2919  N  N     . PRO A  1 361 ? 25.350  23.118  44.437  1.00 54.65  ? 502 PRO A N     1 
ATOM   2920  C  CA    . PRO A  1 361 ? 25.806  22.732  45.776  1.00 55.54  ? 502 PRO A CA    1 
ATOM   2921  C  C     . PRO A  1 361 ? 25.795  21.217  45.975  1.00 59.78  ? 502 PRO A C     1 
ATOM   2922  O  O     . PRO A  1 361 ? 26.545  20.718  46.814  1.00 64.17  ? 502 PRO A O     1 
ATOM   2923  C  CB    . PRO A  1 361 ? 24.782  23.399  46.701  1.00 54.58  ? 502 PRO A CB    1 
ATOM   2924  C  CG    . PRO A  1 361 ? 23.551  23.517  45.877  1.00 54.10  ? 502 PRO A CG    1 
ATOM   2925  C  CD    . PRO A  1 361 ? 24.017  23.749  44.465  1.00 53.50  ? 502 PRO A CD    1 
ATOM   2926  N  N     . ILE A  1 362 ? 24.972  20.497  45.213  1.00 58.92  ? 503 ILE A N     1 
ATOM   2927  C  CA    . ILE A  1 362 ? 24.864  19.042  45.367  1.00 55.28  ? 503 ILE A CA    1 
ATOM   2928  C  C     . ILE A  1 362 ? 26.146  18.306  44.978  1.00 52.27  ? 503 ILE A C     1 
ATOM   2929  O  O     . ILE A  1 362 ? 26.392  17.188  45.436  1.00 51.12  ? 503 ILE A O     1 
ATOM   2930  C  CB    . ILE A  1 362 ? 23.661  18.456  44.584  1.00 47.58  ? 503 ILE A CB    1 
ATOM   2931  C  CG1   . ILE A  1 362 ? 23.227  17.121  45.191  1.00 47.47  ? 503 ILE A CG1   1 
ATOM   2932  C  CG2   . ILE A  1 362 ? 23.992  18.276  43.108  1.00 45.36  ? 503 ILE A CG2   1 
ATOM   2933  C  CD1   . ILE A  1 362 ? 21.970  16.548  44.589  1.00 45.86  ? 503 ILE A CD1   1 
ATOM   2934  N  N     . PHE A  1 363 ? 26.959  18.940  44.137  1.00 51.54  ? 504 PHE A N     1 
ATOM   2935  C  CA    . PHE A  1 363 ? 28.239  18.370  43.739  1.00 53.55  ? 504 PHE A CA    1 
ATOM   2936  C  C     . PHE A  1 363 ? 29.183  18.369  44.933  1.00 54.04  ? 504 PHE A C     1 
ATOM   2937  O  O     . PHE A  1 363 ? 30.160  17.616  44.976  1.00 49.17  ? 504 PHE A O     1 
ATOM   2938  C  CB    . PHE A  1 363 ? 28.847  19.174  42.588  1.00 55.67  ? 504 PHE A CB    1 
ATOM   2939  C  CG    . PHE A  1 363 ? 28.170  18.955  41.263  1.00 58.42  ? 504 PHE A CG    1 
ATOM   2940  C  CD1   . PHE A  1 363 ? 27.281  17.906  41.083  1.00 59.52  ? 504 PHE A CD1   1 
ATOM   2941  C  CD2   . PHE A  1 363 ? 28.438  19.793  40.190  1.00 59.46  ? 504 PHE A CD2   1 
ATOM   2942  C  CE1   . PHE A  1 363 ? 26.663  17.702  39.859  1.00 58.71  ? 504 PHE A CE1   1 
ATOM   2943  C  CE2   . PHE A  1 363 ? 27.824  19.593  38.964  1.00 58.85  ? 504 PHE A CE2   1 
ATOM   2944  C  CZ    . PHE A  1 363 ? 26.937  18.546  38.800  1.00 58.71  ? 504 PHE A CZ    1 
ATOM   2945  N  N     . ASP A  1 364 ? 28.866  19.215  45.907  1.00 59.60  ? 505 ASP A N     1 
ATOM   2946  C  CA    . ASP A  1 364 ? 29.676  19.357  47.103  1.00 65.35  ? 505 ASP A CA    1 
ATOM   2947  C  C     . ASP A  1 364 ? 29.078  18.551  48.259  1.00 68.05  ? 505 ASP A C     1 
ATOM   2948  O  O     . ASP A  1 364 ? 29.435  18.760  49.419  1.00 66.12  ? 505 ASP A O     1 
ATOM   2949  C  CB    . ASP A  1 364 ? 29.787  20.838  47.476  1.00 67.20  ? 505 ASP A CB    1 
ATOM   2950  C  CG    . ASP A  1 364 ? 30.217  21.705  46.302  1.00 70.46  ? 505 ASP A CG    1 
ATOM   2951  O  OD1   . ASP A  1 364 ? 31.214  21.353  45.636  1.00 72.74  ? 505 ASP A OD1   1 
ATOM   2952  O  OD2   . ASP A  1 364 ? 29.558  22.734  46.038  1.00 71.12  ? 505 ASP A OD2   1 
ATOM   2953  N  N     . LYS A  1 365 ? 28.183  17.619  47.931  1.00 72.40  ? 506 LYS A N     1 
ATOM   2954  C  CA    . LYS A  1 365 ? 27.473  16.838  48.945  1.00 76.60  ? 506 LYS A CA    1 
ATOM   2955  C  C     . LYS A  1 365 ? 28.068  15.453  49.202  1.00 80.94  ? 506 LYS A C     1 
ATOM   2956  O  O     . LYS A  1 365 ? 29.193  15.162  48.789  1.00 81.59  ? 506 LYS A O     1 
ATOM   2957  C  CB    . LYS A  1 365 ? 25.988  16.709  48.597  1.00 78.79  ? 506 LYS A CB    1 
ATOM   2958  C  CG    . LYS A  1 365 ? 25.165  17.963  48.876  1.00 82.21  ? 506 LYS A CG    1 
ATOM   2959  C  CD    . LYS A  1 365 ? 23.677  17.676  48.740  1.00 85.13  ? 506 LYS A CD    1 
ATOM   2960  C  CE    . LYS A  1 365 ? 22.869  18.957  48.576  1.00 90.61  ? 506 LYS A CE    1 
ATOM   2961  N  NZ    . LYS A  1 365 ? 21.434  18.678  48.267  1.00 92.56  ? 506 LYS A NZ    1 
ATOM   2962  N  N     . LEU A  1 366 ? 27.281  14.610  49.870  1.00 84.37  ? 507 LEU A N     1 
ATOM   2963  C  CA    . LEU A  1 366 ? 27.738  13.338  50.444  1.00 85.47  ? 507 LEU A CA    1 
ATOM   2964  C  C     . LEU A  1 366 ? 28.992  13.506  51.300  1.00 85.71  ? 507 LEU A C     1 
ATOM   2965  O  O     . LEU A  1 366 ? 28.908  13.601  52.523  1.00 86.06  ? 507 LEU A O     1 
ATOM   2966  C  CB    . LEU A  1 366 ? 27.896  12.223  49.387  1.00 84.66  ? 507 LEU A CB    1 
ATOM   2967  C  CG    . LEU A  1 366 ? 29.073  12.071  48.411  1.00 85.63  ? 507 LEU A CG    1 
ATOM   2968  C  CD1   . LEU A  1 366 ? 30.376  11.660  49.084  1.00 84.97  ? 507 LEU A CD1   1 
ATOM   2969  C  CD2   . LEU A  1 366 ? 28.715  11.052  47.344  1.00 86.00  ? 507 LEU A CD2   1 
ATOM   2970  N  N     . LYS B  1 8   ? 2.606   16.697  68.640  1.00 62.12  ? 149 LYS B N     1 
ATOM   2971  C  CA    . LYS B  1 8   ? 4.038   16.869  68.850  1.00 63.65  ? 149 LYS B CA    1 
ATOM   2972  C  C     . LYS B  1 8   ? 4.449   18.316  68.593  1.00 60.06  ? 149 LYS B C     1 
ATOM   2973  O  O     . LYS B  1 8   ? 4.529   19.127  69.515  1.00 58.34  ? 149 LYS B O     1 
ATOM   2974  C  CB    . LYS B  1 8   ? 4.822   15.938  67.924  1.00 69.70  ? 149 LYS B CB    1 
ATOM   2975  C  CG    . LYS B  1 8   ? 4.312   14.501  67.901  1.00 74.60  ? 149 LYS B CG    1 
ATOM   2976  C  CD    . LYS B  1 8   ? 5.147   13.631  66.968  1.00 76.96  ? 149 LYS B CD    1 
ATOM   2977  C  CE    . LYS B  1 8   ? 4.684   12.180  67.003  1.00 79.34  ? 149 LYS B CE    1 
ATOM   2978  N  NZ    . LYS B  1 8   ? 5.587   11.279  66.228  1.00 78.82  ? 149 LYS B NZ    1 
ATOM   2979  N  N     . LEU B  1 9   ? 4.702   18.626  67.324  1.00 58.25  ? 150 LEU B N     1 
ATOM   2980  C  CA    . LEU B  1 9   ? 5.116   19.962  66.905  1.00 54.61  ? 150 LEU B CA    1 
ATOM   2981  C  C     . LEU B  1 9   ? 3.937   20.936  66.849  1.00 60.70  ? 150 LEU B C     1 
ATOM   2982  O  O     . LEU B  1 9   ? 4.111   22.144  67.036  1.00 62.89  ? 150 LEU B O     1 
ATOM   2983  C  CB    . LEU B  1 9   ? 5.808   19.897  65.541  1.00 43.43  ? 150 LEU B CB    1 
ATOM   2984  C  CG    . LEU B  1 9   ? 7.132   19.135  65.478  1.00 32.57  ? 150 LEU B CG    1 
ATOM   2985  C  CD1   . LEU B  1 9   ? 7.709   19.131  64.068  1.00 28.70  ? 150 LEU B CD1   1 
ATOM   2986  C  CD2   . LEU B  1 9   ? 8.117   19.740  66.449  1.00 26.70  ? 150 LEU B CD2   1 
ATOM   2987  N  N     . LYS B  1 10  ? 2.741   20.409  66.596  1.00 61.31  ? 151 LYS B N     1 
ATOM   2988  C  CA    . LYS B  1 10  ? 1.539   21.234  66.525  1.00 62.89  ? 151 LYS B CA    1 
ATOM   2989  C  C     . LYS B  1 10  ? 1.249   21.900  67.864  1.00 63.97  ? 151 LYS B C     1 
ATOM   2990  O  O     . LYS B  1 10  ? 0.753   23.029  67.914  1.00 65.13  ? 151 LYS B O     1 
ATOM   2991  C  CB    . LYS B  1 10  ? 0.339   20.392  66.102  1.00 64.94  ? 151 LYS B CB    1 
ATOM   2992  C  CG    . LYS B  1 10  ? 0.538   19.635  64.800  1.00 67.47  ? 151 LYS B CG    1 
ATOM   2993  C  CD    . LYS B  1 10  ? -0.754  18.952  64.371  1.00 70.39  ? 151 LYS B CD    1 
ATOM   2994  C  CE    . LYS B  1 10  ? -0.581  18.190  63.066  1.00 72.28  ? 151 LYS B CE    1 
ATOM   2995  N  NZ    . LYS B  1 10  ? -1.892  17.784  62.475  1.00 73.12  ? 151 LYS B NZ    1 
ATOM   2996  N  N     . LYS B  1 11  ? 1.562   21.195  68.947  1.00 64.10  ? 152 LYS B N     1 
ATOM   2997  C  CA    . LYS B  1 11  ? 1.396   21.741  70.287  1.00 63.07  ? 152 LYS B CA    1 
ATOM   2998  C  C     . LYS B  1 11  ? 2.390   22.876  70.521  1.00 55.19  ? 152 LYS B C     1 
ATOM   2999  O  O     . LYS B  1 11  ? 2.065   23.880  71.168  1.00 53.36  ? 152 LYS B O     1 
ATOM   3000  C  CB    . LYS B  1 11  ? 1.584   20.645  71.334  1.00 68.54  ? 152 LYS B CB    1 
ATOM   3001  C  CG    . LYS B  1 11  ? 0.807   19.366  71.040  1.00 72.80  ? 152 LYS B CG    1 
ATOM   3002  C  CD    . LYS B  1 11  ? 1.085   18.307  72.103  1.00 76.57  ? 152 LYS B CD    1 
ATOM   3003  C  CE    . LYS B  1 11  ? 0.972   16.901  71.530  1.00 78.59  ? 152 LYS B CE    1 
ATOM   3004  N  NZ    . LYS B  1 11  ? 1.514   15.880  72.467  1.00 78.62  ? 152 LYS B NZ    1 
ATOM   3005  N  N     . VAL B  1 12  ? 3.598   22.717  69.983  1.00 50.16  ? 153 VAL B N     1 
ATOM   3006  C  CA    . VAL B  1 12  ? 4.609   23.766  70.062  1.00 48.57  ? 153 VAL B CA    1 
ATOM   3007  C  C     . VAL B  1 12  ? 4.118   25.005  69.318  1.00 49.23  ? 153 VAL B C     1 
ATOM   3008  O  O     . VAL B  1 12  ? 4.221   26.124  69.822  1.00 52.49  ? 153 VAL B O     1 
ATOM   3009  C  CB    . VAL B  1 12  ? 5.950   23.313  69.476  1.00 49.06  ? 153 VAL B CB    1 
ATOM   3010  C  CG1   . VAL B  1 12  ? 7.013   24.367  69.714  1.00 48.63  ? 153 VAL B CG1   1 
ATOM   3011  C  CG2   . VAL B  1 12  ? 6.378   21.993  70.091  1.00 50.82  ? 153 VAL B CG2   1 
ATOM   3012  N  N     . LEU B  1 13  ? 3.566   24.794  68.126  1.00 45.31  ? 154 LEU B N     1 
ATOM   3013  C  CA    . LEU B  1 13  ? 3.017   25.884  67.328  1.00 43.53  ? 154 LEU B CA    1 
ATOM   3014  C  C     . LEU B  1 13  ? 1.853   26.569  68.041  1.00 42.59  ? 154 LEU B C     1 
ATOM   3015  O  O     . LEU B  1 13  ? 1.661   27.780  67.910  1.00 44.17  ? 154 LEU B O     1 
ATOM   3016  C  CB    . LEU B  1 13  ? 2.588   25.374  65.953  1.00 45.67  ? 154 LEU B CB    1 
ATOM   3017  C  CG    . LEU B  1 13  ? 3.723   25.146  64.953  1.00 47.39  ? 154 LEU B CG    1 
ATOM   3018  C  CD1   . LEU B  1 13  ? 3.211   24.515  63.668  1.00 49.25  ? 154 LEU B CD1   1 
ATOM   3019  C  CD2   . LEU B  1 13  ? 4.429   26.451  64.646  1.00 43.52  ? 154 LEU B CD2   1 
ATOM   3020  N  N     . ASP B  1 14  ? 1.083   25.792  68.798  1.00 44.43  ? 155 ASP B N     1 
ATOM   3021  C  CA    . ASP B  1 14  ? 0.026   26.351  69.632  1.00 48.24  ? 155 ASP B CA    1 
ATOM   3022  C  C     . ASP B  1 14  ? 0.609   27.243  70.730  1.00 52.74  ? 155 ASP B C     1 
ATOM   3023  O  O     . ASP B  1 14  ? 0.079   28.319  71.006  1.00 54.05  ? 155 ASP B O     1 
ATOM   3024  C  CB    . ASP B  1 14  ? -0.828  25.238  70.243  1.00 49.91  ? 155 ASP B CB    1 
ATOM   3025  C  CG    . ASP B  1 14  ? -1.774  24.610  69.238  1.00 52.11  ? 155 ASP B CG    1 
ATOM   3026  O  OD1   . ASP B  1 14  ? -2.161  25.303  68.272  1.00 54.54  ? 155 ASP B OD1   1 
ATOM   3027  O  OD2   . ASP B  1 14  ? -2.137  23.428  69.418  1.00 51.37  ? 155 ASP B OD2   1 
ATOM   3028  N  N     . LYS B  1 15  ? 1.700   26.795  71.349  1.00 54.31  ? 156 LYS B N     1 
ATOM   3029  C  CA    . LYS B  1 15  ? 2.375   27.591  72.376  1.00 54.06  ? 156 LYS B CA    1 
ATOM   3030  C  C     . LYS B  1 15  ? 2.952   28.890  71.803  1.00 50.59  ? 156 LYS B C     1 
ATOM   3031  O  O     . LYS B  1 15  ? 2.978   29.919  72.482  1.00 49.89  ? 156 LYS B O     1 
ATOM   3032  C  CB    . LYS B  1 15  ? 3.484   26.775  73.054  1.00 57.31  ? 156 LYS B CB    1 
ATOM   3033  C  CG    . LYS B  1 15  ? 4.198   27.507  74.185  1.00 60.08  ? 156 LYS B CG    1 
ATOM   3034  C  CD    . LYS B  1 15  ? 5.221   26.622  74.886  1.00 60.21  ? 156 LYS B CD    1 
ATOM   3035  C  CE    . LYS B  1 15  ? 6.318   26.168  73.942  1.00 61.00  ? 156 LYS B CE    1 
ATOM   3036  N  NZ    . LYS B  1 15  ? 7.290   25.270  74.624  1.00 59.39  ? 156 LYS B NZ    1 
ATOM   3037  N  N     . LEU B  1 16  ? 3.401   28.837  70.551  1.00 45.87  ? 157 LEU B N     1 
ATOM   3038  C  CA    . LEU B  1 16  ? 4.063   29.977  69.917  1.00 41.12  ? 157 LEU B CA    1 
ATOM   3039  C  C     . LEU B  1 16  ? 3.079   31.004  69.374  1.00 40.46  ? 157 LEU B C     1 
ATOM   3040  O  O     . LEU B  1 16  ? 3.467   32.122  69.031  1.00 40.54  ? 157 LEU B O     1 
ATOM   3041  C  CB    . LEU B  1 16  ? 4.965   29.501  68.779  1.00 38.38  ? 157 LEU B CB    1 
ATOM   3042  C  CG    . LEU B  1 16  ? 6.097   28.558  69.171  1.00 34.66  ? 157 LEU B CG    1 
ATOM   3043  C  CD1   . LEU B  1 16  ? 6.980   28.251  67.979  1.00 30.82  ? 157 LEU B CD1   1 
ATOM   3044  C  CD2   . LEU B  1 16  ? 6.900   29.162  70.297  1.00 31.84  ? 157 LEU B CD2   1 
ATOM   3045  N  N     . ARG B  1 17  ? 1.811   30.613  69.294  1.00 40.98  ? 158 ARG B N     1 
ATOM   3046  C  CA    . ARG B  1 17  ? 0.771   31.445  68.699  1.00 39.97  ? 158 ARG B CA    1 
ATOM   3047  C  C     . ARG B  1 17  ? 0.580   32.743  69.465  1.00 40.18  ? 158 ARG B C     1 
ATOM   3048  O  O     . ARG B  1 17  ? 0.549   32.748  70.695  1.00 42.96  ? 158 ARG B O     1 
ATOM   3049  C  CB    . ARG B  1 17  ? -0.545  30.667  68.638  1.00 39.55  ? 158 ARG B CB    1 
ATOM   3050  C  CG    . ARG B  1 17  ? -1.671  31.355  67.872  1.00 41.61  ? 158 ARG B CG    1 
ATOM   3051  C  CD    . ARG B  1 17  ? -2.650  30.320  67.335  1.00 41.63  ? 158 ARG B CD    1 
ATOM   3052  N  NE    . ARG B  1 17  ? -1.940  29.249  66.641  1.00 42.07  ? 158 ARG B NE    1 
ATOM   3053  C  CZ    . ARG B  1 17  ? -2.464  28.065  66.343  1.00 43.23  ? 158 ARG B CZ    1 
ATOM   3054  N  NH1   . ARG B  1 17  ? -3.715  27.784  66.676  1.00 47.26  ? 158 ARG B NH1   1 
ATOM   3055  N  NH2   . ARG B  1 17  ? -1.732  27.156  65.715  1.00 41.08  ? 158 ARG B NH2   1 
ATOM   3056  N  N     . LEU B  1 18  ? 0.469   33.846  68.732  1.00 37.70  ? 159 LEU B N     1 
ATOM   3057  C  CA    . LEU B  1 18  ? 0.194   35.135  69.349  1.00 36.12  ? 159 LEU B CA    1 
ATOM   3058  C  C     . LEU B  1 18  ? -1.280  35.222  69.709  1.00 37.33  ? 159 LEU B C     1 
ATOM   3059  O  O     . LEU B  1 18  ? -2.115  34.529  69.124  1.00 38.94  ? 159 LEU B O     1 
ATOM   3060  C  CB    . LEU B  1 18  ? 0.567   36.284  68.414  1.00 35.84  ? 159 LEU B CB    1 
ATOM   3061  C  CG    . LEU B  1 18  ? 2.006   36.334  67.912  1.00 32.12  ? 159 LEU B CG    1 
ATOM   3062  C  CD1   . LEU B  1 18  ? 2.272   37.626  67.177  1.00 28.58  ? 159 LEU B CD1   1 
ATOM   3063  C  CD2   . LEU B  1 18  ? 2.957   36.184  69.069  1.00 33.55  ? 159 LEU B CD2   1 
ATOM   3064  N  N     . LYS B  1 19  ? -1.590  36.070  70.682  1.00 36.58  ? 160 LYS B N     1 
ATOM   3065  C  CA    . LYS B  1 19  ? -2.957  36.269  71.126  1.00 38.49  ? 160 LYS B CA    1 
ATOM   3066  C  C     . LYS B  1 19  ? -3.423  37.655  70.722  1.00 42.67  ? 160 LYS B C     1 
ATOM   3067  O  O     . LYS B  1 19  ? -2.705  38.638  70.915  1.00 46.06  ? 160 LYS B O     1 
ATOM   3068  C  CB    . LYS B  1 19  ? -3.046  36.080  72.637  1.00 41.12  ? 160 LYS B CB    1 
ATOM   3069  C  CG    . LYS B  1 19  ? -2.485  34.745  73.084  1.00 45.65  ? 160 LYS B CG    1 
ATOM   3070  C  CD    . LYS B  1 19  ? -2.602  34.551  74.579  1.00 52.07  ? 160 LYS B CD    1 
ATOM   3071  C  CE    . LYS B  1 19  ? -2.039  33.196  74.978  1.00 59.86  ? 160 LYS B CE    1 
ATOM   3072  N  NZ    . LYS B  1 19  ? -1.965  33.016  76.457  1.00 64.40  ? 160 LYS B NZ    1 
ATOM   3073  N  N     . ARG B  1 20  ? -4.627  37.735  70.167  1.00 42.04  ? 161 ARG B N     1 
ATOM   3074  C  CA    . ARG B  1 20  ? -5.080  38.966  69.537  1.00 44.70  ? 161 ARG B CA    1 
ATOM   3075  C  C     . ARG B  1 20  ? -5.316  40.109  70.519  1.00 44.49  ? 161 ARG B C     1 
ATOM   3076  O  O     . ARG B  1 20  ? -5.405  41.267  70.112  1.00 46.75  ? 161 ARG B O     1 
ATOM   3077  C  CB    . ARG B  1 20  ? -6.319  38.716  68.675  1.00 45.97  ? 161 ARG B CB    1 
ATOM   3078  C  CG    . ARG B  1 20  ? -7.551  38.303  69.442  1.00 43.17  ? 161 ARG B CG    1 
ATOM   3079  C  CD    . ARG B  1 20  ? -8.798  38.601  68.629  1.00 42.05  ? 161 ARG B CD    1 
ATOM   3080  N  NE    . ARG B  1 20  ? -9.999  38.533  69.453  1.00 42.65  ? 161 ARG B NE    1 
ATOM   3081  C  CZ    . ARG B  1 20  ? -10.877 37.539  69.408  1.00 39.53  ? 161 ARG B CZ    1 
ATOM   3082  N  NH1   . ARG B  1 20  ? -10.696 36.531  68.565  1.00 41.43  ? 161 ARG B NH1   1 
ATOM   3083  N  NH2   . ARG B  1 20  ? -11.940 37.554  70.199  1.00 34.69  ? 161 ARG B NH2   1 
ATOM   3084  N  N     . LYS B  1 21  ? -5.410  39.794  71.805  1.00 43.40  ? 162 LYS B N     1 
ATOM   3085  C  CA    . LYS B  1 21  ? -5.500  40.839  72.820  1.00 45.55  ? 162 LYS B CA    1 
ATOM   3086  C  C     . LYS B  1 21  ? -4.134  41.509  72.985  1.00 42.56  ? 162 LYS B C     1 
ATOM   3087  O  O     . LYS B  1 21  ? -4.017  42.746  72.908  1.00 44.63  ? 162 LYS B O     1 
ATOM   3088  C  CB    . LYS B  1 21  ? -5.984  40.262  74.151  1.00 47.06  ? 162 LYS B CB    1 
ATOM   3089  C  CG    . LYS B  1 21  ? -6.125  41.295  75.258  1.00 51.26  ? 162 LYS B CG    1 
ATOM   3090  C  CD    . LYS B  1 21  ? -6.383  40.642  76.609  1.00 58.24  ? 162 LYS B CD    1 
ATOM   3091  C  CE    . LYS B  1 21  ? -6.279  41.656  77.744  1.00 63.83  ? 162 LYS B CE    1 
ATOM   3092  N  NZ    . LYS B  1 21  ? -4.922  42.266  77.847  1.00 66.84  ? 162 LYS B NZ    1 
ATOM   3093  N  N     . ASP B  1 22  ? -3.109  40.682  73.199  1.00 38.91  ? 163 ASP B N     1 
ATOM   3094  C  CA    . ASP B  1 22  ? -1.732  41.156  73.274  1.00 35.58  ? 163 ASP B CA    1 
ATOM   3095  C  C     . ASP B  1 22  ? -1.393  41.958  72.020  1.00 34.95  ? 163 ASP B C     1 
ATOM   3096  O  O     . ASP B  1 22  ? -0.846  43.067  72.098  1.00 40.18  ? 163 ASP B O     1 
ATOM   3097  C  CB    . ASP B  1 22  ? -0.771  39.975  73.401  1.00 39.50  ? 163 ASP B CB    1 
ATOM   3098  C  CG    . ASP B  1 22  ? -1.051  39.111  74.617  1.00 41.99  ? 163 ASP B CG    1 
ATOM   3099  O  OD1   . ASP B  1 22  ? -1.563  39.634  75.626  1.00 42.78  ? 163 ASP B OD1   1 
ATOM   3100  O  OD2   . ASP B  1 22  ? -0.743  37.902  74.565  1.00 45.03  ? 163 ASP B OD2   1 
ATOM   3101  N  N     . ILE B  1 23  ? -1.734  41.383  70.868  1.00 35.56  ? 164 ILE B N     1 
ATOM   3102  C  CA    . ILE B  1 23  ? -1.544  42.032  69.572  1.00 35.20  ? 164 ILE B CA    1 
ATOM   3103  C  C     . ILE B  1 23  ? -2.225  43.393  69.519  1.00 36.48  ? 164 ILE B C     1 
ATOM   3104  O  O     . ILE B  1 23  ? -1.622  44.378  69.107  1.00 41.18  ? 164 ILE B O     1 
ATOM   3105  C  CB    . ILE B  1 23  ? -2.086  41.163  68.417  1.00 32.93  ? 164 ILE B CB    1 
ATOM   3106  C  CG1   . ILE B  1 23  ? -1.331  39.840  68.332  1.00 32.00  ? 164 ILE B CG1   1 
ATOM   3107  C  CG2   . ILE B  1 23  ? -1.979  41.897  67.094  1.00 32.37  ? 164 ILE B CG2   1 
ATOM   3108  C  CD1   . ILE B  1 23  ? -1.813  38.931  67.214  1.00 31.54  ? 164 ILE B CD1   1 
ATOM   3109  N  N     . SER B  1 24  ? -3.481  43.438  69.949  1.00 34.81  ? 165 SER B N     1 
ATOM   3110  C  CA    . SER B  1 24  ? -4.269  44.666  69.930  1.00 33.48  ? 165 SER B CA    1 
ATOM   3111  C  C     . SER B  1 24  ? -3.630  45.784  70.759  1.00 34.82  ? 165 SER B C     1 
ATOM   3112  O  O     . SER B  1 24  ? -3.428  46.900  70.261  1.00 39.60  ? 165 SER B O     1 
ATOM   3113  C  CB    . SER B  1 24  ? -5.686  44.374  70.429  1.00 32.81  ? 165 SER B CB    1 
ATOM   3114  O  OG    . SER B  1 24  ? -6.595  45.371  70.019  1.00 31.21  ? 165 SER B OG    1 
ATOM   3115  N  N     . GLU B  1 25  ? -3.301  45.486  72.012  1.00 34.10  ? 166 GLU B N     1 
ATOM   3116  C  CA    . GLU B  1 25  ? -2.707  46.494  72.892  1.00 39.15  ? 166 GLU B CA    1 
ATOM   3117  C  C     . GLU B  1 25  ? -1.334  46.969  72.404  1.00 43.79  ? 166 GLU B C     1 
ATOM   3118  O  O     . GLU B  1 25  ? -1.087  48.187  72.243  1.00 52.22  ? 166 GLU B O     1 
ATOM   3119  C  CB    . GLU B  1 25  ? -2.601  45.938  74.306  1.00 40.17  ? 166 GLU B CB    1 
ATOM   3120  C  CG    . GLU B  1 25  ? -3.924  45.419  74.842  1.00 40.79  ? 166 GLU B CG    1 
ATOM   3121  C  CD    . GLU B  1 25  ? -3.740  44.488  76.014  1.00 43.18  ? 166 GLU B CD    1 
ATOM   3122  O  OE1   . GLU B  1 25  ? -2.651  43.887  76.129  1.00 47.19  ? 166 GLU B OE1   1 
ATOM   3123  O  OE2   . GLU B  1 25  ? -4.686  44.346  76.815  1.00 39.61  ? 166 GLU B OE2   1 
ATOM   3124  N  N     . ALA B  1 26  ? -0.446  46.002  72.173  1.00 39.74  ? 167 ALA B N     1 
ATOM   3125  C  CA    . ALA B  1 26  ? 0.899   46.298  71.686  1.00 34.78  ? 167 ALA B CA    1 
ATOM   3126  C  C     . ALA B  1 26  ? 0.843   47.162  70.427  1.00 33.28  ? 167 ALA B C     1 
ATOM   3127  O  O     . ALA B  1 26  ? 1.482   48.207  70.355  1.00 33.51  ? 167 ALA B O     1 
ATOM   3128  C  CB    . ALA B  1 26  ? 1.660   45.022  71.431  1.00 33.98  ? 167 ALA B CB    1 
ATOM   3129  N  N     . ALA B  1 27  ? 0.050   46.734  69.450  1.00 33.97  ? 168 ALA B N     1 
ATOM   3130  C  CA    . ALA B  1 27  ? -0.150  47.513  68.230  1.00 32.64  ? 168 ALA B CA    1 
ATOM   3131  C  C     . ALA B  1 27  ? -0.681  48.931  68.492  1.00 37.38  ? 168 ALA B C     1 
ATOM   3132  O  O     . ALA B  1 27  ? -0.231  49.880  67.850  1.00 39.32  ? 168 ALA B O     1 
ATOM   3133  C  CB    . ALA B  1 27  ? -1.055  46.773  67.266  1.00 29.61  ? 168 ALA B CB    1 
ATOM   3134  N  N     . GLU B  1 28  ? -1.648  49.072  69.401  1.00 39.56  ? 169 GLU B N     1 
ATOM   3135  C  CA    . GLU B  1 28  ? -2.148  50.397  69.778  1.00 42.04  ? 169 GLU B CA    1 
ATOM   3136  C  C     . GLU B  1 28  ? -0.993  51.324  70.157  1.00 46.02  ? 169 GLU B C     1 
ATOM   3137  O  O     . GLU B  1 28  ? -0.713  52.328  69.466  1.00 52.22  ? 169 GLU B O     1 
ATOM   3138  C  CB    . GLU B  1 28  ? -3.106  50.291  70.965  1.00 46.89  ? 169 GLU B CB    1 
ATOM   3139  C  CG    . GLU B  1 28  ? -4.560  50.007  70.611  1.00 52.63  ? 169 GLU B CG    1 
ATOM   3140  C  CD    . GLU B  1 28  ? -5.417  49.744  71.840  1.00 55.94  ? 169 GLU B CD    1 
ATOM   3141  O  OE1   . GLU B  1 28  ? -5.162  50.359  72.898  1.00 57.19  ? 169 GLU B OE1   1 
ATOM   3142  O  OE2   . GLU B  1 28  ? -6.344  48.915  71.747  1.00 56.53  ? 169 GLU B OE2   1 
ATOM   3143  N  N     . THR B  1 29  ? -0.320  50.969  71.253  1.00 42.55  ? 170 THR B N     1 
ATOM   3144  C  CA    . THR B  1 29  ? 0.792   51.780  71.763  1.00 38.23  ? 170 THR B CA    1 
ATOM   3145  C  C     . THR B  1 29  ? 1.846   52.059  70.673  1.00 35.26  ? 170 THR B C     1 
ATOM   3146  O  O     . THR B  1 29  ? 2.193   53.225  70.388  1.00 35.51  ? 170 THR B O     1 
ATOM   3147  C  CB    . THR B  1 29  ? 1.454   51.103  72.982  1.00 33.22  ? 170 THR B CB    1 
ATOM   3148  O  OG1   . THR B  1 29  ? 0.454   50.763  73.949  1.00 34.69  ? 170 THR B OG1   1 
ATOM   3149  C  CG2   . THR B  1 29  ? 2.448   52.019  73.624  1.00 30.14  ? 170 THR B CG2   1 
ATOM   3150  N  N     . VAL B  1 30  ? 2.328   50.976  70.061  1.00 35.90  ? 171 VAL B N     1 
ATOM   3151  C  CA    . VAL B  1 30  ? 3.349   51.031  69.017  1.00 36.34  ? 171 VAL B CA    1 
ATOM   3152  C  C     . VAL B  1 30  ? 2.985   52.027  67.916  1.00 41.09  ? 171 VAL B C     1 
ATOM   3153  O  O     . VAL B  1 30  ? 3.765   52.934  67.621  1.00 47.22  ? 171 VAL B O     1 
ATOM   3154  C  CB    . VAL B  1 30  ? 3.628   49.630  68.428  1.00 33.13  ? 171 VAL B CB    1 
ATOM   3155  C  CG1   . VAL B  1 30  ? 4.343   49.728  67.098  1.00 30.20  ? 171 VAL B CG1   1 
ATOM   3156  C  CG2   . VAL B  1 30  ? 4.455   48.807  69.399  1.00 36.04  ? 171 VAL B CG2   1 
ATOM   3157  N  N     . ASN B  1 31  ? 1.799   51.871  67.332  1.00 36.33  ? 172 ASN B N     1 
ATOM   3158  C  CA    . ASN B  1 31  ? 1.321   52.794  66.306  1.00 30.70  ? 172 ASN B CA    1 
ATOM   3159  C  C     . ASN B  1 31  ? 1.279   54.248  66.766  1.00 29.31  ? 172 ASN B C     1 
ATOM   3160  O  O     . ASN B  1 31  ? 1.589   55.157  65.985  1.00 28.71  ? 172 ASN B O     1 
ATOM   3161  C  CB    . ASN B  1 31  ? -0.065  52.385  65.812  1.00 33.45  ? 172 ASN B CB    1 
ATOM   3162  C  CG    . ASN B  1 31  ? -0.068  51.046  65.114  1.00 28.20  ? 172 ASN B CG    1 
ATOM   3163  O  OD1   . ASN B  1 31  ? 0.917   50.646  64.510  1.00 26.27  ? 172 ASN B OD1   1 
ATOM   3164  N  ND2   . ASN B  1 31  ? -1.189  50.348  65.193  1.00 30.24  ? 172 ASN B ND2   1 
ATOM   3165  N  N     . LYS B  1 32  ? 0.874   54.478  68.015  1.00 33.28  ? 173 LYS B N     1 
ATOM   3166  C  CA    . LYS B  1 32  ? 0.880   55.849  68.535  1.00 35.34  ? 173 LYS B CA    1 
ATOM   3167  C  C     . LYS B  1 32  ? 2.277   56.468  68.493  1.00 36.80  ? 173 LYS B C     1 
ATOM   3168  O  O     . LYS B  1 32  ? 2.500   57.522  67.860  1.00 42.12  ? 173 LYS B O     1 
ATOM   3169  C  CB    . LYS B  1 32  ? 0.352   55.889  69.962  1.00 40.92  ? 173 LYS B CB    1 
ATOM   3170  C  CG    . LYS B  1 32  ? -1.156  55.769  70.059  1.00 45.10  ? 173 LYS B CG    1 
ATOM   3171  C  CD    . LYS B  1 32  ? -1.569  55.553  71.495  1.00 44.48  ? 173 LYS B CD    1 
ATOM   3172  C  CE    . LYS B  1 32  ? -3.058  55.351  71.605  1.00 45.57  ? 173 LYS B CE    1 
ATOM   3173  N  NZ    . LYS B  1 32  ? -3.375  54.905  72.973  1.00 44.73  ? 173 LYS B NZ    1 
ATOM   3174  N  N     . VAL B  1 33  ? 3.218   55.799  69.160  1.00 33.44  ? 174 VAL B N     1 
ATOM   3175  C  CA    . VAL B  1 33  ? 4.609   56.270  69.186  1.00 29.40  ? 174 VAL B CA    1 
ATOM   3176  C  C     . VAL B  1 33  ? 5.199   56.471  67.777  1.00 25.31  ? 174 VAL B C     1 
ATOM   3177  O  O     . VAL B  1 33  ? 5.755   57.535  67.473  1.00 30.71  ? 174 VAL B O     1 
ATOM   3178  C  CB    . VAL B  1 33  ? 5.502   55.332  70.020  1.00 28.70  ? 174 VAL B CB    1 
ATOM   3179  C  CG1   . VAL B  1 33  ? 6.936   55.820  70.036  1.00 27.74  ? 174 VAL B CG1   1 
ATOM   3180  C  CG2   . VAL B  1 33  ? 4.984   55.243  71.433  1.00 27.21  ? 174 VAL B CG2   1 
ATOM   3181  N  N     . VAL B  1 34  ? 5.065   55.457  66.926  1.00 18.68  ? 175 VAL B N     1 
ATOM   3182  C  CA    . VAL B  1 34  ? 5.543   55.539  65.544  1.00 20.36  ? 175 VAL B CA    1 
ATOM   3183  C  C     . VAL B  1 34  ? 4.972   56.749  64.804  1.00 28.33  ? 175 VAL B C     1 
ATOM   3184  O  O     . VAL B  1 34  ? 5.706   57.466  64.113  1.00 34.05  ? 175 VAL B O     1 
ATOM   3185  C  CB    . VAL B  1 34  ? 5.218   54.257  64.754  1.00 23.90  ? 175 VAL B CB    1 
ATOM   3186  C  CG1   . VAL B  1 34  ? 5.635   54.408  63.310  1.00 27.76  ? 175 VAL B CG1   1 
ATOM   3187  C  CG2   . VAL B  1 34  ? 5.913   53.057  65.369  1.00 15.39  ? 175 VAL B CG2   1 
ATOM   3188  N  N     . GLU B  1 35  ? 3.667   56.978  64.951  1.00 33.83  ? 176 GLU B N     1 
ATOM   3189  C  CA    . GLU B  1 35  ? 3.021   58.115  64.299  1.00 36.02  ? 176 GLU B CA    1 
ATOM   3190  C  C     . GLU B  1 35  ? 3.641   59.429  64.762  1.00 38.46  ? 176 GLU B C     1 
ATOM   3191  O  O     . GLU B  1 35  ? 3.984   60.286  63.933  1.00 43.85  ? 176 GLU B O     1 
ATOM   3192  C  CB    . GLU B  1 35  ? 1.512   58.106  64.553  1.00 43.86  ? 176 GLU B CB    1 
ATOM   3193  C  CG    . GLU B  1 35  ? 0.747   59.247  63.882  1.00 52.18  ? 176 GLU B CG    1 
ATOM   3194  C  CD    . GLU B  1 35  ? 0.571   60.462  64.785  1.00 62.54  ? 176 GLU B CD    1 
ATOM   3195  O  OE1   . GLU B  1 35  ? 0.417   61.587  64.256  1.00 64.17  ? 176 GLU B OE1   1 
ATOM   3196  O  OE2   . GLU B  1 35  ? 0.573   60.290  66.024  1.00 66.21  ? 176 GLU B OE2   1 
ATOM   3197  N  N     . ARG B  1 36  ? 3.803   59.577  66.078  1.00 35.01  ? 177 ARG B N     1 
ATOM   3198  C  CA    . ARG B  1 36  ? 4.440   60.781  66.619  1.00 32.59  ? 177 ARG B CA    1 
ATOM   3199  C  C     . ARG B  1 36  ? 5.840   61.023  66.058  1.00 33.19  ? 177 ARG B C     1 
ATOM   3200  O  O     . ARG B  1 36  ? 6.178   62.144  65.649  1.00 37.56  ? 177 ARG B O     1 
ATOM   3201  C  CB    . ARG B  1 36  ? 4.502   60.729  68.143  1.00 36.04  ? 177 ARG B CB    1 
ATOM   3202  C  CG    . ARG B  1 36  ? 3.186   61.057  68.824  1.00 37.75  ? 177 ARG B CG    1 
ATOM   3203  C  CD    . ARG B  1 36  ? 3.415   61.649  70.202  1.00 41.70  ? 177 ARG B CD    1 
ATOM   3204  N  NE    . ARG B  1 36  ? 4.196   62.883  70.143  1.00 43.58  ? 177 ARG B NE    1 
ATOM   3205  C  CZ    . ARG B  1 36  ? 4.197   63.814  71.094  1.00 45.19  ? 177 ARG B CZ    1 
ATOM   3206  N  NH1   . ARG B  1 36  ? 3.454   63.662  72.182  1.00 38.98  ? 177 ARG B NH1   1 
ATOM   3207  N  NH2   . ARG B  1 36  ? 4.937   64.904  70.953  1.00 49.55  ? 177 ARG B NH2   1 
ATOM   3208  N  N     . LEU B  1 37  ? 6.647   59.968  66.033  1.00 31.46  ? 178 LEU B N     1 
ATOM   3209  C  CA    . LEU B  1 37  ? 8.014   60.069  65.534  1.00 34.72  ? 178 LEU B CA    1 
ATOM   3210  C  C     . LEU B  1 37  ? 8.076   60.452  64.055  1.00 39.69  ? 178 LEU B C     1 
ATOM   3211  O  O     . LEU B  1 37  ? 8.842   61.336  63.675  1.00 40.60  ? 178 LEU B O     1 
ATOM   3212  C  CB    . LEU B  1 37  ? 8.751   58.755  65.769  1.00 37.85  ? 178 LEU B CB    1 
ATOM   3213  C  CG    . LEU B  1 37  ? 8.870   58.329  67.228  1.00 38.89  ? 178 LEU B CG    1 
ATOM   3214  C  CD1   . LEU B  1 37  ? 9.202   56.860  67.317  1.00 39.14  ? 178 LEU B CD1   1 
ATOM   3215  C  CD2   . LEU B  1 37  ? 9.922   59.155  67.948  1.00 38.53  ? 178 LEU B CD2   1 
ATOM   3216  N  N     . LEU B  1 38  ? 7.276   59.782  63.227  1.00 42.19  ? 179 LEU B N     1 
ATOM   3217  C  CA    . LEU B  1 38  ? 7.227   60.086  61.796  1.00 38.81  ? 179 LEU B CA    1 
ATOM   3218  C  C     . LEU B  1 38  ? 6.817   61.541  61.575  1.00 45.07  ? 179 LEU B C     1 
ATOM   3219  O  O     . LEU B  1 38  ? 7.490   62.291  60.855  1.00 49.07  ? 179 LEU B O     1 
ATOM   3220  C  CB    . LEU B  1 38  ? 6.247   59.143  61.091  1.00 32.06  ? 179 LEU B CB    1 
ATOM   3221  C  CG    . LEU B  1 38  ? 6.231   59.110  59.561  1.00 28.17  ? 179 LEU B CG    1 
ATOM   3222  C  CD1   . LEU B  1 38  ? 7.511   58.534  59.006  1.00 25.18  ? 179 LEU B CD1   1 
ATOM   3223  C  CD2   . LEU B  1 38  ? 5.055   58.318  59.047  1.00 23.00  ? 179 LEU B CD2   1 
ATOM   3224  N  N     . ARG B  1 39  ? 5.718   61.936  62.214  1.00 43.98  ? 180 ARG B N     1 
ATOM   3225  C  CA    . ARG B  1 39  ? 5.197   63.290  62.080  1.00 44.29  ? 180 ARG B CA    1 
ATOM   3226  C  C     . ARG B  1 39  ? 6.232   64.344  62.463  1.00 44.58  ? 180 ARG B C     1 
ATOM   3227  O  O     . ARG B  1 39  ? 6.422   65.318  61.734  1.00 47.69  ? 180 ARG B O     1 
ATOM   3228  C  CB    . ARG B  1 39  ? 3.935   63.448  62.923  1.00 51.70  ? 180 ARG B CB    1 
ATOM   3229  C  CG    . ARG B  1 39  ? 3.108   64.661  62.566  1.00 58.42  ? 180 ARG B CG    1 
ATOM   3230  C  CD    . ARG B  1 39  ? 1.712   64.550  63.150  1.00 64.74  ? 180 ARG B CD    1 
ATOM   3231  N  NE    . ARG B  1 39  ? 0.839   65.618  62.673  1.00 70.91  ? 180 ARG B NE    1 
ATOM   3232  C  CZ    . ARG B  1 39  ? -0.466  65.683  62.914  1.00 73.58  ? 180 ARG B CZ    1 
ATOM   3233  N  NH1   . ARG B  1 39  ? -1.061  64.736  63.626  1.00 73.99  ? 180 ARG B NH1   1 
ATOM   3234  N  NH2   . ARG B  1 39  ? -1.178  66.697  62.441  1.00 73.68  ? 180 ARG B NH2   1 
ATOM   3235  N  N     . ARG B  1 40  ? 6.900   64.149  63.600  1.00 43.16  ? 181 ARG B N     1 
ATOM   3236  C  CA    . ARG B  1 40  ? 8.003   65.030  63.987  1.00 38.64  ? 181 ARG B CA    1 
ATOM   3237  C  C     . ARG B  1 40  ? 9.094   65.038  62.917  1.00 35.40  ? 181 ARG B C     1 
ATOM   3238  O  O     . ARG B  1 40  ? 9.653   66.084  62.586  1.00 37.37  ? 181 ARG B O     1 
ATOM   3239  C  CB    . ARG B  1 40  ? 8.581   64.603  65.339  1.00 38.74  ? 181 ARG B CB    1 
ATOM   3240  C  CG    . ARG B  1 40  ? 10.015  65.076  65.624  1.00 42.00  ? 181 ARG B CG    1 
ATOM   3241  C  CD    . ARG B  1 40  ? 10.118  66.597  65.796  1.00 41.79  ? 181 ARG B CD    1 
ATOM   3242  N  NE    . ARG B  1 40  ? 11.415  67.028  66.320  1.00 38.25  ? 181 ARG B NE    1 
ATOM   3243  C  CZ    . ARG B  1 40  ? 12.385  67.560  65.580  1.00 39.10  ? 181 ARG B CZ    1 
ATOM   3244  N  NH1   . ARG B  1 40  ? 12.218  67.730  64.274  1.00 40.74  ? 181 ARG B NH1   1 
ATOM   3245  N  NH2   . ARG B  1 40  ? 13.526  67.926  66.143  1.00 36.82  ? 181 ARG B NH2   1 
ATOM   3246  N  N     . MET B  1 41  ? 9.373   63.867  62.361  1.00 34.80  ? 182 MET B N     1 
ATOM   3247  C  CA    . MET B  1 41  ? 10.411  63.728  61.350  1.00 34.51  ? 182 MET B CA    1 
ATOM   3248  C  C     . MET B  1 41  ? 10.053  64.535  60.100  1.00 40.04  ? 182 MET B C     1 
ATOM   3249  O  O     . MET B  1 41  ? 10.930  64.903  59.317  1.00 40.79  ? 182 MET B O     1 
ATOM   3250  C  CB    . MET B  1 41  ? 10.609  62.248  61.014  1.00 28.53  ? 182 MET B CB    1 
ATOM   3251  C  CG    . MET B  1 41  ? 12.013  61.861  60.624  1.00 25.31  ? 182 MET B CG    1 
ATOM   3252  S  SD    . MET B  1 41  ? 13.217  62.097  61.936  1.00 39.64  ? 182 MET B SD    1 
ATOM   3253  C  CE    . MET B  1 41  ? 12.561  61.002  63.186  1.00 53.98  ? 182 MET B CE    1 
ATOM   3254  N  N     . GLN B  1 42  ? 8.761   64.811  59.924  1.00 45.33  ? 183 GLN B N     1 
ATOM   3255  C  CA    . GLN B  1 42  ? 8.305   65.664  58.830  1.00 46.45  ? 183 GLN B CA    1 
ATOM   3256  C  C     . GLN B  1 42  ? 8.154   67.115  59.266  1.00 53.66  ? 183 GLN B C     1 
ATOM   3257  O  O     . GLN B  1 42  ? 8.585   68.028  58.563  1.00 52.23  ? 183 GLN B O     1 
ATOM   3258  C  CB    . GLN B  1 42  ? 6.952   65.187  58.303  1.00 44.32  ? 183 GLN B CB    1 
ATOM   3259  C  CG    . GLN B  1 42  ? 6.804   63.685  58.160  1.00 41.08  ? 183 GLN B CG    1 
ATOM   3260  C  CD    . GLN B  1 42  ? 7.769   63.095  57.174  1.00 36.63  ? 183 GLN B CD    1 
ATOM   3261  O  OE1   . GLN B  1 42  ? 8.234   63.770  56.258  1.00 36.77  ? 183 GLN B OE1   1 
ATOM   3262  N  NE2   . GLN B  1 42  ? 8.082   61.824  57.353  1.00 40.33  ? 183 GLN B NE2   1 
ATOM   3263  N  N     . LYS B  1 43  ? 7.535   67.306  60.430  1.00 66.53  ? 184 LYS B N     1 
ATOM   3264  C  CA    . LYS B  1 43  ? 7.086   68.615  60.906  1.00 73.62  ? 184 LYS B CA    1 
ATOM   3265  C  C     . LYS B  1 43  ? 8.163   69.691  60.967  1.00 79.43  ? 184 LYS B C     1 
ATOM   3266  O  O     . LYS B  1 43  ? 8.460   70.334  59.957  1.00 82.98  ? 184 LYS B O     1 
ATOM   3267  C  CB    . LYS B  1 43  ? 6.425   68.471  62.281  1.00 74.23  ? 184 LYS B CB    1 
ATOM   3268  C  CG    . LYS B  1 43  ? 4.940   68.798  62.290  1.00 74.72  ? 184 LYS B CG    1 
ATOM   3269  C  CD    . LYS B  1 43  ? 4.247   68.240  63.525  1.00 74.51  ? 184 LYS B CD    1 
ATOM   3270  C  CE    . LYS B  1 43  ? 2.751   68.500  63.455  1.00 74.26  ? 184 LYS B CE    1 
ATOM   3271  N  NZ    . LYS B  1 43  ? 2.207   68.162  62.110  1.00 74.05  ? 184 LYS B NZ    1 
ATOM   3272  N  N     . ARG B  1 44  ? 8.699   69.906  62.166  1.00 81.18  ? 185 ARG B N     1 
ATOM   3273  C  CA    . ARG B  1 44  ? 9.751   70.888  62.391  1.00 83.87  ? 185 ARG B CA    1 
ATOM   3274  C  C     . ARG B  1 44  ? 10.812  70.729  61.320  1.00 85.04  ? 185 ARG B C     1 
ATOM   3275  O  O     . ARG B  1 44  ? 11.657  69.839  61.415  1.00 87.13  ? 185 ARG B O     1 
ATOM   3276  C  CB    . ARG B  1 44  ? 10.367  70.682  63.769  1.00 84.16  ? 185 ARG B CB    1 
ATOM   3277  C  CG    . ARG B  1 44  ? 9.344   70.385  64.852  1.00 83.50  ? 185 ARG B CG    1 
ATOM   3278  C  CD    . ARG B  1 44  ? 9.997   70.413  66.214  1.00 82.90  ? 185 ARG B CD    1 
ATOM   3279  N  NE    . ARG B  1 44  ? 9.197   69.739  67.229  1.00 82.48  ? 185 ARG B NE    1 
ATOM   3280  C  CZ    . ARG B  1 44  ? 9.592   69.552  68.485  1.00 82.19  ? 185 ARG B CZ    1 
ATOM   3281  N  NH1   . ARG B  1 44  ? 10.778  69.990  68.885  1.00 80.81  ? 185 ARG B NH1   1 
ATOM   3282  N  NH2   . ARG B  1 44  ? 8.801   68.926  69.343  1.00 82.54  ? 185 ARG B NH2   1 
ATOM   3283  N  N     . GLU B  1 45  ? 10.741  71.590  60.303  1.00 83.96  ? 186 GLU B N     1 
ATOM   3284  C  CA    . GLU B  1 45  ? 11.489  71.423  59.049  1.00 83.00  ? 186 GLU B CA    1 
ATOM   3285  C  C     . GLU B  1 45  ? 12.936  70.964  59.225  1.00 74.33  ? 186 GLU B C     1 
ATOM   3286  O  O     . GLU B  1 45  ? 13.873  71.762  59.221  1.00 72.21  ? 186 GLU B O     1 
ATOM   3287  C  CB    . GLU B  1 45  ? 11.407  72.690  58.190  1.00 88.68  ? 186 GLU B CB    1 
ATOM   3288  C  CG    . GLU B  1 45  ? 10.109  72.808  57.390  1.00 95.08  ? 186 GLU B CG    1 
ATOM   3289  C  CD    . GLU B  1 45  ? 10.331  72.662  55.895  1.00 100.17 ? 186 GLU B CD    1 
ATOM   3290  O  OE1   . GLU B  1 45  ? 11.500  72.539  55.474  1.00 102.30 ? 186 GLU B OE1   1 
ATOM   3291  O  OE2   . GLU B  1 45  ? 9.336   72.674  55.139  1.00 101.10 ? 186 GLU B OE2   1 
ATOM   3292  N  N     . SER B  1 46  ? 13.088  69.652  59.376  1.00 65.83  ? 187 SER B N     1 
ATOM   3293  C  CA    . SER B  1 46  ? 14.380  69.027  59.605  1.00 55.76  ? 187 SER B CA    1 
ATOM   3294  C  C     . SER B  1 46  ? 15.103  68.756  58.295  1.00 55.84  ? 187 SER B C     1 
ATOM   3295  O  O     . SER B  1 46  ? 14.915  69.468  57.307  1.00 59.61  ? 187 SER B O     1 
ATOM   3296  C  CB    . SER B  1 46  ? 14.193  67.715  60.365  1.00 49.19  ? 187 SER B CB    1 
ATOM   3297  O  OG    . SER B  1 46  ? 13.243  66.877  59.729  1.00 43.99  ? 187 SER B OG    1 
ATOM   3298  N  N     . GLU B  1 47  ? 15.940  67.724  58.303  1.00 50.51  ? 188 GLU B N     1 
ATOM   3299  C  CA    . GLU B  1 47  ? 16.597  67.252  57.096  1.00 47.24  ? 188 GLU B CA    1 
ATOM   3300  C  C     . GLU B  1 47  ? 16.162  65.819  56.800  1.00 40.35  ? 188 GLU B C     1 
ATOM   3301  O  O     . GLU B  1 47  ? 16.533  65.246  55.781  1.00 39.02  ? 188 GLU B O     1 
ATOM   3302  C  CB    . GLU B  1 47  ? 18.116  67.323  57.250  1.00 49.91  ? 188 GLU B CB    1 
ATOM   3303  C  CG    . GLU B  1 47  ? 18.657  66.598  58.469  1.00 51.86  ? 188 GLU B CG    1 
ATOM   3304  C  CD    . GLU B  1 47  ? 18.967  67.542  59.606  1.00 53.85  ? 188 GLU B CD    1 
ATOM   3305  O  OE1   . GLU B  1 47  ? 18.156  67.633  60.548  1.00 55.05  ? 188 GLU B OE1   1 
ATOM   3306  O  OE2   . GLU B  1 47  ? 20.030  68.191  59.561  1.00 53.30  ? 188 GLU B OE2   1 
ATOM   3307  N  N     . PHE B  1 48  ? 15.382  65.242  57.707  1.00 40.34  ? 189 PHE B N     1 
ATOM   3308  C  CA    . PHE B  1 48  ? 14.817  63.919  57.496  1.00 39.64  ? 189 PHE B CA    1 
ATOM   3309  C  C     . PHE B  1 48  ? 13.380  64.071  57.021  1.00 43.29  ? 189 PHE B C     1 
ATOM   3310  O  O     . PHE B  1 48  ? 12.599  63.120  57.030  1.00 44.73  ? 189 PHE B O     1 
ATOM   3311  C  CB    . PHE B  1 48  ? 14.884  63.089  58.779  1.00 37.32  ? 189 PHE B CB    1 
ATOM   3312  C  CG    . PHE B  1 48  ? 16.280  62.693  59.174  1.00 36.89  ? 189 PHE B CG    1 
ATOM   3313  C  CD1   . PHE B  1 48  ? 16.827  61.498  58.726  1.00 36.39  ? 189 PHE B CD1   1 
ATOM   3314  C  CD2   . PHE B  1 48  ? 17.047  63.513  59.988  1.00 36.42  ? 189 PHE B CD2   1 
ATOM   3315  C  CE1   . PHE B  1 48  ? 18.116  61.130  59.083  1.00 37.15  ? 189 PHE B CE1   1 
ATOM   3316  C  CE2   . PHE B  1 48  ? 18.335  63.149  60.348  1.00 37.42  ? 189 PHE B CE2   1 
ATOM   3317  C  CZ    . PHE B  1 48  ? 18.868  61.957  59.895  1.00 36.85  ? 189 PHE B CZ    1 
ATOM   3318  N  N     . LYS B  1 49  ? 13.047  65.289  56.610  1.00 45.00  ? 190 LYS B N     1 
ATOM   3319  C  CA    . LYS B  1 49  ? 11.749  65.591  56.034  1.00 42.67  ? 190 LYS B CA    1 
ATOM   3320  C  C     . LYS B  1 49  ? 11.609  64.854  54.713  1.00 42.09  ? 190 LYS B C     1 
ATOM   3321  O  O     . LYS B  1 49  ? 12.530  64.854  53.894  1.00 44.24  ? 190 LYS B O     1 
ATOM   3322  C  CB    . LYS B  1 49  ? 11.621  67.094  55.798  1.00 43.84  ? 190 LYS B CB    1 
ATOM   3323  C  CG    . LYS B  1 49  ? 10.204  67.551  55.509  1.00 49.48  ? 190 LYS B CG    1 
ATOM   3324  C  CD    . LYS B  1 49  ? 10.164  69.017  55.135  1.00 54.96  ? 190 LYS B CD    1 
ATOM   3325  C  CE    . LYS B  1 49  ? 8.733   69.494  54.984  1.00 59.28  ? 190 LYS B CE    1 
ATOM   3326  N  NZ    . LYS B  1 49  ? 7.979   69.399  56.264  1.00 61.46  ? 190 LYS B NZ    1 
ATOM   3327  N  N     . GLY B  1 50  ? 10.459  64.223  54.504  1.00 39.42  ? 191 GLY B N     1 
ATOM   3328  C  CA    . GLY B  1 50  ? 10.252  63.432  53.305  1.00 39.94  ? 191 GLY B CA    1 
ATOM   3329  C  C     . GLY B  1 50  ? 10.463  61.956  53.577  1.00 41.11  ? 191 GLY B C     1 
ATOM   3330  O  O     . GLY B  1 50  ? 10.317  61.122  52.682  1.00 46.36  ? 191 GLY B O     1 
ATOM   3331  N  N     . VAL B  1 51  ? 10.817  61.634  54.817  1.00 36.98  ? 192 VAL B N     1 
ATOM   3332  C  CA    . VAL B  1 51  ? 10.984  60.244  55.214  1.00 35.71  ? 192 VAL B CA    1 
ATOM   3333  C  C     . VAL B  1 51  ? 9.631   59.529  55.138  1.00 33.99  ? 192 VAL B C     1 
ATOM   3334  O  O     . VAL B  1 51  ? 8.585   60.140  55.359  1.00 33.62  ? 192 VAL B O     1 
ATOM   3335  C  CB    . VAL B  1 51  ? 11.642  60.135  56.615  1.00 28.75  ? 192 VAL B CB    1 
ATOM   3336  C  CG1   . VAL B  1 51  ? 10.646  59.736  57.682  1.00 30.95  ? 192 VAL B CG1   1 
ATOM   3337  C  CG2   . VAL B  1 51  ? 12.806  59.160  56.586  1.00 26.61  ? 192 VAL B CG2   1 
ATOM   3338  N  N     . GLU B  1 52  ? 9.653   58.250  54.776  1.00 30.04  ? 193 GLU B N     1 
ATOM   3339  C  CA    . GLU B  1 52  ? 8.430   57.464  54.647  1.00 28.21  ? 193 GLU B CA    1 
ATOM   3340  C  C     . GLU B  1 52  ? 8.548   56.174  55.438  1.00 29.84  ? 193 GLU B C     1 
ATOM   3341  O  O     . GLU B  1 52  ? 9.647   55.727  55.763  1.00 30.57  ? 193 GLU B O     1 
ATOM   3342  C  CB    . GLU B  1 52  ? 8.112   57.162  53.178  1.00 31.00  ? 193 GLU B CB    1 
ATOM   3343  C  CG    . GLU B  1 52  ? 7.563   58.351  52.402  1.00 33.60  ? 193 GLU B CG    1 
ATOM   3344  C  CD    . GLU B  1 52  ? 7.541   58.110  50.909  1.00 37.06  ? 193 GLU B CD    1 
ATOM   3345  O  OE1   . GLU B  1 52  ? 7.779   56.960  50.493  1.00 40.28  ? 193 GLU B OE1   1 
ATOM   3346  O  OE2   . GLU B  1 52  ? 7.292   59.073  50.153  1.00 37.52  ? 193 GLU B OE2   1 
ATOM   3347  N  N     . GLN B  1 53  ? 7.406   55.567  55.730  1.00 33.37  ? 194 GLN B N     1 
ATOM   3348  C  CA    . GLN B  1 53  ? 7.369   54.412  56.608  1.00 34.07  ? 194 GLN B CA    1 
ATOM   3349  C  C     . GLN B  1 53  ? 7.246   53.109  55.821  1.00 40.32  ? 194 GLN B C     1 
ATOM   3350  O  O     . GLN B  1 53  ? 6.669   53.076  54.729  1.00 44.21  ? 194 GLN B O     1 
ATOM   3351  C  CB    . GLN B  1 53  ? 6.202   54.558  57.581  1.00 32.57  ? 194 GLN B CB    1 
ATOM   3352  C  CG    . GLN B  1 53  ? 6.210   53.579  58.736  1.00 33.88  ? 194 GLN B CG    1 
ATOM   3353  C  CD    . GLN B  1 53  ? 4.984   53.717  59.602  1.00 35.50  ? 194 GLN B CD    1 
ATOM   3354  O  OE1   . GLN B  1 53  ? 4.166   54.609  59.395  1.00 37.73  ? 194 GLN B OE1   1 
ATOM   3355  N  NE2   . GLN B  1 53  ? 4.843   52.828  60.573  1.00 35.32  ? 194 GLN B NE2   1 
ATOM   3356  N  N     . LEU B  1 54  ? 7.809   52.040  56.377  1.00 40.64  ? 195 LEU B N     1 
ATOM   3357  C  CA    . LEU B  1 54  ? 7.700   50.711  55.794  1.00 35.95  ? 195 LEU B CA    1 
ATOM   3358  C  C     . LEU B  1 54  ? 7.794   49.710  56.941  1.00 31.99  ? 195 LEU B C     1 
ATOM   3359  O  O     . LEU B  1 54  ? 8.879   49.461  57.460  1.00 30.43  ? 195 LEU B O     1 
ATOM   3360  C  CB    . LEU B  1 54  ? 8.835   50.481  54.793  1.00 36.63  ? 195 LEU B CB    1 
ATOM   3361  C  CG    . LEU B  1 54  ? 8.623   49.572  53.577  1.00 41.53  ? 195 LEU B CG    1 
ATOM   3362  C  CD1   . LEU B  1 54  ? 9.951   49.292  52.883  1.00 45.31  ? 195 LEU B CD1   1 
ATOM   3363  C  CD2   . LEU B  1 54  ? 7.938   48.272  53.943  1.00 39.80  ? 195 LEU B CD2   1 
ATOM   3364  N  N     . ASN B  1 55  ? 6.660   49.145  57.345  1.00 30.49  ? 196 ASN B N     1 
ATOM   3365  C  CA    . ASN B  1 55  ? 6.658   48.154  58.414  1.00 28.60  ? 196 ASN B CA    1 
ATOM   3366  C  C     . ASN B  1 55  ? 7.181   46.809  57.911  1.00 32.14  ? 196 ASN B C     1 
ATOM   3367  O  O     . ASN B  1 55  ? 6.675   46.279  56.923  1.00 36.93  ? 196 ASN B O     1 
ATOM   3368  C  CB    . ASN B  1 55  ? 5.250   47.991  58.982  1.00 27.12  ? 196 ASN B CB    1 
ATOM   3369  C  CG    . ASN B  1 55  ? 4.691   49.286  59.544  1.00 27.13  ? 196 ASN B CG    1 
ATOM   3370  O  OD1   . ASN B  1 55  ? 5.434   50.157  59.990  1.00 29.29  ? 196 ASN B OD1   1 
ATOM   3371  N  ND2   . ASN B  1 55  ? 3.370   49.412  59.532  1.00 25.67  ? 196 ASN B ND2   1 
ATOM   3372  N  N     . THR B  1 56  ? 8.185   46.261  58.593  1.00 28.95  ? 197 THR B N     1 
ATOM   3373  C  CA    . THR B  1 56  ? 8.853   45.038  58.140  1.00 27.60  ? 197 THR B CA    1 
ATOM   3374  C  C     . THR B  1 56  ? 9.066   44.053  59.286  1.00 30.41  ? 197 THR B C     1 
ATOM   3375  O  O     . THR B  1 56  ? 8.752   44.361  60.436  1.00 36.92  ? 197 THR B O     1 
ATOM   3376  C  CB    . THR B  1 56  ? 10.214  45.366  57.503  1.00 26.08  ? 197 THR B CB    1 
ATOM   3377  O  OG1   . THR B  1 56  ? 11.026  46.079  58.443  1.00 26.58  ? 197 THR B OG1   1 
ATOM   3378  C  CG2   . THR B  1 56  ? 10.033  46.232  56.280  1.00 27.14  ? 197 THR B CG2   1 
ATOM   3379  N  N     . GLY B  1 57  ? 9.587   42.869  58.978  1.00 28.78  ? 198 GLY B N     1 
ATOM   3380  C  CA    . GLY B  1 57  ? 9.951   41.913  60.015  1.00 29.14  ? 198 GLY B CA    1 
ATOM   3381  C  C     . GLY B  1 57  ? 8.887   40.885  60.354  1.00 31.82  ? 198 GLY B C     1 
ATOM   3382  O  O     . GLY B  1 57  ? 7.793   40.918  59.794  1.00 34.59  ? 198 GLY B O     1 
ATOM   3383  N  N     . SER B  1 58  ? 9.210   39.991  61.291  1.00 31.17  ? 199 SER B N     1 
ATOM   3384  C  CA    . SER B  1 58  ? 8.347   38.870  61.670  1.00 25.58  ? 199 SER B CA    1 
ATOM   3385  C  C     . SER B  1 58  ? 6.903   39.238  61.976  1.00 23.80  ? 199 SER B C     1 
ATOM   3386  O  O     . SER B  1 58  ? 5.979   38.537  61.561  1.00 30.32  ? 199 SER B O     1 
ATOM   3387  C  CB    . SER B  1 58  ? 8.932   38.133  62.870  1.00 29.25  ? 199 SER B CB    1 
ATOM   3388  O  OG    . SER B  1 58  ? 10.220  37.640  62.584  1.00 37.63  ? 199 SER B OG    1 
ATOM   3389  N  N     . TYR B  1 59  ? 6.706   40.319  62.716  1.00 20.20  ? 200 TYR B N     1 
ATOM   3390  C  CA    . TYR B  1 59  ? 5.361   40.727  63.094  1.00 23.83  ? 200 TYR B CA    1 
ATOM   3391  C  C     . TYR B  1 59  ? 4.490   41.008  61.870  1.00 28.42  ? 200 TYR B C     1 
ATOM   3392  O  O     . TYR B  1 59  ? 3.335   40.589  61.819  1.00 31.95  ? 200 TYR B O     1 
ATOM   3393  C  CB    . TYR B  1 59  ? 5.393   41.952  64.015  1.00 21.57  ? 200 TYR B CB    1 
ATOM   3394  C  CG    . TYR B  1 59  ? 4.018   42.424  64.397  1.00 25.66  ? 200 TYR B CG    1 
ATOM   3395  C  CD1   . TYR B  1 59  ? 3.287   41.768  65.369  1.00 25.88  ? 200 TYR B CD1   1 
ATOM   3396  C  CD2   . TYR B  1 59  ? 3.439   43.518  63.772  1.00 33.18  ? 200 TYR B CD2   1 
ATOM   3397  C  CE1   . TYR B  1 59  ? 2.023   42.190  65.711  1.00 26.46  ? 200 TYR B CE1   1 
ATOM   3398  C  CE2   . TYR B  1 59  ? 2.176   43.943  64.109  1.00 28.10  ? 200 TYR B CE2   1 
ATOM   3399  C  CZ    . TYR B  1 59  ? 1.478   43.278  65.075  1.00 28.45  ? 200 TYR B CZ    1 
ATOM   3400  O  OH    . TYR B  1 59  ? 0.221   43.712  65.403  1.00 38.50  ? 200 TYR B OH    1 
ATOM   3401  N  N     . TYR B  1 60  ? 5.053   41.700  60.884  1.00 28.96  ? 201 TYR B N     1 
ATOM   3402  C  CA    . TYR B  1 60  ? 4.292   42.104  59.707  1.00 28.66  ? 201 TYR B CA    1 
ATOM   3403  C  C     . TYR B  1 60  ? 4.298   41.050  58.605  1.00 31.20  ? 201 TYR B C     1 
ATOM   3404  O  O     . TYR B  1 60  ? 3.683   41.239  57.551  1.00 38.28  ? 201 TYR B O     1 
ATOM   3405  C  CB    . TYR B  1 60  ? 4.806   43.444  59.185  1.00 29.31  ? 201 TYR B CB    1 
ATOM   3406  C  CG    . TYR B  1 60  ? 4.646   44.550  60.195  1.00 29.06  ? 201 TYR B CG    1 
ATOM   3407  C  CD1   . TYR B  1 60  ? 3.435   45.198  60.345  1.00 32.30  ? 201 TYR B CD1   1 
ATOM   3408  C  CD2   . TYR B  1 60  ? 5.697   44.935  61.007  1.00 24.90  ? 201 TYR B CD2   1 
ATOM   3409  C  CE1   . TYR B  1 60  ? 3.276   46.201  61.271  1.00 32.21  ? 201 TYR B CE1   1 
ATOM   3410  C  CE2   . TYR B  1 60  ? 5.547   45.938  61.934  1.00 24.67  ? 201 TYR B CE2   1 
ATOM   3411  C  CZ    . TYR B  1 60  ? 4.335   46.566  62.063  1.00 28.88  ? 201 TYR B CZ    1 
ATOM   3412  O  OH    . TYR B  1 60  ? 4.175   47.569  62.989  1.00 31.00  ? 201 TYR B OH    1 
ATOM   3413  N  N     . GLU B  1 61  ? 4.988   39.941  58.856  1.00 27.19  ? 202 GLU B N     1 
ATOM   3414  C  CA    . GLU B  1 61  ? 5.003   38.818  57.932  1.00 22.73  ? 202 GLU B CA    1 
ATOM   3415  C  C     . GLU B  1 61  ? 4.164   37.690  58.514  1.00 24.11  ? 202 GLU B C     1 
ATOM   3416  O  O     . GLU B  1 61  ? 3.943   36.678  57.854  1.00 26.73  ? 202 GLU B O     1 
ATOM   3417  C  CB    . GLU B  1 61  ? 6.437   38.333  57.694  1.00 28.65  ? 202 GLU B CB    1 
ATOM   3418  C  CG    . GLU B  1 61  ? 7.373   39.353  57.030  1.00 32.80  ? 202 GLU B CG    1 
ATOM   3419  C  CD    . GLU B  1 61  ? 8.838   38.957  57.141  1.00 36.67  ? 202 GLU B CD    1 
ATOM   3420  O  OE1   . GLU B  1 61  ? 9.168   38.128  58.011  1.00 37.08  ? 202 GLU B OE1   1 
ATOM   3421  O  OE2   . GLU B  1 61  ? 9.662   39.480  56.366  1.00 38.92  ? 202 GLU B OE2   1 
ATOM   3422  N  N     . HIS B  1 62  ? 3.704   37.882  59.751  1.00 28.02  ? 203 HIS B N     1 
ATOM   3423  C  CA    . HIS B  1 62  ? 2.943   36.880  60.500  1.00 25.27  ? 203 HIS B CA    1 
ATOM   3424  C  C     . HIS B  1 62  ? 3.776   35.649  60.790  1.00 28.10  ? 203 HIS B C     1 
ATOM   3425  O  O     . HIS B  1 62  ? 3.281   34.531  60.719  1.00 34.50  ? 203 HIS B O     1 
ATOM   3426  C  CB    . HIS B  1 62  ? 1.651   36.496  59.777  1.00 24.59  ? 203 HIS B CB    1 
ATOM   3427  C  CG    . HIS B  1 62  ? 0.916   37.664  59.201  1.00 26.85  ? 203 HIS B CG    1 
ATOM   3428  N  ND1   . HIS B  1 62  ? 0.034   38.427  59.938  1.00 33.02  ? 203 HIS B ND1   1 
ATOM   3429  C  CD2   . HIS B  1 62  ? 0.933   38.202  57.959  1.00 28.61  ? 203 HIS B CD2   1 
ATOM   3430  C  CE1   . HIS B  1 62  ? -0.460  39.384  59.172  1.00 37.99  ? 203 HIS B CE1   1 
ATOM   3431  N  NE2   . HIS B  1 62  ? 0.072   39.273  57.967  1.00 34.54  ? 203 HIS B NE2   1 
ATOM   3432  N  N     . VAL B  1 63  ? 5.045   35.866  61.119  1.00 29.76  ? 204 VAL B N     1 
ATOM   3433  C  CA    . VAL B  1 63  ? 5.915   34.781  61.558  1.00 29.73  ? 204 VAL B CA    1 
ATOM   3434  C  C     . VAL B  1 63  ? 6.489   35.077  62.948  1.00 31.35  ? 204 VAL B C     1 
ATOM   3435  O  O     . VAL B  1 63  ? 7.397   34.390  63.419  1.00 31.70  ? 204 VAL B O     1 
ATOM   3436  C  CB    . VAL B  1 63  ? 7.031   34.455  60.526  1.00 27.07  ? 204 VAL B CB    1 
ATOM   3437  C  CG1   . VAL B  1 63  ? 6.461   33.709  59.339  1.00 28.87  ? 204 VAL B CG1   1 
ATOM   3438  C  CG2   . VAL B  1 63  ? 7.716   35.720  60.058  1.00 27.76  ? 204 VAL B CG2   1 
ATOM   3439  N  N     . LYS B  1 64  ? 5.945   36.104  63.598  1.00 31.33  ? 205 LYS B N     1 
ATOM   3440  C  CA    . LYS B  1 64  ? 6.296   36.410  64.978  1.00 30.10  ? 205 LYS B CA    1 
ATOM   3441  C  C     . LYS B  1 64  ? 5.804   35.289  65.879  1.00 37.21  ? 205 LYS B C     1 
ATOM   3442  O  O     . LYS B  1 64  ? 4.714   34.754  65.674  1.00 38.86  ? 205 LYS B O     1 
ATOM   3443  C  CB    . LYS B  1 64  ? 5.658   37.726  65.411  1.00 26.26  ? 205 LYS B CB    1 
ATOM   3444  C  CG    . LYS B  1 64  ? 6.186   38.260  66.730  1.00 23.11  ? 205 LYS B CG    1 
ATOM   3445  C  CD    . LYS B  1 64  ? 7.614   38.743  66.576  1.00 23.14  ? 205 LYS B CD    1 
ATOM   3446  C  CE    . LYS B  1 64  ? 8.223   39.150  67.909  1.00 26.22  ? 205 LYS B CE    1 
ATOM   3447  N  NZ    . LYS B  1 64  ? 8.355   38.015  68.852  1.00 24.06  ? 205 LYS B NZ    1 
ATOM   3448  N  N     . ILE B  1 65  ? 6.609   34.922  66.870  1.00 39.49  ? 206 ILE B N     1 
ATOM   3449  C  CA    . ILE B  1 65  ? 6.243   33.838  67.770  1.00 34.84  ? 206 ILE B CA    1 
ATOM   3450  C  C     . ILE B  1 65  ? 6.225   34.291  69.224  1.00 40.10  ? 206 ILE B C     1 
ATOM   3451  O  O     . ILE B  1 65  ? 6.771   35.348  69.563  1.00 42.26  ? 206 ILE B O     1 
ATOM   3452  C  CB    . ILE B  1 65  ? 7.192   32.634  67.625  1.00 30.67  ? 206 ILE B CB    1 
ATOM   3453  C  CG1   . ILE B  1 65  ? 8.608   32.995  68.066  1.00 28.27  ? 206 ILE B CG1   1 
ATOM   3454  C  CG2   . ILE B  1 65  ? 7.214   32.129  66.191  1.00 29.91  ? 206 ILE B CG2   1 
ATOM   3455  C  CD1   . ILE B  1 65  ? 9.515   31.785  68.185  1.00 30.53  ? 206 ILE B CD1   1 
ATOM   3456  N  N     . SER B  1 66  ? 5.571   33.492  70.067  1.00 41.86  ? 207 SER B N     1 
ATOM   3457  C  CA    . SER B  1 66  ? 5.552   33.697  71.518  1.00 38.90  ? 207 SER B CA    1 
ATOM   3458  C  C     . SER B  1 66  ? 4.833   34.967  71.989  1.00 40.34  ? 207 SER B C     1 
ATOM   3459  O  O     . SER B  1 66  ? 3.896   34.888  72.788  1.00 43.63  ? 207 SER B O     1 
ATOM   3460  C  CB    . SER B  1 66  ? 6.970   33.630  72.096  1.00 36.05  ? 207 SER B CB    1 
ATOM   3461  O  OG    . SER B  1 66  ? 7.462   32.306  72.061  1.00 36.77  ? 207 SER B OG    1 
ATOM   3462  N  N     . ALA B  1 67  ? 5.271   36.128  71.502  1.00 37.90  ? 208 ALA B N     1 
ATOM   3463  C  CA    . ALA B  1 67  ? 4.723   37.403  71.957  1.00 31.56  ? 208 ALA B CA    1 
ATOM   3464  C  C     . ALA B  1 67  ? 4.915   38.499  70.920  1.00 28.46  ? 208 ALA B C     1 
ATOM   3465  O  O     . ALA B  1 67  ? 5.849   38.443  70.127  1.00 31.05  ? 208 ALA B O     1 
ATOM   3466  C  CB    . ALA B  1 67  ? 5.373   37.809  73.267  1.00 28.20  ? 208 ALA B CB    1 
ATOM   3467  N  N     . PRO B  1 68  ? 4.030   39.509  70.929  1.00 29.33  ? 209 PRO B N     1 
ATOM   3468  C  CA    . PRO B  1 68  ? 4.226   40.665  70.054  1.00 27.86  ? 209 PRO B CA    1 
ATOM   3469  C  C     . PRO B  1 68  ? 5.020   41.758  70.766  1.00 31.65  ? 209 PRO B C     1 
ATOM   3470  O  O     . PRO B  1 68  ? 4.501   42.853  71.009  1.00 34.41  ? 209 PRO B O     1 
ATOM   3471  C  CB    . PRO B  1 68  ? 2.794   41.131  69.775  1.00 26.33  ? 209 PRO B CB    1 
ATOM   3472  C  CG    . PRO B  1 68  ? 1.967   40.615  70.933  1.00 27.07  ? 209 PRO B CG    1 
ATOM   3473  C  CD    . PRO B  1 68  ? 2.796   39.635  71.726  1.00 29.70  ? 209 PRO B CD    1 
ATOM   3474  N  N     . ASN B  1 69  ? 6.279   41.458  71.077  1.00 30.01  ? 210 ASN B N     1 
ATOM   3475  C  CA    . ASN B  1 69  ? 7.135   42.381  71.806  1.00 30.26  ? 210 ASN B CA    1 
ATOM   3476  C  C     . ASN B  1 69  ? 8.306   42.913  70.982  1.00 35.13  ? 210 ASN B C     1 
ATOM   3477  O  O     . ASN B  1 69  ? 9.213   43.550  71.526  1.00 40.24  ? 210 ASN B O     1 
ATOM   3478  C  CB    . ASN B  1 69  ? 7.663   41.712  73.073  1.00 29.96  ? 210 ASN B CB    1 
ATOM   3479  C  CG    . ASN B  1 69  ? 8.211   40.322  72.814  1.00 32.05  ? 210 ASN B CG    1 
ATOM   3480  O  OD1   . ASN B  1 69  ? 8.468   39.936  71.672  1.00 33.43  ? 210 ASN B OD1   1 
ATOM   3481  N  ND2   . ASN B  1 69  ? 8.398   39.562  73.883  1.00 33.39  ? 210 ASN B ND2   1 
ATOM   3482  N  N     . GLU B  1 70  ? 8.294   42.644  69.679  1.00 34.05  ? 211 GLU B N     1 
ATOM   3483  C  CA    . GLU B  1 70  ? 9.319   43.167  68.780  1.00 35.87  ? 211 GLU B CA    1 
ATOM   3484  C  C     . GLU B  1 70  ? 8.705   43.686  67.485  1.00 31.57  ? 211 GLU B C     1 
ATOM   3485  O  O     . GLU B  1 70  ? 7.975   42.963  66.795  1.00 30.44  ? 211 GLU B O     1 
ATOM   3486  C  CB    . GLU B  1 70  ? 10.379  42.102  68.479  1.00 45.83  ? 211 GLU B CB    1 
ATOM   3487  C  CG    . GLU B  1 70  ? 11.362  41.875  69.619  1.00 54.49  ? 211 GLU B CG    1 
ATOM   3488  C  CD    . GLU B  1 70  ? 12.308  40.721  69.358  1.00 59.71  ? 211 GLU B CD    1 
ATOM   3489  O  OE1   . GLU B  1 70  ? 13.238  40.527  70.165  1.00 60.74  ? 211 GLU B OE1   1 
ATOM   3490  O  OE2   . GLU B  1 70  ? 12.120  40.005  68.354  1.00 62.69  ? 211 GLU B OE2   1 
ATOM   3491  N  N     . PHE B  1 71  ? 9.018   44.935  67.156  1.00 27.55  ? 212 PHE B N     1 
ATOM   3492  C  CA    . PHE B  1 71  ? 8.479   45.579  65.966  1.00 27.76  ? 212 PHE B CA    1 
ATOM   3493  C  C     . PHE B  1 71  ? 9.600   46.212  65.138  1.00 31.58  ? 212 PHE B C     1 
ATOM   3494  O  O     . PHE B  1 71  ? 10.504  46.849  65.690  1.00 35.59  ? 212 PHE B O     1 
ATOM   3495  C  CB    . PHE B  1 71  ? 7.451   46.645  66.368  1.00 28.22  ? 212 PHE B CB    1 
ATOM   3496  C  CG    . PHE B  1 71  ? 6.154   46.083  66.906  1.00 25.52  ? 212 PHE B CG    1 
ATOM   3497  C  CD1   . PHE B  1 71  ? 5.040   45.984  66.090  1.00 25.70  ? 212 PHE B CD1   1 
ATOM   3498  C  CD2   . PHE B  1 71  ? 6.046   45.671  68.226  1.00 25.87  ? 212 PHE B CD2   1 
ATOM   3499  C  CE1   . PHE B  1 71  ? 3.847   45.482  66.576  1.00 24.17  ? 212 PHE B CE1   1 
ATOM   3500  C  CE2   . PHE B  1 71  ? 4.852   45.163  68.718  1.00 25.60  ? 212 PHE B CE2   1 
ATOM   3501  C  CZ    . PHE B  1 71  ? 3.755   45.070  67.894  1.00 25.10  ? 212 PHE B CZ    1 
ATOM   3502  N  N     . ASP B  1 72  ? 9.550   46.024  63.819  1.00 30.50  ? 213 ASP B N     1 
ATOM   3503  C  CA    . ASP B  1 72  ? 10.538  46.622  62.922  1.00 26.48  ? 213 ASP B CA    1 
ATOM   3504  C  C     . ASP B  1 72  ? 9.896   47.650  61.995  1.00 28.17  ? 213 ASP B C     1 
ATOM   3505  O  O     . ASP B  1 72  ? 9.047   47.306  61.173  1.00 29.74  ? 213 ASP B O     1 
ATOM   3506  C  CB    . ASP B  1 72  ? 11.251  45.553  62.084  1.00 26.79  ? 213 ASP B CB    1 
ATOM   3507  C  CG    . ASP B  1 72  ? 12.173  44.679  62.903  1.00 28.49  ? 213 ASP B CG    1 
ATOM   3508  O  OD1   . ASP B  1 72  ? 12.447  43.538  62.476  1.00 34.86  ? 213 ASP B OD1   1 
ATOM   3509  O  OD2   . ASP B  1 72  ? 12.626  45.129  63.970  1.00 29.59  ? 213 ASP B OD2   1 
ATOM   3510  N  N     . VAL B  1 73  ? 10.307  48.911  62.119  1.00 31.85  ? 214 VAL B N     1 
ATOM   3511  C  CA    . VAL B  1 73  ? 9.745   49.962  61.272  1.00 36.48  ? 214 VAL B CA    1 
ATOM   3512  C  C     . VAL B  1 73  ? 10.845  50.711  60.540  1.00 35.10  ? 214 VAL B C     1 
ATOM   3513  O  O     . VAL B  1 73  ? 11.734  51.290  61.170  1.00 37.21  ? 214 VAL B O     1 
ATOM   3514  C  CB    . VAL B  1 73  ? 8.923   50.979  62.089  1.00 42.62  ? 214 VAL B CB    1 
ATOM   3515  C  CG1   . VAL B  1 73  ? 8.263   51.987  61.170  1.00 40.90  ? 214 VAL B CG1   1 
ATOM   3516  C  CG2   . VAL B  1 73  ? 7.875   50.268  62.922  1.00 44.40  ? 214 VAL B CG2   1 
ATOM   3517  N  N     . MET B  1 74  ? 10.785  50.702  59.211  1.00 31.16  ? 215 MET B N     1 
ATOM   3518  C  CA    . MET B  1 74  ? 11.781  51.400  58.398  1.00 27.06  ? 215 MET B CA    1 
ATOM   3519  C  C     . MET B  1 74  ? 11.358  52.829  58.065  1.00 29.41  ? 215 MET B C     1 
ATOM   3520  O  O     . MET B  1 74  ? 10.289  53.058  57.491  1.00 28.81  ? 215 MET B O     1 
ATOM   3521  C  CB    . MET B  1 74  ? 12.064  50.639  57.103  1.00 19.74  ? 215 MET B CB    1 
ATOM   3522  C  CG    . MET B  1 74  ? 12.813  49.332  57.304  1.00 20.44  ? 215 MET B CG    1 
ATOM   3523  S  SD    . MET B  1 74  ? 13.169  48.509  55.742  1.00 58.76  ? 215 MET B SD    1 
ATOM   3524  C  CE    . MET B  1 74  ? 13.968  49.843  54.857  1.00 28.16  ? 215 MET B CE    1 
ATOM   3525  N  N     . PHE B  1 75  ? 12.198  53.784  58.448  1.00 30.20  ? 216 PHE B N     1 
ATOM   3526  C  CA    . PHE B  1 75  ? 12.047  55.158  58.008  1.00 29.42  ? 216 PHE B CA    1 
ATOM   3527  C  C     . PHE B  1 75  ? 13.006  55.350  56.848  1.00 27.37  ? 216 PHE B C     1 
ATOM   3528  O  O     . PHE B  1 75  ? 14.201  55.591  57.048  1.00 31.26  ? 216 PHE B O     1 
ATOM   3529  C  CB    . PHE B  1 75  ? 12.378  56.135  59.135  1.00 34.15  ? 216 PHE B CB    1 
ATOM   3530  C  CG    . PHE B  1 75  ? 11.257  56.336  60.126  1.00 36.80  ? 216 PHE B CG    1 
ATOM   3531  C  CD1   . PHE B  1 75  ? 10.298  55.349  60.340  1.00 35.71  ? 216 PHE B CD1   1 
ATOM   3532  C  CD2   . PHE B  1 75  ? 11.160  57.526  60.841  1.00 36.03  ? 216 PHE B CD2   1 
ATOM   3533  C  CE1   . PHE B  1 75  ? 9.269   55.541  61.259  1.00 35.78  ? 216 PHE B CE1   1 
ATOM   3534  C  CE2   . PHE B  1 75  ? 10.137  57.726  61.755  1.00 36.56  ? 216 PHE B CE2   1 
ATOM   3535  C  CZ    . PHE B  1 75  ? 9.190   56.733  61.964  1.00 37.91  ? 216 PHE B CZ    1 
ATOM   3536  N  N     . LYS B  1 76  ? 12.483  55.212  55.635  1.00 26.32  ? 217 LYS B N     1 
ATOM   3537  C  CA    . LYS B  1 76  ? 13.293  55.293  54.425  1.00 28.87  ? 217 LYS B CA    1 
ATOM   3538  C  C     . LYS B  1 76  ? 13.271  56.709  53.857  1.00 34.13  ? 217 LYS B C     1 
ATOM   3539  O  O     . LYS B  1 76  ? 12.248  57.391  53.903  1.00 37.54  ? 217 LYS B O     1 
ATOM   3540  C  CB    . LYS B  1 76  ? 12.773  54.302  53.388  1.00 27.97  ? 217 LYS B CB    1 
ATOM   3541  C  CG    . LYS B  1 76  ? 11.367  54.621  52.897  1.00 26.52  ? 217 LYS B CG    1 
ATOM   3542  C  CD    . LYS B  1 76  ? 10.702  53.427  52.251  1.00 28.66  ? 217 LYS B CD    1 
ATOM   3543  C  CE    . LYS B  1 76  ? 9.422   53.849  51.549  1.00 32.34  ? 217 LYS B CE    1 
ATOM   3544  N  NZ    . LYS B  1 76  ? 9.700   54.882  50.524  1.00 33.62  ? 217 LYS B NZ    1 
ATOM   3545  N  N     . LEU B  1 77  ? 14.406  57.155  53.330  1.00 33.28  ? 218 LEU B N     1 
ATOM   3546  C  CA    . LEU B  1 77  ? 14.518  58.504  52.785  1.00 31.96  ? 218 LEU B CA    1 
ATOM   3547  C  C     . LEU B  1 77  ? 15.156  58.419  51.415  1.00 32.71  ? 218 LEU B C     1 
ATOM   3548  O  O     . LEU B  1 77  ? 16.286  57.948  51.288  1.00 32.64  ? 218 LEU B O     1 
ATOM   3549  C  CB    . LEU B  1 77  ? 15.366  59.384  53.704  1.00 27.83  ? 218 LEU B CB    1 
ATOM   3550  C  CG    . LEU B  1 77  ? 15.550  60.852  53.323  1.00 25.24  ? 218 LEU B CG    1 
ATOM   3551  C  CD1   . LEU B  1 77  ? 14.244  61.578  53.416  1.00 18.48  ? 218 LEU B CD1   1 
ATOM   3552  C  CD2   . LEU B  1 77  ? 16.577  61.514  54.218  1.00 29.58  ? 218 LEU B CD2   1 
ATOM   3553  N  N     . GLU B  1 78  ? 14.436  58.861  50.387  1.00 30.97  ? 219 GLU B N     1 
ATOM   3554  C  CA    . GLU B  1 78  ? 14.969  58.771  49.038  1.00 29.80  ? 219 GLU B CA    1 
ATOM   3555  C  C     . GLU B  1 78  ? 16.171  59.681  48.899  1.00 36.14  ? 219 GLU B C     1 
ATOM   3556  O  O     . GLU B  1 78  ? 16.128  60.848  49.286  1.00 38.20  ? 219 GLU B O     1 
ATOM   3557  C  CB    . GLU B  1 78  ? 13.929  59.130  47.980  1.00 28.84  ? 219 GLU B CB    1 
ATOM   3558  C  CG    . GLU B  1 78  ? 14.404  58.797  46.568  1.00 26.71  ? 219 GLU B CG    1 
ATOM   3559  C  CD    . GLU B  1 78  ? 13.558  59.429  45.490  1.00 27.57  ? 219 GLU B CD    1 
ATOM   3560  O  OE1   . GLU B  1 78  ? 12.620  60.173  45.825  1.00 30.03  ? 219 GLU B OE1   1 
ATOM   3561  O  OE2   . GLU B  1 78  ? 13.841  59.185  44.302  1.00 31.12  ? 219 GLU B OE2   1 
ATOM   3562  N  N     . VAL B  1 79  ? 17.249  59.130  48.355  1.00 40.39  ? 220 VAL B N     1 
ATOM   3563  C  CA    . VAL B  1 79  ? 18.466  59.890  48.135  1.00 43.60  ? 220 VAL B CA    1 
ATOM   3564  C  C     . VAL B  1 79  ? 18.818  59.837  46.653  1.00 44.53  ? 220 VAL B C     1 
ATOM   3565  O  O     . VAL B  1 79  ? 19.581  58.972  46.221  1.00 52.01  ? 220 VAL B O     1 
ATOM   3566  C  CB    . VAL B  1 79  ? 19.625  59.346  48.988  1.00 45.32  ? 220 VAL B CB    1 
ATOM   3567  C  CG1   . VAL B  1 79  ? 20.807  60.276  48.909  1.00 47.30  ? 220 VAL B CG1   1 
ATOM   3568  C  CG2   . VAL B  1 79  ? 19.193  59.203  50.440  1.00 45.70  ? 220 VAL B CG2   1 
ATOM   3569  N  N     . PRO B  1 80  ? 18.242  60.758  45.864  1.00 36.87  ? 221 PRO B N     1 
ATOM   3570  C  CA    . PRO B  1 80  ? 18.457  60.767  44.412  1.00 35.00  ? 221 PRO B CA    1 
ATOM   3571  C  C     . PRO B  1 80  ? 19.861  61.191  44.002  1.00 40.24  ? 221 PRO B C     1 
ATOM   3572  O  O     . PRO B  1 80  ? 20.604  61.747  44.814  1.00 39.31  ? 221 PRO B O     1 
ATOM   3573  C  CB    . PRO B  1 80  ? 17.437  61.798  43.914  1.00 31.22  ? 221 PRO B CB    1 
ATOM   3574  C  CG    . PRO B  1 80  ? 17.110  62.643  45.100  1.00 26.71  ? 221 PRO B CG    1 
ATOM   3575  C  CD    . PRO B  1 80  ? 17.215  61.731  46.280  1.00 30.47  ? 221 PRO B CD    1 
ATOM   3576  N  N     . ARG B  1 81  ? 20.207  60.913  42.747  1.00 45.45  ? 222 ARG B N     1 
ATOM   3577  C  CA    . ARG B  1 81  ? 21.487  61.316  42.171  1.00 48.05  ? 222 ARG B CA    1 
ATOM   3578  C  C     . ARG B  1 81  ? 22.702  60.823  42.950  1.00 45.82  ? 222 ARG B C     1 
ATOM   3579  O  O     . ARG B  1 81  ? 23.625  61.592  43.226  1.00 45.82  ? 222 ARG B O     1 
ATOM   3580  C  CB    . ARG B  1 81  ? 21.554  62.835  42.014  1.00 52.54  ? 222 ARG B CB    1 
ATOM   3581  C  CG    . ARG B  1 81  ? 20.705  63.366  40.884  1.00 57.02  ? 222 ARG B CG    1 
ATOM   3582  C  CD    . ARG B  1 81  ? 21.289  64.662  40.375  1.00 65.60  ? 222 ARG B CD    1 
ATOM   3583  N  NE    . ARG B  1 81  ? 20.593  65.135  39.186  1.00 72.85  ? 222 ARG B NE    1 
ATOM   3584  C  CZ    . ARG B  1 81  ? 21.006  66.149  38.433  1.00 76.40  ? 222 ARG B CZ    1 
ATOM   3585  N  NH1   . ARG B  1 81  ? 22.119  66.795  38.745  1.00 76.82  ? 222 ARG B NH1   1 
ATOM   3586  N  NH2   . ARG B  1 81  ? 20.307  66.514  37.368  1.00 77.68  ? 222 ARG B NH2   1 
ATOM   3587  N  N     . ILE B  1 82  ? 22.714  59.538  43.284  1.00 43.64  ? 223 ILE B N     1 
ATOM   3588  C  CA    . ILE B  1 82  ? 23.854  58.971  43.992  1.00 43.98  ? 223 ILE B CA    1 
ATOM   3589  C  C     . ILE B  1 82  ? 24.639  57.957  43.167  1.00 43.51  ? 223 ILE B C     1 
ATOM   3590  O  O     . ILE B  1 82  ? 24.149  57.420  42.166  1.00 41.67  ? 223 ILE B O     1 
ATOM   3591  C  CB    . ILE B  1 82  ? 23.447  58.301  45.318  1.00 44.63  ? 223 ILE B CB    1 
ATOM   3592  C  CG1   . ILE B  1 82  ? 22.412  57.196  45.083  1.00 45.67  ? 223 ILE B CG1   1 
ATOM   3593  C  CG2   . ILE B  1 82  ? 22.940  59.336  46.298  1.00 41.81  ? 223 ILE B CG2   1 
ATOM   3594  C  CD1   . ILE B  1 82  ? 22.085  56.408  46.342  1.00 48.57  ? 223 ILE B CD1   1 
ATOM   3595  N  N     . GLU B  1 83  ? 25.869  57.709  43.605  1.00 41.51  ? 224 GLU B N     1 
ATOM   3596  C  CA    . GLU B  1 83  ? 26.687  56.636  43.065  1.00 42.80  ? 224 GLU B CA    1 
ATOM   3597  C  C     . GLU B  1 83  ? 27.218  55.771  44.206  1.00 39.64  ? 224 GLU B C     1 
ATOM   3598  O  O     . GLU B  1 83  ? 27.743  56.284  45.199  1.00 38.59  ? 224 GLU B O     1 
ATOM   3599  C  CB    . GLU B  1 83  ? 27.856  57.197  42.256  1.00 50.93  ? 224 GLU B CB    1 
ATOM   3600  C  CG    . GLU B  1 83  ? 27.491  57.736  40.881  1.00 58.11  ? 224 GLU B CG    1 
ATOM   3601  C  CD    . GLU B  1 83  ? 28.723  58.028  40.040  1.00 63.28  ? 224 GLU B CD    1 
ATOM   3602  O  OE1   . GLU B  1 83  ? 29.834  57.652  40.470  1.00 67.10  ? 224 GLU B OE1   1 
ATOM   3603  O  OE2   . GLU B  1 83  ? 28.583  58.630  38.953  1.00 61.00  ? 224 GLU B OE2   1 
ATOM   3604  N  N     . LEU B  1 84  ? 27.084  54.459  44.056  1.00 39.48  ? 225 LEU B N     1 
ATOM   3605  C  CA    . LEU B  1 84  ? 27.568  53.524  45.061  1.00 36.61  ? 225 LEU B CA    1 
ATOM   3606  C  C     . LEU B  1 84  ? 28.958  53.018  44.708  1.00 32.92  ? 225 LEU B C     1 
ATOM   3607  O  O     . LEU B  1 84  ? 29.197  52.566  43.584  1.00 34.26  ? 225 LEU B O     1 
ATOM   3608  C  CB    . LEU B  1 84  ? 26.622  52.332  45.168  1.00 36.27  ? 225 LEU B CB    1 
ATOM   3609  C  CG    . LEU B  1 84  ? 25.152  52.667  45.373  1.00 31.66  ? 225 LEU B CG    1 
ATOM   3610  C  CD1   . LEU B  1 84  ? 24.339  51.411  45.613  1.00 24.77  ? 225 LEU B CD1   1 
ATOM   3611  C  CD2   . LEU B  1 84  ? 25.013  53.618  46.534  1.00 35.78  ? 225 LEU B CD2   1 
ATOM   3612  N  N     . GLN B  1 85  ? 29.878  53.093  45.663  1.00 30.11  ? 226 GLN B N     1 
ATOM   3613  C  CA    . GLN B  1 85  ? 31.167  52.448  45.485  1.00 32.07  ? 226 GLN B CA    1 
ATOM   3614  C  C     . GLN B  1 85  ? 31.195  51.206  46.350  1.00 34.13  ? 226 GLN B C     1 
ATOM   3615  O  O     . GLN B  1 85  ? 31.248  51.313  47.566  1.00 37.15  ? 226 GLN B O     1 
ATOM   3616  C  CB    . GLN B  1 85  ? 32.313  53.372  45.888  1.00 37.48  ? 226 GLN B CB    1 
ATOM   3617  C  CG    . GLN B  1 85  ? 33.679  52.712  45.733  1.00 47.45  ? 226 GLN B CG    1 
ATOM   3618  C  CD    . GLN B  1 85  ? 34.796  53.495  46.387  1.00 55.21  ? 226 GLN B CD    1 
ATOM   3619  O  OE1   . GLN B  1 85  ? 34.736  54.719  46.490  1.00 61.50  ? 226 GLN B OE1   1 
ATOM   3620  N  NE2   . GLN B  1 85  ? 35.827  52.788  46.834  1.00 54.96  ? 226 GLN B NE2   1 
ATOM   3621  N  N     . GLU B  1 86  ? 31.160  50.032  45.731  1.00 33.29  ? 227 GLU B N     1 
ATOM   3622  C  CA    . GLU B  1 86  ? 31.147  48.789  46.489  1.00 30.16  ? 227 GLU B CA    1 
ATOM   3623  C  C     . GLU B  1 86  ? 32.332  48.722  47.439  1.00 31.30  ? 227 GLU B C     1 
ATOM   3624  O  O     . GLU B  1 86  ? 33.475  48.869  47.023  1.00 37.51  ? 227 GLU B O     1 
ATOM   3625  C  CB    . GLU B  1 86  ? 31.148  47.586  45.551  1.00 27.65  ? 227 GLU B CB    1 
ATOM   3626  C  CG    . GLU B  1 86  ? 30.921  46.259  46.260  1.00 24.32  ? 227 GLU B CG    1 
ATOM   3627  C  CD    . GLU B  1 86  ? 31.037  45.087  45.323  1.00 27.14  ? 227 GLU B CD    1 
ATOM   3628  O  OE1   . GLU B  1 86  ? 31.296  45.307  44.125  1.00 27.66  ? 227 GLU B OE1   1 
ATOM   3629  O  OE2   . GLU B  1 86  ? 30.877  43.944  45.784  1.00 33.64  ? 227 GLU B OE2   1 
ATOM   3630  N  N     . TYR B  1 87  ? 32.045  48.529  48.720  1.00 34.06  ? 228 TYR B N     1 
ATOM   3631  C  CA    . TYR B  1 87  ? 33.082  48.393  49.732  1.00 37.86  ? 228 TYR B CA    1 
ATOM   3632  C  C     . TYR B  1 87  ? 33.817  47.088  49.497  1.00 42.45  ? 228 TYR B C     1 
ATOM   3633  O  O     . TYR B  1 87  ? 33.371  46.026  49.933  1.00 43.46  ? 228 TYR B O     1 
ATOM   3634  C  CB    . TYR B  1 87  ? 32.456  48.416  51.127  1.00 38.52  ? 228 TYR B CB    1 
ATOM   3635  C  CG    . TYR B  1 87  ? 33.424  48.200  52.263  1.00 42.96  ? 228 TYR B CG    1 
ATOM   3636  C  CD1   . TYR B  1 87  ? 34.266  49.216  52.687  1.00 42.88  ? 228 TYR B CD1   1 
ATOM   3637  C  CD2   . TYR B  1 87  ? 33.477  46.983  52.929  1.00 47.92  ? 228 TYR B CD2   1 
ATOM   3638  C  CE1   . TYR B  1 87  ? 35.149  49.022  53.731  1.00 44.59  ? 228 TYR B CE1   1 
ATOM   3639  C  CE2   . TYR B  1 87  ? 34.357  46.780  53.976  1.00 49.59  ? 228 TYR B CE2   1 
ATOM   3640  C  CZ    . TYR B  1 87  ? 35.191  47.803  54.370  1.00 50.04  ? 228 TYR B CZ    1 
ATOM   3641  O  OH    . TYR B  1 87  ? 36.070  47.609  55.409  1.00 55.04  ? 228 TYR B OH    1 
ATOM   3642  N  N     . TYR B  1 88  ? 34.945  47.188  48.799  1.00 49.57  ? 229 TYR B N     1 
ATOM   3643  C  CA    . TYR B  1 88  ? 35.721  46.027  48.360  1.00 53.90  ? 229 TYR B CA    1 
ATOM   3644  C  C     . TYR B  1 88  ? 34.947  45.156  47.368  1.00 51.57  ? 229 TYR B C     1 
ATOM   3645  O  O     . TYR B  1 88  ? 34.533  45.636  46.314  1.00 49.49  ? 229 TYR B O     1 
ATOM   3646  C  CB    . TYR B  1 88  ? 36.247  45.218  49.553  1.00 56.60  ? 229 TYR B CB    1 
ATOM   3647  C  CG    . TYR B  1 88  ? 37.297  45.956  50.350  1.00 60.89  ? 229 TYR B CG    1 
ATOM   3648  C  CD1   . TYR B  1 88  ? 36.980  46.579  51.548  1.00 60.10  ? 229 TYR B CD1   1 
ATOM   3649  C  CD2   . TYR B  1 88  ? 38.607  46.042  49.895  1.00 65.09  ? 229 TYR B CD2   1 
ATOM   3650  C  CE1   . TYR B  1 88  ? 37.938  47.258  52.275  1.00 60.88  ? 229 TYR B CE1   1 
ATOM   3651  C  CE2   . TYR B  1 88  ? 39.571  46.718  50.615  1.00 64.73  ? 229 TYR B CE2   1 
ATOM   3652  C  CZ    . TYR B  1 88  ? 39.232  47.324  51.803  1.00 62.59  ? 229 TYR B CZ    1 
ATOM   3653  O  OH    . TYR B  1 88  ? 40.188  47.999  52.526  1.00 60.75  ? 229 TYR B OH    1 
ATOM   3654  N  N     . GLU B  1 89  ? 34.769  43.881  47.692  1.00 50.31  ? 230 GLU B N     1 
ATOM   3655  C  CA    . GLU B  1 89  ? 34.014  42.980  46.829  1.00 54.53  ? 230 GLU B CA    1 
ATOM   3656  C  C     . GLU B  1 89  ? 33.047  42.193  47.695  1.00 52.75  ? 230 GLU B C     1 
ATOM   3657  O  O     . GLU B  1 89  ? 32.774  41.016  47.460  1.00 53.92  ? 230 GLU B O     1 
ATOM   3658  C  CB    . GLU B  1 89  ? 34.952  42.047  46.053  1.00 59.31  ? 230 GLU B CB    1 
ATOM   3659  C  CG    . GLU B  1 89  ? 35.713  42.733  44.916  1.00 59.57  ? 230 GLU B CG    1 
ATOM   3660  C  CD    . GLU B  1 89  ? 36.809  41.864  44.326  1.00 63.02  ? 230 GLU B CD    1 
ATOM   3661  O  OE1   . GLU B  1 89  ? 37.110  42.018  43.124  1.00 65.89  ? 230 GLU B OE1   1 
ATOM   3662  O  OE2   . GLU B  1 89  ? 37.377  41.032  45.065  1.00 62.49  ? 230 GLU B OE2   1 
ATOM   3663  N  N     . THR B  1 90  ? 32.536  42.874  48.712  1.00 49.59  ? 231 THR B N     1 
ATOM   3664  C  CA    . THR B  1 90  ? 31.641  42.267  49.678  1.00 46.99  ? 231 THR B CA    1 
ATOM   3665  C  C     . THR B  1 90  ? 30.274  42.002  49.066  1.00 40.56  ? 231 THR B C     1 
ATOM   3666  O  O     . THR B  1 90  ? 29.560  41.092  49.489  1.00 36.38  ? 231 THR B O     1 
ATOM   3667  C  CB    . THR B  1 90  ? 31.482  43.172  50.910  1.00 48.14  ? 231 THR B CB    1 
ATOM   3668  O  OG1   . THR B  1 90  ? 31.091  44.487  50.491  1.00 48.17  ? 231 THR B OG1   1 
ATOM   3669  C  CG2   . THR B  1 90  ? 32.796  43.264  51.673  1.00 44.73  ? 231 THR B CG2   1 
ATOM   3670  N  N     . GLY B  1 91  ? 29.905  42.807  48.073  1.00 38.01  ? 232 GLY B N     1 
ATOM   3671  C  CA    . GLY B  1 91  ? 28.601  42.688  47.448  1.00 32.32  ? 232 GLY B CA    1 
ATOM   3672  C  C     . GLY B  1 91  ? 27.509  43.308  48.295  1.00 29.17  ? 232 GLY B C     1 
ATOM   3673  O  O     . GLY B  1 91  ? 26.514  43.803  47.772  1.00 27.05  ? 232 GLY B O     1 
ATOM   3674  N  N     . ALA B  1 92  ? 27.701  43.294  49.608  1.00 25.95  ? 233 ALA B N     1 
ATOM   3675  C  CA    . ALA B  1 92  ? 26.672  43.753  50.520  1.00 31.93  ? 233 ALA B CA    1 
ATOM   3676  C  C     . ALA B  1 92  ? 26.945  45.160  51.010  1.00 33.91  ? 233 ALA B C     1 
ATOM   3677  O  O     . ALA B  1 92  ? 26.031  45.842  51.481  1.00 35.01  ? 233 ALA B O     1 
ATOM   3678  C  CB    . ALA B  1 92  ? 26.554  42.806  51.694  1.00 35.73  ? 233 ALA B CB    1 
ATOM   3679  N  N     . PHE B  1 93  ? 28.196  45.596  50.913  1.00 33.98  ? 234 PHE B N     1 
ATOM   3680  C  CA    . PHE B  1 93  ? 28.568  46.857  51.539  1.00 32.00  ? 234 PHE B CA    1 
ATOM   3681  C  C     . PHE B  1 93  ? 29.045  47.913  50.556  1.00 29.35  ? 234 PHE B C     1 
ATOM   3682  O  O     . PHE B  1 93  ? 29.769  47.621  49.603  1.00 32.70  ? 234 PHE B O     1 
ATOM   3683  C  CB    . PHE B  1 93  ? 29.583  46.621  52.650  1.00 30.32  ? 234 PHE B CB    1 
ATOM   3684  C  CG    . PHE B  1 93  ? 29.137  45.604  53.650  1.00 30.27  ? 234 PHE B CG    1 
ATOM   3685  C  CD1   . PHE B  1 93  ? 28.190  45.924  54.607  1.00 29.96  ? 234 PHE B CD1   1 
ATOM   3686  C  CD2   . PHE B  1 93  ? 29.658  44.323  53.630  1.00 33.82  ? 234 PHE B CD2   1 
ATOM   3687  C  CE1   . PHE B  1 93  ? 27.777  44.981  55.527  1.00 33.66  ? 234 PHE B CE1   1 
ATOM   3688  C  CE2   . PHE B  1 93  ? 29.248  43.376  54.546  1.00 34.50  ? 234 PHE B CE2   1 
ATOM   3689  C  CZ    . PHE B  1 93  ? 28.309  43.704  55.494  1.00 34.62  ? 234 PHE B CZ    1 
ATOM   3690  N  N     . TYR B  1 94  ? 28.613  49.146  50.796  1.00 25.85  ? 235 TYR B N     1 
ATOM   3691  C  CA    . TYR B  1 94  ? 28.817  50.217  49.837  1.00 27.54  ? 235 TYR B CA    1 
ATOM   3692  C  C     . TYR B  1 94  ? 29.149  51.531  50.516  1.00 32.31  ? 235 TYR B C     1 
ATOM   3693  O  O     . TYR B  1 94  ? 28.864  51.730  51.701  1.00 35.78  ? 235 TYR B O     1 
ATOM   3694  C  CB    . TYR B  1 94  ? 27.581  50.373  48.934  1.00 23.31  ? 235 TYR B CB    1 
ATOM   3695  C  CG    . TYR B  1 94  ? 27.296  49.126  48.140  1.00 25.68  ? 235 TYR B CG    1 
ATOM   3696  C  CD1   . TYR B  1 94  ? 27.815  48.953  46.874  1.00 25.59  ? 235 TYR B CD1   1 
ATOM   3697  C  CD2   . TYR B  1 94  ? 26.526  48.106  48.670  1.00 31.72  ? 235 TYR B CD2   1 
ATOM   3698  C  CE1   . TYR B  1 94  ? 27.576  47.807  46.160  1.00 24.42  ? 235 TYR B CE1   1 
ATOM   3699  C  CE2   . TYR B  1 94  ? 26.287  46.957  47.961  1.00 28.58  ? 235 TYR B CE2   1 
ATOM   3700  C  CZ    . TYR B  1 94  ? 26.812  46.815  46.710  1.00 24.67  ? 235 TYR B CZ    1 
ATOM   3701  O  OH    . TYR B  1 94  ? 26.568  45.668  45.999  1.00 32.27  ? 235 TYR B OH    1 
ATOM   3702  N  N     . LEU B  1 95  ? 29.782  52.412  49.751  1.00 30.63  ? 236 LEU B N     1 
ATOM   3703  C  CA    . LEU B  1 95  ? 30.021  53.778  50.166  1.00 32.50  ? 236 LEU B CA    1 
ATOM   3704  C  C     . LEU B  1 95  ? 29.087  54.608  49.310  1.00 30.34  ? 236 LEU B C     1 
ATOM   3705  O  O     . LEU B  1 95  ? 28.868  54.279  48.142  1.00 29.52  ? 236 LEU B O     1 
ATOM   3706  C  CB    . LEU B  1 95  ? 31.477  54.170  49.924  1.00 34.84  ? 236 LEU B CB    1 
ATOM   3707  C  CG    . LEU B  1 95  ? 32.502  53.898  51.031  1.00 32.26  ? 236 LEU B CG    1 
ATOM   3708  C  CD1   . LEU B  1 95  ? 32.151  52.665  51.839  1.00 33.41  ? 236 LEU B CD1   1 
ATOM   3709  C  CD2   . LEU B  1 95  ? 33.888  53.743  50.441  1.00 28.98  ? 236 LEU B CD2   1 
ATOM   3710  N  N     . VAL B  1 96  ? 28.509  55.655  49.894  1.00 33.78  ? 237 VAL B N     1 
ATOM   3711  C  CA    . VAL B  1 96  ? 27.544  56.482  49.176  1.00 35.66  ? 237 VAL B CA    1 
ATOM   3712  C  C     . VAL B  1 96  ? 28.140  57.820  48.764  1.00 41.90  ? 237 VAL B C     1 
ATOM   3713  O  O     . VAL B  1 96  ? 28.555  58.615  49.613  1.00 42.79  ? 237 VAL B O     1 
ATOM   3714  C  CB    . VAL B  1 96  ? 26.271  56.728  50.004  1.00 29.72  ? 237 VAL B CB    1 
ATOM   3715  C  CG1   . VAL B  1 96  ? 25.438  57.844  49.396  1.00 26.20  ? 237 VAL B CG1   1 
ATOM   3716  C  CG2   . VAL B  1 96  ? 25.454  55.455  50.093  1.00 31.49  ? 237 VAL B CG2   1 
ATOM   3717  N  N     . LYS B  1 97  ? 28.178  58.059  47.456  1.00 43.22  ? 238 LYS B N     1 
ATOM   3718  C  CA    . LYS B  1 97  ? 28.616  59.345  46.933  1.00 45.48  ? 238 LYS B CA    1 
ATOM   3719  C  C     . LYS B  1 97  ? 27.469  60.048  46.235  1.00 44.75  ? 238 LYS B C     1 
ATOM   3720  O  O     . LYS B  1 97  ? 26.468  59.423  45.883  1.00 39.30  ? 238 LYS B O     1 
ATOM   3721  C  CB    . LYS B  1 97  ? 29.777  59.171  45.959  1.00 49.28  ? 238 LYS B CB    1 
ATOM   3722  C  CG    . LYS B  1 97  ? 31.069  58.730  46.613  1.00 51.97  ? 238 LYS B CG    1 
ATOM   3723  C  CD    . LYS B  1 97  ? 32.121  58.454  45.564  1.00 54.14  ? 238 LYS B CD    1 
ATOM   3724  C  CE    . LYS B  1 97  ? 33.441  58.066  46.198  1.00 56.09  ? 238 LYS B CE    1 
ATOM   3725  N  NZ    . LYS B  1 97  ? 34.427  57.671  45.153  1.00 56.42  ? 238 LYS B NZ    1 
ATOM   3726  N  N     . PHE B  1 98  ? 27.625  61.351  46.034  1.00 52.98  ? 239 PHE B N     1 
ATOM   3727  C  CA    . PHE B  1 98  ? 26.630  62.130  45.317  1.00 59.90  ? 239 PHE B CA    1 
ATOM   3728  C  C     . PHE B  1 98  ? 27.171  62.561  43.960  1.00 70.68  ? 239 PHE B C     1 
ATOM   3729  O  O     . PHE B  1 98  ? 28.356  62.880  43.832  1.00 74.33  ? 239 PHE B O     1 
ATOM   3730  C  CB    . PHE B  1 98  ? 26.221  63.348  46.141  1.00 58.02  ? 239 PHE B CB    1 
ATOM   3731  C  CG    . PHE B  1 98  ? 25.393  63.011  47.344  1.00 53.65  ? 239 PHE B CG    1 
ATOM   3732  C  CD1   . PHE B  1 98  ? 24.014  62.917  47.242  1.00 52.09  ? 239 PHE B CD1   1 
ATOM   3733  C  CD2   . PHE B  1 98  ? 25.990  62.784  48.577  1.00 52.65  ? 239 PHE B CD2   1 
ATOM   3734  C  CE1   . PHE B  1 98  ? 23.242  62.607  48.347  1.00 51.31  ? 239 PHE B CE1   1 
ATOM   3735  C  CE2   . PHE B  1 98  ? 25.222  62.472  49.688  1.00 50.04  ? 239 PHE B CE2   1 
ATOM   3736  C  CZ    . PHE B  1 98  ? 23.848  62.386  49.571  1.00 50.31  ? 239 PHE B CZ    1 
ATOM   3737  N  N     . LYS B  1 99  ? 26.301  62.568  42.953  1.00 78.96  ? 240 LYS B N     1 
ATOM   3738  C  CA    . LYS B  1 99  ? 26.692  62.943  41.596  1.00 85.86  ? 240 LYS B CA    1 
ATOM   3739  C  C     . LYS B  1 99  ? 26.919  64.442  41.491  1.00 90.68  ? 240 LYS B C     1 
ATOM   3740  O  O     . LYS B  1 99  ? 27.561  65.046  42.350  1.00 88.38  ? 240 LYS B O     1 
ATOM   3741  C  CB    . LYS B  1 99  ? 25.621  62.516  40.593  1.00 86.89  ? 240 LYS B CB    1 
ATOM   3742  C  CG    . LYS B  1 99  ? 25.401  61.017  40.522  1.00 87.71  ? 240 LYS B CG    1 
ATOM   3743  C  CD    . LYS B  1 99  ? 24.523  60.649  39.344  1.00 88.85  ? 240 LYS B CD    1 
ATOM   3744  C  CE    . LYS B  1 99  ? 24.502  59.148  39.132  1.00 89.86  ? 240 LYS B CE    1 
ATOM   3745  N  NZ    . LYS B  1 99  ? 23.859  58.787  37.839  1.00 91.02  ? 240 LYS B NZ    1 
ATOM   3746  N  N     . ARG B  1 100 ? 26.402  65.044  40.426  1.00 98.10  ? 241 ARG B N     1 
ATOM   3747  C  CA    . ARG B  1 100 ? 26.436  66.490  40.320  1.00 104.15 ? 241 ARG B CA    1 
ATOM   3748  C  C     . ARG B  1 100 ? 25.646  67.055  41.484  1.00 109.44 ? 241 ARG B C     1 
ATOM   3749  O  O     . ARG B  1 100 ? 24.450  67.308  41.348  1.00 108.91 ? 241 ARG B O     1 
ATOM   3750  C  CB    . ARG B  1 100 ? 25.814  66.953  39.008  1.00 103.71 ? 241 ARG B CB    1 
ATOM   3751  C  CG    . ARG B  1 100 ? 26.479  66.376  37.780  1.00 103.38 ? 241 ARG B CG    1 
ATOM   3752  C  CD    . ARG B  1 100 ? 26.164  67.221  36.569  1.00 103.26 ? 241 ARG B CD    1 
ATOM   3753  N  NE    . ARG B  1 100 ? 26.698  66.642  35.343  1.00 103.13 ? 241 ARG B NE    1 
ATOM   3754  C  CZ    . ARG B  1 100 ? 26.816  67.309  34.201  1.00 103.10 ? 241 ARG B CZ    1 
ATOM   3755  N  NH1   . ARG B  1 100 ? 26.446  68.581  34.135  1.00 102.79 ? 241 ARG B NH1   1 
ATOM   3756  N  NH2   . ARG B  1 100 ? 27.309  66.710  33.127  1.00 103.01 ? 241 ARG B NH2   1 
ATOM   3757  N  N     . ILE B  1 101 ? 26.322  67.208  42.626  1.00 114.35 ? 242 ILE B N     1 
ATOM   3758  C  CA    . ILE B  1 101 ? 25.733  67.776  43.837  1.00 118.24 ? 242 ILE B CA    1 
ATOM   3759  C  C     . ILE B  1 101 ? 24.965  69.042  43.471  1.00 121.71 ? 242 ILE B C     1 
ATOM   3760  O  O     . ILE B  1 101 ? 25.557  70.098  43.242  1.00 122.52 ? 242 ILE B O     1 
ATOM   3761  C  CB    . ILE B  1 101 ? 26.811  68.016  44.942  1.00 103.26 ? 242 ILE B CB    1 
ATOM   3762  C  CG1   . ILE B  1 101 ? 26.294  68.946  46.044  1.00 103.02 ? 242 ILE B CG1   1 
ATOM   3763  C  CG2   . ILE B  1 101 ? 28.106  68.545  44.340  1.00 103.39 ? 242 ILE B CG2   1 
ATOM   3764  C  CD1   . ILE B  1 101 ? 27.300  69.185  47.156  1.00 102.48 ? 242 ILE B CD1   1 
ATOM   3765  N  N     . PRO B  1 102 ? 23.631  68.917  43.388  1.00 123.45 ? 243 PRO B N     1 
ATOM   3766  C  CA    . PRO B  1 102 ? 22.787  69.898  42.699  1.00 124.87 ? 243 PRO B CA    1 
ATOM   3767  C  C     . PRO B  1 102 ? 22.754  71.261  43.378  1.00 125.85 ? 243 PRO B C     1 
ATOM   3768  O  O     . PRO B  1 102 ? 22.999  72.277  42.725  1.00 126.06 ? 243 PRO B O     1 
ATOM   3769  C  CB    . PRO B  1 102 ? 21.399  69.247  42.726  1.00 124.19 ? 243 PRO B CB    1 
ATOM   3770  C  CG    . PRO B  1 102 ? 21.429  68.329  43.895  1.00 123.10 ? 243 PRO B CG    1 
ATOM   3771  C  CD    . PRO B  1 102 ? 22.839  67.832  43.999  1.00 123.13 ? 243 PRO B CD    1 
ATOM   3772  N  N     . ARG B  1 103 ? 22.457  71.277  44.672  1.00 125.27 ? 244 ARG B N     1 
ATOM   3773  C  CA    . ARG B  1 103 ? 22.336  72.523  45.410  1.00 123.89 ? 244 ARG B CA    1 
ATOM   3774  C  C     . ARG B  1 103 ? 23.134  72.460  46.702  1.00 120.16 ? 244 ARG B C     1 
ATOM   3775  O  O     . ARG B  1 103 ? 24.332  72.172  46.699  1.00 118.84 ? 244 ARG B O     1 
ATOM   3776  C  CB    . ARG B  1 103 ? 20.867  72.800  45.730  1.00 125.19 ? 244 ARG B CB    1 
ATOM   3777  C  CG    . ARG B  1 103 ? 19.983  72.942  44.507  1.00 127.00 ? 244 ARG B CG    1 
ATOM   3778  C  CD    . ARG B  1 103 ? 18.519  72.769  44.862  1.00 129.23 ? 244 ARG B CD    1 
ATOM   3779  N  NE    . ARG B  1 103 ? 17.665  72.892  43.685  1.00 132.32 ? 244 ARG B NE    1 
ATOM   3780  C  CZ    . ARG B  1 103 ? 16.368  72.599  43.665  1.00 134.95 ? 244 ARG B CZ    1 
ATOM   3781  N  NH1   . ARG B  1 103 ? 15.766  72.157  44.761  1.00 135.63 ? 244 ARG B NH1   1 
ATOM   3782  N  NH2   . ARG B  1 103 ? 15.673  72.745  42.546  1.00 135.88 ? 244 ARG B NH2   1 
ATOM   3783  N  N     . GLY B  1 104 ? 22.450  72.735  47.806  1.00 117.81 ? 245 GLY B N     1 
ATOM   3784  C  CA    . GLY B  1 104 ? 23.054  72.663  49.119  1.00 114.27 ? 245 GLY B CA    1 
ATOM   3785  C  C     . GLY B  1 104 ? 23.019  71.255  49.673  1.00 110.45 ? 245 GLY B C     1 
ATOM   3786  O  O     . GLY B  1 104 ? 23.939  70.859  50.379  1.00 111.57 ? 245 GLY B O     1 
ATOM   3787  N  N     . ASN B  1 105 ? 21.962  70.510  49.344  1.00 104.62 ? 246 ASN B N     1 
ATOM   3788  C  CA    . ASN B  1 105 ? 21.741  69.141  49.834  1.00 97.22  ? 246 ASN B CA    1 
ATOM   3789  C  C     . ASN B  1 105 ? 21.518  69.079  51.347  1.00 90.77  ? 246 ASN B C     1 
ATOM   3790  O  O     . ASN B  1 105 ? 22.414  69.407  52.123  1.00 93.31  ? 246 ASN B O     1 
ATOM   3791  C  CB    . ASN B  1 105 ? 22.887  68.209  49.410  1.00 96.41  ? 246 ASN B CB    1 
ATOM   3792  C  CG    . ASN B  1 105 ? 22.559  66.739  49.614  1.00 95.01  ? 246 ASN B CG    1 
ATOM   3793  O  OD1   . ASN B  1 105 ? 21.404  66.367  49.820  1.00 95.22  ? 246 ASN B OD1   1 
ATOM   3794  N  ND2   . ASN B  1 105 ? 23.580  65.894  49.541  1.00 93.60  ? 246 ASN B ND2   1 
ATOM   3795  N  N     . PRO B  1 106 ? 20.315  68.654  51.774  1.00 81.47  ? 247 PRO B N     1 
ATOM   3796  C  CA    . PRO B  1 106 ? 19.996  68.621  53.206  1.00 74.62  ? 247 PRO B CA    1 
ATOM   3797  C  C     . PRO B  1 106 ? 20.865  67.630  53.975  1.00 68.30  ? 247 PRO B C     1 
ATOM   3798  O  O     . PRO B  1 106 ? 20.873  67.659  55.204  1.00 69.21  ? 247 PRO B O     1 
ATOM   3799  C  CB    . PRO B  1 106 ? 18.533  68.163  53.231  1.00 74.49  ? 247 PRO B CB    1 
ATOM   3800  C  CG    . PRO B  1 106 ? 18.004  68.461  51.871  1.00 75.95  ? 247 PRO B CG    1 
ATOM   3801  C  CD    . PRO B  1 106 ? 19.162  68.261  50.945  1.00 78.61  ? 247 PRO B CD    1 
ATOM   3802  N  N     . LEU B  1 107 ? 21.582  66.768  53.260  1.00 61.86  ? 248 LEU B N     1 
ATOM   3803  C  CA    . LEU B  1 107 ? 22.472  65.802  53.895  1.00 54.49  ? 248 LEU B CA    1 
ATOM   3804  C  C     . LEU B  1 107 ? 23.935  66.241  53.800  1.00 55.52  ? 248 LEU B C     1 
ATOM   3805  O  O     . LEU B  1 107 ? 24.842  65.421  53.941  1.00 54.66  ? 248 LEU B O     1 
ATOM   3806  C  CB    . LEU B  1 107 ? 22.291  64.419  53.265  1.00 46.40  ? 248 LEU B CB    1 
ATOM   3807  C  CG    . LEU B  1 107 ? 20.839  63.955  53.142  1.00 41.74  ? 248 LEU B CG    1 
ATOM   3808  C  CD1   . LEU B  1 107 ? 20.745  62.560  52.549  1.00 39.51  ? 248 LEU B CD1   1 
ATOM   3809  C  CD2   . LEU B  1 107 ? 20.148  64.003  54.487  1.00 43.12  ? 248 LEU B CD2   1 
ATOM   3810  N  N     . SER B  1 108 ? 24.156  67.535  53.578  1.00 57.64  ? 249 SER B N     1 
ATOM   3811  C  CA    . SER B  1 108 ? 25.502  68.071  53.410  1.00 58.02  ? 249 SER B CA    1 
ATOM   3812  C  C     . SER B  1 108 ? 26.279  68.014  54.705  1.00 59.61  ? 249 SER B C     1 
ATOM   3813  O  O     . SER B  1 108 ? 27.499  67.856  54.703  1.00 62.10  ? 249 SER B O     1 
ATOM   3814  C  CB    . SER B  1 108 ? 25.434  69.513  52.931  1.00 58.05  ? 249 SER B CB    1 
ATOM   3815  O  OG    . SER B  1 108 ? 24.627  69.601  51.779  1.00 58.39  ? 249 SER B OG    1 
ATOM   3816  N  N     . HIS B  1 109 ? 25.560  68.145  55.812  1.00 63.79  ? 250 HIS B N     1 
ATOM   3817  C  CA    . HIS B  1 109 ? 26.167  68.120  57.132  1.00 70.36  ? 250 HIS B CA    1 
ATOM   3818  C  C     . HIS B  1 109 ? 26.461  66.680  57.548  1.00 68.17  ? 250 HIS B C     1 
ATOM   3819  O  O     . HIS B  1 109 ? 27.092  66.433  58.577  1.00 68.41  ? 250 HIS B O     1 
ATOM   3820  C  CB    . HIS B  1 109 ? 25.237  68.806  58.133  1.00 75.95  ? 250 HIS B CB    1 
ATOM   3821  C  CG    . HIS B  1 109 ? 24.440  69.925  57.536  1.00 82.41  ? 250 HIS B CG    1 
ATOM   3822  N  ND1   . HIS B  1 109 ? 23.251  69.719  56.870  1.00 85.41  ? 250 HIS B ND1   1 
ATOM   3823  C  CD2   . HIS B  1 109 ? 24.672  71.259  57.488  1.00 84.53  ? 250 HIS B CD2   1 
ATOM   3824  C  CE1   . HIS B  1 109 ? 22.779  70.877  56.446  1.00 85.69  ? 250 HIS B CE1   1 
ATOM   3825  N  NE2   . HIS B  1 109 ? 23.622  71.828  56.807  1.00 85.38  ? 250 HIS B NE2   1 
ATOM   3826  N  N     . PHE B  1 110 ? 26.001  65.739  56.727  1.00 64.52  ? 251 PHE B N     1 
ATOM   3827  C  CA    . PHE B  1 110 ? 26.229  64.321  56.945  1.00 58.62  ? 251 PHE B CA    1 
ATOM   3828  C  C     . PHE B  1 110 ? 27.306  63.810  55.991  1.00 59.25  ? 251 PHE B C     1 
ATOM   3829  O  O     . PHE B  1 110 ? 27.515  62.601  55.859  1.00 62.00  ? 251 PHE B O     1 
ATOM   3830  C  CB    . PHE B  1 110 ? 24.926  63.554  56.739  1.00 52.03  ? 251 PHE B CB    1 
ATOM   3831  C  CG    . PHE B  1 110 ? 23.822  63.986  57.657  1.00 46.03  ? 251 PHE B CG    1 
ATOM   3832  C  CD1   . PHE B  1 110 ? 24.084  64.280  58.986  1.00 42.65  ? 251 PHE B CD1   1 
ATOM   3833  C  CD2   . PHE B  1 110 ? 22.523  64.108  57.193  1.00 46.18  ? 251 PHE B CD2   1 
ATOM   3834  C  CE1   . PHE B  1 110 ? 23.067  64.680  59.840  1.00 39.25  ? 251 PHE B CE1   1 
ATOM   3835  C  CE2   . PHE B  1 110 ? 21.500  64.504  58.039  1.00 42.73  ? 251 PHE B CE2   1 
ATOM   3836  C  CZ    . PHE B  1 110 ? 21.772  64.792  59.363  1.00 38.21  ? 251 PHE B CZ    1 
ATOM   3837  N  N     . LEU B  1 111 ? 27.991  64.743  55.337  1.00 57.24  ? 252 LEU B N     1 
ATOM   3838  C  CA    . LEU B  1 111 ? 29.040  64.404  54.384  1.00 57.06  ? 252 LEU B CA    1 
ATOM   3839  C  C     . LEU B  1 111 ? 30.433  64.479  55.012  1.00 57.91  ? 252 LEU B C     1 
ATOM   3840  O  O     . LEU B  1 111 ? 30.729  65.387  55.795  1.00 59.47  ? 252 LEU B O     1 
ATOM   3841  C  CB    . LEU B  1 111 ? 28.966  65.322  53.162  1.00 56.12  ? 252 LEU B CB    1 
ATOM   3842  C  CG    . LEU B  1 111 ? 27.808  65.091  52.192  1.00 56.87  ? 252 LEU B CG    1 
ATOM   3843  C  CD1   . LEU B  1 111 ? 27.701  66.216  51.173  1.00 57.98  ? 252 LEU B CD1   1 
ATOM   3844  C  CD2   . LEU B  1 111 ? 27.982  63.762  51.484  1.00 57.48  ? 252 LEU B CD2   1 
ATOM   3845  N  N     . GLU B  1 112 ? 31.273  63.503  54.677  1.00 55.09  ? 253 GLU B N     1 
ATOM   3846  C  CA    . GLU B  1 112 ? 32.687  63.529  55.032  1.00 53.35  ? 253 GLU B CA    1 
ATOM   3847  C  C     . GLU B  1 112 ? 33.484  63.587  53.734  1.00 56.40  ? 253 GLU B C     1 
ATOM   3848  O  O     . GLU B  1 112 ? 34.335  62.732  53.468  1.00 58.76  ? 253 GLU B O     1 
ATOM   3849  C  CB    . GLU B  1 112 ? 33.073  62.294  55.855  1.00 49.22  ? 253 GLU B CB    1 
ATOM   3850  C  CG    . GLU B  1 112 ? 32.424  62.230  57.239  1.00 50.19  ? 253 GLU B CG    1 
ATOM   3851  C  CD    . GLU B  1 112 ? 33.393  61.792  58.332  1.00 54.06  ? 253 GLU B CD    1 
ATOM   3852  O  OE1   . GLU B  1 112 ? 34.621  61.870  58.119  1.00 54.91  ? 253 GLU B OE1   1 
ATOM   3853  O  OE2   . GLU B  1 112 ? 32.925  61.374  59.411  1.00 54.92  ? 253 GLU B OE2   1 
ATOM   3854  N  N     . GLY B  1 113 ? 33.188  64.604  52.927  1.00 56.09  ? 254 GLY B N     1 
ATOM   3855  C  CA    . GLY B  1 113 ? 33.766  64.743  51.602  1.00 53.29  ? 254 GLY B CA    1 
ATOM   3856  C  C     . GLY B  1 113 ? 32.663  64.778  50.566  1.00 52.42  ? 254 GLY B C     1 
ATOM   3857  O  O     . GLY B  1 113 ? 31.796  65.656  50.600  1.00 51.36  ? 254 GLY B O     1 
ATOM   3858  N  N     . GLU B  1 114 ? 32.706  63.833  49.632  1.00 56.40  ? 255 GLU B N     1 
ATOM   3859  C  CA    . GLU B  1 114 ? 31.587  63.593  48.731  1.00 56.49  ? 255 GLU B CA    1 
ATOM   3860  C  C     . GLU B  1 114 ? 30.917  62.305  49.164  1.00 50.90  ? 255 GLU B C     1 
ATOM   3861  O  O     . GLU B  1 114 ? 30.067  61.765  48.459  1.00 53.22  ? 255 GLU B O     1 
ATOM   3862  C  CB    . GLU B  1 114 ? 32.062  63.449  47.291  1.00 58.65  ? 255 GLU B CB    1 
ATOM   3863  C  CG    . GLU B  1 114 ? 32.609  64.717  46.677  1.00 64.95  ? 255 GLU B CG    1 
ATOM   3864  C  CD    . GLU B  1 114 ? 33.019  64.515  45.230  1.00 69.59  ? 255 GLU B CD    1 
ATOM   3865  O  OE1   . GLU B  1 114 ? 33.142  63.345  44.804  1.00 69.94  ? 255 GLU B OE1   1 
ATOM   3866  O  OE2   . GLU B  1 114 ? 33.214  65.525  44.522  1.00 70.66  ? 255 GLU B OE2   1 
ATOM   3867  N  N     . VAL B  1 115 ? 31.316  61.823  50.337  1.00 46.89  ? 256 VAL B N     1 
ATOM   3868  C  CA    . VAL B  1 115 ? 30.871  60.534  50.850  1.00 45.05  ? 256 VAL B CA    1 
ATOM   3869  C  C     . VAL B  1 115 ? 29.933  60.705  52.042  1.00 44.24  ? 256 VAL B C     1 
ATOM   3870  O  O     . VAL B  1 115 ? 30.320  61.280  53.060  1.00 47.01  ? 256 VAL B O     1 
ATOM   3871  C  CB    . VAL B  1 115 ? 32.078  59.688  51.271  1.00 45.78  ? 256 VAL B CB    1 
ATOM   3872  C  CG1   . VAL B  1 115 ? 31.629  58.413  51.946  1.00 46.41  ? 256 VAL B CG1   1 
ATOM   3873  C  CG2   . VAL B  1 115 ? 32.932  59.371  50.063  1.00 49.56  ? 256 VAL B CG2   1 
ATOM   3874  N  N     . LEU B  1 116 ? 28.706  60.204  51.913  1.00 38.96  ? 257 LEU B N     1 
ATOM   3875  C  CA    . LEU B  1 116 ? 27.707  60.317  52.979  1.00 35.06  ? 257 LEU B CA    1 
ATOM   3876  C  C     . LEU B  1 116 ? 28.060  59.470  54.194  1.00 34.70  ? 257 LEU B C     1 
ATOM   3877  O  O     . LEU B  1 116 ? 28.215  58.254  54.083  1.00 36.80  ? 257 LEU B O     1 
ATOM   3878  C  CB    . LEU B  1 116 ? 26.324  59.911  52.463  1.00 32.54  ? 257 LEU B CB    1 
ATOM   3879  C  CG    . LEU B  1 116 ? 25.146  60.081  53.424  1.00 26.95  ? 257 LEU B CG    1 
ATOM   3880  C  CD1   . LEU B  1 116 ? 24.886  61.546  53.658  1.00 23.28  ? 257 LEU B CD1   1 
ATOM   3881  C  CD2   . LEU B  1 116 ? 23.895  59.395  52.906  1.00 20.33  ? 257 LEU B CD2   1 
ATOM   3882  N  N     . SER B  1 117 ? 28.171  60.115  55.354  1.00 34.44  ? 258 SER B N     1 
ATOM   3883  C  CA    . SER B  1 117 ? 28.485  59.419  56.600  1.00 33.70  ? 258 SER B CA    1 
ATOM   3884  C  C     . SER B  1 117 ? 27.245  58.838  57.266  1.00 32.62  ? 258 SER B C     1 
ATOM   3885  O  O     . SER B  1 117 ? 26.301  59.558  57.574  1.00 36.20  ? 258 SER B O     1 
ATOM   3886  C  CB    . SER B  1 117 ? 29.179  60.361  57.575  1.00 38.99  ? 258 SER B CB    1 
ATOM   3887  O  OG    . SER B  1 117 ? 29.473  59.703  58.797  1.00 42.27  ? 258 SER B OG    1 
ATOM   3888  N  N     . ALA B  1 118 ? 27.265  57.531  57.501  1.00 31.24  ? 259 ALA B N     1 
ATOM   3889  C  CA    . ALA B  1 118 ? 26.148  56.839  58.129  1.00 33.23  ? 259 ALA B CA    1 
ATOM   3890  C  C     . ALA B  1 118 ? 26.055  57.171  59.613  1.00 33.36  ? 259 ALA B C     1 
ATOM   3891  O  O     . ALA B  1 118 ? 24.964  57.222  60.177  1.00 34.59  ? 259 ALA B O     1 
ATOM   3892  C  CB    . ALA B  1 118 ? 26.288  55.337  57.925  1.00 36.38  ? 259 ALA B CB    1 
ATOM   3893  N  N     . THR B  1 119 ? 27.210  57.393  60.231  1.00 35.86  ? 260 THR B N     1 
ATOM   3894  C  CA    . THR B  1 119 ? 27.296  57.678  61.661  1.00 35.79  ? 260 THR B CA    1 
ATOM   3895  C  C     . THR B  1 119 ? 26.705  59.043  62.037  1.00 33.82  ? 260 THR B C     1 
ATOM   3896  O  O     . THR B  1 119 ? 26.012  59.169  63.055  1.00 36.18  ? 260 THR B O     1 
ATOM   3897  C  CB    . THR B  1 119 ? 28.751  57.577  62.154  1.00 37.26  ? 260 THR B CB    1 
ATOM   3898  O  OG1   . THR B  1 119 ? 29.186  56.213  62.083  1.00 39.78  ? 260 THR B OG1   1 
ATOM   3899  C  CG2   . THR B  1 119 ? 28.872  58.054  63.584  1.00 38.48  ? 260 THR B CG2   1 
ATOM   3900  N  N     . LYS B  1 120 ? 26.976  60.060  61.222  1.00 29.99  ? 261 LYS B N     1 
ATOM   3901  C  CA    . LYS B  1 120 ? 26.444  61.398  61.474  1.00 32.43  ? 261 LYS B CA    1 
ATOM   3902  C  C     . LYS B  1 120 ? 24.933  61.433  61.279  1.00 36.15  ? 261 LYS B C     1 
ATOM   3903  O  O     . LYS B  1 120 ? 24.192  61.966  62.115  1.00 37.64  ? 261 LYS B O     1 
ATOM   3904  C  CB    . LYS B  1 120 ? 27.084  62.413  60.532  1.00 33.29  ? 261 LYS B CB    1 
ATOM   3905  C  CG    . LYS B  1 120 ? 28.593  62.545  60.638  1.00 31.98  ? 261 LYS B CG    1 
ATOM   3906  C  CD    . LYS B  1 120 ? 29.026  63.827  59.950  1.00 32.98  ? 261 LYS B CD    1 
ATOM   3907  C  CE    . LYS B  1 120 ? 30.526  63.907  59.816  1.00 35.05  ? 261 LYS B CE    1 
ATOM   3908  N  NZ    . LYS B  1 120 ? 30.915  65.047  58.943  1.00 38.16  ? 261 LYS B NZ    1 
ATOM   3909  N  N     . MET B  1 121 ? 24.494  60.884  60.152  1.00 36.88  ? 262 MET B N     1 
ATOM   3910  C  CA    . MET B  1 121 ? 23.080  60.763  59.842  1.00 38.36  ? 262 MET B CA    1 
ATOM   3911  C  C     . MET B  1 121 ? 22.363  60.056  60.985  1.00 39.76  ? 262 MET B C     1 
ATOM   3912  O  O     . MET B  1 121 ? 21.340  60.534  61.495  1.00 43.73  ? 262 MET B O     1 
ATOM   3913  C  CB    . MET B  1 121 ? 22.912  59.965  58.551  1.00 36.44  ? 262 MET B CB    1 
ATOM   3914  C  CG    . MET B  1 121 ? 22.166  60.699  57.456  1.00 36.49  ? 262 MET B CG    1 
ATOM   3915  S  SD    . MET B  1 121 ? 21.835  59.618  56.056  1.00 54.78  ? 262 MET B SD    1 
ATOM   3916  C  CE    . MET B  1 121 ? 20.116  60.019  55.731  1.00 31.87  ? 262 MET B CE    1 
ATOM   3917  N  N     . LEU B  1 122 ? 22.925  58.923  61.397  1.00 36.80  ? 263 LEU B N     1 
ATOM   3918  C  CA    . LEU B  1 122 ? 22.354  58.120  62.474  1.00 35.81  ? 263 LEU B CA    1 
ATOM   3919  C  C     . LEU B  1 122 ? 22.302  58.904  63.789  1.00 39.36  ? 263 LEU B C     1 
ATOM   3920  O  O     . LEU B  1 122 ? 21.339  58.784  64.549  1.00 43.90  ? 263 LEU B O     1 
ATOM   3921  C  CB    . LEU B  1 122 ? 23.140  56.812  62.630  1.00 31.33  ? 263 LEU B CB    1 
ATOM   3922  C  CG    . LEU B  1 122 ? 22.421  55.606  63.226  1.00 34.43  ? 263 LEU B CG    1 
ATOM   3923  C  CD1   . LEU B  1 122 ? 21.024  55.482  62.656  1.00 31.15  ? 263 LEU B CD1   1 
ATOM   3924  C  CD2   . LEU B  1 122 ? 23.202  54.330  62.969  1.00 35.84  ? 263 LEU B CD2   1 
ATOM   3925  N  N     . SER B  1 123 ? 23.321  59.725  64.036  1.00 40.76  ? 264 SER B N     1 
ATOM   3926  C  CA    . SER B  1 123 ? 23.383  60.548  65.246  1.00 41.46  ? 264 SER B CA    1 
ATOM   3927  C  C     . SER B  1 123 ? 22.313  61.644  65.296  1.00 40.91  ? 264 SER B C     1 
ATOM   3928  O  O     . SER B  1 123 ? 21.686  61.866  66.342  1.00 41.52  ? 264 SER B O     1 
ATOM   3929  C  CB    . SER B  1 123 ? 24.772  61.166  65.391  1.00 45.47  ? 264 SER B CB    1 
ATOM   3930  O  OG    . SER B  1 123 ? 25.780  60.176  65.283  1.00 52.41  ? 264 SER B OG    1 
ATOM   3931  N  N     . LYS B  1 124 ? 22.109  62.332  64.175  1.00 39.89  ? 265 LYS B N     1 
ATOM   3932  C  CA    . LYS B  1 124 ? 21.076  63.365  64.109  1.00 39.29  ? 265 LYS B CA    1 
ATOM   3933  C  C     . LYS B  1 124 ? 19.679  62.747  64.227  1.00 36.66  ? 265 LYS B C     1 
ATOM   3934  O  O     . LYS B  1 124 ? 18.817  63.254  64.957  1.00 38.12  ? 265 LYS B O     1 
ATOM   3935  C  CB    . LYS B  1 124 ? 21.211  64.174  62.818  1.00 37.99  ? 265 LYS B CB    1 
ATOM   3936  C  CG    . LYS B  1 124 ? 20.262  65.353  62.718  1.00 38.62  ? 265 LYS B CG    1 
ATOM   3937  C  CD    . LYS B  1 124 ? 20.341  66.226  63.960  1.00 39.45  ? 265 LYS B CD    1 
ATOM   3938  C  CE    . LYS B  1 124 ? 19.622  67.552  63.754  1.00 44.03  ? 265 LYS B CE    1 
ATOM   3939  N  NZ    . LYS B  1 124 ? 20.065  68.255  62.515  1.00 47.13  ? 265 LYS B NZ    1 
ATOM   3940  N  N     . PHE B  1 125 ? 19.483  61.641  63.515  1.00 31.49  ? 266 PHE B N     1 
ATOM   3941  C  CA    . PHE B  1 125 ? 18.263  60.845  63.584  1.00 28.79  ? 266 PHE B CA    1 
ATOM   3942  C  C     . PHE B  1 125 ? 17.932  60.510  65.038  1.00 35.88  ? 266 PHE B C     1 
ATOM   3943  O  O     . PHE B  1 125 ? 16.808  60.741  65.524  1.00 39.17  ? 266 PHE B O     1 
ATOM   3944  C  CB    . PHE B  1 125 ? 18.505  59.560  62.795  1.00 26.50  ? 266 PHE B CB    1 
ATOM   3945  C  CG    . PHE B  1 125 ? 17.259  58.819  62.415  1.00 27.63  ? 266 PHE B CG    1 
ATOM   3946  C  CD1   . PHE B  1 125 ? 16.352  59.367  61.519  1.00 24.13  ? 266 PHE B CD1   1 
ATOM   3947  C  CD2   . PHE B  1 125 ? 17.014  57.548  62.921  1.00 27.86  ? 266 PHE B CD2   1 
ATOM   3948  C  CE1   . PHE B  1 125 ? 15.203  58.675  61.163  1.00 24.59  ? 266 PHE B CE1   1 
ATOM   3949  C  CE2   . PHE B  1 125 ? 15.870  56.852  62.565  1.00 27.11  ? 266 PHE B CE2   1 
ATOM   3950  C  CZ    . PHE B  1 125 ? 14.966  57.417  61.684  1.00 26.18  ? 266 PHE B CZ    1 
ATOM   3951  N  N     . ARG B  1 126 ? 18.936  59.976  65.726  1.00 38.54  ? 267 ARG B N     1 
ATOM   3952  C  CA    . ARG B  1 126 ? 18.816  59.582  67.123  1.00 36.61  ? 267 ARG B CA    1 
ATOM   3953  C  C     . ARG B  1 126 ? 18.436  60.771  67.999  1.00 41.45  ? 267 ARG B C     1 
ATOM   3954  O  O     . ARG B  1 126 ? 17.547  60.669  68.847  1.00 45.47  ? 267 ARG B O     1 
ATOM   3955  C  CB    . ARG B  1 126 ? 20.132  58.961  67.598  1.00 37.59  ? 267 ARG B CB    1 
ATOM   3956  C  CG    . ARG B  1 126 ? 20.055  58.304  68.962  1.00 40.63  ? 267 ARG B CG    1 
ATOM   3957  C  CD    . ARG B  1 126 ? 21.215  57.343  69.211  1.00 40.09  ? 267 ARG B CD    1 
ATOM   3958  N  NE    . ARG B  1 126 ? 20.870  56.379  70.253  1.00 42.84  ? 267 ARG B NE    1 
ATOM   3959  C  CZ    . ARG B  1 126 ? 20.599  55.100  70.022  1.00 42.54  ? 267 ARG B CZ    1 
ATOM   3960  N  NH1   . ARG B  1 126 ? 20.656  54.625  68.789  1.00 45.69  ? 267 ARG B NH1   1 
ATOM   3961  N  NH2   . ARG B  1 126 ? 20.284  54.292  71.021  1.00 43.49  ? 267 ARG B NH2   1 
ATOM   3962  N  N     . LYS B  1 127 ? 19.106  61.899  67.779  1.00 43.40  ? 268 LYS B N     1 
ATOM   3963  C  CA    . LYS B  1 127 ? 18.846  63.122  68.539  1.00 44.05  ? 268 LYS B CA    1 
ATOM   3964  C  C     . LYS B  1 127 ? 17.393  63.602  68.405  1.00 45.87  ? 268 LYS B C     1 
ATOM   3965  O  O     . LYS B  1 127 ? 16.719  63.876  69.411  1.00 50.77  ? 268 LYS B O     1 
ATOM   3966  C  CB    . LYS B  1 127 ? 19.825  64.209  68.091  1.00 44.66  ? 268 LYS B CB    1 
ATOM   3967  C  CG    . LYS B  1 127 ? 19.601  65.569  68.713  1.00 46.57  ? 268 LYS B CG    1 
ATOM   3968  C  CD    . LYS B  1 127 ? 20.722  66.516  68.323  1.00 48.77  ? 268 LYS B CD    1 
ATOM   3969  C  CE    . LYS B  1 127 ? 20.285  67.961  68.466  1.00 52.06  ? 268 LYS B CE    1 
ATOM   3970  N  NZ    . LYS B  1 127 ? 19.094  68.259  67.621  1.00 52.50  ? 268 LYS B NZ    1 
ATOM   3971  N  N     . ILE B  1 128 ? 16.915  63.696  67.165  1.00 40.66  ? 269 ILE B N     1 
ATOM   3972  C  CA    . ILE B  1 128 ? 15.519  64.051  66.912  1.00 37.93  ? 269 ILE B CA    1 
ATOM   3973  C  C     . ILE B  1 128 ? 14.561  63.096  67.635  1.00 39.96  ? 269 ILE B C     1 
ATOM   3974  O  O     . ILE B  1 128 ? 13.658  63.538  68.361  1.00 42.53  ? 269 ILE B O     1 
ATOM   3975  C  CB    . ILE B  1 128 ? 15.202  64.065  65.405  1.00 33.05  ? 269 ILE B CB    1 
ATOM   3976  C  CG1   . ILE B  1 128 ? 15.925  65.225  64.720  1.00 27.98  ? 269 ILE B CG1   1 
ATOM   3977  C  CG2   . ILE B  1 128 ? 13.702  64.168  65.175  1.00 34.96  ? 269 ILE B CG2   1 
ATOM   3978  C  CD1   . ILE B  1 128 ? 15.996  65.107  63.209  1.00 25.70  ? 269 ILE B CD1   1 
ATOM   3979  N  N     . ILE B  1 129 ? 14.766  61.792  67.444  1.00 38.51  ? 270 ILE B N     1 
ATOM   3980  C  CA    . ILE B  1 129 ? 13.908  60.798  68.091  1.00 32.79  ? 270 ILE B CA    1 
ATOM   3981  C  C     . ILE B  1 129 ? 13.875  60.936  69.616  1.00 35.05  ? 270 ILE B C     1 
ATOM   3982  O  O     . ILE B  1 129 ? 12.808  60.859  70.216  1.00 37.74  ? 270 ILE B O     1 
ATOM   3983  C  CB    . ILE B  1 129 ? 14.273  59.357  67.673  1.00 26.44  ? 270 ILE B CB    1 
ATOM   3984  C  CG1   . ILE B  1 129 ? 13.899  59.124  66.213  1.00 24.82  ? 270 ILE B CG1   1 
ATOM   3985  C  CG2   . ILE B  1 129 ? 13.556  58.335  68.533  1.00 20.90  ? 270 ILE B CG2   1 
ATOM   3986  C  CD1   . ILE B  1 129 ? 14.233  57.740  65.712  1.00 26.19  ? 270 ILE B CD1   1 
ATOM   3987  N  N     . LYS B  1 130 ? 15.029  61.151  70.242  1.00 38.13  ? 271 LYS B N     1 
ATOM   3988  C  CA    . LYS B  1 130 ? 15.067  61.339  71.691  1.00 36.13  ? 271 LYS B CA    1 
ATOM   3989  C  C     . LYS B  1 130 ? 14.294  62.585  72.106  1.00 39.61  ? 271 LYS B C     1 
ATOM   3990  O  O     . LYS B  1 130 ? 13.543  62.564  73.097  1.00 39.12  ? 271 LYS B O     1 
ATOM   3991  C  CB    . LYS B  1 130 ? 16.503  61.447  72.186  1.00 33.51  ? 271 LYS B CB    1 
ATOM   3992  C  CG    . LYS B  1 130 ? 17.318  60.172  72.041  1.00 34.15  ? 271 LYS B CG    1 
ATOM   3993  C  CD    . LYS B  1 130 ? 18.643  60.308  72.794  1.00 33.70  ? 271 LYS B CD    1 
ATOM   3994  C  CE    . LYS B  1 130 ? 19.531  59.099  72.567  1.00 32.45  ? 271 LYS B CE    1 
ATOM   3995  N  NZ    . LYS B  1 130 ? 20.898  59.314  73.111  1.00 31.91  ? 271 LYS B NZ    1 
ATOM   3996  N  N     . GLU B  1 131 ? 14.486  63.666  71.348  1.00 41.78  ? 272 GLU B N     1 
ATOM   3997  C  CA    . GLU B  1 131 ? 13.770  64.916  71.601  1.00 42.03  ? 272 GLU B CA    1 
ATOM   3998  C  C     . GLU B  1 131 ? 12.267  64.701  71.604  1.00 41.94  ? 272 GLU B C     1 
ATOM   3999  O  O     . GLU B  1 131 ? 11.580  65.093  72.547  1.00 44.99  ? 272 GLU B O     1 
ATOM   4000  C  CB    . GLU B  1 131 ? 14.124  65.976  70.558  1.00 45.26  ? 272 GLU B CB    1 
ATOM   4001  C  CG    . GLU B  1 131 ? 15.437  66.700  70.799  1.00 50.67  ? 272 GLU B CG    1 
ATOM   4002  C  CD    . GLU B  1 131 ? 15.518  67.983  70.004  1.00 56.66  ? 272 GLU B CD    1 
ATOM   4003  O  OE1   . GLU B  1 131 ? 16.591  68.625  70.009  1.00 63.01  ? 272 GLU B OE1   1 
ATOM   4004  O  OE2   . GLU B  1 131 ? 14.499  68.351  69.382  1.00 53.87  ? 272 GLU B OE2   1 
ATOM   4005  N  N     . GLU B  1 132 ? 11.751  64.079  70.550  1.00 40.17  ? 273 GLU B N     1 
ATOM   4006  C  CA    . GLU B  1 132 ? 10.313  63.837  70.480  1.00 37.99  ? 273 GLU B CA    1 
ATOM   4007  C  C     . GLU B  1 132 ? 9.830   62.845  71.554  1.00 36.57  ? 273 GLU B C     1 
ATOM   4008  O  O     . GLU B  1 132 ? 8.737   62.995  72.104  1.00 34.83  ? 273 GLU B O     1 
ATOM   4009  C  CB    . GLU B  1 132 ? 9.911   63.385  69.075  1.00 36.60  ? 273 GLU B CB    1 
ATOM   4010  C  CG    . GLU B  1 132 ? 8.422   63.494  68.795  1.00 38.77  ? 273 GLU B CG    1 
ATOM   4011  C  CD    . GLU B  1 132 ? 7.884   64.901  68.987  1.00 40.55  ? 273 GLU B CD    1 
ATOM   4012  O  OE1   . GLU B  1 132 ? 8.615   65.872  68.701  1.00 38.85  ? 273 GLU B OE1   1 
ATOM   4013  O  OE2   . GLU B  1 132 ? 6.724   65.034  69.423  1.00 42.44  ? 273 GLU B OE2   1 
ATOM   4014  N  N     . VAL B  1 133 ? 10.659  61.854  71.870  1.00 37.66  ? 274 VAL B N     1 
ATOM   4015  C  CA    . VAL B  1 133 ? 10.316  60.848  72.877  1.00 40.11  ? 274 VAL B CA    1 
ATOM   4016  C  C     . VAL B  1 133 ? 10.182  61.456  74.279  1.00 44.87  ? 274 VAL B C     1 
ATOM   4017  O  O     . VAL B  1 133 ? 9.369   60.998  75.087  1.00 49.01  ? 274 VAL B O     1 
ATOM   4018  C  CB    . VAL B  1 133 ? 11.312  59.662  72.854  1.00 41.16  ? 274 VAL B CB    1 
ATOM   4019  C  CG1   . VAL B  1 133 ? 11.274  58.875  74.154  1.00 42.15  ? 274 VAL B CG1   1 
ATOM   4020  C  CG2   . VAL B  1 133 ? 11.010  58.746  71.685  1.00 41.41  ? 274 VAL B CG2   1 
ATOM   4021  N  N     . LYS B  1 134 ? 10.963  62.497  74.560  1.00 44.65  ? 275 LYS B N     1 
ATOM   4022  C  CA    . LYS B  1 134 ? 10.785  63.252  75.800  1.00 43.56  ? 275 LYS B CA    1 
ATOM   4023  C  C     . LYS B  1 134 ? 9.379   63.838  75.914  1.00 43.37  ? 275 LYS B C     1 
ATOM   4024  O  O     . LYS B  1 134 ? 8.841   63.971  77.011  1.00 43.78  ? 275 LYS B O     1 
ATOM   4025  C  CB    . LYS B  1 134 ? 11.802  64.386  75.887  1.00 47.05  ? 275 LYS B CB    1 
ATOM   4026  C  CG    . LYS B  1 134 ? 13.201  63.946  76.280  1.00 54.80  ? 275 LYS B CG    1 
ATOM   4027  C  CD    . LYS B  1 134 ? 14.146  65.139  76.323  1.00 60.03  ? 275 LYS B CD    1 
ATOM   4028  C  CE    . LYS B  1 134 ? 15.518  64.749  76.849  1.00 63.25  ? 275 LYS B CE    1 
ATOM   4029  N  NZ    . LYS B  1 134 ? 16.408  65.940  76.979  1.00 66.37  ? 275 LYS B NZ    1 
ATOM   4030  N  N     . GLU B  1 135 ? 8.791   64.186  74.774  1.00 47.08  ? 276 GLU B N     1 
ATOM   4031  C  CA    . GLU B  1 135 ? 7.498   64.868  74.740  1.00 48.03  ? 276 GLU B CA    1 
ATOM   4032  C  C     . GLU B  1 135 ? 6.295   63.931  74.870  1.00 44.82  ? 276 GLU B C     1 
ATOM   4033  O  O     . GLU B  1 135 ? 5.156   64.390  74.970  1.00 46.59  ? 276 GLU B O     1 
ATOM   4034  C  CB    . GLU B  1 135 ? 7.379   65.693  73.458  1.00 49.28  ? 276 GLU B CB    1 
ATOM   4035  C  CG    . GLU B  1 135 ? 8.422   66.786  73.344  1.00 51.70  ? 276 GLU B CG    1 
ATOM   4036  C  CD    . GLU B  1 135 ? 8.410   67.708  74.542  1.00 58.85  ? 276 GLU B CD    1 
ATOM   4037  O  OE1   . GLU B  1 135 ? 7.520   68.580  74.608  1.00 61.90  ? 276 GLU B OE1   1 
ATOM   4038  O  OE2   . GLU B  1 135 ? 9.283   67.561  75.420  1.00 61.13  ? 276 GLU B OE2   1 
ATOM   4039  N  N     . ILE B  1 136 ? 6.553   62.627  74.882  1.00 38.86  ? 277 ILE B N     1 
ATOM   4040  C  CA    . ILE B  1 136 ? 5.494   61.625  74.986  1.00 34.07  ? 277 ILE B CA    1 
ATOM   4041  C  C     . ILE B  1 136 ? 5.170   61.290  76.452  1.00 39.16  ? 277 ILE B C     1 
ATOM   4042  O  O     . ILE B  1 136 ? 5.968   60.660  77.152  1.00 38.09  ? 277 ILE B O     1 
ATOM   4043  C  CB    . ILE B  1 136 ? 5.863   60.356  74.191  1.00 32.67  ? 277 ILE B CB    1 
ATOM   4044  C  CG1   . ILE B  1 136 ? 5.998   60.691  72.706  1.00 28.51  ? 277 ILE B CG1   1 
ATOM   4045  C  CG2   . ILE B  1 136 ? 4.818   59.275  74.385  1.00 38.81  ? 277 ILE B CG2   1 
ATOM   4046  C  CD1   . ILE B  1 136 ? 6.749   59.658  71.901  1.00 25.44  ? 277 ILE B CD1   1 
ATOM   4047  N  N     . LYS B  1 137 ? 3.983   61.706  76.896  1.00 41.67  ? 278 LYS B N     1 
ATOM   4048  C  CA    . LYS B  1 137 ? 3.604   61.648  78.304  1.00 34.23  ? 278 LYS B CA    1 
ATOM   4049  C  C     . LYS B  1 137 ? 2.542   60.590  78.608  1.00 36.16  ? 278 LYS B C     1 
ATOM   4050  O  O     . LYS B  1 137 ? 2.284   60.286  79.781  1.00 39.08  ? 278 LYS B O     1 
ATOM   4051  C  CB    . LYS B  1 137 ? 3.101   63.017  78.773  1.00 33.13  ? 278 LYS B CB    1 
ATOM   4052  C  CG    . LYS B  1 137 ? 3.992   64.198  78.406  1.00 32.84  ? 278 LYS B CG    1 
ATOM   4053  C  CD    . LYS B  1 137 ? 5.368   64.081  79.047  1.00 34.58  ? 278 LYS B CD    1 
ATOM   4054  C  CE    . LYS B  1 137 ? 6.291   65.208  78.594  1.00 33.15  ? 278 LYS B CE    1 
ATOM   4055  N  NZ    . LYS B  1 137 ? 7.691   64.993  79.057  1.00 28.13  ? 278 LYS B NZ    1 
ATOM   4056  N  N     . ASP B  1 138 ? 1.921   60.033  77.570  1.00 34.12  ? 279 ASP B N     1 
ATOM   4057  C  CA    . ASP B  1 138 ? 0.921   58.984  77.787  1.00 36.35  ? 279 ASP B CA    1 
ATOM   4058  C  C     . ASP B  1 138 ? 1.476   57.566  77.641  1.00 39.41  ? 279 ASP B C     1 
ATOM   4059  O  O     . ASP B  1 138 ? 0.805   56.594  77.996  1.00 42.25  ? 279 ASP B O     1 
ATOM   4060  C  CB    . ASP B  1 138 ? -0.330  59.183  76.918  1.00 37.39  ? 279 ASP B CB    1 
ATOM   4061  C  CG    . ASP B  1 138 ? -0.002  59.487  75.475  1.00 40.40  ? 279 ASP B CG    1 
ATOM   4062  O  OD1   . ASP B  1 138 ? 1.174   59.767  75.166  1.00 45.23  ? 279 ASP B OD1   1 
ATOM   4063  O  OD2   . ASP B  1 138 ? -0.934  59.464  74.645  1.00 40.60  ? 279 ASP B OD2   1 
ATOM   4064  N  N     . ILE B  1 139 ? 2.702   57.451  77.136  1.00 40.11  ? 280 ILE B N     1 
ATOM   4065  C  CA    . ILE B  1 139 ? 3.362   56.153  77.029  1.00 39.77  ? 280 ILE B CA    1 
ATOM   4066  C  C     . ILE B  1 139 ? 4.650   56.123  77.857  1.00 39.64  ? 280 ILE B C     1 
ATOM   4067  O  O     . ILE B  1 139 ? 5.385   57.113  77.893  1.00 39.92  ? 280 ILE B O     1 
ATOM   4068  C  CB    . ILE B  1 139 ? 3.719   55.813  75.567  1.00 42.06  ? 280 ILE B CB    1 
ATOM   4069  C  CG1   . ILE B  1 139 ? 2.530   56.046  74.625  1.00 44.11  ? 280 ILE B CG1   1 
ATOM   4070  C  CG2   . ILE B  1 139 ? 4.240   54.384  75.466  1.00 41.53  ? 280 ILE B CG2   1 
ATOM   4071  C  CD1   . ILE B  1 139 ? 1.306   55.218  74.943  1.00 45.67  ? 280 ILE B CD1   1 
ATOM   4072  N  N     . ASP B  1 140 ? 4.917   54.998  78.522  1.00 40.09  ? 281 ASP B N     1 
ATOM   4073  C  CA    . ASP B  1 140 ? 6.225   54.772  79.122  1.00 40.48  ? 281 ASP B CA    1 
ATOM   4074  C  C     . ASP B  1 140 ? 7.150   54.249  78.035  1.00 39.22  ? 281 ASP B C     1 
ATOM   4075  O  O     . ASP B  1 140 ? 7.302   53.035  77.863  1.00 39.26  ? 281 ASP B O     1 
ATOM   4076  C  CB    . ASP B  1 140 ? 6.149   53.766  80.271  1.00 41.85  ? 281 ASP B CB    1 
ATOM   4077  C  CG    . ASP B  1 140 ? 7.431   53.710  81.085  1.00 42.23  ? 281 ASP B CG    1 
ATOM   4078  O  OD1   . ASP B  1 140 ? 8.403   54.402  80.724  1.00 41.94  ? 281 ASP B OD1   1 
ATOM   4079  O  OD2   . ASP B  1 140 ? 7.469   52.966  82.085  1.00 43.59  ? 281 ASP B OD2   1 
ATOM   4080  N  N     . VAL B  1 141 ? 7.748   55.178  77.293  1.00 35.79  ? 282 VAL B N     1 
ATOM   4081  C  CA    . VAL B  1 141 ? 8.662   54.833  76.216  1.00 35.05  ? 282 VAL B CA    1 
ATOM   4082  C  C     . VAL B  1 141 ? 9.999   55.535  76.414  1.00 42.93  ? 282 VAL B C     1 
ATOM   4083  O  O     . VAL B  1 141 ? 10.047  56.725  76.732  1.00 45.66  ? 282 VAL B O     1 
ATOM   4084  C  CB    . VAL B  1 141 ? 8.070   55.185  74.828  1.00 33.11  ? 282 VAL B CB    1 
ATOM   4085  C  CG1   . VAL B  1 141 ? 7.582   56.619  74.786  1.00 28.91  ? 282 VAL B CG1   1 
ATOM   4086  C  CG2   . VAL B  1 141 ? 9.087   54.942  73.736  1.00 32.47  ? 282 VAL B CG2   1 
ATOM   4087  N  N     . SER B  1 142 ? 11.087  54.790  76.244  1.00 45.31  ? 283 SER B N     1 
ATOM   4088  C  CA    . SER B  1 142 ? 12.420  55.368  76.345  1.00 38.78  ? 283 SER B CA    1 
ATOM   4089  C  C     . SER B  1 142 ? 13.304  54.893  75.194  1.00 38.83  ? 283 SER B C     1 
ATOM   4090  O  O     . SER B  1 142 ? 12.956  53.946  74.484  1.00 37.77  ? 283 SER B O     1 
ATOM   4091  C  CB    . SER B  1 142 ? 13.052  55.017  77.690  1.00 34.56  ? 283 SER B CB    1 
ATOM   4092  O  OG    . SER B  1 142 ? 13.055  53.618  77.901  1.00 36.92  ? 283 SER B OG    1 
ATOM   4093  N  N     . VAL B  1 143 ? 14.438  55.564  75.004  1.00 41.31  ? 284 VAL B N     1 
ATOM   4094  C  CA    . VAL B  1 143 ? 15.388  55.196  73.955  1.00 39.76  ? 284 VAL B CA    1 
ATOM   4095  C  C     . VAL B  1 143 ? 16.473  54.265  74.503  1.00 40.08  ? 284 VAL B C     1 
ATOM   4096  O  O     . VAL B  1 143 ? 17.111  54.568  75.515  1.00 36.63  ? 284 VAL B O     1 
ATOM   4097  C  CB    . VAL B  1 143 ? 16.037  56.440  73.308  1.00 34.92  ? 284 VAL B CB    1 
ATOM   4098  C  CG1   . VAL B  1 143 ? 17.001  56.029  72.213  1.00 35.37  ? 284 VAL B CG1   1 
ATOM   4099  C  CG2   . VAL B  1 143 ? 14.969  57.359  72.741  1.00 32.82  ? 284 VAL B CG2   1 
ATOM   4100  N  N     . GLU B  1 144 ? 16.666  53.128  73.835  1.00 40.56  ? 285 GLU B N     1 
ATOM   4101  C  CA    . GLU B  1 144 ? 17.671  52.149  74.231  1.00 35.37  ? 285 GLU B CA    1 
ATOM   4102  C  C     . GLU B  1 144 ? 19.052  52.650  73.837  1.00 37.65  ? 285 GLU B C     1 
ATOM   4103  O  O     . GLU B  1 144 ? 19.202  53.293  72.800  1.00 37.78  ? 285 GLU B O     1 
ATOM   4104  C  CB    . GLU B  1 144 ? 17.394  50.812  73.543  1.00 34.32  ? 285 GLU B CB    1 
ATOM   4105  C  CG    . GLU B  1 144 ? 18.330  49.673  73.940  1.00 37.40  ? 285 GLU B CG    1 
ATOM   4106  C  CD    . GLU B  1 144 ? 18.356  48.558  72.913  1.00 40.04  ? 285 GLU B CD    1 
ATOM   4107  O  OE1   . GLU B  1 144 ? 18.974  48.747  71.846  1.00 41.31  ? 285 GLU B OE1   1 
ATOM   4108  O  OE2   . GLU B  1 144 ? 17.758  47.495  73.168  1.00 42.00  ? 285 GLU B OE2   1 
ATOM   4109  N  N     . LYS B  1 145 ? 20.054  52.365  74.665  1.00 39.49  ? 286 LYS B N     1 
ATOM   4110  C  CA    . LYS B  1 145 ? 21.429  52.758  74.368  1.00 35.89  ? 286 LYS B CA    1 
ATOM   4111  C  C     . LYS B  1 145 ? 21.884  52.082  73.083  1.00 37.54  ? 286 LYS B C     1 
ATOM   4112  O  O     . LYS B  1 145 ? 21.546  50.927  72.840  1.00 39.44  ? 286 LYS B O     1 
ATOM   4113  C  CB    . LYS B  1 145 ? 22.357  52.392  75.529  1.00 34.59  ? 286 LYS B CB    1 
ATOM   4114  C  CG    . LYS B  1 145 ? 23.834  52.643  75.247  1.00 36.69  ? 286 LYS B CG    1 
ATOM   4115  C  CD    . LYS B  1 145 ? 24.711  52.311  76.447  1.00 36.63  ? 286 LYS B CD    1 
ATOM   4116  C  CE    . LYS B  1 145 ? 26.176  52.260  76.034  1.00 40.12  ? 286 LYS B CE    1 
ATOM   4117  N  NZ    . LYS B  1 145 ? 27.082  51.922  77.167  1.00 44.27  ? 286 LYS B NZ    1 
ATOM   4118  N  N     . GLU B  1 146 ? 22.633  52.810  72.258  1.00 40.59  ? 287 GLU B N     1 
ATOM   4119  C  CA    . GLU B  1 146 ? 23.059  52.312  70.953  1.00 40.69  ? 287 GLU B CA    1 
ATOM   4120  C  C     . GLU B  1 146 ? 23.808  50.988  71.037  1.00 38.80  ? 287 GLU B C     1 
ATOM   4121  O  O     . GLU B  1 146 ? 24.743  50.844  71.828  1.00 38.18  ? 287 GLU B O     1 
ATOM   4122  C  CB    . GLU B  1 146 ? 23.923  53.352  70.236  1.00 43.09  ? 287 GLU B CB    1 
ATOM   4123  C  CG    . GLU B  1 146 ? 24.432  52.888  68.879  1.00 43.79  ? 287 GLU B CG    1 
ATOM   4124  C  CD    . GLU B  1 146 ? 25.489  53.805  68.305  1.00 45.34  ? 287 GLU B CD    1 
ATOM   4125  O  OE1   . GLU B  1 146 ? 26.210  54.459  69.082  1.00 44.91  ? 287 GLU B OE1   1 
ATOM   4126  O  OE2   . GLU B  1 146 ? 25.602  53.865  67.066  1.00 51.97  ? 287 GLU B OE2   1 
ATOM   4127  N  N     . LYS B  1 147 ? 23.373  50.026  70.224  1.00 40.52  ? 288 LYS B N     1 
ATOM   4128  C  CA    . LYS B  1 147 ? 24.040  48.737  70.098  1.00 40.11  ? 288 LYS B CA    1 
ATOM   4129  C  C     . LYS B  1 147 ? 24.975  48.783  68.899  1.00 44.62  ? 288 LYS B C     1 
ATOM   4130  O  O     . LYS B  1 147 ? 24.590  49.248  67.828  1.00 45.19  ? 288 LYS B O     1 
ATOM   4131  C  CB    . LYS B  1 147 ? 23.021  47.611  69.900  1.00 41.22  ? 288 LYS B CB    1 
ATOM   4132  C  CG    . LYS B  1 147 ? 22.156  47.297  71.118  1.00 50.13  ? 288 LYS B CG    1 
ATOM   4133  C  CD    . LYS B  1 147 ? 21.263  46.081  70.861  1.00 58.28  ? 288 LYS B CD    1 
ATOM   4134  C  CE    . LYS B  1 147 ? 20.295  45.819  72.015  1.00 61.03  ? 288 LYS B CE    1 
ATOM   4135  N  NZ    . LYS B  1 147 ? 20.985  45.552  73.310  1.00 60.92  ? 288 LYS B NZ    1 
ATOM   4136  N  N     . PRO B  1 148 ? 26.214  48.296  69.072  1.00 48.74  ? 289 PRO B N     1 
ATOM   4137  C  CA    . PRO B  1 148 ? 27.153  48.285  67.947  1.00 48.85  ? 289 PRO B CA    1 
ATOM   4138  C  C     . PRO B  1 148 ? 26.662  47.354  66.849  1.00 50.79  ? 289 PRO B C     1 
ATOM   4139  O  O     . PRO B  1 148 ? 26.294  46.213  67.135  1.00 57.04  ? 289 PRO B O     1 
ATOM   4140  C  CB    . PRO B  1 148 ? 28.447  47.750  68.573  1.00 47.43  ? 289 PRO B CB    1 
ATOM   4141  C  CG    . PRO B  1 148 ? 28.009  46.982  69.780  1.00 49.06  ? 289 PRO B CG    1 
ATOM   4142  C  CD    . PRO B  1 148 ? 26.793  47.703  70.292  1.00 49.73  ? 289 PRO B CD    1 
ATOM   4143  N  N     . GLY B  1 149 ? 26.631  47.843  65.614  1.00 44.86  ? 290 GLY B N     1 
ATOM   4144  C  CA    . GLY B  1 149 ? 26.177  47.032  64.500  1.00 41.42  ? 290 GLY B CA    1 
ATOM   4145  C  C     . GLY B  1 149 ? 24.692  47.131  64.202  1.00 40.97  ? 290 GLY B C     1 
ATOM   4146  O  O     . GLY B  1 149 ? 24.166  46.351  63.405  1.00 46.80  ? 290 GLY B O     1 
ATOM   4147  N  N     . SER B  1 150 ? 24.017  48.088  64.832  1.00 35.37  ? 291 SER B N     1 
ATOM   4148  C  CA    . SER B  1 150 ? 22.589  48.284  64.606  1.00 35.03  ? 291 SER B CA    1 
ATOM   4149  C  C     . SER B  1 150 ? 22.330  49.501  63.718  1.00 35.76  ? 291 SER B C     1 
ATOM   4150  O  O     . SER B  1 150 ? 22.935  50.554  63.919  1.00 40.20  ? 291 SER B O     1 
ATOM   4151  C  CB    . SER B  1 150 ? 21.865  48.456  65.940  1.00 33.65  ? 291 SER B CB    1 
ATOM   4152  O  OG    . SER B  1 150 ? 20.463  48.440  65.764  1.00 36.05  ? 291 SER B OG    1 
ATOM   4153  N  N     . PRO B  1 151 ? 21.433  49.354  62.730  1.00 30.08  ? 292 PRO B N     1 
ATOM   4154  C  CA    . PRO B  1 151 ? 21.045  50.439  61.824  1.00 28.13  ? 292 PRO B CA    1 
ATOM   4155  C  C     . PRO B  1 151 ? 19.847  51.200  62.378  1.00 26.38  ? 292 PRO B C     1 
ATOM   4156  O  O     . PRO B  1 151 ? 19.269  52.037  61.679  1.00 24.87  ? 292 PRO B O     1 
ATOM   4157  C  CB    . PRO B  1 151 ? 20.614  49.680  60.570  1.00 28.30  ? 292 PRO B CB    1 
ATOM   4158  C  CG    . PRO B  1 151 ? 19.983  48.438  61.116  1.00 27.09  ? 292 PRO B CG    1 
ATOM   4159  C  CD    . PRO B  1 151 ? 20.816  48.073  62.334  1.00 30.20  ? 292 PRO B CD    1 
ATOM   4160  N  N     . ALA B  1 152 ? 19.499  50.921  63.632  1.00 25.03  ? 293 ALA B N     1 
ATOM   4161  C  CA    . ALA B  1 152 ? 18.248  51.397  64.208  1.00 20.82  ? 293 ALA B CA    1 
ATOM   4162  C  C     . ALA B  1 152 ? 18.408  52.214  65.496  1.00 25.22  ? 293 ALA B C     1 
ATOM   4163  O  O     . ALA B  1 152 ? 19.475  52.237  66.118  1.00 22.96  ? 293 ALA B O     1 
ATOM   4164  C  CB    . ALA B  1 152 ? 17.318  50.224  64.453  1.00 21.50  ? 293 ALA B CB    1 
ATOM   4165  N  N     . VAL B  1 153 ? 17.326  52.891  65.871  1.00 25.96  ? 294 VAL B N     1 
ATOM   4166  C  CA    . VAL B  1 153 ? 17.177  53.511  67.178  1.00 25.89  ? 294 VAL B CA    1 
ATOM   4167  C  C     . VAL B  1 153 ? 16.077  52.709  67.864  1.00 27.34  ? 294 VAL B C     1 
ATOM   4168  O  O     . VAL B  1 153 ? 14.921  52.717  67.421  1.00 28.99  ? 294 VAL B O     1 
ATOM   4169  C  CB    . VAL B  1 153 ? 16.766  54.995  67.060  1.00 28.60  ? 294 VAL B CB    1 
ATOM   4170  C  CG1   . VAL B  1 153 ? 16.577  55.622  68.426  1.00 15.44  ? 294 VAL B CG1   1 
ATOM   4171  C  CG2   . VAL B  1 153 ? 17.804  55.774  66.267  1.00 27.37  ? 294 VAL B CG2   1 
ATOM   4172  N  N     . THR B  1 154 ? 16.448  51.987  68.920  1.00 26.27  ? 295 THR B N     1 
ATOM   4173  C  CA    . THR B  1 154 ? 15.537  51.045  69.557  1.00 24.43  ? 295 THR B CA    1 
ATOM   4174  C  C     . THR B  1 154 ? 14.800  51.689  70.726  1.00 27.17  ? 295 THR B C     1 
ATOM   4175  O  O     . THR B  1 154 ? 15.410  52.297  71.606  1.00 28.52  ? 295 THR B O     1 
ATOM   4176  C  CB    . THR B  1 154 ? 16.270  49.775  70.022  1.00 27.45  ? 295 THR B CB    1 
ATOM   4177  O  OG1   . THR B  1 154 ? 16.890  49.145  68.893  1.00 30.73  ? 295 THR B OG1   1 
ATOM   4178  C  CG2   . THR B  1 154 ? 15.306  48.794  70.678  1.00 26.46  ? 295 THR B CG2   1 
ATOM   4179  N  N     . LEU B  1 155 ? 13.478  51.554  70.714  1.00 28.81  ? 296 LEU B N     1 
ATOM   4180  C  CA    . LEU B  1 155 ? 12.634  52.087  71.765  1.00 27.75  ? 296 LEU B CA    1 
ATOM   4181  C  C     . LEU B  1 155 ? 12.184  50.951  72.667  1.00 34.86  ? 296 LEU B C     1 
ATOM   4182  O  O     . LEU B  1 155 ? 11.780  49.887  72.181  1.00 35.47  ? 296 LEU B O     1 
ATOM   4183  C  CB    . LEU B  1 155 ? 11.409  52.764  71.161  1.00 24.82  ? 296 LEU B CB    1 
ATOM   4184  C  CG    . LEU B  1 155 ? 11.656  53.737  70.021  1.00 21.93  ? 296 LEU B CG    1 
ATOM   4185  C  CD1   . LEU B  1 155 ? 10.343  54.232  69.465  1.00 23.39  ? 296 LEU B CD1   1 
ATOM   4186  C  CD2   . LEU B  1 155 ? 12.493  54.890  70.500  1.00 21.46  ? 296 LEU B CD2   1 
ATOM   4187  N  N     . LEU B  1 156 ? 12.267  51.169  73.977  1.00 37.59  ? 297 LEU B N     1 
ATOM   4188  C  CA    . LEU B  1 156 ? 11.677  50.243  74.931  1.00 37.04  ? 297 LEU B CA    1 
ATOM   4189  C  C     . LEU B  1 156 ? 10.390  50.850  75.467  1.00 36.89  ? 297 LEU B C     1 
ATOM   4190  O  O     . LEU B  1 156 ? 10.389  51.948  76.032  1.00 42.15  ? 297 LEU B O     1 
ATOM   4191  C  CB    . LEU B  1 156 ? 12.635  49.927  76.079  1.00 39.69  ? 297 LEU B CB    1 
ATOM   4192  C  CG    . LEU B  1 156 ? 12.069  49.001  77.161  1.00 37.24  ? 297 LEU B CG    1 
ATOM   4193  C  CD1   . LEU B  1 156 ? 11.583  47.709  76.550  1.00 39.71  ? 297 LEU B CD1   1 
ATOM   4194  C  CD2   . LEU B  1 156 ? 13.096  48.711  78.229  1.00 36.50  ? 297 LEU B CD2   1 
ATOM   4195  N  N     . ILE B  1 157 ? 9.292   50.134  75.262  1.00 32.90  ? 298 ILE B N     1 
ATOM   4196  C  CA    . ILE B  1 157 ? 7.987   50.568  75.726  1.00 30.99  ? 298 ILE B CA    1 
ATOM   4197  C  C     . ILE B  1 157 ? 7.496   49.672  76.853  1.00 34.46  ? 298 ILE B C     1 
ATOM   4198  O  O     . ILE B  1 157 ? 7.308   48.461  76.669  1.00 32.00  ? 298 ILE B O     1 
ATOM   4199  C  CB    . ILE B  1 157 ? 6.955   50.560  74.588  1.00 27.92  ? 298 ILE B CB    1 
ATOM   4200  C  CG1   . ILE B  1 157 ? 7.327   51.591  73.526  1.00 23.44  ? 298 ILE B CG1   1 
ATOM   4201  C  CG2   . ILE B  1 157 ? 5.562   50.834  75.131  1.00 30.43  ? 298 ILE B CG2   1 
ATOM   4202  C  CD1   . ILE B  1 157 ? 6.381   51.632  72.341  1.00 21.40  ? 298 ILE B CD1   1 
ATOM   4203  N  N     . ARG B  1 158 ? 7.311   50.277  78.022  1.00 38.65  ? 299 ARG B N     1 
ATOM   4204  C  CA    . ARG B  1 158 ? 6.696   49.598  79.148  1.00 44.12  ? 299 ARG B CA    1 
ATOM   4205  C  C     . ARG B  1 158 ? 5.186   49.729  79.032  1.00 44.68  ? 299 ARG B C     1 
ATOM   4206  O  O     . ARG B  1 158 ? 4.566   50.532  79.728  1.00 47.46  ? 299 ARG B O     1 
ATOM   4207  C  CB    . ARG B  1 158 ? 7.164   50.209  80.464  1.00 51.06  ? 299 ARG B CB    1 
ATOM   4208  C  CG    . ARG B  1 158 ? 8.026   49.286  81.303  1.00 56.06  ? 299 ARG B CG    1 
ATOM   4209  C  CD    . ARG B  1 158 ? 9.116   48.647  80.471  1.00 60.36  ? 299 ARG B CD    1 
ATOM   4210  N  NE    . ARG B  1 158 ? 10.280  48.334  81.289  1.00 64.86  ? 299 ARG B NE    1 
ATOM   4211  C  CZ    . ARG B  1 158 ? 11.337  49.131  81.401  1.00 68.93  ? 299 ARG B CZ    1 
ATOM   4212  N  NH1   . ARG B  1 158 ? 11.372  50.279  80.737  1.00 67.56  ? 299 ARG B NH1   1 
ATOM   4213  N  NH2   . ARG B  1 158 ? 12.359  48.780  82.170  1.00 71.89  ? 299 ARG B NH2   1 
ATOM   4214  N  N     . ASN B  1 159 ? 4.602   48.947  78.134  1.00 46.25  ? 300 ASN B N     1 
ATOM   4215  C  CA    . ASN B  1 159 ? 3.164   48.905  77.965  1.00 48.32  ? 300 ASN B CA    1 
ATOM   4216  C  C     . ASN B  1 159 ? 2.689   47.891  78.979  1.00 59.96  ? 300 ASN B C     1 
ATOM   4217  O  O     . ASN B  1 159 ? 2.067   46.904  78.608  1.00 69.47  ? 300 ASN B O     1 
ATOM   4218  C  CB    . ASN B  1 159 ? 2.856   48.424  76.551  1.00 42.49  ? 300 ASN B CB    1 
ATOM   4219  C  CG    . ASN B  1 159 ? 1.410   48.598  76.174  1.00 38.61  ? 300 ASN B CG    1 
ATOM   4220  O  OD1   . ASN B  1 159 ? 0.703   47.626  75.925  1.00 38.39  ? 300 ASN B OD1   1 
ATOM   4221  N  ND2   . ASN B  1 159 ? 0.959   49.842  76.124  1.00 38.78  ? 300 ASN B ND2   1 
ATOM   4222  N  N     . PRO B  1 160 ? 2.881   48.195  80.272  1.00 58.19  ? 301 PRO B N     1 
ATOM   4223  C  CA    . PRO B  1 160 ? 3.349   47.235  81.268  1.00 50.96  ? 301 PRO B CA    1 
ATOM   4224  C  C     . PRO B  1 160 ? 4.344   46.191  80.738  1.00 44.90  ? 301 PRO B C     1 
ATOM   4225  O  O     . PRO B  1 160 ? 5.520   46.298  81.088  1.00 41.88  ? 301 PRO B O     1 
ATOM   4226  C  CB    . PRO B  1 160 ? 2.041   46.658  81.794  1.00 46.53  ? 301 PRO B CB    1 
ATOM   4227  C  CG    . PRO B  1 160 ? 1.073   47.923  81.714  1.00 62.57  ? 301 PRO B CG    1 
ATOM   4228  C  CD    . PRO B  1 160 ? 1.816   48.998  80.885  1.00 60.96  ? 301 PRO B CD    1 
ATOM   4229  N  N     . GLU B  1 161 ? 3.915   45.227  79.929  1.00 40.45  ? 302 GLU B N     1 
ATOM   4230  C  CA    . GLU B  1 161 ? 4.866   44.317  79.308  1.00 41.00  ? 302 GLU B CA    1 
ATOM   4231  C  C     . GLU B  1 161 ? 5.832   45.089  78.406  1.00 41.84  ? 302 GLU B C     1 
ATOM   4232  O  O     . GLU B  1 161 ? 5.506   46.173  77.902  1.00 43.55  ? 302 GLU B O     1 
ATOM   4233  C  CB    . GLU B  1 161 ? 4.159   43.199  78.538  1.00 39.02  ? 302 GLU B CB    1 
ATOM   4234  C  CG    . GLU B  1 161 ? 3.500   43.630  77.250  1.00 42.10  ? 302 GLU B CG    1 
ATOM   4235  C  CD    . GLU B  1 161 ? 2.135   44.253  77.462  1.00 48.60  ? 302 GLU B CD    1 
ATOM   4236  O  OE1   . GLU B  1 161 ? 1.670   44.986  76.563  1.00 51.42  ? 302 GLU B OE1   1 
ATOM   4237  O  OE2   . GLU B  1 161 ? 1.510   44.005  78.515  1.00 48.70  ? 302 GLU B OE2   1 
ATOM   4238  N  N     . GLU B  1 162 ? 7.032   44.543  78.239  1.00 38.48  ? 303 GLU B N     1 
ATOM   4239  C  CA    . GLU B  1 162 ? 8.083   45.225  77.497  1.00 39.15  ? 303 GLU B CA    1 
ATOM   4240  C  C     . GLU B  1 162 ? 7.990   44.943  76.008  1.00 38.37  ? 303 GLU B C     1 
ATOM   4241  O  O     . GLU B  1 162 ? 7.901   43.785  75.589  1.00 33.78  ? 303 GLU B O     1 
ATOM   4242  C  CB    . GLU B  1 162 ? 9.456   44.807  78.013  1.00 43.15  ? 303 GLU B CB    1 
ATOM   4243  C  CG    . GLU B  1 162 ? 9.721   45.194  79.463  1.00 51.98  ? 303 GLU B CG    1 
ATOM   4244  C  CD    . GLU B  1 162 ? 11.120  44.811  79.907  1.00 56.82  ? 303 GLU B CD    1 
ATOM   4245  O  OE1   . GLU B  1 162 ? 11.791  44.068  79.160  1.00 58.50  ? 303 GLU B OE1   1 
ATOM   4246  O  OE2   . GLU B  1 162 ? 11.553  45.253  80.994  1.00 56.55  ? 303 GLU B OE2   1 
ATOM   4247  N  N     . ILE B  1 163 ? 8.015   46.011  75.214  1.00 39.25  ? 304 ILE B N     1 
ATOM   4248  C  CA    . ILE B  1 163 ? 8.005   45.891  73.763  1.00 33.51  ? 304 ILE B CA    1 
ATOM   4249  C  C     . ILE B  1 163 ? 9.176   46.671  73.179  1.00 35.67  ? 304 ILE B C     1 
ATOM   4250  O  O     . ILE B  1 163 ? 9.413   47.814  73.570  1.00 30.74  ? 304 ILE B O     1 
ATOM   4251  C  CB    . ILE B  1 163 ? 6.703   46.437  73.172  1.00 29.87  ? 304 ILE B CB    1 
ATOM   4252  C  CG1   . ILE B  1 163 ? 5.498   45.756  73.817  1.00 28.80  ? 304 ILE B CG1   1 
ATOM   4253  C  CG2   . ILE B  1 163 ? 6.675   46.224  71.671  1.00 32.78  ? 304 ILE B CG2   1 
ATOM   4254  C  CD1   . ILE B  1 163 ? 4.202   46.500  73.620  1.00 28.81  ? 304 ILE B CD1   1 
ATOM   4255  N  N     . SER B  1 164 ? 9.913   46.061  72.252  1.00 39.14  ? 305 SER B N     1 
ATOM   4256  C  CA    . SER B  1 164 ? 11.025  46.754  71.607  1.00 39.75  ? 305 SER B CA    1 
ATOM   4257  C  C     . SER B  1 164 ? 10.661  47.153  70.179  1.00 36.54  ? 305 SER B C     1 
ATOM   4258  O  O     . SER B  1 164 ? 10.098  46.352  69.430  1.00 36.14  ? 305 SER B O     1 
ATOM   4259  C  CB    . SER B  1 164 ? 12.282  45.887  71.604  1.00 42.15  ? 305 SER B CB    1 
ATOM   4260  O  OG    . SER B  1 164 ? 12.129  44.763  70.758  1.00 47.88  ? 305 SER B OG    1 
ATOM   4261  N  N     . VAL B  1 165 ? 10.972  48.394  69.810  1.00 33.17  ? 306 VAL B N     1 
ATOM   4262  C  CA    . VAL B  1 165 ? 10.687  48.886  68.464  1.00 28.76  ? 306 VAL B CA    1 
ATOM   4263  C  C     . VAL B  1 165 ? 11.946  49.434  67.795  1.00 32.82  ? 306 VAL B C     1 
ATOM   4264  O  O     . VAL B  1 165 ? 12.488  50.458  68.225  1.00 31.64  ? 306 VAL B O     1 
ATOM   4265  C  CB    . VAL B  1 165 ? 9.615   49.990  68.481  1.00 25.81  ? 306 VAL B CB    1 
ATOM   4266  C  CG1   . VAL B  1 165 ? 9.311   50.462  67.063  1.00 26.79  ? 306 VAL B CG1   1 
ATOM   4267  C  CG2   . VAL B  1 165 ? 8.358   49.499  69.153  1.00 23.72  ? 306 VAL B CG2   1 
ATOM   4268  N  N     . ASP B  1 166 ? 12.411  48.758  66.747  1.00 36.53  ? 307 ASP B N     1 
ATOM   4269  C  CA    . ASP B  1 166 ? 13.555  49.259  65.992  1.00 36.92  ? 307 ASP B CA    1 
ATOM   4270  C  C     . ASP B  1 166 ? 13.095  50.259  64.938  1.00 36.18  ? 307 ASP B C     1 
ATOM   4271  O  O     . ASP B  1 166 ? 12.356  49.900  64.004  1.00 37.25  ? 307 ASP B O     1 
ATOM   4272  C  CB    . ASP B  1 166 ? 14.340  48.118  65.337  1.00 35.66  ? 307 ASP B CB    1 
ATOM   4273  C  CG    . ASP B  1 166 ? 14.886  47.134  66.348  1.00 39.20  ? 307 ASP B CG    1 
ATOM   4274  O  OD1   . ASP B  1 166 ? 14.822  47.426  67.556  1.00 40.48  ? 307 ASP B OD1   1 
ATOM   4275  O  OD2   . ASP B  1 166 ? 15.382  46.066  65.941  1.00 43.56  ? 307 ASP B OD2   1 
ATOM   4276  N  N     . ILE B  1 167 ? 13.505  51.517  65.114  1.00 32.03  ? 308 ILE B N     1 
ATOM   4277  C  CA    . ILE B  1 167 ? 13.286  52.535  64.091  1.00 24.51  ? 308 ILE B CA    1 
ATOM   4278  C  C     . ILE B  1 167 ? 14.527  52.549  63.221  1.00 23.07  ? 308 ILE B C     1 
ATOM   4279  O  O     . ILE B  1 167 ? 15.549  53.116  63.602  1.00 22.95  ? 308 ILE B O     1 
ATOM   4280  C  CB    . ILE B  1 167 ? 13.064  53.945  64.677  1.00 26.85  ? 308 ILE B CB    1 
ATOM   4281  C  CG1   . ILE B  1 167 ? 11.902  53.946  65.672  1.00 25.87  ? 308 ILE B CG1   1 
ATOM   4282  C  CG2   . ILE B  1 167 ? 12.834  54.952  63.557  1.00 24.44  ? 308 ILE B CG2   1 
ATOM   4283  C  CD1   . ILE B  1 167 ? 10.577  53.475  65.098  1.00 24.60  ? 308 ILE B CD1   1 
ATOM   4284  N  N     . ILE B  1 168 ? 14.428  51.918  62.055  1.00 26.97  ? 309 ILE B N     1 
ATOM   4285  C  CA    . ILE B  1 168 ? 15.570  51.681  61.179  1.00 22.66  ? 309 ILE B CA    1 
ATOM   4286  C  C     . ILE B  1 168 ? 15.711  52.799  60.155  1.00 25.16  ? 309 ILE B C     1 
ATOM   4287  O  O     . ILE B  1 168 ? 14.825  52.992  59.328  1.00 27.42  ? 309 ILE B O     1 
ATOM   4288  C  CB    . ILE B  1 168 ? 15.394  50.337  60.455  1.00 22.77  ? 309 ILE B CB    1 
ATOM   4289  C  CG1   . ILE B  1 168 ? 15.103  49.231  61.473  1.00 25.62  ? 309 ILE B CG1   1 
ATOM   4290  C  CG2   . ILE B  1 168 ? 16.617  50.001  59.617  1.00 23.82  ? 309 ILE B CG2   1 
ATOM   4291  C  CD1   . ILE B  1 168 ? 14.255  48.087  60.936  1.00 23.84  ? 309 ILE B CD1   1 
ATOM   4292  N  N     . LEU B  1 169 ? 16.819  53.539  60.217  1.00 31.56  ? 310 LEU B N     1 
ATOM   4293  C  CA    . LEU B  1 169 ? 17.102  54.586  59.234  1.00 30.67  ? 310 LEU B CA    1 
ATOM   4294  C  C     . LEU B  1 169 ? 17.533  53.958  57.918  1.00 32.92  ? 310 LEU B C     1 
ATOM   4295  O  O     . LEU B  1 169 ? 18.510  53.215  57.879  1.00 38.23  ? 310 LEU B O     1 
ATOM   4296  C  CB    . LEU B  1 169 ? 18.205  55.515  59.741  1.00 31.15  ? 310 LEU B CB    1 
ATOM   4297  C  CG    . LEU B  1 169 ? 18.825  56.504  58.751  1.00 30.68  ? 310 LEU B CG    1 
ATOM   4298  C  CD1   . LEU B  1 169 ? 17.799  57.523  58.296  1.00 33.21  ? 310 LEU B CD1   1 
ATOM   4299  C  CD2   . LEU B  1 169 ? 20.035  57.202  59.349  1.00 26.37  ? 310 LEU B CD2   1 
ATOM   4300  N  N     . ALA B  1 170 ? 16.819  54.253  56.835  1.00 28.43  ? 311 ALA B N     1 
ATOM   4301  C  CA    . ALA B  1 170 ? 17.191  53.675  55.544  1.00 22.15  ? 311 ALA B CA    1 
ATOM   4302  C  C     . ALA B  1 170 ? 17.261  54.717  54.431  1.00 25.29  ? 311 ALA B C     1 
ATOM   4303  O  O     . ALA B  1 170 ? 16.610  55.749  54.504  1.00 24.51  ? 311 ALA B O     1 
ATOM   4304  C  CB    . ALA B  1 170 ? 16.237  52.565  55.173  1.00 17.99  ? 311 ALA B CB    1 
ATOM   4305  N  N     . LEU B  1 171 ? 18.057  54.428  53.406  1.00 28.65  ? 312 LEU B N     1 
ATOM   4306  C  CA    . LEU B  1 171 ? 18.130  55.252  52.205  1.00 27.91  ? 312 LEU B CA    1 
ATOM   4307  C  C     . LEU B  1 171 ? 17.433  54.513  51.076  1.00 29.65  ? 312 LEU B C     1 
ATOM   4308  O  O     . LEU B  1 171 ? 17.742  53.346  50.826  1.00 32.41  ? 312 LEU B O     1 
ATOM   4309  C  CB    . LEU B  1 171 ? 19.582  55.484  51.788  1.00 27.21  ? 312 LEU B CB    1 
ATOM   4310  C  CG    . LEU B  1 171 ? 20.629  55.885  52.818  1.00 28.60  ? 312 LEU B CG    1 
ATOM   4311  C  CD1   . LEU B  1 171 ? 21.992  55.998  52.171  1.00 28.02  ? 312 LEU B CD1   1 
ATOM   4312  C  CD2   . LEU B  1 171 ? 20.257  57.191  53.450  1.00 33.82  ? 312 LEU B CD2   1 
ATOM   4313  N  N     . GLU B  1 172 ? 16.519  55.191  50.385  1.00 28.38  ? 313 GLU B N     1 
ATOM   4314  C  CA    . GLU B  1 172 ? 15.798  54.585  49.267  1.00 26.83  ? 313 GLU B CA    1 
ATOM   4315  C  C     . GLU B  1 172 ? 16.324  55.023  47.899  1.00 29.85  ? 313 GLU B C     1 
ATOM   4316  O  O     . GLU B  1 172 ? 16.424  56.217  47.615  1.00 26.74  ? 313 GLU B O     1 
ATOM   4317  C  CB    . GLU B  1 172 ? 14.315  54.922  49.361  1.00 25.72  ? 313 GLU B CB    1 
ATOM   4318  C  CG    . GLU B  1 172 ? 13.500  54.479  48.167  1.00 26.45  ? 313 GLU B CG    1 
ATOM   4319  C  CD    . GLU B  1 172 ? 12.047  54.831  48.324  1.00 31.72  ? 313 GLU B CD    1 
ATOM   4320  O  OE1   . GLU B  1 172 ? 11.685  55.981  48.015  1.00 36.92  ? 313 GLU B OE1   1 
ATOM   4321  O  OE2   . GLU B  1 172 ? 11.267  53.961  48.755  1.00 33.20  ? 313 GLU B OE2   1 
ATOM   4322  N  N     . SER B  1 173 ? 16.641  54.053  47.044  1.00 36.34  ? 314 SER B N     1 
ATOM   4323  C  CA    . SER B  1 173 ? 17.082  54.353  45.682  1.00 38.14  ? 314 SER B CA    1 
ATOM   4324  C  C     . SER B  1 173 ? 16.172  53.682  44.656  1.00 38.51  ? 314 SER B C     1 
ATOM   4325  O  O     . SER B  1 173 ? 15.973  52.466  44.696  1.00 41.01  ? 314 SER B O     1 
ATOM   4326  C  CB    . SER B  1 173 ? 18.533  53.915  45.474  1.00 40.32  ? 314 SER B CB    1 
ATOM   4327  O  OG    . SER B  1 173 ? 19.032  54.354  44.222  1.00 43.69  ? 314 SER B OG    1 
ATOM   4328  N  N     . LYS B  1 174 ? 15.623  54.480  43.741  1.00 29.02  ? 315 LYS B N     1 
ATOM   4329  C  CA    . LYS B  1 174 ? 14.690  53.978  42.736  1.00 30.64  ? 315 LYS B CA    1 
ATOM   4330  C  C     . LYS B  1 174 ? 15.387  53.414  41.496  1.00 35.21  ? 315 LYS B C     1 
ATOM   4331  O  O     . LYS B  1 174 ? 14.733  52.886  40.596  1.00 39.50  ? 315 LYS B O     1 
ATOM   4332  C  CB    . LYS B  1 174 ? 13.712  55.076  42.317  1.00 28.94  ? 315 LYS B CB    1 
ATOM   4333  C  CG    . LYS B  1 174 ? 12.842  55.626  43.444  1.00 28.33  ? 315 LYS B CG    1 
ATOM   4334  C  CD    . LYS B  1 174 ? 11.836  56.636  42.893  1.00 30.66  ? 315 LYS B CD    1 
ATOM   4335  C  CE    . LYS B  1 174 ? 10.756  56.978  43.903  1.00 32.75  ? 315 LYS B CE    1 
ATOM   4336  N  NZ    . LYS B  1 174 ? 9.720   57.857  43.299  1.00 35.00  ? 315 LYS B NZ    1 
ATOM   4337  N  N     . GLY B  1 175 ? 16.711  53.522  41.444  1.00 34.64  ? 316 GLY B N     1 
ATOM   4338  C  CA    . GLY B  1 175 ? 17.460  52.986  40.321  1.00 31.84  ? 316 GLY B CA    1 
ATOM   4339  C  C     . GLY B  1 175 ? 17.461  51.469  40.297  1.00 33.78  ? 316 GLY B C     1 
ATOM   4340  O  O     . GLY B  1 175 ? 16.830  50.833  41.144  1.00 34.10  ? 316 GLY B O     1 
ATOM   4341  N  N     . SER B  1 176 ? 18.162  50.880  39.332  1.00 31.40  ? 317 SER B N     1 
ATOM   4342  C  CA    . SER B  1 176 ? 18.214  49.431  39.255  1.00 34.39  ? 317 SER B CA    1 
ATOM   4343  C  C     . SER B  1 176 ? 19.161  48.903  40.321  1.00 32.35  ? 317 SER B C     1 
ATOM   4344  O  O     . SER B  1 176 ? 20.144  49.558  40.664  1.00 32.16  ? 317 SER B O     1 
ATOM   4345  C  CB    . SER B  1 176 ? 18.637  48.964  37.864  1.00 42.32  ? 317 SER B CB    1 
ATOM   4346  O  OG    . SER B  1 176 ? 19.985  49.302  37.590  1.00 50.46  ? 317 SER B OG    1 
ATOM   4347  N  N     . TRP B  1 177 ? 18.845  47.725  40.850  1.00 28.90  ? 318 TRP B N     1 
ATOM   4348  C  CA    . TRP B  1 177 ? 19.589  47.141  41.960  1.00 29.31  ? 318 TRP B CA    1 
ATOM   4349  C  C     . TRP B  1 177 ? 21.035  46.863  41.572  1.00 34.39  ? 318 TRP B C     1 
ATOM   4350  O  O     . TRP B  1 177 ? 21.308  46.481  40.431  1.00 41.73  ? 318 TRP B O     1 
ATOM   4351  C  CB    . TRP B  1 177 ? 18.922  45.843  42.423  1.00 32.01  ? 318 TRP B CB    1 
ATOM   4352  C  CG    . TRP B  1 177 ? 17.521  46.009  42.958  1.00 30.45  ? 318 TRP B CG    1 
ATOM   4353  C  CD1   . TRP B  1 177 ? 16.736  47.126  42.888  1.00 28.50  ? 318 TRP B CD1   1 
ATOM   4354  C  CD2   . TRP B  1 177 ? 16.744  45.021  43.649  1.00 25.37  ? 318 TRP B CD2   1 
ATOM   4355  N  NE1   . TRP B  1 177 ? 15.524  46.889  43.488  1.00 23.83  ? 318 TRP B NE1   1 
ATOM   4356  C  CE2   . TRP B  1 177 ? 15.506  45.605  43.964  1.00 24.19  ? 318 TRP B CE2   1 
ATOM   4357  C  CE3   . TRP B  1 177 ? 16.982  43.696  44.030  1.00 20.39  ? 318 TRP B CE3   1 
ATOM   4358  C  CZ2   . TRP B  1 177 ? 14.504  44.908  44.643  1.00 32.29  ? 318 TRP B CZ2   1 
ATOM   4359  C  CZ3   . TRP B  1 177 ? 15.991  43.010  44.701  1.00 23.67  ? 318 TRP B CZ3   1 
ATOM   4360  C  CH2   . TRP B  1 177 ? 14.768  43.613  45.004  1.00 31.67  ? 318 TRP B CH2   1 
ATOM   4361  N  N     . PRO B  1 178 ? 21.968  47.060  42.522  1.00 31.29  ? 319 PRO B N     1 
ATOM   4362  C  CA    . PRO B  1 178 ? 23.390  46.804  42.277  1.00 25.18  ? 319 PRO B CA    1 
ATOM   4363  C  C     . PRO B  1 178 ? 23.616  45.432  41.651  1.00 30.73  ? 319 PRO B C     1 
ATOM   4364  O  O     . PRO B  1 178 ? 22.832  44.513  41.888  1.00 29.13  ? 319 PRO B O     1 
ATOM   4365  C  CB    . PRO B  1 178 ? 23.990  46.841  43.681  1.00 19.42  ? 319 PRO B CB    1 
ATOM   4366  C  CG    . PRO B  1 178 ? 23.122  47.795  44.424  1.00 20.75  ? 319 PRO B CG    1 
ATOM   4367  C  CD    . PRO B  1 178 ? 21.728  47.554  43.893  1.00 27.66  ? 319 PRO B CD    1 
ATOM   4368  N  N     . ILE B  1 179 ? 24.680  45.310  40.865  1.00 37.00  ? 320 ILE B N     1 
ATOM   4369  C  CA    . ILE B  1 179 ? 24.941  44.115  40.078  1.00 38.97  ? 320 ILE B CA    1 
ATOM   4370  C  C     . ILE B  1 179 ? 25.202  42.887  40.945  1.00 43.08  ? 320 ILE B C     1 
ATOM   4371  O  O     . ILE B  1 179 ? 25.073  41.756  40.482  1.00 48.73  ? 320 ILE B O     1 
ATOM   4372  C  CB    . ILE B  1 179 ? 26.146  44.330  39.154  1.00 41.17  ? 320 ILE B CB    1 
ATOM   4373  C  CG1   . ILE B  1 179 ? 27.389  44.659  39.984  1.00 45.08  ? 320 ILE B CG1   1 
ATOM   4374  C  CG2   . ILE B  1 179 ? 25.865  45.453  38.172  1.00 39.93  ? 320 ILE B CG2   1 
ATOM   4375  C  CD1   . ILE B  1 179 ? 28.695  44.290  39.314  1.00 47.21  ? 320 ILE B CD1   1 
ATOM   4376  N  N     . SER B  1 180 ? 25.564  43.111  42.204  1.00 41.77  ? 321 SER B N     1 
ATOM   4377  C  CA    . SER B  1 180 ? 25.845  42.013  43.123  1.00 41.61  ? 321 SER B CA    1 
ATOM   4378  C  C     . SER B  1 180 ? 24.586  41.200  43.417  1.00 39.60  ? 321 SER B C     1 
ATOM   4379  O  O     . SER B  1 180 ? 24.670  40.086  43.937  1.00 40.15  ? 321 SER B O     1 
ATOM   4380  C  CB    . SER B  1 180 ? 26.445  42.543  44.424  1.00 43.94  ? 321 SER B CB    1 
ATOM   4381  O  OG    . SER B  1 180 ? 25.538  43.406  45.086  1.00 46.11  ? 321 SER B OG    1 
ATOM   4382  N  N     . THR B  1 181 ? 23.429  41.760  43.065  1.00 34.86  ? 322 THR B N     1 
ATOM   4383  C  CA    . THR B  1 181 ? 22.147  41.097  43.253  1.00 31.07  ? 322 THR B CA    1 
ATOM   4384  C  C     . THR B  1 181 ? 21.620  40.483  41.965  1.00 36.65  ? 322 THR B C     1 
ATOM   4385  O  O     . THR B  1 181 ? 20.543  39.891  41.960  1.00 42.95  ? 322 THR B O     1 
ATOM   4386  C  CB    . THR B  1 181 ? 21.075  42.085  43.737  1.00 25.65  ? 322 THR B CB    1 
ATOM   4387  O  OG1   . THR B  1 181 ? 20.646  42.895  42.637  1.00 26.12  ? 322 THR B OG1   1 
ATOM   4388  C  CG2   . THR B  1 181 ? 21.613  42.970  44.835  1.00 22.72  ? 322 THR B CG2   1 
ATOM   4389  N  N     . LYS B  1 182 ? 22.363  40.634  40.874  1.00 36.79  ? 323 LYS B N     1 
ATOM   4390  C  CA    . LYS B  1 182 ? 21.876  40.214  39.563  1.00 37.85  ? 323 LYS B CA    1 
ATOM   4391  C  C     . LYS B  1 182 ? 21.577  38.714  39.495  1.00 37.91  ? 323 LYS B C     1 
ATOM   4392  O  O     . LYS B  1 182 ? 20.597  38.302  38.872  1.00 36.79  ? 323 LYS B O     1 
ATOM   4393  C  CB    . LYS B  1 182 ? 22.866  40.621  38.471  1.00 42.61  ? 323 LYS B CB    1 
ATOM   4394  C  CG    . LYS B  1 182 ? 22.319  40.528  37.050  1.00 44.76  ? 323 LYS B CG    1 
ATOM   4395  C  CD    . LYS B  1 182 ? 23.342  41.038  36.043  1.00 47.06  ? 323 LYS B CD    1 
ATOM   4396  C  CE    . LYS B  1 182 ? 22.816  40.968  34.618  1.00 48.27  ? 323 LYS B CE    1 
ATOM   4397  N  NZ    . LYS B  1 182 ? 23.773  41.573  33.649  1.00 49.59  ? 323 LYS B NZ    1 
ATOM   4398  N  N     . GLU B  1 183 ? 22.410  37.902  40.142  1.00 39.56  ? 324 GLU B N     1 
ATOM   4399  C  CA    . GLU B  1 183 ? 22.177  36.463  40.175  1.00 39.49  ? 324 GLU B CA    1 
ATOM   4400  C  C     . GLU B  1 183 ? 21.402  36.050  41.419  1.00 40.89  ? 324 GLU B C     1 
ATOM   4401  O  O     . GLU B  1 183 ? 21.120  34.864  41.618  1.00 45.07  ? 324 GLU B O     1 
ATOM   4402  C  CB    . GLU B  1 183 ? 23.495  35.694  40.098  1.00 44.88  ? 324 GLU B CB    1 
ATOM   4403  C  CG    . GLU B  1 183 ? 24.319  36.009  38.859  1.00 50.77  ? 324 GLU B CG    1 
ATOM   4404  C  CD    . GLU B  1 183 ? 23.528  35.847  37.578  1.00 55.66  ? 324 GLU B CD    1 
ATOM   4405  O  OE1   . GLU B  1 183 ? 22.779  34.856  37.457  1.00 55.69  ? 324 GLU B OE1   1 
ATOM   4406  O  OE2   . GLU B  1 183 ? 23.646  36.718  36.693  1.00 59.72  ? 324 GLU B OE2   1 
ATOM   4407  N  N     . GLY B  1 184 ? 21.053  37.030  42.249  1.00 37.38  ? 325 GLY B N     1 
ATOM   4408  C  CA    . GLY B  1 184 ? 20.292  36.773  43.458  1.00 32.73  ? 325 GLY B CA    1 
ATOM   4409  C  C     . GLY B  1 184 ? 18.811  36.604  43.173  1.00 34.78  ? 325 GLY B C     1 
ATOM   4410  O  O     . GLY B  1 184 ? 18.394  36.695  42.019  1.00 38.35  ? 325 GLY B O     1 
ATOM   4411  N  N     . LEU B  1 185 ? 18.026  36.361  44.222  1.00 33.90  ? 326 LEU B N     1 
ATOM   4412  C  CA    . LEU B  1 185 ? 16.582  36.132  44.105  1.00 33.47  ? 326 LEU B CA    1 
ATOM   4413  C  C     . LEU B  1 185 ? 16.241  35.119  43.009  1.00 35.27  ? 326 LEU B C     1 
ATOM   4414  O  O     . LEU B  1 185 ? 15.655  35.481  41.990  1.00 35.18  ? 326 LEU B O     1 
ATOM   4415  C  CB    . LEU B  1 185 ? 15.849  37.462  43.866  1.00 31.62  ? 326 LEU B CB    1 
ATOM   4416  C  CG    . LEU B  1 185 ? 14.329  37.561  44.026  1.00 26.92  ? 326 LEU B CG    1 
ATOM   4417  C  CD1   . LEU B  1 185 ? 13.902  37.194  45.430  1.00 25.35  ? 326 LEU B CD1   1 
ATOM   4418  C  CD2   . LEU B  1 185 ? 13.852  38.963  43.675  1.00 25.82  ? 326 LEU B CD2   1 
ATOM   4419  N  N     . PRO B  1 186 ? 16.622  33.844  43.210  1.00 36.41  ? 327 PRO B N     1 
ATOM   4420  C  CA    . PRO B  1 186 ? 16.406  32.812  42.189  1.00 32.76  ? 327 PRO B CA    1 
ATOM   4421  C  C     . PRO B  1 186 ? 15.026  32.166  42.289  1.00 32.52  ? 327 PRO B C     1 
ATOM   4422  O  O     . PRO B  1 186 ? 14.931  30.941  42.346  1.00 31.99  ? 327 PRO B O     1 
ATOM   4423  C  CB    . PRO B  1 186 ? 17.490  31.783  42.515  1.00 33.90  ? 327 PRO B CB    1 
ATOM   4424  C  CG    . PRO B  1 186 ? 17.678  31.896  43.991  1.00 35.39  ? 327 PRO B CG    1 
ATOM   4425  C  CD    . PRO B  1 186 ? 17.401  33.332  44.355  1.00 36.41  ? 327 PRO B CD    1 
ATOM   4426  N  N     . ILE B  1 187 ? 13.973  32.980  42.281  1.00 32.39  ? 328 ILE B N     1 
ATOM   4427  C  CA    . ILE B  1 187 ? 12.604  32.492  42.440  1.00 29.95  ? 328 ILE B CA    1 
ATOM   4428  C  C     . ILE B  1 187 ? 11.956  32.054  41.127  1.00 36.99  ? 328 ILE B C     1 
ATOM   4429  O  O     . ILE B  1 187 ? 10.786  31.666  41.106  1.00 39.35  ? 328 ILE B O     1 
ATOM   4430  C  CB    . ILE B  1 187 ? 11.716  33.589  43.016  1.00 24.52  ? 328 ILE B CB    1 
ATOM   4431  C  CG1   . ILE B  1 187 ? 11.624  34.762  42.035  1.00 18.44  ? 328 ILE B CG1   1 
ATOM   4432  C  CG2   . ILE B  1 187 ? 12.250  34.057  44.354  1.00 25.30  ? 328 ILE B CG2   1 
ATOM   4433  C  CD1   . ILE B  1 187 ? 10.713  35.857  42.494  1.00 17.61  ? 328 ILE B CD1   1 
ATOM   4434  N  N     . GLN B  1 188 ? 12.725  32.116  40.044  1.00 39.99  ? 329 GLN B N     1 
ATOM   4435  C  CA    . GLN B  1 188 ? 12.214  31.963  38.681  1.00 38.49  ? 329 GLN B CA    1 
ATOM   4436  C  C     . GLN B  1 188 ? 11.416  30.685  38.383  1.00 37.86  ? 329 GLN B C     1 
ATOM   4437  O  O     . GLN B  1 188 ? 10.632  30.652  37.430  1.00 37.08  ? 329 GLN B O     1 
ATOM   4438  C  CB    . GLN B  1 188 ? 13.370  32.110  37.689  1.00 40.11  ? 329 GLN B CB    1 
ATOM   4439  C  CG    . GLN B  1 188 ? 14.709  32.412  38.364  1.00 44.49  ? 329 GLN B CG    1 
ATOM   4440  C  CD    . GLN B  1 188 ? 15.358  33.680  37.850  1.00 48.73  ? 329 GLN B CD    1 
ATOM   4441  O  OE1   . GLN B  1 188 ? 14.800  34.387  37.010  1.00 52.39  ? 329 GLN B OE1   1 
ATOM   4442  N  NE2   . GLN B  1 188 ? 16.545  33.975  38.356  1.00 48.48  ? 329 GLN B NE2   1 
ATOM   4443  N  N     . GLY B  1 189 ? 11.603  29.642  39.185  1.00 40.93  ? 330 GLY B N     1 
ATOM   4444  C  CA    . GLY B  1 189 ? 10.844  28.417  38.985  1.00 41.86  ? 330 GLY B CA    1 
ATOM   4445  C  C     . GLY B  1 189 ? 9.827   28.194  40.089  1.00 41.59  ? 330 GLY B C     1 
ATOM   4446  O  O     . GLY B  1 189 ? 9.076   27.214  40.074  1.00 41.64  ? 330 GLY B O     1 
ATOM   4447  N  N     . TRP B  1 190 ? 9.807   29.123  41.041  1.00 39.42  ? 331 TRP B N     1 
ATOM   4448  C  CA    . TRP B  1 190 ? 8.964   29.035  42.227  1.00 35.49  ? 331 TRP B CA    1 
ATOM   4449  C  C     . TRP B  1 190 ? 7.874   30.106  42.179  1.00 36.87  ? 331 TRP B C     1 
ATOM   4450  O  O     . TRP B  1 190 ? 6.684   29.791  42.117  1.00 38.28  ? 331 TRP B O     1 
ATOM   4451  C  CB    . TRP B  1 190 ? 9.835   29.192  43.475  1.00 30.78  ? 331 TRP B CB    1 
ATOM   4452  C  CG    . TRP B  1 190 ? 9.077   29.423  44.744  1.00 29.11  ? 331 TRP B CG    1 
ATOM   4453  C  CD1   . TRP B  1 190 ? 7.836   28.956  45.061  1.00 26.04  ? 331 TRP B CD1   1 
ATOM   4454  C  CD2   . TRP B  1 190 ? 9.516   30.197  45.871  1.00 26.00  ? 331 TRP B CD2   1 
ATOM   4455  N  NE1   . TRP B  1 190 ? 7.476   29.394  46.314  1.00 26.12  ? 331 TRP B NE1   1 
ATOM   4456  C  CE2   . TRP B  1 190 ? 8.491   30.156  46.830  1.00 25.10  ? 331 TRP B CE2   1 
ATOM   4457  C  CE3   . TRP B  1 190 ? 10.677  30.920  46.155  1.00 22.31  ? 331 TRP B CE3   1 
ATOM   4458  C  CZ2   . TRP B  1 190 ? 8.596   30.809  48.060  1.00 24.99  ? 331 TRP B CZ2   1 
ATOM   4459  C  CZ3   . TRP B  1 190 ? 10.779  31.565  47.368  1.00 19.71  ? 331 TRP B CZ3   1 
ATOM   4460  C  CH2   . TRP B  1 190 ? 9.749   31.506  48.306  1.00 22.70  ? 331 TRP B CH2   1 
ATOM   4461  N  N     . LEU B  1 191 ? 8.282   31.372  42.211  1.00 32.50  ? 332 LEU B N     1 
ATOM   4462  C  CA    . LEU B  1 191 ? 7.330   32.473  42.115  1.00 25.00  ? 332 LEU B CA    1 
ATOM   4463  C  C     . LEU B  1 191 ? 7.226   33.003  40.681  1.00 24.64  ? 332 LEU B C     1 
ATOM   4464  O  O     . LEU B  1 191 ? 6.200   33.570  40.291  1.00 25.07  ? 332 LEU B O     1 
ATOM   4465  C  CB    . LEU B  1 191 ? 7.693   33.590  43.091  1.00 19.67  ? 332 LEU B CB    1 
ATOM   4466  C  CG    . LEU B  1 191 ? 7.804   33.184  44.560  1.00 20.39  ? 332 LEU B CG    1 
ATOM   4467  C  CD1   . LEU B  1 191 ? 8.254   34.349  45.430  1.00 17.85  ? 332 LEU B CD1   1 
ATOM   4468  C  CD2   . LEU B  1 191 ? 6.484   32.637  45.066  1.00 22.87  ? 332 LEU B CD2   1 
ATOM   4469  N  N     . GLY B  1 192 ? 8.284   32.819  39.896  1.00 21.61  ? 333 GLY B N     1 
ATOM   4470  C  CA    . GLY B  1 192 ? 8.224   33.143  38.483  1.00 28.80  ? 333 GLY B CA    1 
ATOM   4471  C  C     . GLY B  1 192 ? 9.073   34.314  38.032  1.00 30.65  ? 333 GLY B C     1 
ATOM   4472  O  O     . GLY B  1 192 ? 9.708   34.982  38.845  1.00 27.74  ? 333 GLY B O     1 
ATOM   4473  N  N     . THR B  1 193 ? 9.059   34.564  36.723  1.00 33.37  ? 334 THR B N     1 
ATOM   4474  C  CA    . THR B  1 193 ? 9.873   35.604  36.103  1.00 32.64  ? 334 THR B CA    1 
ATOM   4475  C  C     . THR B  1 193 ? 9.228   36.992  36.143  1.00 37.01  ? 334 THR B C     1 
ATOM   4476  O  O     . THR B  1 193 ? 9.923   38.001  36.286  1.00 40.81  ? 334 THR B O     1 
ATOM   4477  C  CB    . THR B  1 193 ? 10.215  35.238  34.651  1.00 31.55  ? 334 THR B CB    1 
ATOM   4478  O  OG1   . THR B  1 193 ? 9.015   34.913  33.937  1.00 30.10  ? 334 THR B OG1   1 
ATOM   4479  C  CG2   . THR B  1 193 ? 11.149  34.040  34.612  1.00 29.35  ? 334 THR B CG2   1 
ATOM   4480  N  N     . LYS B  1 194 ? 7.904   37.039  36.017  1.00 31.80  ? 335 LYS B N     1 
ATOM   4481  C  CA    . LYS B  1 194 ? 7.171   38.302  36.070  1.00 30.09  ? 335 LYS B CA    1 
ATOM   4482  C  C     . LYS B  1 194 ? 7.149   38.880  37.485  1.00 28.68  ? 335 LYS B C     1 
ATOM   4483  O  O     . LYS B  1 194 ? 7.166   40.106  37.672  1.00 32.19  ? 335 LYS B O     1 
ATOM   4484  C  CB    . LYS B  1 194 ? 5.743   38.119  35.552  1.00 29.10  ? 335 LYS B CB    1 
ATOM   4485  C  CG    . LYS B  1 194 ? 5.660   37.778  34.069  1.00 28.33  ? 335 LYS B CG    1 
ATOM   4486  C  CD    . LYS B  1 194 ? 4.238   37.918  33.538  1.00 25.06  ? 335 LYS B CD    1 
ATOM   4487  C  CE    . LYS B  1 194 ? 3.347   36.783  33.993  1.00 25.34  ? 335 LYS B CE    1 
ATOM   4488  N  NZ    . LYS B  1 194 ? 3.568   35.543  33.201  1.00 25.54  ? 335 LYS B NZ    1 
ATOM   4489  N  N     . VAL B  1 195 ? 7.116   37.990  38.474  1.00 25.10  ? 336 VAL B N     1 
ATOM   4490  C  CA    . VAL B  1 195 ? 7.188   38.385  39.876  1.00 25.43  ? 336 VAL B CA    1 
ATOM   4491  C  C     . VAL B  1 195 ? 8.564   38.954  40.186  1.00 25.28  ? 336 VAL B C     1 
ATOM   4492  O  O     . VAL B  1 195 ? 8.672   40.054  40.710  1.00 28.41  ? 336 VAL B O     1 
ATOM   4493  C  CB    . VAL B  1 195 ? 6.864   37.209  40.823  1.00 27.43  ? 336 VAL B CB    1 
ATOM   4494  C  CG1   . VAL B  1 195 ? 7.237   37.545  42.251  1.00 30.51  ? 336 VAL B CG1   1 
ATOM   4495  C  CG2   . VAL B  1 195 ? 5.391   36.858  40.749  1.00 22.90  ? 336 VAL B CG2   1 
ATOM   4496  N  N     . ARG B  1 196 ? 9.611   38.208  39.852  1.00 24.90  ? 337 ARG B N     1 
ATOM   4497  C  CA    . ARG B  1 196 ? 10.980  38.665  40.070  1.00 26.71  ? 337 ARG B CA    1 
ATOM   4498  C  C     . ARG B  1 196 ? 11.239  39.988  39.350  1.00 25.99  ? 337 ARG B C     1 
ATOM   4499  O  O     . ARG B  1 196 ? 11.876  40.893  39.897  1.00 28.11  ? 337 ARG B O     1 
ATOM   4500  C  CB    . ARG B  1 196 ? 11.974  37.602  39.594  1.00 31.22  ? 337 ARG B CB    1 
ATOM   4501  C  CG    . ARG B  1 196 ? 13.425  37.942  39.888  1.00 34.03  ? 337 ARG B CG    1 
ATOM   4502  C  CD    . ARG B  1 196 ? 14.382  36.874  39.394  1.00 33.84  ? 337 ARG B CD    1 
ATOM   4503  N  NE    . ARG B  1 196 ? 15.761  37.192  39.760  1.00 37.05  ? 337 ARG B NE    1 
ATOM   4504  C  CZ    . ARG B  1 196 ? 16.565  37.968  39.036  1.00 35.22  ? 337 ARG B CZ    1 
ATOM   4505  N  NH1   . ARG B  1 196 ? 16.131  38.516  37.908  1.00 32.07  ? 337 ARG B NH1   1 
ATOM   4506  N  NH2   . ARG B  1 196 ? 17.806  38.202  39.440  1.00 35.73  ? 337 ARG B NH2   1 
ATOM   4507  N  N     . THR B  1 197 ? 10.723  40.096  38.128  1.00 27.20  ? 338 THR B N     1 
ATOM   4508  C  CA    . THR B  1 197 ? 10.888  41.303  37.325  1.00 28.80  ? 338 THR B CA    1 
ATOM   4509  C  C     . THR B  1 197 ? 10.213  42.483  38.003  1.00 30.73  ? 338 THR B C     1 
ATOM   4510  O  O     . THR B  1 197 ? 10.773  43.580  38.047  1.00 31.93  ? 338 THR B O     1 
ATOM   4511  C  CB    . THR B  1 197 ? 10.301  41.145  35.916  1.00 30.38  ? 338 THR B CB    1 
ATOM   4512  O  OG1   . THR B  1 197 ? 10.816  39.955  35.307  1.00 35.33  ? 338 THR B OG1   1 
ATOM   4513  C  CG2   . THR B  1 197 ? 10.652  42.347  35.054  1.00 30.77  ? 338 THR B CG2   1 
ATOM   4514  N  N     . ASN B  1 198 ? 9.005   42.258  38.515  1.00 33.57  ? 339 ASN B N     1 
ATOM   4515  C  CA    . ASN B  1 198 ? 8.271   43.314  39.204  1.00 35.47  ? 339 ASN B CA    1 
ATOM   4516  C  C     . ASN B  1 198 ? 8.889   43.702  40.543  1.00 33.77  ? 339 ASN B C     1 
ATOM   4517  O  O     . ASN B  1 198 ? 8.804   44.853  40.960  1.00 40.43  ? 339 ASN B O     1 
ATOM   4518  C  CB    . ASN B  1 198 ? 6.806   42.923  39.389  1.00 39.96  ? 339 ASN B CB    1 
ATOM   4519  C  CG    . ASN B  1 198 ? 6.013   43.012  38.103  1.00 46.64  ? 339 ASN B CG    1 
ATOM   4520  O  OD1   . ASN B  1 198 ? 6.432   43.660  37.147  1.00 48.07  ? 339 ASN B OD1   1 
ATOM   4521  N  ND2   . ASN B  1 198 ? 4.851   42.368  38.078  1.00 46.25  ? 339 ASN B ND2   1 
ATOM   4522  N  N     . LEU B  1 199 ? 9.499   42.735  41.216  1.00 26.81  ? 340 LEU B N     1 
ATOM   4523  C  CA    . LEU B  1 199 ? 10.110  42.974  42.510  1.00 25.78  ? 340 LEU B CA    1 
ATOM   4524  C  C     . LEU B  1 199 ? 11.395  43.778  42.337  1.00 30.03  ? 340 LEU B C     1 
ATOM   4525  O  O     . LEU B  1 199 ? 11.656  44.705  43.097  1.00 30.73  ? 340 LEU B O     1 
ATOM   4526  C  CB    . LEU B  1 199 ? 10.371  41.650  43.237  1.00 24.18  ? 340 LEU B CB    1 
ATOM   4527  C  CG    . LEU B  1 199 ? 9.146   40.932  43.820  1.00 24.52  ? 340 LEU B CG    1 
ATOM   4528  C  CD1   . LEU B  1 199 ? 9.496   39.571  44.418  1.00 22.24  ? 340 LEU B CD1   1 
ATOM   4529  C  CD2   . LEU B  1 199 ? 8.445   41.792  44.859  1.00 10.73  ? 340 LEU B CD2   1 
ATOM   4530  N  N     . ARG B  1 200 ? 12.183  43.438  41.320  1.00 32.68  ? 341 ARG B N     1 
ATOM   4531  C  CA    . ARG B  1 200 ? 13.433  44.151  41.054  1.00 31.31  ? 341 ARG B CA    1 
ATOM   4532  C  C     . ARG B  1 200 ? 13.220  45.518  40.387  1.00 30.93  ? 341 ARG B C     1 
ATOM   4533  O  O     . ARG B  1 200 ? 14.176  46.279  40.210  1.00 31.32  ? 341 ARG B O     1 
ATOM   4534  C  CB    . ARG B  1 200 ? 14.379  43.286  40.217  1.00 29.18  ? 341 ARG B CB    1 
ATOM   4535  C  CG    . ARG B  1 200 ? 14.931  42.079  40.962  1.00 29.54  ? 341 ARG B CG    1 
ATOM   4536  C  CD    . ARG B  1 200 ? 15.875  41.265  40.087  1.00 35.80  ? 341 ARG B CD    1 
ATOM   4537  N  NE    . ARG B  1 200 ? 16.930  42.085  39.495  1.00 35.23  ? 341 ARG B NE    1 
ATOM   4538  C  CZ    . ARG B  1 200 ? 18.112  42.291  40.063  1.00 35.02  ? 341 ARG B CZ    1 
ATOM   4539  N  NH1   . ARG B  1 200 ? 18.388  41.742  41.238  1.00 37.36  ? 341 ARG B NH1   1 
ATOM   4540  N  NH2   . ARG B  1 200 ? 19.018  43.046  39.463  1.00 35.61  ? 341 ARG B NH2   1 
ATOM   4541  N  N     . ARG B  1 201 ? 11.973  45.823  40.027  1.00 29.18  ? 342 ARG B N     1 
ATOM   4542  C  CA    . ARG B  1 201 ? 11.610  47.149  39.525  1.00 27.68  ? 342 ARG B CA    1 
ATOM   4543  C  C     . ARG B  1 201 ? 11.336  48.093  40.688  1.00 28.79  ? 342 ARG B C     1 
ATOM   4544  O  O     . ARG B  1 201 ? 11.163  49.301  40.498  1.00 31.45  ? 342 ARG B O     1 
ATOM   4545  C  CB    . ARG B  1 201 ? 10.361  47.081  38.650  1.00 28.11  ? 342 ARG B CB    1 
ATOM   4546  C  CG    . ARG B  1 201 ? 10.601  46.700  37.196  1.00 27.84  ? 342 ARG B CG    1 
ATOM   4547  C  CD    . ARG B  1 201 ? 9.426   47.130  36.322  1.00 34.17  ? 342 ARG B CD    1 
ATOM   4548  N  NE    . ARG B  1 201 ? 9.629   46.785  34.918  1.00 40.72  ? 342 ARG B NE    1 
ATOM   4549  C  CZ    . ARG B  1 201 ? 8.972   45.819  34.286  1.00 41.65  ? 342 ARG B CZ    1 
ATOM   4550  N  NH1   . ARG B  1 201 ? 8.056   45.105  34.927  1.00 40.18  ? 342 ARG B NH1   1 
ATOM   4551  N  NH2   . ARG B  1 201 ? 9.223   45.572  33.009  1.00 42.35  ? 342 ARG B NH2   1 
ATOM   4552  N  N     . GLU B  1 202 ? 11.286  47.530  41.891  1.00 28.10  ? 343 GLU B N     1 
ATOM   4553  C  CA    . GLU B  1 202 ? 11.040  48.304  43.096  1.00 25.99  ? 343 GLU B CA    1 
ATOM   4554  C  C     . GLU B  1 202 ? 12.333  48.956  43.552  1.00 26.74  ? 343 GLU B C     1 
ATOM   4555  O  O     . GLU B  1 202 ? 13.408  48.588  43.083  1.00 36.45  ? 343 GLU B O     1 
ATOM   4556  C  CB    . GLU B  1 202 ? 10.509  47.390  44.193  1.00 33.31  ? 343 GLU B CB    1 
ATOM   4557  C  CG    . GLU B  1 202 ? 9.133   46.817  43.916  1.00 38.07  ? 343 GLU B CG    1 
ATOM   4558  C  CD    . GLU B  1 202 ? 8.059   47.874  43.939  1.00 48.23  ? 343 GLU B CD    1 
ATOM   4559  O  OE1   . GLU B  1 202 ? 7.553   48.176  45.035  1.00 50.43  ? 343 GLU B OE1   1 
ATOM   4560  O  OE2   . GLU B  1 202 ? 7.721   48.409  42.864  1.00 56.95  ? 343 GLU B OE2   1 
ATOM   4561  N  N     . PRO B  1 203 ? 12.242  49.946  44.454  1.00 26.35  ? 344 PRO B N     1 
ATOM   4562  C  CA    . PRO B  1 203 ? 13.501  50.544  44.906  1.00 25.05  ? 344 PRO B CA    1 
ATOM   4563  C  C     . PRO B  1 203 ? 14.296  49.596  45.791  1.00 30.16  ? 344 PRO B C     1 
ATOM   4564  O  O     . PRO B  1 203 ? 13.749  48.581  46.233  1.00 34.25  ? 344 PRO B O     1 
ATOM   4565  C  CB    . PRO B  1 203 ? 13.038  51.742  45.736  1.00 19.97  ? 344 PRO B CB    1 
ATOM   4566  C  CG    . PRO B  1 203 ? 11.672  52.052  45.257  1.00 19.24  ? 344 PRO B CG    1 
ATOM   4567  C  CD    . PRO B  1 203 ? 11.071  50.723  44.903  1.00 23.35  ? 344 PRO B CD    1 
ATOM   4568  N  N     . PHE B  1 204 ? 15.568  49.914  46.024  1.00 29.14  ? 345 PHE B N     1 
ATOM   4569  C  CA    . PHE B  1 204 ? 16.366  49.169  46.987  1.00 26.49  ? 345 PHE B CA    1 
ATOM   4570  C  C     . PHE B  1 204 ? 16.777  50.098  48.117  1.00 30.35  ? 345 PHE B C     1 
ATOM   4571  O  O     . PHE B  1 204 ? 16.652  51.320  47.998  1.00 31.65  ? 345 PHE B O     1 
ATOM   4572  C  CB    . PHE B  1 204 ? 17.584  48.509  46.339  1.00 28.02  ? 345 PHE B CB    1 
ATOM   4573  C  CG    . PHE B  1 204 ? 18.640  49.476  45.877  1.00 27.77  ? 345 PHE B CG    1 
ATOM   4574  C  CD1   . PHE B  1 204 ? 18.595  50.000  44.594  1.00 26.91  ? 345 PHE B CD1   1 
ATOM   4575  C  CD2   . PHE B  1 204 ? 19.696  49.832  46.711  1.00 25.35  ? 345 PHE B CD2   1 
ATOM   4576  C  CE1   . PHE B  1 204 ? 19.567  50.875  44.154  1.00 26.06  ? 345 PHE B CE1   1 
ATOM   4577  C  CE2   . PHE B  1 204 ? 20.670  50.710  46.281  1.00 21.59  ? 345 PHE B CE2   1 
ATOM   4578  C  CZ    . PHE B  1 204 ? 20.609  51.228  44.998  1.00 23.89  ? 345 PHE B CZ    1 
ATOM   4579  N  N     . TYR B  1 205 ? 17.258  49.526  49.215  1.00 30.24  ? 346 TYR B N     1 
ATOM   4580  C  CA    . TYR B  1 205 ? 17.487  50.314  50.416  1.00 26.68  ? 346 TYR B CA    1 
ATOM   4581  C  C     . TYR B  1 205 ? 18.839  50.050  51.050  1.00 24.56  ? 346 TYR B C     1 
ATOM   4582  O  O     . TYR B  1 205 ? 19.353  48.935  50.988  1.00 27.67  ? 346 TYR B O     1 
ATOM   4583  C  CB    . TYR B  1 205 ? 16.369  50.065  51.425  1.00 27.24  ? 346 TYR B CB    1 
ATOM   4584  C  CG    . TYR B  1 205 ? 15.002  50.311  50.847  1.00 29.42  ? 346 TYR B CG    1 
ATOM   4585  C  CD1   . TYR B  1 205 ? 14.282  49.286  50.254  1.00 32.07  ? 346 TYR B CD1   1 
ATOM   4586  C  CD2   . TYR B  1 205 ? 14.436  51.571  50.882  1.00 30.58  ? 346 TYR B CD2   1 
ATOM   4587  C  CE1   . TYR B  1 205 ? 13.028  49.513  49.719  1.00 32.18  ? 346 TYR B CE1   1 
ATOM   4588  C  CE2   . TYR B  1 205 ? 13.188  51.804  50.351  1.00 30.46  ? 346 TYR B CE2   1 
ATOM   4589  C  CZ    . TYR B  1 205 ? 12.489  50.777  49.773  1.00 31.21  ? 346 TYR B CZ    1 
ATOM   4590  O  OH    . TYR B  1 205 ? 11.240  51.019  49.246  1.00 34.07  ? 346 TYR B OH    1 
ATOM   4591  N  N     . LEU B  1 206 ? 19.407  51.088  51.655  1.00 24.31  ? 347 LEU B N     1 
ATOM   4592  C  CA    . LEU B  1 206 ? 20.692  50.975  52.335  1.00 21.12  ? 347 LEU B CA    1 
ATOM   4593  C  C     . LEU B  1 206 ? 20.551  51.410  53.789  1.00 26.66  ? 347 LEU B C     1 
ATOM   4594  O  O     . LEU B  1 206 ? 20.108  52.523  54.075  1.00 26.86  ? 347 LEU B O     1 
ATOM   4595  C  CB    . LEU B  1 206 ? 21.742  51.848  51.649  1.00 20.12  ? 347 LEU B CB    1 
ATOM   4596  C  CG    . LEU B  1 206 ? 22.215  51.492  50.241  1.00 21.57  ? 347 LEU B CG    1 
ATOM   4597  C  CD1   . LEU B  1 206 ? 22.711  52.735  49.544  1.00 26.74  ? 347 LEU B CD1   1 
ATOM   4598  C  CD2   . LEU B  1 206 ? 23.326  50.473  50.285  1.00 19.21  ? 347 LEU B CD2   1 
ATOM   4599  N  N     . VAL B  1 207 ? 20.929  50.527  54.706  1.00 31.26  ? 348 VAL B N     1 
ATOM   4600  C  CA    . VAL B  1 207 ? 20.877  50.835  56.129  1.00 29.92  ? 348 VAL B CA    1 
ATOM   4601  C  C     . VAL B  1 207 ? 22.313  50.991  56.625  1.00 34.72  ? 348 VAL B C     1 
ATOM   4602  O  O     . VAL B  1 207 ? 23.227  50.444  56.022  1.00 40.28  ? 348 VAL B O     1 
ATOM   4603  C  CB    . VAL B  1 207 ? 20.117  49.736  56.905  1.00 28.07  ? 348 VAL B CB    1 
ATOM   4604  C  CG1   . VAL B  1 207 ? 18.737  49.539  56.312  1.00 25.83  ? 348 VAL B CG1   1 
ATOM   4605  C  CG2   . VAL B  1 207 ? 20.867  48.424  56.854  1.00 26.40  ? 348 VAL B CG2   1 
ATOM   4606  N  N     . PRO B  1 208 ? 22.529  51.768  57.701  1.00 30.21  ? 349 PRO B N     1 
ATOM   4607  C  CA    . PRO B  1 208 ? 23.908  51.916  58.186  1.00 23.09  ? 349 PRO B CA    1 
ATOM   4608  C  C     . PRO B  1 208 ? 24.457  50.603  58.729  1.00 33.49  ? 349 PRO B C     1 
ATOM   4609  O  O     . PRO B  1 208 ? 23.760  49.918  59.475  1.00 42.97  ? 349 PRO B O     1 
ATOM   4610  C  CB    . PRO B  1 208 ? 23.766  52.902  59.349  1.00 19.63  ? 349 PRO B CB    1 
ATOM   4611  C  CG    . PRO B  1 208 ? 22.478  53.622  59.102  1.00 20.61  ? 349 PRO B CG    1 
ATOM   4612  C  CD    . PRO B  1 208 ? 21.582  52.620  58.445  1.00 25.53  ? 349 PRO B CD    1 
ATOM   4613  N  N     . LYS B  1 209 ? 25.690  50.262  58.373  1.00 35.18  ? 350 LYS B N     1 
ATOM   4614  C  CA    . LYS B  1 209 ? 26.326  49.070  58.913  1.00 34.79  ? 350 LYS B CA    1 
ATOM   4615  C  C     . LYS B  1 209 ? 26.660  49.287  60.386  1.00 41.58  ? 350 LYS B C     1 
ATOM   4616  O  O     . LYS B  1 209 ? 26.459  48.397  61.210  1.00 48.24  ? 350 LYS B O     1 
ATOM   4617  C  CB    . LYS B  1 209 ? 27.586  48.729  58.123  1.00 31.29  ? 350 LYS B CB    1 
ATOM   4618  C  CG    . LYS B  1 209 ? 28.244  47.422  58.548  1.00 35.98  ? 350 LYS B CG    1 
ATOM   4619  C  CD    . LYS B  1 209 ? 29.621  47.275  57.916  1.00 38.56  ? 350 LYS B CD    1 
ATOM   4620  C  CE    . LYS B  1 209 ? 30.243  45.928  58.247  1.00 40.09  ? 350 LYS B CE    1 
ATOM   4621  N  NZ    . LYS B  1 209 ? 31.579  45.762  57.605  1.00 41.86  ? 350 LYS B NZ    1 
ATOM   4622  N  N     . ASN B  1 210 ? 27.173  50.475  60.698  1.00 40.37  ? 351 ASN B N     1 
ATOM   4623  C  CA    . ASN B  1 210 ? 27.433  50.906  62.073  1.00 38.58  ? 351 ASN B CA    1 
ATOM   4624  C  C     . ASN B  1 210 ? 28.200  49.908  62.940  1.00 41.36  ? 351 ASN B C     1 
ATOM   4625  O  O     . ASN B  1 210 ? 27.920  49.765  64.132  1.00 44.14  ? 351 ASN B O     1 
ATOM   4626  C  CB    . ASN B  1 210 ? 26.132  51.316  62.768  1.00 36.05  ? 351 ASN B CB    1 
ATOM   4627  C  CG    . ASN B  1 210 ? 26.355  52.330  63.877  1.00 40.41  ? 351 ASN B CG    1 
ATOM   4628  O  OD1   . ASN B  1 210 ? 27.211  53.207  63.775  1.00 46.66  ? 351 ASN B OD1   1 
ATOM   4629  N  ND2   . ASN B  1 210 ? 25.579  52.214  64.943  1.00 43.00  ? 351 ASN B ND2   1 
ATOM   4630  N  N     . ALA B  1 211 ? 29.160  49.213  62.338  1.00 37.64  ? 352 ALA B N     1 
ATOM   4631  C  CA    . ALA B  1 211 ? 30.084  48.389  63.106  1.00 34.07  ? 352 ALA B CA    1 
ATOM   4632  C  C     . ALA B  1 211 ? 30.973  49.316  63.925  1.00 39.81  ? 352 ALA B C     1 
ATOM   4633  O  O     . ALA B  1 211 ? 31.277  50.430  63.493  1.00 43.13  ? 352 ALA B O     1 
ATOM   4634  C  CB    . ALA B  1 211 ? 30.917  47.538  62.184  1.00 31.02  ? 352 ALA B CB    1 
ATOM   4635  N  N     . LYS B  1 212 ? 31.386  48.869  65.106  1.00 38.75  ? 353 LYS B N     1 
ATOM   4636  C  CA    . LYS B  1 212 ? 32.248  49.693  65.944  1.00 40.55  ? 353 LYS B CA    1 
ATOM   4637  C  C     . LYS B  1 212 ? 33.624  49.058  66.140  1.00 43.10  ? 353 LYS B C     1 
ATOM   4638  O  O     . LYS B  1 212 ? 34.150  49.027  67.254  1.00 44.06  ? 353 LYS B O     1 
ATOM   4639  C  CB    . LYS B  1 212 ? 31.579  49.982  67.287  1.00 43.44  ? 353 LYS B CB    1 
ATOM   4640  C  CG    . LYS B  1 212 ? 30.305  50.826  67.187  1.00 43.75  ? 353 LYS B CG    1 
ATOM   4641  C  CD    . LYS B  1 212 ? 30.563  52.149  66.467  1.00 43.42  ? 353 LYS B CD    1 
ATOM   4642  C  CE    . LYS B  1 212 ? 29.366  53.087  66.587  1.00 44.09  ? 353 LYS B CE    1 
ATOM   4643  N  NZ    . LYS B  1 212 ? 29.627  54.414  65.964  1.00 41.11  ? 353 LYS B NZ    1 
ATOM   4644  N  N     . ASP B  1 213 ? 34.207  48.582  65.041  1.00 44.53  ? 354 ASP B N     1 
ATOM   4645  C  CA    . ASP B  1 213 ? 35.477  47.860  65.076  1.00 46.54  ? 354 ASP B CA    1 
ATOM   4646  C  C     . ASP B  1 213 ? 36.713  48.751  64.904  1.00 45.26  ? 354 ASP B C     1 
ATOM   4647  O  O     . ASP B  1 213 ? 37.824  48.355  65.266  1.00 43.27  ? 354 ASP B O     1 
ATOM   4648  C  CB    . ASP B  1 213 ? 35.485  46.739  64.032  1.00 47.63  ? 354 ASP B CB    1 
ATOM   4649  C  CG    . ASP B  1 213 ? 34.984  47.198  62.674  1.00 48.50  ? 354 ASP B CG    1 
ATOM   4650  O  OD1   . ASP B  1 213 ? 34.993  48.420  62.406  1.00 48.10  ? 354 ASP B OD1   1 
ATOM   4651  O  OD2   . ASP B  1 213 ? 34.589  46.331  61.867  1.00 49.33  ? 354 ASP B OD2   1 
ATOM   4652  N  N     . GLY B  1 214 ? 36.525  49.942  64.343  1.00 44.32  ? 355 GLY B N     1 
ATOM   4653  C  CA    . GLY B  1 214 ? 37.617  50.891  64.196  1.00 41.50  ? 355 GLY B CA    1 
ATOM   4654  C  C     . GLY B  1 214 ? 38.297  50.851  62.840  1.00 45.37  ? 355 GLY B C     1 
ATOM   4655  O  O     . GLY B  1 214 ? 39.309  51.523  62.624  1.00 45.74  ? 355 GLY B O     1 
ATOM   4656  N  N     . ASN B  1 215 ? 37.737  50.066  61.925  1.00 46.90  ? 356 ASN B N     1 
ATOM   4657  C  CA    . ASN B  1 215 ? 38.304  49.917  60.591  1.00 48.33  ? 356 ASN B CA    1 
ATOM   4658  C  C     . ASN B  1 215 ? 38.127  51.145  59.706  1.00 49.51  ? 356 ASN B C     1 
ATOM   4659  O  O     . ASN B  1 215 ? 37.559  52.153  60.122  1.00 46.33  ? 356 ASN B O     1 
ATOM   4660  C  CB    . ASN B  1 215 ? 37.713  48.696  59.888  1.00 52.15  ? 356 ASN B CB    1 
ATOM   4661  C  CG    . ASN B  1 215 ? 38.332  47.400  60.358  1.00 56.31  ? 356 ASN B CG    1 
ATOM   4662  O  OD1   . ASN B  1 215 ? 39.440  47.388  60.890  1.00 58.52  ? 356 ASN B OD1   1 
ATOM   4663  N  ND2   . ASN B  1 215 ? 37.623  46.295  60.153  1.00 55.74  ? 356 ASN B ND2   1 
ATOM   4664  N  N     . SER B  1 216 ? 38.622  51.046  58.477  1.00 53.01  ? 357 SER B N     1 
ATOM   4665  C  CA    . SER B  1 216 ? 38.521  52.137  57.521  1.00 52.79  ? 357 SER B CA    1 
ATOM   4666  C  C     . SER B  1 216 ? 37.113  52.207  56.939  1.00 50.86  ? 357 SER B C     1 
ATOM   4667  O  O     . SER B  1 216 ? 36.457  51.178  56.779  1.00 52.93  ? 357 SER B O     1 
ATOM   4668  C  CB    . SER B  1 216 ? 39.555  51.955  56.412  1.00 54.33  ? 357 SER B CB    1 
ATOM   4669  O  OG    . SER B  1 216 ? 40.836  51.705  56.962  1.00 54.68  ? 357 SER B OG    1 
ATOM   4670  N  N     . PHE B  1 217 ? 36.655  53.423  56.645  1.00 46.89  ? 358 PHE B N     1 
ATOM   4671  C  CA    . PHE B  1 217 ? 35.303  53.662  56.139  1.00 40.61  ? 358 PHE B CA    1 
ATOM   4672  C  C     . PHE B  1 217 ? 34.246  53.141  57.109  1.00 40.49  ? 358 PHE B C     1 
ATOM   4673  O  O     . PHE B  1 217 ? 33.141  52.785  56.707  1.00 41.50  ? 358 PHE B O     1 
ATOM   4674  C  CB    . PHE B  1 217 ? 35.119  53.035  54.753  1.00 36.73  ? 358 PHE B CB    1 
ATOM   4675  C  CG    . PHE B  1 217 ? 36.164  53.442  53.759  1.00 33.82  ? 358 PHE B CG    1 
ATOM   4676  C  CD1   . PHE B  1 217 ? 36.057  54.643  53.070  1.00 35.94  ? 358 PHE B CD1   1 
ATOM   4677  C  CD2   . PHE B  1 217 ? 37.249  52.621  53.504  1.00 33.40  ? 358 PHE B CD2   1 
ATOM   4678  C  CE1   . PHE B  1 217 ? 37.019  55.015  52.143  1.00 34.62  ? 358 PHE B CE1   1 
ATOM   4679  C  CE2   . PHE B  1 217 ? 38.215  52.986  52.579  1.00 31.99  ? 358 PHE B CE2   1 
ATOM   4680  C  CZ    . PHE B  1 217 ? 38.098  54.182  51.899  1.00 32.93  ? 358 PHE B CZ    1 
ATOM   4681  N  N     . GLN B  1 218 ? 34.603  53.120  58.387  1.00 41.41  ? 359 GLN B N     1 
ATOM   4682  C  CA    . GLN B  1 218 ? 33.782  52.540  59.439  1.00 39.81  ? 359 GLN B CA    1 
ATOM   4683  C  C     . GLN B  1 218 ? 32.411  53.192  59.535  1.00 42.25  ? 359 GLN B C     1 
ATOM   4684  O  O     . GLN B  1 218 ? 31.390  52.500  59.601  1.00 48.29  ? 359 GLN B O     1 
ATOM   4685  C  CB    . GLN B  1 218 ? 34.512  52.685  60.774  1.00 40.61  ? 359 GLN B CB    1 
ATOM   4686  C  CG    . GLN B  1 218 ? 33.855  51.997  61.960  1.00 38.94  ? 359 GLN B CG    1 
ATOM   4687  C  CD    . GLN B  1 218 ? 34.538  52.348  63.268  1.00 40.29  ? 359 GLN B CD    1 
ATOM   4688  O  OE1   . GLN B  1 218 ? 35.454  53.170  63.302  1.00 42.14  ? 359 GLN B OE1   1 
ATOM   4689  N  NE2   . GLN B  1 218 ? 34.094  51.733  64.350  1.00 39.40  ? 359 GLN B NE2   1 
ATOM   4690  N  N     . GLY B  1 219 ? 32.393  54.523  59.542  1.00 40.12  ? 360 GLY B N     1 
ATOM   4691  C  CA    . GLY B  1 219 ? 31.158  55.269  59.716  1.00 38.45  ? 360 GLY B CA    1 
ATOM   4692  C  C     . GLY B  1 219 ? 30.522  55.730  58.420  1.00 39.08  ? 360 GLY B C     1 
ATOM   4693  O  O     . GLY B  1 219 ? 29.590  56.538  58.435  1.00 43.62  ? 360 GLY B O     1 
ATOM   4694  N  N     . GLU B  1 220 ? 31.013  55.207  57.301  1.00 35.28  ? 361 GLU B N     1 
ATOM   4695  C  CA    . GLU B  1 220 ? 30.475  55.563  55.998  1.00 35.40  ? 361 GLU B CA    1 
ATOM   4696  C  C     . GLU B  1 220 ? 30.013  54.324  55.235  1.00 34.00  ? 361 GLU B C     1 
ATOM   4697  O  O     . GLU B  1 220 ? 29.623  54.421  54.071  1.00 37.66  ? 361 GLU B O     1 
ATOM   4698  C  CB    . GLU B  1 220 ? 31.529  56.313  55.175  1.00 39.50  ? 361 GLU B CB    1 
ATOM   4699  C  CG    . GLU B  1 220 ? 32.242  57.443  55.908  1.00 36.51  ? 361 GLU B CG    1 
ATOM   4700  C  CD    . GLU B  1 220 ? 33.572  57.016  56.480  1.00 36.33  ? 361 GLU B CD    1 
ATOM   4701  O  OE1   . GLU B  1 220 ? 33.665  56.833  57.707  1.00 40.48  ? 361 GLU B OE1   1 
ATOM   4702  O  OE2   . GLU B  1 220 ? 34.533  56.877  55.701  1.00 37.99  ? 361 GLU B OE2   1 
ATOM   4703  N  N     . THR B  1 221 ? 30.064  53.164  55.890  1.00 30.99  ? 362 THR B N     1 
ATOM   4704  C  CA    . THR B  1 221 ? 29.699  51.898  55.250  1.00 30.03  ? 362 THR B CA    1 
ATOM   4705  C  C     . THR B  1 221 ? 28.214  51.592  55.403  1.00 30.00  ? 362 THR B C     1 
ATOM   4706  O  O     . THR B  1 221 ? 27.693  51.567  56.523  1.00 28.20  ? 362 THR B O     1 
ATOM   4707  C  CB    . THR B  1 221 ? 30.478  50.703  55.831  1.00 31.69  ? 362 THR B CB    1 
ATOM   4708  O  OG1   . THR B  1 221 ? 31.848  51.063  56.046  1.00 31.32  ? 362 THR B OG1   1 
ATOM   4709  C  CG2   . THR B  1 221 ? 30.405  49.516  54.884  1.00 33.06  ? 362 THR B CG2   1 
ATOM   4710  N  N     . TRP B  1 222 ? 27.546  51.344  54.277  1.00 31.59  ? 363 TRP B N     1 
ATOM   4711  C  CA    . TRP B  1 222 ? 26.135  50.976  54.275  1.00 30.01  ? 363 TRP B CA    1 
ATOM   4712  C  C     . TRP B  1 222 ? 25.962  49.534  53.824  1.00 32.25  ? 363 TRP B C     1 
ATOM   4713  O  O     . TRP B  1 222 ? 26.764  49.020  53.040  1.00 36.52  ? 363 TRP B O     1 
ATOM   4714  C  CB    . TRP B  1 222 ? 25.350  51.896  53.343  1.00 28.69  ? 363 TRP B CB    1 
ATOM   4715  C  CG    . TRP B  1 222 ? 25.479  53.344  53.693  1.00 27.84  ? 363 TRP B CG    1 
ATOM   4716  C  CD1   . TRP B  1 222 ? 26.513  54.178  53.376  1.00 28.49  ? 363 TRP B CD1   1 
ATOM   4717  C  CD2   . TRP B  1 222 ? 24.535  54.135  54.423  1.00 22.79  ? 363 TRP B CD2   1 
ATOM   4718  N  NE1   . TRP B  1 222 ? 26.272  55.437  53.872  1.00 24.63  ? 363 TRP B NE1   1 
ATOM   4719  C  CE2   . TRP B  1 222 ? 25.063  55.435  54.517  1.00 24.06  ? 363 TRP B CE2   1 
ATOM   4720  C  CE3   . TRP B  1 222 ? 23.297  53.866  55.004  1.00 22.53  ? 363 TRP B CE3   1 
ATOM   4721  C  CZ2   . TRP B  1 222 ? 24.384  56.468  55.173  1.00 25.54  ? 363 TRP B CZ2   1 
ATOM   4722  C  CZ3   . TRP B  1 222 ? 22.630  54.888  55.656  1.00 23.57  ? 363 TRP B CZ3   1 
ATOM   4723  C  CH2   . TRP B  1 222 ? 23.172  56.169  55.738  1.00 23.97  ? 363 TRP B CH2   1 
ATOM   4724  N  N     . ARG B  1 223 ? 24.914  48.889  54.323  1.00 32.46  ? 364 ARG B N     1 
ATOM   4725  C  CA    . ARG B  1 223 ? 24.560  47.538  53.908  1.00 34.05  ? 364 ARG B CA    1 
ATOM   4726  C  C     . ARG B  1 223 ? 23.227  47.541  53.166  1.00 31.03  ? 364 ARG B C     1 
ATOM   4727  O  O     . ARG B  1 223 ? 22.293  48.245  53.559  1.00 30.68  ? 364 ARG B O     1 
ATOM   4728  C  CB    . ARG B  1 223 ? 24.471  46.617  55.125  1.00 37.96  ? 364 ARG B CB    1 
ATOM   4729  C  CG    . ARG B  1 223 ? 24.179  45.166  54.781  1.00 42.89  ? 364 ARG B CG    1 
ATOM   4730  C  CD    . ARG B  1 223 ? 24.040  44.305  56.025  1.00 48.14  ? 364 ARG B CD    1 
ATOM   4731  N  NE    . ARG B  1 223 ? 22.898  44.697  56.849  1.00 52.26  ? 364 ARG B NE    1 
ATOM   4732  C  CZ    . ARG B  1 223 ? 22.998  45.369  57.991  1.00 51.56  ? 364 ARG B CZ    1 
ATOM   4733  N  NH1   . ARG B  1 223 ? 24.190  45.720  58.450  1.00 50.60  ? 364 ARG B NH1   1 
ATOM   4734  N  NH2   . ARG B  1 223 ? 21.910  45.688  58.681  1.00 51.29  ? 364 ARG B NH2   1 
ATOM   4735  N  N     . LEU B  1 224 ? 23.150  46.763  52.089  1.00 30.67  ? 365 LEU B N     1 
ATOM   4736  C  CA    . LEU B  1 224 ? 21.900  46.576  51.353  1.00 27.41  ? 365 LEU B CA    1 
ATOM   4737  C  C     . LEU B  1 224 ? 20.842  45.913  52.236  1.00 26.63  ? 365 LEU B C     1 
ATOM   4738  O  O     . LEU B  1 224 ? 21.167  45.105  53.109  1.00 28.66  ? 365 LEU B O     1 
ATOM   4739  C  CB    . LEU B  1 224 ? 22.127  45.727  50.095  1.00 26.85  ? 365 LEU B CB    1 
ATOM   4740  C  CG    . LEU B  1 224 ? 22.797  46.357  48.872  1.00 28.21  ? 365 LEU B CG    1 
ATOM   4741  C  CD1   . LEU B  1 224 ? 23.112  45.321  47.808  1.00 27.85  ? 365 LEU B CD1   1 
ATOM   4742  C  CD2   . LEU B  1 224 ? 21.927  47.441  48.278  1.00 27.17  ? 365 LEU B CD2   1 
ATOM   4743  N  N     . SER B  1 225 ? 19.580  46.263  52.006  1.00 24.03  ? 366 SER B N     1 
ATOM   4744  C  CA    . SER B  1 225 ? 18.468  45.695  52.764  1.00 24.20  ? 366 SER B CA    1 
ATOM   4745  C  C     . SER B  1 225 ? 17.301  45.382  51.832  1.00 28.57  ? 366 SER B C     1 
ATOM   4746  O  O     . SER B  1 225 ? 17.002  46.157  50.922  1.00 29.86  ? 366 SER B O     1 
ATOM   4747  C  CB    . SER B  1 225 ? 18.025  46.650  53.876  1.00 24.28  ? 366 SER B CB    1 
ATOM   4748  O  OG    . SER B  1 225 ? 16.904  46.131  54.564  1.00 28.05  ? 366 SER B OG    1 
ATOM   4749  N  N     . PHE B  1 226 ? 16.647  44.246  52.057  1.00 32.73  ? 367 PHE B N     1 
ATOM   4750  C  CA    . PHE B  1 226 ? 15.554  43.826  51.192  1.00 32.25  ? 367 PHE B CA    1 
ATOM   4751  C  C     . PHE B  1 226 ? 14.337  43.366  51.989  1.00 34.81  ? 367 PHE B C     1 
ATOM   4752  O  O     . PHE B  1 226 ? 13.655  42.420  51.601  1.00 45.49  ? 367 PHE B O     1 
ATOM   4753  C  CB    . PHE B  1 226 ? 16.023  42.712  50.253  1.00 33.19  ? 367 PHE B CB    1 
ATOM   4754  C  CG    . PHE B  1 226 ? 17.130  43.128  49.323  1.00 32.89  ? 367 PHE B CG    1 
ATOM   4755  C  CD1   . PHE B  1 226 ? 16.868  43.942  48.229  1.00 32.22  ? 367 PHE B CD1   1 
ATOM   4756  C  CD2   . PHE B  1 226 ? 18.434  42.700  49.539  1.00 32.62  ? 367 PHE B CD2   1 
ATOM   4757  C  CE1   . PHE B  1 226 ? 17.893  44.324  47.372  1.00 31.81  ? 367 PHE B CE1   1 
ATOM   4758  C  CE2   . PHE B  1 226 ? 19.458  43.077  48.683  1.00 27.01  ? 367 PHE B CE2   1 
ATOM   4759  C  CZ    . PHE B  1 226 ? 19.187  43.887  47.603  1.00 27.13  ? 367 PHE B CZ    1 
ATOM   4760  N  N     . SER B  1 227 ? 14.055  44.055  53.090  1.00 29.00  ? 368 SER B N     1 
ATOM   4761  C  CA    . SER B  1 227 ? 12.944  43.692  53.961  1.00 23.29  ? 368 SER B CA    1 
ATOM   4762  C  C     . SER B  1 227 ? 11.582  43.815  53.278  1.00 21.86  ? 368 SER B C     1 
ATOM   4763  O  O     . SER B  1 227 ? 10.659  43.060  53.591  1.00 29.52  ? 368 SER B O     1 
ATOM   4764  C  CB    . SER B  1 227 ? 12.987  44.529  55.235  1.00 25.48  ? 368 SER B CB    1 
ATOM   4765  O  OG    . SER B  1 227 ? 14.247  44.426  55.864  1.00 29.69  ? 368 SER B OG    1 
ATOM   4766  N  N     . HIS B  1 228 ? 11.460  44.751  52.341  1.00 16.77  ? 369 HIS B N     1 
ATOM   4767  C  CA    . HIS B  1 228 ? 10.223  44.899  51.574  1.00 20.29  ? 369 HIS B CA    1 
ATOM   4768  C  C     . HIS B  1 228 ? 9.918   43.670  50.709  1.00 26.21  ? 369 HIS B C     1 
ATOM   4769  O  O     . HIS B  1 228 ? 8.791   43.152  50.691  1.00 30.91  ? 369 HIS B O     1 
ATOM   4770  C  CB    . HIS B  1 228 ? 10.245  46.180  50.726  1.00 20.26  ? 369 HIS B CB    1 
ATOM   4771  C  CG    . HIS B  1 228 ? 11.383  46.262  49.751  1.00 31.44  ? 369 HIS B CG    1 
ATOM   4772  N  ND1   . HIS B  1 228 ? 12.689  46.002  50.099  1.00 35.67  ? 369 HIS B ND1   1 
ATOM   4773  C  CD2   . HIS B  1 228 ? 11.405  46.614  48.442  1.00 34.02  ? 369 HIS B CD2   1 
ATOM   4774  C  CE1   . HIS B  1 228 ? 13.468  46.171  49.041  1.00 30.52  ? 369 HIS B CE1   1 
ATOM   4775  N  NE2   . HIS B  1 228 ? 12.714  46.545  48.027  1.00 31.64  ? 369 HIS B NE2   1 
ATOM   4776  N  N     . THR B  1 229 ? 10.940  43.200  50.010  1.00 27.83  ? 370 THR B N     1 
ATOM   4777  C  CA    . THR B  1 229 ? 10.813  42.041  49.147  1.00 26.10  ? 370 THR B CA    1 
ATOM   4778  C  C     . THR B  1 229 ? 10.560  40.777  49.957  1.00 25.99  ? 370 THR B C     1 
ATOM   4779  O  O     . THR B  1 229 ? 9.781   39.920  49.543  1.00 35.23  ? 370 THR B O     1 
ATOM   4780  C  CB    . THR B  1 229 ? 12.073  41.861  48.314  1.00 27.19  ? 370 THR B CB    1 
ATOM   4781  O  OG1   . THR B  1 229 ? 12.384  43.095  47.657  1.00 30.35  ? 370 THR B OG1   1 
ATOM   4782  C  CG2   . THR B  1 229 ? 11.871  40.784  47.281  1.00 24.76  ? 370 THR B CG2   1 
ATOM   4783  N  N     . GLU B  1 230 ? 11.228  40.659  51.101  1.00 21.48  ? 371 GLU B N     1 
ATOM   4784  C  CA    . GLU B  1 230 ? 11.055  39.504  51.977  1.00 22.76  ? 371 GLU B CA    1 
ATOM   4785  C  C     . GLU B  1 230 ? 9.637   39.481  52.540  1.00 27.94  ? 371 GLU B C     1 
ATOM   4786  O  O     . GLU B  1 230 ? 9.030   38.421  52.694  1.00 31.73  ? 371 GLU B O     1 
ATOM   4787  C  CB    . GLU B  1 230 ? 12.087  39.529  53.110  1.00 21.78  ? 371 GLU B CB    1 
ATOM   4788  C  CG    . GLU B  1 230 ? 13.538  39.426  52.645  1.00 21.90  ? 371 GLU B CG    1 
ATOM   4789  C  CD    . GLU B  1 230 ? 14.524  39.786  53.737  1.00 25.28  ? 371 GLU B CD    1 
ATOM   4790  O  OE1   . GLU B  1 230 ? 14.098  39.886  54.908  1.00 26.68  ? 371 GLU B OE1   1 
ATOM   4791  O  OE2   . GLU B  1 230 ? 15.721  39.964  53.424  1.00 23.40  ? 371 GLU B OE2   1 
ATOM   4792  N  N     . LYS B  1 231 ? 9.122   40.663  52.853  1.00 27.91  ? 372 LYS B N     1 
ATOM   4793  C  CA    . LYS B  1 231 ? 7.741   40.812  53.291  1.00 30.48  ? 372 LYS B CA    1 
ATOM   4794  C  C     . LYS B  1 231 ? 6.806   40.298  52.203  1.00 31.74  ? 372 LYS B C     1 
ATOM   4795  O  O     . LYS B  1 231 ? 5.915   39.480  52.466  1.00 36.69  ? 372 LYS B O     1 
ATOM   4796  C  CB    . LYS B  1 231 ? 7.463   42.285  53.576  1.00 31.25  ? 372 LYS B CB    1 
ATOM   4797  C  CG    . LYS B  1 231 ? 6.181   42.571  54.328  1.00 34.80  ? 372 LYS B CG    1 
ATOM   4798  C  CD    . LYS B  1 231 ? 6.086   44.061  54.600  1.00 37.30  ? 372 LYS B CD    1 
ATOM   4799  C  CE    . LYS B  1 231 ? 4.763   44.426  55.215  1.00 39.04  ? 372 LYS B CE    1 
ATOM   4800  N  NZ    . LYS B  1 231 ? 4.629   45.900  55.328  1.00 41.29  ? 372 LYS B NZ    1 
ATOM   4801  N  N     . TYR B  1 232 ? 7.024   40.760  50.974  1.00 31.98  ? 373 TYR B N     1 
ATOM   4802  C  CA    . TYR B  1 232 ? 6.196   40.302  49.861  1.00 31.65  ? 373 TYR B CA    1 
ATOM   4803  C  C     . TYR B  1 232 ? 6.257   38.784  49.679  1.00 35.83  ? 373 TYR B C     1 
ATOM   4804  O  O     . TYR B  1 232 ? 5.233   38.147  49.449  1.00 38.35  ? 373 TYR B O     1 
ATOM   4805  C  CB    . TYR B  1 232 ? 6.574   41.004  48.553  1.00 28.41  ? 373 TYR B CB    1 
ATOM   4806  C  CG    . TYR B  1 232 ? 5.691   40.608  47.388  1.00 31.26  ? 373 TYR B CG    1 
ATOM   4807  C  CD1   . TYR B  1 232 ? 6.067   39.595  46.512  1.00 32.05  ? 373 TYR B CD1   1 
ATOM   4808  C  CD2   . TYR B  1 232 ? 4.479   41.240  47.168  1.00 32.94  ? 373 TYR B CD2   1 
ATOM   4809  C  CE1   . TYR B  1 232 ? 5.259   39.230  45.445  1.00 27.60  ? 373 TYR B CE1   1 
ATOM   4810  C  CE2   . TYR B  1 232 ? 3.665   40.882  46.106  1.00 32.31  ? 373 TYR B CE2   1 
ATOM   4811  C  CZ    . TYR B  1 232 ? 4.063   39.876  45.251  1.00 32.02  ? 373 TYR B CZ    1 
ATOM   4812  O  OH    . TYR B  1 232 ? 3.260   39.514  44.195  1.00 34.96  ? 373 TYR B OH    1 
ATOM   4813  N  N     . ILE B  1 233 ? 7.455   38.213  49.782  1.00 35.42  ? 374 ILE B N     1 
ATOM   4814  C  CA    . ILE B  1 233 ? 7.635   36.773  49.618  1.00 30.63  ? 374 ILE B CA    1 
ATOM   4815  C  C     . ILE B  1 233 ? 6.911   35.993  50.706  1.00 29.82  ? 374 ILE B C     1 
ATOM   4816  O  O     . ILE B  1 233 ? 6.227   35.009  50.423  1.00 36.43  ? 374 ILE B O     1 
ATOM   4817  C  CB    . ILE B  1 233 ? 9.124   36.387  49.605  1.00 29.85  ? 374 ILE B CB    1 
ATOM   4818  C  CG1   . ILE B  1 233 ? 9.803   36.952  48.361  1.00 36.95  ? 374 ILE B CG1   1 
ATOM   4819  C  CG2   . ILE B  1 233 ? 9.292   34.881  49.643  1.00 24.95  ? 374 ILE B CG2   1 
ATOM   4820  C  CD1   . ILE B  1 233 ? 11.281  36.651  48.277  1.00 40.86  ? 374 ILE B CD1   1 
ATOM   4821  N  N     . LEU B  1 234 ? 7.063   36.430  51.951  1.00 28.39  ? 375 LEU B N     1 
ATOM   4822  C  CA    . LEU B  1 234 ? 6.374   35.784  53.058  1.00 24.20  ? 375 LEU B CA    1 
ATOM   4823  C  C     . LEU B  1 234 ? 4.863   35.848  52.865  1.00 23.47  ? 375 LEU B C     1 
ATOM   4824  O  O     . LEU B  1 234 ? 4.154   34.908  53.218  1.00 26.21  ? 375 LEU B O     1 
ATOM   4825  C  CB    . LEU B  1 234 ? 6.777   36.409  54.394  1.00 22.99  ? 375 LEU B CB    1 
ATOM   4826  C  CG    . LEU B  1 234 ? 7.825   35.636  55.192  1.00 20.64  ? 375 LEU B CG    1 
ATOM   4827  C  CD1   . LEU B  1 234 ? 7.318   34.245  55.475  1.00 21.62  ? 375 LEU B CD1   1 
ATOM   4828  C  CD2   . LEU B  1 234 ? 9.141   35.567  54.448  1.00 17.80  ? 375 LEU B CD2   1 
ATOM   4829  N  N     . ASN B  1 235 ? 4.368   36.936  52.283  1.00 25.46  ? 376 ASN B N     1 
ATOM   4830  C  CA    . ASN B  1 235 ? 2.929   37.046  52.073  1.00 28.45  ? 376 ASN B CA    1 
ATOM   4831  C  C     . ASN B  1 235 ? 2.446   36.534  50.714  1.00 35.89  ? 376 ASN B C     1 
ATOM   4832  O  O     . ASN B  1 235 ? 1.245   36.415  50.475  1.00 42.43  ? 376 ASN B O     1 
ATOM   4833  C  CB    . ASN B  1 235 ? 2.444   38.467  52.357  1.00 31.43  ? 376 ASN B CB    1 
ATOM   4834  C  CG    . ASN B  1 235 ? 2.482   38.804  53.839  1.00 40.72  ? 376 ASN B CG    1 
ATOM   4835  O  OD1   . ASN B  1 235 ? 2.136   37.976  54.682  1.00 45.47  ? 376 ASN B OD1   1 
ATOM   4836  N  ND2   . ASN B  1 235 ? 2.922   40.015  54.165  1.00 41.70  ? 376 ASN B ND2   1 
ATOM   4837  N  N     . ASN B  1 236 ? 3.386   36.222  49.832  1.00 34.54  ? 377 ASN B N     1 
ATOM   4838  C  CA    . ASN B  1 236 ? 3.053   35.627  48.547  1.00 31.75  ? 377 ASN B CA    1 
ATOM   4839  C  C     . ASN B  1 236 ? 4.008   34.478  48.243  1.00 28.14  ? 377 ASN B C     1 
ATOM   4840  O  O     . ASN B  1 236 ? 4.854   34.585  47.358  1.00 34.23  ? 377 ASN B O     1 
ATOM   4841  C  CB    . ASN B  1 236 ? 3.110   36.683  47.439  1.00 30.81  ? 377 ASN B CB    1 
ATOM   4842  C  CG    . ASN B  1 236 ? 2.146   37.829  47.673  1.00 26.76  ? 377 ASN B CG    1 
ATOM   4843  O  OD1   . ASN B  1 236 ? 1.060   37.869  47.098  1.00 24.40  ? 377 ASN B OD1   1 
ATOM   4844  N  ND2   . ASN B  1 236 ? 2.543   38.772  48.515  1.00 25.72  ? 377 ASN B ND2   1 
ATOM   4845  N  N     . HIS B  1 237 ? 3.843   33.372  48.965  1.00 23.62  ? 378 HIS B N     1 
ATOM   4846  C  CA    . HIS B  1 237 ? 4.853   32.317  49.025  1.00 27.40  ? 378 HIS B CA    1 
ATOM   4847  C  C     . HIS B  1 237 ? 4.560   31.030  48.246  1.00 33.59  ? 378 HIS B C     1 
ATOM   4848  O  O     . HIS B  1 237 ? 5.358   30.089  48.289  1.00 40.92  ? 378 HIS B O     1 
ATOM   4849  C  CB    . HIS B  1 237 ? 5.112   31.949  50.487  1.00 24.58  ? 378 HIS B CB    1 
ATOM   4850  C  CG    . HIS B  1 237 ? 3.892   31.473  51.210  1.00 22.29  ? 378 HIS B CG    1 
ATOM   4851  N  ND1   . HIS B  1 237 ? 3.220   32.255  52.129  1.00 18.46  ? 378 HIS B ND1   1 
ATOM   4852  C  CD2   . HIS B  1 237 ? 3.219   30.301  51.159  1.00 23.03  ? 378 HIS B CD2   1 
ATOM   4853  C  CE1   . HIS B  1 237 ? 2.186   31.581  52.605  1.00 19.49  ? 378 HIS B CE1   1 
ATOM   4854  N  NE2   . HIS B  1 237 ? 2.165   30.393  52.030  1.00 19.67  ? 378 HIS B NE2   1 
ATOM   4855  N  N     . GLY B  1 238 ? 3.437   30.971  47.540  1.00 30.74  ? 379 GLY B N     1 
ATOM   4856  C  CA    . GLY B  1 238 ? 3.072   29.747  46.850  1.00 30.95  ? 379 GLY B CA    1 
ATOM   4857  C  C     . GLY B  1 238 ? 3.422   29.727  45.373  1.00 34.67  ? 379 GLY B C     1 
ATOM   4858  O  O     . GLY B  1 238 ? 3.637   30.773  44.764  1.00 37.41  ? 379 GLY B O     1 
ATOM   4859  N  N     . ILE B  1 239 ? 3.496   28.532  44.795  1.00 34.61  ? 380 ILE B N     1 
ATOM   4860  C  CA    . ILE B  1 239 ? 3.559   28.410  43.348  1.00 34.75  ? 380 ILE B CA    1 
ATOM   4861  C  C     . ILE B  1 239 ? 2.159   28.670  42.839  1.00 35.02  ? 380 ILE B C     1 
ATOM   4862  O  O     . ILE B  1 239 ? 1.973   29.262  41.774  1.00 39.35  ? 380 ILE B O     1 
ATOM   4863  C  CB    . ILE B  1 239 ? 3.982   27.012  42.890  1.00 37.08  ? 380 ILE B CB    1 
ATOM   4864  C  CG1   . ILE B  1 239 ? 3.538   25.955  43.893  1.00 39.34  ? 380 ILE B CG1   1 
ATOM   4865  C  CG2   . ILE B  1 239 ? 5.484   26.936  42.699  1.00 38.52  ? 380 ILE B CG2   1 
ATOM   4866  C  CD1   . ILE B  1 239 ? 3.235   24.631  43.261  1.00 42.82  ? 380 ILE B CD1   1 
ATOM   4867  N  N     . GLU B  1 240 ? 1.174   28.211  43.609  1.00 32.53  ? 381 GLU B N     1 
ATOM   4868  C  CA    . GLU B  1 240 ? -0.228  28.476  43.309  1.00 26.88  ? 381 GLU B CA    1 
ATOM   4869  C  C     . GLU B  1 240 ? -0.645  29.757  44.008  1.00 24.77  ? 381 GLU B C     1 
ATOM   4870  O  O     . GLU B  1 240 ? -0.292  29.986  45.164  1.00 29.54  ? 381 GLU B O     1 
ATOM   4871  C  CB    . GLU B  1 240 ? -1.120  27.312  43.750  1.00 26.51  ? 381 GLU B CB    1 
ATOM   4872  C  CG    . GLU B  1 240 ? -0.749  25.978  43.106  1.00 30.51  ? 381 GLU B CG    1 
ATOM   4873  C  CD    . GLU B  1 240 ? -1.913  25.016  43.032  1.00 33.03  ? 381 GLU B CD    1 
ATOM   4874  O  OE1   . GLU B  1 240 ? -2.897  25.210  43.771  1.00 29.43  ? 381 GLU B OE1   1 
ATOM   4875  O  OE2   . GLU B  1 240 ? -1.844  24.065  42.228  1.00 39.74  ? 381 GLU B OE2   1 
ATOM   4876  N  N     . LYS B  1 241 ? -1.402  30.590  43.305  1.00 26.80  ? 382 LYS B N     1 
ATOM   4877  C  CA    . LYS B  1 241 ? -1.797  31.895  43.824  1.00 27.75  ? 382 LYS B CA    1 
ATOM   4878  C  C     . LYS B  1 241 ? -2.803  31.789  44.974  1.00 28.86  ? 382 LYS B C     1 
ATOM   4879  O  O     . LYS B  1 241 ? -3.032  32.748  45.706  1.00 32.86  ? 382 LYS B O     1 
ATOM   4880  C  CB    . LYS B  1 241 ? -2.342  32.746  42.677  1.00 28.41  ? 382 LYS B CB    1 
ATOM   4881  C  CG    . LYS B  1 241 ? -1.363  32.846  41.502  1.00 28.35  ? 382 LYS B CG    1 
ATOM   4882  C  CD    . LYS B  1 241 ? -2.040  33.247  40.200  1.00 27.53  ? 382 LYS B CD    1 
ATOM   4883  C  CE    . LYS B  1 241 ? -1.017  33.317  39.077  1.00 26.90  ? 382 LYS B CE    1 
ATOM   4884  N  NZ    . LYS B  1 241 ? -1.640  33.528  37.740  1.00 26.28  ? 382 LYS B NZ    1 
ATOM   4885  N  N     . THR B  1 242 ? -3.378  30.605  45.140  1.00 30.17  ? 383 THR B N     1 
ATOM   4886  C  CA    . THR B  1 242 ? -4.411  30.374  46.141  1.00 27.18  ? 383 THR B CA    1 
ATOM   4887  C  C     . THR B  1 242 ? -3.842  29.834  47.447  1.00 34.17  ? 383 THR B C     1 
ATOM   4888  O  O     . THR B  1 242 ? -4.587  29.595  48.401  1.00 39.94  ? 383 THR B O     1 
ATOM   4889  C  CB    . THR B  1 242 ? -5.439  29.371  45.623  1.00 21.74  ? 383 THR B CB    1 
ATOM   4890  O  OG1   . THR B  1 242 ? -4.788  28.121  45.357  1.00 28.50  ? 383 THR B OG1   1 
ATOM   4891  C  CG2   . THR B  1 242 ? -6.070  29.884  44.352  1.00 14.67  ? 383 THR B CG2   1 
ATOM   4892  N  N     . CYS B  1 243 ? -2.525  29.640  47.476  1.00 30.26  ? 384 CYS B N     1 
ATOM   4893  C  CA    . CYS B  1 243 ? -1.834  29.113  48.649  1.00 31.40  ? 384 CYS B CA    1 
ATOM   4894  C  C     . CYS B  1 243 ? -2.119  29.962  49.888  1.00 33.09  ? 384 CYS B C     1 
ATOM   4895  O  O     . CYS B  1 243 ? -1.810  31.157  49.914  1.00 31.33  ? 384 CYS B O     1 
ATOM   4896  C  CB    . CYS B  1 243 ? -0.327  29.056  48.377  1.00 33.40  ? 384 CYS B CB    1 
ATOM   4897  S  SG    . CYS B  1 243 ? 0.637   28.063  49.543  1.00 31.69  ? 384 CYS B SG    1 
ATOM   4898  N  N     . CYS B  1 244 ? -2.734  29.333  50.890  1.00 32.77  ? 385 CYS B N     1 
ATOM   4899  C  CA    . CYS B  1 244 ? -3.092  29.968  52.165  1.00 29.52  ? 385 CYS B CA    1 
ATOM   4900  C  C     . CYS B  1 244 ? -4.201  31.016  52.044  1.00 29.18  ? 385 CYS B C     1 
ATOM   4901  O  O     . CYS B  1 244 ? -4.466  31.766  52.991  1.00 30.40  ? 385 CYS B O     1 
ATOM   4902  C  CB    . CYS B  1 244 ? -1.859  30.546  52.870  1.00 28.70  ? 385 CYS B CB    1 
ATOM   4903  S  SG    . CYS B  1 244 ? -0.661  29.295  53.386  1.00 33.88  ? 385 CYS B SG    1 
ATOM   4904  N  N     . GLU B  1 245 ? -4.853  31.052  50.885  1.00 28.09  ? 386 GLU B N     1 
ATOM   4905  C  CA    . GLU B  1 245 ? -5.992  31.940  50.676  1.00 26.19  ? 386 GLU B CA    1 
ATOM   4906  C  C     . GLU B  1 245 ? -7.289  31.268  51.122  1.00 29.98  ? 386 GLU B C     1 
ATOM   4907  O  O     . GLU B  1 245 ? -7.299  30.081  51.442  1.00 35.32  ? 386 GLU B O     1 
ATOM   4908  C  CB    . GLU B  1 245 ? -6.091  32.344  49.211  1.00 18.06  ? 386 GLU B CB    1 
ATOM   4909  C  CG    . GLU B  1 245 ? -5.101  33.411  48.805  1.00 17.27  ? 386 GLU B CG    1 
ATOM   4910  C  CD    . GLU B  1 245 ? -5.404  33.976  47.443  1.00 20.76  ? 386 GLU B CD    1 
ATOM   4911  O  OE1   . GLU B  1 245 ? -6.210  33.362  46.720  1.00 25.52  ? 386 GLU B OE1   1 
ATOM   4912  O  OE2   . GLU B  1 245 ? -4.845  35.035  47.100  1.00 21.06  ? 386 GLU B OE2   1 
ATOM   4913  N  N     . SER B  1 246 ? -8.382  32.022  51.133  1.00 27.34  ? 387 SER B N     1 
ATOM   4914  C  CA    . SER B  1 246 ? -9.653  31.498  51.623  1.00 34.42  ? 387 SER B CA    1 
ATOM   4915  C  C     . SER B  1 246 ? -10.280 30.475  50.667  1.00 41.78  ? 387 SER B C     1 
ATOM   4916  O  O     . SER B  1 246 ? -11.032 29.597  51.093  1.00 43.91  ? 387 SER B O     1 
ATOM   4917  C  CB    . SER B  1 246 ? -10.630 32.639  51.921  1.00 34.10  ? 387 SER B CB    1 
ATOM   4918  O  OG    . SER B  1 246 ? -10.691 33.563  50.851  1.00 37.95  ? 387 SER B OG    1 
ATOM   4919  N  N     . SER B  1 247 ? -9.962  30.588  49.381  1.00 43.66  ? 388 SER B N     1 
ATOM   4920  C  CA    . SER B  1 247 ? -10.423 29.616  48.399  1.00 42.66  ? 388 SER B CA    1 
ATOM   4921  C  C     . SER B  1 247 ? -9.265  28.755  47.905  1.00 43.23  ? 388 SER B C     1 
ATOM   4922  O  O     . SER B  1 247 ? -9.311  28.214  46.798  1.00 44.24  ? 388 SER B O     1 
ATOM   4923  C  CB    . SER B  1 247 ? -11.108 30.313  47.223  1.00 38.96  ? 388 SER B CB    1 
ATOM   4924  O  OG    . SER B  1 247 ? -12.257 31.026  47.641  1.00 35.03  ? 388 SER B OG    1 
ATOM   4925  N  N     . GLY B  1 248 ? -8.233  28.627  48.736  1.00 43.82  ? 389 GLY B N     1 
ATOM   4926  C  CA    . GLY B  1 248 ? -7.089  27.799  48.404  1.00 41.38  ? 389 GLY B CA    1 
ATOM   4927  C  C     . GLY B  1 248 ? -6.727  26.826  49.511  1.00 37.98  ? 389 GLY B C     1 
ATOM   4928  O  O     . GLY B  1 248 ? -7.558  26.517  50.368  1.00 38.39  ? 389 GLY B O     1 
ATOM   4929  N  N     . ALA B  1 249 ? -5.485  26.344  49.502  1.00 32.84  ? 390 ALA B N     1 
ATOM   4930  C  CA    . ALA B  1 249 ? -5.044  25.363  50.491  1.00 29.23  ? 390 ALA B CA    1 
ATOM   4931  C  C     . ALA B  1 249 ? -3.895  25.882  51.346  1.00 34.70  ? 390 ALA B C     1 
ATOM   4932  O  O     . ALA B  1 249 ? -3.002  26.580  50.855  1.00 36.96  ? 390 ALA B O     1 
ATOM   4933  C  CB    . ALA B  1 249 ? -4.643  24.065  49.811  1.00 22.92  ? 390 ALA B CB    1 
ATOM   4934  N  N     . LYS B  1 250 ? -3.920  25.513  52.623  1.00 36.69  ? 391 LYS B N     1 
ATOM   4935  C  CA    . LYS B  1 250 ? -2.884  25.890  53.577  1.00 38.56  ? 391 LYS B CA    1 
ATOM   4936  C  C     . LYS B  1 250 ? -1.591  25.112  53.355  1.00 41.72  ? 391 LYS B C     1 
ATOM   4937  O  O     . LYS B  1 250 ? -1.618  23.919  53.038  1.00 45.38  ? 391 LYS B O     1 
ATOM   4938  C  CB    . LYS B  1 250 ? -3.379  25.625  54.996  1.00 38.63  ? 391 LYS B CB    1 
ATOM   4939  C  CG    . LYS B  1 250 ? -3.480  26.866  55.876  1.00 43.50  ? 391 LYS B CG    1 
ATOM   4940  C  CD    . LYS B  1 250 ? -2.103  27.406  56.237  1.00 47.84  ? 391 LYS B CD    1 
ATOM   4941  C  CE    . LYS B  1 250 ? -2.217  28.627  57.139  1.00 53.13  ? 391 LYS B CE    1 
ATOM   4942  N  NZ    . LYS B  1 250 ? -0.886  29.220  57.448  1.00 56.14  ? 391 LYS B NZ    1 
ATOM   4943  N  N     . CYS B  1 251 ? -0.462  25.795  53.521  1.00 37.69  ? 392 CYS B N     1 
ATOM   4944  C  CA    . CYS B  1 251 ? 0.842   25.150  53.493  1.00 32.82  ? 392 CYS B CA    1 
ATOM   4945  C  C     . CYS B  1 251 ? 1.460   25.311  54.872  1.00 36.76  ? 392 CYS B C     1 
ATOM   4946  O  O     . CYS B  1 251 ? 0.911   26.015  55.719  1.00 38.85  ? 392 CYS B O     1 
ATOM   4947  C  CB    . CYS B  1 251 ? 1.742   25.792  52.445  1.00 26.47  ? 392 CYS B CB    1 
ATOM   4948  S  SG    . CYS B  1 251 ? 2.381   27.396  52.941  1.00 65.57  ? 392 CYS B SG    1 
ATOM   4949  N  N     . CYS B  1 252 ? 2.598   24.670  55.105  1.00 36.97  ? 393 CYS B N     1 
ATOM   4950  C  CA    . CYS B  1 252 ? 3.229   24.737  56.417  1.00 36.64  ? 393 CYS B CA    1 
ATOM   4951  C  C     . CYS B  1 252 ? 4.612   25.394  56.374  1.00 37.61  ? 393 CYS B C     1 
ATOM   4952  O  O     . CYS B  1 252 ? 5.474   25.100  57.201  1.00 41.17  ? 393 CYS B O     1 
ATOM   4953  C  CB    . CYS B  1 252 ? 3.301   23.344  57.048  1.00 39.26  ? 393 CYS B CB    1 
ATOM   4954  S  SG    . CYS B  1 252 ? 4.325   22.147  56.171  1.00 35.31  ? 393 CYS B SG    1 
ATOM   4955  N  N     . ARG B  1 253 ? 4.800   26.295  55.414  1.00 35.32  ? 394 ARG B N     1 
ATOM   4956  C  CA    . ARG B  1 253 ? 6.049   27.025  55.254  1.00 34.95  ? 394 ARG B CA    1 
ATOM   4957  C  C     . ARG B  1 253 ? 6.322   27.937  56.452  1.00 36.26  ? 394 ARG B C     1 
ATOM   4958  O  O     . ARG B  1 253 ? 7.345   27.794  57.131  1.00 40.98  ? 394 ARG B O     1 
ATOM   4959  C  CB    . ARG B  1 253 ? 5.999   27.861  53.973  1.00 32.98  ? 394 ARG B CB    1 
ATOM   4960  C  CG    . ARG B  1 253 ? 6.013   27.062  52.666  1.00 29.81  ? 394 ARG B CG    1 
ATOM   4961  C  CD    . ARG B  1 253 ? 6.020   28.006  51.471  1.00 27.09  ? 394 ARG B CD    1 
ATOM   4962  N  NE    . ARG B  1 253 ? 6.282   27.354  50.189  1.00 27.22  ? 394 ARG B NE    1 
ATOM   4963  C  CZ    . ARG B  1 253 ? 5.335   26.934  49.355  1.00 29.47  ? 394 ARG B CZ    1 
ATOM   4964  N  NH1   . ARG B  1 253 ? 4.055   27.076  49.668  1.00 24.69  ? 394 ARG B NH1   1 
ATOM   4965  N  NH2   . ARG B  1 253 ? 5.662   26.363  48.205  1.00 33.21  ? 394 ARG B NH2   1 
ATOM   4966  N  N     . LYS B  1 254 ? 5.407   28.871  56.704  1.00 34.34  ? 395 LYS B N     1 
ATOM   4967  C  CA    . LYS B  1 254 ? 5.555   29.823  57.801  1.00 31.72  ? 395 LYS B CA    1 
ATOM   4968  C  C     . LYS B  1 254 ? 5.643   29.100  59.138  1.00 31.32  ? 395 LYS B C     1 
ATOM   4969  O  O     . LYS B  1 254 ? 6.326   29.547  60.050  1.00 36.28  ? 395 LYS B O     1 
ATOM   4970  C  CB    . LYS B  1 254 ? 4.388   30.813  57.818  1.00 30.57  ? 395 LYS B CB    1 
ATOM   4971  C  CG    . LYS B  1 254 ? 4.383   31.828  56.672  1.00 26.32  ? 395 LYS B CG    1 
ATOM   4972  C  CD    . LYS B  1 254 ? 3.178   32.758  56.814  1.00 25.27  ? 395 LYS B CD    1 
ATOM   4973  C  CE    . LYS B  1 254 ? 3.395   34.074  56.094  1.00 24.75  ? 395 LYS B CE    1 
ATOM   4974  N  NZ    . LYS B  1 254 ? 2.120   34.815  55.880  1.00 27.12  ? 395 LYS B NZ    1 
ATOM   4975  N  N     . GLU B  1 255 ? 4.946   27.977  59.244  1.00 32.04  ? 396 GLU B N     1 
ATOM   4976  C  CA    . GLU B  1 255 ? 4.998   27.153  60.442  1.00 30.44  ? 396 GLU B CA    1 
ATOM   4977  C  C     . GLU B  1 255 ? 6.410   26.612  60.678  1.00 27.48  ? 396 GLU B C     1 
ATOM   4978  O  O     . GLU B  1 255 ? 6.928   26.700  61.793  1.00 29.63  ? 396 GLU B O     1 
ATOM   4979  C  CB    . GLU B  1 255 ? 3.977   26.015  60.348  1.00 35.14  ? 396 GLU B CB    1 
ATOM   4980  C  CG    . GLU B  1 255 ? 2.516   26.449  60.509  1.00 34.67  ? 396 GLU B CG    1 
ATOM   4981  C  CD    . GLU B  1 255 ? 1.998   27.287  59.348  1.00 42.18  ? 396 GLU B CD    1 
ATOM   4982  O  OE1   . GLU B  1 255 ? 2.596   27.245  58.257  1.00 45.67  ? 396 GLU B OE1   1 
ATOM   4983  O  OE2   . GLU B  1 255 ? 0.988   27.995  59.527  1.00 44.99  ? 396 GLU B OE2   1 
ATOM   4984  N  N     . CYS B  1 256 ? 7.034   26.074  59.630  1.00 26.34  ? 397 CYS B N     1 
ATOM   4985  C  CA    . CYS B  1 256 ? 8.422   25.616  59.724  1.00 26.29  ? 397 CYS B CA    1 
ATOM   4986  C  C     . CYS B  1 256 ? 9.383   26.765  60.035  1.00 27.49  ? 397 CYS B C     1 
ATOM   4987  O  O     . CYS B  1 256 ? 10.337  26.588  60.800  1.00 29.76  ? 397 CYS B O     1 
ATOM   4988  C  CB    . CYS B  1 256 ? 8.854   24.903  58.444  1.00 27.75  ? 397 CYS B CB    1 
ATOM   4989  S  SG    . CYS B  1 256 ? 7.995   23.347  58.103  1.00 45.01  ? 397 CYS B SG    1 
ATOM   4990  N  N     . LEU B  1 257 ? 9.132   27.942  59.461  1.00 29.54  ? 398 LEU B N     1 
ATOM   4991  C  CA    . LEU B  1 257 ? 9.925   29.123  59.809  1.00 30.30  ? 398 LEU B CA    1 
ATOM   4992  C  C     . LEU B  1 257 ? 9.812   29.421  61.297  1.00 39.42  ? 398 LEU B C     1 
ATOM   4993  O  O     . LEU B  1 257 ? 10.816  29.715  61.948  1.00 47.21  ? 398 LEU B O     1 
ATOM   4994  C  CB    . LEU B  1 257 ? 9.511   30.349  58.990  1.00 27.61  ? 398 LEU B CB    1 
ATOM   4995  C  CG    . LEU B  1 257 ? 10.380  31.593  59.202  1.00 22.99  ? 398 LEU B CG    1 
ATOM   4996  C  CD1   . LEU B  1 257 ? 11.833  31.214  59.100  1.00 22.36  ? 398 LEU B CD1   1 
ATOM   4997  C  CD2   . LEU B  1 257 ? 10.069  32.678  58.192  1.00 18.79  ? 398 LEU B CD2   1 
ATOM   4998  N  N     . LYS B  1 258 ? 8.595   29.328  61.831  1.00 36.73  ? 399 LYS B N     1 
ATOM   4999  C  CA    . LYS B  1 258 ? 8.359   29.585  63.248  1.00 34.37  ? 399 LYS B CA    1 
ATOM   5000  C  C     . LYS B  1 258 ? 9.086   28.579  64.127  1.00 30.54  ? 399 LYS B C     1 
ATOM   5001  O  O     . LYS B  1 258 ? 9.822   28.968  65.022  1.00 31.31  ? 399 LYS B O     1 
ATOM   5002  C  CB    . LYS B  1 258 ? 6.863   29.571  63.565  1.00 38.68  ? 399 LYS B CB    1 
ATOM   5003  C  CG    . LYS B  1 258 ? 6.075   30.759  63.016  1.00 38.38  ? 399 LYS B CG    1 
ATOM   5004  C  CD    . LYS B  1 258 ? 4.635   30.712  63.518  1.00 36.78  ? 399 LYS B CD    1 
ATOM   5005  C  CE    . LYS B  1 258 ? 3.826   31.899  63.025  1.00 38.83  ? 399 LYS B CE    1 
ATOM   5006  N  NZ    . LYS B  1 258 ? 2.467   31.924  63.650  1.00 43.65  ? 399 LYS B NZ    1 
ATOM   5007  N  N     . LEU B  1 259 ? 8.871   27.291  63.872  1.00 35.42  ? 400 LEU B N     1 
ATOM   5008  C  CA    . LEU B  1 259 ? 9.539   26.223  64.625  1.00 37.90  ? 400 LEU B CA    1 
ATOM   5009  C  C     . LEU B  1 259 ? 11.062  26.373  64.617  1.00 39.30  ? 400 LEU B C     1 
ATOM   5010  O  O     . LEU B  1 259 ? 11.722  26.225  65.650  1.00 41.16  ? 400 LEU B O     1 
ATOM   5011  C  CB    . LEU B  1 259 ? 9.149   24.851  64.069  1.00 37.76  ? 400 LEU B CB    1 
ATOM   5012  C  CG    . LEU B  1 259 ? 7.688   24.427  64.228  1.00 39.46  ? 400 LEU B CG    1 
ATOM   5013  C  CD1   . LEU B  1 259 ? 7.401   23.097  63.540  1.00 34.43  ? 400 LEU B CD1   1 
ATOM   5014  C  CD2   . LEU B  1 259 ? 7.326   24.348  65.700  1.00 44.41  ? 400 LEU B CD2   1 
ATOM   5015  N  N     . MET B  1 260 ? 11.613  26.678  63.447  1.00 38.34  ? 401 MET B N     1 
ATOM   5016  C  CA    . MET B  1 260 ? 13.053  26.855  63.310  1.00 40.18  ? 401 MET B CA    1 
ATOM   5017  C  C     . MET B  1 260 ? 13.532  28.059  64.127  1.00 41.33  ? 401 MET B C     1 
ATOM   5018  O  O     . MET B  1 260 ? 14.523  27.976  64.877  1.00 46.37  ? 401 MET B O     1 
ATOM   5019  C  CB    . MET B  1 260 ? 13.400  27.021  61.834  1.00 45.20  ? 401 MET B CB    1 
ATOM   5020  C  CG    . MET B  1 260 ? 14.839  26.721  61.495  1.00 50.95  ? 401 MET B CG    1 
ATOM   5021  S  SD    . MET B  1 260 ? 15.399  25.163  62.190  1.00 70.52  ? 401 MET B SD    1 
ATOM   5022  C  CE    . MET B  1 260 ? 17.061  25.107  61.525  1.00 37.72  ? 401 MET B CE    1 
ATOM   5023  N  N     . LYS B  1 261 ? 12.808  29.167  63.984  1.00 37.78  ? 402 LYS B N     1 
ATOM   5024  C  CA    . LYS B  1 261 ? 13.052  30.375  64.760  1.00 35.02  ? 402 LYS B CA    1 
ATOM   5025  C  C     . LYS B  1 261 ? 13.106  30.077  66.249  1.00 34.29  ? 402 LYS B C     1 
ATOM   5026  O  O     . LYS B  1 261 ? 14.001  30.540  66.951  1.00 36.81  ? 402 LYS B O     1 
ATOM   5027  C  CB    . LYS B  1 261 ? 11.935  31.388  64.512  1.00 34.42  ? 402 LYS B CB    1 
ATOM   5028  C  CG    . LYS B  1 261 ? 12.214  32.419  63.426  1.00 31.97  ? 402 LYS B CG    1 
ATOM   5029  C  CD    . LYS B  1 261 ? 11.071  33.429  63.361  1.00 32.12  ? 402 LYS B CD    1 
ATOM   5030  C  CE    . LYS B  1 261 ? 11.558  34.783  62.879  1.00 35.84  ? 402 LYS B CE    1 
ATOM   5031  N  NZ    . LYS B  1 261 ? 12.215  34.738  61.540  1.00 37.65  ? 402 LYS B NZ    1 
ATOM   5032  N  N     . TYR B  1 262 ? 12.136  29.306  66.725  1.00 31.49  ? 403 TYR B N     1 
ATOM   5033  C  CA    . TYR B  1 262 ? 12.007  29.014  68.149  1.00 34.75  ? 403 TYR B CA    1 
ATOM   5034  C  C     . TYR B  1 262 ? 13.154  28.148  68.623  1.00 36.05  ? 403 TYR B C     1 
ATOM   5035  O  O     . TYR B  1 262 ? 13.792  28.464  69.629  1.00 37.29  ? 403 TYR B O     1 
ATOM   5036  C  CB    . TYR B  1 262 ? 10.673  28.321  68.435  1.00 34.00  ? 403 TYR B CB    1 
ATOM   5037  C  CG    . TYR B  1 262 ? 10.348  28.176  69.900  1.00 34.48  ? 403 TYR B CG    1 
ATOM   5038  C  CD1   . TYR B  1 262 ? 10.307  29.283  70.732  1.00 37.60  ? 403 TYR B CD1   1 
ATOM   5039  C  CD2   . TYR B  1 262 ? 10.060  26.937  70.447  1.00 39.13  ? 403 TYR B CD2   1 
ATOM   5040  C  CE1   . TYR B  1 262 ? 9.997   29.158  72.074  1.00 40.69  ? 403 TYR B CE1   1 
ATOM   5041  C  CE2   . TYR B  1 262 ? 9.751   26.800  71.790  1.00 42.32  ? 403 TYR B CE2   1 
ATOM   5042  C  CZ    . TYR B  1 262 ? 9.720   27.915  72.596  1.00 43.81  ? 403 TYR B CZ    1 
ATOM   5043  O  OH    . TYR B  1 262 ? 9.411   27.787  73.931  1.00 46.44  ? 403 TYR B OH    1 
ATOM   5044  N  N     . LEU B  1 263 ? 13.394  27.052  67.904  1.00 37.58  ? 404 LEU B N     1 
ATOM   5045  C  CA    . LEU B  1 263 ? 14.538  26.187  68.168  1.00 38.09  ? 404 LEU B CA    1 
ATOM   5046  C  C     . LEU B  1 263 ? 15.785  27.032  68.388  1.00 43.15  ? 404 LEU B C     1 
ATOM   5047  O  O     . LEU B  1 263 ? 16.459  26.907  69.419  1.00 47.84  ? 404 LEU B O     1 
ATOM   5048  C  CB    . LEU B  1 263 ? 14.761  25.230  66.995  1.00 37.23  ? 404 LEU B CB    1 
ATOM   5049  C  CG    . LEU B  1 263 ? 15.963  24.289  67.123  1.00 34.96  ? 404 LEU B CG    1 
ATOM   5050  C  CD1   . LEU B  1 263 ? 15.767  23.358  68.306  1.00 36.71  ? 404 LEU B CD1   1 
ATOM   5051  C  CD2   . LEU B  1 263 ? 16.203  23.497  65.855  1.00 26.49  ? 404 LEU B CD2   1 
ATOM   5052  N  N     . LEU B  1 264 ? 16.071  27.916  67.432  1.00 45.73  ? 405 LEU B N     1 
ATOM   5053  C  CA    . LEU B  1 264 ? 17.249  28.776  67.539  1.00 45.62  ? 405 LEU B CA    1 
ATOM   5054  C  C     . LEU B  1 264 ? 17.195  29.734  68.731  1.00 50.21  ? 405 LEU B C     1 
ATOM   5055  O  O     . LEU B  1 264 ? 18.211  29.950  69.394  1.00 52.88  ? 405 LEU B O     1 
ATOM   5056  C  CB    . LEU B  1 264 ? 17.468  29.566  66.251  1.00 43.47  ? 405 LEU B CB    1 
ATOM   5057  C  CG    . LEU B  1 264 ? 18.663  30.518  66.296  1.00 42.72  ? 405 LEU B CG    1 
ATOM   5058  C  CD1   . LEU B  1 264 ? 19.957  29.738  66.292  1.00 44.13  ? 405 LEU B CD1   1 
ATOM   5059  C  CD2   . LEU B  1 264 ? 18.628  31.482  65.140  1.00 45.45  ? 405 LEU B CD2   1 
ATOM   5060  N  N     . GLU B  1 265 ? 16.022  30.309  68.995  1.00 53.52  ? 406 GLU B N     1 
ATOM   5061  C  CA    . GLU B  1 265 ? 15.850  31.217  70.129  1.00 56.75  ? 406 GLU B CA    1 
ATOM   5062  C  C     . GLU B  1 265 ? 16.237  30.536  71.438  1.00 56.20  ? 406 GLU B C     1 
ATOM   5063  O  O     . GLU B  1 265 ? 17.021  31.075  72.221  1.00 55.98  ? 406 GLU B O     1 
ATOM   5064  C  CB    . GLU B  1 265 ? 14.404  31.716  70.217  1.00 59.38  ? 406 GLU B CB    1 
ATOM   5065  C  CG    . GLU B  1 265 ? 14.104  32.970  69.400  1.00 63.91  ? 406 GLU B CG    1 
ATOM   5066  C  CD    . GLU B  1 265 ? 12.660  33.425  69.544  1.00 69.28  ? 406 GLU B CD    1 
ATOM   5067  O  OE1   . GLU B  1 265 ? 12.014  33.047  70.545  1.00 71.99  ? 406 GLU B OE1   1 
ATOM   5068  O  OE2   . GLU B  1 265 ? 12.173  34.157  68.655  1.00 69.36  ? 406 GLU B OE2   1 
ATOM   5069  N  N     . GLN B  1 266 ? 15.683  29.347  71.662  1.00 53.43  ? 407 GLN B N     1 
ATOM   5070  C  CA    . GLN B  1 266 ? 15.944  28.582  72.876  1.00 50.45  ? 407 GLN B CA    1 
ATOM   5071  C  C     . GLN B  1 266 ? 17.412  28.169  72.983  1.00 51.58  ? 407 GLN B C     1 
ATOM   5072  O  O     . GLN B  1 266 ? 18.065  28.400  74.018  1.00 49.64  ? 407 GLN B O     1 
ATOM   5073  C  CB    . GLN B  1 266 ? 15.054  27.340  72.908  1.00 48.56  ? 407 GLN B CB    1 
ATOM   5074  C  CG    . GLN B  1 266 ? 13.563  27.618  72.809  1.00 45.59  ? 407 GLN B CG    1 
ATOM   5075  C  CD    . GLN B  1 266 ? 12.993  28.211  74.078  1.00 47.04  ? 407 GLN B CD    1 
ATOM   5076  O  OE1   . GLN B  1 266 ? 12.948  29.430  74.241  1.00 48.31  ? 407 GLN B OE1   1 
ATOM   5077  N  NE2   . GLN B  1 266 ? 12.550  27.349  74.984  1.00 45.26  ? 407 GLN B NE2   1 
ATOM   5078  N  N     . LEU B  1 267 ? 17.928  27.563  71.911  1.00 53.92  ? 408 LEU B N     1 
ATOM   5079  C  CA    . LEU B  1 267 ? 19.334  27.160  71.873  1.00 54.62  ? 408 LEU B CA    1 
ATOM   5080  C  C     . LEU B  1 267 ? 20.275  28.351  72.094  1.00 57.41  ? 408 LEU B C     1 
ATOM   5081  O  O     . LEU B  1 267 ? 21.410  28.169  72.531  1.00 61.57  ? 408 LEU B O     1 
ATOM   5082  C  CB    . LEU B  1 267 ? 19.677  26.443  70.560  1.00 52.29  ? 408 LEU B CB    1 
ATOM   5083  C  CG    . LEU B  1 267 ? 19.142  25.028  70.319  1.00 50.28  ? 408 LEU B CG    1 
ATOM   5084  C  CD1   . LEU B  1 267 ? 19.590  24.492  68.969  1.00 47.65  ? 408 LEU B CD1   1 
ATOM   5085  C  CD2   . LEU B  1 267 ? 19.582  24.089  71.424  1.00 52.06  ? 408 LEU B CD2   1 
ATOM   5086  N  N     . LYS B  1 268 ? 19.793  29.560  71.801  1.00 54.47  ? 409 LYS B N     1 
ATOM   5087  C  CA    . LYS B  1 268 ? 20.566  30.786  72.018  1.00 52.82  ? 409 LYS B CA    1 
ATOM   5088  C  C     . LYS B  1 268 ? 20.454  31.312  73.448  1.00 56.21  ? 409 LYS B C     1 
ATOM   5089  O  O     . LYS B  1 268 ? 21.416  31.855  73.993  1.00 57.86  ? 409 LYS B O     1 
ATOM   5090  C  CB    . LYS B  1 268 ? 20.137  31.884  71.042  1.00 50.07  ? 409 LYS B CB    1 
ATOM   5091  C  CG    . LYS B  1 268 ? 20.916  31.911  69.739  1.00 46.75  ? 409 LYS B CG    1 
ATOM   5092  C  CD    . LYS B  1 268 ? 20.449  33.050  68.856  1.00 43.87  ? 409 LYS B CD    1 
ATOM   5093  C  CE    . LYS B  1 268 ? 20.677  34.402  69.513  1.00 45.19  ? 409 LYS B CE    1 
ATOM   5094  N  NZ    . LYS B  1 268 ? 22.079  34.881  69.345  1.00 46.61  ? 409 LYS B NZ    1 
ATOM   5095  N  N     . LYS B  1 269 ? 19.276  31.171  74.046  1.00 58.30  ? 410 LYS B N     1 
ATOM   5096  C  CA    . LYS B  1 269 ? 19.078  31.594  75.426  1.00 59.15  ? 410 LYS B CA    1 
ATOM   5097  C  C     . LYS B  1 269 ? 19.854  30.702  76.384  1.00 59.68  ? 410 LYS B C     1 
ATOM   5098  O  O     . LYS B  1 269 ? 20.243  31.142  77.465  1.00 58.33  ? 410 LYS B O     1 
ATOM   5099  C  CB    . LYS B  1 269 ? 17.594  31.584  75.797  1.00 62.04  ? 410 LYS B CB    1 
ATOM   5100  C  CG    . LYS B  1 269 ? 16.785  32.709  75.182  1.00 64.43  ? 410 LYS B CG    1 
ATOM   5101  C  CD    . LYS B  1 269 ? 15.335  32.645  75.638  1.00 65.67  ? 410 LYS B CD    1 
ATOM   5102  C  CE    . LYS B  1 269 ? 14.527  33.793  75.058  1.00 67.54  ? 410 LYS B CE    1 
ATOM   5103  N  NZ    . LYS B  1 269 ? 13.105  33.744  75.493  1.00 68.92  ? 410 LYS B NZ    1 
ATOM   5104  N  N     . GLU B  1 270 ? 20.077  29.449  75.995  1.00 62.45  ? 411 GLU B N     1 
ATOM   5105  C  CA    . GLU B  1 270 ? 20.807  28.534  76.872  1.00 63.89  ? 411 GLU B CA    1 
ATOM   5106  C  C     . GLU B  1 270 ? 22.326  28.533  76.644  1.00 64.74  ? 411 GLU B C     1 
ATOM   5107  O  O     . GLU B  1 270 ? 23.098  28.244  77.563  1.00 62.74  ? 411 GLU B O     1 
ATOM   5108  C  CB    . GLU B  1 270 ? 20.240  27.118  76.764  1.00 67.08  ? 411 GLU B CB    1 
ATOM   5109  C  CG    . GLU B  1 270 ? 20.749  26.168  77.831  1.00 72.59  ? 411 GLU B CG    1 
ATOM   5110  C  CD    . GLU B  1 270 ? 19.820  24.999  78.066  1.00 76.65  ? 411 GLU B CD    1 
ATOM   5111  O  OE1   . GLU B  1 270 ? 18.794  24.897  77.362  1.00 77.49  ? 411 GLU B OE1   1 
ATOM   5112  O  OE2   . GLU B  1 270 ? 20.115  24.183  78.964  1.00 79.74  ? 411 GLU B OE2   1 
ATOM   5113  N  N     . PHE B  1 271 ? 22.757  28.867  75.430  1.00 67.52  ? 412 PHE B N     1 
ATOM   5114  C  CA    . PHE B  1 271 ? 24.186  28.850  75.122  1.00 69.30  ? 412 PHE B CA    1 
ATOM   5115  C  C     . PHE B  1 271 ? 24.707  30.181  74.571  1.00 68.44  ? 412 PHE B C     1 
ATOM   5116  O  O     . PHE B  1 271 ? 24.283  30.639  73.509  1.00 68.97  ? 412 PHE B O     1 
ATOM   5117  C  CB    . PHE B  1 271 ? 24.516  27.697  74.170  1.00 72.73  ? 412 PHE B CB    1 
ATOM   5118  C  CG    . PHE B  1 271 ? 24.200  26.336  74.733  1.00 76.93  ? 412 PHE B CG    1 
ATOM   5119  C  CD1   . PHE B  1 271 ? 25.106  25.683  75.558  1.00 77.25  ? 412 PHE B CD1   1 
ATOM   5120  C  CD2   . PHE B  1 271 ? 22.998  25.710  74.439  1.00 78.27  ? 412 PHE B CD2   1 
ATOM   5121  C  CE1   . PHE B  1 271 ? 24.823  24.431  76.071  1.00 78.29  ? 412 PHE B CE1   1 
ATOM   5122  C  CE2   . PHE B  1 271 ? 22.706  24.459  74.953  1.00 78.35  ? 412 PHE B CE2   1 
ATOM   5123  C  CZ    . PHE B  1 271 ? 23.620  23.819  75.770  1.00 78.82  ? 412 PHE B CZ    1 
ATOM   5124  N  N     . GLN B  1 272 ? 25.640  30.784  75.303  1.00 66.45  ? 413 GLN B N     1 
ATOM   5125  C  CA    . GLN B  1 272 ? 26.234  32.061  74.923  1.00 63.64  ? 413 GLN B CA    1 
ATOM   5126  C  C     . GLN B  1 272 ? 27.225  31.866  73.779  1.00 59.61  ? 413 GLN B C     1 
ATOM   5127  O  O     . GLN B  1 272 ? 27.690  32.831  73.171  1.00 59.22  ? 413 GLN B O     1 
ATOM   5128  C  CB    . GLN B  1 272 ? 26.937  32.677  76.132  1.00 66.27  ? 413 GLN B CB    1 
ATOM   5129  C  CG    . GLN B  1 272 ? 27.082  34.193  76.088  1.00 70.31  ? 413 GLN B CG    1 
ATOM   5130  C  CD    . GLN B  1 272 ? 27.412  34.777  77.450  1.00 73.72  ? 413 GLN B CD    1 
ATOM   5131  O  OE1   . GLN B  1 272 ? 27.121  34.172  78.484  1.00 74.38  ? 413 GLN B OE1   1 
ATOM   5132  N  NE2   . GLN B  1 272 ? 28.023  35.956  77.458  1.00 73.80  ? 413 GLN B NE2   1 
ATOM   5133  N  N     . GLU B  1 273 ? 27.527  30.605  73.487  1.00 57.84  ? 414 GLU B N     1 
ATOM   5134  C  CA    . GLU B  1 273 ? 28.449  30.235  72.425  1.00 57.70  ? 414 GLU B CA    1 
ATOM   5135  C  C     . GLU B  1 273 ? 27.853  30.520  71.047  1.00 61.49  ? 414 GLU B C     1 
ATOM   5136  O  O     . GLU B  1 273 ? 28.542  30.414  70.030  1.00 63.94  ? 414 GLU B O     1 
ATOM   5137  C  CB    . GLU B  1 273 ? 28.791  28.745  72.539  1.00 58.26  ? 414 GLU B CB    1 
ATOM   5138  C  CG    . GLU B  1 273 ? 29.436  28.315  73.867  1.00 60.95  ? 414 GLU B CG    1 
ATOM   5139  C  CD    . GLU B  1 273 ? 28.438  28.146  75.012  1.00 66.39  ? 414 GLU B CD    1 
ATOM   5140  O  OE1   . GLU B  1 273 ? 28.565  27.168  75.778  1.00 68.44  ? 414 GLU B OE1   1 
ATOM   5141  O  OE2   . GLU B  1 273 ? 27.540  28.999  75.169  1.00 68.35  ? 414 GLU B OE2   1 
ATOM   5142  N  N     . LEU B  1 274 ? 26.575  30.894  71.024  1.00 62.59  ? 415 LEU B N     1 
ATOM   5143  C  CA    . LEU B  1 274 ? 25.834  31.070  69.779  1.00 60.51  ? 415 LEU B CA    1 
ATOM   5144  C  C     . LEU B  1 274 ? 25.377  32.515  69.588  1.00 60.66  ? 415 LEU B C     1 
ATOM   5145  O  O     . LEU B  1 274 ? 24.324  32.766  69.003  1.00 62.60  ? 415 LEU B O     1 
ATOM   5146  C  CB    . LEU B  1 274 ? 24.623  30.132  69.766  1.00 56.86  ? 415 LEU B CB    1 
ATOM   5147  C  CG    . LEU B  1 274 ? 24.949  28.645  69.889  1.00 53.06  ? 415 LEU B CG    1 
ATOM   5148  C  CD1   . LEU B  1 274 ? 23.725  27.849  70.288  1.00 50.72  ? 415 LEU B CD1   1 
ATOM   5149  C  CD2   . LEU B  1 274 ? 25.522  28.120  68.584  1.00 52.23  ? 415 LEU B CD2   1 
ATOM   5150  N  N     . ASP B  1 275 ? 26.177  33.461  70.069  1.00 62.80  ? 416 ASP B N     1 
ATOM   5151  C  CA    . ASP B  1 275 ? 25.824  34.874  69.992  1.00 65.38  ? 416 ASP B CA    1 
ATOM   5152  C  C     . ASP B  1 275 ? 25.997  35.446  68.579  1.00 60.81  ? 416 ASP B C     1 
ATOM   5153  O  O     . ASP B  1 275 ? 25.492  36.523  68.271  1.00 60.57  ? 416 ASP B O     1 
ATOM   5154  C  CB    . ASP B  1 275 ? 26.630  35.680  71.016  1.00 71.04  ? 416 ASP B CB    1 
ATOM   5155  C  CG    . ASP B  1 275 ? 26.169  35.441  72.445  1.00 76.24  ? 416 ASP B CG    1 
ATOM   5156  O  OD1   . ASP B  1 275 ? 25.347  34.526  72.664  1.00 77.84  ? 416 ASP B OD1   1 
ATOM   5157  O  OD2   . ASP B  1 275 ? 26.634  36.165  73.352  1.00 77.77  ? 416 ASP B OD2   1 
ATOM   5158  N  N     . ALA B  1 276 ? 26.704  34.715  67.723  1.00 57.91  ? 417 ALA B N     1 
ATOM   5159  C  CA    . ALA B  1 276 ? 26.897  35.127  66.334  1.00 55.39  ? 417 ALA B CA    1 
ATOM   5160  C  C     . ALA B  1 276 ? 25.650  34.856  65.500  1.00 50.92  ? 417 ALA B C     1 
ATOM   5161  O  O     . ALA B  1 276 ? 25.418  35.503  64.479  1.00 49.76  ? 417 ALA B O     1 
ATOM   5162  C  CB    . ALA B  1 276 ? 28.090  34.407  65.732  1.00 55.10  ? 417 ALA B CB    1 
ATOM   5163  N  N     . PHE B  1 277 ? 24.852  33.893  65.944  1.00 47.90  ? 418 PHE B N     1 
ATOM   5164  C  CA    . PHE B  1 277 ? 23.699  33.440  65.183  1.00 42.11  ? 418 PHE B CA    1 
ATOM   5165  C  C     . PHE B  1 277 ? 22.441  34.265  65.473  1.00 40.38  ? 418 PHE B C     1 
ATOM   5166  O  O     . PHE B  1 277 ? 22.174  34.618  66.621  1.00 39.14  ? 418 PHE B O     1 
ATOM   5167  C  CB    . PHE B  1 277 ? 23.462  31.950  65.456  1.00 38.06  ? 418 PHE B CB    1 
ATOM   5168  C  CG    . PHE B  1 277 ? 24.602  31.066  65.021  1.00 35.21  ? 418 PHE B CG    1 
ATOM   5169  C  CD1   . PHE B  1 277 ? 24.718  30.668  63.698  1.00 33.09  ? 418 PHE B CD1   1 
ATOM   5170  C  CD2   . PHE B  1 277 ? 25.554  30.628  65.931  1.00 37.25  ? 418 PHE B CD2   1 
ATOM   5171  C  CE1   . PHE B  1 277 ? 25.761  29.854  63.290  1.00 33.25  ? 418 PHE B CE1   1 
ATOM   5172  C  CE2   . PHE B  1 277 ? 26.607  29.810  65.527  1.00 32.70  ? 418 PHE B CE2   1 
ATOM   5173  C  CZ    . PHE B  1 277 ? 26.707  29.425  64.209  1.00 31.79  ? 418 PHE B CZ    1 
ATOM   5174  N  N     . CYS B  1 278 ? 21.686  34.580  64.419  1.00 40.75  ? 419 CYS B N     1 
ATOM   5175  C  CA    . CYS B  1 278 ? 20.408  35.286  64.538  1.00 40.45  ? 419 CYS B CA    1 
ATOM   5176  C  C     . CYS B  1 278 ? 19.331  34.606  63.694  1.00 41.17  ? 419 CYS B C     1 
ATOM   5177  O  O     . CYS B  1 278 ? 19.598  33.613  63.018  1.00 40.50  ? 419 CYS B O     1 
ATOM   5178  C  CB    . CYS B  1 278 ? 20.550  36.749  64.115  1.00 40.00  ? 419 CYS B CB    1 
ATOM   5179  S  SG    . CYS B  1 278 ? 21.203  37.004  62.454  1.00 36.31  ? 419 CYS B SG    1 
ATOM   5180  N  N     . SER B  1 279 ? 18.120  35.155  63.717  1.00 41.94  ? 420 SER B N     1 
ATOM   5181  C  CA    . SER B  1 279 ? 17.000  34.541  63.008  1.00 41.68  ? 420 SER B CA    1 
ATOM   5182  C  C     . SER B  1 279 ? 17.107  34.676  61.492  1.00 35.85  ? 420 SER B C     1 
ATOM   5183  O  O     . SER B  1 279 ? 16.475  33.916  60.759  1.00 34.93  ? 420 SER B O     1 
ATOM   5184  C  CB    . SER B  1 279 ? 15.666  35.110  63.492  1.00 43.18  ? 420 SER B CB    1 
ATOM   5185  O  OG    . SER B  1 279 ? 15.523  36.473  63.131  1.00 46.95  ? 420 SER B OG    1 
ATOM   5186  N  N     . TYR B  1 280 ? 17.916  35.620  61.019  1.00 34.60  ? 421 TYR B N     1 
ATOM   5187  C  CA    . TYR B  1 280 ? 18.028  35.838  59.581  1.00 33.71  ? 421 TYR B CA    1 
ATOM   5188  C  C     . TYR B  1 280 ? 18.736  34.681  58.886  1.00 35.10  ? 421 TYR B C     1 
ATOM   5189  O  O     . TYR B  1 280 ? 18.591  34.498  57.682  1.00 37.75  ? 421 TYR B O     1 
ATOM   5190  C  CB    . TYR B  1 280 ? 18.730  37.160  59.261  1.00 32.57  ? 421 TYR B CB    1 
ATOM   5191  C  CG    . TYR B  1 280 ? 18.556  37.584  57.817  1.00 31.86  ? 421 TYR B CG    1 
ATOM   5192  C  CD1   . TYR B  1 280 ? 17.402  38.230  57.398  1.00 32.35  ? 421 TYR B CD1   1 
ATOM   5193  C  CD2   . TYR B  1 280 ? 19.540  37.331  56.871  1.00 33.24  ? 421 TYR B CD2   1 
ATOM   5194  C  CE1   . TYR B  1 280 ? 17.232  38.614  56.081  1.00 34.68  ? 421 TYR B CE1   1 
ATOM   5195  C  CE2   . TYR B  1 280 ? 19.375  37.712  55.547  1.00 34.17  ? 421 TYR B CE2   1 
ATOM   5196  C  CZ    . TYR B  1 280 ? 18.220  38.354  55.164  1.00 35.19  ? 421 TYR B CZ    1 
ATOM   5197  O  OH    . TYR B  1 280 ? 18.041  38.742  53.860  1.00 39.61  ? 421 TYR B OH    1 
ATOM   5198  N  N     . HIS B  1 281 ? 19.500  33.904  59.644  1.00 36.78  ? 422 HIS B N     1 
ATOM   5199  C  CA    . HIS B  1 281 ? 20.146  32.716  59.100  1.00 36.27  ? 422 HIS B CA    1 
ATOM   5200  C  C     . HIS B  1 281 ? 19.088  31.657  58.820  1.00 37.21  ? 422 HIS B C     1 
ATOM   5201  O  O     . HIS B  1 281 ? 19.098  30.998  57.775  1.00 44.20  ? 422 HIS B O     1 
ATOM   5202  C  CB    . HIS B  1 281 ? 21.188  32.180  60.081  1.00 38.67  ? 422 HIS B CB    1 
ATOM   5203  C  CG    . HIS B  1 281 ? 22.308  33.135  60.357  1.00 42.54  ? 422 HIS B CG    1 
ATOM   5204  N  ND1   . HIS B  1 281 ? 22.702  33.470  61.635  1.00 46.06  ? 422 HIS B ND1   1 
ATOM   5205  C  CD2   . HIS B  1 281 ? 23.122  33.821  59.520  1.00 44.23  ? 422 HIS B CD2   1 
ATOM   5206  C  CE1   . HIS B  1 281 ? 23.708  34.325  61.572  1.00 44.42  ? 422 HIS B CE1   1 
ATOM   5207  N  NE2   . HIS B  1 281 ? 23.982  34.554  60.301  1.00 43.32  ? 422 HIS B NE2   1 
ATOM   5208  N  N     . VAL B  1 282 ? 18.172  31.509  59.770  1.00 37.55  ? 423 VAL B N     1 
ATOM   5209  C  CA    . VAL B  1 282 ? 17.006  30.650  59.607  1.00 39.74  ? 423 VAL B CA    1 
ATOM   5210  C  C     . VAL B  1 282 ? 16.152  31.085  58.413  1.00 39.60  ? 423 VAL B C     1 
ATOM   5211  O  O     . VAL B  1 282 ? 15.756  30.261  57.585  1.00 39.90  ? 423 VAL B O     1 
ATOM   5212  C  CB    . VAL B  1 282 ? 16.152  30.663  60.882  1.00 38.95  ? 423 VAL B CB    1 
ATOM   5213  C  CG1   . VAL B  1 282 ? 14.789  30.087  60.617  1.00 40.58  ? 423 VAL B CG1   1 
ATOM   5214  C  CG2   . VAL B  1 282 ? 16.844  29.898  61.998  1.00 39.81  ? 423 VAL B CG2   1 
ATOM   5215  N  N     . LYS B  1 283 ? 15.881  32.385  58.333  1.00 39.36  ? 424 LYS B N     1 
ATOM   5216  C  CA    . LYS B  1 283 ? 15.088  32.961  57.247  1.00 34.18  ? 424 LYS B CA    1 
ATOM   5217  C  C     . LYS B  1 283 ? 15.736  32.733  55.876  1.00 32.41  ? 424 LYS B C     1 
ATOM   5218  O  O     . LYS B  1 283 ? 15.064  32.351  54.918  1.00 37.06  ? 424 LYS B O     1 
ATOM   5219  C  CB    . LYS B  1 283 ? 14.876  34.458  57.503  1.00 29.57  ? 424 LYS B CB    1 
ATOM   5220  C  CG    . LYS B  1 283 ? 13.693  35.073  56.763  1.00 29.13  ? 424 LYS B CG    1 
ATOM   5221  C  CD    . LYS B  1 283 ? 13.609  36.575  57.026  1.00 27.57  ? 424 LYS B CD    1 
ATOM   5222  C  CE    . LYS B  1 283 ? 12.387  37.181  56.359  1.00 30.31  ? 424 LYS B CE    1 
ATOM   5223  N  NZ    . LYS B  1 283 ? 12.290  38.652  56.582  1.00 33.39  ? 424 LYS B NZ    1 
ATOM   5224  N  N     . THR B  1 284 ? 17.046  32.954  55.795  1.00 31.55  ? 425 THR B N     1 
ATOM   5225  C  CA    . THR B  1 284 ? 17.792  32.772  54.552  1.00 29.98  ? 425 THR B CA    1 
ATOM   5226  C  C     . THR B  1 284 ? 17.775  31.314  54.117  1.00 32.07  ? 425 THR B C     1 
ATOM   5227  O  O     . THR B  1 284 ? 17.467  30.986  52.958  1.00 37.10  ? 425 THR B O     1 
ATOM   5228  C  CB    . THR B  1 284 ? 19.243  33.214  54.721  1.00 30.84  ? 425 THR B CB    1 
ATOM   5229  O  OG1   . THR B  1 284 ? 19.276  34.544  55.253  1.00 30.83  ? 425 THR B OG1   1 
ATOM   5230  C  CG2   . THR B  1 284 ? 19.963  33.190  53.388  1.00 33.76  ? 425 THR B CG2   1 
ATOM   5231  N  N     . ALA B  1 285 ? 18.117  30.440  55.054  1.00 29.39  ? 426 ALA B N     1 
ATOM   5232  C  CA    . ALA B  1 285 ? 18.064  29.009  54.806  1.00 28.31  ? 426 ALA B CA    1 
ATOM   5233  C  C     . ALA B  1 285 ? 16.684  28.572  54.306  1.00 32.06  ? 426 ALA B C     1 
ATOM   5234  O  O     . ALA B  1 285 ? 16.583  27.797  53.354  1.00 35.01  ? 426 ALA B O     1 
ATOM   5235  C  CB    . ALA B  1 285 ? 18.444  28.254  56.058  1.00 28.28  ? 426 ALA B CB    1 
ATOM   5236  N  N     . ILE B  1 286 ? 15.622  29.063  54.939  1.00 32.16  ? 427 ILE B N     1 
ATOM   5237  C  CA    . ILE B  1 286 ? 14.274  28.657  54.548  1.00 31.69  ? 427 ILE B CA    1 
ATOM   5238  C  C     . ILE B  1 286 ? 13.865  29.233  53.192  1.00 30.54  ? 427 ILE B C     1 
ATOM   5239  O  O     . ILE B  1 286 ? 13.059  28.635  52.483  1.00 32.82  ? 427 ILE B O     1 
ATOM   5240  C  CB    . ILE B  1 286 ? 13.219  28.957  55.644  1.00 34.64  ? 427 ILE B CB    1 
ATOM   5241  C  CG1   . ILE B  1 286 ? 12.098  27.918  55.576  1.00 40.42  ? 427 ILE B CG1   1 
ATOM   5242  C  CG2   . ILE B  1 286 ? 12.673  30.372  55.525  1.00 30.37  ? 427 ILE B CG2   1 
ATOM   5243  C  CD1   . ILE B  1 286 ? 11.051  28.066  56.636  1.00 41.12  ? 427 ILE B CD1   1 
ATOM   5244  N  N     . PHE B  1 287 ? 14.424  30.386  52.836  1.00 31.49  ? 428 PHE B N     1 
ATOM   5245  C  CA    . PHE B  1 287 ? 14.271  30.913  51.487  1.00 33.14  ? 428 PHE B CA    1 
ATOM   5246  C  C     . PHE B  1 287 ? 14.871  29.930  50.492  1.00 35.39  ? 428 PHE B C     1 
ATOM   5247  O  O     . PHE B  1 287 ? 14.255  29.597  49.468  1.00 37.33  ? 428 PHE B O     1 
ATOM   5248  C  CB    . PHE B  1 287 ? 14.987  32.255  51.352  1.00 40.29  ? 428 PHE B CB    1 
ATOM   5249  C  CG    . PHE B  1 287 ? 14.220  33.419  51.911  1.00 47.41  ? 428 PHE B CG    1 
ATOM   5250  C  CD1   . PHE B  1 287 ? 12.880  33.292  52.249  1.00 50.02  ? 428 PHE B CD1   1 
ATOM   5251  C  CD2   . PHE B  1 287 ? 14.841  34.649  52.085  1.00 50.40  ? 428 PHE B CD2   1 
ATOM   5252  C  CE1   . PHE B  1 287 ? 12.175  34.371  52.758  1.00 51.63  ? 428 PHE B CE1   1 
ATOM   5253  C  CE2   . PHE B  1 287 ? 14.140  35.728  52.595  1.00 51.34  ? 428 PHE B CE2   1 
ATOM   5254  C  CZ    . PHE B  1 287 ? 12.807  35.588  52.927  1.00 51.42  ? 428 PHE B CZ    1 
ATOM   5255  N  N     . HIS B  1 288 ? 16.080  29.467  50.797  1.00 34.41  ? 429 HIS B N     1 
ATOM   5256  C  CA    . HIS B  1 288 ? 16.741  28.499  49.932  1.00 28.32  ? 429 HIS B CA    1 
ATOM   5257  C  C     . HIS B  1 288 ? 15.946  27.194  49.824  1.00 29.06  ? 429 HIS B C     1 
ATOM   5258  O  O     . HIS B  1 288 ? 15.862  26.599  48.750  1.00 34.36  ? 429 HIS B O     1 
ATOM   5259  C  CB    . HIS B  1 288 ? 18.180  28.250  50.396  1.00 28.29  ? 429 HIS B CB    1 
ATOM   5260  C  CG    . HIS B  1 288 ? 19.109  29.393  50.117  1.00 33.45  ? 429 HIS B CG    1 
ATOM   5261  N  ND1   . HIS B  1 288 ? 19.314  29.893  48.848  1.00 35.61  ? 429 HIS B ND1   1 
ATOM   5262  C  CD2   . HIS B  1 288 ? 19.894  30.128  50.941  1.00 34.74  ? 429 HIS B CD2   1 
ATOM   5263  C  CE1   . HIS B  1 288 ? 20.179  30.889  48.903  1.00 33.52  ? 429 HIS B CE1   1 
ATOM   5264  N  NE2   . HIS B  1 288 ? 20.547  31.053  50.163  1.00 33.48  ? 429 HIS B NE2   1 
ATOM   5265  N  N     . MET B  1 289 ? 15.342  26.766  50.928  1.00 32.03  ? 430 MET B N     1 
ATOM   5266  C  CA    . MET B  1 289 ? 14.529  25.553  50.911  1.00 33.61  ? 430 MET B CA    1 
ATOM   5267  C  C     . MET B  1 289 ? 13.256  25.724  50.085  1.00 34.89  ? 430 MET B C     1 
ATOM   5268  O  O     . MET B  1 289 ? 12.888  24.837  49.314  1.00 37.04  ? 430 MET B O     1 
ATOM   5269  C  CB    . MET B  1 289 ? 14.191  25.092  52.329  1.00 36.05  ? 430 MET B CB    1 
ATOM   5270  C  CG    . MET B  1 289 ? 15.196  24.108  52.921  1.00 38.52  ? 430 MET B CG    1 
ATOM   5271  S  SD    . MET B  1 289 ? 14.751  22.370  52.706  1.00 54.50  ? 430 MET B SD    1 
ATOM   5272  C  CE    . MET B  1 289 ? 15.228  22.064  51.008  1.00 32.60  ? 430 MET B CE    1 
ATOM   5273  N  N     . TRP B  1 290 ? 12.592  26.865  50.243  1.00 33.21  ? 431 TRP B N     1 
ATOM   5274  C  CA    . TRP B  1 290 ? 11.390  27.169  49.472  1.00 31.80  ? 431 TRP B CA    1 
ATOM   5275  C  C     . TRP B  1 290 ? 11.712  27.240  47.990  1.00 34.42  ? 431 TRP B C     1 
ATOM   5276  O  O     . TRP B  1 290 ? 10.873  26.917  47.155  1.00 38.60  ? 431 TRP B O     1 
ATOM   5277  C  CB    . TRP B  1 290 ? 10.769  28.486  49.934  1.00 31.37  ? 431 TRP B CB    1 
ATOM   5278  C  CG    . TRP B  1 290 ? 10.191  28.417  51.311  1.00 29.84  ? 431 TRP B CG    1 
ATOM   5279  C  CD1   . TRP B  1 290 ? 9.881   27.287  52.014  1.00 31.37  ? 431 TRP B CD1   1 
ATOM   5280  C  CD2   . TRP B  1 290 ? 9.857   29.524  52.162  1.00 27.24  ? 431 TRP B CD2   1 
ATOM   5281  N  NE1   . TRP B  1 290 ? 9.373   27.625  53.247  1.00 33.13  ? 431 TRP B NE1   1 
ATOM   5282  C  CE2   . TRP B  1 290 ? 9.350   28.990  53.363  1.00 27.84  ? 431 TRP B CE2   1 
ATOM   5283  C  CE3   . TRP B  1 290 ? 9.940   30.911  52.028  1.00 28.69  ? 431 TRP B CE3   1 
ATOM   5284  C  CZ2   . TRP B  1 290 ? 8.924   29.799  54.419  1.00 23.17  ? 431 TRP B CZ2   1 
ATOM   5285  C  CZ3   . TRP B  1 290 ? 9.517   31.709  53.082  1.00 30.85  ? 431 TRP B CZ3   1 
ATOM   5286  C  CH2   . TRP B  1 290 ? 9.017   31.151  54.258  1.00 24.62  ? 431 TRP B CH2   1 
ATOM   5287  N  N     . THR B  1 291 ? 12.933  27.653  47.669  1.00 34.36  ? 432 THR B N     1 
ATOM   5288  C  CA    . THR B  1 291 ? 13.371  27.671  46.280  1.00 32.61  ? 432 THR B CA    1 
ATOM   5289  C  C     . THR B  1 291 ? 13.695  26.252  45.798  1.00 37.39  ? 432 THR B C     1 
ATOM   5290  O  O     . THR B  1 291 ? 13.560  25.942  44.611  1.00 39.90  ? 432 THR B O     1 
ATOM   5291  C  CB    . THR B  1 291 ? 14.589  28.572  46.100  1.00 30.33  ? 432 THR B CB    1 
ATOM   5292  O  OG1   . THR B  1 291 ? 14.418  29.771  46.866  1.00 29.24  ? 432 THR B OG1   1 
ATOM   5293  C  CG2   . THR B  1 291 ? 14.756  28.932  44.646  1.00 29.14  ? 432 THR B CG2   1 
ATOM   5294  N  N     . GLN B  1 292 ? 14.119  25.400  46.729  1.00 41.41  ? 433 GLN B N     1 
ATOM   5295  C  CA    . GLN B  1 292 ? 14.427  24.004  46.433  1.00 45.85  ? 433 GLN B CA    1 
ATOM   5296  C  C     . GLN B  1 292 ? 13.167  23.173  46.224  1.00 49.53  ? 433 GLN B C     1 
ATOM   5297  O  O     . GLN B  1 292 ? 13.074  22.397  45.266  1.00 51.24  ? 433 GLN B O     1 
ATOM   5298  C  CB    . GLN B  1 292 ? 15.226  23.395  47.578  1.00 47.15  ? 433 GLN B CB    1 
ATOM   5299  C  CG    . GLN B  1 292 ? 16.694  23.192  47.280  1.00 48.12  ? 433 GLN B CG    1 
ATOM   5300  C  CD    . GLN B  1 292 ? 17.425  22.534  48.426  1.00 46.90  ? 433 GLN B CD    1 
ATOM   5301  O  OE1   . GLN B  1 292 ? 17.468  21.309  48.527  1.00 46.29  ? 433 GLN B OE1   1 
ATOM   5302  N  NE2   . GLN B  1 292 ? 18.000  23.346  49.304  1.00 45.54  ? 433 GLN B NE2   1 
ATOM   5303  N  N     . ASP B  1 293 ? 12.218  23.314  47.146  1.00 47.85  ? 434 ASP B N     1 
ATOM   5304  C  CA    . ASP B  1 293 ? 10.928  22.643  47.040  1.00 45.86  ? 434 ASP B CA    1 
ATOM   5305  C  C     . ASP B  1 293 ? 9.826   23.676  46.780  1.00 45.04  ? 434 ASP B C     1 
ATOM   5306  O  O     . ASP B  1 293 ? 9.161   24.132  47.715  1.00 46.18  ? 434 ASP B O     1 
ATOM   5307  C  CB    . ASP B  1 293 ? 10.627  21.847  48.317  1.00 43.46  ? 434 ASP B CB    1 
ATOM   5308  C  CG    . ASP B  1 293 ? 11.811  21.015  48.788  1.00 43.99  ? 434 ASP B CG    1 
ATOM   5309  O  OD1   . ASP B  1 293 ? 11.926  20.783  50.006  1.00 43.66  ? 434 ASP B OD1   1 
ATOM   5310  O  OD2   . ASP B  1 293 ? 12.626  20.590  47.947  1.00 47.34  ? 434 ASP B OD2   1 
ATOM   5311  N  N     . PRO B  1 294 ? 9.625   24.044  45.501  1.00 41.85  ? 435 PRO B N     1 
ATOM   5312  C  CA    . PRO B  1 294 ? 8.678   25.098  45.121  1.00 38.78  ? 435 PRO B CA    1 
ATOM   5313  C  C     . PRO B  1 294 ? 7.235   24.641  45.276  1.00 41.61  ? 435 PRO B C     1 
ATOM   5314  O  O     . PRO B  1 294 ? 6.360   25.453  45.585  1.00 42.76  ? 435 PRO B O     1 
ATOM   5315  C  CB    . PRO B  1 294 ? 8.975   25.322  43.630  1.00 35.28  ? 435 PRO B CB    1 
ATOM   5316  C  CG    . PRO B  1 294 ? 10.217  24.535  43.326  1.00 38.00  ? 435 PRO B CG    1 
ATOM   5317  C  CD    . PRO B  1 294 ? 10.252  23.431  44.321  1.00 40.52  ? 435 PRO B CD    1 
ATOM   5318  N  N     . GLN B  1 295 ? 6.997   23.350  45.058  1.00 43.62  ? 436 GLN B N     1 
ATOM   5319  C  CA    . GLN B  1 295 ? 5.650   22.784  45.121  1.00 39.77  ? 436 GLN B CA    1 
ATOM   5320  C  C     . GLN B  1 295 ? 4.974   22.973  46.473  1.00 38.46  ? 436 GLN B C     1 
ATOM   5321  O  O     . GLN B  1 295 ? 5.565   22.681  47.515  1.00 37.96  ? 436 GLN B O     1 
ATOM   5322  C  CB    . GLN B  1 295 ? 5.685   21.297  44.772  1.00 43.62  ? 436 GLN B CB    1 
ATOM   5323  C  CG    . GLN B  1 295 ? 5.994   21.021  43.311  1.00 47.88  ? 436 GLN B CG    1 
ATOM   5324  C  CD    . GLN B  1 295 ? 4.990   21.665  42.384  1.00 53.68  ? 436 GLN B CD    1 
ATOM   5325  O  OE1   . GLN B  1 295 ? 3.784   21.605  42.621  1.00 55.09  ? 436 GLN B OE1   1 
ATOM   5326  N  NE2   . GLN B  1 295 ? 5.480   22.294  41.324  1.00 56.55  ? 436 GLN B NE2   1 
ATOM   5327  N  N     . ASP B  1 296 ? 3.731   23.455  46.441  1.00 39.96  ? 437 ASP B N     1 
ATOM   5328  C  CA    . ASP B  1 296 ? 2.937   23.642  47.650  1.00 37.45  ? 437 ASP B CA    1 
ATOM   5329  C  C     . ASP B  1 296 ? 2.616   22.286  48.271  1.00 38.03  ? 437 ASP B C     1 
ATOM   5330  O  O     . ASP B  1 296 ? 2.455   22.163  49.485  1.00 39.45  ? 437 ASP B O     1 
ATOM   5331  C  CB    . ASP B  1 296 ? 1.644   24.397  47.332  1.00 36.66  ? 437 ASP B CB    1 
ATOM   5332  C  CG    . ASP B  1 296 ? 1.895   25.786  46.777  1.00 39.99  ? 437 ASP B CG    1 
ATOM   5333  O  OD1   . ASP B  1 296 ? 2.937   26.383  47.104  1.00 42.10  ? 437 ASP B OD1   1 
ATOM   5334  O  OD2   . ASP B  1 296 ? 1.049   26.284  46.008  1.00 41.31  ? 437 ASP B OD2   1 
ATOM   5335  N  N     . SER B  1 297 ? 2.536   21.270  47.420  1.00 38.52  ? 438 SER B N     1 
ATOM   5336  C  CA    . SER B  1 297 ? 2.332   19.898  47.866  1.00 42.25  ? 438 SER B CA    1 
ATOM   5337  C  C     . SER B  1 297 ? 3.499   19.411  48.723  1.00 44.49  ? 438 SER B C     1 
ATOM   5338  O  O     . SER B  1 297 ? 3.326   18.535  49.574  1.00 48.39  ? 438 SER B O     1 
ATOM   5339  C  CB    . SER B  1 297 ? 2.148   18.972  46.662  1.00 38.22  ? 438 SER B CB    1 
ATOM   5340  O  OG    . SER B  1 297 ? 3.213   19.123  45.741  1.00 36.79  ? 438 SER B OG    1 
ATOM   5341  N  N     . GLN B  1 298 ? 4.680   19.988  48.498  1.00 41.34  ? 439 GLN B N     1 
ATOM   5342  C  CA    . GLN B  1 298 ? 5.873   19.653  49.269  1.00 40.00  ? 439 GLN B CA    1 
ATOM   5343  C  C     . GLN B  1 298 ? 5.885   20.417  50.585  1.00 44.01  ? 439 GLN B C     1 
ATOM   5344  O  O     . GLN B  1 298 ? 6.838   20.326  51.355  1.00 46.81  ? 439 GLN B O     1 
ATOM   5345  C  CB    . GLN B  1 298 ? 7.144   19.966  48.473  1.00 39.26  ? 439 GLN B CB    1 
ATOM   5346  C  CG    . GLN B  1 298 ? 7.342   19.106  47.228  1.00 44.51  ? 439 GLN B CG    1 
ATOM   5347  C  CD    . GLN B  1 298 ? 8.631   19.420  46.479  1.00 50.31  ? 439 GLN B CD    1 
ATOM   5348  O  OE1   . GLN B  1 298 ? 8.659   20.277  45.596  1.00 50.89  ? 439 GLN B OE1   1 
ATOM   5349  N  NE2   . GLN B  1 298 ? 9.700   18.709  46.817  1.00 55.37  ? 439 GLN B NE2   1 
ATOM   5350  N  N     . TRP B  1 299 ? 4.825   21.182  50.828  1.00 45.68  ? 440 TRP B N     1 
ATOM   5351  C  CA    . TRP B  1 299 ? 4.644   21.868  52.101  1.00 44.98  ? 440 TRP B CA    1 
ATOM   5352  C  C     . TRP B  1 299 ? 3.215   21.683  52.609  1.00 45.01  ? 440 TRP B C     1 
ATOM   5353  O  O     . TRP B  1 299 ? 2.561   22.637  53.025  1.00 45.06  ? 440 TRP B O     1 
ATOM   5354  C  CB    . TRP B  1 299 ? 5.022   23.349  51.977  1.00 37.97  ? 440 TRP B CB    1 
ATOM   5355  C  CG    . TRP B  1 299 ? 6.433   23.531  51.496  1.00 29.45  ? 440 TRP B CG    1 
ATOM   5356  C  CD1   . TRP B  1 299 ? 6.849   23.652  50.204  1.00 29.19  ? 440 TRP B CD1   1 
ATOM   5357  C  CD2   . TRP B  1 299 ? 7.615   23.583  52.305  1.00 24.33  ? 440 TRP B CD2   1 
ATOM   5358  N  NE1   . TRP B  1 299 ? 8.217   23.786  50.159  1.00 24.76  ? 440 TRP B NE1   1 
ATOM   5359  C  CE2   . TRP B  1 299 ? 8.711   23.746  51.436  1.00 26.03  ? 440 TRP B CE2   1 
ATOM   5360  C  CE3   . TRP B  1 299 ? 7.851   23.513  53.681  1.00 24.41  ? 440 TRP B CE3   1 
ATOM   5361  C  CZ2   . TRP B  1 299 ? 10.030  23.841  51.902  1.00 30.14  ? 440 TRP B CZ2   1 
ATOM   5362  C  CZ3   . TRP B  1 299 ? 9.156   23.604  54.141  1.00 26.23  ? 440 TRP B CZ3   1 
ATOM   5363  C  CH2   . TRP B  1 299 ? 10.228  23.766  53.256  1.00 27.72  ? 440 TRP B CH2   1 
ATOM   5364  N  N     . ASP B  1 300 ? 2.740   20.440  52.564  1.00 44.10  ? 441 ASP B N     1 
ATOM   5365  C  CA    . ASP B  1 300 ? 1.436   20.096  53.113  1.00 44.66  ? 441 ASP B CA    1 
ATOM   5366  C  C     . ASP B  1 300 ? 1.558   20.001  54.624  1.00 46.09  ? 441 ASP B C     1 
ATOM   5367  O  O     . ASP B  1 300 ? 2.521   19.414  55.132  1.00 49.22  ? 441 ASP B O     1 
ATOM   5368  C  CB    . ASP B  1 300 ? 0.956   18.759  52.557  1.00 45.76  ? 441 ASP B CB    1 
ATOM   5369  C  CG    . ASP B  1 300 ? -0.539  18.560  52.719  1.00 47.35  ? 441 ASP B CG    1 
ATOM   5370  O  OD1   . ASP B  1 300 ? -0.992  18.183  53.824  1.00 49.76  ? 441 ASP B OD1   1 
ATOM   5371  O  OD2   . ASP B  1 300 ? -1.265  18.773  51.728  1.00 46.86  ? 441 ASP B OD2   1 
ATOM   5372  N  N     . PRO B  1 301 ? 0.592   20.591  55.347  1.00 40.28  ? 442 PRO B N     1 
ATOM   5373  C  CA    . PRO B  1 301 ? 0.563   20.590  56.813  1.00 36.18  ? 442 PRO B CA    1 
ATOM   5374  C  C     . PRO B  1 301 ? 0.712   19.186  57.393  1.00 39.81  ? 442 PRO B C     1 
ATOM   5375  O  O     . PRO B  1 301 ? 1.407   19.021  58.396  1.00 46.12  ? 442 PRO B O     1 
ATOM   5376  C  CB    . PRO B  1 301 ? -0.823  21.156  57.124  1.00 31.13  ? 442 PRO B CB    1 
ATOM   5377  C  CG    . PRO B  1 301 ? -1.098  22.081  55.988  1.00 27.53  ? 442 PRO B CG    1 
ATOM   5378  C  CD    . PRO B  1 301 ? -0.508  21.393  54.778  1.00 34.46  ? 442 PRO B CD    1 
ATOM   5379  N  N     . ARG B  1 302 ? 0.089   18.198  56.754  1.00 41.90  ? 443 ARG B N     1 
ATOM   5380  C  CA    . ARG B  1 302 ? 0.187   16.800  57.176  1.00 47.76  ? 443 ARG B CA    1 
ATOM   5381  C  C     . ARG B  1 302 ? 1.626   16.279  57.175  1.00 51.08  ? 443 ARG B C     1 
ATOM   5382  O  O     . ARG B  1 302 ? 1.946   15.310  57.867  1.00 53.97  ? 443 ARG B O     1 
ATOM   5383  C  CB    . ARG B  1 302 ? -0.685  15.923  56.277  1.00 51.90  ? 443 ARG B CB    1 
ATOM   5384  C  CG    . ARG B  1 302 ? -2.150  16.306  56.310  1.00 55.32  ? 443 ARG B CG    1 
ATOM   5385  C  CD    . ARG B  1 302 ? -2.945  15.672  55.185  1.00 59.24  ? 443 ARG B CD    1 
ATOM   5386  N  NE    . ARG B  1 302 ? -4.308  16.197  55.164  1.00 64.29  ? 443 ARG B NE    1 
ATOM   5387  C  CZ    . ARG B  1 302 ? -5.270  15.779  54.347  1.00 67.05  ? 443 ARG B CZ    1 
ATOM   5388  N  NH1   . ARG B  1 302 ? -5.031  14.813  53.472  1.00 67.45  ? 443 ARG B NH1   1 
ATOM   5389  N  NH2   . ARG B  1 302 ? -6.477  16.328  54.410  1.00 67.01  ? 443 ARG B NH2   1 
ATOM   5390  N  N     . ASN B  1 303 ? 2.486   16.923  56.390  1.00 50.25  ? 444 ASN B N     1 
ATOM   5391  C  CA    . ASN B  1 303 ? 3.890   16.553  56.325  1.00 49.07  ? 444 ASN B CA    1 
ATOM   5392  C  C     . ASN B  1 303 ? 4.741   17.567  57.067  1.00 48.96  ? 444 ASN B C     1 
ATOM   5393  O  O     . ASN B  1 303 ? 5.871   17.837  56.665  1.00 51.05  ? 444 ASN B O     1 
ATOM   5394  C  CB    . ASN B  1 303 ? 4.353   16.470  54.871  1.00 51.28  ? 444 ASN B CB    1 
ATOM   5395  C  CG    . ASN B  1 303 ? 3.422   15.649  54.006  1.00 55.55  ? 444 ASN B CG    1 
ATOM   5396  O  OD1   . ASN B  1 303 ? 2.360   15.218  54.446  1.00 58.30  ? 444 ASN B OD1   1 
ATOM   5397  N  ND2   . ASN B  1 303 ? 3.812   15.445  52.755  1.00 57.23  ? 444 ASN B ND2   1 
ATOM   5398  N  N     . LEU B  1 304 ? 4.190   18.131  58.141  1.00 47.62  ? 445 LEU B N     1 
ATOM   5399  C  CA    . LEU B  1 304 ? 4.905   19.125  58.941  1.00 48.11  ? 445 LEU B CA    1 
ATOM   5400  C  C     . LEU B  1 304 ? 6.260   18.600  59.420  1.00 52.12  ? 445 LEU B C     1 
ATOM   5401  O  O     . LEU B  1 304 ? 7.308   19.122  59.030  1.00 52.82  ? 445 LEU B O     1 
ATOM   5402  C  CB    . LEU B  1 304 ? 4.051   19.558  60.137  1.00 48.19  ? 445 LEU B CB    1 
ATOM   5403  C  CG    . LEU B  1 304 ? 4.586   20.647  61.069  1.00 49.04  ? 445 LEU B CG    1 
ATOM   5404  C  CD1   . LEU B  1 304 ? 4.931   21.894  60.282  1.00 49.64  ? 445 LEU B CD1   1 
ATOM   5405  C  CD2   . LEU B  1 304 ? 3.584   20.978  62.163  1.00 49.22  ? 445 LEU B CD2   1 
ATOM   5406  N  N     . SER B  1 305 ? 6.222   17.553  60.240  1.00 53.48  ? 446 SER B N     1 
ATOM   5407  C  CA    . SER B  1 305 ? 7.410   17.015  60.894  1.00 53.57  ? 446 SER B CA    1 
ATOM   5408  C  C     . SER B  1 305 ? 8.528   16.678  59.914  1.00 50.17  ? 446 SER B C     1 
ATOM   5409  O  O     . SER B  1 305 ? 9.696   16.981  60.166  1.00 52.26  ? 446 SER B O     1 
ATOM   5410  C  CB    . SER B  1 305 ? 7.032   15.784  61.714  1.00 56.49  ? 446 SER B CB    1 
ATOM   5411  O  OG    . SER B  1 305 ? 5.955   16.070  62.587  1.00 56.82  ? 446 SER B OG    1 
ATOM   5412  N  N     . SER B  1 306 ? 8.170   16.060  58.795  1.00 44.94  ? 447 SER B N     1 
ATOM   5413  C  CA    . SER B  1 306 ? 9.160   15.728  57.783  1.00 45.50  ? 447 SER B CA    1 
ATOM   5414  C  C     . SER B  1 306 ? 9.710   16.997  57.147  1.00 43.58  ? 447 SER B C     1 
ATOM   5415  O  O     . SER B  1 306 ? 10.925  17.133  56.973  1.00 45.75  ? 447 SER B O     1 
ATOM   5416  C  CB    . SER B  1 306 ? 8.565   14.814  56.715  1.00 48.92  ? 447 SER B CB    1 
ATOM   5417  O  OG    . SER B  1 306 ? 7.973   15.559  55.668  1.00 52.24  ? 447 SER B OG    1 
ATOM   5418  N  N     . CYS B  1 307 ? 8.817   17.930  56.818  1.00 40.47  ? 448 CYS B N     1 
ATOM   5419  C  CA    . CYS B  1 307 ? 9.228   19.198  56.222  1.00 36.31  ? 448 CYS B CA    1 
ATOM   5420  C  C     . CYS B  1 307 ? 10.212  19.909  57.144  1.00 35.79  ? 448 CYS B C     1 
ATOM   5421  O  O     . CYS B  1 307 ? 11.299  20.302  56.716  1.00 36.17  ? 448 CYS B O     1 
ATOM   5422  C  CB    . CYS B  1 307 ? 8.020   20.093  55.935  1.00 36.23  ? 448 CYS B CB    1 
ATOM   5423  S  SG    . CYS B  1 307 ? 7.052   19.641  54.469  1.00 37.46  ? 448 CYS B SG    1 
ATOM   5424  N  N     . PHE B  1 308 ? 9.845   20.032  58.417  1.00 34.64  ? 449 PHE B N     1 
ATOM   5425  C  CA    . PHE B  1 308 ? 10.731  20.635  59.401  1.00 34.52  ? 449 PHE B CA    1 
ATOM   5426  C  C     . PHE B  1 308 ? 12.068  19.899  59.485  1.00 39.30  ? 449 PHE B C     1 
ATOM   5427  O  O     . PHE B  1 308 ? 13.106  20.512  59.755  1.00 36.13  ? 449 PHE B O     1 
ATOM   5428  C  CB    . PHE B  1 308 ? 10.071  20.691  60.778  1.00 33.79  ? 449 PHE B CB    1 
ATOM   5429  C  CG    . PHE B  1 308 ? 10.931  21.343  61.823  1.00 36.19  ? 449 PHE B CG    1 
ATOM   5430  C  CD1   . PHE B  1 308 ? 11.590  22.534  61.545  1.00 35.47  ? 449 PHE B CD1   1 
ATOM   5431  C  CD2   . PHE B  1 308 ? 11.097  20.767  63.074  1.00 36.95  ? 449 PHE B CD2   1 
ATOM   5432  C  CE1   . PHE B  1 308 ? 12.398  23.139  62.497  1.00 34.47  ? 449 PHE B CE1   1 
ATOM   5433  C  CE2   . PHE B  1 308 ? 11.903  21.371  64.031  1.00 35.13  ? 449 PHE B CE2   1 
ATOM   5434  C  CZ    . PHE B  1 308 ? 12.552  22.558  63.738  1.00 32.47  ? 449 PHE B CZ    1 
ATOM   5435  N  N     . ASP B  1 309 ? 12.051  18.590  59.252  1.00 42.87  ? 450 ASP B N     1 
ATOM   5436  C  CA    . ASP B  1 309 ? 13.292  17.837  59.275  1.00 47.73  ? 450 ASP B CA    1 
ATOM   5437  C  C     . ASP B  1 309 ? 14.120  18.214  58.058  1.00 52.30  ? 450 ASP B C     1 
ATOM   5438  O  O     . ASP B  1 309 ? 15.327  18.435  58.169  1.00 57.64  ? 450 ASP B O     1 
ATOM   5439  C  CB    . ASP B  1 309 ? 13.031  16.334  59.291  1.00 52.22  ? 450 ASP B CB    1 
ATOM   5440  C  CG    . ASP B  1 309 ? 14.262  15.536  59.679  1.00 58.55  ? 450 ASP B CG    1 
ATOM   5441  O  OD1   . ASP B  1 309 ? 15.126  15.303  58.807  1.00 62.36  ? 450 ASP B OD1   1 
ATOM   5442  O  OD2   . ASP B  1 309 ? 14.366  15.142  60.859  1.00 59.47  ? 450 ASP B OD2   1 
ATOM   5443  N  N     . LYS B  1 310 ? 13.458  18.309  56.905  1.00 49.97  ? 451 LYS B N     1 
ATOM   5444  C  CA    . LYS B  1 310 ? 14.134  18.626  55.654  1.00 48.20  ? 451 LYS B CA    1 
ATOM   5445  C  C     . LYS B  1 310 ? 14.942  19.900  55.841  1.00 49.72  ? 451 LYS B C     1 
ATOM   5446  O  O     . LYS B  1 310 ? 16.176  19.886  55.740  1.00 54.08  ? 451 LYS B O     1 
ATOM   5447  C  CB    . LYS B  1 310 ? 13.111  18.793  54.533  1.00 51.00  ? 451 LYS B CB    1 
ATOM   5448  C  CG    . LYS B  1 310 ? 13.693  18.688  53.133  1.00 55.28  ? 451 LYS B CG    1 
ATOM   5449  C  CD    . LYS B  1 310 ? 12.761  17.908  52.210  1.00 55.87  ? 451 LYS B CD    1 
ATOM   5450  C  CE    . LYS B  1 310 ? 13.436  17.578  50.883  1.00 56.37  ? 451 LYS B CE    1 
ATOM   5451  N  NZ    . LYS B  1 310 ? 12.584  16.717  50.018  1.00 57.24  ? 451 LYS B NZ    1 
ATOM   5452  N  N     . LEU B  1 311 ? 14.237  20.983  56.162  1.00 48.36  ? 452 LEU B N     1 
ATOM   5453  C  CA    . LEU B  1 311 ? 14.869  22.244  56.530  1.00 48.80  ? 452 LEU B CA    1 
ATOM   5454  C  C     . LEU B  1 311 ? 16.016  22.014  57.508  1.00 48.63  ? 452 LEU B C     1 
ATOM   5455  O  O     . LEU B  1 311 ? 17.146  22.431  57.245  1.00 51.68  ? 452 LEU B O     1 
ATOM   5456  C  CB    . LEU B  1 311 ? 13.841  23.200  57.138  1.00 50.31  ? 452 LEU B CB    1 
ATOM   5457  C  CG    . LEU B  1 311 ? 14.371  24.557  57.601  1.00 51.33  ? 452 LEU B CG    1 
ATOM   5458  C  CD1   . LEU B  1 311 ? 14.865  25.372  56.418  1.00 48.33  ? 452 LEU B CD1   1 
ATOM   5459  C  CD2   . LEU B  1 311 ? 13.326  25.328  58.389  1.00 50.97  ? 452 LEU B CD2   1 
ATOM   5460  N  N     . LEU B  1 312 ? 15.727  21.319  58.608  1.00 49.12  ? 453 LEU B N     1 
ATOM   5461  C  CA    . LEU B  1 312 ? 16.737  21.048  59.629  1.00 51.32  ? 453 LEU B CA    1 
ATOM   5462  C  C     . LEU B  1 312 ? 17.970  20.456  58.966  1.00 48.05  ? 453 LEU B C     1 
ATOM   5463  O  O     . LEU B  1 312 ? 19.076  20.994  59.097  1.00 50.04  ? 453 LEU B O     1 
ATOM   5464  C  CB    . LEU B  1 312 ? 16.186  20.085  60.681  1.00 57.98  ? 453 LEU B CB    1 
ATOM   5465  C  CG    . LEU B  1 312 ? 16.480  20.369  62.151  1.00 61.69  ? 453 LEU B CG    1 
ATOM   5466  C  CD1   . LEU B  1 312 ? 15.958  21.733  62.523  1.00 61.99  ? 453 LEU B CD1   1 
ATOM   5467  C  CD2   . LEU B  1 312 ? 15.850  19.310  63.042  1.00 61.08  ? 453 LEU B CD2   1 
ATOM   5468  N  N     . ALA B  1 313 ? 17.756  19.384  58.206  1.00 43.51  ? 454 ALA B N     1 
ATOM   5469  C  CA    . ALA B  1 313 ? 18.837  18.731  57.489  1.00 44.40  ? 454 ALA B CA    1 
ATOM   5470  C  C     . ALA B  1 313 ? 19.617  19.768  56.696  1.00 48.20  ? 454 ALA B C     1 
ATOM   5471  O  O     . ALA B  1 313 ? 20.829  19.919  56.885  1.00 49.63  ? 454 ALA B O     1 
ATOM   5472  C  CB    . ALA B  1 313 ? 18.290  17.660  56.572  1.00 44.47  ? 454 ALA B CB    1 
ATOM   5473  N  N     . PHE B  1 314 ? 18.901  20.503  55.846  1.00 47.84  ? 455 PHE B N     1 
ATOM   5474  C  CA    . PHE B  1 314 ? 19.502  21.529  55.009  1.00 44.27  ? 455 PHE B CA    1 
ATOM   5475  C  C     . PHE B  1 314 ? 20.400  22.435  55.835  1.00 43.71  ? 455 PHE B C     1 
ATOM   5476  O  O     . PHE B  1 314 ? 21.565  22.645  55.484  1.00 43.59  ? 455 PHE B O     1 
ATOM   5477  C  CB    . PHE B  1 314 ? 18.413  22.350  54.320  1.00 45.60  ? 455 PHE B CB    1 
ATOM   5478  C  CG    . PHE B  1 314 ? 18.940  23.497  53.505  1.00 47.14  ? 455 PHE B CG    1 
ATOM   5479  C  CD1   . PHE B  1 314 ? 19.783  23.271  52.426  1.00 49.73  ? 455 PHE B CD1   1 
ATOM   5480  C  CD2   . PHE B  1 314 ? 18.578  24.800  53.804  1.00 44.65  ? 455 PHE B CD2   1 
ATOM   5481  C  CE1   . PHE B  1 314 ? 20.265  24.329  51.673  1.00 48.80  ? 455 PHE B CE1   1 
ATOM   5482  C  CE2   . PHE B  1 314 ? 19.056  25.857  53.054  1.00 44.23  ? 455 PHE B CE2   1 
ATOM   5483  C  CZ    . PHE B  1 314 ? 19.901  25.619  51.990  1.00 46.13  ? 455 PHE B CZ    1 
ATOM   5484  N  N     . PHE B  1 315 ? 19.869  22.926  56.955  1.00 44.82  ? 456 PHE B N     1 
ATOM   5485  C  CA    . PHE B  1 315 ? 20.596  23.889  57.771  1.00 44.10  ? 456 PHE B CA    1 
ATOM   5486  C  C     . PHE B  1 315 ? 21.920  23.297  58.234  1.00 46.54  ? 456 PHE B C     1 
ATOM   5487  O  O     . PHE B  1 315 ? 22.962  23.956  58.162  1.00 49.18  ? 456 PHE B O     1 
ATOM   5488  C  CB    . PHE B  1 315 ? 19.757  24.328  58.968  1.00 46.44  ? 456 PHE B CB    1 
ATOM   5489  C  CG    . PHE B  1 315 ? 20.259  25.579  59.630  1.00 48.05  ? 456 PHE B CG    1 
ATOM   5490  C  CD1   . PHE B  1 315 ? 19.907  26.829  59.138  1.00 45.46  ? 456 PHE B CD1   1 
ATOM   5491  C  CD2   . PHE B  1 315 ? 21.080  25.510  60.745  1.00 48.95  ? 456 PHE B CD2   1 
ATOM   5492  C  CE1   . PHE B  1 315 ? 20.367  27.984  59.745  1.00 45.39  ? 456 PHE B CE1   1 
ATOM   5493  C  CE2   . PHE B  1 315 ? 21.545  26.664  61.355  1.00 49.62  ? 456 PHE B CE2   1 
ATOM   5494  C  CZ    . PHE B  1 315 ? 21.187  27.900  60.852  1.00 48.24  ? 456 PHE B CZ    1 
ATOM   5495  N  N     . LEU B  1 316 ? 21.879  22.041  58.673  1.00 44.37  ? 457 LEU B N     1 
ATOM   5496  C  CA    . LEU B  1 316 ? 23.083  21.377  59.147  1.00 40.83  ? 457 LEU B CA    1 
ATOM   5497  C  C     . LEU B  1 316 ? 24.120  21.354  58.041  1.00 43.40  ? 457 LEU B C     1 
ATOM   5498  O  O     . LEU B  1 316 ? 25.294  21.642  58.277  1.00 45.63  ? 457 LEU B O     1 
ATOM   5499  C  CB    . LEU B  1 316 ? 22.768  19.966  59.636  1.00 36.56  ? 457 LEU B CB    1 
ATOM   5500  C  CG    . LEU B  1 316 ? 22.003  19.934  60.956  1.00 34.95  ? 457 LEU B CG    1 
ATOM   5501  C  CD1   . LEU B  1 316 ? 21.373  18.582  61.212  1.00 36.87  ? 457 LEU B CD1   1 
ATOM   5502  C  CD2   . LEU B  1 316 ? 22.931  20.297  62.088  1.00 35.54  ? 457 LEU B CD2   1 
ATOM   5503  N  N     . GLU B  1 317 ? 23.672  21.057  56.825  1.00 44.74  ? 458 GLU B N     1 
ATOM   5504  C  CA    . GLU B  1 317 ? 24.572  21.007  55.686  1.00 43.40  ? 458 GLU B CA    1 
ATOM   5505  C  C     . GLU B  1 317 ? 25.206  22.375  55.471  1.00 44.16  ? 458 GLU B C     1 
ATOM   5506  O  O     . GLU B  1 317 ? 26.406  22.471  55.197  1.00 46.88  ? 458 GLU B O     1 
ATOM   5507  C  CB    . GLU B  1 317 ? 23.824  20.544  54.436  1.00 45.78  ? 458 GLU B CB    1 
ATOM   5508  C  CG    . GLU B  1 317 ? 24.694  20.383  53.202  1.00 53.07  ? 458 GLU B CG    1 
ATOM   5509  C  CD    . GLU B  1 317 ? 25.708  19.256  53.324  1.00 57.63  ? 458 GLU B CD    1 
ATOM   5510  O  OE1   . GLU B  1 317 ? 25.594  18.434  54.257  1.00 58.99  ? 458 GLU B OE1   1 
ATOM   5511  O  OE2   . GLU B  1 317 ? 26.621  19.191  52.475  1.00 58.59  ? 458 GLU B OE2   1 
ATOM   5512  N  N     . CYS B  1 318 ? 24.407  23.427  55.643  1.00 42.60  ? 459 CYS B N     1 
ATOM   5513  C  CA    . CYS B  1 318 ? 24.911  24.786  55.506  1.00 41.61  ? 459 CYS B CA    1 
ATOM   5514  C  C     . CYS B  1 318 ? 26.028  25.026  56.507  1.00 43.95  ? 459 CYS B C     1 
ATOM   5515  O  O     . CYS B  1 318 ? 27.007  25.701  56.202  1.00 44.08  ? 459 CYS B O     1 
ATOM   5516  C  CB    . CYS B  1 318 ? 23.794  25.799  55.726  1.00 41.56  ? 459 CYS B CB    1 
ATOM   5517  S  SG    . CYS B  1 318 ? 22.588  25.864  54.399  1.00 42.98  ? 459 CYS B SG    1 
ATOM   5518  N  N     . LEU B  1 319 ? 25.881  24.450  57.697  1.00 47.04  ? 460 LEU B N     1 
ATOM   5519  C  CA    . LEU B  1 319 ? 26.907  24.552  58.722  1.00 44.46  ? 460 LEU B CA    1 
ATOM   5520  C  C     . LEU B  1 319 ? 28.098  23.676  58.358  1.00 48.49  ? 460 LEU B C     1 
ATOM   5521  O  O     . LEU B  1 319 ? 29.244  24.068  58.571  1.00 52.35  ? 460 LEU B O     1 
ATOM   5522  C  CB    . LEU B  1 319 ? 26.347  24.151  60.090  1.00 39.96  ? 460 LEU B CB    1 
ATOM   5523  C  CG    . LEU B  1 319 ? 25.345  25.096  60.758  1.00 34.76  ? 460 LEU B CG    1 
ATOM   5524  C  CD1   . LEU B  1 319 ? 24.705  24.448  61.972  1.00 32.74  ? 460 LEU B CD1   1 
ATOM   5525  C  CD2   . LEU B  1 319 ? 26.023  26.378  61.167  1.00 32.75  ? 460 LEU B CD2   1 
ATOM   5526  N  N     . ARG B  1 320 ? 27.826  22.501  57.793  1.00 52.00  ? 461 ARG B N     1 
ATOM   5527  C  CA    . ARG B  1 320 ? 28.892  21.551  57.485  1.00 55.39  ? 461 ARG B CA    1 
ATOM   5528  C  C     . ARG B  1 320 ? 29.766  22.073  56.359  1.00 54.71  ? 461 ARG B C     1 
ATOM   5529  O  O     . ARG B  1 320 ? 30.987  21.923  56.381  1.00 58.02  ? 461 ARG B O     1 
ATOM   5530  C  CB    . ARG B  1 320 ? 28.325  20.182  57.103  1.00 57.20  ? 461 ARG B CB    1 
ATOM   5531  C  CG    . ARG B  1 320 ? 29.395  19.114  56.900  1.00 59.90  ? 461 ARG B CG    1 
ATOM   5532  C  CD    . ARG B  1 320 ? 28.876  17.910  56.125  1.00 61.90  ? 461 ARG B CD    1 
ATOM   5533  N  NE    . ARG B  1 320 ? 28.506  18.264  54.757  1.00 65.69  ? 461 ARG B NE    1 
ATOM   5534  C  CZ    . ARG B  1 320 ? 29.341  18.233  53.719  1.00 67.61  ? 461 ARG B CZ    1 
ATOM   5535  N  NH1   . ARG B  1 320 ? 30.605  17.866  53.882  1.00 67.80  ? 461 ARG B NH1   1 
ATOM   5536  N  NH2   . ARG B  1 320 ? 28.913  18.572  52.513  1.00 67.23  ? 461 ARG B NH2   1 
ATOM   5537  N  N     . THR B  1 321 ? 29.124  22.690  55.375  1.00 53.13  ? 462 THR B N     1 
ATOM   5538  C  CA    . THR B  1 321 ? 29.827  23.259  54.239  1.00 54.81  ? 462 THR B CA    1 
ATOM   5539  C  C     . THR B  1 321 ? 30.339  24.649  54.585  1.00 56.89  ? 462 THR B C     1 
ATOM   5540  O  O     . THR B  1 321 ? 31.172  25.207  53.866  1.00 56.64  ? 462 THR B O     1 
ATOM   5541  C  CB    . THR B  1 321 ? 28.917  23.335  52.995  1.00 52.45  ? 462 THR B CB    1 
ATOM   5542  O  OG1   . THR B  1 321 ? 27.667  23.948  53.342  1.00 52.36  ? 462 THR B OG1   1 
ATOM   5543  C  CG2   . THR B  1 321 ? 28.642  21.946  52.454  1.00 51.28  ? 462 THR B CG2   1 
ATOM   5544  N  N     . GLU B  1 322 ? 29.845  25.183  55.703  1.00 59.35  ? 463 GLU B N     1 
ATOM   5545  C  CA    . GLU B  1 322 ? 30.100  26.566  56.103  1.00 61.21  ? 463 GLU B CA    1 
ATOM   5546  C  C     . GLU B  1 322 ? 29.723  27.492  54.958  1.00 58.53  ? 463 GLU B C     1 
ATOM   5547  O  O     . GLU B  1 322 ? 30.496  28.371  54.563  1.00 61.57  ? 463 GLU B O     1 
ATOM   5548  C  CB    . GLU B  1 322 ? 31.556  26.760  56.528  1.00 64.32  ? 463 GLU B CB    1 
ATOM   5549  C  CG    . GLU B  1 322 ? 32.033  25.695  57.500  1.00 67.81  ? 463 GLU B CG    1 
ATOM   5550  C  CD    . GLU B  1 322 ? 33.458  25.917  57.952  1.00 70.90  ? 463 GLU B CD    1 
ATOM   5551  O  OE1   . GLU B  1 322 ? 34.126  24.923  58.305  1.00 72.33  ? 463 GLU B OE1   1 
ATOM   5552  O  OE2   . GLU B  1 322 ? 33.910  27.083  57.962  1.00 70.92  ? 463 GLU B OE2   1 
ATOM   5553  N  N     . LYS B  1 323 ? 28.528  27.266  54.424  1.00 52.31  ? 464 LYS B N     1 
ATOM   5554  C  CA    . LYS B  1 323 ? 28.055  27.999  53.267  1.00 47.81  ? 464 LYS B CA    1 
ATOM   5555  C  C     . LYS B  1 323 ? 26.566  28.274  53.369  1.00 38.98  ? 464 LYS B C     1 
ATOM   5556  O  O     . LYS B  1 323 ? 25.741  27.399  53.104  1.00 39.97  ? 464 LYS B O     1 
ATOM   5557  C  CB    . LYS B  1 323 ? 28.364  27.226  51.983  1.00 52.86  ? 464 LYS B CB    1 
ATOM   5558  C  CG    . LYS B  1 323 ? 27.755  27.845  50.739  1.00 53.41  ? 464 LYS B CG    1 
ATOM   5559  C  CD    . LYS B  1 323 ? 28.608  27.582  49.519  1.00 55.10  ? 464 LYS B CD    1 
ATOM   5560  C  CE    . LYS B  1 323 ? 27.953  28.157  48.278  1.00 56.85  ? 464 LYS B CE    1 
ATOM   5561  N  NZ    . LYS B  1 323 ? 26.552  27.679  48.130  1.00 56.18  ? 464 LYS B NZ    1 
ATOM   5562  N  N     . LEU B  1 324 ? 26.238  29.493  53.779  1.00 37.08  ? 465 LEU B N     1 
ATOM   5563  C  CA    . LEU B  1 324 ? 24.873  29.985  53.729  1.00 34.97  ? 465 LEU B CA    1 
ATOM   5564  C  C     . LEU B  1 324 ? 24.893  31.309  52.983  1.00 36.68  ? 465 LEU B C     1 
ATOM   5565  O  O     . LEU B  1 324 ? 25.136  32.354  53.585  1.00 40.68  ? 465 LEU B O     1 
ATOM   5566  C  CB    . LEU B  1 324 ? 24.316  30.182  55.137  1.00 32.40  ? 465 LEU B CB    1 
ATOM   5567  C  CG    . LEU B  1 324 ? 22.845  30.601  55.197  1.00 31.62  ? 465 LEU B CG    1 
ATOM   5568  C  CD1   . LEU B  1 324 ? 21.993  29.591  54.462  1.00 34.21  ? 465 LEU B CD1   1 
ATOM   5569  C  CD2   . LEU B  1 324 ? 22.362  30.763  56.623  1.00 25.20  ? 465 LEU B CD2   1 
ATOM   5570  N  N     . ASP B  1 325 ? 24.660  31.262  51.673  1.00 37.23  ? 466 ASP B N     1 
ATOM   5571  C  CA    . ASP B  1 325 ? 24.730  32.457  50.837  1.00 40.06  ? 466 ASP B CA    1 
ATOM   5572  C  C     . ASP B  1 325 ? 23.579  33.401  51.127  1.00 41.35  ? 466 ASP B C     1 
ATOM   5573  O  O     . ASP B  1 325 ? 22.480  32.954  51.447  1.00 47.96  ? 466 ASP B O     1 
ATOM   5574  C  CB    . ASP B  1 325 ? 24.677  32.075  49.361  1.00 43.39  ? 466 ASP B CB    1 
ATOM   5575  C  CG    . ASP B  1 325 ? 25.884  31.287  48.914  1.00 48.91  ? 466 ASP B CG    1 
ATOM   5576  O  OD1   . ASP B  1 325 ? 27.011  31.619  49.339  1.00 49.20  ? 466 ASP B OD1   1 
ATOM   5577  O  OD2   . ASP B  1 325 ? 25.699  30.340  48.123  1.00 52.41  ? 466 ASP B OD2   1 
ATOM   5578  N  N     . HIS B  1 326 ? 23.818  34.703  51.008  1.00 38.16  ? 467 HIS B N     1 
ATOM   5579  C  CA    . HIS B  1 326 ? 22.729  35.669  51.116  1.00 36.86  ? 467 HIS B CA    1 
ATOM   5580  C  C     . HIS B  1 326 ? 21.787  35.454  49.933  1.00 37.15  ? 467 HIS B C     1 
ATOM   5581  O  O     . HIS B  1 326 ? 22.248  35.247  48.812  1.00 38.89  ? 467 HIS B O     1 
ATOM   5582  C  CB    . HIS B  1 326 ? 23.281  37.093  51.113  1.00 38.59  ? 467 HIS B CB    1 
ATOM   5583  C  CG    . HIS B  1 326 ? 22.296  38.131  51.556  1.00 33.66  ? 467 HIS B CG    1 
ATOM   5584  N  ND1   . HIS B  1 326 ? 21.233  38.529  50.775  1.00 32.75  ? 467 HIS B ND1   1 
ATOM   5585  C  CD2   . HIS B  1 326 ? 22.224  38.866  52.690  1.00 31.04  ? 467 HIS B CD2   1 
ATOM   5586  C  CE1   . HIS B  1 326 ? 20.542  39.457  51.414  1.00 32.05  ? 467 HIS B CE1   1 
ATOM   5587  N  NE2   . HIS B  1 326 ? 21.124  39.681  52.577  1.00 30.55  ? 467 HIS B NE2   1 
ATOM   5588  N  N     . TYR B  1 327 ? 20.478  35.489  50.178  1.00 38.93  ? 468 TYR B N     1 
ATOM   5589  C  CA    . TYR B  1 327 ? 19.497  35.105  49.158  1.00 34.09  ? 468 TYR B CA    1 
ATOM   5590  C  C     . TYR B  1 327 ? 19.396  36.109  48.021  1.00 36.97  ? 468 TYR B C     1 
ATOM   5591  O  O     . TYR B  1 327 ? 18.953  35.768  46.922  1.00 40.42  ? 468 TYR B O     1 
ATOM   5592  C  CB    . TYR B  1 327 ? 18.117  34.891  49.784  1.00 30.10  ? 468 TYR B CB    1 
ATOM   5593  C  CG    . TYR B  1 327 ? 17.130  34.168  48.883  1.00 30.39  ? 468 TYR B CG    1 
ATOM   5594  C  CD1   . TYR B  1 327 ? 17.324  32.840  48.534  1.00 28.20  ? 468 TYR B CD1   1 
ATOM   5595  C  CD2   . TYR B  1 327 ? 15.992  34.808  48.401  1.00 31.87  ? 468 TYR B CD2   1 
ATOM   5596  C  CE1   . TYR B  1 327 ? 16.424  32.173  47.721  1.00 26.34  ? 468 TYR B CE1   1 
ATOM   5597  C  CE2   . TYR B  1 327 ? 15.088  34.146  47.587  1.00 28.35  ? 468 TYR B CE2   1 
ATOM   5598  C  CZ    . TYR B  1 327 ? 15.313  32.831  47.253  1.00 28.36  ? 468 TYR B CZ    1 
ATOM   5599  O  OH    . TYR B  1 327 ? 14.420  32.168  46.448  1.00 34.41  ? 468 TYR B OH    1 
ATOM   5600  N  N     . PHE B  1 328 ? 19.806  37.344  48.288  1.00 37.47  ? 469 PHE B N     1 
ATOM   5601  C  CA    . PHE B  1 328 ? 19.761  38.386  47.278  1.00 31.17  ? 469 PHE B CA    1 
ATOM   5602  C  C     . PHE B  1 328 ? 21.161  38.708  46.759  1.00 31.79  ? 469 PHE B C     1 
ATOM   5603  O  O     . PHE B  1 328 ? 21.315  39.198  45.644  1.00 35.12  ? 469 PHE B O     1 
ATOM   5604  C  CB    . PHE B  1 328 ? 19.088  39.636  47.841  1.00 24.97  ? 469 PHE B CB    1 
ATOM   5605  C  CG    . PHE B  1 328 ? 17.654  39.424  48.258  1.00 26.74  ? 469 PHE B CG    1 
ATOM   5606  C  CD1   . PHE B  1 328 ? 17.346  38.851  49.487  1.00 28.93  ? 469 PHE B CD1   1 
ATOM   5607  C  CD2   . PHE B  1 328 ? 16.611  39.817  47.430  1.00 20.06  ? 469 PHE B CD2   1 
ATOM   5608  C  CE1   . PHE B  1 328 ? 16.029  38.661  49.870  1.00 23.54  ? 469 PHE B CE1   1 
ATOM   5609  C  CE2   . PHE B  1 328 ? 15.297  39.624  47.811  1.00 17.55  ? 469 PHE B CE2   1 
ATOM   5610  C  CZ    . PHE B  1 328 ? 15.007  39.048  49.030  1.00 18.83  ? 469 PHE B CZ    1 
ATOM   5611  N  N     . ILE B  1 329 ? 22.172  38.425  47.576  1.00 32.22  ? 470 ILE B N     1 
ATOM   5612  C  CA    . ILE B  1 329 ? 23.567  38.630  47.197  1.00 33.11  ? 470 ILE B CA    1 
ATOM   5613  C  C     . ILE B  1 329 ? 24.333  37.319  47.347  1.00 37.89  ? 470 ILE B C     1 
ATOM   5614  O  O     . ILE B  1 329 ? 24.904  37.052  48.406  1.00 43.93  ? 470 ILE B O     1 
ATOM   5615  C  CB    . ILE B  1 329 ? 24.231  39.702  48.070  1.00 27.09  ? 470 ILE B CB    1 
ATOM   5616  C  CG1   . ILE B  1 329 ? 23.349  40.944  48.153  1.00 22.72  ? 470 ILE B CG1   1 
ATOM   5617  C  CG2   . ILE B  1 329 ? 25.588  40.068  47.514  1.00 31.04  ? 470 ILE B CG2   1 
ATOM   5618  C  CD1   . ILE B  1 329 ? 23.446  41.678  49.466  1.00 25.03  ? 470 ILE B CD1   1 
ATOM   5619  N  N     . PRO B  1 330 ? 24.345  36.503  46.278  1.00 33.38  ? 471 PRO B N     1 
ATOM   5620  C  CA    . PRO B  1 330 ? 24.877  35.134  46.271  1.00 35.49  ? 471 PRO B CA    1 
ATOM   5621  C  C     . PRO B  1 330 ? 26.338  35.025  46.705  1.00 39.20  ? 471 PRO B C     1 
ATOM   5622  O  O     . PRO B  1 330 ? 26.696  34.035  47.350  1.00 40.71  ? 471 PRO B O     1 
ATOM   5623  C  CB    . PRO B  1 330 ? 24.745  34.720  44.804  1.00 38.02  ? 471 PRO B CB    1 
ATOM   5624  C  CG    . PRO B  1 330 ? 23.620  35.548  44.280  1.00 38.76  ? 471 PRO B CG    1 
ATOM   5625  C  CD    . PRO B  1 330 ? 23.767  36.871  44.973  1.00 35.71  ? 471 PRO B CD    1 
ATOM   5626  N  N     . LYS B  1 331 ? 27.163  36.009  46.352  1.00 42.09  ? 472 LYS B N     1 
ATOM   5627  C  CA    . LYS B  1 331 ? 28.584  35.968  46.697  1.00 44.58  ? 472 LYS B CA    1 
ATOM   5628  C  C     . LYS B  1 331 ? 28.848  36.318  48.161  1.00 44.99  ? 472 LYS B C     1 
ATOM   5629  O  O     . LYS B  1 331 ? 29.921  36.026  48.694  1.00 44.36  ? 472 LYS B O     1 
ATOM   5630  C  CB    . LYS B  1 331 ? 29.403  36.877  45.777  1.00 45.01  ? 472 LYS B CB    1 
ATOM   5631  C  CG    . LYS B  1 331 ? 29.267  38.367  46.054  1.00 42.96  ? 472 LYS B CG    1 
ATOM   5632  C  CD    . LYS B  1 331 ? 30.570  39.071  45.697  1.00 43.01  ? 472 LYS B CD    1 
ATOM   5633  C  CE    . LYS B  1 331 ? 30.339  40.496  45.227  1.00 42.16  ? 472 LYS B CE    1 
ATOM   5634  N  NZ    . LYS B  1 331 ? 31.612  41.117  44.762  1.00 40.34  ? 472 LYS B NZ    1 
ATOM   5635  N  N     . PHE B  1 332 ? 27.865  36.937  48.805  1.00 46.25  ? 473 PHE B N     1 
ATOM   5636  C  CA    . PHE B  1 332 ? 27.969  37.285  50.214  1.00 43.78  ? 473 PHE B CA    1 
ATOM   5637  C  C     . PHE B  1 332 ? 27.622  36.077  51.079  1.00 45.45  ? 473 PHE B C     1 
ATOM   5638  O  O     . PHE B  1 332 ? 26.455  35.687  51.180  1.00 48.47  ? 473 PHE B O     1 
ATOM   5639  C  CB    . PHE B  1 332 ? 27.047  38.466  50.520  1.00 41.90  ? 473 PHE B CB    1 
ATOM   5640  C  CG    . PHE B  1 332 ? 27.139  38.971  51.932  1.00 41.96  ? 473 PHE B CG    1 
ATOM   5641  C  CD1   . PHE B  1 332 ? 28.362  39.315  52.487  1.00 44.88  ? 473 PHE B CD1   1 
ATOM   5642  C  CD2   . PHE B  1 332 ? 25.994  39.134  52.694  1.00 43.36  ? 473 PHE B CD2   1 
ATOM   5643  C  CE1   . PHE B  1 332 ? 28.440  39.788  53.791  1.00 45.33  ? 473 PHE B CE1   1 
ATOM   5644  C  CE2   . PHE B  1 332 ? 26.066  39.609  53.995  1.00 44.23  ? 473 PHE B CE2   1 
ATOM   5645  C  CZ    . PHE B  1 332 ? 27.291  39.935  54.543  1.00 43.37  ? 473 PHE B CZ    1 
ATOM   5646  N  N     . ASN B  1 333 ? 28.642  35.480  51.689  1.00 43.68  ? 474 ASN B N     1 
ATOM   5647  C  CA    . ASN B  1 333 ? 28.449  34.309  52.539  1.00 45.36  ? 474 ASN B CA    1 
ATOM   5648  C  C     . ASN B  1 333 ? 28.197  34.692  53.989  1.00 47.78  ? 474 ASN B C     1 
ATOM   5649  O  O     . ASN B  1 333 ? 28.881  35.553  54.542  1.00 51.41  ? 474 ASN B O     1 
ATOM   5650  C  CB    . ASN B  1 333 ? 29.655  33.369  52.457  1.00 46.41  ? 474 ASN B CB    1 
ATOM   5651  C  CG    . ASN B  1 333 ? 29.428  32.059  53.198  1.00 47.16  ? 474 ASN B CG    1 
ATOM   5652  O  OD1   . ASN B  1 333 ? 28.292  31.612  53.367  1.00 47.51  ? 474 ASN B OD1   1 
ATOM   5653  N  ND2   . ASN B  1 333 ? 30.512  31.436  53.637  1.00 46.53  ? 474 ASN B ND2   1 
ATOM   5654  N  N     . LEU B  1 334 ? 27.220  34.035  54.601  1.00 46.30  ? 475 LEU B N     1 
ATOM   5655  C  CA    . LEU B  1 334 ? 26.831  34.335  55.969  1.00 46.86  ? 475 LEU B CA    1 
ATOM   5656  C  C     . LEU B  1 334 ? 27.502  33.381  56.957  1.00 52.11  ? 475 LEU B C     1 
ATOM   5657  O  O     . LEU B  1 334 ? 27.541  33.653  58.158  1.00 54.78  ? 475 LEU B O     1 
ATOM   5658  C  CB    . LEU B  1 334 ? 25.306  34.278  56.109  1.00 45.21  ? 475 LEU B CB    1 
ATOM   5659  C  CG    . LEU B  1 334 ? 24.496  35.555  55.853  1.00 44.87  ? 475 LEU B CG    1 
ATOM   5660  C  CD1   . LEU B  1 334 ? 25.049  36.351  54.695  1.00 44.70  ? 475 LEU B CD1   1 
ATOM   5661  C  CD2   . LEU B  1 334 ? 23.041  35.227  55.595  1.00 45.74  ? 475 LEU B CD2   1 
ATOM   5662  N  N     . PHE B  1 335 ? 28.027  32.268  56.448  1.00 52.96  ? 476 PHE B N     1 
ATOM   5663  C  CA    . PHE B  1 335 ? 28.712  31.293  57.287  1.00 52.43  ? 476 PHE B CA    1 
ATOM   5664  C  C     . PHE B  1 335 ? 30.209  31.261  56.982  1.00 59.89  ? 476 PHE B C     1 
ATOM   5665  O  O     . PHE B  1 335 ? 30.860  30.219  57.106  1.00 64.17  ? 476 PHE B O     1 
ATOM   5666  C  CB    . PHE B  1 335 ? 28.097  29.899  57.120  1.00 48.85  ? 476 PHE B CB    1 
ATOM   5667  C  CG    . PHE B  1 335 ? 26.836  29.688  57.915  1.00 46.27  ? 476 PHE B CG    1 
ATOM   5668  C  CD1   . PHE B  1 335 ? 26.387  30.655  58.803  1.00 45.28  ? 476 PHE B CD1   1 
ATOM   5669  C  CD2   . PHE B  1 335 ? 26.104  28.516  57.782  1.00 46.50  ? 476 PHE B CD2   1 
ATOM   5670  C  CE1   . PHE B  1 335 ? 25.228  30.462  59.540  1.00 43.59  ? 476 PHE B CE1   1 
ATOM   5671  C  CE2   . PHE B  1 335 ? 24.942  28.317  58.514  1.00 47.06  ? 476 PHE B CE2   1 
ATOM   5672  C  CZ    . PHE B  1 335 ? 24.507  29.289  59.394  1.00 45.07  ? 476 PHE B CZ    1 
ATOM   5673  N  N     . SER B  1 336 ? 30.751  32.409  56.587  1.00 59.50  ? 477 SER B N     1 
ATOM   5674  C  CA    . SER B  1 336 ? 32.182  32.520  56.345  1.00 59.15  ? 477 SER B CA    1 
ATOM   5675  C  C     . SER B  1 336 ? 32.936  32.449  57.664  1.00 60.09  ? 477 SER B C     1 
ATOM   5676  O  O     . SER B  1 336 ? 32.347  32.591  58.736  1.00 58.28  ? 477 SER B O     1 
ATOM   5677  C  CB    . SER B  1 336 ? 32.513  33.830  55.630  1.00 57.12  ? 477 SER B CB    1 
ATOM   5678  O  OG    . SER B  1 336 ? 32.203  34.946  56.443  1.00 57.71  ? 477 SER B OG    1 
ATOM   5679  N  N     . GLN B  1 337 ? 34.240  32.216  57.580  1.00 60.75  ? 478 GLN B N     1 
ATOM   5680  C  CA    . GLN B  1 337 ? 35.083  32.191  58.764  1.00 57.77  ? 478 GLN B CA    1 
ATOM   5681  C  C     . GLN B  1 337 ? 35.265  33.617  59.287  1.00 55.51  ? 478 GLN B C     1 
ATOM   5682  O  O     . GLN B  1 337 ? 35.467  33.833  60.482  1.00 54.23  ? 478 GLN B O     1 
ATOM   5683  C  CB    . GLN B  1 337 ? 36.428  31.539  58.430  1.00 59.15  ? 478 GLN B CB    1 
ATOM   5684  C  CG    . GLN B  1 337 ? 37.367  31.346  59.618  1.00 61.40  ? 478 GLN B CG    1 
ATOM   5685  C  CD    . GLN B  1 337 ? 36.787  30.452  60.701  1.00 61.85  ? 478 GLN B CD    1 
ATOM   5686  O  OE1   . GLN B  1 337 ? 35.844  29.698  60.466  1.00 65.18  ? 478 GLN B OE1   1 
ATOM   5687  N  NE2   . GLN B  1 337 ? 37.352  30.538  61.897  1.00 58.43  ? 478 GLN B NE2   1 
ATOM   5688  N  N     . GLU B  1 338 ? 35.161  34.585  58.381  1.00 55.61  ? 479 GLU B N     1 
ATOM   5689  C  CA    . GLU B  1 338 ? 35.327  35.993  58.719  1.00 56.14  ? 479 GLU B CA    1 
ATOM   5690  C  C     . GLU B  1 338 ? 34.237  36.468  59.675  1.00 59.54  ? 479 GLU B C     1 
ATOM   5691  O  O     . GLU B  1 338 ? 34.481  37.313  60.541  1.00 63.61  ? 479 GLU B O     1 
ATOM   5692  C  CB    . GLU B  1 338 ? 35.294  36.856  57.454  1.00 56.37  ? 479 GLU B CB    1 
ATOM   5693  C  CG    . GLU B  1 338 ? 36.259  36.434  56.349  1.00 62.39  ? 479 GLU B CG    1 
ATOM   5694  C  CD    . GLU B  1 338 ? 35.727  35.297  55.494  1.00 66.47  ? 479 GLU B CD    1 
ATOM   5695  O  OE1   . GLU B  1 338 ? 35.767  34.134  55.949  1.00 66.59  ? 479 GLU B OE1   1 
ATOM   5696  O  OE2   . GLU B  1 338 ? 35.274  35.565  54.364  1.00 69.39  ? 479 GLU B OE2   1 
ATOM   5697  N  N     . LEU B  1 339 ? 33.036  35.919  59.509  1.00 56.01  ? 480 LEU B N     1 
ATOM   5698  C  CA    . LEU B  1 339 ? 31.876  36.344  60.283  1.00 53.53  ? 480 LEU B CA    1 
ATOM   5699  C  C     . LEU B  1 339 ? 31.566  35.392  61.441  1.00 53.30  ? 480 LEU B C     1 
ATOM   5700  O  O     . LEU B  1 339 ? 31.243  35.834  62.546  1.00 55.14  ? 480 LEU B O     1 
ATOM   5701  C  CB    . LEU B  1 339 ? 30.656  36.481  59.372  1.00 53.84  ? 480 LEU B CB    1 
ATOM   5702  C  CG    . LEU B  1 339 ? 30.803  37.401  58.159  1.00 52.80  ? 480 LEU B CG    1 
ATOM   5703  C  CD1   . LEU B  1 339 ? 29.603  37.289  57.231  1.00 51.25  ? 480 LEU B CD1   1 
ATOM   5704  C  CD2   . LEU B  1 339 ? 30.995  38.835  58.602  1.00 51.17  ? 480 LEU B CD2   1 
ATOM   5705  N  N     . ILE B  1 340 ? 31.652  34.089  61.185  1.00 53.06  ? 481 ILE B N     1 
ATOM   5706  C  CA    . ILE B  1 340 ? 31.399  33.090  62.224  1.00 54.59  ? 481 ILE B CA    1 
ATOM   5707  C  C     . ILE B  1 340 ? 32.533  32.069  62.321  1.00 58.30  ? 481 ILE B C     1 
ATOM   5708  O  O     . ILE B  1 340 ? 32.989  31.539  61.306  1.00 60.47  ? 481 ILE B O     1 
ATOM   5709  C  CB    . ILE B  1 340 ? 30.052  32.366  62.005  1.00 48.90  ? 481 ILE B CB    1 
ATOM   5710  C  CG1   . ILE B  1 340 ? 28.919  33.384  61.851  1.00 42.63  ? 481 ILE B CG1   1 
ATOM   5711  C  CG2   . ILE B  1 340 ? 29.752  31.437  63.163  1.00 47.66  ? 481 ILE B CG2   1 
ATOM   5712  C  CD1   . ILE B  1 340 ? 27.552  32.777  61.707  1.00 34.90  ? 481 ILE B CD1   1 
ATOM   5713  N  N     . ASP B  1 341 ? 32.986  31.800  63.543  1.00 60.12  ? 482 ASP B N     1 
ATOM   5714  C  CA    . ASP B  1 341 ? 34.057  30.837  63.765  1.00 64.79  ? 482 ASP B CA    1 
ATOM   5715  C  C     . ASP B  1 341 ? 33.539  29.412  63.605  1.00 67.55  ? 482 ASP B C     1 
ATOM   5716  O  O     . ASP B  1 341 ? 32.417  29.106  64.009  1.00 69.73  ? 482 ASP B O     1 
ATOM   5717  C  CB    . ASP B  1 341 ? 34.659  31.022  65.157  1.00 68.68  ? 482 ASP B CB    1 
ATOM   5718  C  CG    . ASP B  1 341 ? 36.172  30.893  65.158  1.00 74.88  ? 482 ASP B CG    1 
ATOM   5719  O  OD1   . ASP B  1 341 ? 36.762  30.767  64.064  1.00 76.84  ? 482 ASP B OD1   1 
ATOM   5720  O  OD2   . ASP B  1 341 ? 36.774  30.939  66.252  1.00 76.85  ? 482 ASP B OD2   1 
ATOM   5721  N  N     . ARG B  1 342 ? 34.362  28.550  63.013  1.00 69.10  ? 483 ARG B N     1 
ATOM   5722  C  CA    . ARG B  1 342 ? 34.002  27.151  62.798  1.00 70.25  ? 483 ARG B CA    1 
ATOM   5723  C  C     . ARG B  1 342 ? 33.539  26.460  64.069  1.00 70.12  ? 483 ARG B C     1 
ATOM   5724  O  O     . ARG B  1 342 ? 32.577  25.704  64.042  1.00 73.48  ? 483 ARG B O     1 
ATOM   5725  C  CB    . ARG B  1 342 ? 35.176  26.377  62.207  1.00 72.89  ? 483 ARG B CB    1 
ATOM   5726  C  CG    . ARG B  1 342 ? 35.434  26.665  60.749  1.00 76.00  ? 483 ARG B CG    1 
ATOM   5727  C  CD    . ARG B  1 342 ? 36.516  25.759  60.202  1.00 79.67  ? 483 ARG B CD    1 
ATOM   5728  N  NE    . ARG B  1 342 ? 36.905  26.137  58.848  1.00 81.38  ? 483 ARG B NE    1 
ATOM   5729  C  CZ    . ARG B  1 342 ? 37.766  25.452  58.107  1.00 83.49  ? 483 ARG B CZ    1 
ATOM   5730  N  NH1   . ARG B  1 342 ? 38.319  24.351  58.592  1.00 86.40  ? 483 ARG B NH1   1 
ATOM   5731  N  NH2   . ARG B  1 342 ? 38.071  25.864  56.885  1.00 83.03  ? 483 ARG B NH2   1 
ATOM   5732  N  N     . LYS B  1 343 ? 34.224  26.725  65.176  1.00 68.27  ? 484 LYS B N     1 
ATOM   5733  C  CA    . LYS B  1 343 ? 33.872  26.128  66.463  1.00 68.19  ? 484 LYS B CA    1 
ATOM   5734  C  C     . LYS B  1 343 ? 32.426  26.422  66.857  1.00 66.68  ? 484 LYS B C     1 
ATOM   5735  O  O     . LYS B  1 343 ? 31.756  25.574  67.451  1.00 68.82  ? 484 LYS B O     1 
ATOM   5736  C  CB    . LYS B  1 343 ? 34.826  26.615  67.556  1.00 69.44  ? 484 LYS B CB    1 
ATOM   5737  C  CG    . LYS B  1 343 ? 35.966  25.652  67.886  1.00 71.09  ? 484 LYS B CG    1 
ATOM   5738  C  CD    . LYS B  1 343 ? 35.467  24.455  68.694  1.00 72.56  ? 484 LYS B CD    1 
ATOM   5739  C  CE    . LYS B  1 343 ? 36.608  23.742  69.418  1.00 72.10  ? 484 LYS B CE    1 
ATOM   5740  N  NZ    . LYS B  1 343 ? 36.118  22.717  70.388  1.00 69.66  ? 484 LYS B NZ    1 
ATOM   5741  N  N     . SER B  1 344 ? 31.949  27.616  66.515  1.00 63.07  ? 485 SER B N     1 
ATOM   5742  C  CA    . SER B  1 344 ? 30.561  27.983  66.770  1.00 59.90  ? 485 SER B CA    1 
ATOM   5743  C  C     . SER B  1 344 ? 29.624  27.109  65.942  1.00 58.77  ? 485 SER B C     1 
ATOM   5744  O  O     . SER B  1 344 ? 28.698  26.498  66.475  1.00 60.65  ? 485 SER B O     1 
ATOM   5745  C  CB    . SER B  1 344 ? 30.322  29.454  66.430  1.00 59.44  ? 485 SER B CB    1 
ATOM   5746  O  OG    . SER B  1 344 ? 31.282  30.289  67.045  1.00 59.18  ? 485 SER B OG    1 
ATOM   5747  N  N     . LYS B  1 345 ? 29.875  27.056  64.639  1.00 55.25  ? 486 LYS B N     1 
ATOM   5748  C  CA    . LYS B  1 345 ? 29.054  26.276  63.722  1.00 51.69  ? 486 LYS B CA    1 
ATOM   5749  C  C     . LYS B  1 345 ? 29.019  24.792  64.096  1.00 52.90  ? 486 LYS B C     1 
ATOM   5750  O  O     . LYS B  1 345 ? 27.978  24.138  63.983  1.00 53.48  ? 486 LYS B O     1 
ATOM   5751  C  CB    . LYS B  1 345 ? 29.556  26.460  62.289  1.00 51.38  ? 486 LYS B CB    1 
ATOM   5752  C  CG    . LYS B  1 345 ? 29.518  27.910  61.800  1.00 49.91  ? 486 LYS B CG    1 
ATOM   5753  C  CD    . LYS B  1 345 ? 29.662  27.999  60.282  1.00 46.86  ? 486 LYS B CD    1 
ATOM   5754  C  CE    . LYS B  1 345 ? 31.089  28.282  59.857  1.00 44.67  ? 486 LYS B CE    1 
ATOM   5755  N  NZ    . LYS B  1 345 ? 31.564  29.589  60.369  1.00 44.98  ? 486 LYS B NZ    1 
ATOM   5756  N  N     . GLU B  1 346 ? 30.157  24.272  64.551  1.00 53.79  ? 487 GLU B N     1 
ATOM   5757  C  CA    . GLU B  1 346 ? 30.271  22.880  64.977  1.00 57.55  ? 487 GLU B CA    1 
ATOM   5758  C  C     . GLU B  1 346 ? 29.481  22.647  66.257  1.00 60.03  ? 487 GLU B C     1 
ATOM   5759  O  O     . GLU B  1 346 ? 28.745  21.666  66.370  1.00 61.60  ? 487 GLU B O     1 
ATOM   5760  C  CB    . GLU B  1 346 ? 31.738  22.502  65.205  1.00 61.18  ? 487 GLU B CB    1 
ATOM   5761  C  CG    . GLU B  1 346 ? 32.590  22.448  63.937  1.00 65.71  ? 487 GLU B CG    1 
ATOM   5762  C  CD    . GLU B  1 346 ? 34.040  22.110  64.228  1.00 70.88  ? 487 GLU B CD    1 
ATOM   5763  O  OE1   . GLU B  1 346 ? 34.382  21.912  65.413  1.00 74.64  ? 487 GLU B OE1   1 
ATOM   5764  O  OE2   . GLU B  1 346 ? 34.840  22.046  63.272  1.00 71.32  ? 487 GLU B OE2   1 
ATOM   5765  N  N     . PHE B  1 347 ? 29.654  23.547  67.222  1.00 60.88  ? 488 PHE B N     1 
ATOM   5766  C  CA    . PHE B  1 347 ? 28.893  23.517  68.468  1.00 59.17  ? 488 PHE B CA    1 
ATOM   5767  C  C     . PHE B  1 347 ? 27.394  23.455  68.180  1.00 55.69  ? 488 PHE B C     1 
ATOM   5768  O  O     . PHE B  1 347 ? 26.666  22.611  68.725  1.00 56.73  ? 488 PHE B O     1 
ATOM   5769  C  CB    . PHE B  1 347 ? 29.225  24.763  69.290  1.00 59.54  ? 488 PHE B CB    1 
ATOM   5770  C  CG    . PHE B  1 347 ? 28.419  24.899  70.544  1.00 60.86  ? 488 PHE B CG    1 
ATOM   5771  C  CD1   . PHE B  1 347 ? 28.715  24.131  71.659  1.00 63.31  ? 488 PHE B CD1   1 
ATOM   5772  C  CD2   . PHE B  1 347 ? 27.381  25.815  70.620  1.00 59.54  ? 488 PHE B CD2   1 
ATOM   5773  C  CE1   . PHE B  1 347 ? 27.979  24.262  72.822  1.00 62.65  ? 488 PHE B CE1   1 
ATOM   5774  C  CE2   . PHE B  1 347 ? 26.641  25.948  71.779  1.00 60.88  ? 488 PHE B CE2   1 
ATOM   5775  C  CZ    . PHE B  1 347 ? 26.942  25.170  72.879  1.00 61.97  ? 488 PHE B CZ    1 
ATOM   5776  N  N     . LEU B  1 348 ? 26.948  24.349  67.304  1.00 51.15  ? 489 LEU B N     1 
ATOM   5777  C  CA    . LEU B  1 348 ? 25.549  24.424  66.911  1.00 47.33  ? 489 LEU B CA    1 
ATOM   5778  C  C     . LEU B  1 348 ? 25.082  23.142  66.232  1.00 47.65  ? 489 LEU B C     1 
ATOM   5779  O  O     . LEU B  1 348 ? 23.986  22.660  66.503  1.00 49.92  ? 489 LEU B O     1 
ATOM   5780  C  CB    . LEU B  1 348 ? 25.317  25.619  65.990  1.00 44.01  ? 489 LEU B CB    1 
ATOM   5781  C  CG    . LEU B  1 348 ? 23.881  25.779  65.500  1.00 41.75  ? 489 LEU B CG    1 
ATOM   5782  C  CD1   . LEU B  1 348 ? 22.944  25.866  66.686  1.00 44.96  ? 489 LEU B CD1   1 
ATOM   5783  C  CD2   . LEU B  1 348 ? 23.737  26.999  64.614  1.00 37.50  ? 489 LEU B CD2   1 
ATOM   5784  N  N     . SER B  1 349 ? 25.913  22.601  65.347  1.00 47.45  ? 490 SER B N     1 
ATOM   5785  C  CA    . SER B  1 349 ? 25.589  21.353  64.666  1.00 51.42  ? 490 SER B CA    1 
ATOM   5786  C  C     . SER B  1 349 ? 25.387  20.240  65.681  1.00 53.02  ? 490 SER B C     1 
ATOM   5787  O  O     . SER B  1 349 ? 24.487  19.409  65.541  1.00 50.62  ? 490 SER B O     1 
ATOM   5788  C  CB    . SER B  1 349 ? 26.699  20.973  63.689  1.00 55.65  ? 490 SER B CB    1 
ATOM   5789  O  OG    . SER B  1 349 ? 26.913  21.995  62.734  1.00 57.24  ? 490 SER B OG    1 
ATOM   5790  N  N     . LYS B  1 350 ? 26.226  20.246  66.712  1.00 59.03  ? 491 LYS B N     1 
ATOM   5791  C  CA    . LYS B  1 350 ? 26.149  19.267  67.785  1.00 61.91  ? 491 LYS B CA    1 
ATOM   5792  C  C     . LYS B  1 350 ? 24.834  19.381  68.549  1.00 61.72  ? 491 LYS B C     1 
ATOM   5793  O  O     . LYS B  1 350 ? 24.079  18.409  68.635  1.00 64.79  ? 491 LYS B O     1 
ATOM   5794  C  CB    . LYS B  1 350 ? 27.330  19.442  68.739  1.00 65.58  ? 491 LYS B CB    1 
ATOM   5795  C  CG    . LYS B  1 350 ? 27.818  18.147  69.369  1.00 71.07  ? 491 LYS B CG    1 
ATOM   5796  C  CD    . LYS B  1 350 ? 29.124  18.360  70.119  1.00 76.08  ? 491 LYS B CD    1 
ATOM   5797  C  CE    . LYS B  1 350 ? 29.800  17.034  70.443  1.00 80.91  ? 491 LYS B CE    1 
ATOM   5798  N  NZ    . LYS B  1 350 ? 31.130  17.230  71.090  1.00 83.81  ? 491 LYS B NZ    1 
ATOM   5799  N  N     . LYS B  1 351 ? 24.560  20.563  69.098  1.00 61.32  ? 492 LYS B N     1 
ATOM   5800  C  CA    . LYS B  1 351 ? 23.323  20.784  69.857  1.00 61.50  ? 492 LYS B CA    1 
ATOM   5801  C  C     . LYS B  1 351 ? 22.058  20.479  69.044  1.00 61.13  ? 492 LYS B C     1 
ATOM   5802  O  O     . LYS B  1 351 ? 21.161  19.756  69.501  1.00 63.67  ? 492 LYS B O     1 
ATOM   5803  C  CB    . LYS B  1 351 ? 23.272  22.219  70.381  1.00 63.19  ? 492 LYS B CB    1 
ATOM   5804  C  CG    . LYS B  1 351 ? 24.389  22.559  71.354  1.00 65.62  ? 492 LYS B CG    1 
ATOM   5805  C  CD    . LYS B  1 351 ? 24.359  21.637  72.561  1.00 68.56  ? 492 LYS B CD    1 
ATOM   5806  C  CE    . LYS B  1 351 ? 25.551  21.889  73.471  1.00 72.27  ? 492 LYS B CE    1 
ATOM   5807  N  NZ    . LYS B  1 351 ? 25.484  21.095  74.731  1.00 73.09  ? 492 LYS B NZ    1 
ATOM   5808  N  N     . ILE B  1 352 ? 22.000  21.037  67.838  1.00 58.62  ? 493 ILE B N     1 
ATOM   5809  C  CA    . ILE B  1 352 ? 20.908  20.786  66.905  1.00 58.96  ? 493 ILE B CA    1 
ATOM   5810  C  C     . ILE B  1 352 ? 20.711  19.300  66.639  1.00 62.79  ? 493 ILE B C     1 
ATOM   5811  O  O     . ILE B  1 352 ? 19.592  18.800  66.730  1.00 64.60  ? 493 ILE B O     1 
ATOM   5812  C  CB    . ILE B  1 352 ? 21.134  21.512  65.566  1.00 57.18  ? 493 ILE B CB    1 
ATOM   5813  C  CG1   . ILE B  1 352 ? 20.838  23.002  65.713  1.00 55.48  ? 493 ILE B CG1   1 
ATOM   5814  C  CG2   . ILE B  1 352 ? 20.260  20.920  64.474  1.00 57.51  ? 493 ILE B CG2   1 
ATOM   5815  C  CD1   . ILE B  1 352 ? 20.905  23.763  64.404  1.00 55.32  ? 493 ILE B CD1   1 
ATOM   5816  N  N     . GLU B  1 353 ? 21.793  18.601  66.304  1.00 64.09  ? 494 GLU B N     1 
ATOM   5817  C  CA    . GLU B  1 353 ? 21.714  17.168  66.037  1.00 64.25  ? 494 GLU B CA    1 
ATOM   5818  C  C     . GLU B  1 353 ? 21.186  16.405  67.248  1.00 63.28  ? 494 GLU B C     1 
ATOM   5819  O  O     . GLU B  1 353 ? 20.337  15.524  67.110  1.00 63.89  ? 494 GLU B O     1 
ATOM   5820  C  CB    . GLU B  1 353 ? 23.070  16.613  65.590  1.00 66.05  ? 494 GLU B CB    1 
ATOM   5821  C  CG    . GLU B  1 353 ? 23.330  16.721  64.091  1.00 68.06  ? 494 GLU B CG    1 
ATOM   5822  C  CD    . GLU B  1 353 ? 22.627  15.637  63.285  1.00 70.92  ? 494 GLU B CD    1 
ATOM   5823  O  OE1   . GLU B  1 353 ? 23.269  15.053  62.388  1.00 72.35  ? 494 GLU B OE1   1 
ATOM   5824  O  OE2   . GLU B  1 353 ? 21.431  15.371  63.534  1.00 70.94  ? 494 GLU B OE2   1 
ATOM   5825  N  N     . TYR B  1 354 ? 21.682  16.762  68.429  1.00 62.76  ? 495 TYR B N     1 
ATOM   5826  C  CA    . TYR B  1 354 ? 21.172  16.204  69.675  1.00 64.99  ? 495 TYR B CA    1 
ATOM   5827  C  C     . TYR B  1 354 ? 19.659  16.338  69.768  1.00 65.59  ? 495 TYR B C     1 
ATOM   5828  O  O     . TYR B  1 354 ? 18.951  15.340  69.911  1.00 67.58  ? 495 TYR B O     1 
ATOM   5829  C  CB    . TYR B  1 354 ? 21.802  16.907  70.874  1.00 68.17  ? 495 TYR B CB    1 
ATOM   5830  C  CG    . TYR B  1 354 ? 21.171  16.498  72.183  1.00 72.90  ? 495 TYR B CG    1 
ATOM   5831  C  CD1   . TYR B  1 354 ? 21.469  15.273  72.759  1.00 74.50  ? 495 TYR B CD1   1 
ATOM   5832  C  CD2   . TYR B  1 354 ? 20.270  17.329  72.839  1.00 75.19  ? 495 TYR B CD2   1 
ATOM   5833  C  CE1   . TYR B  1 354 ? 20.896  14.886  73.948  1.00 75.34  ? 495 TYR B CE1   1 
ATOM   5834  C  CE2   . TYR B  1 354 ? 19.690  16.948  74.034  1.00 75.03  ? 495 TYR B CE2   1 
ATOM   5835  C  CZ    . TYR B  1 354 ? 20.008  15.724  74.581  1.00 75.84  ? 495 TYR B CZ    1 
ATOM   5836  O  OH    . TYR B  1 354 ? 19.438  15.330  75.767  1.00 77.22  ? 495 TYR B OH    1 
ATOM   5837  N  N     . GLU B  1 355 ? 19.177  17.578  69.695  1.00 64.81  ? 496 GLU B N     1 
ATOM   5838  C  CA    . GLU B  1 355 ? 17.744  17.868  69.749  1.00 63.72  ? 496 GLU B CA    1 
ATOM   5839  C  C     . GLU B  1 355 ? 16.950  17.096  68.700  1.00 61.04  ? 496 GLU B C     1 
ATOM   5840  O  O     . GLU B  1 355 ? 15.819  16.673  68.952  1.00 62.87  ? 496 GLU B O     1 
ATOM   5841  C  CB    . GLU B  1 355 ? 17.502  19.363  69.544  1.00 64.92  ? 496 GLU B CB    1 
ATOM   5842  C  CG    . GLU B  1 355 ? 18.064  20.254  70.635  1.00 66.76  ? 496 GLU B CG    1 
ATOM   5843  C  CD    . GLU B  1 355 ? 17.244  20.197  71.902  1.00 67.74  ? 496 GLU B CD    1 
ATOM   5844  O  OE1   . GLU B  1 355 ? 16.089  19.734  71.837  1.00 67.79  ? 496 GLU B OE1   1 
ATOM   5845  O  OE2   . GLU B  1 355 ? 17.752  20.616  72.960  1.00 68.83  ? 496 GLU B OE2   1 
ATOM   5846  N  N     . ARG B  1 356 ? 17.553  16.925  67.526  1.00 57.41  ? 497 ARG B N     1 
ATOM   5847  C  CA    . ARG B  1 356 ? 16.907  16.273  66.392  1.00 55.58  ? 497 ARG B CA    1 
ATOM   5848  C  C     . ARG B  1 356 ? 16.766  14.780  66.643  1.00 57.85  ? 497 ARG B C     1 
ATOM   5849  O  O     . ARG B  1 356 ? 15.806  14.150  66.189  1.00 59.80  ? 497 ARG B O     1 
ATOM   5850  C  CB    . ARG B  1 356 ? 17.715  16.511  65.112  1.00 51.55  ? 497 ARG B CB    1 
ATOM   5851  C  CG    . ARG B  1 356 ? 17.100  15.909  63.855  1.00 48.09  ? 497 ARG B CG    1 
ATOM   5852  C  CD    . ARG B  1 356 ? 17.993  16.095  62.636  1.00 45.37  ? 497 ARG B CD    1 
ATOM   5853  N  NE    . ARG B  1 356 ? 17.394  15.538  61.425  1.00 44.36  ? 497 ARG B NE    1 
ATOM   5854  C  CZ    . ARG B  1 356 ? 18.051  15.328  60.290  1.00 45.07  ? 497 ARG B CZ    1 
ATOM   5855  N  NH1   . ARG B  1 356 ? 19.340  15.622  60.201  1.00 42.38  ? 497 ARG B NH1   1 
ATOM   5856  N  NH2   . ARG B  1 356 ? 17.421  14.817  59.243  1.00 49.06  ? 497 ARG B NH2   1 
ATOM   5857  N  N     . ASN B  1 357 ? 17.724  14.220  67.376  1.00 58.22  ? 498 ASN B N     1 
ATOM   5858  C  CA    . ASN B  1 357 ? 17.715  12.794  67.665  1.00 58.93  ? 498 ASN B CA    1 
ATOM   5859  C  C     . ASN B  1 357 ? 17.068  12.454  69.008  1.00 62.63  ? 498 ASN B C     1 
ATOM   5860  O  O     . ASN B  1 357 ? 17.056  11.291  69.411  1.00 66.44  ? 498 ASN B O     1 
ATOM   5861  C  CB    . ASN B  1 357 ? 19.140  12.237  67.627  1.00 59.93  ? 498 ASN B CB    1 
ATOM   5862  C  CG    . ASN B  1 357 ? 19.914  12.684  66.401  1.00 62.29  ? 498 ASN B CG    1 
ATOM   5863  O  OD1   . ASN B  1 357 ? 19.348  13.244  65.463  1.00 63.47  ? 498 ASN B OD1   1 
ATOM   5864  N  ND2   . ASN B  1 357 ? 21.220  12.442  66.407  1.00 62.14  ? 498 ASN B ND2   1 
ATOM   5865  N  N     . ASN B  1 358 ? 16.529  13.456  69.697  1.00 61.44  ? 499 ASN B N     1 
ATOM   5866  C  CA    . ASN B  1 358 ? 16.024  13.242  71.051  1.00 62.34  ? 499 ASN B CA    1 
ATOM   5867  C  C     . ASN B  1 358 ? 14.615  13.756  71.327  1.00 63.54  ? 499 ASN B C     1 
ATOM   5868  O  O     . ASN B  1 358 ? 14.255  13.974  72.485  1.00 61.29  ? 499 ASN B O     1 
ATOM   5869  C  CB    . ASN B  1 358 ? 16.993  13.830  72.080  1.00 63.39  ? 499 ASN B CB    1 
ATOM   5870  C  CG    . ASN B  1 358 ? 18.117  12.880  72.434  1.00 65.26  ? 499 ASN B CG    1 
ATOM   5871  O  OD1   . ASN B  1 358 ? 18.616  12.141  71.587  1.00 65.83  ? 499 ASN B OD1   1 
ATOM   5872  N  ND2   . ASN B  1 358 ? 18.516  12.889  73.701  1.00 65.62  ? 499 ASN B ND2   1 
ATOM   5873  N  N     . GLY B  1 359 ? 13.825  13.948  70.275  1.00 66.63  ? 500 GLY B N     1 
ATOM   5874  C  CA    . GLY B  1 359 ? 12.441  14.364  70.430  1.00 65.66  ? 500 GLY B CA    1 
ATOM   5875  C  C     . GLY B  1 359 ? 12.273  15.821  70.818  1.00 62.88  ? 500 GLY B C     1 
ATOM   5876  O  O     . GLY B  1 359 ? 11.246  16.202  71.383  1.00 65.82  ? 500 GLY B O     1 
ATOM   5877  N  N     . PHE B  1 360 ? 13.288  16.626  70.510  1.00 56.32  ? 501 PHE B N     1 
ATOM   5878  C  CA    . PHE B  1 360 ? 13.290  18.063  70.786  1.00 53.05  ? 501 PHE B CA    1 
ATOM   5879  C  C     . PHE B  1 360 ? 12.849  18.441  72.201  1.00 53.85  ? 501 PHE B C     1 
ATOM   5880  O  O     . PHE B  1 360 ? 11.823  19.103  72.372  1.00 52.64  ? 501 PHE B O     1 
ATOM   5881  C  CB    . PHE B  1 360 ? 12.439  18.813  69.754  1.00 48.46  ? 501 PHE B CB    1 
ATOM   5882  C  CG    . PHE B  1 360 ? 12.933  18.678  68.337  1.00 44.13  ? 501 PHE B CG    1 
ATOM   5883  C  CD1   . PHE B  1 360 ? 14.007  19.432  67.887  1.00 40.76  ? 501 PHE B CD1   1 
ATOM   5884  C  CD2   . PHE B  1 360 ? 12.312  17.810  67.451  1.00 44.57  ? 501 PHE B CD2   1 
ATOM   5885  C  CE1   . PHE B  1 360 ? 14.460  19.313  66.585  1.00 41.13  ? 501 PHE B CE1   1 
ATOM   5886  C  CE2   . PHE B  1 360 ? 12.760  17.686  66.147  1.00 45.62  ? 501 PHE B CE2   1 
ATOM   5887  C  CZ    . PHE B  1 360 ? 13.836  18.438  65.715  1.00 43.99  ? 501 PHE B CZ    1 
ATOM   5888  N  N     . PRO B  1 361 ? 13.626  18.033  73.218  1.00 56.04  ? 502 PRO B N     1 
ATOM   5889  C  CA    . PRO B  1 361 ? 13.282  18.397  74.598  1.00 58.09  ? 502 PRO B CA    1 
ATOM   5890  C  C     . PRO B  1 361 ? 13.219  19.909  74.821  1.00 58.46  ? 502 PRO B C     1 
ATOM   5891  O  O     . PRO B  1 361 ? 12.373  20.371  75.588  1.00 58.91  ? 502 PRO B O     1 
ATOM   5892  C  CB    . PRO B  1 361 ? 14.432  17.793  75.416  1.00 58.53  ? 502 PRO B CB    1 
ATOM   5893  C  CG    . PRO B  1 361 ? 15.541  17.559  74.430  1.00 56.52  ? 502 PRO B CG    1 
ATOM   5894  C  CD    . PRO B  1 361 ? 14.848  17.212  73.157  1.00 55.59  ? 502 PRO B CD    1 
ATOM   5895  N  N     . ILE B  1 362 ? 14.085  20.661  74.144  1.00 59.51  ? 503 ILE B N     1 
ATOM   5896  C  CA    . ILE B  1 362 ? 14.191  22.111  74.341  1.00 59.87  ? 503 ILE B CA    1 
ATOM   5897  C  C     . ILE B  1 362 ? 12.886  22.864  74.067  1.00 59.81  ? 503 ILE B C     1 
ATOM   5898  O  O     . ILE B  1 362 ? 12.694  23.984  74.546  1.00 61.10  ? 503 ILE B O     1 
ATOM   5899  C  CB    . ILE B  1 362 ? 15.344  22.719  73.495  1.00 50.34  ? 503 ILE B CB    1 
ATOM   5900  C  CG1   . ILE B  1 362 ? 15.782  24.070  74.067  1.00 49.65  ? 503 ILE B CG1   1 
ATOM   5901  C  CG2   . ILE B  1 362 ? 14.936  22.855  72.035  1.00 48.35  ? 503 ILE B CG2   1 
ATOM   5902  C  CD1   . ILE B  1 362 ? 17.276  24.206  74.275  1.00 49.51  ? 503 ILE B CD1   1 
ATOM   5903  N  N     . PHE B  1 363 ? 11.991  22.240  73.307  1.00 60.60  ? 504 PHE B N     1 
ATOM   5904  C  CA    . PHE B  1 363 ? 10.704  22.843  72.985  1.00 60.39  ? 504 PHE B CA    1 
ATOM   5905  C  C     . PHE B  1 363 ? 9.781   22.922  74.200  1.00 68.09  ? 504 PHE B C     1 
ATOM   5906  O  O     . PHE B  1 363 ? 8.830   23.704  74.214  1.00 71.86  ? 504 PHE B O     1 
ATOM   5907  C  CB    . PHE B  1 363 ? 10.017  22.062  71.863  1.00 52.61  ? 504 PHE B CB    1 
ATOM   5908  C  CG    . PHE B  1 363 ? 10.546  22.374  70.488  1.00 46.66  ? 504 PHE B CG    1 
ATOM   5909  C  CD1   . PHE B  1 363 ? 11.217  23.561  70.237  1.00 44.52  ? 504 PHE B CD1   1 
ATOM   5910  C  CD2   . PHE B  1 363 ? 10.361  21.482  69.444  1.00 44.44  ? 504 PHE B CD2   1 
ATOM   5911  C  CE1   . PHE B  1 363 ? 11.701  23.844  68.967  1.00 42.74  ? 504 PHE B CE1   1 
ATOM   5912  C  CE2   . PHE B  1 363 ? 10.843  21.759  68.177  1.00 40.37  ? 504 PHE B CE2   1 
ATOM   5913  C  CZ    . PHE B  1 363 ? 11.510  22.938  67.937  1.00 38.76  ? 504 PHE B CZ    1 
ATOM   5914  N  N     . ASP B  1 364 ? 10.065  22.118  75.220  1.00 71.46  ? 505 ASP B N     1 
ATOM   5915  C  CA    . ASP B  1 364 ? 9.175   22.017  76.374  1.00 74.02  ? 505 ASP B CA    1 
ATOM   5916  C  C     . ASP B  1 364 ? 9.549   22.970  77.514  1.00 76.25  ? 505 ASP B C     1 
ATOM   5917  O  O     . ASP B  1 364 ? 8.814   23.096  78.494  1.00 74.50  ? 505 ASP B O     1 
ATOM   5918  C  CB    . ASP B  1 364 ? 9.128   20.572  76.874  1.00 75.30  ? 505 ASP B CB    1 
ATOM   5919  C  CG    . ASP B  1 364 ? 8.780   19.590  75.773  1.00 76.01  ? 505 ASP B CG    1 
ATOM   5920  O  OD1   . ASP B  1 364 ? 7.830   19.861  75.012  1.00 75.21  ? 505 ASP B OD1   1 
ATOM   5921  O  OD2   . ASP B  1 364 ? 9.462   18.550  75.660  1.00 77.36  ? 505 ASP B OD2   1 
ATOM   5922  N  N     . LYS B  1 365 ? 10.682  23.650  77.371  1.00 80.29  ? 506 LYS B N     1 
ATOM   5923  C  CA    . LYS B  1 365 ? 11.183  24.550  78.407  1.00 82.82  ? 506 LYS B CA    1 
ATOM   5924  C  C     . LYS B  1 365 ? 10.600  25.957  78.355  1.00 84.00  ? 506 LYS B C     1 
ATOM   5925  O  O     . LYS B  1 365 ? 10.156  26.421  77.300  1.00 84.54  ? 506 LYS B O     1 
ATOM   5926  C  CB    . LYS B  1 365 ? 12.701  24.675  78.306  1.00 85.63  ? 506 LYS B CB    1 
ATOM   5927  C  CG    . LYS B  1 365 ? 13.477  23.457  78.748  1.00 89.54  ? 506 LYS B CG    1 
ATOM   5928  C  CD    . LYS B  1 365 ? 14.965  23.743  78.671  1.00 92.31  ? 506 LYS B CD    1 
ATOM   5929  C  CE    . LYS B  1 365 ? 15.782  22.579  79.193  1.00 95.81  ? 506 LYS B CE    1 
ATOM   5930  N  NZ    . LYS B  1 365 ? 17.227  22.926  79.257  1.00 96.91  ? 506 LYS B NZ    1 
ATOM   5931  N  N     . LEU B  1 366 ? 10.611  26.609  79.517  1.00 86.12  ? 507 LEU B N     1 
ATOM   5932  C  CA    . LEU B  1 366 ? 10.426  28.055  79.657  1.00 87.12  ? 507 LEU B CA    1 
ATOM   5933  C  C     . LEU B  1 366 ? 10.543  28.441  81.127  1.00 88.13  ? 507 LEU B C     1 
ATOM   5934  O  O     . LEU B  1 366 ? 11.450  27.989  81.828  1.00 89.02  ? 507 LEU B O     1 
ATOM   5935  C  CB    . LEU B  1 366 ? 9.087   28.537  79.090  1.00 85.67  ? 507 LEU B CB    1 
ATOM   5936  C  CG    . LEU B  1 366 ? 9.195   29.830  78.273  1.00 83.72  ? 507 LEU B CG    1 
ATOM   5937  C  CD1   . LEU B  1 366 ? 9.545   31.019  79.152  1.00 82.71  ? 507 LEU B CD1   1 
ATOM   5938  C  CD2   . LEU B  1 366 ? 10.232  29.670  77.177  1.00 83.51  ? 507 LEU B CD2   1 
ATOM   5939  N  N     . LYS C  1 8   ? 41.609  28.090  -14.734 1.00 60.79  ? 149 LYS C N     1 
ATOM   5940  C  CA    . LYS C  1 8   ? 43.008  27.864  -15.070 1.00 62.27  ? 149 LYS C CA    1 
ATOM   5941  C  C     . LYS C  1 8   ? 43.392  26.408  -14.841 1.00 59.07  ? 149 LYS C C     1 
ATOM   5942  O  O     . LYS C  1 8   ? 43.302  25.581  -15.747 1.00 60.97  ? 149 LYS C O     1 
ATOM   5943  C  CB    . LYS C  1 8   ? 43.906  28.784  -14.242 1.00 65.41  ? 149 LYS C CB    1 
ATOM   5944  C  CG    . LYS C  1 8   ? 43.368  29.081  -12.853 1.00 67.38  ? 149 LYS C CG    1 
ATOM   5945  C  CD    . LYS C  1 8   ? 44.397  29.789  -12.001 1.00 68.76  ? 149 LYS C CD    1 
ATOM   5946  C  CE    . LYS C  1 8   ? 43.791  30.171  -10.665 1.00 69.54  ? 149 LYS C CE    1 
ATOM   5947  N  NZ    . LYS C  1 8   ? 42.542  30.964  -10.828 1.00 67.48  ? 149 LYS C NZ    1 
ATOM   5948  N  N     . LEU C  1 9   ? 43.826  26.109  -13.622 1.00 55.90  ? 150 LEU C N     1 
ATOM   5949  C  CA    . LEU C  1 9   ? 44.124  24.749  -13.214 1.00 54.68  ? 150 LEU C CA    1 
ATOM   5950  C  C     . LEU C  1 9   ? 42.837  23.936  -13.214 1.00 57.93  ? 150 LEU C C     1 
ATOM   5951  O  O     . LEU C  1 9   ? 42.859  22.719  -13.389 1.00 61.24  ? 150 LEU C O     1 
ATOM   5952  C  CB    . LEU C  1 9   ? 44.748  24.752  -11.820 1.00 49.78  ? 150 LEU C CB    1 
ATOM   5953  C  CG    . LEU C  1 9   ? 46.050  25.534  -11.674 1.00 45.02  ? 150 LEU C CG    1 
ATOM   5954  C  CD1   . LEU C  1 9   ? 46.415  25.707  -10.217 1.00 44.25  ? 150 LEU C CD1   1 
ATOM   5955  C  CD2   . LEU C  1 9   ? 47.163  24.822  -12.402 1.00 40.68  ? 150 LEU C CD2   1 
ATOM   5956  N  N     . LYS C  1 10  ? 41.715  24.625  -13.026 1.00 58.16  ? 151 LYS C N     1 
ATOM   5957  C  CA    . LYS C  1 10  ? 40.405  23.990  -13.035 1.00 61.13  ? 151 LYS C CA    1 
ATOM   5958  C  C     . LYS C  1 10  ? 40.077  23.426  -14.415 1.00 64.76  ? 151 LYS C C     1 
ATOM   5959  O  O     . LYS C  1 10  ? 39.529  22.330  -14.530 1.00 69.01  ? 151 LYS C O     1 
ATOM   5960  C  CB    . LYS C  1 10  ? 39.334  24.987  -12.589 1.00 61.41  ? 151 LYS C CB    1 
ATOM   5961  C  CG    . LYS C  1 10  ? 39.571  25.547  -11.187 1.00 63.58  ? 151 LYS C CG    1 
ATOM   5962  C  CD    . LYS C  1 10  ? 38.513  26.576  -10.809 1.00 65.79  ? 151 LYS C CD    1 
ATOM   5963  C  CE    . LYS C  1 10  ? 38.798  27.200  -9.446  1.00 65.46  ? 151 LYS C CE    1 
ATOM   5964  N  NZ    . LYS C  1 10  ? 37.815  28.276  -9.112  1.00 64.78  ? 151 LYS C NZ    1 
ATOM   5965  N  N     . LYS C  1 11  ? 40.420  24.177  -15.458 1.00 62.04  ? 152 LYS C N     1 
ATOM   5966  C  CA    . LYS C  1 11  ? 40.215  23.734  -16.835 1.00 60.01  ? 152 LYS C CA    1 
ATOM   5967  C  C     . LYS C  1 11  ? 41.077  22.506  -17.133 1.00 54.99  ? 152 LYS C C     1 
ATOM   5968  O  O     . LYS C  1 11  ? 40.625  21.547  -17.778 1.00 59.38  ? 152 LYS C O     1 
ATOM   5969  C  CB    . LYS C  1 11  ? 40.561  24.869  -17.798 1.00 66.19  ? 152 LYS C CB    1 
ATOM   5970  C  CG    . LYS C  1 11  ? 40.149  26.252  -17.291 1.00 70.58  ? 152 LYS C CG    1 
ATOM   5971  C  CD    . LYS C  1 11  ? 40.697  27.356  -18.190 1.00 73.83  ? 152 LYS C CD    1 
ATOM   5972  C  CE    . LYS C  1 11  ? 40.391  28.740  -17.627 1.00 75.39  ? 152 LYS C CE    1 
ATOM   5973  N  NZ    . LYS C  1 11  ? 41.064  29.815  -18.406 1.00 76.49  ? 152 LYS C NZ    1 
ATOM   5974  N  N     . VAL C  1 12  ? 42.317  22.543  -16.647 1.00 46.48  ? 153 VAL C N     1 
ATOM   5975  C  CA    . VAL C  1 12  ? 43.236  21.412  -16.746 1.00 42.46  ? 153 VAL C CA    1 
ATOM   5976  C  C     . VAL C  1 12  ? 42.638  20.183  -16.071 1.00 41.81  ? 153 VAL C C     1 
ATOM   5977  O  O     . VAL C  1 12  ? 42.716  19.071  -16.593 1.00 39.98  ? 153 VAL C O     1 
ATOM   5978  C  CB    . VAL C  1 12  ? 44.579  21.729  -16.074 1.00 43.87  ? 153 VAL C CB    1 
ATOM   5979  C  CG1   . VAL C  1 12  ? 45.545  20.571  -16.233 1.00 44.05  ? 153 VAL C CG1   1 
ATOM   5980  C  CG2   . VAL C  1 12  ? 45.177  22.997  -16.654 1.00 44.51  ? 153 VAL C CG2   1 
ATOM   5981  N  N     . LEU C  1 13  ? 42.037  20.398  -14.905 1.00 42.72  ? 154 LEU C N     1 
ATOM   5982  C  CA    . LEU C  1 13  ? 41.398  19.328  -14.153 1.00 40.82  ? 154 LEU C CA    1 
ATOM   5983  C  C     . LEU C  1 13  ? 40.202  18.790  -14.919 1.00 42.81  ? 154 LEU C C     1 
ATOM   5984  O  O     . LEU C  1 13  ? 39.877  17.605  -14.832 1.00 46.06  ? 154 LEU C O     1 
ATOM   5985  C  CB    . LEU C  1 13  ? 40.949  19.837  -12.785 1.00 39.55  ? 154 LEU C CB    1 
ATOM   5986  C  CG    . LEU C  1 13  ? 42.047  20.075  -11.754 1.00 37.63  ? 154 LEU C CG    1 
ATOM   5987  C  CD1   . LEU C  1 13  ? 41.486  20.762  -10.521 1.00 34.25  ? 154 LEU C CD1   1 
ATOM   5988  C  CD2   . LEU C  1 13  ? 42.710  18.763  -11.375 1.00 37.46  ? 154 LEU C CD2   1 
ATOM   5989  N  N     . ASP C  1 14  ? 39.549  19.673  -15.667 1.00 43.73  ? 155 ASP C N     1 
ATOM   5990  C  CA    . ASP C  1 14  ? 38.409  19.284  -16.478 1.00 47.12  ? 155 ASP C CA    1 
ATOM   5991  C  C     . ASP C  1 14  ? 38.841  18.370  -17.621 1.00 43.93  ? 155 ASP C C     1 
ATOM   5992  O  O     . ASP C  1 14  ? 38.174  17.378  -17.906 1.00 46.18  ? 155 ASP C O     1 
ATOM   5993  C  CB    . ASP C  1 14  ? 37.672  20.520  -17.003 1.00 53.50  ? 155 ASP C CB    1 
ATOM   5994  C  CG    . ASP C  1 14  ? 36.896  21.239  -15.916 1.00 58.04  ? 155 ASP C CG    1 
ATOM   5995  O  OD1   . ASP C  1 14  ? 36.554  20.592  -14.907 1.00 57.87  ? 155 ASP C OD1   1 
ATOM   5996  O  OD2   . ASP C  1 14  ? 36.616  22.446  -16.074 1.00 63.07  ? 155 ASP C OD2   1 
ATOM   5997  N  N     . LYS C  1 15  ? 39.963  18.689  -18.261 1.00 42.25  ? 156 LYS C N     1 
ATOM   5998  C  CA    . LYS C  1 15  ? 40.452  17.843  -19.354 1.00 41.63  ? 156 LYS C CA    1 
ATOM   5999  C  C     . LYS C  1 15  ? 41.144  16.562  -18.858 1.00 39.58  ? 156 LYS C C     1 
ATOM   6000  O  O     . LYS C  1 15  ? 41.252  15.582  -19.599 1.00 40.10  ? 156 LYS C O     1 
ATOM   6001  C  CB    . LYS C  1 15  ? 41.357  18.633  -20.313 1.00 41.10  ? 156 LYS C CB    1 
ATOM   6002  C  CG    . LYS C  1 15  ? 42.850  18.533  -20.028 1.00 43.34  ? 156 LYS C CG    1 
ATOM   6003  C  CD    . LYS C  1 15  ? 43.648  19.172  -21.154 1.00 45.50  ? 156 LYS C CD    1 
ATOM   6004  C  CE    . LYS C  1 15  ? 45.148  19.024  -20.941 1.00 50.11  ? 156 LYS C CE    1 
ATOM   6005  N  NZ    . LYS C  1 15  ? 45.931  19.464  -22.142 1.00 52.57  ? 156 LYS C NZ    1 
ATOM   6006  N  N     . LEU C  1 16  ? 41.598  16.572  -17.605 1.00 37.19  ? 157 LEU C N     1 
ATOM   6007  C  CA    . LEU C  1 16  ? 42.229  15.397  -17.003 1.00 34.32  ? 157 LEU C CA    1 
ATOM   6008  C  C     . LEU C  1 16  ? 41.192  14.426  -16.454 1.00 40.60  ? 157 LEU C C     1 
ATOM   6009  O  O     . LEU C  1 16  ? 41.517  13.286  -16.112 1.00 42.98  ? 157 LEU C O     1 
ATOM   6010  C  CB    . LEU C  1 16  ? 43.166  15.812  -15.870 1.00 29.11  ? 157 LEU C CB    1 
ATOM   6011  C  CG    . LEU C  1 16  ? 44.467  16.511  -16.251 1.00 28.60  ? 157 LEU C CG    1 
ATOM   6012  C  CD1   . LEU C  1 16  ? 45.247  16.901  -15.015 1.00 28.11  ? 157 LEU C CD1   1 
ATOM   6013  C  CD2   . LEU C  1 16  ? 45.300  15.615  -17.133 1.00 29.30  ? 157 LEU C CD2   1 
ATOM   6014  N  N     . ARG C  1 17  ? 39.947  14.887  -16.364 1.00 39.53  ? 158 ARG C N     1 
ATOM   6015  C  CA    . ARG C  1 17  ? 38.872  14.097  -15.779 1.00 37.01  ? 158 ARG C CA    1 
ATOM   6016  C  C     . ARG C  1 17  ? 38.446  12.957  -16.688 1.00 38.05  ? 158 ARG C C     1 
ATOM   6017  O  O     . ARG C  1 17  ? 38.282  13.142  -17.893 1.00 41.07  ? 158 ARG C O     1 
ATOM   6018  C  CB    . ARG C  1 17  ? 37.677  14.992  -15.463 1.00 39.70  ? 158 ARG C CB    1 
ATOM   6019  C  CG    . ARG C  1 17  ? 36.432  14.249  -15.023 1.00 39.78  ? 158 ARG C CG    1 
ATOM   6020  C  CD    . ARG C  1 17  ? 35.379  15.216  -14.529 1.00 42.30  ? 158 ARG C CD    1 
ATOM   6021  N  NE    . ARG C  1 17  ? 35.920  16.101  -13.503 1.00 47.35  ? 158 ARG C NE    1 
ATOM   6022  C  CZ    . ARG C  1 17  ? 36.035  17.417  -13.643 1.00 49.87  ? 158 ARG C CZ    1 
ATOM   6023  N  NH1   . ARG C  1 17  ? 35.633  18.001  -14.765 1.00 51.07  ? 158 ARG C NH1   1 
ATOM   6024  N  NH2   . ARG C  1 17  ? 36.542  18.152  -12.663 1.00 47.12  ? 158 ARG C NH2   1 
ATOM   6025  N  N     . LEU C  1 18  ? 38.272  11.778  -16.099 1.00 40.14  ? 159 LEU C N     1 
ATOM   6026  C  CA    . LEU C  1 18  ? 37.875  10.589  -16.844 1.00 42.01  ? 159 LEU C CA    1 
ATOM   6027  C  C     . LEU C  1 18  ? 36.406  10.660  -17.254 1.00 42.59  ? 159 LEU C C     1 
ATOM   6028  O  O     . LEU C  1 18  ? 35.624  11.405  -16.660 1.00 45.24  ? 159 LEU C O     1 
ATOM   6029  C  CB    . LEU C  1 18  ? 38.115  9.332   -16.004 1.00 42.16  ? 159 LEU C CB    1 
ATOM   6030  C  CG    . LEU C  1 18  ? 39.537  9.095   -15.496 1.00 36.58  ? 159 LEU C CG    1 
ATOM   6031  C  CD1   . LEU C  1 18  ? 39.716  7.674   -14.997 1.00 36.01  ? 159 LEU C CD1   1 
ATOM   6032  C  CD2   . LEU C  1 18  ? 40.538  9.396   -16.582 1.00 36.84  ? 159 LEU C CD2   1 
ATOM   6033  N  N     . LYS C  1 19  ? 36.036  9.891   -18.272 1.00 38.89  ? 160 LYS C N     1 
ATOM   6034  C  CA    . LYS C  1 19  ? 34.646  9.829   -18.708 1.00 36.79  ? 160 LYS C CA    1 
ATOM   6035  C  C     . LYS C  1 19  ? 34.024  8.486   -18.345 1.00 41.46  ? 160 LYS C C     1 
ATOM   6036  O  O     . LYS C  1 19  ? 34.594  7.434   -18.644 1.00 47.23  ? 160 LYS C O     1 
ATOM   6037  C  CB    . LYS C  1 19  ? 34.551  10.092  -20.211 1.00 33.55  ? 160 LYS C CB    1 
ATOM   6038  C  CG    . LYS C  1 19  ? 35.236  11.389  -20.629 1.00 38.88  ? 160 LYS C CG    1 
ATOM   6039  C  CD    . LYS C  1 19  ? 35.128  11.636  -22.128 1.00 48.75  ? 160 LYS C CD    1 
ATOM   6040  C  CE    . LYS C  1 19  ? 35.874  12.900  -22.548 1.00 55.24  ? 160 LYS C CE    1 
ATOM   6041  N  NZ    . LYS C  1 19  ? 35.502  13.328  -23.933 1.00 57.96  ? 160 LYS C NZ    1 
ATOM   6042  N  N     . ARG C  1 20  ? 32.852  8.524   -17.715 1.00 39.98  ? 161 ARG C N     1 
ATOM   6043  C  CA    . ARG C  1 20  ? 32.221  7.313   -17.191 1.00 40.83  ? 161 ARG C CA    1 
ATOM   6044  C  C     . ARG C  1 20  ? 31.900  6.278   -18.266 1.00 37.37  ? 161 ARG C C     1 
ATOM   6045  O  O     . ARG C  1 20  ? 31.727  5.098   -17.962 1.00 36.07  ? 161 ARG C O     1 
ATOM   6046  C  CB    . ARG C  1 20  ? 30.954  7.657   -16.411 1.00 43.45  ? 161 ARG C CB    1 
ATOM   6047  C  CG    . ARG C  1 20  ? 29.735  7.859   -17.280 1.00 44.88  ? 161 ARG C CG    1 
ATOM   6048  C  CD    . ARG C  1 20  ? 28.520  8.155   -16.442 1.00 50.40  ? 161 ARG C CD    1 
ATOM   6049  N  NE    . ARG C  1 20  ? 27.370  8.487   -17.268 1.00 55.03  ? 161 ARG C NE    1 
ATOM   6050  C  CZ    . ARG C  1 20  ? 26.315  9.156   -16.824 1.00 58.73  ? 161 ARG C CZ    1 
ATOM   6051  N  NH1   . ARG C  1 20  ? 26.275  9.565   -15.564 1.00 59.27  ? 161 ARG C NH1   1 
ATOM   6052  N  NH2   . ARG C  1 20  ? 25.306  9.423   -17.639 1.00 61.65  ? 161 ARG C NH2   1 
ATOM   6053  N  N     . LYS C  1 21  ? 31.814  6.723   -19.516 1.00 36.02  ? 162 LYS C N     1 
ATOM   6054  C  CA    . LYS C  1 21  ? 31.581  5.809   -20.625 1.00 37.61  ? 162 LYS C CA    1 
ATOM   6055  C  C     . LYS C  1 21  ? 32.845  5.005   -20.897 1.00 37.14  ? 162 LYS C C     1 
ATOM   6056  O  O     . LYS C  1 21  ? 32.805  3.770   -21.002 1.00 41.85  ? 162 LYS C O     1 
ATOM   6057  C  CB    . LYS C  1 21  ? 31.167  6.575   -21.875 1.00 42.13  ? 162 LYS C CB    1 
ATOM   6058  C  CG    . LYS C  1 21  ? 31.123  5.709   -23.125 1.00 51.95  ? 162 LYS C CG    1 
ATOM   6059  C  CD    . LYS C  1 21  ? 30.964  6.547   -24.384 1.00 57.71  ? 162 LYS C CD    1 
ATOM   6060  C  CE    . LYS C  1 21  ? 30.757  5.656   -25.598 1.00 59.94  ? 162 LYS C CE    1 
ATOM   6061  N  NZ    . LYS C  1 21  ? 30.600  6.443   -26.853 1.00 62.02  ? 162 LYS C NZ    1 
ATOM   6062  N  N     . ASP C  1 22  ? 33.967  5.714   -20.995 1.00 35.45  ? 163 ASP C N     1 
ATOM   6063  C  CA    . ASP C  1 22  ? 35.267  5.073   -21.141 1.00 36.69  ? 163 ASP C CA    1 
ATOM   6064  C  C     . ASP C  1 22  ? 35.536  4.170   -19.938 1.00 40.27  ? 163 ASP C C     1 
ATOM   6065  O  O     . ASP C  1 22  ? 36.068  3.070   -20.082 1.00 42.31  ? 163 ASP C O     1 
ATOM   6066  C  CB    . ASP C  1 22  ? 36.370  6.123   -21.261 1.00 37.10  ? 163 ASP C CB    1 
ATOM   6067  C  CG    . ASP C  1 22  ? 36.067  7.180   -22.303 1.00 41.80  ? 163 ASP C CG    1 
ATOM   6068  O  OD1   . ASP C  1 22  ? 35.434  6.856   -23.328 1.00 40.91  ? 163 ASP C OD1   1 
ATOM   6069  O  OD2   . ASP C  1 22  ? 36.471  8.342   -22.094 1.00 47.04  ? 163 ASP C OD2   1 
ATOM   6070  N  N     . ILE C  1 23  ? 35.156  4.650   -18.756 1.00 40.65  ? 164 ILE C N     1 
ATOM   6071  C  CA    . ILE C  1 23  ? 35.295  3.894   -17.512 1.00 37.04  ? 164 ILE C CA    1 
ATOM   6072  C  C     . ILE C  1 23  ? 34.538  2.570   -17.572 1.00 41.71  ? 164 ILE C C     1 
ATOM   6073  O  O     . ILE C  1 23  ? 35.084  1.513   -17.237 1.00 42.84  ? 164 ILE C O     1 
ATOM   6074  C  CB    . ILE C  1 23  ? 34.790  4.707   -16.297 1.00 31.98  ? 164 ILE C CB    1 
ATOM   6075  C  CG1   . ILE C  1 23  ? 35.662  5.936   -16.059 1.00 29.84  ? 164 ILE C CG1   1 
ATOM   6076  C  CG2   . ILE C  1 23  ? 34.775  3.861   -15.047 1.00 27.51  ? 164 ILE C CG2   1 
ATOM   6077  C  CD1   . ILE C  1 23  ? 35.179  6.808   -14.922 1.00 33.16  ? 164 ILE C CD1   1 
ATOM   6078  N  N     . SER C  1 24  ? 33.279  2.636   -17.997 1.00 45.24  ? 165 SER C N     1 
ATOM   6079  C  CA    . SER C  1 24  ? 32.435  1.450   -18.122 1.00 45.37  ? 165 SER C CA    1 
ATOM   6080  C  C     . SER C  1 24  ? 33.034  0.454   -19.111 1.00 44.53  ? 165 SER C C     1 
ATOM   6081  O  O     . SER C  1 24  ? 33.267  -0.718  -18.778 1.00 49.17  ? 165 SER C O     1 
ATOM   6082  C  CB    . SER C  1 24  ? 31.035  1.861   -18.580 1.00 47.58  ? 165 SER C CB    1 
ATOM   6083  O  OG    . SER C  1 24  ? 30.229  0.733   -18.860 1.00 49.49  ? 165 SER C OG    1 
ATOM   6084  N  N     . GLU C  1 25  ? 33.295  0.940   -20.322 1.00 43.12  ? 166 GLU C N     1 
ATOM   6085  C  CA    . GLU C  1 25  ? 33.829  0.108   -21.394 1.00 41.86  ? 166 GLU C CA    1 
ATOM   6086  C  C     . GLU C  1 25  ? 35.152  -0.567  -21.033 1.00 42.13  ? 166 GLU C C     1 
ATOM   6087  O  O     . GLU C  1 25  ? 35.343  -1.751  -21.306 1.00 43.25  ? 166 GLU C O     1 
ATOM   6088  C  CB    . GLU C  1 25  ? 34.007  0.934   -22.668 1.00 43.48  ? 166 GLU C CB    1 
ATOM   6089  C  CG    . GLU C  1 25  ? 32.722  1.469   -23.281 1.00 47.74  ? 166 GLU C CG    1 
ATOM   6090  C  CD    . GLU C  1 25  ? 32.978  2.223   -24.575 1.00 54.61  ? 166 GLU C CD    1 
ATOM   6091  O  OE1   . GLU C  1 25  ? 34.159  2.482   -24.894 1.00 53.38  ? 166 GLU C OE1   1 
ATOM   6092  O  OE2   . GLU C  1 25  ? 31.998  2.552   -25.274 1.00 60.10  ? 166 GLU C OE2   1 
ATOM   6093  N  N     . ALA C  1 26  ? 36.069  0.190   -20.436 1.00 42.49  ? 167 ALA C N     1 
ATOM   6094  C  CA    . ALA C  1 26  ? 37.369  -0.353  -20.042 1.00 40.98  ? 167 ALA C CA    1 
ATOM   6095  C  C     . ALA C  1 26  ? 37.233  -1.359  -18.901 1.00 41.72  ? 167 ALA C C     1 
ATOM   6096  O  O     . ALA C  1 26  ? 37.719  -2.491  -18.992 1.00 45.76  ? 167 ALA C O     1 
ATOM   6097  C  CB    . ALA C  1 26  ? 38.326  0.769   -19.654 1.00 36.22  ? 167 ALA C CB    1 
ATOM   6098  N  N     . ALA C  1 27  ? 36.569  -0.940  -17.829 1.00 40.70  ? 168 ALA C N     1 
ATOM   6099  C  CA    . ALA C  1 27  ? 36.411  -1.789  -16.651 1.00 39.91  ? 168 ALA C CA    1 
ATOM   6100  C  C     . ALA C  1 27  ? 35.722  -3.126  -16.942 1.00 41.52  ? 168 ALA C C     1 
ATOM   6101  O  O     . ALA C  1 27  ? 36.083  -4.143  -16.357 1.00 42.32  ? 168 ALA C O     1 
ATOM   6102  C  CB    . ALA C  1 27  ? 35.689  -1.046  -15.554 1.00 39.12  ? 168 ALA C CB    1 
ATOM   6103  N  N     . GLU C  1 28  ? 34.730  -3.122  -17.828 1.00 40.93  ? 169 GLU C N     1 
ATOM   6104  C  CA    . GLU C  1 28  ? 34.070  -4.366  -18.224 1.00 41.31  ? 169 GLU C CA    1 
ATOM   6105  C  C     . GLU C  1 28  ? 35.083  -5.418  -18.701 1.00 41.70  ? 169 GLU C C     1 
ATOM   6106  O  O     . GLU C  1 28  ? 35.174  -6.527  -18.151 1.00 44.27  ? 169 GLU C O     1 
ATOM   6107  C  CB    . GLU C  1 28  ? 33.040  -4.076  -19.319 1.00 40.73  ? 169 GLU C CB    1 
ATOM   6108  C  CG    . GLU C  1 28  ? 32.164  -5.263  -19.703 1.00 43.73  ? 169 GLU C CG    1 
ATOM   6109  C  CD    . GLU C  1 28  ? 31.041  -4.870  -20.639 1.00 48.39  ? 169 GLU C CD    1 
ATOM   6110  O  OE1   . GLU C  1 28  ? 30.155  -5.711  -20.889 1.00 50.92  ? 169 GLU C OE1   1 
ATOM   6111  O  OE2   . GLU C  1 28  ? 31.044  -3.718  -21.118 1.00 49.56  ? 169 GLU C OE2   1 
ATOM   6112  N  N     . THR C  1 29  ? 35.856  -5.046  -19.716 1.00 40.79  ? 170 THR C N     1 
ATOM   6113  C  CA    . THR C  1 29  ? 36.863  -5.922  -20.310 1.00 38.04  ? 170 THR C CA    1 
ATOM   6114  C  C     . THR C  1 29  ? 37.977  -6.306  -19.334 1.00 32.31  ? 170 THR C C     1 
ATOM   6115  O  O     . THR C  1 29  ? 38.334  -7.489  -19.215 1.00 31.60  ? 170 THR C O     1 
ATOM   6116  C  CB    . THR C  1 29  ? 37.494  -5.255  -21.537 1.00 39.26  ? 170 THR C CB    1 
ATOM   6117  O  OG1   . THR C  1 29  ? 36.461  -4.707  -22.365 1.00 45.69  ? 170 THR C OG1   1 
ATOM   6118  C  CG2   . THR C  1 29  ? 38.294  -6.256  -22.336 1.00 32.91  ? 170 THR C CG2   1 
ATOM   6119  N  N     . VAL C  1 30  ? 38.533  -5.301  -18.657 1.00 31.45  ? 171 VAL C N     1 
ATOM   6120  C  CA    . VAL C  1 30  ? 39.593  -5.527  -17.674 1.00 30.87  ? 171 VAL C CA    1 
ATOM   6121  C  C     . VAL C  1 30  ? 39.150  -6.544  -16.626 1.00 35.68  ? 171 VAL C C     1 
ATOM   6122  O  O     . VAL C  1 30  ? 39.866  -7.507  -16.339 1.00 38.35  ? 171 VAL C O     1 
ATOM   6123  C  CB    . VAL C  1 30  ? 40.014  -4.218  -16.984 1.00 28.67  ? 171 VAL C CB    1 
ATOM   6124  C  CG1   . VAL C  1 30  ? 41.034  -4.489  -15.897 1.00 30.72  ? 171 VAL C CG1   1 
ATOM   6125  C  CG2   . VAL C  1 30  ? 40.587  -3.249  -17.995 1.00 17.02  ? 171 VAL C CG2   1 
ATOM   6126  N  N     . ASN C  1 31  ? 37.962  -6.330  -16.068 1.00 35.37  ? 172 ASN C N     1 
ATOM   6127  C  CA    . ASN C  1 31  ? 37.383  -7.261  -15.110 1.00 32.91  ? 172 ASN C CA    1 
ATOM   6128  C  C     . ASN C  1 31  ? 37.211  -8.659  -15.683 1.00 37.13  ? 172 ASN C C     1 
ATOM   6129  O  O     . ASN C  1 31  ? 37.480  -9.645  -14.991 1.00 35.57  ? 172 ASN C O     1 
ATOM   6130  C  CB    . ASN C  1 31  ? 36.041  -6.744  -14.609 1.00 32.60  ? 172 ASN C CB    1 
ATOM   6131  C  CG    . ASN C  1 31  ? 36.181  -5.523  -13.737 1.00 37.75  ? 172 ASN C CG    1 
ATOM   6132  O  OD1   . ASN C  1 31  ? 37.289  -5.059  -13.471 1.00 42.27  ? 172 ASN C OD1   1 
ATOM   6133  N  ND2   . ASN C  1 31  ? 35.053  -4.982  -13.295 1.00 37.68  ? 172 ASN C ND2   1 
ATOM   6134  N  N     . LYS C  1 32  ? 36.753  -8.743  -16.935 1.00 42.02  ? 173 LYS C N     1 
ATOM   6135  C  CA    . LYS C  1 32  ? 36.653  -10.037 -17.617 1.00 40.46  ? 173 LYS C CA    1 
ATOM   6136  C  C     . LYS C  1 32  ? 37.981  -10.798 -17.600 1.00 40.21  ? 173 LYS C C     1 
ATOM   6137  O  O     . LYS C  1 32  ? 38.089  -11.896 -17.026 1.00 45.66  ? 173 LYS C O     1 
ATOM   6138  C  CB    . LYS C  1 32  ? 36.211  -9.853  -19.066 1.00 41.05  ? 173 LYS C CB    1 
ATOM   6139  C  CG    . LYS C  1 32  ? 34.710  -9.706  -19.273 1.00 45.65  ? 173 LYS C CG    1 
ATOM   6140  C  CD    . LYS C  1 32  ? 34.377  -9.980  -20.738 1.00 47.95  ? 173 LYS C CD    1 
ATOM   6141  C  CE    . LYS C  1 32  ? 32.939  -9.645  -21.084 1.00 49.09  ? 173 LYS C CE    1 
ATOM   6142  N  NZ    . LYS C  1 32  ? 32.724  -9.800  -22.551 1.00 50.17  ? 173 LYS C NZ    1 
ATOM   6143  N  N     . VAL C  1 33  ? 38.990  -10.203 -18.233 1.00 37.15  ? 174 VAL C N     1 
ATOM   6144  C  CA    . VAL C  1 33  ? 40.310  -10.824 -18.335 1.00 37.51  ? 174 VAL C CA    1 
ATOM   6145  C  C     . VAL C  1 33  ? 40.887  -11.190 -16.960 1.00 38.47  ? 174 VAL C C     1 
ATOM   6146  O  O     . VAL C  1 33  ? 41.234  -12.352 -16.712 1.00 39.29  ? 174 VAL C O     1 
ATOM   6147  C  CB    . VAL C  1 33  ? 41.286  -9.914  -19.097 1.00 36.56  ? 174 VAL C CB    1 
ATOM   6148  C  CG1   . VAL C  1 33  ? 42.567  -10.654 -19.414 1.00 36.90  ? 174 VAL C CG1   1 
ATOM   6149  C  CG2   . VAL C  1 33  ? 40.644  -9.425  -20.382 1.00 32.24  ? 174 VAL C CG2   1 
ATOM   6150  N  N     . VAL C  1 34  ? 40.976  -10.195 -16.077 1.00 39.20  ? 175 VAL C N     1 
ATOM   6151  C  CA    . VAL C  1 34  ? 41.456  -10.395 -14.707 1.00 39.03  ? 175 VAL C CA    1 
ATOM   6152  C  C     . VAL C  1 34  ? 40.782  -11.577 -14.014 1.00 46.10  ? 175 VAL C C     1 
ATOM   6153  O  O     . VAL C  1 34  ? 41.461  -12.432 -13.446 1.00 49.37  ? 175 VAL C O     1 
ATOM   6154  C  CB    . VAL C  1 34  ? 41.251  -9.137  -13.848 1.00 34.81  ? 175 VAL C CB    1 
ATOM   6155  C  CG1   . VAL C  1 34  ? 41.437  -9.460  -12.382 1.00 32.69  ? 175 VAL C CG1   1 
ATOM   6156  C  CG2   . VAL C  1 34  ? 42.210  -8.042  -14.270 1.00 31.06  ? 175 VAL C CG2   1 
ATOM   6157  N  N     . GLU C  1 35  ? 39.451  -11.619 -14.063 1.00 47.99  ? 176 GLU C N     1 
ATOM   6158  C  CA    . GLU C  1 35  ? 38.695  -12.726 -13.476 1.00 48.52  ? 176 GLU C CA    1 
ATOM   6159  C  C     . GLU C  1 35  ? 39.098  -14.073 -14.073 1.00 46.95  ? 176 GLU C C     1 
ATOM   6160  O  O     . GLU C  1 35  ? 39.273  -15.054 -13.341 1.00 49.04  ? 176 GLU C O     1 
ATOM   6161  C  CB    . GLU C  1 35  ? 37.190  -12.502 -13.650 1.00 54.67  ? 176 GLU C CB    1 
ATOM   6162  C  CG    . GLU C  1 35  ? 36.308  -13.534 -12.958 1.00 62.20  ? 176 GLU C CG    1 
ATOM   6163  C  CD    . GLU C  1 35  ? 35.629  -14.478 -13.932 1.00 72.41  ? 176 GLU C CD    1 
ATOM   6164  O  OE1   . GLU C  1 35  ? 36.295  -15.413 -14.422 1.00 76.35  ? 176 GLU C OE1   1 
ATOM   6165  O  OE2   . GLU C  1 35  ? 34.426  -14.287 -14.206 1.00 75.85  ? 176 GLU C OE2   1 
ATOM   6166  N  N     . ARG C  1 36  ? 39.251  -14.123 -15.395 1.00 43.68  ? 177 ARG C N     1 
ATOM   6167  C  CA    . ARG C  1 36  ? 39.665  -15.369 -16.039 1.00 43.17  ? 177 ARG C CA    1 
ATOM   6168  C  C     . ARG C  1 36  ? 41.040  -15.836 -15.555 1.00 46.35  ? 177 ARG C C     1 
ATOM   6169  O  O     . ARG C  1 36  ? 41.235  -17.016 -15.244 1.00 50.57  ? 177 ARG C O     1 
ATOM   6170  C  CB    . ARG C  1 36  ? 39.653  -15.225 -17.561 1.00 43.95  ? 177 ARG C CB    1 
ATOM   6171  C  CG    . ARG C  1 36  ? 40.167  -16.457 -18.289 1.00 45.08  ? 177 ARG C CG    1 
ATOM   6172  C  CD    . ARG C  1 36  ? 39.723  -16.498 -19.739 1.00 45.03  ? 177 ARG C CD    1 
ATOM   6173  N  NE    . ARG C  1 36  ? 40.100  -17.754 -20.380 1.00 48.49  ? 177 ARG C NE    1 
ATOM   6174  C  CZ    . ARG C  1 36  ? 39.713  -18.120 -21.599 1.00 52.54  ? 177 ARG C CZ    1 
ATOM   6175  N  NH1   . ARG C  1 36  ? 38.932  -17.327 -22.321 1.00 52.03  ? 177 ARG C NH1   1 
ATOM   6176  N  NH2   . ARG C  1 36  ? 40.105  -19.283 -22.097 1.00 54.60  ? 177 ARG C NH2   1 
ATOM   6177  N  N     . LEU C  1 37  ? 41.982  -14.901 -15.481 1.00 45.27  ? 178 LEU C N     1 
ATOM   6178  C  CA    . LEU C  1 37  ? 43.338  -15.208 -15.042 1.00 42.38  ? 178 LEU C CA    1 
ATOM   6179  C  C     . LEU C  1 37  ? 43.371  -15.661 -13.593 1.00 44.13  ? 178 LEU C C     1 
ATOM   6180  O  O     . LEU C  1 37  ? 44.133  -16.560 -13.230 1.00 47.28  ? 178 LEU C O     1 
ATOM   6181  C  CB    . LEU C  1 37  ? 44.226  -13.984 -15.209 1.00 37.98  ? 178 LEU C CB    1 
ATOM   6182  C  CG    . LEU C  1 37  ? 44.337  -13.465 -16.635 1.00 32.67  ? 178 LEU C CG    1 
ATOM   6183  C  CD1   . LEU C  1 37  ? 45.269  -12.284 -16.678 1.00 33.87  ? 178 LEU C CD1   1 
ATOM   6184  C  CD2   . LEU C  1 37  ? 44.838  -14.566 -17.543 1.00 30.81  ? 178 LEU C CD2   1 
ATOM   6185  N  N     . LEU C  1 38  ? 42.548  -15.025 -12.766 1.00 43.28  ? 179 LEU C N     1 
ATOM   6186  C  CA    . LEU C  1 38  ? 42.473  -15.371 -11.357 1.00 40.46  ? 179 LEU C CA    1 
ATOM   6187  C  C     . LEU C  1 38  ? 41.929  -16.782 -11.216 1.00 42.66  ? 179 LEU C C     1 
ATOM   6188  O  O     . LEU C  1 38  ? 42.446  -17.574 -10.424 1.00 39.96  ? 179 LEU C O     1 
ATOM   6189  C  CB    . LEU C  1 38  ? 41.593  -14.378 -10.595 1.00 38.77  ? 179 LEU C CB    1 
ATOM   6190  C  CG    . LEU C  1 38  ? 41.545  -14.581 -9.079  1.00 38.80  ? 179 LEU C CG    1 
ATOM   6191  C  CD1   . LEU C  1 38  ? 42.925  -14.423 -8.480  1.00 36.60  ? 179 LEU C CD1   1 
ATOM   6192  C  CD2   . LEU C  1 38  ? 40.578  -13.625 -8.416  1.00 39.77  ? 179 LEU C CD2   1 
ATOM   6193  N  N     . ARG C  1 39  ? 40.892  -17.092 -11.992 1.00 49.31  ? 180 ARG C N     1 
ATOM   6194  C  CA    . ARG C  1 39  ? 40.298  -18.424 -11.965 1.00 53.04  ? 180 ARG C CA    1 
ATOM   6195  C  C     . ARG C  1 39  ? 41.307  -19.480 -12.376 1.00 54.56  ? 180 ARG C C     1 
ATOM   6196  O  O     . ARG C  1 39  ? 41.482  -20.477 -11.679 1.00 58.11  ? 180 ARG C O     1 
ATOM   6197  C  CB    . ARG C  1 39  ? 39.075  -18.501 -12.874 1.00 56.45  ? 180 ARG C CB    1 
ATOM   6198  C  CG    . ARG C  1 39  ? 37.823  -17.898 -12.278 1.00 62.05  ? 180 ARG C CG    1 
ATOM   6199  C  CD    . ARG C  1 39  ? 36.595  -18.324 -13.060 1.00 67.49  ? 180 ARG C CD    1 
ATOM   6200  N  NE    . ARG C  1 39  ? 35.376  -17.732 -12.521 1.00 72.78  ? 180 ARG C NE    1 
ATOM   6201  C  CZ    . ARG C  1 39  ? 34.233  -18.390 -12.358 1.00 78.75  ? 180 ARG C CZ    1 
ATOM   6202  N  NH1   . ARG C  1 39  ? 34.147  -19.672 -12.692 1.00 80.31  ? 180 ARG C NH1   1 
ATOM   6203  N  NH2   . ARG C  1 39  ? 33.172  -17.766 -11.861 1.00 81.01  ? 180 ARG C NH2   1 
ATOM   6204  N  N     . ARG C  1 40  ? 41.964  -19.255 -13.508 1.00 51.86  ? 181 ARG C N     1 
ATOM   6205  C  CA    . ARG C  1 40  ? 43.011  -20.154 -13.971 1.00 51.88  ? 181 ARG C CA    1 
ATOM   6206  C  C     . ARG C  1 40  ? 44.061  -20.354 -12.890 1.00 49.26  ? 181 ARG C C     1 
ATOM   6207  O  O     . ARG C  1 40  ? 44.536  -21.468 -12.669 1.00 51.49  ? 181 ARG C O     1 
ATOM   6208  C  CB    . ARG C  1 40  ? 43.665  -19.588 -15.228 1.00 56.32  ? 181 ARG C CB    1 
ATOM   6209  C  CG    . ARG C  1 40  ? 45.013  -20.202 -15.573 1.00 60.59  ? 181 ARG C CG    1 
ATOM   6210  C  CD    . ARG C  1 40  ? 44.905  -21.686 -15.896 1.00 63.91  ? 181 ARG C CD    1 
ATOM   6211  N  NE    . ARG C  1 40  ? 46.061  -22.149 -16.657 1.00 66.22  ? 181 ARG C NE    1 
ATOM   6212  C  CZ    . ARG C  1 40  ? 47.082  -22.827 -16.142 1.00 68.05  ? 181 ARG C CZ    1 
ATOM   6213  N  NH1   . ARG C  1 40  ? 47.097  -23.143 -14.854 1.00 68.34  ? 181 ARG C NH1   1 
ATOM   6214  N  NH2   . ARG C  1 40  ? 48.087  -23.199 -16.922 1.00 68.82  ? 181 ARG C NH2   1 
ATOM   6215  N  N     . MET C  1 41  ? 44.404  -19.270 -12.204 1.00 49.53  ? 182 MET C N     1 
ATOM   6216  C  CA    . MET C  1 41  ? 45.450  -19.307 -11.196 1.00 50.86  ? 182 MET C CA    1 
ATOM   6217  C  C     . MET C  1 41  ? 45.045  -20.169 -10.001 1.00 55.80  ? 182 MET C C     1 
ATOM   6218  O  O     . MET C  1 41  ? 45.828  -20.990 -9.518  1.00 56.94  ? 182 MET C O     1 
ATOM   6219  C  CB    . MET C  1 41  ? 45.778  -17.889 -10.739 1.00 49.03  ? 182 MET C CB    1 
ATOM   6220  C  CG    . MET C  1 41  ? 47.128  -17.752 -10.077 1.00 49.94  ? 182 MET C CG    1 
ATOM   6221  S  SD    . MET C  1 41  ? 48.487  -18.006 -11.226 1.00 65.82  ? 182 MET C SD    1 
ATOM   6222  C  CE    . MET C  1 41  ? 48.244  -16.599 -12.305 1.00 40.74  ? 182 MET C CE    1 
ATOM   6223  N  N     . GLN C  1 42  ? 43.814  -19.991 -9.536  1.00 60.19  ? 183 GLN C N     1 
ATOM   6224  C  CA    . GLN C  1 42  ? 43.352  -20.714 -8.361  1.00 63.74  ? 183 GLN C CA    1 
ATOM   6225  C  C     . GLN C  1 42  ? 42.937  -22.147 -8.666  1.00 66.89  ? 183 GLN C C     1 
ATOM   6226  O  O     . GLN C  1 42  ? 42.866  -22.976 -7.765  1.00 68.49  ? 183 GLN C O     1 
ATOM   6227  C  CB    . GLN C  1 42  ? 42.186  -19.976 -7.703  1.00 63.69  ? 183 GLN C CB    1 
ATOM   6228  C  CG    . GLN C  1 42  ? 42.561  -18.677 -7.011  1.00 64.82  ? 183 GLN C CG    1 
ATOM   6229  C  CD    . GLN C  1 42  ? 41.341  -17.834 -6.676  1.00 68.67  ? 183 GLN C CD    1 
ATOM   6230  O  OE1   . GLN C  1 42  ? 40.289  -17.974 -7.302  1.00 69.41  ? 183 GLN C OE1   1 
ATOM   6231  N  NE2   . GLN C  1 42  ? 41.477  -16.955 -5.688  1.00 68.89  ? 183 GLN C NE2   1 
ATOM   6232  N  N     . LYS C  1 43  ? 42.662  -22.449 -9.928  1.00 69.51  ? 184 LYS C N     1 
ATOM   6233  C  CA    . LYS C  1 43  ? 42.059  -23.740 -10.251 1.00 73.00  ? 184 LYS C CA    1 
ATOM   6234  C  C     . LYS C  1 43  ? 43.031  -24.845 -10.645 1.00 77.65  ? 184 LYS C C     1 
ATOM   6235  O  O     . LYS C  1 43  ? 43.298  -25.737 -9.848  1.00 79.86  ? 184 LYS C O     1 
ATOM   6236  C  CB    . LYS C  1 43  ? 40.955  -23.580 -11.300 1.00 74.04  ? 184 LYS C CB    1 
ATOM   6237  C  CG    . LYS C  1 43  ? 39.693  -22.964 -10.720 1.00 75.92  ? 184 LYS C CG    1 
ATOM   6238  C  CD    . LYS C  1 43  ? 38.543  -22.982 -11.707 1.00 76.36  ? 184 LYS C CD    1 
ATOM   6239  C  CE    . LYS C  1 43  ? 37.283  -22.450 -11.050 1.00 75.18  ? 184 LYS C CE    1 
ATOM   6240  N  NZ    . LYS C  1 43  ? 36.118  -22.495 -11.967 1.00 74.56  ? 184 LYS C NZ    1 
ATOM   6241  N  N     . ARG C  1 44  ? 43.563  -24.780 -11.862 1.00 79.57  ? 185 ARG C N     1 
ATOM   6242  C  CA    . ARG C  1 44  ? 44.326  -25.887 -12.444 1.00 82.19  ? 185 ARG C CA    1 
ATOM   6243  C  C     . ARG C  1 44  ? 45.546  -26.355 -11.636 1.00 81.54  ? 185 ARG C C     1 
ATOM   6244  O  O     . ARG C  1 44  ? 46.567  -26.735 -12.207 1.00 83.28  ? 185 ARG C O     1 
ATOM   6245  C  CB    . ARG C  1 44  ? 44.737  -25.553 -13.877 1.00 84.97  ? 185 ARG C CB    1 
ATOM   6246  C  CG    . ARG C  1 44  ? 44.768  -26.760 -14.797 1.00 87.12  ? 185 ARG C CG    1 
ATOM   6247  C  CD    . ARG C  1 44  ? 45.360  -26.434 -16.151 1.00 89.26  ? 185 ARG C CD    1 
ATOM   6248  N  NE    . ARG C  1 44  ? 45.599  -27.652 -16.918 1.00 91.80  ? 185 ARG C NE    1 
ATOM   6249  C  CZ    . ARG C  1 44  ? 46.161  -27.684 -18.120 1.00 95.37  ? 185 ARG C CZ    1 
ATOM   6250  N  NH1   . ARG C  1 44  ? 46.547  -26.560 -18.706 1.00 97.40  ? 185 ARG C NH1   1 
ATOM   6251  N  NH2   . ARG C  1 44  ? 46.336  -28.844 -18.737 1.00 95.69  ? 185 ARG C NH2   1 
ATOM   6252  N  N     . GLU C  1 45  ? 45.419  -26.340 -10.310 1.00 77.99  ? 186 GLU C N     1 
ATOM   6253  C  CA    . GLU C  1 45  ? 46.438  -26.850 -9.389  1.00 73.91  ? 186 GLU C CA    1 
ATOM   6254  C  C     . GLU C  1 45  ? 47.826  -26.288 -9.670  1.00 68.66  ? 186 GLU C C     1 
ATOM   6255  O  O     . GLU C  1 45  ? 48.706  -26.976 -10.187 1.00 67.28  ? 186 GLU C O     1 
ATOM   6256  C  CB    . GLU C  1 45  ? 46.436  -28.385 -9.381  1.00 73.49  ? 186 GLU C CB    1 
ATOM   6257  C  CG    . GLU C  1 45  ? 45.302  -28.991 -8.555  1.00 74.79  ? 186 GLU C CG    1 
ATOM   6258  C  CD    . GLU C  1 45  ? 43.925  -28.659 -9.103  1.00 78.09  ? 186 GLU C CD    1 
ATOM   6259  O  OE1   . GLU C  1 45  ? 43.786  -28.521 -10.336 1.00 80.71  ? 186 GLU C OE1   1 
ATOM   6260  O  OE2   . GLU C  1 45  ? 42.977  -28.538 -8.303  1.00 77.92  ? 186 GLU C OE2   1 
ATOM   6261  N  N     . SER C  1 46  ? 47.997  -25.019 -9.324  1.00 63.69  ? 187 SER C N     1 
ATOM   6262  C  CA    . SER C  1 46  ? 49.277  -24.350 -9.451  1.00 60.59  ? 187 SER C CA    1 
ATOM   6263  C  C     . SER C  1 46  ? 49.875  -24.127 -8.072  1.00 57.89  ? 187 SER C C     1 
ATOM   6264  O  O     . SER C  1 46  ? 49.236  -24.403 -7.058  1.00 57.50  ? 187 SER C O     1 
ATOM   6265  C  CB    . SER C  1 46  ? 49.110  -23.010 -10.168 1.00 59.63  ? 187 SER C CB    1 
ATOM   6266  O  OG    . SER C  1 46  ? 47.980  -22.306 -9.679  1.00 59.19  ? 187 SER C OG    1 
ATOM   6267  N  N     . GLU C  1 47  ? 51.108  -23.635 -8.036  1.00 58.24  ? 188 GLU C N     1 
ATOM   6268  C  CA    . GLU C  1 47  ? 51.724  -23.237 -6.779  1.00 56.15  ? 188 GLU C CA    1 
ATOM   6269  C  C     . GLU C  1 47  ? 51.122  -21.915 -6.319  1.00 51.42  ? 188 GLU C C     1 
ATOM   6270  O  O     . GLU C  1 47  ? 51.289  -21.508 -5.168  1.00 51.07  ? 188 GLU C O     1 
ATOM   6271  C  CB    . GLU C  1 47  ? 53.238  -23.103 -6.944  1.00 56.53  ? 188 GLU C CB    1 
ATOM   6272  C  CG    . GLU C  1 47  ? 53.686  -22.781 -8.362  1.00 58.73  ? 188 GLU C CG    1 
ATOM   6273  C  CD    . GLU C  1 47  ? 54.083  -24.020 -9.138  1.00 61.83  ? 188 GLU C CD    1 
ATOM   6274  O  OE1   . GLU C  1 47  ? 54.132  -25.110 -8.535  1.00 67.26  ? 188 GLU C OE1   1 
ATOM   6275  O  OE2   . GLU C  1 47  ? 54.351  -23.903 -10.349 1.00 59.33  ? 188 GLU C OE2   1 
ATOM   6276  N  N     . PHE C  1 48  ? 50.414  -21.257 -7.230  1.00 46.96  ? 189 PHE C N     1 
ATOM   6277  C  CA    . PHE C  1 48  ? 49.795  -19.979 -6.943  1.00 43.83  ? 189 PHE C CA    1 
ATOM   6278  C  C     . PHE C  1 48  ? 48.321  -20.174 -6.625  1.00 42.36  ? 189 PHE C C     1 
ATOM   6279  O  O     . PHE C  1 48  ? 47.526  -19.239 -6.695  1.00 45.80  ? 189 PHE C O     1 
ATOM   6280  C  CB    . PHE C  1 48  ? 49.976  -19.043 -8.133  1.00 43.38  ? 189 PHE C CB    1 
ATOM   6281  C  CG    . PHE C  1 48  ? 51.411  -18.874 -8.553  1.00 44.00  ? 189 PHE C CG    1 
ATOM   6282  C  CD1   . PHE C  1 48  ? 52.234  -17.968 -7.902  1.00 40.97  ? 189 PHE C CD1   1 
ATOM   6283  C  CD2   . PHE C  1 48  ? 51.937  -19.621 -9.597  1.00 44.60  ? 189 PHE C CD2   1 
ATOM   6284  C  CE1   . PHE C  1 48  ? 53.554  -17.807 -8.281  1.00 40.41  ? 189 PHE C CE1   1 
ATOM   6285  C  CE2   . PHE C  1 48  ? 53.259  -19.465 -9.984  1.00 42.66  ? 189 PHE C CE2   1 
ATOM   6286  C  CZ    . PHE C  1 48  ? 54.066  -18.557 -9.324  1.00 41.45  ? 189 PHE C CZ    1 
ATOM   6287  N  N     . LYS C  1 49  ? 47.965  -21.404 -6.276  1.00 39.65  ? 190 LYS C N     1 
ATOM   6288  C  CA    . LYS C  1 49  ? 46.608  -21.717 -5.869  1.00 39.07  ? 190 LYS C CA    1 
ATOM   6289  C  C     . LYS C  1 49  ? 46.337  -21.056 -4.526  1.00 43.34  ? 190 LYS C C     1 
ATOM   6290  O  O     . LYS C  1 49  ? 47.170  -21.110 -3.615  1.00 40.13  ? 190 LYS C O     1 
ATOM   6291  C  CB    . LYS C  1 49  ? 46.423  -23.231 -5.782  1.00 36.80  ? 190 LYS C CB    1 
ATOM   6292  C  CG    . LYS C  1 49  ? 44.985  -23.676 -5.596  1.00 40.42  ? 190 LYS C CG    1 
ATOM   6293  C  CD    . LYS C  1 49  ? 44.797  -25.085 -6.127  1.00 42.51  ? 190 LYS C CD    1 
ATOM   6294  C  CE    . LYS C  1 49  ? 43.356  -25.527 -6.009  1.00 43.87  ? 190 LYS C CE    1 
ATOM   6295  N  NZ    . LYS C  1 49  ? 43.164  -26.890 -6.570  1.00 46.94  ? 190 LYS C NZ    1 
ATOM   6296  N  N     . GLY C  1 50  ? 45.185  -20.406 -4.411  1.00 47.94  ? 191 GLY C N     1 
ATOM   6297  C  CA    . GLY C  1 50  ? 44.868  -19.663 -3.207  1.00 49.92  ? 191 GLY C CA    1 
ATOM   6298  C  C     . GLY C  1 50  ? 45.302  -18.213 -3.299  1.00 50.39  ? 191 GLY C C     1 
ATOM   6299  O  O     . GLY C  1 50  ? 45.220  -17.470 -2.319  1.00 51.10  ? 191 GLY C O     1 
ATOM   6300  N  N     . VAL C  1 51  ? 45.776  -17.812 -4.475  1.00 48.54  ? 192 VAL C N     1 
ATOM   6301  C  CA    . VAL C  1 51  ? 46.125  -16.418 -4.710  1.00 42.96  ? 192 VAL C CA    1 
ATOM   6302  C  C     . VAL C  1 51  ? 44.847  -15.576 -4.648  1.00 45.05  ? 192 VAL C C     1 
ATOM   6303  O  O     . VAL C  1 51  ? 43.765  -16.055 -5.000  1.00 47.95  ? 192 VAL C O     1 
ATOM   6304  C  CB    . VAL C  1 51  ? 46.861  -16.248 -6.059  1.00 37.88  ? 192 VAL C CB    1 
ATOM   6305  C  CG1   . VAL C  1 51  ? 45.892  -16.133 -7.207  1.00 36.71  ? 192 VAL C CG1   1 
ATOM   6306  C  CG2   . VAL C  1 51  ? 47.774  -15.044 -6.024  1.00 39.83  ? 192 VAL C CG2   1 
ATOM   6307  N  N     . GLU C  1 52  ? 44.960  -14.343 -4.157  1.00 41.84  ? 193 GLU C N     1 
ATOM   6308  C  CA    . GLU C  1 52  ? 43.794  -13.474 -4.008  1.00 38.74  ? 193 GLU C CA    1 
ATOM   6309  C  C     . GLU C  1 52  ? 44.020  -12.150 -4.723  1.00 39.32  ? 193 GLU C C     1 
ATOM   6310  O  O     . GLU C  1 52  ? 45.154  -11.796 -5.045  1.00 40.22  ? 193 GLU C O     1 
ATOM   6311  C  CB    . GLU C  1 52  ? 43.443  -13.250 -2.527  1.00 37.94  ? 193 GLU C CB    1 
ATOM   6312  C  CG    . GLU C  1 52  ? 43.111  -14.529 -1.754  1.00 41.89  ? 193 GLU C CG    1 
ATOM   6313  C  CD    . GLU C  1 52  ? 42.591  -14.262 -0.348  1.00 47.77  ? 193 GLU C CD    1 
ATOM   6314  O  OE1   . GLU C  1 52  ? 41.912  -13.236 -0.148  1.00 50.52  ? 193 GLU C OE1   1 
ATOM   6315  O  OE2   . GLU C  1 52  ? 42.856  -15.084 0.555   1.00 49.24  ? 193 GLU C OE2   1 
ATOM   6316  N  N     . GLN C  1 53  ? 42.937  -11.418 -4.962  1.00 39.48  ? 194 GLN C N     1 
ATOM   6317  C  CA    . GLN C  1 53  ? 42.998  -10.195 -5.749  1.00 34.16  ? 194 GLN C CA    1 
ATOM   6318  C  C     . GLN C  1 53  ? 42.917  -8.950  -4.871  1.00 38.02  ? 194 GLN C C     1 
ATOM   6319  O  O     . GLN C  1 53  ? 42.120  -8.884  -3.928  1.00 41.75  ? 194 GLN C O     1 
ATOM   6320  C  CB    . GLN C  1 53  ? 41.868  -10.190 -6.775  1.00 31.79  ? 194 GLN C CB    1 
ATOM   6321  C  CG    . GLN C  1 53  ? 41.838  -8.978  -7.694  1.00 32.98  ? 194 GLN C CG    1 
ATOM   6322  C  CD    . GLN C  1 53  ? 40.634  -8.989  -8.615  1.00 34.43  ? 194 GLN C CD    1 
ATOM   6323  O  OE1   . GLN C  1 53  ? 39.916  -9.985  -8.704  1.00 33.08  ? 194 GLN C OE1   1 
ATOM   6324  N  NE2   . GLN C  1 53  ? 40.406  -7.879  -9.304  1.00 34.25  ? 194 GLN C NE2   1 
ATOM   6325  N  N     . LEU C  1 54  ? 43.758  -7.970  -5.181  1.00 37.23  ? 195 LEU C N     1 
ATOM   6326  C  CA    . LEU C  1 54  ? 43.730  -6.686  -4.497  1.00 36.60  ? 195 LEU C CA    1 
ATOM   6327  C  C     . LEU C  1 54  ? 43.946  -5.595  -5.535  1.00 38.81  ? 195 LEU C C     1 
ATOM   6328  O  O     . LEU C  1 54  ? 45.036  -5.457  -6.079  1.00 41.54  ? 195 LEU C O     1 
ATOM   6329  C  CB    . LEU C  1 54  ? 44.832  -6.619  -3.439  1.00 39.29  ? 195 LEU C CB    1 
ATOM   6330  C  CG    . LEU C  1 54  ? 44.564  -5.853  -2.142  1.00 42.58  ? 195 LEU C CG    1 
ATOM   6331  C  CD1   . LEU C  1 54  ? 45.870  -5.554  -1.416  1.00 45.34  ? 195 LEU C CD1   1 
ATOM   6332  C  CD2   . LEU C  1 54  ? 43.776  -4.575  -2.381  1.00 39.90  ? 195 LEU C CD2   1 
ATOM   6333  N  N     . ASN C  1 55  ? 42.911  -4.815  -5.809  1.00 36.73  ? 196 ASN C N     1 
ATOM   6334  C  CA    . ASN C  1 55  ? 43.050  -3.721  -6.755  1.00 30.68  ? 196 ASN C CA    1 
ATOM   6335  C  C     . ASN C  1 55  ? 43.757  -2.534  -6.126  1.00 30.01  ? 196 ASN C C     1 
ATOM   6336  O  O     . ASN C  1 55  ? 43.396  -2.106  -5.029  1.00 33.28  ? 196 ASN C O     1 
ATOM   6337  C  CB    . ASN C  1 55  ? 41.683  -3.310  -7.286  1.00 29.05  ? 196 ASN C CB    1 
ATOM   6338  C  CG    . ASN C  1 55  ? 41.025  -4.404  -8.082  1.00 24.98  ? 196 ASN C CG    1 
ATOM   6339  O  OD1   . ASN C  1 55  ? 41.682  -5.093  -8.858  1.00 21.62  ? 196 ASN C OD1   1 
ATOM   6340  N  ND2   . ASN C  1 55  ? 39.722  -4.582  -7.889  1.00 24.11  ? 196 ASN C ND2   1 
ATOM   6341  N  N     . THR C  1 56  ? 44.760  -2.003  -6.822  1.00 27.56  ? 197 THR C N     1 
ATOM   6342  C  CA    . THR C  1 56  ? 45.544  -0.884  -6.308  1.00 26.87  ? 197 THR C CA    1 
ATOM   6343  C  C     . THR C  1 56  ? 45.871  0.087   -7.427  1.00 29.18  ? 197 THR C C     1 
ATOM   6344  O  O     . THR C  1 56  ? 45.528  -0.154  -8.583  1.00 36.13  ? 197 THR C O     1 
ATOM   6345  C  CB    . THR C  1 56  ? 46.867  -1.357  -5.685  1.00 26.89  ? 197 THR C CB    1 
ATOM   6346  O  OG1   . THR C  1 56  ? 47.567  -2.177  -6.627  1.00 29.92  ? 197 THR C OG1   1 
ATOM   6347  C  CG2   . THR C  1 56  ? 46.617  -2.153  -4.420  1.00 25.44  ? 197 THR C CG2   1 
ATOM   6348  N  N     . GLY C  1 57  ? 46.536  1.184   -7.089  1.00 24.29  ? 198 GLY C N     1 
ATOM   6349  C  CA    . GLY C  1 57  ? 46.956  2.129   -8.102  1.00 26.45  ? 198 GLY C CA    1 
ATOM   6350  C  C     . GLY C  1 57  ? 45.999  3.288   -8.267  1.00 32.43  ? 198 GLY C C     1 
ATOM   6351  O  O     . GLY C  1 57  ? 44.928  3.312   -7.659  1.00 33.74  ? 198 GLY C O     1 
ATOM   6352  N  N     . SER C  1 58  ? 46.388  4.233   -9.117  1.00 36.37  ? 199 SER C N     1 
ATOM   6353  C  CA    . SER C  1 58  ? 45.675  5.491   -9.298  1.00 35.54  ? 199 SER C CA    1 
ATOM   6354  C  C     . SER C  1 58  ? 44.191  5.354   -9.604  1.00 35.01  ? 199 SER C C     1 
ATOM   6355  O  O     . SER C  1 58  ? 43.391  6.151   -9.122  1.00 39.14  ? 199 SER C O     1 
ATOM   6356  C  CB    . SER C  1 58  ? 46.350  6.311   -10.395 1.00 36.64  ? 199 SER C CB    1 
ATOM   6357  O  OG    . SER C  1 58  ? 47.718  6.498   -10.107 1.00 40.76  ? 199 SER C OG    1 
ATOM   6358  N  N     . TYR C  1 59  ? 43.829  4.361   -10.412 1.00 34.84  ? 200 TYR C N     1 
ATOM   6359  C  CA    . TYR C  1 59  ? 42.438  4.178   -10.822 1.00 31.03  ? 200 TYR C CA    1 
ATOM   6360  C  C     . TYR C  1 59  ? 41.535  3.911   -9.631  1.00 31.18  ? 200 TYR C C     1 
ATOM   6361  O  O     . TYR C  1 59  ? 40.484  4.532   -9.482  1.00 38.01  ? 200 TYR C O     1 
ATOM   6362  C  CB    . TYR C  1 59  ? 42.319  3.031   -11.826 1.00 26.40  ? 200 TYR C CB    1 
ATOM   6363  C  CG    . TYR C  1 59  ? 40.895  2.712   -12.232 1.00 26.54  ? 200 TYR C CG    1 
ATOM   6364  C  CD1   . TYR C  1 59  ? 40.216  3.504   -13.145 1.00 27.91  ? 200 TYR C CD1   1 
ATOM   6365  C  CD2   . TYR C  1 59  ? 40.232  1.614   -11.706 1.00 26.90  ? 200 TYR C CD2   1 
ATOM   6366  C  CE1   . TYR C  1 59  ? 38.916  3.213   -13.517 1.00 27.05  ? 200 TYR C CE1   1 
ATOM   6367  C  CE2   . TYR C  1 59  ? 38.935  1.318   -12.073 1.00 26.02  ? 200 TYR C CE2   1 
ATOM   6368  C  CZ    . TYR C  1 59  ? 38.286  2.118   -12.978 1.00 27.09  ? 200 TYR C CZ    1 
ATOM   6369  O  OH    . TYR C  1 59  ? 36.996  1.817   -13.338 1.00 29.18  ? 200 TYR C OH    1 
ATOM   6370  N  N     . TYR C  1 60  ? 41.957  2.986   -8.780  1.00 27.55  ? 201 TYR C N     1 
ATOM   6371  C  CA    . TYR C  1 60  ? 41.169  2.593   -7.626  1.00 28.20  ? 201 TYR C CA    1 
ATOM   6372  C  C     . TYR C  1 60  ? 41.334  3.581   -6.470  1.00 33.40  ? 201 TYR C C     1 
ATOM   6373  O  O     . TYR C  1 60  ? 40.652  3.478   -5.448  1.00 34.27  ? 201 TYR C O     1 
ATOM   6374  C  CB    . TYR C  1 60  ? 41.548  1.174   -7.216  1.00 28.23  ? 201 TYR C CB    1 
ATOM   6375  C  CG    . TYR C  1 60  ? 41.290  0.170   -8.313  1.00 30.11  ? 201 TYR C CG    1 
ATOM   6376  C  CD1   . TYR C  1 60  ? 40.003  -0.267  -8.584  1.00 34.30  ? 201 TYR C CD1   1 
ATOM   6377  C  CD2   . TYR C  1 60  ? 42.328  -0.331  -9.087  1.00 28.66  ? 201 TYR C CD2   1 
ATOM   6378  C  CE1   . TYR C  1 60  ? 39.756  -1.179  -9.587  1.00 33.70  ? 201 TYR C CE1   1 
ATOM   6379  C  CE2   . TYR C  1 60  ? 42.088  -1.247  -10.098 1.00 27.64  ? 201 TYR C CE2   1 
ATOM   6380  C  CZ    . TYR C  1 60  ? 40.801  -1.665  -10.338 1.00 32.44  ? 201 TYR C CZ    1 
ATOM   6381  O  OH    . TYR C  1 60  ? 40.554  -2.577  -11.336 1.00 35.89  ? 201 TYR C OH    1 
ATOM   6382  N  N     . GLU C  1 61  ? 42.242  4.538   -6.646  1.00 36.44  ? 202 GLU C N     1 
ATOM   6383  C  CA    . GLU C  1 61  ? 42.407  5.636   -5.700  1.00 32.88  ? 202 GLU C CA    1 
ATOM   6384  C  C     . GLU C  1 61  ? 41.664  6.866   -6.212  1.00 31.18  ? 202 GLU C C     1 
ATOM   6385  O  O     . GLU C  1 61  ? 41.621  7.894   -5.536  1.00 33.82  ? 202 GLU C O     1 
ATOM   6386  C  CB    . GLU C  1 61  ? 43.892  5.968   -5.504  1.00 31.21  ? 202 GLU C CB    1 
ATOM   6387  C  CG    . GLU C  1 61  ? 44.705  4.868   -4.819  1.00 26.38  ? 202 GLU C CG    1 
ATOM   6388  C  CD    . GLU C  1 61  ? 46.198  5.149   -4.824  1.00 27.65  ? 202 GLU C CD    1 
ATOM   6389  O  OE1   . GLU C  1 61  ? 46.621  6.143   -5.446  1.00 28.11  ? 202 GLU C OE1   1 
ATOM   6390  O  OE2   . GLU C  1 61  ? 46.949  4.367   -4.208  1.00 27.04  ? 202 GLU C OE2   1 
ATOM   6391  N  N     . HIS C  1 62  ? 41.079  6.741   -7.405  1.00 28.58  ? 203 HIS C N     1 
ATOM   6392  C  CA    . HIS C  1 62  ? 40.386  7.840   -8.075  1.00 28.67  ? 203 HIS C CA    1 
ATOM   6393  C  C     . HIS C  1 62  ? 41.338  9.009   -8.274  1.00 36.20  ? 203 HIS C C     1 
ATOM   6394  O  O     . HIS C  1 62  ? 41.018  10.157  -7.966  1.00 41.66  ? 203 HIS C O     1 
ATOM   6395  C  CB    . HIS C  1 62  ? 39.147  8.280   -7.296  1.00 27.91  ? 203 HIS C CB    1 
ATOM   6396  C  CG    . HIS C  1 62  ? 38.250  7.153   -6.887  1.00 30.16  ? 203 HIS C CG    1 
ATOM   6397  N  ND1   . HIS C  1 62  ? 37.269  6.641   -7.712  1.00 31.75  ? 203 HIS C ND1   1 
ATOM   6398  C  CD2   . HIS C  1 62  ? 38.168  6.457   -5.729  1.00 29.12  ? 203 HIS C CD2   1 
ATOM   6399  C  CE1   . HIS C  1 62  ? 36.631  5.671   -7.080  1.00 33.34  ? 203 HIS C CE1   1 
ATOM   6400  N  NE2   . HIS C  1 62  ? 37.157  5.539   -5.876  1.00 30.99  ? 203 HIS C NE2   1 
ATOM   6401  N  N     . VAL C  1 63  ? 42.512  8.687   -8.802  1.00 36.21  ? 204 VAL C N     1 
ATOM   6402  C  CA    . VAL C  1 63  ? 43.584  9.643   -8.995  1.00 36.44  ? 204 VAL C CA    1 
ATOM   6403  C  C     . VAL C  1 63  ? 44.138  9.441   -10.420 1.00 40.29  ? 204 VAL C C     1 
ATOM   6404  O  O     . VAL C  1 63  ? 45.034  10.155  -10.882 1.00 40.73  ? 204 VAL C O     1 
ATOM   6405  C  CB    . VAL C  1 63  ? 44.619  9.530   -7.823  1.00 35.78  ? 204 VAL C CB    1 
ATOM   6406  C  CG1   . VAL C  1 63  ? 46.044  9.316   -8.298  1.00 39.09  ? 204 VAL C CG1   1 
ATOM   6407  C  CG2   . VAL C  1 63  ? 44.523  10.732  -6.897  1.00 33.53  ? 204 VAL C CG2   1 
ATOM   6408  N  N     . LYS C  1 64  ? 43.539  8.490   -11.133 1.00 40.12  ? 205 LYS C N     1 
ATOM   6409  C  CA    . LYS C  1 64  ? 43.825  8.286   -12.550 1.00 37.28  ? 205 LYS C CA    1 
ATOM   6410  C  C     . LYS C  1 64  ? 43.395  9.491   -13.381 1.00 40.32  ? 205 LYS C C     1 
ATOM   6411  O  O     . LYS C  1 64  ? 42.289  10.003  -13.209 1.00 42.46  ? 205 LYS C O     1 
ATOM   6412  C  CB    . LYS C  1 64  ? 43.101  7.043   -13.062 1.00 32.49  ? 205 LYS C CB    1 
ATOM   6413  C  CG    . LYS C  1 64  ? 43.555  6.609   -14.434 1.00 27.03  ? 205 LYS C CG    1 
ATOM   6414  C  CD    . LYS C  1 64  ? 45.051  6.371   -14.433 1.00 24.39  ? 205 LYS C CD    1 
ATOM   6415  C  CE    . LYS C  1 64  ? 45.548  5.928   -15.798 1.00 31.87  ? 205 LYS C CE    1 
ATOM   6416  N  NZ    . LYS C  1 64  ? 45.416  6.972   -16.853 1.00 33.75  ? 205 LYS C NZ    1 
ATOM   6417  N  N     . ILE C  1 65  ? 44.270  9.942   -14.279 1.00 42.40  ? 206 ILE C N     1 
ATOM   6418  C  CA    . ILE C  1 65  ? 43.990  11.120  -15.105 1.00 39.92  ? 206 ILE C CA    1 
ATOM   6419  C  C     . ILE C  1 65  ? 43.921  10.812  -16.597 1.00 40.01  ? 206 ILE C C     1 
ATOM   6420  O  O     . ILE C  1 65  ? 44.439  9.787   -17.052 1.00 40.06  ? 206 ILE C O     1 
ATOM   6421  C  CB    . ILE C  1 65  ? 45.035  12.229  -14.897 1.00 36.53  ? 206 ILE C CB    1 
ATOM   6422  C  CG1   . ILE C  1 65  ? 46.441  11.731  -15.254 1.00 36.75  ? 206 ILE C CG1   1 
ATOM   6423  C  CG2   . ILE C  1 65  ? 44.995  12.741  -13.467 1.00 34.33  ? 206 ILE C CG2   1 
ATOM   6424  C  CD1   . ILE C  1 65  ? 47.504  12.826  -15.279 1.00 30.39  ? 206 ILE C CD1   1 
ATOM   6425  N  N     . SER C  1 66  ? 43.265  11.706  -17.338 1.00 41.30  ? 207 SER C N     1 
ATOM   6426  C  CA    . SER C  1 66  ? 43.172  11.644  -18.799 1.00 39.76  ? 207 SER C CA    1 
ATOM   6427  C  C     . SER C  1 66  ? 42.339  10.477  -19.335 1.00 40.64  ? 207 SER C C     1 
ATOM   6428  O  O     . SER C  1 66  ? 41.291  10.692  -19.951 1.00 40.80  ? 207 SER C O     1 
ATOM   6429  C  CB    . SER C  1 66  ? 44.562  11.659  -19.444 1.00 38.18  ? 207 SER C CB    1 
ATOM   6430  O  OG    . SER C  1 66  ? 45.299  12.788  -19.027 1.00 38.01  ? 207 SER C OG    1 
ATOM   6431  N  N     . ALA C  1 67  ? 42.808  9.252   -19.112 1.00 40.45  ? 208 ALA C N     1 
ATOM   6432  C  CA    . ALA C  1 67  ? 42.111  8.065   -19.606 1.00 36.24  ? 208 ALA C CA    1 
ATOM   6433  C  C     . ALA C  1 67  ? 42.226  6.894   -18.644 1.00 35.22  ? 208 ALA C C     1 
ATOM   6434  O  O     . ALA C  1 67  ? 43.199  6.790   -17.897 1.00 30.36  ? 208 ALA C O     1 
ATOM   6435  C  CB    . ALA C  1 67  ? 42.637  7.667   -20.975 1.00 31.17  ? 208 ALA C CB    1 
ATOM   6436  N  N     . PRO C  1 68  ? 41.226  6.000   -18.668 1.00 38.41  ? 209 PRO C N     1 
ATOM   6437  C  CA    . PRO C  1 68  ? 41.277  4.764   -17.883 1.00 37.53  ? 209 PRO C CA    1 
ATOM   6438  C  C     . PRO C  1 68  ? 42.059  3.701   -18.652 1.00 33.11  ? 209 PRO C C     1 
ATOM   6439  O  O     . PRO C  1 68  ? 41.507  2.660   -19.017 1.00 33.82  ? 209 PRO C O     1 
ATOM   6440  C  CB    . PRO C  1 68  ? 39.797  4.363   -17.759 1.00 39.99  ? 209 PRO C CB    1 
ATOM   6441  C  CG    . PRO C  1 68  ? 38.996  5.493   -18.390 1.00 39.96  ? 209 PRO C CG    1 
ATOM   6442  C  CD    . PRO C  1 68  ? 39.923  6.170   -19.334 1.00 37.89  ? 209 PRO C CD    1 
ATOM   6443  N  N     . ASN C  1 69  ? 43.344  3.970   -18.869 1.00 29.95  ? 210 ASN C N     1 
ATOM   6444  C  CA    . ASN C  1 69  ? 44.191  3.161   -19.737 1.00 28.23  ? 210 ASN C CA    1 
ATOM   6445  C  C     . ASN C  1 69  ? 45.247  2.362   -18.978 1.00 31.15  ? 210 ASN C C     1 
ATOM   6446  O  O     . ASN C  1 69  ? 46.092  1.695   -19.587 1.00 31.61  ? 210 ASN C O     1 
ATOM   6447  C  CB    . ASN C  1 69  ? 44.892  4.071   -20.743 1.00 28.03  ? 210 ASN C CB    1 
ATOM   6448  C  CG    . ASN C  1 69  ? 45.809  5.083   -20.072 1.00 32.02  ? 210 ASN C CG    1 
ATOM   6449  O  OD1   . ASN C  1 69  ? 45.634  5.416   -18.902 1.00 36.04  ? 210 ASN C OD1   1 
ATOM   6450  N  ND2   . ASN C  1 69  ? 46.789  5.581   -20.815 1.00 31.57  ? 210 ASN C ND2   1 
ATOM   6451  N  N     . GLU C  1 70  ? 45.214  2.455   -17.653 1.00 28.61  ? 211 GLU C N     1 
ATOM   6452  C  CA    . GLU C  1 70  ? 46.155  1.736   -16.803 1.00 31.81  ? 211 GLU C CA    1 
ATOM   6453  C  C     . GLU C  1 70  ? 45.425  1.172   -15.599 1.00 32.63  ? 211 GLU C C     1 
ATOM   6454  O  O     . GLU C  1 70  ? 44.613  1.862   -14.972 1.00 32.91  ? 211 GLU C O     1 
ATOM   6455  C  CB    . GLU C  1 70  ? 47.288  2.659   -16.348 1.00 35.39  ? 211 GLU C CB    1 
ATOM   6456  C  CG    . GLU C  1 70  ? 48.189  3.105   -17.483 1.00 42.75  ? 211 GLU C CG    1 
ATOM   6457  C  CD    . GLU C  1 70  ? 49.147  4.192   -17.073 1.00 50.56  ? 211 GLU C CD    1 
ATOM   6458  O  OE1   . GLU C  1 70  ? 49.743  4.823   -17.970 1.00 52.97  ? 211 GLU C OE1   1 
ATOM   6459  O  OE2   . GLU C  1 70  ? 49.306  4.415   -15.856 1.00 54.48  ? 211 GLU C OE2   1 
ATOM   6460  N  N     . PHE C  1 71  ? 45.709  -0.085  -15.281 1.00 32.82  ? 212 PHE C N     1 
ATOM   6461  C  CA    . PHE C  1 71  ? 45.090  -0.727  -14.132 1.00 29.65  ? 212 PHE C CA    1 
ATOM   6462  C  C     . PHE C  1 71  ? 46.137  -1.542  -13.393 1.00 29.26  ? 212 PHE C C     1 
ATOM   6463  O  O     . PHE C  1 71  ? 46.948  -2.224  -14.025 1.00 35.03  ? 212 PHE C O     1 
ATOM   6464  C  CB    . PHE C  1 71  ? 43.945  -1.637  -14.585 1.00 29.17  ? 212 PHE C CB    1 
ATOM   6465  C  CG    . PHE C  1 71  ? 42.756  -0.896  -15.125 1.00 26.12  ? 212 PHE C CG    1 
ATOM   6466  C  CD1   . PHE C  1 71  ? 41.668  -0.629  -14.310 1.00 25.42  ? 212 PHE C CD1   1 
ATOM   6467  C  CD2   . PHE C  1 71  ? 42.720  -0.475  -16.448 1.00 23.41  ? 212 PHE C CD2   1 
ATOM   6468  C  CE1   . PHE C  1 71  ? 40.567  0.048   -14.800 1.00 26.83  ? 212 PHE C CE1   1 
ATOM   6469  C  CE2   . PHE C  1 71  ? 41.624  0.207   -16.942 1.00 22.92  ? 212 PHE C CE2   1 
ATOM   6470  C  CZ    . PHE C  1 71  ? 40.547  0.468   -16.115 1.00 25.39  ? 212 PHE C CZ    1 
ATOM   6471  N  N     . ASP C  1 72  ? 46.133  -1.464  -12.066 1.00 25.86  ? 213 ASP C N     1 
ATOM   6472  C  CA    . ASP C  1 72  ? 47.088  -2.229  -11.272 1.00 28.91  ? 213 ASP C CA    1 
ATOM   6473  C  C     . ASP C  1 72  ? 46.371  -3.226  -10.353 1.00 30.03  ? 213 ASP C C     1 
ATOM   6474  O  O     . ASP C  1 72  ? 45.531  -2.840  -9.531  1.00 32.25  ? 213 ASP C O     1 
ATOM   6475  C  CB    . ASP C  1 72  ? 48.015  -1.295  -10.480 1.00 33.34  ? 213 ASP C CB    1 
ATOM   6476  C  CG    . ASP C  1 72  ? 48.830  -0.369  -11.380 1.00 38.84  ? 213 ASP C CG    1 
ATOM   6477  O  OD1   . ASP C  1 72  ? 48.961  0.826   -11.045 1.00 36.72  ? 213 ASP C OD1   1 
ATOM   6478  O  OD2   . ASP C  1 72  ? 49.339  -0.832  -12.421 1.00 42.51  ? 213 ASP C OD2   1 
ATOM   6479  N  N     . VAL C  1 73  ? 46.693  -4.511  -10.513 1.00 32.57  ? 214 VAL C N     1 
ATOM   6480  C  CA    . VAL C  1 73  ? 46.085  -5.570  -9.700  1.00 34.34  ? 214 VAL C CA    1 
ATOM   6481  C  C     . VAL C  1 73  ? 47.154  -6.435  -9.037  1.00 31.53  ? 214 VAL C C     1 
ATOM   6482  O  O     . VAL C  1 73  ? 48.048  -6.942  -9.710  1.00 30.17  ? 214 VAL C O     1 
ATOM   6483  C  CB    . VAL C  1 73  ? 45.178  -6.497  -10.539 1.00 36.30  ? 214 VAL C CB    1 
ATOM   6484  C  CG1   . VAL C  1 73  ? 44.500  -7.516  -9.649  1.00 36.32  ? 214 VAL C CG1   1 
ATOM   6485  C  CG2   . VAL C  1 73  ? 44.139  -5.700  -11.301 1.00 36.02  ? 214 VAL C CG2   1 
ATOM   6486  N  N     . MET C  1 74  ? 47.064  -6.605  -7.722  1.00 29.83  ? 215 MET C N     1 
ATOM   6487  C  CA    . MET C  1 74  ? 47.966  -7.501  -7.007  1.00 21.61  ? 215 MET C CA    1 
ATOM   6488  C  C     . MET C  1 74  ? 47.338  -8.878  -6.867  1.00 25.44  ? 215 MET C C     1 
ATOM   6489  O  O     . MET C  1 74  ? 46.217  -9.011  -6.369  1.00 23.82  ? 215 MET C O     1 
ATOM   6490  C  CB    . MET C  1 74  ? 48.286  -6.957  -5.617  1.00 14.32  ? 215 MET C CB    1 
ATOM   6491  C  CG    . MET C  1 74  ? 49.036  -5.638  -5.623  1.00 16.93  ? 215 MET C CG    1 
ATOM   6492  S  SD    . MET C  1 74  ? 49.247  -4.953  -3.974  1.00 79.29  ? 215 MET C SD    1 
ATOM   6493  C  CE    . MET C  1 74  ? 50.079  -6.310  -3.164  1.00 45.30  ? 215 MET C CE    1 
ATOM   6494  N  N     . PHE C  1 75  ? 48.049  -9.897  -7.337  1.00 30.91  ? 216 PHE C N     1 
ATOM   6495  C  CA    . PHE C  1 75  ? 47.723  -11.269 -6.995  1.00 30.55  ? 216 PHE C CA    1 
ATOM   6496  C  C     . PHE C  1 75  ? 48.606  -11.620 -5.807  1.00 30.65  ? 216 PHE C C     1 
ATOM   6497  O  O     . PHE C  1 75  ? 49.809  -11.869 -5.955  1.00 33.50  ? 216 PHE C O     1 
ATOM   6498  C  CB    . PHE C  1 75  ? 47.950  -12.215 -8.180  1.00 32.44  ? 216 PHE C CB    1 
ATOM   6499  C  CG    . PHE C  1 75  ? 46.866  -12.153 -9.229  1.00 33.41  ? 216 PHE C CG    1 
ATOM   6500  C  CD1   . PHE C  1 75  ? 45.996  -11.074 -9.291  1.00 35.94  ? 216 PHE C CD1   1 
ATOM   6501  C  CD2   . PHE C  1 75  ? 46.708  -13.181 -10.145 1.00 33.89  ? 216 PHE C CD2   1 
ATOM   6502  C  CE1   . PHE C  1 75  ? 44.998  -11.016 -10.253 1.00 35.27  ? 216 PHE C CE1   1 
ATOM   6503  C  CE2   . PHE C  1 75  ? 45.710  -13.126 -11.110 1.00 32.78  ? 216 PHE C CE2   1 
ATOM   6504  C  CZ    . PHE C  1 75  ? 44.858  -12.045 -11.161 1.00 33.60  ? 216 PHE C CZ    1 
ATOM   6505  N  N     . LYS C  1 76  ? 48.009  -11.585 -4.619  1.00 31.31  ? 217 LYS C N     1 
ATOM   6506  C  CA    . LYS C  1 76  ? 48.746  -11.794 -3.378  1.00 34.24  ? 217 LYS C CA    1 
ATOM   6507  C  C     . LYS C  1 76  ? 48.623  -13.241 -2.908  1.00 34.28  ? 217 LYS C C     1 
ATOM   6508  O  O     . LYS C  1 76  ? 47.556  -13.844 -2.988  1.00 32.96  ? 217 LYS C O     1 
ATOM   6509  C  CB    . LYS C  1 76  ? 48.260  -10.824 -2.295  1.00 35.62  ? 217 LYS C CB    1 
ATOM   6510  C  CG    . LYS C  1 76  ? 46.804  -11.018 -1.896  1.00 35.94  ? 217 LYS C CG    1 
ATOM   6511  C  CD    . LYS C  1 76  ? 46.214  -9.771  -1.272  1.00 37.65  ? 217 LYS C CD    1 
ATOM   6512  C  CE    . LYS C  1 76  ? 44.814  -10.050 -0.746  1.00 39.16  ? 217 LYS C CE    1 
ATOM   6513  N  NZ    . LYS C  1 76  ? 44.826  -11.101 0.303   1.00 41.15  ? 217 LYS C NZ    1 
ATOM   6514  N  N     . LEU C  1 77  ? 49.730  -13.800 -2.437  1.00 37.51  ? 218 LEU C N     1 
ATOM   6515  C  CA    . LEU C  1 77  ? 49.756  -15.176 -1.969  1.00 40.09  ? 218 LEU C CA    1 
ATOM   6516  C  C     . LEU C  1 77  ? 50.295  -15.198 -0.553  1.00 41.60  ? 218 LEU C C     1 
ATOM   6517  O  O     . LEU C  1 77  ? 51.447  -14.826 -0.317  1.00 42.26  ? 218 LEU C O     1 
ATOM   6518  C  CB    . LEU C  1 77  ? 50.629  -16.037 -2.887  1.00 39.91  ? 218 LEU C CB    1 
ATOM   6519  C  CG    . LEU C  1 77  ? 50.902  -17.482 -2.458  1.00 38.16  ? 218 LEU C CG    1 
ATOM   6520  C  CD1   . LEU C  1 77  ? 49.610  -18.265 -2.336  1.00 35.32  ? 218 LEU C CD1   1 
ATOM   6521  C  CD2   . LEU C  1 77  ? 51.840  -18.160 -3.431  1.00 36.67  ? 218 LEU C CD2   1 
ATOM   6522  N  N     . GLU C  1 78  ? 49.460  -15.614 0.394   1.00 45.81  ? 219 GLU C N     1 
ATOM   6523  C  CA    . GLU C  1 78  ? 49.879  -15.637 1.789   1.00 50.27  ? 219 GLU C CA    1 
ATOM   6524  C  C     . GLU C  1 78  ? 50.972  -16.671 2.000   1.00 49.11  ? 219 GLU C C     1 
ATOM   6525  O  O     . GLU C  1 78  ? 50.744  -17.872 1.872   1.00 47.72  ? 219 GLU C O     1 
ATOM   6526  C  CB    . GLU C  1 78  ? 48.701  -15.904 2.729   1.00 57.73  ? 219 GLU C CB    1 
ATOM   6527  C  CG    . GLU C  1 78  ? 49.087  -15.856 4.207   1.00 65.46  ? 219 GLU C CG    1 
ATOM   6528  C  CD    . GLU C  1 78  ? 47.918  -16.116 5.141   1.00 71.67  ? 219 GLU C CD    1 
ATOM   6529  O  OE1   . GLU C  1 78  ? 46.771  -16.221 4.659   1.00 72.14  ? 219 GLU C OE1   1 
ATOM   6530  O  OE2   . GLU C  1 78  ? 48.151  -16.213 6.364   1.00 73.55  ? 219 GLU C OE2   1 
ATOM   6531  N  N     . VAL C  1 79  ? 52.166  -16.185 2.314   1.00 54.25  ? 220 VAL C N     1 
ATOM   6532  C  CA    . VAL C  1 79  ? 53.313  -17.044 2.543   1.00 59.71  ? 220 VAL C CA    1 
ATOM   6533  C  C     . VAL C  1 79  ? 53.671  -17.006 4.026   1.00 62.84  ? 220 VAL C C     1 
ATOM   6534  O  O     . VAL C  1 79  ? 54.152  -15.992 4.530   1.00 62.72  ? 220 VAL C O     1 
ATOM   6535  C  CB    . VAL C  1 79  ? 54.505  -16.617 1.671   1.00 61.40  ? 220 VAL C CB    1 
ATOM   6536  C  CG1   . VAL C  1 79  ? 55.697  -17.505 1.932   1.00 64.50  ? 220 VAL C CG1   1 
ATOM   6537  C  CG2   . VAL C  1 79  ? 54.120  -16.675 0.197   1.00 60.65  ? 220 VAL C CG2   1 
ATOM   6538  N  N     . PRO C  1 80  ? 53.416  -18.119 4.731   1.00 66.19  ? 221 PRO C N     1 
ATOM   6539  C  CA    . PRO C  1 80  ? 53.596  -18.217 6.183   1.00 69.37  ? 221 PRO C CA    1 
ATOM   6540  C  C     . PRO C  1 80  ? 55.018  -18.603 6.563   1.00 72.58  ? 221 PRO C C     1 
ATOM   6541  O  O     . PRO C  1 80  ? 55.738  -19.146 5.726   1.00 73.21  ? 221 PRO C O     1 
ATOM   6542  C  CB    . PRO C  1 80  ? 52.642  -19.349 6.562   1.00 68.83  ? 221 PRO C CB    1 
ATOM   6543  C  CG    . PRO C  1 80  ? 52.657  -20.250 5.365   1.00 67.18  ? 221 PRO C CG    1 
ATOM   6544  C  CD    . PRO C  1 80  ? 52.854  -19.358 4.159   1.00 66.16  ? 221 PRO C CD    1 
ATOM   6545  N  N     . ARG C  1 81  ? 55.407  -18.313 7.803   1.00 74.56  ? 222 ARG C N     1 
ATOM   6546  C  CA    . ARG C  1 81  ? 56.716  -18.698 8.331   1.00 76.59  ? 222 ARG C CA    1 
ATOM   6547  C  C     . ARG C  1 81  ? 57.899  -18.185 7.520   1.00 73.19  ? 222 ARG C C     1 
ATOM   6548  O  O     . ARG C  1 81  ? 58.790  -18.962 7.162   1.00 74.28  ? 222 ARG C O     1 
ATOM   6549  C  CB    . ARG C  1 81  ? 56.822  -20.218 8.445   1.00 81.91  ? 222 ARG C CB    1 
ATOM   6550  C  CG    . ARG C  1 81  ? 56.034  -20.822 9.587   1.00 85.87  ? 222 ARG C CG    1 
ATOM   6551  C  CD    . ARG C  1 81  ? 56.149  -22.335 9.555   1.00 89.07  ? 222 ARG C CD    1 
ATOM   6552  N  NE    . ARG C  1 81  ? 55.669  -22.949 10.787  1.00 90.55  ? 222 ARG C NE    1 
ATOM   6553  C  CZ    . ARG C  1 81  ? 56.447  -23.228 11.828  1.00 91.81  ? 222 ARG C CZ    1 
ATOM   6554  N  NH1   . ARG C  1 81  ? 57.744  -22.948 11.785  1.00 90.20  ? 222 ARG C NH1   1 
ATOM   6555  N  NH2   . ARG C  1 81  ? 55.932  -23.788 12.913  1.00 93.96  ? 222 ARG C NH2   1 
ATOM   6556  N  N     . ILE C  1 82  ? 57.926  -16.887 7.236   1.00 67.20  ? 223 ILE C N     1 
ATOM   6557  C  CA    . ILE C  1 82  ? 59.076  -16.326 6.538   1.00 61.69  ? 223 ILE C CA    1 
ATOM   6558  C  C     . ILE C  1 82  ? 60.061  -15.670 7.498   1.00 56.20  ? 223 ILE C C     1 
ATOM   6559  O  O     . ILE C  1 82  ? 59.676  -15.104 8.525   1.00 54.31  ? 223 ILE C O     1 
ATOM   6560  C  CB    . ILE C  1 82  ? 58.683  -15.344 5.404   1.00 60.65  ? 223 ILE C CB    1 
ATOM   6561  C  CG1   . ILE C  1 82  ? 58.007  -14.086 5.950   1.00 62.37  ? 223 ILE C CG1   1 
ATOM   6562  C  CG2   . ILE C  1 82  ? 57.772  -16.025 4.407   1.00 59.59  ? 223 ILE C CG2   1 
ATOM   6563  C  CD1   . ILE C  1 82  ? 57.625  -13.098 4.862   1.00 63.07  ? 223 ILE C CD1   1 
ATOM   6564  N  N     . GLU C  1 83  ? 61.339  -15.793 7.161   1.00 53.47  ? 224 GLU C N     1 
ATOM   6565  C  CA    . GLU C  1 83  ? 62.412  -15.114 7.862   1.00 53.25  ? 224 GLU C CA    1 
ATOM   6566  C  C     . GLU C  1 83  ? 62.941  -14.070 6.888   1.00 50.29  ? 224 GLU C C     1 
ATOM   6567  O  O     . GLU C  1 83  ? 63.376  -14.413 5.784   1.00 51.47  ? 224 GLU C O     1 
ATOM   6568  C  CB    . GLU C  1 83  ? 63.519  -16.111 8.214   1.00 59.25  ? 224 GLU C CB    1 
ATOM   6569  C  CG    . GLU C  1 83  ? 64.530  -15.618 9.238   1.00 66.81  ? 224 GLU C CG    1 
ATOM   6570  C  CD    . GLU C  1 83  ? 63.972  -15.614 10.645  1.00 74.92  ? 224 GLU C CD    1 
ATOM   6571  O  OE1   . GLU C  1 83  ? 63.048  -16.410 10.919  1.00 76.43  ? 224 GLU C OE1   1 
ATOM   6572  O  OE2   . GLU C  1 83  ? 64.455  -14.817 11.476  1.00 77.65  ? 224 GLU C OE2   1 
ATOM   6573  N  N     . LEU C  1 84  ? 62.881  -12.800 7.275   1.00 47.27  ? 225 LEU C N     1 
ATOM   6574  C  CA    . LEU C  1 84  ? 63.366  -11.728 6.411   1.00 43.73  ? 225 LEU C CA    1 
ATOM   6575  C  C     . LEU C  1 84  ? 64.817  -11.365 6.717   1.00 43.62  ? 225 LEU C C     1 
ATOM   6576  O  O     . LEU C  1 84  ? 65.184  -11.134 7.874   1.00 42.20  ? 225 LEU C O     1 
ATOM   6577  C  CB    . LEU C  1 84  ? 62.468  -10.494 6.523   1.00 45.00  ? 225 LEU C CB    1 
ATOM   6578  C  CG    . LEU C  1 84  ? 61.591  -10.209 5.305   1.00 47.35  ? 225 LEU C CG    1 
ATOM   6579  C  CD1   . LEU C  1 84  ? 60.970  -11.494 4.802   1.00 49.13  ? 225 LEU C CD1   1 
ATOM   6580  C  CD2   . LEU C  1 84  ? 60.507  -9.189  5.620   1.00 48.14  ? 225 LEU C CD2   1 
ATOM   6581  N  N     . GLN C  1 85  ? 65.640  -11.328 5.675   1.00 42.68  ? 226 GLN C N     1 
ATOM   6582  C  CA    . GLN C  1 85  ? 67.032  -10.937 5.822   1.00 43.10  ? 226 GLN C CA    1 
ATOM   6583  C  C     . GLN C  1 85  ? 67.273  -9.670  5.019   1.00 39.86  ? 226 GLN C C     1 
ATOM   6584  O  O     . GLN C  1 85  ? 67.266  -9.704  3.798   1.00 41.93  ? 226 GLN C O     1 
ATOM   6585  C  CB    . GLN C  1 85  ? 67.950  -12.055 5.329   1.00 48.55  ? 226 GLN C CB    1 
ATOM   6586  C  CG    . GLN C  1 85  ? 69.437  -11.742 5.446   1.00 52.97  ? 226 GLN C CG    1 
ATOM   6587  C  CD    . GLN C  1 85  ? 70.311  -12.910 5.040   1.00 54.18  ? 226 GLN C CD    1 
ATOM   6588  O  OE1   . GLN C  1 85  ? 69.814  -13.974 4.676   1.00 56.65  ? 226 GLN C OE1   1 
ATOM   6589  N  NE2   . GLN C  1 85  ? 71.621  -12.716 5.100   1.00 51.51  ? 226 GLN C NE2   1 
ATOM   6590  N  N     . GLU C  1 86  ? 67.491  -8.554  5.700   1.00 35.13  ? 227 GLU C N     1 
ATOM   6591  C  CA    . GLU C  1 86  ? 67.638  -7.276  5.017   1.00 32.94  ? 227 GLU C CA    1 
ATOM   6592  C  C     . GLU C  1 86  ? 68.803  -7.275  4.032   1.00 35.38  ? 227 GLU C C     1 
ATOM   6593  O  O     . GLU C  1 86  ? 69.870  -7.811  4.315   1.00 40.05  ? 227 GLU C O     1 
ATOM   6594  C  CB    . GLU C  1 86  ? 67.800  -6.148  6.034   1.00 33.58  ? 227 GLU C CB    1 
ATOM   6595  C  CG    . GLU C  1 86  ? 67.725  -4.751  5.428   1.00 35.30  ? 227 GLU C CG    1 
ATOM   6596  C  CD    . GLU C  1 86  ? 67.694  -3.674  6.486   1.00 35.60  ? 227 GLU C CD    1 
ATOM   6597  O  OE1   . GLU C  1 86  ? 67.613  -4.022  7.680   1.00 35.39  ? 227 GLU C OE1   1 
ATOM   6598  O  OE2   . GLU C  1 86  ? 67.744  -2.483  6.126   1.00 39.64  ? 227 GLU C OE2   1 
ATOM   6599  N  N     . TYR C  1 87  ? 68.576  -6.695  2.861   1.00 42.24  ? 228 TYR C N     1 
ATOM   6600  C  CA    . TYR C  1 87  ? 69.633  -6.502  1.882   1.00 47.10  ? 228 TYR C CA    1 
ATOM   6601  C  C     . TYR C  1 87  ? 70.407  -5.251  2.270   1.00 50.52  ? 228 TYR C C     1 
ATOM   6602  O  O     . TYR C  1 87  ? 69.891  -4.141  2.145   1.00 48.17  ? 228 TYR C O     1 
ATOM   6603  C  CB    . TYR C  1 87  ? 69.027  -6.345  0.492   1.00 47.50  ? 228 TYR C CB    1 
ATOM   6604  C  CG    . TYR C  1 87  ? 70.034  -6.395  -0.624  1.00 50.62  ? 228 TYR C CG    1 
ATOM   6605  C  CD1   . TYR C  1 87  ? 70.747  -7.554  -0.888  1.00 51.87  ? 228 TYR C CD1   1 
ATOM   6606  C  CD2   . TYR C  1 87  ? 70.261  -5.289  -1.426  1.00 52.16  ? 228 TYR C CD2   1 
ATOM   6607  C  CE1   . TYR C  1 87  ? 71.666  -7.607  -1.911  1.00 53.56  ? 228 TYR C CE1   1 
ATOM   6608  C  CE2   . TYR C  1 87  ? 71.176  -5.333  -2.455  1.00 54.88  ? 228 TYR C CE2   1 
ATOM   6609  C  CZ    . TYR C  1 87  ? 71.876  -6.496  -2.692  1.00 55.55  ? 228 TYR C CZ    1 
ATOM   6610  O  OH    . TYR C  1 87  ? 72.794  -6.546  -3.716  1.00 56.18  ? 228 TYR C OH    1 
ATOM   6611  N  N     . TYR C  1 88  ? 71.650  -5.456  2.709   1.00 55.75  ? 229 TYR C N     1 
ATOM   6612  C  CA    . TYR C  1 88  ? 72.450  -4.471  3.456   1.00 63.13  ? 229 TYR C CA    1 
ATOM   6613  C  C     . TYR C  1 88  ? 71.855  -3.083  3.692   1.00 64.22  ? 229 TYR C C     1 
ATOM   6614  O  O     . TYR C  1 88  ? 71.961  -2.204  2.837   1.00 66.20  ? 229 TYR C O     1 
ATOM   6615  C  CB    . TYR C  1 88  ? 73.867  -4.316  2.884   1.00 68.81  ? 229 TYR C CB    1 
ATOM   6616  C  CG    . TYR C  1 88  ? 74.272  -5.287  1.800   1.00 72.34  ? 229 TYR C CG    1 
ATOM   6617  C  CD1   . TYR C  1 88  ? 74.866  -6.500  2.111   1.00 73.56  ? 229 TYR C CD1   1 
ATOM   6618  C  CD2   . TYR C  1 88  ? 74.104  -4.966  0.463   1.00 72.69  ? 229 TYR C CD2   1 
ATOM   6619  C  CE1   . TYR C  1 88  ? 75.253  -7.376  1.122   1.00 74.49  ? 229 TYR C CE1   1 
ATOM   6620  C  CE2   . TYR C  1 88  ? 74.489  -5.834  -0.529  1.00 73.14  ? 229 TYR C CE2   1 
ATOM   6621  C  CZ    . TYR C  1 88  ? 75.063  -7.038  -0.195  1.00 74.64  ? 229 TYR C CZ    1 
ATOM   6622  O  OH    . TYR C  1 88  ? 75.449  -7.909  -1.187  1.00 77.22  ? 229 TYR C OH    1 
ATOM   6623  N  N     . GLU C  1 89  ? 71.229  -2.907  4.853   1.00 63.16  ? 230 GLU C N     1 
ATOM   6624  C  CA    . GLU C  1 89  ? 70.824  -1.590  5.348   1.00 63.76  ? 230 GLU C CA    1 
ATOM   6625  C  C     . GLU C  1 89  ? 70.049  -0.718  4.354   1.00 57.19  ? 230 GLU C C     1 
ATOM   6626  O  O     . GLU C  1 89  ? 70.020  0.505   4.489   1.00 57.03  ? 230 GLU C O     1 
ATOM   6627  C  CB    . GLU C  1 89  ? 72.052  -0.826  5.850   1.00 68.32  ? 230 GLU C CB    1 
ATOM   6628  C  CG    . GLU C  1 89  ? 72.851  -1.552  6.924   1.00 72.19  ? 230 GLU C CG    1 
ATOM   6629  C  CD    . GLU C  1 89  ? 73.900  -0.661  7.563   1.00 74.81  ? 230 GLU C CD    1 
ATOM   6630  O  OE1   . GLU C  1 89  ? 74.611  -1.126  8.479   1.00 72.98  ? 230 GLU C OE1   1 
ATOM   6631  O  OE2   . GLU C  1 89  ? 74.013  0.513   7.149   1.00 78.03  ? 230 GLU C OE2   1 
ATOM   6632  N  N     . THR C  1 90  ? 69.434  -1.345  3.358   1.00 52.50  ? 231 THR C N     1 
ATOM   6633  C  CA    . THR C  1 90  ? 68.620  -0.618  2.393   1.00 50.98  ? 231 THR C CA    1 
ATOM   6634  C  C     . THR C  1 90  ? 67.283  -0.234  3.012   1.00 46.39  ? 231 THR C C     1 
ATOM   6635  O  O     . THR C  1 90  ? 66.736  0.833   2.727   1.00 45.58  ? 231 THR C O     1 
ATOM   6636  C  CB    . THR C  1 90  ? 68.372  -1.444  1.117   1.00 53.08  ? 231 THR C CB    1 
ATOM   6637  O  OG1   . THR C  1 90  ? 68.124  -2.811  1.469   1.00 55.34  ? 231 THR C OG1   1 
ATOM   6638  C  CG2   . THR C  1 90  ? 69.580  -1.386  0.200   1.00 54.04  ? 231 THR C CG2   1 
ATOM   6639  N  N     . GLY C  1 91  ? 66.763  -1.112  3.863   1.00 43.11  ? 232 GLY C N     1 
ATOM   6640  C  CA    . GLY C  1 91  ? 65.489  -0.881  4.516   1.00 40.59  ? 232 GLY C CA    1 
ATOM   6641  C  C     . GLY C  1 91  ? 64.331  -1.429  3.708   1.00 36.29  ? 232 GLY C C     1 
ATOM   6642  O  O     . GLY C  1 91  ? 63.372  -1.959  4.264   1.00 33.58  ? 232 GLY C O     1 
ATOM   6643  N  N     . ALA C  1 92  ? 64.430  -1.310  2.388   1.00 32.13  ? 233 ALA C N     1 
ATOM   6644  C  CA    . ALA C  1 92  ? 63.341  -1.692  1.501   1.00 31.24  ? 233 ALA C CA    1 
ATOM   6645  C  C     . ALA C  1 92  ? 63.546  -3.060  0.862   1.00 36.30  ? 233 ALA C C     1 
ATOM   6646  O  O     . ALA C  1 92  ? 62.576  -3.713  0.478   1.00 38.81  ? 233 ALA C O     1 
ATOM   6647  C  CB    . ALA C  1 92  ? 63.150  -0.641  0.430   1.00 30.06  ? 233 ALA C CB    1 
ATOM   6648  N  N     . PHE C  1 93  ? 64.798  -3.491  0.732   1.00 36.50  ? 234 PHE C N     1 
ATOM   6649  C  CA    . PHE C  1 93  ? 65.081  -4.734  0.020   1.00 35.19  ? 234 PHE C CA    1 
ATOM   6650  C  C     . PHE C  1 93  ? 65.457  -5.879  0.947   1.00 33.79  ? 234 PHE C C     1 
ATOM   6651  O  O     . PHE C  1 93  ? 66.166  -5.687  1.935   1.00 33.45  ? 234 PHE C O     1 
ATOM   6652  C  CB    . PHE C  1 93  ? 66.157  -4.503  -1.033  1.00 38.68  ? 234 PHE C CB    1 
ATOM   6653  C  CG    . PHE C  1 93  ? 65.835  -3.383  -1.963  1.00 36.73  ? 234 PHE C CG    1 
ATOM   6654  C  CD1   . PHE C  1 93  ? 64.845  -3.528  -2.921  1.00 35.42  ? 234 PHE C CD1   1 
ATOM   6655  C  CD2   . PHE C  1 93  ? 66.505  -2.175  -1.870  1.00 36.47  ? 234 PHE C CD2   1 
ATOM   6656  C  CE1   . PHE C  1 93  ? 64.532  -2.488  -3.773  1.00 34.41  ? 234 PHE C CE1   1 
ATOM   6657  C  CE2   . PHE C  1 93  ? 66.199  -1.134  -2.723  1.00 34.92  ? 234 PHE C CE2   1 
ATOM   6658  C  CZ    . PHE C  1 93  ? 65.212  -1.291  -3.672  1.00 33.30  ? 234 PHE C CZ    1 
ATOM   6659  N  N     . TYR C  1 94  ? 64.970  -7.072  0.622   1.00 31.23  ? 235 TYR C N     1 
ATOM   6660  C  CA    . TYR C  1 94  ? 65.118  -8.210  1.516   1.00 32.66  ? 235 TYR C CA    1 
ATOM   6661  C  C     . TYR C  1 94  ? 65.342  -9.516  0.764   1.00 36.67  ? 235 TYR C C     1 
ATOM   6662  O  O     . TYR C  1 94  ? 65.058  -9.617  -0.426  1.00 37.87  ? 235 TYR C O     1 
ATOM   6663  C  CB    . TYR C  1 94  ? 63.875  -8.345  2.403   1.00 33.95  ? 235 TYR C CB    1 
ATOM   6664  C  CG    . TYR C  1 94  ? 63.670  -7.205  3.375   1.00 33.62  ? 235 TYR C CG    1 
ATOM   6665  C  CD1   . TYR C  1 94  ? 64.160  -7.275  4.669   1.00 35.86  ? 235 TYR C CD1   1 
ATOM   6666  C  CD2   . TYR C  1 94  ? 62.977  -6.065  3.003   1.00 32.13  ? 235 TYR C CD2   1 
ATOM   6667  C  CE1   . TYR C  1 94  ? 63.976  -6.238  5.559   1.00 35.63  ? 235 TYR C CE1   1 
ATOM   6668  C  CE2   . TYR C  1 94  ? 62.789  -5.024  3.888   1.00 31.70  ? 235 TYR C CE2   1 
ATOM   6669  C  CZ    . TYR C  1 94  ? 63.292  -5.117  5.163   1.00 32.15  ? 235 TYR C CZ    1 
ATOM   6670  O  OH    . TYR C  1 94  ? 63.107  -4.085  6.048   1.00 34.26  ? 235 TYR C OH    1 
ATOM   6671  N  N     . LEU C  1 95  ? 65.866  -10.507 1.476   1.00 40.76  ? 236 LEU C N     1 
ATOM   6672  C  CA    . LEU C  1 95  ? 65.904  -11.883 1.012   1.00 40.07  ? 236 LEU C CA    1 
ATOM   6673  C  C     . LEU C  1 95  ? 64.901  -12.625 1.867   1.00 40.64  ? 236 LEU C C     1 
ATOM   6674  O  O     . LEU C  1 95  ? 64.783  -12.349 3.066   1.00 40.90  ? 236 LEU C O     1 
ATOM   6675  C  CB    . LEU C  1 95  ? 67.287  -12.490 1.216   1.00 38.75  ? 236 LEU C CB    1 
ATOM   6676  C  CG    . LEU C  1 95  ? 68.289  -12.390 0.071   1.00 42.62  ? 236 LEU C CG    1 
ATOM   6677  C  CD1   . LEU C  1 95  ? 68.536  -10.950 -0.323  1.00 45.60  ? 236 LEU C CD1   1 
ATOM   6678  C  CD2   . LEU C  1 95  ? 69.589  -13.046 0.469   1.00 44.84  ? 236 LEU C CD2   1 
ATOM   6679  N  N     . VAL C  1 96  ? 64.173  -13.557 1.262   1.00 42.64  ? 237 VAL C N     1 
ATOM   6680  C  CA    . VAL C  1 96  ? 63.170  -14.315 2.000   1.00 46.53  ? 237 VAL C CA    1 
ATOM   6681  C  C     . VAL C  1 96  ? 63.594  -15.761 2.227   1.00 50.09  ? 237 VAL C C     1 
ATOM   6682  O  O     . VAL C  1 96  ? 63.670  -16.555 1.287   1.00 50.76  ? 237 VAL C O     1 
ATOM   6683  C  CB    . VAL C  1 96  ? 61.814  -14.290 1.292   1.00 43.94  ? 237 VAL C CB    1 
ATOM   6684  C  CG1   . VAL C  1 96  ? 60.763  -14.961 2.149   1.00 40.03  ? 237 VAL C CG1   1 
ATOM   6685  C  CG2   . VAL C  1 96  ? 61.413  -12.862 1.008   1.00 45.41  ? 237 VAL C CG2   1 
ATOM   6686  N  N     . LYS C  1 97  ? 63.865  -16.106 3.480   1.00 53.97  ? 238 LYS C N     1 
ATOM   6687  C  CA    . LYS C  1 97  ? 64.209  -17.479 3.817   1.00 56.64  ? 238 LYS C CA    1 
ATOM   6688  C  C     . LYS C  1 97  ? 63.032  -18.083 4.569   1.00 62.04  ? 238 LYS C C     1 
ATOM   6689  O  O     . LYS C  1 97  ? 62.070  -17.389 4.890   1.00 60.75  ? 238 LYS C O     1 
ATOM   6690  C  CB    . LYS C  1 97  ? 65.472  -17.503 4.675   1.00 51.00  ? 238 LYS C CB    1 
ATOM   6691  C  CG    . LYS C  1 97  ? 66.463  -16.430 4.265   1.00 48.51  ? 238 LYS C CG    1 
ATOM   6692  C  CD    . LYS C  1 97  ? 67.570  -16.247 5.273   1.00 50.79  ? 238 LYS C CD    1 
ATOM   6693  C  CE    . LYS C  1 97  ? 68.441  -17.481 5.385   1.00 53.28  ? 238 LYS C CE    1 
ATOM   6694  N  NZ    . LYS C  1 97  ? 69.714  -17.198 6.112   1.00 55.55  ? 238 LYS C NZ    1 
ATOM   6695  N  N     . PHE C  1 98  ? 63.101  -19.374 4.854   1.00 68.92  ? 239 PHE C N     1 
ATOM   6696  C  CA    . PHE C  1 98  ? 62.052  -20.001 5.640   1.00 76.70  ? 239 PHE C CA    1 
ATOM   6697  C  C     . PHE C  1 98  ? 62.593  -20.511 6.973   1.00 86.62  ? 239 PHE C C     1 
ATOM   6698  O  O     . PHE C  1 98  ? 63.703  -21.045 7.032   1.00 89.01  ? 239 PHE C O     1 
ATOM   6699  C  CB    . PHE C  1 98  ? 61.379  -21.112 4.848   1.00 73.47  ? 239 PHE C CB    1 
ATOM   6700  C  CG    . PHE C  1 98  ? 60.370  -20.611 3.847   1.00 69.37  ? 239 PHE C CG    1 
ATOM   6701  C  CD1   . PHE C  1 98  ? 59.397  -19.697 4.219   1.00 67.35  ? 239 PHE C CD1   1 
ATOM   6702  C  CD2   . PHE C  1 98  ? 60.394  -21.052 2.534   1.00 69.39  ? 239 PHE C CD2   1 
ATOM   6703  C  CE1   . PHE C  1 98  ? 58.466  -19.240 3.300   1.00 66.15  ? 239 PHE C CE1   1 
ATOM   6704  C  CE2   . PHE C  1 98  ? 59.462  -20.604 1.612   1.00 66.04  ? 239 PHE C CE2   1 
ATOM   6705  C  CZ    . PHE C  1 98  ? 58.501  -19.693 1.996   1.00 64.28  ? 239 PHE C CZ    1 
ATOM   6706  N  N     . LYS C  1 99  ? 61.822  -20.309 8.043   1.00 92.70  ? 240 LYS C N     1 
ATOM   6707  C  CA    . LYS C  1 99  ? 62.172  -20.822 9.369   1.00 99.95  ? 240 LYS C CA    1 
ATOM   6708  C  C     . LYS C  1 99  ? 62.364  -22.328 9.306   1.00 106.58 ? 240 LYS C C     1 
ATOM   6709  O  O     . LYS C  1 99  ? 63.454  -22.821 9.017   1.00 106.94 ? 240 LYS C O     1 
ATOM   6710  C  CB    . LYS C  1 99  ? 61.063  -20.501 10.370  1.00 100.20 ? 240 LYS C CB    1 
ATOM   6711  C  CG    . LYS C  1 99  ? 60.916  -19.032 10.709  1.00 100.30 ? 240 LYS C CG    1 
ATOM   6712  C  CD    . LYS C  1 99  ? 59.802  -18.824 11.719  1.00 100.47 ? 240 LYS C CD    1 
ATOM   6713  C  CE    . LYS C  1 99  ? 60.007  -17.549 12.514  1.00 100.79 ? 240 LYS C CE    1 
ATOM   6714  N  NZ    . LYS C  1 99  ? 59.041  -17.479 13.641  1.00 101.17 ? 240 LYS C NZ    1 
ATOM   6715  N  N     . ARG C  1 100 ? 61.298  -23.058 9.599   1.00 112.28 ? 241 ARG C N     1 
ATOM   6716  C  CA    . ARG C  1 100 ? 61.279  -24.480 9.318   1.00 118.59 ? 241 ARG C CA    1 
ATOM   6717  C  C     . ARG C  1 100 ? 60.486  -24.659 8.036   1.00 119.35 ? 241 ARG C C     1 
ATOM   6718  O  O     . ARG C  1 100 ? 59.288  -24.386 8.009   1.00 117.14 ? 241 ARG C O     1 
ATOM   6719  C  CB    . ARG C  1 100 ? 60.632  -25.253 10.466  1.00 123.36 ? 241 ARG C CB    1 
ATOM   6720  C  CG    . ARG C  1 100 ? 61.341  -25.057 11.796  1.00 126.69 ? 241 ARG C CG    1 
ATOM   6721  C  CD    . ARG C  1 100 ? 60.640  -25.793 12.922  1.00 129.48 ? 241 ARG C CD    1 
ATOM   6722  N  NE    . ARG C  1 100 ? 61.278  -25.531 14.208  1.00 132.68 ? 241 ARG C NE    1 
ATOM   6723  C  CZ    . ARG C  1 100 ? 60.831  -25.986 15.375  1.00 135.37 ? 241 ARG C CZ    1 
ATOM   6724  N  NH1   . ARG C  1 100 ? 59.736  -26.731 15.425  1.00 136.55 ? 241 ARG C NH1   1 
ATOM   6725  N  NH2   . ARG C  1 100 ? 61.481  -25.695 16.494  1.00 135.53 ? 241 ARG C NH2   1 
ATOM   6726  N  N     . ILE C  1 101 ? 61.164  -25.079 6.971   1.00 122.66 ? 242 ILE C N     1 
ATOM   6727  C  CA    . ILE C  1 101 ? 60.514  -25.300 5.681   1.00 125.22 ? 242 ILE C CA    1 
ATOM   6728  C  C     . ILE C  1 101 ? 59.434  -26.382 5.809   1.00 127.55 ? 242 ILE C C     1 
ATOM   6729  O  O     . ILE C  1 101 ? 59.746  -27.573 5.851   1.00 128.73 ? 242 ILE C O     1 
ATOM   6730  C  CB    . ILE C  1 101 ? 61.556  -25.613 4.569   1.00 96.10  ? 242 ILE C CB    1 
ATOM   6731  C  CG1   . ILE C  1 101 ? 60.873  -26.073 3.278   1.00 96.77  ? 242 ILE C CG1   1 
ATOM   6732  C  CG2   . ILE C  1 101 ? 62.589  -26.627 5.048   1.00 96.07  ? 242 ILE C CG2   1 
ATOM   6733  C  CD1   . ILE C  1 101 ? 61.851  -26.536 2.214   1.00 97.35  ? 242 ILE C CD1   1 
ATOM   6734  N  N     . PRO C  1 102 ? 58.157  -25.950 5.869   1.00 127.54 ? 243 PRO C N     1 
ATOM   6735  C  CA    . PRO C  1 102 ? 56.984  -26.718 6.320   1.00 128.03 ? 243 PRO C CA    1 
ATOM   6736  C  C     . PRO C  1 102 ? 56.832  -28.084 5.659   1.00 129.33 ? 243 PRO C C     1 
ATOM   6737  O  O     . PRO C  1 102 ? 57.534  -29.028 6.024   1.00 130.00 ? 243 PRO C O     1 
ATOM   6738  C  CB    . PRO C  1 102 ? 55.806  -25.816 5.933   1.00 126.56 ? 243 PRO C CB    1 
ATOM   6739  C  CG    . PRO C  1 102 ? 56.381  -24.452 5.865   1.00 126.06 ? 243 PRO C CG    1 
ATOM   6740  C  CD    . PRO C  1 102 ? 57.767  -24.634 5.334   1.00 126.25 ? 243 PRO C CD    1 
ATOM   6741  N  N     . ARG C  1 103 ? 55.907  -28.194 4.712   1.00 129.79 ? 244 ARG C N     1 
ATOM   6742  C  CA    . ARG C  1 103 ? 55.759  -29.425 3.946   1.00 131.11 ? 244 ARG C CA    1 
ATOM   6743  C  C     . ARG C  1 103 ? 56.888  -29.504 2.935   1.00 130.17 ? 244 ARG C C     1 
ATOM   6744  O  O     . ARG C  1 103 ? 57.955  -28.915 3.125   1.00 129.78 ? 244 ARG C O     1 
ATOM   6745  C  CB    . ARG C  1 103 ? 54.426  -29.439 3.194   1.00 132.26 ? 244 ARG C CB    1 
ATOM   6746  C  CG    . ARG C  1 103 ? 53.196  -29.587 4.070   1.00 133.32 ? 244 ARG C CG    1 
ATOM   6747  C  CD    . ARG C  1 103 ? 51.990  -30.047 3.256   1.00 134.82 ? 244 ARG C CD    1 
ATOM   6748  N  NE    . ARG C  1 103 ? 51.094  -28.950 2.899   1.00 135.61 ? 244 ARG C NE    1 
ATOM   6749  C  CZ    . ARG C  1 103 ? 50.002  -29.092 2.152   1.00 135.50 ? 244 ARG C CZ    1 
ATOM   6750  N  NH1   . ARG C  1 103 ? 49.673  -30.286 1.676   1.00 135.78 ? 244 ARG C NH1   1 
ATOM   6751  N  NH2   . ARG C  1 103 ? 49.240  -28.041 1.877   1.00 134.60 ? 244 ARG C NH2   1 
ATOM   6752  N  N     . GLY C  1 104 ? 56.651  -30.236 1.854   1.00 129.09 ? 245 GLY C N     1 
ATOM   6753  C  CA    . GLY C  1 104 ? 57.446  -30.037 0.664   1.00 127.14 ? 245 GLY C CA    1 
ATOM   6754  C  C     . GLY C  1 104 ? 57.190  -28.589 0.301   1.00 124.52 ? 245 GLY C C     1 
ATOM   6755  O  O     . GLY C  1 104 ? 58.104  -27.859 -0.079  1.00 126.25 ? 245 GLY C O     1 
ATOM   6756  N  N     . ASN C  1 105 ? 55.929  -28.186 0.456   1.00 119.06 ? 246 ASN C N     1 
ATOM   6757  C  CA    . ASN C  1 105 ? 55.455  -26.819 0.220   1.00 112.56 ? 246 ASN C CA    1 
ATOM   6758  C  C     . ASN C  1 105 ? 55.529  -26.394 -1.247  1.00 104.59 ? 246 ASN C C     1 
ATOM   6759  O  O     . ASN C  1 105 ? 56.550  -26.588 -1.901  1.00 106.17 ? 246 ASN C O     1 
ATOM   6760  C  CB    . ASN C  1 105 ? 56.087  -25.808 1.208   1.00 112.94 ? 246 ASN C CB    1 
ATOM   6761  C  CG    . ASN C  1 105 ? 57.216  -24.987 0.603   1.00 112.96 ? 246 ASN C CG    1 
ATOM   6762  O  OD1   . ASN C  1 105 ? 57.205  -23.757 0.677   1.00 112.97 ? 246 ASN C OD1   1 
ATOM   6763  N  ND2   . ASN C  1 105 ? 58.208  -25.658 0.037   1.00 113.27 ? 246 ASN C ND2   1 
ATOM   6764  N  N     . PRO C  1 106 ? 54.422  -25.840 -1.775  1.00 95.09  ? 247 PRO C N     1 
ATOM   6765  C  CA    . PRO C  1 106 ? 54.307  -25.499 -3.199  1.00 88.89  ? 247 PRO C CA    1 
ATOM   6766  C  C     . PRO C  1 106 ? 55.480  -24.653 -3.672  1.00 82.57  ? 247 PRO C C     1 
ATOM   6767  O  O     . PRO C  1 106 ? 55.821  -24.679 -4.855  1.00 82.11  ? 247 PRO C O     1 
ATOM   6768  C  CB    . PRO C  1 106 ? 53.018  -24.680 -3.257  1.00 89.49  ? 247 PRO C CB    1 
ATOM   6769  C  CG    . PRO C  1 106 ? 52.209  -25.179 -2.121  1.00 91.33  ? 247 PRO C CG    1 
ATOM   6770  C  CD    . PRO C  1 106 ? 53.189  -25.522 -1.032  1.00 92.92  ? 247 PRO C CD    1 
ATOM   6771  N  N     . LEU C  1 107 ? 56.098  -23.932 -2.742  1.00 76.27  ? 248 LEU C N     1 
ATOM   6772  C  CA    . LEU C  1 107 ? 57.245  -23.089 -3.040  1.00 68.43  ? 248 LEU C CA    1 
ATOM   6773  C  C     . LEU C  1 107 ? 58.578  -23.843 -2.914  1.00 65.42  ? 248 LEU C C     1 
ATOM   6774  O  O     . LEU C  1 107 ? 59.626  -23.217 -2.782  1.00 64.12  ? 248 LEU C O     1 
ATOM   6775  C  CB    . LEU C  1 107 ? 57.230  -21.855 -2.131  1.00 63.32  ? 248 LEU C CB    1 
ATOM   6776  C  CG    . LEU C  1 107 ? 55.886  -21.128 -2.046  1.00 60.08  ? 248 LEU C CG    1 
ATOM   6777  C  CD1   . LEU C  1 107 ? 55.930  -19.949 -1.081  1.00 61.22  ? 248 LEU C CD1   1 
ATOM   6778  C  CD2   . LEU C  1 107 ? 55.444  -20.675 -3.421  1.00 58.24  ? 248 LEU C CD2   1 
ATOM   6779  N  N     . SER C  1 108 ? 58.533  -25.177 -2.967  1.00 64.69  ? 249 SER C N     1 
ATOM   6780  C  CA    . SER C  1 108 ? 59.738  -26.009 -2.908  1.00 66.65  ? 249 SER C CA    1 
ATOM   6781  C  C     . SER C  1 108 ? 60.711  -25.634 -4.011  1.00 69.75  ? 249 SER C C     1 
ATOM   6782  O  O     . SER C  1 108 ? 61.818  -25.168 -3.745  1.00 73.11  ? 249 SER C O     1 
ATOM   6783  C  CB    . SER C  1 108 ? 59.389  -27.485 -3.087  1.00 67.70  ? 249 SER C CB    1 
ATOM   6784  O  OG    . SER C  1 108 ? 58.295  -27.867 -2.287  1.00 67.45  ? 249 SER C OG    1 
ATOM   6785  N  N     . HIS C  1 109 ? 60.282  -25.839 -5.254  1.00 69.14  ? 250 HIS C N     1 
ATOM   6786  C  CA    . HIS C  1 109 ? 61.140  -25.623 -6.415  1.00 71.44  ? 250 HIS C CA    1 
ATOM   6787  C  C     . HIS C  1 109 ? 61.556  -24.168 -6.627  1.00 65.94  ? 250 HIS C C     1 
ATOM   6788  O  O     . HIS C  1 109 ? 62.409  -23.881 -7.469  1.00 68.03  ? 250 HIS C O     1 
ATOM   6789  C  CB    . HIS C  1 109 ? 60.504  -26.201 -7.690  1.00 78.76  ? 250 HIS C CB    1 
ATOM   6790  C  CG    . HIS C  1 109 ? 59.018  -25.992 -7.790  1.00 85.93  ? 250 HIS C CG    1 
ATOM   6791  N  ND1   . HIS C  1 109 ? 58.438  -24.746 -7.746  1.00 89.13  ? 250 HIS C ND1   1 
ATOM   6792  C  CD2   . HIS C  1 109 ? 58.007  -26.880 -7.946  1.00 88.63  ? 250 HIS C CD2   1 
ATOM   6793  C  CE1   . HIS C  1 109 ? 57.122  -24.873 -7.869  1.00 90.44  ? 250 HIS C CE1   1 
ATOM   6794  N  NE2   . HIS C  1 109 ? 56.839  -26.154 -7.989  1.00 90.40  ? 250 HIS C NE2   1 
ATOM   6795  N  N     . PHE C  1 110 ? 60.965  -23.259 -5.857  1.00 56.22  ? 251 PHE C N     1 
ATOM   6796  C  CA    . PHE C  1 110 ? 61.321  -21.850 -5.931  1.00 47.29  ? 251 PHE C CA    1 
ATOM   6797  C  C     . PHE C  1 110 ? 62.398  -21.522 -4.906  1.00 44.18  ? 251 PHE C C     1 
ATOM   6798  O  O     . PHE C  1 110 ? 62.889  -20.398 -4.846  1.00 43.37  ? 251 PHE C O     1 
ATOM   6799  C  CB    . PHE C  1 110 ? 60.086  -20.978 -5.702  1.00 42.42  ? 251 PHE C CB    1 
ATOM   6800  C  CG    . PHE C  1 110 ? 59.006  -21.176 -6.727  1.00 37.73  ? 251 PHE C CG    1 
ATOM   6801  C  CD1   . PHE C  1 110 ? 59.325  -21.479 -8.045  1.00 35.71  ? 251 PHE C CD1   1 
ATOM   6802  C  CD2   . PHE C  1 110 ? 57.671  -21.060 -6.375  1.00 35.03  ? 251 PHE C CD2   1 
ATOM   6803  C  CE1   . PHE C  1 110 ? 58.330  -21.663 -8.991  1.00 29.82  ? 251 PHE C CE1   1 
ATOM   6804  C  CE2   . PHE C  1 110 ? 56.674  -21.241 -7.315  1.00 33.09  ? 251 PHE C CE2   1 
ATOM   6805  C  CZ    . PHE C  1 110 ? 57.005  -21.542 -8.625  1.00 29.79  ? 251 PHE C CZ    1 
ATOM   6806  N  N     . LEU C  1 111 ? 62.763  -22.515 -4.102  1.00 47.38  ? 252 LEU C N     1 
ATOM   6807  C  CA    . LEU C  1 111 ? 63.758  -22.325 -3.054  1.00 54.39  ? 252 LEU C CA    1 
ATOM   6808  C  C     . LEU C  1 111 ? 65.171  -22.620 -3.536  1.00 59.55  ? 252 LEU C C     1 
ATOM   6809  O  O     . LEU C  1 111 ? 65.404  -23.610 -4.230  1.00 62.51  ? 252 LEU C O     1 
ATOM   6810  C  CB    . LEU C  1 111 ? 63.437  -23.210 -1.852  1.00 58.98  ? 252 LEU C CB    1 
ATOM   6811  C  CG    . LEU C  1 111 ? 62.183  -22.802 -1.084  1.00 63.32  ? 252 LEU C CG    1 
ATOM   6812  C  CD1   . LEU C  1 111 ? 61.626  -23.959 -0.278  1.00 64.72  ? 252 LEU C CD1   1 
ATOM   6813  C  CD2   . LEU C  1 111 ? 62.478  -21.617 -0.185  1.00 64.99  ? 252 LEU C CD2   1 
ATOM   6814  N  N     . GLU C  1 112 ? 66.110  -21.755 -3.170  1.00 62.05  ? 253 GLU C N     1 
ATOM   6815  C  CA    . GLU C  1 112 ? 67.517  -22.006 -3.438  1.00 64.21  ? 253 GLU C CA    1 
ATOM   6816  C  C     . GLU C  1 112 ? 68.182  -22.359 -2.113  1.00 67.87  ? 253 GLU C C     1 
ATOM   6817  O  O     . GLU C  1 112 ? 68.953  -21.573 -1.555  1.00 68.52  ? 253 GLU C O     1 
ATOM   6818  C  CB    . GLU C  1 112 ? 68.173  -20.789 -4.098  1.00 62.75  ? 253 GLU C CB    1 
ATOM   6819  C  CG    . GLU C  1 112 ? 67.461  -20.329 -5.369  1.00 63.65  ? 253 GLU C CG    1 
ATOM   6820  C  CD    . GLU C  1 112 ? 68.372  -19.578 -6.319  1.00 67.19  ? 253 GLU C CD    1 
ATOM   6821  O  OE1   . GLU C  1 112 ? 69.602  -19.625 -6.124  1.00 69.32  ? 253 GLU C OE1   1 
ATOM   6822  O  OE2   . GLU C  1 112 ? 67.859  -18.944 -7.264  1.00 68.59  ? 253 GLU C OE2   1 
ATOM   6823  N  N     . GLY C  1 113 ? 67.854  -23.547 -1.611  1.00 69.31  ? 254 GLY C N     1 
ATOM   6824  C  CA    . GLY C  1 113 ? 68.325  -24.002 -0.316  1.00 69.65  ? 254 GLY C CA    1 
ATOM   6825  C  C     . GLY C  1 113 ? 67.394  -23.569 0.797   1.00 72.16  ? 254 GLY C C     1 
ATOM   6826  O  O     . GLY C  1 113 ? 66.526  -24.329 1.232   1.00 73.21  ? 254 GLY C O     1 
ATOM   6827  N  N     . GLU C  1 114 ? 67.582  -22.336 1.257   1.00 74.03  ? 255 GLU C N     1 
ATOM   6828  C  CA    . GLU C  1 114 ? 66.758  -21.760 2.311   1.00 73.40  ? 255 GLU C CA    1 
ATOM   6829  C  C     . GLU C  1 114 ? 66.076  -20.502 1.787   1.00 68.83  ? 255 GLU C C     1 
ATOM   6830  O  O     . GLU C  1 114 ? 64.983  -20.141 2.229   1.00 69.00  ? 255 GLU C O     1 
ATOM   6831  C  CB    . GLU C  1 114 ? 67.619  -21.433 3.535   1.00 79.16  ? 255 GLU C CB    1 
ATOM   6832  C  CG    . GLU C  1 114 ? 68.875  -20.634 3.200   1.00 84.33  ? 255 GLU C CG    1 
ATOM   6833  C  CD    . GLU C  1 114 ? 69.777  -20.401 4.399   1.00 90.09  ? 255 GLU C CD    1 
ATOM   6834  O  OE1   . GLU C  1 114 ? 69.454  -20.887 5.506   1.00 91.73  ? 255 GLU C OE1   1 
ATOM   6835  O  OE2   . GLU C  1 114 ? 70.814  -19.722 4.230   1.00 92.12  ? 255 GLU C OE2   1 
ATOM   6836  N  N     . VAL C  1 115 ? 66.729  -19.849 0.830   1.00 64.11  ? 256 VAL C N     1 
ATOM   6837  C  CA    . VAL C  1 115 ? 66.225  -18.614 0.242   1.00 59.13  ? 256 VAL C CA    1 
ATOM   6838  C  C     . VAL C  1 115 ? 65.230  -18.889 -0.892  1.00 58.56  ? 256 VAL C C     1 
ATOM   6839  O  O     . VAL C  1 115 ? 65.418  -19.812 -1.685  1.00 61.91  ? 256 VAL C O     1 
ATOM   6840  C  CB    . VAL C  1 115 ? 67.395  -17.723 -0.241  1.00 57.98  ? 256 VAL C CB    1 
ATOM   6841  C  CG1   . VAL C  1 115 ? 68.293  -18.489 -1.182  1.00 62.49  ? 256 VAL C CG1   1 
ATOM   6842  C  CG2   . VAL C  1 115 ? 66.893  -16.458 -0.901  1.00 56.92  ? 256 VAL C CG2   1 
ATOM   6843  N  N     . LEU C  1 116 ? 64.161  -18.096 -0.940  1.00 54.15  ? 257 LEU C N     1 
ATOM   6844  C  CA    . LEU C  1 116 ? 63.141  -18.216 -1.981  1.00 50.90  ? 257 LEU C CA    1 
ATOM   6845  C  C     . LEU C  1 116 ? 63.518  -17.379 -3.193  1.00 50.03  ? 257 LEU C C     1 
ATOM   6846  O  O     . LEU C  1 116 ? 63.696  -16.167 -3.085  1.00 51.20  ? 257 LEU C O     1 
ATOM   6847  C  CB    . LEU C  1 116 ? 61.788  -17.751 -1.442  1.00 49.72  ? 257 LEU C CB    1 
ATOM   6848  C  CG    . LEU C  1 116 ? 60.609  -17.636 -2.410  1.00 48.07  ? 257 LEU C CG    1 
ATOM   6849  C  CD1   . LEU C  1 116 ? 60.051  -18.995 -2.755  1.00 47.54  ? 257 LEU C CD1   1 
ATOM   6850  C  CD2   . LEU C  1 116 ? 59.518  -16.763 -1.824  1.00 47.32  ? 257 LEU C CD2   1 
ATOM   6851  N  N     . SER C  1 117 ? 63.640  -18.023 -4.349  1.00 48.92  ? 258 SER C N     1 
ATOM   6852  C  CA    . SER C  1 117 ? 63.994  -17.309 -5.571  1.00 45.12  ? 258 SER C CA    1 
ATOM   6853  C  C     . SER C  1 117 ? 62.809  -16.513 -6.101  1.00 42.70  ? 258 SER C C     1 
ATOM   6854  O  O     . SER C  1 117 ? 61.688  -17.014 -6.163  1.00 42.53  ? 258 SER C O     1 
ATOM   6855  C  CB    . SER C  1 117 ? 64.505  -18.273 -6.638  1.00 48.04  ? 258 SER C CB    1 
ATOM   6856  O  OG    . SER C  1 117 ? 65.040  -17.563 -7.742  1.00 52.27  ? 258 SER C OG    1 
ATOM   6857  N  N     . ALA C  1 118 ? 63.067  -15.265 -6.477  1.00 41.29  ? 259 ALA C N     1 
ATOM   6858  C  CA    . ALA C  1 118 ? 62.023  -14.375 -6.973  1.00 32.97  ? 259 ALA C CA    1 
ATOM   6859  C  C     . ALA C  1 118 ? 61.849  -14.523 -8.479  1.00 33.74  ? 259 ALA C C     1 
ATOM   6860  O  O     . ALA C  1 118 ? 60.728  -14.612 -8.980  1.00 33.39  ? 259 ALA C O     1 
ATOM   6861  C  CB    . ALA C  1 118 ? 62.342  -12.938 -6.607  1.00 28.29  ? 259 ALA C CB    1 
ATOM   6862  N  N     . THR C  1 119 ? 62.972  -14.543 -9.190  1.00 37.11  ? 260 THR C N     1 
ATOM   6863  C  CA    . THR C  1 119 ? 62.987  -14.684 -10.645 1.00 36.43  ? 260 THR C CA    1 
ATOM   6864  C  C     . THR C  1 119 ? 62.281  -15.958 -11.103 1.00 37.91  ? 260 THR C C     1 
ATOM   6865  O  O     . THR C  1 119 ? 61.571  -15.955 -12.107 1.00 38.47  ? 260 THR C O     1 
ATOM   6866  C  CB    . THR C  1 119 ? 64.428  -14.675 -11.182 1.00 33.20  ? 260 THR C CB    1 
ATOM   6867  O  OG1   . THR C  1 119 ? 65.022  -13.399 -10.922 1.00 36.39  ? 260 THR C OG1   1 
ATOM   6868  C  CG2   . THR C  1 119 ? 64.448  -14.923 -12.669 1.00 29.98  ? 260 THR C CG2   1 
ATOM   6869  N  N     . LYS C  1 120 ? 62.477  -17.041 -10.358 1.00 40.74  ? 261 LYS C N     1 
ATOM   6870  C  CA    . LYS C  1 120 ? 61.869  -18.327 -10.686 1.00 39.81  ? 261 LYS C CA    1 
ATOM   6871  C  C     . LYS C  1 120 ? 60.356  -18.338 -10.464 1.00 37.49  ? 261 LYS C C     1 
ATOM   6872  O  O     . LYS C  1 120 ? 59.592  -18.734 -11.351 1.00 44.26  ? 261 LYS C O     1 
ATOM   6873  C  CB    . LYS C  1 120 ? 62.543  -19.437 -9.877  1.00 40.51  ? 261 LYS C CB    1 
ATOM   6874  C  CG    . LYS C  1 120 ? 64.048  -19.502 -10.092 1.00 38.83  ? 261 LYS C CG    1 
ATOM   6875  C  CD    . LYS C  1 120 ? 64.682  -20.698 -9.391  1.00 38.50  ? 261 LYS C CD    1 
ATOM   6876  C  CE    . LYS C  1 120 ? 66.172  -20.755 -9.696  1.00 36.94  ? 261 LYS C CE    1 
ATOM   6877  N  NZ    . LYS C  1 120 ? 66.873  -21.859 -8.996  1.00 38.24  ? 261 LYS C NZ    1 
ATOM   6878  N  N     . MET C  1 121 ? 59.932  -17.906 -9.281  1.00 31.62  ? 262 MET C N     1 
ATOM   6879  C  CA    . MET C  1 121 ? 58.513  -17.828 -8.946  1.00 31.83  ? 262 MET C CA    1 
ATOM   6880  C  C     . MET C  1 121 ? 57.784  -16.921 -9.943  1.00 34.56  ? 262 MET C C     1 
ATOM   6881  O  O     . MET C  1 121 ? 56.697  -17.257 -10.430 1.00 39.22  ? 262 MET C O     1 
ATOM   6882  C  CB    . MET C  1 121 ? 58.344  -17.324 -7.508  1.00 32.20  ? 262 MET C CB    1 
ATOM   6883  C  CG    . MET C  1 121 ? 56.960  -17.540 -6.905  1.00 32.23  ? 262 MET C CG    1 
ATOM   6884  S  SD    . MET C  1 121 ? 56.913  -17.028 -5.175  1.00 37.46  ? 262 MET C SD    1 
ATOM   6885  C  CE    . MET C  1 121 ? 55.189  -17.317 -4.765  1.00 37.17  ? 262 MET C CE    1 
ATOM   6886  N  N     . LEU C  1 122 ? 58.408  -15.792 -10.272 1.00 36.19  ? 263 LEU C N     1 
ATOM   6887  C  CA    . LEU C  1 122 ? 57.849  -14.861 -11.251 1.00 37.31  ? 263 LEU C CA    1 
ATOM   6888  C  C     . LEU C  1 122 ? 57.836  -15.440 -12.667 1.00 38.64  ? 263 LEU C C     1 
ATOM   6889  O  O     . LEU C  1 122 ? 56.915  -15.176 -13.439 1.00 41.83  ? 263 LEU C O     1 
ATOM   6890  C  CB    . LEU C  1 122 ? 58.604  -13.528 -11.232 1.00 36.57  ? 263 LEU C CB    1 
ATOM   6891  C  CG    . LEU C  1 122 ? 57.994  -12.399 -12.062 1.00 34.76  ? 263 LEU C CG    1 
ATOM   6892  C  CD1   . LEU C  1 122 ? 56.593  -12.095 -11.575 1.00 32.89  ? 263 LEU C CD1   1 
ATOM   6893  C  CD2   . LEU C  1 122 ? 58.851  -11.154 -12.011 1.00 36.42  ? 263 LEU C CD2   1 
ATOM   6894  N  N     . SER C  1 123 ? 58.851  -16.228 -13.006 1.00 37.71  ? 264 SER C N     1 
ATOM   6895  C  CA    . SER C  1 123 ? 58.899  -16.877 -14.312 1.00 35.89  ? 264 SER C CA    1 
ATOM   6896  C  C     . SER C  1 123 ? 57.750  -17.858 -14.478 1.00 36.48  ? 264 SER C C     1 
ATOM   6897  O  O     . SER C  1 123 ? 57.103  -17.890 -15.527 1.00 37.88  ? 264 SER C O     1 
ATOM   6898  C  CB    . SER C  1 123 ? 60.234  -17.584 -14.522 1.00 36.83  ? 264 SER C CB    1 
ATOM   6899  O  OG    . SER C  1 123 ? 61.285  -16.647 -14.622 1.00 43.05  ? 264 SER C OG    1 
ATOM   6900  N  N     . LYS C  1 124 ? 57.493  -18.651 -13.441 1.00 37.49  ? 265 LYS C N     1 
ATOM   6901  C  CA    . LYS C  1 124 ? 56.361  -19.570 -13.467 1.00 35.24  ? 265 LYS C CA    1 
ATOM   6902  C  C     . LYS C  1 124 ? 55.017  -18.827 -13.539 1.00 36.21  ? 265 LYS C C     1 
ATOM   6903  O  O     . LYS C  1 124 ? 54.169  -19.156 -14.376 1.00 40.23  ? 265 LYS C O     1 
ATOM   6904  C  CB    . LYS C  1 124 ? 56.407  -20.506 -12.262 1.00 38.42  ? 265 LYS C CB    1 
ATOM   6905  C  CG    . LYS C  1 124 ? 55.447  -21.678 -12.354 1.00 44.36  ? 265 LYS C CG    1 
ATOM   6906  C  CD    . LYS C  1 124 ? 55.720  -22.518 -13.593 1.00 48.47  ? 265 LYS C CD    1 
ATOM   6907  C  CE    . LYS C  1 124 ? 54.915  -23.808 -13.587 1.00 53.62  ? 265 LYS C CE    1 
ATOM   6908  N  NZ    . LYS C  1 124 ? 55.217  -24.644 -12.395 1.00 56.80  ? 265 LYS C NZ    1 
ATOM   6909  N  N     . PHE C  1 125 ? 54.841  -17.833 -12.664 1.00 36.88  ? 266 PHE C N     1 
ATOM   6910  C  CA    . PHE C  1 125 ? 53.654  -16.964 -12.643 1.00 36.61  ? 266 PHE C CA    1 
ATOM   6911  C  C     . PHE C  1 125 ? 53.359  -16.464 -14.061 1.00 37.81  ? 266 PHE C C     1 
ATOM   6912  O  O     . PHE C  1 125 ? 52.242  -16.621 -14.596 1.00 41.45  ? 266 PHE C O     1 
ATOM   6913  C  CB    . PHE C  1 125 ? 53.950  -15.789 -11.696 1.00 33.58  ? 266 PHE C CB    1 
ATOM   6914  C  CG    . PHE C  1 125 ? 52.766  -14.889 -11.395 1.00 28.63  ? 266 PHE C CG    1 
ATOM   6915  C  CD1   . PHE C  1 125 ? 51.772  -15.286 -10.513 1.00 26.50  ? 266 PHE C CD1   1 
ATOM   6916  C  CD2   . PHE C  1 125 ? 52.695  -13.611 -11.937 1.00 26.60  ? 266 PHE C CD2   1 
ATOM   6917  C  CE1   . PHE C  1 125 ? 50.706  -14.444 -10.218 1.00 21.92  ? 266 PHE C CE1   1 
ATOM   6918  C  CE2   . PHE C  1 125 ? 51.636  -12.769 -11.648 1.00 21.55  ? 266 PHE C CE2   1 
ATOM   6919  C  CZ    . PHE C  1 125 ? 50.642  -13.187 -10.789 1.00 21.04  ? 266 PHE C CZ    1 
ATOM   6920  N  N     . ARG C  1 126 ? 54.401  -15.894 -14.664 1.00 32.53  ? 267 ARG C N     1 
ATOM   6921  C  CA    . ARG C  1 126 ? 54.364  -15.344 -16.013 1.00 28.72  ? 267 ARG C CA    1 
ATOM   6922  C  C     . ARG C  1 126 ? 53.975  -16.392 -17.050 1.00 27.47  ? 267 ARG C C     1 
ATOM   6923  O  O     . ARG C  1 126 ? 53.101  -16.154 -17.872 1.00 29.52  ? 267 ARG C O     1 
ATOM   6924  C  CB    . ARG C  1 126 ? 55.732  -14.745 -16.352 1.00 30.51  ? 267 ARG C CB    1 
ATOM   6925  C  CG    . ARG C  1 126 ? 55.814  -14.043 -17.696 1.00 28.32  ? 267 ARG C CG    1 
ATOM   6926  C  CD    . ARG C  1 126 ? 57.080  -13.194 -17.807 1.00 23.10  ? 267 ARG C CD    1 
ATOM   6927  N  NE    . ARG C  1 126 ? 57.076  -12.409 -19.037 1.00 26.20  ? 267 ARG C NE    1 
ATOM   6928  C  CZ    . ARG C  1 126 ? 56.763  -11.118 -19.107 1.00 32.73  ? 267 ARG C CZ    1 
ATOM   6929  N  NH1   . ARG C  1 126 ? 56.443  -10.442 -18.011 1.00 33.61  ? 267 ARG C NH1   1 
ATOM   6930  N  NH2   . ARG C  1 126 ? 56.779  -10.498 -20.279 1.00 37.42  ? 267 ARG C NH2   1 
ATOM   6931  N  N     . LYS C  1 127 ? 54.629  -17.548 -17.003 1.00 29.08  ? 268 LYS C N     1 
ATOM   6932  C  CA    . LYS C  1 127 ? 54.352  -18.647 -17.926 1.00 30.64  ? 268 LYS C CA    1 
ATOM   6933  C  C     . LYS C  1 127 ? 52.881  -19.081 -17.896 1.00 33.16  ? 268 LYS C C     1 
ATOM   6934  O  O     . LYS C  1 127 ? 52.241  -19.221 -18.945 1.00 38.28  ? 268 LYS C O     1 
ATOM   6935  C  CB    . LYS C  1 127 ? 55.262  -19.830 -17.595 1.00 32.48  ? 268 LYS C CB    1 
ATOM   6936  C  CG    . LYS C  1 127 ? 55.002  -21.065 -18.426 1.00 37.00  ? 268 LYS C CG    1 
ATOM   6937  C  CD    . LYS C  1 127 ? 55.950  -22.188 -18.049 1.00 39.57  ? 268 LYS C CD    1 
ATOM   6938  C  CE    . LYS C  1 127 ? 55.749  -23.391 -18.958 1.00 41.92  ? 268 LYS C CE    1 
ATOM   6939  N  NZ    . LYS C  1 127 ? 54.370  -23.938 -18.863 1.00 43.33  ? 268 LYS C NZ    1 
ATOM   6940  N  N     . ILE C  1 128 ? 52.355  -19.290 -16.690 1.00 35.07  ? 269 ILE C N     1 
ATOM   6941  C  CA    . ILE C  1 128 ? 50.938  -19.601 -16.511 1.00 38.46  ? 269 ILE C CA    1 
ATOM   6942  C  C     . ILE C  1 128 ? 50.053  -18.528 -17.153 1.00 39.85  ? 269 ILE C C     1 
ATOM   6943  O  O     . ILE C  1 128 ? 49.150  -18.844 -17.945 1.00 37.83  ? 269 ILE C O     1 
ATOM   6944  C  CB    . ILE C  1 128 ? 50.574  -19.737 -15.015 1.00 38.17  ? 269 ILE C CB    1 
ATOM   6945  C  CG1   . ILE C  1 128 ? 51.227  -20.975 -14.403 1.00 35.65  ? 269 ILE C CG1   1 
ATOM   6946  C  CG2   . ILE C  1 128 ? 49.069  -19.816 -14.833 1.00 40.18  ? 269 ILE C CG2   1 
ATOM   6947  C  CD1   . ILE C  1 128 ? 50.913  -21.170 -12.928 1.00 34.30  ? 269 ILE C CD1   1 
ATOM   6948  N  N     . ILE C  1 129 ? 50.318  -17.265 -16.813 1.00 42.10  ? 270 ILE C N     1 
ATOM   6949  C  CA    . ILE C  1 129 ? 49.525  -16.161 -17.356 1.00 39.36  ? 270 ILE C CA    1 
ATOM   6950  C  C     . ILE C  1 129 ? 49.563  -16.090 -18.891 1.00 42.10  ? 270 ILE C C     1 
ATOM   6951  O  O     . ILE C  1 129 ? 48.543  -15.809 -19.524 1.00 45.24  ? 270 ILE C O     1 
ATOM   6952  C  CB    . ILE C  1 129 ? 49.904  -14.808 -16.710 1.00 36.70  ? 270 ILE C CB    1 
ATOM   6953  C  CG1   . ILE C  1 129 ? 49.417  -14.768 -15.262 1.00 39.30  ? 270 ILE C CG1   1 
ATOM   6954  C  CG2   . ILE C  1 129 ? 49.309  -13.643 -17.483 1.00 32.00  ? 270 ILE C CG2   1 
ATOM   6955  C  CD1   . ILE C  1 129 ? 49.462  -13.397 -14.629 1.00 40.00  ? 270 ILE C CD1   1 
ATOM   6956  N  N     . LYS C  1 130 ? 50.725  -16.362 -19.482 1.00 43.87  ? 271 LYS C N     1 
ATOM   6957  C  CA    . LYS C  1 130 ? 50.861  -16.407 -20.936 1.00 39.59  ? 271 LYS C CA    1 
ATOM   6958  C  C     . LYS C  1 130 ? 50.019  -17.528 -21.521 1.00 39.61  ? 271 LYS C C     1 
ATOM   6959  O  O     . LYS C  1 130 ? 49.311  -17.326 -22.511 1.00 42.06  ? 271 LYS C O     1 
ATOM   6960  C  CB    . LYS C  1 130 ? 52.319  -16.620 -21.338 1.00 39.91  ? 271 LYS C CB    1 
ATOM   6961  C  CG    . LYS C  1 130 ? 53.213  -15.387 -21.228 1.00 40.42  ? 271 LYS C CG    1 
ATOM   6962  C  CD    . LYS C  1 130 ? 54.003  -15.195 -22.520 1.00 40.98  ? 271 LYS C CD    1 
ATOM   6963  C  CE    . LYS C  1 130 ? 55.184  -14.256 -22.338 1.00 36.86  ? 271 LYS C CE    1 
ATOM   6964  N  NZ    . LYS C  1 130 ? 56.265  -14.913 -21.564 1.00 32.69  ? 271 LYS C NZ    1 
ATOM   6965  N  N     . GLU C  1 131 ? 50.106  -18.711 -20.912 1.00 41.87  ? 272 GLU C N     1 
ATOM   6966  C  CA    . GLU C  1 131 ? 49.326  -19.861 -21.371 1.00 42.84  ? 272 GLU C CA    1 
ATOM   6967  C  C     . GLU C  1 131 ? 47.826  -19.607 -21.311 1.00 38.70  ? 272 GLU C C     1 
ATOM   6968  O  O     . GLU C  1 131 ? 47.081  -20.096 -22.156 1.00 43.74  ? 272 GLU C O     1 
ATOM   6969  C  CB    . GLU C  1 131 ? 49.672  -21.116 -20.573 1.00 49.23  ? 272 GLU C CB    1 
ATOM   6970  C  CG    . GLU C  1 131 ? 51.064  -21.651 -20.855 1.00 55.31  ? 272 GLU C CG    1 
ATOM   6971  C  CD    . GLU C  1 131 ? 51.241  -23.075 -20.381 1.00 60.50  ? 272 GLU C CD    1 
ATOM   6972  O  OE1   . GLU C  1 131 ? 52.398  -23.481 -20.156 1.00 61.17  ? 272 GLU C OE1   1 
ATOM   6973  O  OE2   . GLU C  1 131 ? 50.225  -23.793 -20.251 1.00 63.06  ? 272 GLU C OE2   1 
ATOM   6974  N  N     . GLU C  1 132 ? 47.380  -18.843 -20.319 1.00 37.65  ? 273 GLU C N     1 
ATOM   6975  C  CA    . GLU C  1 132 ? 45.955  -18.520 -20.220 1.00 41.47  ? 273 GLU C CA    1 
ATOM   6976  C  C     . GLU C  1 132 ? 45.535  -17.314 -21.072 1.00 43.44  ? 273 GLU C C     1 
ATOM   6977  O  O     . GLU C  1 132 ? 44.354  -17.158 -21.378 1.00 46.03  ? 273 GLU C O     1 
ATOM   6978  C  CB    . GLU C  1 132 ? 45.536  -18.320 -18.762 1.00 41.85  ? 273 GLU C CB    1 
ATOM   6979  C  CG    . GLU C  1 132 ? 44.042  -18.448 -18.531 1.00 44.46  ? 273 GLU C CG    1 
ATOM   6980  C  CD    . GLU C  1 132 ? 43.509  -19.843 -18.826 1.00 48.94  ? 273 GLU C CD    1 
ATOM   6981  O  OE1   . GLU C  1 132 ? 44.303  -20.807 -18.831 1.00 50.94  ? 273 GLU C OE1   1 
ATOM   6982  O  OE2   . GLU C  1 132 ? 42.288  -19.973 -19.054 1.00 49.66  ? 273 GLU C OE2   1 
ATOM   6983  N  N     . VAL C  1 133 ? 46.495  -16.472 -21.455 1.00 43.05  ? 274 VAL C N     1 
ATOM   6984  C  CA    . VAL C  1 133 ? 46.221  -15.343 -22.348 1.00 43.08  ? 274 VAL C CA    1 
ATOM   6985  C  C     . VAL C  1 133 ? 46.120  -15.844 -23.786 1.00 47.03  ? 274 VAL C C     1 
ATOM   6986  O  O     . VAL C  1 133 ? 45.352  -15.312 -24.592 1.00 51.38  ? 274 VAL C O     1 
ATOM   6987  C  CB    . VAL C  1 133 ? 47.294  -14.227 -22.220 1.00 27.51  ? 274 VAL C CB    1 
ATOM   6988  C  CG1   . VAL C  1 133 ? 47.329  -13.333 -23.453 1.00 23.71  ? 274 VAL C CG1   1 
ATOM   6989  C  CG2   . VAL C  1 133 ? 47.038  -13.385 -20.990 1.00 26.63  ? 274 VAL C CG2   1 
ATOM   6990  N  N     . LYS C  1 134 ? 46.888  -16.884 -24.097 1.00 47.93  ? 275 LYS C N     1 
ATOM   6991  C  CA    . LYS C  1 134 ? 46.803  -17.526 -25.401 1.00 48.40  ? 275 LYS C CA    1 
ATOM   6992  C  C     . LYS C  1 134 ? 45.408  -18.085 -25.649 1.00 45.73  ? 275 LYS C C     1 
ATOM   6993  O  O     . LYS C  1 134 ? 44.940  -18.115 -26.787 1.00 48.18  ? 275 LYS C O     1 
ATOM   6994  C  CB    . LYS C  1 134 ? 47.819  -18.660 -25.498 1.00 54.91  ? 275 LYS C CB    1 
ATOM   6995  C  CG    . LYS C  1 134 ? 49.137  -18.279 -26.149 1.00 62.84  ? 275 LYS C CG    1 
ATOM   6996  C  CD    . LYS C  1 134 ? 50.065  -19.484 -26.231 1.00 70.93  ? 275 LYS C CD    1 
ATOM   6997  C  CE    . LYS C  1 134 ? 51.371  -19.235 -25.482 1.00 76.60  ? 275 LYS C CE    1 
ATOM   6998  N  NZ    . LYS C  1 134 ? 52.274  -20.426 -25.484 1.00 78.88  ? 275 LYS C NZ    1 
ATOM   6999  N  N     . GLU C  1 135 ? 44.747  -18.511 -24.574 1.00 38.57  ? 276 GLU C N     1 
ATOM   7000  C  CA    . GLU C  1 135 ? 43.506  -19.268 -24.673 1.00 38.13  ? 276 GLU C CA    1 
ATOM   7001  C  C     . GLU C  1 135 ? 42.245  -18.422 -24.562 1.00 40.02  ? 276 GLU C C     1 
ATOM   7002  O  O     . GLU C  1 135 ? 41.182  -18.936 -24.202 1.00 43.30  ? 276 GLU C O     1 
ATOM   7003  C  CB    . GLU C  1 135 ? 43.480  -20.372 -23.611 1.00 40.98  ? 276 GLU C CB    1 
ATOM   7004  C  CG    . GLU C  1 135 ? 44.463  -21.503 -23.864 1.00 44.95  ? 276 GLU C CG    1 
ATOM   7005  C  CD    . GLU C  1 135 ? 44.205  -22.194 -25.183 1.00 49.15  ? 276 GLU C CD    1 
ATOM   7006  O  OE1   . GLU C  1 135 ? 43.023  -22.419 -25.516 1.00 52.50  ? 276 GLU C OE1   1 
ATOM   7007  O  OE2   . GLU C  1 135 ? 45.181  -22.513 -25.889 1.00 50.60  ? 276 GLU C OE2   1 
ATOM   7008  N  N     . ILE C  1 136 ? 42.357  -17.135 -24.877 1.00 41.19  ? 277 ILE C N     1 
ATOM   7009  C  CA    . ILE C  1 136 ? 41.195  -16.242 -24.880 1.00 42.66  ? 277 ILE C CA    1 
ATOM   7010  C  C     . ILE C  1 136 ? 41.064  -15.515 -26.228 1.00 46.03  ? 277 ILE C C     1 
ATOM   7011  O  O     . ILE C  1 136 ? 42.004  -14.866 -26.695 1.00 42.17  ? 277 ILE C O     1 
ATOM   7012  C  CB    . ILE C  1 136 ? 41.202  -15.274 -23.661 1.00 61.49  ? 277 ILE C CB    1 
ATOM   7013  C  CG1   . ILE C  1 136 ? 40.554  -13.933 -23.997 1.00 61.01  ? 277 ILE C CG1   1 
ATOM   7014  C  CG2   . ILE C  1 136 ? 42.607  -15.049 -23.149 1.00 62.78  ? 277 ILE C CG2   1 
ATOM   7015  C  CD1   . ILE C  1 136 ? 40.705  -12.918 -22.880 1.00 60.92  ? 277 ILE C CD1   1 
ATOM   7016  N  N     . LYS C  1 137 ? 39.891  -15.642 -26.846 1.00 51.72  ? 278 LYS C N     1 
ATOM   7017  C  CA    . LYS C  1 137 ? 39.711  -15.282 -28.246 1.00 55.63  ? 278 LYS C CA    1 
ATOM   7018  C  C     . LYS C  1 137 ? 38.611  -14.248 -28.473 1.00 53.48  ? 278 LYS C C     1 
ATOM   7019  O  O     . LYS C  1 137 ? 38.370  -13.831 -29.610 1.00 55.60  ? 278 LYS C O     1 
ATOM   7020  C  CB    . LYS C  1 137 ? 39.422  -16.544 -29.061 1.00 61.23  ? 278 LYS C CB    1 
ATOM   7021  C  CG    . LYS C  1 137 ? 40.377  -17.703 -28.765 1.00 67.17  ? 278 LYS C CG    1 
ATOM   7022  C  CD    . LYS C  1 137 ? 40.028  -18.943 -29.581 1.00 72.93  ? 278 LYS C CD    1 
ATOM   7023  C  CE    . LYS C  1 137 ? 41.123  -20.002 -29.485 1.00 76.61  ? 278 LYS C CE    1 
ATOM   7024  N  NZ    . LYS C  1 137 ? 40.879  -21.161 -30.402 1.00 77.35  ? 278 LYS C NZ    1 
ATOM   7025  N  N     . ASP C  1 138 ? 37.948  -13.840 -27.394 1.00 47.51  ? 279 ASP C N     1 
ATOM   7026  C  CA    . ASP C  1 138 ? 36.910  -12.816 -27.484 1.00 42.32  ? 279 ASP C CA    1 
ATOM   7027  C  C     . ASP C  1 138 ? 37.440  -11.434 -27.105 1.00 44.22  ? 279 ASP C C     1 
ATOM   7028  O  O     . ASP C  1 138 ? 36.738  -10.429 -27.247 1.00 42.50  ? 279 ASP C O     1 
ATOM   7029  C  CB    . ASP C  1 138 ? 35.706  -13.182 -26.617 1.00 36.93  ? 279 ASP C CB    1 
ATOM   7030  C  CG    . ASP C  1 138 ? 36.085  -13.475 -25.185 1.00 33.82  ? 279 ASP C CG    1 
ATOM   7031  O  OD1   . ASP C  1 138 ? 37.239  -13.870 -24.936 1.00 37.04  ? 279 ASP C OD1   1 
ATOM   7032  O  OD2   . ASP C  1 138 ? 35.219  -13.323 -24.308 1.00 36.29  ? 279 ASP C OD2   1 
ATOM   7033  N  N     . ILE C  1 139 ? 38.681  -11.388 -26.626 1.00 44.42  ? 280 ILE C N     1 
ATOM   7034  C  CA    . ILE C  1 139 ? 39.334  -10.121 -26.322 1.00 45.58  ? 280 ILE C CA    1 
ATOM   7035  C  C     . ILE C  1 139 ? 40.660  -10.025 -27.087 1.00 47.83  ? 280 ILE C C     1 
ATOM   7036  O  O     . ILE C  1 139 ? 41.306  -11.044 -27.344 1.00 46.84  ? 280 ILE C O     1 
ATOM   7037  C  CB    . ILE C  1 139 ? 39.603  -9.973  -24.809 1.00 47.25  ? 280 ILE C CB    1 
ATOM   7038  C  CG1   . ILE C  1 139 ? 38.412  -10.466 -23.976 1.00 51.15  ? 280 ILE C CG1   1 
ATOM   7039  C  CG2   . ILE C  1 139 ? 39.936  -8.531  -24.469 1.00 46.51  ? 280 ILE C CG2   1 
ATOM   7040  C  CD1   . ILE C  1 139 ? 37.291  -9.458  -23.812 1.00 52.31  ? 280 ILE C CD1   1 
ATOM   7041  N  N     . ASP C  1 140 ? 41.050  -8.809  -27.469 1.00 47.37  ? 281 ASP C N     1 
ATOM   7042  C  CA    . ASP C  1 140 ? 42.372  -8.577  -28.039 1.00 45.47  ? 281 ASP C CA    1 
ATOM   7043  C  C     . ASP C  1 140 ? 43.324  -8.274  -26.890 1.00 42.41  ? 281 ASP C C     1 
ATOM   7044  O  O     . ASP C  1 140 ? 43.416  -7.133  -26.431 1.00 39.80  ? 281 ASP C O     1 
ATOM   7045  C  CB    . ASP C  1 140 ? 42.340  -7.407  -29.029 1.00 48.49  ? 281 ASP C CB    1 
ATOM   7046  C  CG    . ASP C  1 140 ? 43.598  -7.323  -29.887 1.00 48.46  ? 281 ASP C CG    1 
ATOM   7047  O  OD1   . ASP C  1 140 ? 44.618  -7.954  -29.537 1.00 49.01  ? 281 ASP C OD1   1 
ATOM   7048  O  OD2   . ASP C  1 140 ? 43.566  -6.611  -30.913 1.00 47.41  ? 281 ASP C OD2   1 
ATOM   7049  N  N     . VAL C  1 141 ? 44.018  -9.303  -26.416 1.00 42.64  ? 282 VAL C N     1 
ATOM   7050  C  CA    . VAL C  1 141 ? 44.923  -9.142  -25.287 1.00 40.41  ? 282 VAL C CA    1 
ATOM   7051  C  C     . VAL C  1 141 ? 46.216  -9.915  -25.504 1.00 45.46  ? 282 VAL C C     1 
ATOM   7052  O  O     . VAL C  1 141 ? 46.203  -11.082 -25.909 1.00 51.11  ? 282 VAL C O     1 
ATOM   7053  C  CB    . VAL C  1 141 ? 44.254  -9.544  -23.947 1.00 29.65  ? 282 VAL C CB    1 
ATOM   7054  C  CG1   . VAL C  1 141 ? 43.631  -10.913 -24.042 1.00 27.60  ? 282 VAL C CG1   1 
ATOM   7055  C  CG2   . VAL C  1 141 ? 45.251  -9.490  -22.812 1.00 35.15  ? 282 VAL C CG2   1 
ATOM   7056  N  N     . SER C  1 142 ? 47.332  -9.238  -25.260 1.00 40.48  ? 283 SER C N     1 
ATOM   7057  C  CA    . SER C  1 142 ? 48.645  -9.843  -25.381 1.00 31.89  ? 283 SER C CA    1 
ATOM   7058  C  C     . SER C  1 142 ? 49.409  -9.567  -24.097 1.00 32.42  ? 283 SER C C     1 
ATOM   7059  O  O     . SER C  1 142 ? 48.905  -8.875  -23.213 1.00 34.08  ? 283 SER C O     1 
ATOM   7060  C  CB    . SER C  1 142 ? 49.377  -9.249  -26.579 1.00 32.06  ? 283 SER C CB    1 
ATOM   7061  O  OG    . SER C  1 142 ? 49.096  -7.866  -26.704 1.00 31.64  ? 283 SER C OG    1 
ATOM   7062  N  N     . VAL C  1 143 ? 50.613  -10.116 -23.980 1.00 32.47  ? 284 VAL C N     1 
ATOM   7063  C  CA    . VAL C  1 143 ? 51.448  -9.844  -22.816 1.00 30.99  ? 284 VAL C CA    1 
ATOM   7064  C  C     . VAL C  1 143 ? 52.603  -8.930  -23.211 1.00 35.45  ? 284 VAL C C     1 
ATOM   7065  O  O     . VAL C  1 143 ? 53.243  -9.144  -24.238 1.00 37.89  ? 284 VAL C O     1 
ATOM   7066  C  CB    . VAL C  1 143 ? 51.973  -11.140 -22.176 1.00 25.13  ? 284 VAL C CB    1 
ATOM   7067  C  CG1   . VAL C  1 143 ? 52.840  -10.828 -20.974 1.00 18.40  ? 284 VAL C CG1   1 
ATOM   7068  C  CG2   . VAL C  1 143 ? 50.811  -12.022 -21.763 1.00 22.64  ? 284 VAL C CG2   1 
ATOM   7069  N  N     . GLU C  1 144 ? 52.847  -7.899  -22.407 1.00 38.90  ? 285 GLU C N     1 
ATOM   7070  C  CA    . GLU C  1 144 ? 53.927  -6.952  -22.672 1.00 37.98  ? 285 GLU C CA    1 
ATOM   7071  C  C     . GLU C  1 144 ? 55.281  -7.626  -22.448 1.00 39.10  ? 285 GLU C C     1 
ATOM   7072  O  O     . GLU C  1 144 ? 55.374  -8.587  -21.685 1.00 41.45  ? 285 GLU C O     1 
ATOM   7073  C  CB    . GLU C  1 144 ? 53.781  -5.737  -21.755 1.00 36.68  ? 285 GLU C CB    1 
ATOM   7074  C  CG    . GLU C  1 144 ? 54.690  -4.568  -22.095 1.00 38.44  ? 285 GLU C CG    1 
ATOM   7075  C  CD    . GLU C  1 144 ? 54.959  -3.669  -20.903 1.00 41.10  ? 285 GLU C CD    1 
ATOM   7076  O  OE1   . GLU C  1 144 ? 55.354  -4.191  -19.838 1.00 37.51  ? 285 GLU C OE1   1 
ATOM   7077  O  OE2   . GLU C  1 144 ? 54.776  -2.442  -21.038 1.00 44.04  ? 285 GLU C OE2   1 
ATOM   7078  N  N     . LYS C  1 145 ? 56.324  -7.138  -23.118 1.00 38.21  ? 286 LYS C N     1 
ATOM   7079  C  CA    . LYS C  1 145 ? 57.673  -7.662  -22.919 1.00 34.30  ? 286 LYS C CA    1 
ATOM   7080  C  C     . LYS C  1 145 ? 58.154  -7.271  -21.530 1.00 37.71  ? 286 LYS C C     1 
ATOM   7081  O  O     . LYS C  1 145 ? 57.921  -6.146  -21.093 1.00 38.37  ? 286 LYS C O     1 
ATOM   7082  C  CB    . LYS C  1 145 ? 58.633  -7.122  -23.985 1.00 28.07  ? 286 LYS C CB    1 
ATOM   7083  C  CG    . LYS C  1 145 ? 60.053  -7.686  -23.884 1.00 25.67  ? 286 LYS C CG    1 
ATOM   7084  C  CD    . LYS C  1 145 ? 61.002  -7.059  -24.901 1.00 22.31  ? 286 LYS C CD    1 
ATOM   7085  C  CE    . LYS C  1 145 ? 62.384  -7.705  -24.828 1.00 23.79  ? 286 LYS C CE    1 
ATOM   7086  N  NZ    . LYS C  1 145 ? 63.316  -7.224  -25.890 1.00 27.93  ? 286 LYS C NZ    1 
ATOM   7087  N  N     . GLU C  1 146 ? 58.820  -8.193  -20.839 1.00 40.38  ? 287 GLU C N     1 
ATOM   7088  C  CA    . GLU C  1 146 ? 59.229  -7.957  -19.455 1.00 40.01  ? 287 GLU C CA    1 
ATOM   7089  C  C     . GLU C  1 146 ? 60.155  -6.760  -19.295 1.00 37.33  ? 287 GLU C C     1 
ATOM   7090  O  O     . GLU C  1 146 ? 61.241  -6.721  -19.878 1.00 38.31  ? 287 GLU C O     1 
ATOM   7091  C  CB    . GLU C  1 146 ? 59.888  -9.195  -18.848 1.00 42.91  ? 287 GLU C CB    1 
ATOM   7092  C  CG    . GLU C  1 146 ? 60.252  -9.008  -17.379 1.00 48.11  ? 287 GLU C CG    1 
ATOM   7093  C  CD    . GLU C  1 146 ? 60.963  -10.207 -16.792 1.00 56.42  ? 287 GLU C CD    1 
ATOM   7094  O  OE1   . GLU C  1 146 ? 61.600  -10.962 -17.558 1.00 61.35  ? 287 GLU C OE1   1 
ATOM   7095  O  OE2   . GLU C  1 146 ? 60.887  -10.390 -15.562 1.00 58.66  ? 287 GLU C OE2   1 
ATOM   7096  N  N     . LYS C  1 147 ? 59.708  -5.790  -18.499 1.00 35.75  ? 288 LYS C N     1 
ATOM   7097  C  CA    . LYS C  1 147 ? 60.521  -4.638  -18.142 1.00 34.89  ? 288 LYS C CA    1 
ATOM   7098  C  C     . LYS C  1 147 ? 61.397  -4.993  -16.955 1.00 41.37  ? 288 LYS C C     1 
ATOM   7099  O  O     . LYS C  1 147 ? 60.900  -5.468  -15.933 1.00 44.81  ? 288 LYS C O     1 
ATOM   7100  C  CB    . LYS C  1 147 ? 59.647  -3.439  -17.772 1.00 32.28  ? 288 LYS C CB    1 
ATOM   7101  C  CG    . LYS C  1 147 ? 59.082  -2.658  -18.946 1.00 38.80  ? 288 LYS C CG    1 
ATOM   7102  C  CD    . LYS C  1 147 ? 58.645  -1.266  -18.494 1.00 46.03  ? 288 LYS C CD    1 
ATOM   7103  C  CE    . LYS C  1 147 ? 57.975  -0.478  -19.621 1.00 50.20  ? 288 LYS C CE    1 
ATOM   7104  N  NZ    . LYS C  1 147 ? 56.535  -0.830  -19.794 1.00 50.23  ? 288 LYS C NZ    1 
ATOM   7105  N  N     . PRO C  1 148 ? 62.711  -4.768  -17.084 1.00 42.26  ? 289 PRO C N     1 
ATOM   7106  C  CA    . PRO C  1 148 ? 63.622  -4.929  -15.947 1.00 42.00  ? 289 PRO C CA    1 
ATOM   7107  C  C     . PRO C  1 148 ? 63.247  -3.957  -14.837 1.00 36.44  ? 289 PRO C C     1 
ATOM   7108  O  O     . PRO C  1 148 ? 62.981  -2.782  -15.104 1.00 35.49  ? 289 PRO C O     1 
ATOM   7109  C  CB    . PRO C  1 148 ? 64.992  -4.576  -16.540 1.00 44.84  ? 289 PRO C CB    1 
ATOM   7110  C  CG    . PRO C  1 148 ? 64.701  -3.830  -17.813 1.00 42.98  ? 289 PRO C CG    1 
ATOM   7111  C  CD    . PRO C  1 148 ? 63.420  -4.402  -18.321 1.00 41.88  ? 289 PRO C CD    1 
ATOM   7112  N  N     . GLY C  1 149 ? 63.202  -4.447  -13.605 1.00 33.84  ? 290 GLY C N     1 
ATOM   7113  C  CA    . GLY C  1 149 ? 62.784  -3.616  -12.492 1.00 34.34  ? 290 GLY C CA    1 
ATOM   7114  C  C     . GLY C  1 149 ? 61.300  -3.700  -12.175 1.00 37.91  ? 290 GLY C C     1 
ATOM   7115  O  O     . GLY C  1 149 ? 60.859  -3.179  -11.149 1.00 41.53  ? 290 GLY C O     1 
ATOM   7116  N  N     . SER C  1 150 ? 60.534  -4.355  -13.049 1.00 40.27  ? 291 SER C N     1 
ATOM   7117  C  CA    . SER C  1 150 ? 59.081  -4.461  -12.890 1.00 37.43  ? 291 SER C CA    1 
ATOM   7118  C  C     . SER C  1 150 ? 58.653  -5.810  -12.331 1.00 38.09  ? 291 SER C C     1 
ATOM   7119  O  O     . SER C  1 150 ? 59.031  -6.854  -12.865 1.00 41.83  ? 291 SER C O     1 
ATOM   7120  C  CB    . SER C  1 150 ? 58.379  -4.232  -14.224 1.00 37.71  ? 291 SER C CB    1 
ATOM   7121  O  OG    . SER C  1 150 ? 56.987  -4.469  -14.115 1.00 41.12  ? 291 SER C OG    1 
ATOM   7122  N  N     . PRO C  1 151 ? 57.836  -5.786  -11.265 1.00 34.24  ? 292 PRO C N     1 
ATOM   7123  C  CA    . PRO C  1 151 ? 57.363  -6.967  -10.540 1.00 33.98  ? 292 PRO C CA    1 
ATOM   7124  C  C     . PRO C  1 151 ? 56.092  -7.518  -11.155 1.00 37.01  ? 292 PRO C C     1 
ATOM   7125  O  O     . PRO C  1 151 ? 55.502  -8.452  -10.605 1.00 35.72  ? 292 PRO C O     1 
ATOM   7126  C  CB    . PRO C  1 151 ? 57.021  -6.391  -9.171  1.00 33.17  ? 292 PRO C CB    1 
ATOM   7127  C  CG    . PRO C  1 151 ? 56.505  -5.022  -9.491  1.00 31.15  ? 292 PRO C CG    1 
ATOM   7128  C  CD    . PRO C  1 151 ? 57.323  -4.540  -10.663 1.00 32.62  ? 292 PRO C CD    1 
ATOM   7129  N  N     . ALA C  1 152 ? 55.678  -6.953  -12.286 1.00 40.85  ? 293 ALA C N     1 
ATOM   7130  C  CA    . ALA C  1 152 ? 54.368  -7.269  -12.848 1.00 38.90  ? 293 ALA C CA    1 
ATOM   7131  C  C     . ALA C  1 152 ? 54.429  -7.884  -14.240 1.00 37.75  ? 293 ALA C C     1 
ATOM   7132  O  O     . ALA C  1 152 ? 55.220  -7.464  -15.088 1.00 40.79  ? 293 ALA C O     1 
ATOM   7133  C  CB    . ALA C  1 152 ? 53.495  -6.032  -12.871 1.00 38.00  ? 293 ALA C CB    1 
ATOM   7134  N  N     . VAL C  1 153 ? 53.577  -8.879  -14.465 1.00 31.56  ? 294 VAL C N     1 
ATOM   7135  C  CA    . VAL C  1 153 ? 53.312  -9.365  -15.806 1.00 31.00  ? 294 VAL C CA    1 
ATOM   7136  C  C     . VAL C  1 153 ? 52.284  -8.397  -16.373 1.00 30.12  ? 294 VAL C C     1 
ATOM   7137  O  O     . VAL C  1 153 ? 51.137  -8.365  -15.913 1.00 36.40  ? 294 VAL C O     1 
ATOM   7138  C  CB    . VAL C  1 153 ? 52.747  -10.794 -15.781 1.00 31.98  ? 294 VAL C CB    1 
ATOM   7139  C  CG1   . VAL C  1 153 ? 52.603  -11.348 -17.190 1.00 28.02  ? 294 VAL C CG1   1 
ATOM   7140  C  CG2   . VAL C  1 153 ? 53.657  -11.693 -14.969 1.00 33.60  ? 294 VAL C CG2   1 
ATOM   7141  N  N     . THR C  1 154 ? 52.707  -7.580  -17.338 1.00 22.16  ? 295 THR C N     1 
ATOM   7142  C  CA    . THR C  1 154 ? 51.843  -6.540  -17.887 1.00 22.17  ? 295 THR C CA    1 
ATOM   7143  C  C     . THR C  1 154 ? 51.114  -7.019  -19.142 1.00 27.10  ? 295 THR C C     1 
ATOM   7144  O  O     . THR C  1 154 ? 51.726  -7.575  -20.055 1.00 32.77  ? 295 THR C O     1 
ATOM   7145  C  CB    . THR C  1 154 ? 52.619  -5.239  -18.198 1.00 22.97  ? 295 THR C CB    1 
ATOM   7146  O  OG1   . THR C  1 154 ? 53.297  -4.786  -17.021 1.00 22.14  ? 295 THR C OG1   1 
ATOM   7147  C  CG2   . THR C  1 154 ? 51.674  -4.148  -18.656 1.00 24.94  ? 295 THR C CG2   1 
ATOM   7148  N  N     . LEU C  1 155 ? 49.803  -6.794  -19.175 1.00 26.25  ? 296 LEU C N     1 
ATOM   7149  C  CA    . LEU C  1 155 ? 48.971  -7.151  -20.311 1.00 26.17  ? 296 LEU C CA    1 
ATOM   7150  C  C     . LEU C  1 155 ? 48.634  -5.931  -21.148 1.00 28.81  ? 296 LEU C C     1 
ATOM   7151  O  O     . LEU C  1 155 ? 48.349  -4.854  -20.615 1.00 27.73  ? 296 LEU C O     1 
ATOM   7152  C  CB    . LEU C  1 155 ? 47.670  -7.768  -19.831 1.00 23.78  ? 296 LEU C CB    1 
ATOM   7153  C  CG    . LEU C  1 155 ? 47.764  -8.857  -18.777 1.00 21.69  ? 296 LEU C CG    1 
ATOM   7154  C  CD1   . LEU C  1 155 ? 46.376  -9.352  -18.457 1.00 24.29  ? 296 LEU C CD1   1 
ATOM   7155  C  CD2   . LEU C  1 155 ? 48.631  -9.986  -19.270 1.00 21.61  ? 296 LEU C CD2   1 
ATOM   7156  N  N     . LEU C  1 156 ? 48.663  -6.112  -22.463 1.00 33.41  ? 297 LEU C N     1 
ATOM   7157  C  CA    . LEU C  1 156 ? 48.265  -5.072  -23.397 1.00 36.06  ? 297 LEU C CA    1 
ATOM   7158  C  C     . LEU C  1 156 ? 46.939  -5.469  -24.022 1.00 40.13  ? 297 LEU C C     1 
ATOM   7159  O  O     . LEU C  1 156 ? 46.876  -6.389  -24.844 1.00 46.58  ? 297 LEU C O     1 
ATOM   7160  C  CB    . LEU C  1 156 ? 49.323  -4.892  -24.482 1.00 36.84  ? 297 LEU C CB    1 
ATOM   7161  C  CG    . LEU C  1 156 ? 50.710  -4.526  -23.955 1.00 41.01  ? 297 LEU C CG    1 
ATOM   7162  C  CD1   . LEU C  1 156 ? 51.786  -4.783  -24.992 1.00 41.25  ? 297 LEU C CD1   1 
ATOM   7163  C  CD2   . LEU C  1 156 ? 50.741  -3.075  -23.511 1.00 43.94  ? 297 LEU C CD2   1 
ATOM   7164  N  N     . ILE C  1 157 ? 45.878  -4.786  -23.611 1.00 37.54  ? 298 ILE C N     1 
ATOM   7165  C  CA    . ILE C  1 157 ? 44.560  -5.027  -24.169 1.00 38.59  ? 298 ILE C CA    1 
ATOM   7166  C  C     . ILE C  1 157 ? 44.271  -4.015  -25.263 1.00 41.59  ? 298 ILE C C     1 
ATOM   7167  O  O     . ILE C  1 157 ? 44.230  -2.800  -25.013 1.00 37.87  ? 298 ILE C O     1 
ATOM   7168  C  CB    . ILE C  1 157 ? 43.455  -4.947  -23.103 1.00 41.15  ? 298 ILE C CB    1 
ATOM   7169  C  CG1   . ILE C  1 157 ? 43.703  -5.961  -21.990 1.00 38.37  ? 298 ILE C CG1   1 
ATOM   7170  C  CG2   . ILE C  1 157 ? 42.099  -5.204  -23.728 1.00 45.26  ? 298 ILE C CG2   1 
ATOM   7171  C  CD1   . ILE C  1 157 ? 42.599  -5.994  -20.952 1.00 37.34  ? 298 ILE C CD1   1 
ATOM   7172  N  N     . ARG C  1 158 ? 44.086  -4.530  -26.476 1.00 48.49  ? 299 ARG C N     1 
ATOM   7173  C  CA    . ARG C  1 158 ? 43.706  -3.710  -27.613 1.00 51.75  ? 299 ARG C CA    1 
ATOM   7174  C  C     . ARG C  1 158 ? 42.212  -3.785  -27.865 1.00 59.17  ? 299 ARG C C     1 
ATOM   7175  O  O     . ARG C  1 158 ? 41.772  -3.804  -29.017 1.00 64.50  ? 299 ARG C O     1 
ATOM   7176  C  CB    . ARG C  1 158 ? 44.456  -4.132  -28.870 1.00 50.90  ? 299 ARG C CB    1 
ATOM   7177  C  CG    . ARG C  1 158 ? 45.917  -3.753  -28.877 1.00 50.81  ? 299 ARG C CG    1 
ATOM   7178  C  CD    . ARG C  1 158 ? 46.689  -4.699  -29.766 1.00 53.85  ? 299 ARG C CD    1 
ATOM   7179  N  NE    . ARG C  1 158 ? 48.037  -4.222  -30.039 1.00 56.89  ? 299 ARG C NE    1 
ATOM   7180  C  CZ    . ARG C  1 158 ? 48.983  -4.966  -30.598 1.00 58.97  ? 299 ARG C CZ    1 
ATOM   7181  N  NH1   . ARG C  1 158 ? 48.719  -6.222  -30.929 1.00 59.95  ? 299 ARG C NH1   1 
ATOM   7182  N  NH2   . ARG C  1 158 ? 50.188  -4.459  -30.820 1.00 58.69  ? 299 ARG C NH2   1 
ATOM   7183  N  N     . ASN C  1 159 ? 41.441  -3.870  -26.785 1.00 62.45  ? 300 ASN C N     1 
ATOM   7184  C  CA    . ASN C  1 159 ? 40.052  -3.449  -26.827 1.00 65.38  ? 300 ASN C CA    1 
ATOM   7185  C  C     . ASN C  1 159 ? 40.171  -2.031  -27.334 1.00 67.32  ? 300 ASN C C     1 
ATOM   7186  O  O     . ASN C  1 159 ? 40.601  -1.163  -26.592 1.00 69.84  ? 300 ASN C O     1 
ATOM   7187  C  CB    . ASN C  1 159 ? 39.463  -3.470  -25.417 1.00 64.50  ? 300 ASN C CB    1 
ATOM   7188  C  CG    . ASN C  1 159 ? 38.182  -2.674  -25.301 1.00 61.14  ? 300 ASN C CG    1 
ATOM   7189  O  OD1   . ASN C  1 159 ? 38.142  -1.635  -24.645 1.00 57.97  ? 300 ASN C OD1   1 
ATOM   7190  N  ND2   . ASN C  1 159 ? 37.127  -3.160  -25.937 1.00 62.79  ? 300 ASN C ND2   1 
ATOM   7191  N  N     . PRO C  1 160 ? 39.744  -1.787  -28.583 1.00 65.60  ? 301 PRO C N     1 
ATOM   7192  C  CA    . PRO C  1 160 ? 40.260  -0.767  -29.507 1.00 60.77  ? 301 PRO C CA    1 
ATOM   7193  C  C     . PRO C  1 160 ? 41.247  0.224   -28.886 1.00 61.67  ? 301 PRO C C     1 
ATOM   7194  O  O     . PRO C  1 160 ? 42.337  0.414   -29.429 1.00 62.99  ? 301 PRO C O     1 
ATOM   7195  C  CB    . PRO C  1 160 ? 38.987  -0.054  -29.996 1.00 57.97  ? 301 PRO C CB    1 
ATOM   7196  C  CG    . PRO C  1 160 ? 37.836  -0.677  -29.223 1.00 61.77  ? 301 PRO C CG    1 
ATOM   7197  C  CD    . PRO C  1 160 ? 38.323  -2.041  -28.849 1.00 65.97  ? 301 PRO C CD    1 
ATOM   7198  N  N     . GLU C  1 161 ? 40.867  0.831   -27.764 1.00 59.39  ? 302 GLU C N     1 
ATOM   7199  C  CA    . GLU C  1 161 ? 41.727  1.774   -27.059 1.00 56.93  ? 302 GLU C CA    1 
ATOM   7200  C  C     . GLU C  1 161 ? 42.712  1.030   -26.172 1.00 53.63  ? 302 GLU C C     1 
ATOM   7201  O  O     . GLU C  1 161 ? 42.310  0.250   -25.311 1.00 59.03  ? 302 GLU C O     1 
ATOM   7202  C  CB    . GLU C  1 161 ? 40.890  2.726   -26.204 1.00 57.24  ? 302 GLU C CB    1 
ATOM   7203  C  CG    . GLU C  1 161 ? 40.026  3.697   -26.999 1.00 58.61  ? 302 GLU C CG    1 
ATOM   7204  C  CD    . GLU C  1 161 ? 38.591  3.229   -27.144 1.00 57.85  ? 302 GLU C CD    1 
ATOM   7205  O  OE1   . GLU C  1 161 ? 38.336  2.016   -26.989 1.00 56.85  ? 302 GLU C OE1   1 
ATOM   7206  O  OE2   . GLU C  1 161 ? 37.717  4.080   -27.409 1.00 57.78  ? 302 GLU C OE2   1 
ATOM   7207  N  N     . GLU C  1 162 ? 44.000  1.286   -26.366 1.00 46.73  ? 303 GLU C N     1 
ATOM   7208  C  CA    . GLU C  1 162 ? 45.033  0.575   -25.624 1.00 42.91  ? 303 GLU C CA    1 
ATOM   7209  C  C     . GLU C  1 162 ? 44.911  0.744   -24.113 1.00 37.34  ? 303 GLU C C     1 
ATOM   7210  O  O     . GLU C  1 162 ? 44.907  1.862   -23.594 1.00 39.18  ? 303 GLU C O     1 
ATOM   7211  C  CB    . GLU C  1 162 ? 46.416  1.001   -26.108 1.00 43.67  ? 303 GLU C CB    1 
ATOM   7212  C  CG    . GLU C  1 162 ? 46.629  0.699   -27.577 1.00 45.87  ? 303 GLU C CG    1 
ATOM   7213  C  CD    . GLU C  1 162 ? 48.029  0.995   -28.038 1.00 50.49  ? 303 GLU C CD    1 
ATOM   7214  O  OE1   . GLU C  1 162 ? 48.363  2.187   -28.182 1.00 52.40  ? 303 GLU C OE1   1 
ATOM   7215  O  OE2   . GLU C  1 162 ? 48.790  0.033   -28.266 1.00 52.54  ? 303 GLU C OE2   1 
ATOM   7216  N  N     . ILE C  1 163 ? 44.797  -0.387  -23.424 1.00 32.00  ? 304 ILE C N     1 
ATOM   7217  C  CA    . ILE C  1 163 ? 44.750  -0.417  -21.969 1.00 30.99  ? 304 ILE C CA    1 
ATOM   7218  C  C     . ILE C  1 163 ? 45.889  -1.306  -21.492 1.00 33.52  ? 304 ILE C C     1 
ATOM   7219  O  O     . ILE C  1 163 ? 46.123  -2.363  -22.071 1.00 30.41  ? 304 ILE C O     1 
ATOM   7220  C  CB    . ILE C  1 163 ? 43.408  -1.001  -21.480 1.00 29.60  ? 304 ILE C CB    1 
ATOM   7221  C  CG1   . ILE C  1 163 ? 42.243  -0.133  -21.953 1.00 23.86  ? 304 ILE C CG1   1 
ATOM   7222  C  CG2   . ILE C  1 163 ? 43.386  -1.138  -19.966 1.00 30.15  ? 304 ILE C CG2   1 
ATOM   7223  C  CD1   . ILE C  1 163 ? 40.920  -0.840  -21.964 1.00 21.50  ? 304 ILE C CD1   1 
ATOM   7224  N  N     . SER C  1 164 ? 46.609  -0.884  -20.456 1.00 40.30  ? 305 SER C N     1 
ATOM   7225  C  CA    . SER C  1 164 ? 47.613  -1.753  -19.842 1.00 40.45  ? 305 SER C CA    1 
ATOM   7226  C  C     . SER C  1 164 ? 47.153  -2.246  -18.470 1.00 38.53  ? 305 SER C C     1 
ATOM   7227  O  O     . SER C  1 164 ? 46.546  -1.494  -17.697 1.00 39.43  ? 305 SER C O     1 
ATOM   7228  C  CB    . SER C  1 164 ? 48.959  -1.042  -19.722 1.00 43.87  ? 305 SER C CB    1 
ATOM   7229  O  OG    . SER C  1 164 ? 48.852  0.129   -18.937 1.00 48.24  ? 305 SER C OG    1 
ATOM   7230  N  N     . VAL C  1 165 ? 47.433  -3.515  -18.176 1.00 39.77  ? 306 VAL C N     1 
ATOM   7231  C  CA    . VAL C  1 165 ? 47.092  -4.100  -16.876 1.00 36.24  ? 306 VAL C CA    1 
ATOM   7232  C  C     . VAL C  1 165 ? 48.313  -4.745  -16.212 1.00 35.22  ? 306 VAL C C     1 
ATOM   7233  O  O     . VAL C  1 165 ? 48.851  -5.719  -16.729 1.00 34.87  ? 306 VAL C O     1 
ATOM   7234  C  CB    . VAL C  1 165 ? 45.977  -5.164  -17.011 1.00 35.23  ? 306 VAL C CB    1 
ATOM   7235  C  CG1   . VAL C  1 165 ? 45.694  -5.817  -15.664 1.00 34.15  ? 306 VAL C CG1   1 
ATOM   7236  C  CG2   . VAL C  1 165 ? 44.709  -4.548  -17.585 1.00 35.25  ? 306 VAL C CG2   1 
ATOM   7237  N  N     . ASP C  1 166 ? 48.753  -4.211  -15.073 1.00 31.72  ? 307 ASP C N     1 
ATOM   7238  C  CA    . ASP C  1 166 ? 49.857  -4.828  -14.339 1.00 27.01  ? 307 ASP C CA    1 
ATOM   7239  C  C     . ASP C  1 166 ? 49.348  -5.909  -13.389 1.00 33.13  ? 307 ASP C C     1 
ATOM   7240  O  O     . ASP C  1 166 ? 48.637  -5.610  -12.421 1.00 38.08  ? 307 ASP C O     1 
ATOM   7241  C  CB    . ASP C  1 166 ? 50.647  -3.786  -13.545 1.00 26.94  ? 307 ASP C CB    1 
ATOM   7242  C  CG    . ASP C  1 166 ? 51.557  -2.939  -14.416 1.00 33.85  ? 307 ASP C CG    1 
ATOM   7243  O  OD1   . ASP C  1 166 ? 51.912  -3.381  -15.526 1.00 36.88  ? 307 ASP C OD1   1 
ATOM   7244  O  OD2   . ASP C  1 166 ? 51.926  -1.827  -13.979 1.00 35.28  ? 307 ASP C OD2   1 
ATOM   7245  N  N     . ILE C  1 167 ? 49.694  -7.165  -13.674 1.00 34.85  ? 308 ILE C N     1 
ATOM   7246  C  CA    . ILE C  1 167 ? 49.426  -8.256  -12.737 1.00 33.22  ? 308 ILE C CA    1 
ATOM   7247  C  C     . ILE C  1 167 ? 50.657  -8.466  -11.845 1.00 34.77  ? 308 ILE C C     1 
ATOM   7248  O  O     . ILE C  1 167 ? 51.659  -9.054  -12.268 1.00 35.74  ? 308 ILE C O     1 
ATOM   7249  C  CB    . ILE C  1 167 ? 49.052  -9.576  -13.448 1.00 33.19  ? 308 ILE C CB    1 
ATOM   7250  C  CG1   . ILE C  1 167 ? 47.880  -9.365  -14.403 1.00 32.44  ? 308 ILE C CG1   1 
ATOM   7251  C  CG2   . ILE C  1 167 ? 48.700  -10.641 -12.425 1.00 30.70  ? 308 ILE C CG2   1 
ATOM   7252  C  CD1   . ILE C  1 167 ? 46.568  -9.040  -13.709 1.00 32.02  ? 308 ILE C CD1   1 
ATOM   7253  N  N     . ILE C  1 168 ? 50.562  -7.981  -10.609 1.00 31.55  ? 309 ILE C N     1 
ATOM   7254  C  CA    . ILE C  1 168 ? 51.688  -7.914  -9.688  1.00 29.78  ? 309 ILE C CA    1 
ATOM   7255  C  C     . ILE C  1 168 ? 51.716  -9.101  -8.729  1.00 34.54  ? 309 ILE C C     1 
ATOM   7256  O  O     . ILE C  1 168 ? 50.788  -9.282  -7.937  1.00 36.15  ? 309 ILE C O     1 
ATOM   7257  C  CB    . ILE C  1 168 ? 51.618  -6.608  -8.881  1.00 26.04  ? 309 ILE C CB    1 
ATOM   7258  C  CG1   . ILE C  1 168 ? 51.578  -5.413  -9.835  1.00 21.34  ? 309 ILE C CG1   1 
ATOM   7259  C  CG2   . ILE C  1 168 ? 52.780  -6.508  -7.906  1.00 25.65  ? 309 ILE C CG2   1 
ATOM   7260  C  CD1   . ILE C  1 168 ? 51.234  -4.103  -9.174  1.00 20.30  ? 309 ILE C CD1   1 
ATOM   7261  N  N     . LEU C  1 169 ? 52.779  -9.903  -8.797  1.00 34.20  ? 310 LEU C N     1 
ATOM   7262  C  CA    . LEU C  1 169 ? 52.923  -11.047 -7.898  1.00 31.45  ? 310 LEU C CA    1 
ATOM   7263  C  C     . LEU C  1 169 ? 53.378  -10.589 -6.526  1.00 33.44  ? 310 LEU C C     1 
ATOM   7264  O  O     . LEU C  1 169 ? 54.483  -10.063 -6.385  1.00 35.15  ? 310 LEU C O     1 
ATOM   7265  C  CB    . LEU C  1 169 ? 53.928  -12.058 -8.446  1.00 33.15  ? 310 LEU C CB    1 
ATOM   7266  C  CG    . LEU C  1 169 ? 54.327  -13.186 -7.485  1.00 29.80  ? 310 LEU C CG    1 
ATOM   7267  C  CD1   . LEU C  1 169 ? 53.129  -14.051 -7.125  1.00 24.28  ? 310 LEU C CD1   1 
ATOM   7268  C  CD2   . LEU C  1 169 ? 55.437  -14.032 -8.068  1.00 26.59  ? 310 LEU C CD2   1 
ATOM   7269  N  N     . ALA C  1 170 ? 52.536  -10.799 -5.515  1.00 33.63  ? 311 ALA C N     1 
ATOM   7270  C  CA    . ALA C  1 170 ? 52.864  -10.348 -4.164  1.00 30.14  ? 311 ALA C CA    1 
ATOM   7271  C  C     . ALA C  1 170 ? 52.903  -11.493 -3.163  1.00 33.93  ? 311 ALA C C     1 
ATOM   7272  O  O     . ALA C  1 170 ? 52.115  -12.430 -3.263  1.00 37.60  ? 311 ALA C O     1 
ATOM   7273  C  CB    . ALA C  1 170 ? 51.878  -9.301  -3.713  1.00 27.12  ? 311 ALA C CB    1 
ATOM   7274  N  N     . LEU C  1 171 ? 53.821  -11.411 -2.202  1.00 31.67  ? 312 LEU C N     1 
ATOM   7275  C  CA    . LEU C  1 171 ? 53.813  -12.306 -1.055  1.00 30.16  ? 312 LEU C CA    1 
ATOM   7276  C  C     . LEU C  1 171 ? 53.143  -11.563 0.086   1.00 31.60  ? 312 LEU C C     1 
ATOM   7277  O  O     . LEU C  1 171 ? 53.429  -10.386 0.310   1.00 35.04  ? 312 LEU C O     1 
ATOM   7278  C  CB    . LEU C  1 171 ? 55.230  -12.680 -0.629  1.00 31.89  ? 312 LEU C CB    1 
ATOM   7279  C  CG    . LEU C  1 171 ? 56.188  -13.316 -1.631  1.00 33.34  ? 312 LEU C CG    1 
ATOM   7280  C  CD1   . LEU C  1 171 ? 57.484  -13.736 -0.949  1.00 30.82  ? 312 LEU C CD1   1 
ATOM   7281  C  CD2   . LEU C  1 171 ? 55.537  -14.501 -2.311  1.00 33.35  ? 312 LEU C CD2   1 
ATOM   7282  N  N     . GLU C  1 172 ? 52.260  -12.244 0.808   1.00 31.93  ? 313 GLU C N     1 
ATOM   7283  C  CA    . GLU C  1 172 ? 51.577  -11.631 1.937   1.00 29.74  ? 313 GLU C CA    1 
ATOM   7284  C  C     . GLU C  1 172 ? 52.139  -12.169 3.248   1.00 36.19  ? 313 GLU C C     1 
ATOM   7285  O  O     . GLU C  1 172 ? 52.350  -13.377 3.385   1.00 37.19  ? 313 GLU C O     1 
ATOM   7286  C  CB    . GLU C  1 172 ? 50.077  -11.913 1.853   1.00 33.49  ? 313 GLU C CB    1 
ATOM   7287  C  CG    . GLU C  1 172 ? 49.208  -11.052 2.758   1.00 37.73  ? 313 GLU C CG    1 
ATOM   7288  C  CD    . GLU C  1 172 ? 47.748  -11.457 2.705   1.00 44.31  ? 313 GLU C CD    1 
ATOM   7289  O  OE1   . GLU C  1 172 ? 47.423  -12.563 3.178   1.00 50.61  ? 313 GLU C OE1   1 
ATOM   7290  O  OE2   . GLU C  1 172 ? 46.927  -10.671 2.192   1.00 44.98  ? 313 GLU C OE2   1 
ATOM   7291  N  N     . SER C  1 173 ? 52.388  -11.277 4.207   1.00 38.06  ? 314 SER C N     1 
ATOM   7292  C  CA    . SER C  1 173 ? 52.852  -11.700 5.530   1.00 34.66  ? 314 SER C CA    1 
ATOM   7293  C  C     . SER C  1 173 ? 52.091  -10.977 6.640   1.00 37.07  ? 314 SER C C     1 
ATOM   7294  O  O     . SER C  1 173 ? 51.958  -9.753  6.617   1.00 38.27  ? 314 SER C O     1 
ATOM   7295  C  CB    . SER C  1 173 ? 54.359  -11.491 5.677   1.00 31.21  ? 314 SER C CB    1 
ATOM   7296  O  OG    . SER C  1 173 ? 54.840  -12.045 6.889   1.00 33.55  ? 314 SER C OG    1 
ATOM   7297  N  N     . LYS C  1 174 ? 51.599  -11.739 7.612   1.00 38.63  ? 315 LYS C N     1 
ATOM   7298  C  CA    . LYS C  1 174 ? 50.734  -11.183 8.645   1.00 43.25  ? 315 LYS C CA    1 
ATOM   7299  C  C     . LYS C  1 174 ? 51.456  -10.870 9.950   1.00 45.70  ? 315 LYS C C     1 
ATOM   7300  O  O     . LYS C  1 174 ? 50.830  -10.456 10.926  1.00 52.56  ? 315 LYS C O     1 
ATOM   7301  C  CB    . LYS C  1 174 ? 49.542  -12.107 8.897   1.00 45.13  ? 315 LYS C CB    1 
ATOM   7302  C  CG    . LYS C  1 174 ? 48.600  -12.208 7.707   1.00 50.97  ? 315 LYS C CG    1 
ATOM   7303  C  CD    . LYS C  1 174 ? 47.507  -13.241 7.932   1.00 56.13  ? 315 LYS C CD    1 
ATOM   7304  C  CE    . LYS C  1 174 ? 46.606  -13.339 6.713   1.00 57.78  ? 315 LYS C CE    1 
ATOM   7305  N  NZ    . LYS C  1 174 ? 45.708  -14.522 6.777   1.00 59.64  ? 315 LYS C NZ    1 
ATOM   7306  N  N     . GLY C  1 175 ? 52.772  -11.050 9.969   1.00 40.37  ? 316 GLY C N     1 
ATOM   7307  C  CA    . GLY C  1 175 ? 53.554  -10.687 11.139  1.00 41.22  ? 316 GLY C CA    1 
ATOM   7308  C  C     . GLY C  1 175 ? 53.629  -9.182  11.325  1.00 44.71  ? 316 GLY C C     1 
ATOM   7309  O  O     . GLY C  1 175 ? 53.006  -8.428  10.579  1.00 50.85  ? 316 GLY C O     1 
ATOM   7310  N  N     . SER C  1 176 ? 54.381  -8.741  12.326  1.00 40.72  ? 317 SER C N     1 
ATOM   7311  C  CA    . SER C  1 176 ? 54.613  -7.318  12.529  1.00 41.31  ? 317 SER C CA    1 
ATOM   7312  C  C     . SER C  1 176 ? 55.464  -6.786  11.381  1.00 44.85  ? 317 SER C C     1 
ATOM   7313  O  O     . SER C  1 176 ? 56.271  -7.525  10.821  1.00 48.46  ? 317 SER C O     1 
ATOM   7314  C  CB    . SER C  1 176 ? 55.330  -7.093  13.854  1.00 45.83  ? 317 SER C CB    1 
ATOM   7315  O  OG    . SER C  1 176 ? 56.512  -7.871  13.926  1.00 48.49  ? 317 SER C OG    1 
ATOM   7316  N  N     . TRP C  1 177 ? 55.280  -5.516  11.018  1.00 42.79  ? 318 TRP C N     1 
ATOM   7317  C  CA    . TRP C  1 177 ? 56.029  -4.928  9.905   1.00 34.17  ? 318 TRP C CA    1 
ATOM   7318  C  C     . TRP C  1 177 ? 57.516  -4.872  10.226  1.00 34.93  ? 318 TRP C C     1 
ATOM   7319  O  O     . TRP C  1 177 ? 57.893  -4.735  11.390  1.00 35.11  ? 318 TRP C O     1 
ATOM   7320  C  CB    . TRP C  1 177 ? 55.517  -3.524  9.563   1.00 29.07  ? 318 TRP C CB    1 
ATOM   7321  C  CG    . TRP C  1 177 ? 54.172  -3.521  8.919   1.00 28.66  ? 318 TRP C CG    1 
ATOM   7322  C  CD1   . TRP C  1 177 ? 53.326  -4.584  8.788   1.00 29.69  ? 318 TRP C CD1   1 
ATOM   7323  C  CD2   . TRP C  1 177 ? 53.505  -2.401  8.317   1.00 23.92  ? 318 TRP C CD2   1 
ATOM   7324  N  NE1   . TRP C  1 177 ? 52.175  -4.194  8.150   1.00 26.62  ? 318 TRP C NE1   1 
ATOM   7325  C  CE2   . TRP C  1 177 ? 52.261  -2.862  7.848   1.00 24.97  ? 318 TRP C CE2   1 
ATOM   7326  C  CE3   . TRP C  1 177 ? 53.837  -1.057  8.136   1.00 24.14  ? 318 TRP C CE3   1 
ATOM   7327  C  CZ2   . TRP C  1 177 ? 51.350  -2.020  7.202   1.00 25.40  ? 318 TRP C CZ2   1 
ATOM   7328  C  CZ3   . TRP C  1 177 ? 52.932  -0.228  7.494   1.00 24.51  ? 318 TRP C CZ3   1 
ATOM   7329  C  CH2   . TRP C  1 177 ? 51.705  -0.711  7.038   1.00 26.34  ? 318 TRP C CH2   1 
ATOM   7330  N  N     . PRO C  1 178 ? 58.366  -4.999  9.190   1.00 35.01  ? 319 PRO C N     1 
ATOM   7331  C  CA    . PRO C  1 178 ? 59.824  -4.912  9.348   1.00 32.60  ? 319 PRO C CA    1 
ATOM   7332  C  C     . PRO C  1 178 ? 60.235  -3.649  10.101  1.00 34.03  ? 319 PRO C C     1 
ATOM   7333  O  O     . PRO C  1 178 ? 59.593  -2.612  9.942   1.00 35.10  ? 319 PRO C O     1 
ATOM   7334  C  CB    . PRO C  1 178 ? 60.320  -4.844  7.903   1.00 31.82  ? 319 PRO C CB    1 
ATOM   7335  C  CG    . PRO C  1 178 ? 59.272  -5.560  7.110   1.00 28.38  ? 319 PRO C CG    1 
ATOM   7336  C  CD    . PRO C  1 178 ? 57.975  -5.234  7.784   1.00 29.36  ? 319 PRO C CD    1 
ATOM   7337  N  N     . ILE C  1 179 ? 61.299  -3.732  10.893  1.00 37.13  ? 320 ILE C N     1 
ATOM   7338  C  CA    . ILE C  1 179 ? 61.685  -2.642  11.787  1.00 39.58  ? 320 ILE C CA    1 
ATOM   7339  C  C     . ILE C  1 179 ? 62.176  -1.406  11.038  1.00 41.21  ? 320 ILE C C     1 
ATOM   7340  O  O     . ILE C  1 179 ? 62.413  -0.358  11.642  1.00 44.80  ? 320 ILE C O     1 
ATOM   7341  C  CB    . ILE C  1 179 ? 62.778  -3.086  12.783  1.00 45.03  ? 320 ILE C CB    1 
ATOM   7342  C  CG1   . ILE C  1 179 ? 64.160  -3.049  12.126  1.00 46.96  ? 320 ILE C CG1   1 
ATOM   7343  C  CG2   . ILE C  1 179 ? 62.480  -4.480  13.331  1.00 48.27  ? 320 ILE C CG2   1 
ATOM   7344  C  CD1   . ILE C  1 179 ? 65.282  -3.419  13.073  1.00 48.83  ? 320 ILE C CD1   1 
ATOM   7345  N  N     . SER C  1 180 ? 62.329  -1.526  9.724   1.00 40.02  ? 321 SER C N     1 
ATOM   7346  C  CA    . SER C  1 180 ? 62.738  -0.391  8.909   1.00 40.03  ? 321 SER C CA    1 
ATOM   7347  C  C     . SER C  1 180 ? 61.549  0.536   8.682   1.00 41.34  ? 321 SER C C     1 
ATOM   7348  O  O     . SER C  1 180 ? 61.708  1.660   8.202   1.00 46.01  ? 321 SER C O     1 
ATOM   7349  C  CB    . SER C  1 180 ? 63.311  -0.867  7.574   1.00 40.09  ? 321 SER C CB    1 
ATOM   7350  O  OG    . SER C  1 180 ? 62.311  -1.458  6.765   1.00 44.32  ? 321 SER C OG    1 
ATOM   7351  N  N     . THR C  1 181 ? 60.364  0.053   9.049   1.00 36.10  ? 322 THR C N     1 
ATOM   7352  C  CA    . THR C  1 181 ? 59.120  0.802   8.916   1.00 33.99  ? 322 THR C CA    1 
ATOM   7353  C  C     . THR C  1 181 ? 58.647  1.399   10.244  1.00 37.05  ? 322 THR C C     1 
ATOM   7354  O  O     . THR C  1 181 ? 57.590  2.031   10.302  1.00 37.16  ? 322 THR C O     1 
ATOM   7355  C  CB    . THR C  1 181 ? 57.996  -0.101  8.380   1.00 32.63  ? 322 THR C CB    1 
ATOM   7356  O  OG1   . THR C  1 181 ? 57.927  -1.295  9.167   1.00 36.44  ? 322 THR C OG1   1 
ATOM   7357  C  CG2   . THR C  1 181 ? 58.253  -0.483  6.949   1.00 31.62  ? 322 THR C CG2   1 
ATOM   7358  N  N     . LYS C  1 182 ? 59.428  1.192   11.299  1.00 38.65  ? 323 LYS C N     1 
ATOM   7359  C  CA    . LYS C  1 182 ? 59.044  1.583   12.654  1.00 39.29  ? 323 LYS C CA    1 
ATOM   7360  C  C     . LYS C  1 182 ? 58.736  3.072   12.766  1.00 41.29  ? 323 LYS C C     1 
ATOM   7361  O  O     . LYS C  1 182 ? 57.783  3.474   13.447  1.00 38.52  ? 323 LYS C O     1 
ATOM   7362  C  CB    . LYS C  1 182 ? 60.172  1.232   13.621  1.00 40.80  ? 323 LYS C CB    1 
ATOM   7363  C  CG    . LYS C  1 182 ? 59.728  0.992   15.056  1.00 45.34  ? 323 LYS C CG    1 
ATOM   7364  C  CD    . LYS C  1 182 ? 59.183  -0.415  15.218  1.00 47.70  ? 323 LYS C CD    1 
ATOM   7365  C  CE    . LYS C  1 182 ? 58.932  -0.756  16.683  1.00 48.93  ? 323 LYS C CE    1 
ATOM   7366  N  NZ    . LYS C  1 182 ? 57.865  0.082   17.291  1.00 48.66  ? 323 LYS C NZ    1 
ATOM   7367  N  N     . GLU C  1 183 ? 59.551  3.877   12.089  1.00 43.81  ? 324 GLU C N     1 
ATOM   7368  C  CA    . GLU C  1 183 ? 59.447  5.329   12.145  1.00 43.51  ? 324 GLU C CA    1 
ATOM   7369  C  C     . GLU C  1 183 ? 58.760  5.869   10.896  1.00 39.10  ? 324 GLU C C     1 
ATOM   7370  O  O     . GLU C  1 183 ? 58.676  7.084   10.697  1.00 42.32  ? 324 GLU C O     1 
ATOM   7371  C  CB    . GLU C  1 183 ? 60.840  5.948   12.265  1.00 47.70  ? 324 GLU C CB    1 
ATOM   7372  C  CG    . GLU C  1 183 ? 61.705  5.351   13.366  1.00 51.94  ? 324 GLU C CG    1 
ATOM   7373  C  CD    . GLU C  1 183 ? 61.342  5.877   14.732  1.00 59.60  ? 324 GLU C CD    1 
ATOM   7374  O  OE1   . GLU C  1 183 ? 60.804  7.000   14.804  1.00 62.06  ? 324 GLU C OE1   1 
ATOM   7375  O  OE2   . GLU C  1 183 ? 61.596  5.175   15.733  1.00 63.99  ? 324 GLU C OE2   1 
ATOM   7376  N  N     . GLY C  1 184 ? 58.271  4.967   10.052  1.00 31.93  ? 325 GLY C N     1 
ATOM   7377  C  CA    . GLY C  1 184 ? 57.582  5.376   8.843   1.00 30.27  ? 325 GLY C CA    1 
ATOM   7378  C  C     . GLY C  1 184 ? 56.123  5.662   9.128   1.00 36.43  ? 325 GLY C C     1 
ATOM   7379  O  O     . GLY C  1 184 ? 55.695  5.573   10.277  1.00 44.72  ? 325 GLY C O     1 
ATOM   7380  N  N     . LEU C  1 185 ? 55.365  6.005   8.088   1.00 32.60  ? 326 LEU C N     1 
ATOM   7381  C  CA    . LEU C  1 185 ? 53.939  6.310   8.210   1.00 26.59  ? 326 LEU C CA    1 
ATOM   7382  C  C     . LEU C  1 185 ? 53.657  7.352   9.302   1.00 30.94  ? 326 LEU C C     1 
ATOM   7383  O  O     . LEU C  1 185 ? 52.946  7.061   10.257  1.00 41.81  ? 326 LEU C O     1 
ATOM   7384  C  CB    . LEU C  1 185 ? 53.140  5.013   8.443   1.00 25.33  ? 326 LEU C CB    1 
ATOM   7385  C  CG    . LEU C  1 185 ? 51.621  4.933   8.225   1.00 25.28  ? 326 LEU C CG    1 
ATOM   7386  C  CD1   . LEU C  1 185 ? 51.232  5.397   6.834   1.00 23.17  ? 326 LEU C CD1   1 
ATOM   7387  C  CD2   . LEU C  1 185 ? 51.099  3.519   8.467   1.00 19.30  ? 326 LEU C CD2   1 
ATOM   7388  N  N     . PRO C  1 186 ? 54.204  8.578   9.154   1.00 27.07  ? 327 PRO C N     1 
ATOM   7389  C  CA    . PRO C  1 186 ? 54.106  9.624   10.184  1.00 28.13  ? 327 PRO C CA    1 
ATOM   7390  C  C     . PRO C  1 186 ? 52.756  10.346  10.181  1.00 29.68  ? 327 PRO C C     1 
ATOM   7391  O  O     . PRO C  1 186 ? 52.701  11.578  10.125  1.00 27.29  ? 327 PRO C O     1 
ATOM   7392  C  CB    . PRO C  1 186 ? 55.205  10.602  9.772   1.00 27.35  ? 327 PRO C CB    1 
ATOM   7393  C  CG    . PRO C  1 186 ? 55.219  10.505  8.297   1.00 28.32  ? 327 PRO C CG    1 
ATOM   7394  C  CD    . PRO C  1 186 ? 54.961  9.053   7.982   1.00 28.10  ? 327 PRO C CD    1 
ATOM   7395  N  N     . ILE C  1 187 ? 51.678  9.578   10.276  1.00 30.35  ? 328 ILE C N     1 
ATOM   7396  C  CA    . ILE C  1 187 ? 50.335  10.126  10.162  1.00 26.44  ? 328 ILE C CA    1 
ATOM   7397  C  C     . ILE C  1 187 ? 49.697  10.485  11.509  1.00 29.63  ? 328 ILE C C     1 
ATOM   7398  O  O     . ILE C  1 187 ? 48.540  10.906  11.545  1.00 30.96  ? 328 ILE C O     1 
ATOM   7399  C  CB    . ILE C  1 187 ? 49.422  9.143   9.421   1.00 24.42  ? 328 ILE C CB    1 
ATOM   7400  C  CG1   . ILE C  1 187 ? 49.196  7.877   10.255  1.00 22.46  ? 328 ILE C CG1   1 
ATOM   7401  C  CG2   . ILE C  1 187 ? 50.018  8.794   8.066   1.00 23.35  ? 328 ILE C CG2   1 
ATOM   7402  C  CD1   . ILE C  1 187 ? 48.307  6.857   9.569   1.00 23.66  ? 328 ILE C CD1   1 
ATOM   7403  N  N     . GLN C  1 188 ? 50.451  10.336  12.600  1.00 32.77  ? 329 GLN C N     1 
ATOM   7404  C  CA    . GLN C  1 188 ? 49.931  10.563  13.956  1.00 34.15  ? 329 GLN C CA    1 
ATOM   7405  C  C     . GLN C  1 188 ? 49.170  11.877  14.147  1.00 36.34  ? 329 GLN C C     1 
ATOM   7406  O  O     . GLN C  1 188 ? 48.118  11.895  14.783  1.00 44.27  ? 329 GLN C O     1 
ATOM   7407  C  CB    . GLN C  1 188 ? 51.053  10.473  14.997  1.00 35.66  ? 329 GLN C CB    1 
ATOM   7408  C  CG    . GLN C  1 188 ? 51.689  9.088   15.149  1.00 36.55  ? 329 GLN C CG    1 
ATOM   7409  C  CD    . GLN C  1 188 ? 52.868  8.886   14.223  1.00 37.91  ? 329 GLN C CD    1 
ATOM   7410  O  OE1   . GLN C  1 188 ? 52.981  9.545   13.191  1.00 40.49  ? 329 GLN C OE1   1 
ATOM   7411  N  NE2   . GLN C  1 188 ? 53.758  7.976   14.591  1.00 38.51  ? 329 GLN C NE2   1 
ATOM   7412  N  N     . GLY C  1 189 ? 49.689  12.972  13.597  1.00 33.61  ? 330 GLY C N     1 
ATOM   7413  C  CA    . GLY C  1 189 ? 49.049  14.265  13.772  1.00 31.42  ? 330 GLY C CA    1 
ATOM   7414  C  C     . GLY C  1 189 ? 48.040  14.608  12.689  1.00 32.79  ? 330 GLY C C     1 
ATOM   7415  O  O     . GLY C  1 189 ? 47.500  15.721  12.670  1.00 33.50  ? 330 GLY C O     1 
ATOM   7416  N  N     . TRP C  1 190 ? 47.773  13.648  11.804  1.00 31.92  ? 331 TRP C N     1 
ATOM   7417  C  CA    . TRP C  1 190 ? 46.960  13.874  10.609  1.00 31.37  ? 331 TRP C CA    1 
ATOM   7418  C  C     . TRP C  1 190 ? 45.785  12.898  10.542  1.00 34.81  ? 331 TRP C C     1 
ATOM   7419  O  O     . TRP C  1 190 ? 44.629  13.311  10.478  1.00 37.46  ? 331 TRP C O     1 
ATOM   7420  C  CB    . TRP C  1 190 ? 47.847  13.750  9.360   1.00 30.01  ? 331 TRP C CB    1 
ATOM   7421  C  CG    . TRP C  1 190 ? 47.116  13.664  8.040   1.00 26.26  ? 331 TRP C CG    1 
ATOM   7422  C  CD1   . TRP C  1 190 ? 45.945  14.278  7.700   1.00 26.43  ? 331 TRP C CD1   1 
ATOM   7423  C  CD2   . TRP C  1 190 ? 47.520  12.910  6.887   1.00 26.12  ? 331 TRP C CD2   1 
ATOM   7424  N  NE1   . TRP C  1 190 ? 45.597  13.950  6.411   1.00 27.35  ? 331 TRP C NE1   1 
ATOM   7425  C  CE2   . TRP C  1 190 ? 46.548  13.112  5.890   1.00 28.55  ? 331 TRP C CE2   1 
ATOM   7426  C  CE3   . TRP C  1 190 ? 48.610  12.087  6.603   1.00 26.26  ? 331 TRP C CE3   1 
ATOM   7427  C  CZ2   . TRP C  1 190 ? 46.639  12.518  4.626   1.00 31.01  ? 331 TRP C CZ2   1 
ATOM   7428  C  CZ3   . TRP C  1 190 ? 48.697  11.502  5.352   1.00 31.28  ? 331 TRP C CZ3   1 
ATOM   7429  C  CH2   . TRP C  1 190 ? 47.722  11.720  4.381   1.00 30.95  ? 331 TRP C CH2   1 
ATOM   7430  N  N     . LEU C  1 191 ? 46.090  11.604  10.543  1.00 34.99  ? 332 LEU C N     1 
ATOM   7431  C  CA    . LEU C  1 191 ? 45.061  10.574  10.545  1.00 28.28  ? 332 LEU C CA    1 
ATOM   7432  C  C     . LEU C  1 191 ? 44.926  9.962   11.941  1.00 28.74  ? 332 LEU C C     1 
ATOM   7433  O  O     . LEU C  1 191 ? 43.868  9.432   12.299  1.00 31.58  ? 332 LEU C O     1 
ATOM   7434  C  CB    . LEU C  1 191 ? 45.371  9.499   9.504   1.00 24.62  ? 332 LEU C CB    1 
ATOM   7435  C  CG    . LEU C  1 191 ? 45.388  9.996   8.057   1.00 25.53  ? 332 LEU C CG    1 
ATOM   7436  C  CD1   . LEU C  1 191 ? 45.773  8.905   7.068   1.00 27.66  ? 332 LEU C CD1   1 
ATOM   7437  C  CD2   . LEU C  1 191 ? 44.047  10.576  7.695   1.00 24.57  ? 332 LEU C CD2   1 
ATOM   7438  N  N     . GLY C  1 192 ? 45.993  10.034  12.730  1.00 23.17  ? 333 GLY C N     1 
ATOM   7439  C  CA    . GLY C  1 192 ? 45.918  9.619   14.119  1.00 23.73  ? 333 GLY C CA    1 
ATOM   7440  C  C     . GLY C  1 192 ? 46.643  8.333   14.479  1.00 26.03  ? 333 GLY C C     1 
ATOM   7441  O  O     . GLY C  1 192 ? 47.200  7.648   13.626  1.00 26.63  ? 333 GLY C O     1 
ATOM   7442  N  N     . THR C  1 193 ? 46.616  8.005   15.765  1.00 31.28  ? 334 THR C N     1 
ATOM   7443  C  CA    . THR C  1 193 ? 47.347  6.868   16.303  1.00 29.83  ? 334 THR C CA    1 
ATOM   7444  C  C     . THR C  1 193 ? 46.598  5.547   16.122  1.00 34.15  ? 334 THR C C     1 
ATOM   7445  O  O     . THR C  1 193 ? 47.214  4.504   15.885  1.00 40.23  ? 334 THR C O     1 
ATOM   7446  C  CB    . THR C  1 193 ? 47.657  7.088   17.796  1.00 28.09  ? 334 THR C CB    1 
ATOM   7447  O  OG1   . THR C  1 193 ? 46.462  7.488   18.484  1.00 24.41  ? 334 THR C OG1   1 
ATOM   7448  C  CG2   . THR C  1 193 ? 48.705  8.172   17.967  1.00 26.79  ? 334 THR C CG2   1 
ATOM   7449  N  N     . LYS C  1 194 ? 45.274  5.595   16.242  1.00 28.99  ? 335 LYS C N     1 
ATOM   7450  C  CA    . LYS C  1 194 ? 44.441  4.411   16.068  1.00 26.73  ? 335 LYS C CA    1 
ATOM   7451  C  C     . LYS C  1 194 ? 44.419  3.972   14.605  1.00 26.49  ? 335 LYS C C     1 
ATOM   7452  O  O     . LYS C  1 194 ? 44.491  2.780   14.306  1.00 30.67  ? 335 LYS C O     1 
ATOM   7453  C  CB    . LYS C  1 194 ? 43.018  4.675   16.570  1.00 30.49  ? 335 LYS C CB    1 
ATOM   7454  C  CG    . LYS C  1 194 ? 42.943  5.060   18.054  1.00 29.57  ? 335 LYS C CG    1 
ATOM   7455  C  CD    . LYS C  1 194 ? 41.516  5.010   18.607  1.00 23.22  ? 335 LYS C CD    1 
ATOM   7456  C  CE    . LYS C  1 194 ? 40.655  6.170   18.126  1.00 22.88  ? 335 LYS C CE    1 
ATOM   7457  N  NZ    . LYS C  1 194 ? 41.087  7.491   18.655  1.00 20.35  ? 335 LYS C NZ    1 
ATOM   7458  N  N     . VAL C  1 195 ? 44.325  4.940   13.698  1.00 28.40  ? 336 VAL C N     1 
ATOM   7459  C  CA    . VAL C  1 195 ? 44.407  4.672   12.262  1.00 33.03  ? 336 VAL C CA    1 
ATOM   7460  C  C     . VAL C  1 195 ? 45.746  4.021   11.918  1.00 40.22  ? 336 VAL C C     1 
ATOM   7461  O  O     . VAL C  1 195 ? 45.791  3.016   11.207  1.00 43.50  ? 336 VAL C O     1 
ATOM   7462  C  CB    . VAL C  1 195 ? 44.215  5.961   11.432  1.00 35.98  ? 336 VAL C CB    1 
ATOM   7463  C  CG1   . VAL C  1 195 ? 44.763  5.792   10.025  1.00 38.01  ? 336 VAL C CG1   1 
ATOM   7464  C  CG2   . VAL C  1 195 ? 42.743  6.351   11.380  1.00 34.04  ? 336 VAL C CG2   1 
ATOM   7465  N  N     . ARG C  1 196 ? 46.831  4.589   12.436  1.00 39.42  ? 337 ARG C N     1 
ATOM   7466  C  CA    . ARG C  1 196 ? 48.174  4.079   12.167  1.00 38.26  ? 337 ARG C CA    1 
ATOM   7467  C  C     . ARG C  1 196 ? 48.347  2.658   12.697  1.00 41.52  ? 337 ARG C C     1 
ATOM   7468  O  O     . ARG C  1 196 ? 48.754  1.760   11.961  1.00 45.39  ? 337 ARG C O     1 
ATOM   7469  C  CB    . ARG C  1 196 ? 49.234  5.011   12.769  1.00 34.79  ? 337 ARG C CB    1 
ATOM   7470  C  CG    . ARG C  1 196 ? 50.664  4.613   12.436  1.00 31.30  ? 337 ARG C CG    1 
ATOM   7471  C  CD    . ARG C  1 196 ? 51.683  5.651   12.890  1.00 29.53  ? 337 ARG C CD    1 
ATOM   7472  N  NE    . ARG C  1 196 ? 53.021  5.347   12.383  1.00 29.65  ? 337 ARG C NE    1 
ATOM   7473  C  CZ    . ARG C  1 196 ? 53.851  4.471   12.941  1.00 24.55  ? 337 ARG C CZ    1 
ATOM   7474  N  NH1   . ARG C  1 196 ? 53.490  3.800   14.028  1.00 24.47  ? 337 ARG C NH1   1 
ATOM   7475  N  NH2   . ARG C  1 196 ? 55.044  4.258   12.413  1.00 21.85  ? 337 ARG C NH2   1 
ATOM   7476  N  N     . THR C  1 197 ? 48.034  2.472   13.977  1.00 39.85  ? 338 THR C N     1 
ATOM   7477  C  CA    . THR C  1 197 ? 48.091  1.167   14.630  1.00 32.85  ? 338 THR C CA    1 
ATOM   7478  C  C     . THR C  1 197 ? 47.292  0.121   13.855  1.00 35.51  ? 338 THR C C     1 
ATOM   7479  O  O     . THR C  1 197 ? 47.789  -0.983  13.593  1.00 41.33  ? 338 THR C O     1 
ATOM   7480  C  CB    . THR C  1 197 ? 47.567  1.269   16.070  1.00 26.42  ? 338 THR C CB    1 
ATOM   7481  O  OG1   . THR C  1 197 ? 48.474  2.064   16.842  1.00 28.63  ? 338 THR C OG1   1 
ATOM   7482  C  CG2   . THR C  1 197 ? 47.439  -0.099  16.704  1.00 21.57  ? 338 THR C CG2   1 
ATOM   7483  N  N     . ASN C  1 198 ? 46.063  0.477   13.485  1.00 32.43  ? 339 ASN C N     1 
ATOM   7484  C  CA    . ASN C  1 198 ? 45.222  -0.402  12.682  1.00 32.05  ? 339 ASN C CA    1 
ATOM   7485  C  C     . ASN C  1 198 ? 45.856  -0.767  11.340  1.00 35.76  ? 339 ASN C C     1 
ATOM   7486  O  O     . ASN C  1 198 ? 45.850  -1.931  10.953  1.00 39.78  ? 339 ASN C O     1 
ATOM   7487  C  CB    . ASN C  1 198 ? 43.844  0.219   12.459  1.00 32.10  ? 339 ASN C CB    1 
ATOM   7488  C  CG    . ASN C  1 198 ? 42.978  0.193   13.705  1.00 39.24  ? 339 ASN C CG    1 
ATOM   7489  O  OD1   . ASN C  1 198 ? 43.197  -0.605  14.613  1.00 44.25  ? 339 ASN C OD1   1 
ATOM   7490  N  ND2   . ASN C  1 198 ? 41.979  1.066   13.746  1.00 39.29  ? 339 ASN C ND2   1 
ATOM   7491  N  N     . LEU C  1 199 ? 46.391  0.230   10.634  1.00 36.20  ? 340 LEU C N     1 
ATOM   7492  C  CA    . LEU C  1 199 ? 47.030  0.010   9.331   1.00 30.85  ? 340 LEU C CA    1 
ATOM   7493  C  C     . LEU C  1 199 ? 48.255  -0.890  9.452   1.00 28.92  ? 340 LEU C C     1 
ATOM   7494  O  O     . LEU C  1 199 ? 48.552  -1.668  8.549   1.00 32.75  ? 340 LEU C O     1 
ATOM   7495  C  CB    . LEU C  1 199 ? 47.431  1.340   8.683   1.00 31.48  ? 340 LEU C CB    1 
ATOM   7496  C  CG    . LEU C  1 199 ? 46.343  2.259   8.123   1.00 29.34  ? 340 LEU C CG    1 
ATOM   7497  C  CD1   . LEU C  1 199 ? 46.943  3.550   7.596   1.00 27.44  ? 340 LEU C CD1   1 
ATOM   7498  C  CD2   . LEU C  1 199 ? 45.557  1.567   7.031   1.00 25.04  ? 340 LEU C CD2   1 
ATOM   7499  N  N     . ARG C  1 200 ? 48.958  -0.782  10.576  1.00 27.73  ? 341 ARG C N     1 
ATOM   7500  C  CA    . ARG C  1 200 ? 50.127  -1.614  10.837  1.00 24.91  ? 341 ARG C CA    1 
ATOM   7501  C  C     . ARG C  1 200 ? 49.749  -2.972  11.422  1.00 28.68  ? 341 ARG C C     1 
ATOM   7502  O  O     . ARG C  1 200 ? 50.608  -3.838  11.583  1.00 30.00  ? 341 ARG C O     1 
ATOM   7503  C  CB    . ARG C  1 200 ? 51.105  -0.889  11.754  1.00 19.79  ? 341 ARG C CB    1 
ATOM   7504  C  CG    . ARG C  1 200 ? 51.724  0.335   11.113  1.00 20.45  ? 341 ARG C CG    1 
ATOM   7505  C  CD    . ARG C  1 200 ? 52.619  1.095   12.079  1.00 23.87  ? 341 ARG C CD    1 
ATOM   7506  N  NE    . ARG C  1 200 ? 53.497  0.211   12.840  1.00 25.89  ? 341 ARG C NE    1 
ATOM   7507  C  CZ    . ARG C  1 200 ? 54.687  -0.200  12.423  1.00 22.89  ? 341 ARG C CZ    1 
ATOM   7508  N  NH1   . ARG C  1 200 ? 55.149  0.177   11.243  1.00 28.96  ? 341 ARG C NH1   1 
ATOM   7509  N  NH2   . ARG C  1 200 ? 55.416  -0.996  13.184  1.00 23.55  ? 341 ARG C NH2   1 
ATOM   7510  N  N     . ARG C  1 201 ? 48.469  -3.156  11.743  1.00 30.21  ? 342 ARG C N     1 
ATOM   7511  C  CA    . ARG C  1 201 ? 47.965  -4.478  12.101  1.00 30.79  ? 342 ARG C CA    1 
ATOM   7512  C  C     . ARG C  1 201 ? 47.681  -5.264  10.829  1.00 34.94  ? 342 ARG C C     1 
ATOM   7513  O  O     . ARG C  1 201 ? 47.490  -6.478  10.861  1.00 36.61  ? 342 ARG C O     1 
ATOM   7514  C  CB    . ARG C  1 201 ? 46.687  -4.369  12.927  1.00 30.94  ? 342 ARG C CB    1 
ATOM   7515  C  CG    . ARG C  1 201 ? 46.918  -4.160  14.410  1.00 29.34  ? 342 ARG C CG    1 
ATOM   7516  C  CD    . ARG C  1 201 ? 45.628  -3.794  15.105  1.00 30.81  ? 342 ARG C CD    1 
ATOM   7517  N  NE    . ARG C  1 201 ? 45.744  -3.881  16.554  1.00 31.30  ? 342 ARG C NE    1 
ATOM   7518  C  CZ    . ARG C  1 201 ? 44.967  -3.222  17.403  1.00 34.75  ? 342 ARG C CZ    1 
ATOM   7519  N  NH1   . ARG C  1 201 ? 44.019  -2.416  16.951  1.00 35.17  ? 342 ARG C NH1   1 
ATOM   7520  N  NH2   . ARG C  1 201 ? 45.146  -3.360  18.707  1.00 38.88  ? 342 ARG C NH2   1 
ATOM   7521  N  N     . GLU C  1 202 ? 47.653  -4.555  9.706   1.00 36.32  ? 343 GLU C N     1 
ATOM   7522  C  CA    . GLU C  1 202 ? 47.409  -5.170  8.409   1.00 36.33  ? 343 GLU C CA    1 
ATOM   7523  C  C     . GLU C  1 202 ? 48.671  -5.872  7.915   1.00 38.44  ? 343 GLU C C     1 
ATOM   7524  O  O     . GLU C  1 202 ? 49.775  -5.548  8.359   1.00 42.16  ? 343 GLU C O     1 
ATOM   7525  C  CB    . GLU C  1 202 ? 46.973  -4.106  7.400   1.00 36.79  ? 343 GLU C CB    1 
ATOM   7526  C  CG    . GLU C  1 202 ? 45.637  -3.443  7.716   1.00 38.11  ? 343 GLU C CG    1 
ATOM   7527  C  CD    . GLU C  1 202 ? 44.467  -4.370  7.492   1.00 42.75  ? 343 GLU C CD    1 
ATOM   7528  O  OE1   . GLU C  1 202 ? 44.405  -4.992  6.415   1.00 42.91  ? 343 GLU C OE1   1 
ATOM   7529  O  OE2   . GLU C  1 202 ? 43.606  -4.476  8.386   1.00 47.33  ? 343 GLU C OE2   1 
ATOM   7530  N  N     . PRO C  1 203 ? 48.512  -6.849  7.005   1.00 35.35  ? 344 PRO C N     1 
ATOM   7531  C  CA    . PRO C  1 203 ? 49.675  -7.563  6.464   1.00 34.90  ? 344 PRO C CA    1 
ATOM   7532  C  C     . PRO C  1 203 ? 50.623  -6.650  5.690   1.00 35.16  ? 344 PRO C C     1 
ATOM   7533  O  O     . PRO C  1 203 ? 50.217  -5.566  5.275   1.00 35.49  ? 344 PRO C O     1 
ATOM   7534  C  CB    . PRO C  1 203 ? 49.047  -8.559  5.483   1.00 33.08  ? 344 PRO C CB    1 
ATOM   7535  C  CG    . PRO C  1 203 ? 47.630  -8.713  5.918   1.00 31.25  ? 344 PRO C CG    1 
ATOM   7536  C  CD    . PRO C  1 203 ? 47.238  -7.391  6.493   1.00 33.18  ? 344 PRO C CD    1 
ATOM   7537  N  N     . PHE C  1 204 ? 51.867  -7.083  5.503   1.00 38.18  ? 345 PHE C N     1 
ATOM   7538  C  CA    . PHE C  1 204 ? 52.775  -6.392  4.591   1.00 37.76  ? 345 PHE C CA    1 
ATOM   7539  C  C     . PHE C  1 204 ? 53.068  -7.271  3.381   1.00 37.94  ? 345 PHE C C     1 
ATOM   7540  O  O     . PHE C  1 204 ? 52.904  -8.498  3.441   1.00 36.06  ? 345 PHE C O     1 
ATOM   7541  C  CB    . PHE C  1 204 ? 54.069  -5.948  5.284   1.00 33.12  ? 345 PHE C CB    1 
ATOM   7542  C  CG    . PHE C  1 204 ? 54.930  -7.079  5.774   1.00 27.79  ? 345 PHE C CG    1 
ATOM   7543  C  CD1   . PHE C  1 204 ? 54.835  -7.512  7.085   1.00 28.30  ? 345 PHE C CD1   1 
ATOM   7544  C  CD2   . PHE C  1 204 ? 55.866  -7.678  4.941   1.00 25.83  ? 345 PHE C CD2   1 
ATOM   7545  C  CE1   . PHE C  1 204 ? 55.633  -8.531  7.551   1.00 29.23  ? 345 PHE C CE1   1 
ATOM   7546  C  CE2   . PHE C  1 204 ? 56.667  -8.703  5.402   1.00 24.95  ? 345 PHE C CE2   1 
ATOM   7547  C  CZ    . PHE C  1 204 ? 56.552  -9.126  6.710   1.00 27.63  ? 345 PHE C CZ    1 
ATOM   7548  N  N     . TYR C  1 205 ? 53.494  -6.648  2.284   1.00 37.22  ? 346 TYR C N     1 
ATOM   7549  C  CA    . TYR C  1 205 ? 53.653  -7.375  1.028   1.00 35.74  ? 346 TYR C CA    1 
ATOM   7550  C  C     . TYR C  1 205 ? 55.072  -7.298  0.445   1.00 34.70  ? 346 TYR C C     1 
ATOM   7551  O  O     . TYR C  1 205 ? 55.777  -6.299  0.618   1.00 36.98  ? 346 TYR C O     1 
ATOM   7552  C  CB    . TYR C  1 205 ? 52.606  -6.909  0.006   1.00 34.13  ? 346 TYR C CB    1 
ATOM   7553  C  CG    . TYR C  1 205 ? 51.173  -7.150  0.441   1.00 30.86  ? 346 TYR C CG    1 
ATOM   7554  C  CD1   . TYR C  1 205 ? 50.534  -6.281  1.309   1.00 32.44  ? 346 TYR C CD1   1 
ATOM   7555  C  CD2   . TYR C  1 205 ? 50.460  -8.243  -0.025  1.00 31.64  ? 346 TYR C CD2   1 
ATOM   7556  C  CE1   . TYR C  1 205 ? 49.232  -6.497  1.707   1.00 32.45  ? 346 TYR C CE1   1 
ATOM   7557  C  CE2   . TYR C  1 205 ? 49.155  -8.465  0.368   1.00 30.94  ? 346 TYR C CE2   1 
ATOM   7558  C  CZ    . TYR C  1 205 ? 48.548  -7.590  1.234   1.00 32.87  ? 346 TYR C CZ    1 
ATOM   7559  O  OH    . TYR C  1 205 ? 47.250  -7.810  1.627   1.00 38.16  ? 346 TYR C OH    1 
ATOM   7560  N  N     . LEU C  1 206 ? 55.481  -8.363  -0.241  1.00 31.67  ? 347 LEU C N     1 
ATOM   7561  C  CA    . LEU C  1 206 ? 56.804  -8.424  -0.860  1.00 28.97  ? 347 LEU C CA    1 
ATOM   7562  C  C     . LEU C  1 206 ? 56.700  -8.771  -2.341  1.00 28.74  ? 347 LEU C C     1 
ATOM   7563  O  O     . LEU C  1 206 ? 56.167  -9.821  -2.698  1.00 31.51  ? 347 LEU C O     1 
ATOM   7564  C  CB    . LEU C  1 206 ? 57.681  -9.458  -0.155  1.00 31.22  ? 347 LEU C CB    1 
ATOM   7565  C  CG    . LEU C  1 206 ? 58.249  -9.067  1.208   1.00 33.21  ? 347 LEU C CG    1 
ATOM   7566  C  CD1   . LEU C  1 206 ? 58.718  -10.288 1.974   1.00 32.51  ? 347 LEU C CD1   1 
ATOM   7567  C  CD2   . LEU C  1 206 ? 59.396  -8.096  1.038   1.00 35.34  ? 347 LEU C CD2   1 
ATOM   7568  N  N     . VAL C  1 207 ? 57.218  -7.893  -3.196  1.00 27.13  ? 348 VAL C N     1 
ATOM   7569  C  CA    . VAL C  1 207 ? 57.156  -8.094  -4.642  1.00 31.01  ? 348 VAL C CA    1 
ATOM   7570  C  C     . VAL C  1 207 ? 58.556  -8.254  -5.232  1.00 31.13  ? 348 VAL C C     1 
ATOM   7571  O  O     . VAL C  1 207 ? 59.518  -7.728  -4.684  1.00 32.77  ? 348 VAL C O     1 
ATOM   7572  C  CB    . VAL C  1 207 ? 56.422  -6.933  -5.334  1.00 34.32  ? 348 VAL C CB    1 
ATOM   7573  C  CG1   . VAL C  1 207 ? 55.020  -6.792  -4.771  1.00 35.38  ? 348 VAL C CG1   1 
ATOM   7574  C  CG2   . VAL C  1 207 ? 57.188  -5.639  -5.149  1.00 32.68  ? 348 VAL C CG2   1 
ATOM   7575  N  N     . PRO C  1 208 ? 58.678  -8.995  -6.349  1.00 29.37  ? 349 PRO C N     1 
ATOM   7576  C  CA    . PRO C  1 208 ? 60.013  -9.179  -6.930  1.00 26.56  ? 349 PRO C CA    1 
ATOM   7577  C  C     . PRO C  1 208 ? 60.635  -7.850  -7.330  1.00 29.40  ? 349 PRO C C     1 
ATOM   7578  O  O     . PRO C  1 208 ? 59.989  -7.090  -8.051  1.00 32.33  ? 349 PRO C O     1 
ATOM   7579  C  CB    . PRO C  1 208 ? 59.730  -10.002 -8.188  1.00 21.20  ? 349 PRO C CB    1 
ATOM   7580  C  CG    . PRO C  1 208 ? 58.459  -10.722 -7.894  1.00 20.58  ? 349 PRO C CG    1 
ATOM   7581  C  CD    . PRO C  1 208 ? 57.648  -9.761  -7.078  1.00 24.11  ? 349 PRO C CD    1 
ATOM   7582  N  N     . LYS C  1 209 ? 61.852  -7.572  -6.868  1.00 27.28  ? 350 LYS C N     1 
ATOM   7583  C  CA    . LYS C  1 209 ? 62.560  -6.377  -7.302  1.00 33.15  ? 350 LYS C CA    1 
ATOM   7584  C  C     . LYS C  1 209 ? 62.784  -6.464  -8.807  1.00 38.92  ? 350 LYS C C     1 
ATOM   7585  O  O     . LYS C  1 209 ? 62.593  -5.485  -9.531  1.00 39.43  ? 350 LYS C O     1 
ATOM   7586  C  CB    . LYS C  1 209 ? 63.893  -6.232  -6.571  1.00 33.43  ? 350 LYS C CB    1 
ATOM   7587  C  CG    . LYS C  1 209 ? 64.647  -4.947  -6.926  1.00 34.37  ? 350 LYS C CG    1 
ATOM   7588  C  CD    . LYS C  1 209 ? 66.014  -4.896  -6.255  1.00 36.57  ? 350 LYS C CD    1 
ATOM   7589  C  CE    . LYS C  1 209 ? 66.739  -3.595  -6.567  1.00 39.31  ? 350 LYS C CE    1 
ATOM   7590  N  NZ    . LYS C  1 209 ? 68.182  -3.830  -6.843  1.00 40.99  ? 350 LYS C NZ    1 
ATOM   7591  N  N     . ASN C  1 210 ? 63.181  -7.652  -9.258  1.00 40.64  ? 351 ASN C N     1 
ATOM   7592  C  CA    . ASN C  1 210 ? 63.328  -7.969  -10.677 1.00 43.90  ? 351 ASN C CA    1 
ATOM   7593  C  C     . ASN C  1 210 ? 64.235  -7.021  -11.448 1.00 45.71  ? 351 ASN C C     1 
ATOM   7594  O  O     . ASN C  1 210 ? 63.934  -6.645  -12.579 1.00 47.45  ? 351 ASN C O     1 
ATOM   7595  C  CB    . ASN C  1 210 ? 61.963  -8.087  -11.364 1.00 45.52  ? 351 ASN C CB    1 
ATOM   7596  C  CG    . ASN C  1 210 ? 61.996  -9.012  -12.567 1.00 47.31  ? 351 ASN C CG    1 
ATOM   7597  O  OD1   . ASN C  1 210 ? 62.703  -10.020 -12.570 1.00 50.13  ? 351 ASN C OD1   1 
ATOM   7598  N  ND2   . ASN C  1 210 ? 61.230  -8.673  -13.598 1.00 46.41  ? 351 ASN C ND2   1 
ATOM   7599  N  N     . ALA C  1 211 ? 65.346  -6.636  -10.832 1.00 46.98  ? 352 ALA C N     1 
ATOM   7600  C  CA    . ALA C  1 211 ? 66.386  -5.920  -11.553 1.00 48.49  ? 352 ALA C CA    1 
ATOM   7601  C  C     . ALA C  1 211 ? 67.170  -6.914  -12.401 1.00 50.77  ? 352 ALA C C     1 
ATOM   7602  O  O     . ALA C  1 211 ? 67.276  -8.094  -12.058 1.00 50.04  ? 352 ALA C O     1 
ATOM   7603  C  CB    . ALA C  1 211 ? 67.304  -5.199  -10.591 1.00 45.41  ? 352 ALA C CB    1 
ATOM   7604  N  N     . LYS C  1 212 ? 67.706  -6.437  -13.516 1.00 53.74  ? 353 LYS C N     1 
ATOM   7605  C  CA    . LYS C  1 212 ? 68.555  -7.270  -14.349 1.00 57.15  ? 353 LYS C CA    1 
ATOM   7606  C  C     . LYS C  1 212 ? 69.949  -6.660  -14.402 1.00 55.60  ? 353 LYS C C     1 
ATOM   7607  O  O     . LYS C  1 212 ? 70.673  -6.821  -15.385 1.00 56.60  ? 353 LYS C O     1 
ATOM   7608  C  CB    . LYS C  1 212 ? 67.972  -7.417  -15.757 1.00 57.74  ? 353 LYS C CB    1 
ATOM   7609  C  CG    . LYS C  1 212 ? 66.515  -7.880  -15.806 1.00 57.23  ? 353 LYS C CG    1 
ATOM   7610  C  CD    . LYS C  1 212 ? 66.313  -9.255  -15.183 1.00 59.02  ? 353 LYS C CD    1 
ATOM   7611  C  CE    . LYS C  1 212 ? 64.913  -9.780  -15.492 1.00 62.50  ? 353 LYS C CE    1 
ATOM   7612  N  NZ    . LYS C  1 212 ? 64.655  -11.125 -14.905 1.00 64.53  ? 353 LYS C NZ    1 
ATOM   7613  N  N     . ASP C  1 213 ? 70.319  -5.970  -13.327 1.00 52.79  ? 354 ASP C N     1 
ATOM   7614  C  CA    . ASP C  1 213 ? 71.603  -5.278  -13.249 1.00 52.71  ? 354 ASP C CA    1 
ATOM   7615  C  C     . ASP C  1 213 ? 72.792  -6.235  -13.265 1.00 50.49  ? 354 ASP C C     1 
ATOM   7616  O  O     . ASP C  1 213 ? 73.918  -5.826  -13.556 1.00 48.93  ? 354 ASP C O     1 
ATOM   7617  C  CB    . ASP C  1 213 ? 71.656  -4.388  -12.006 1.00 54.86  ? 354 ASP C CB    1 
ATOM   7618  C  CG    . ASP C  1 213 ? 71.005  -5.032  -10.800 1.00 56.87  ? 354 ASP C CG    1 
ATOM   7619  O  OD1   . ASP C  1 213 ? 70.900  -6.277  -10.763 1.00 57.65  ? 354 ASP C OD1   1 
ATOM   7620  O  OD2   . ASP C  1 213 ? 70.601  -4.290  -9.884  1.00 57.04  ? 354 ASP C OD2   1 
ATOM   7621  N  N     . GLY C  1 214 ? 72.539  -7.502  -12.946 1.00 49.74  ? 355 GLY C N     1 
ATOM   7622  C  CA    . GLY C  1 214 ? 73.581  -8.513  -12.975 1.00 46.06  ? 355 GLY C CA    1 
ATOM   7623  C  C     . GLY C  1 214 ? 74.277  -8.722  -11.644 1.00 44.88  ? 355 GLY C C     1 
ATOM   7624  O  O     . GLY C  1 214 ? 75.036  -9.676  -11.484 1.00 48.27  ? 355 GLY C O     1 
ATOM   7625  N  N     . ASN C  1 215 ? 74.020  -7.835  -10.689 1.00 43.34  ? 356 ASN C N     1 
ATOM   7626  C  CA    . ASN C  1 215 ? 74.683  -7.891  -9.389  1.00 48.33  ? 356 ASN C CA    1 
ATOM   7627  C  C     . ASN C  1 215 ? 74.319  -9.131  -8.565  1.00 50.60  ? 356 ASN C C     1 
ATOM   7628  O  O     . ASN C  1 215 ? 73.612  -10.020 -9.041  1.00 52.28  ? 356 ASN C O     1 
ATOM   7629  C  CB    . ASN C  1 215 ? 74.372  -6.631  -8.578  1.00 50.34  ? 356 ASN C CB    1 
ATOM   7630  C  CG    . ASN C  1 215 ? 74.476  -5.364  -9.402  1.00 50.99  ? 356 ASN C CG    1 
ATOM   7631  O  OD1   . ASN C  1 215 ? 75.131  -5.339  -10.443 1.00 55.16  ? 356 ASN C OD1   1 
ATOM   7632  N  ND2   . ASN C  1 215 ? 73.829  -4.299  -8.935  1.00 47.47  ? 356 ASN C ND2   1 
ATOM   7633  N  N     . SER C  1 216 ? 74.795  -9.177  -7.323  1.00 48.10  ? 357 SER C N     1 
ATOM   7634  C  CA    . SER C  1 216 ? 74.546  -10.320 -6.443  1.00 45.90  ? 357 SER C CA    1 
ATOM   7635  C  C     . SER C  1 216 ? 73.129  -10.329 -5.866  1.00 46.43  ? 357 SER C C     1 
ATOM   7636  O  O     . SER C  1 216 ? 72.541  -9.271  -5.637  1.00 48.11  ? 357 SER C O     1 
ATOM   7637  C  CB    . SER C  1 216 ? 75.564  -10.345 -5.304  1.00 42.87  ? 357 SER C CB    1 
ATOM   7638  O  OG    . SER C  1 216 ? 76.879  -10.467 -5.802  1.00 40.45  ? 357 SER C OG    1 
ATOM   7639  N  N     . PHE C  1 217 ? 72.593  -11.527 -5.636  1.00 42.77  ? 358 PHE C N     1 
ATOM   7640  C  CA    . PHE C  1 217 ? 71.241  -11.707 -5.108  1.00 39.48  ? 358 PHE C CA    1 
ATOM   7641  C  C     . PHE C  1 217 ? 70.195  -11.084 -6.022  1.00 40.65  ? 358 PHE C C     1 
ATOM   7642  O  O     . PHE C  1 217 ? 69.108  -10.713 -5.586  1.00 40.10  ? 358 PHE C O     1 
ATOM   7643  C  CB    . PHE C  1 217 ? 71.130  -11.175 -3.673  1.00 39.98  ? 358 PHE C CB    1 
ATOM   7644  C  CG    . PHE C  1 217 ? 72.177  -11.720 -2.749  1.00 40.41  ? 358 PHE C CG    1 
ATOM   7645  C  CD1   . PHE C  1 217 ? 72.098  -13.025 -2.283  1.00 39.00  ? 358 PHE C CD1   1 
ATOM   7646  C  CD2   . PHE C  1 217 ? 73.250  -10.932 -2.358  1.00 40.32  ? 358 PHE C CD2   1 
ATOM   7647  C  CE1   . PHE C  1 217 ? 73.068  -13.535 -1.437  1.00 38.77  ? 358 PHE C CE1   1 
ATOM   7648  C  CE2   . PHE C  1 217 ? 74.221  -11.433 -1.513  1.00 41.70  ? 358 PHE C CE2   1 
ATOM   7649  C  CZ    . PHE C  1 217 ? 74.127  -12.738 -1.052  1.00 42.43  ? 358 PHE C CZ    1 
ATOM   7650  N  N     . GLN C  1 218 ? 70.549  -10.996 -7.299  1.00 44.35  ? 359 GLN C N     1 
ATOM   7651  C  CA    . GLN C  1 218 ? 69.706  -10.423 -8.339  1.00 45.16  ? 359 GLN C CA    1 
ATOM   7652  C  C     . GLN C  1 218 ? 68.298  -11.018 -8.358  1.00 45.87  ? 359 GLN C C     1 
ATOM   7653  O  O     . GLN C  1 218 ? 67.310  -10.284 -8.302  1.00 47.00  ? 359 GLN C O     1 
ATOM   7654  C  CB    . GLN C  1 218 ? 70.381  -10.630 -9.697  1.00 44.37  ? 359 GLN C CB    1 
ATOM   7655  C  CG    . GLN C  1 218 ? 69.619  -10.091 -10.892 1.00 46.19  ? 359 GLN C CG    1 
ATOM   7656  C  CD    . GLN C  1 218 ? 70.106  -10.697 -12.190 1.00 49.52  ? 359 GLN C CD    1 
ATOM   7657  O  OE1   . GLN C  1 218 ? 70.638  -11.806 -12.205 1.00 49.49  ? 359 GLN C OE1   1 
ATOM   7658  N  NE2   . GLN C  1 218 ? 69.930  -9.976  -13.286 1.00 53.17  ? 359 GLN C NE2   1 
ATOM   7659  N  N     . GLY C  1 219 ? 68.210  -12.345 -8.421  1.00 44.53  ? 360 GLY C N     1 
ATOM   7660  C  CA    . GLY C  1 219 ? 66.926  -13.016 -8.532  1.00 38.74  ? 360 GLY C CA    1 
ATOM   7661  C  C     . GLY C  1 219 ? 66.364  -13.589 -7.244  1.00 41.34  ? 360 GLY C C     1 
ATOM   7662  O  O     . GLY C  1 219 ? 65.473  -14.442 -7.278  1.00 43.61  ? 360 GLY C O     1 
ATOM   7663  N  N     . GLU C  1 220 ? 66.878  -13.128 -6.109  1.00 43.93  ? 361 GLU C N     1 
ATOM   7664  C  CA    . GLU C  1 220 ? 66.356  -13.549 -4.816  1.00 43.08  ? 361 GLU C CA    1 
ATOM   7665  C  C     . GLU C  1 220 ? 65.994  -12.329 -3.980  1.00 39.93  ? 361 GLU C C     1 
ATOM   7666  O  O     . GLU C  1 220 ? 65.660  -12.450 -2.799  1.00 35.87  ? 361 GLU C O     1 
ATOM   7667  C  CB    . GLU C  1 220 ? 67.375  -14.409 -4.064  1.00 43.65  ? 361 GLU C CB    1 
ATOM   7668  C  CG    . GLU C  1 220 ? 67.926  -15.584 -4.850  1.00 43.44  ? 361 GLU C CG    1 
ATOM   7669  C  CD    . GLU C  1 220 ? 69.097  -15.199 -5.727  1.00 44.15  ? 361 GLU C CD    1 
ATOM   7670  O  OE1   . GLU C  1 220 ? 69.034  -15.443 -6.949  1.00 47.43  ? 361 GLU C OE1   1 
ATOM   7671  O  OE2   . GLU C  1 220 ? 70.087  -14.665 -5.193  1.00 41.39  ? 361 GLU C OE2   1 
ATOM   7672  N  N     . THR C  1 221 ? 66.065  -11.155 -4.602  1.00 39.58  ? 362 THR C N     1 
ATOM   7673  C  CA    . THR C  1 221 ? 65.777  -9.904  -3.907  1.00 40.88  ? 362 THR C CA    1 
ATOM   7674  C  C     . THR C  1 221 ? 64.320  -9.474  -4.062  1.00 40.07  ? 362 THR C C     1 
ATOM   7675  O  O     . THR C  1 221 ? 63.808  -9.344  -5.180  1.00 41.00  ? 362 THR C O     1 
ATOM   7676  C  CB    . THR C  1 221 ? 66.714  -8.764  -4.357  1.00 43.70  ? 362 THR C CB    1 
ATOM   7677  O  OG1   . THR C  1 221 ? 68.042  -9.029  -3.890  1.00 41.24  ? 362 THR C OG1   1 
ATOM   7678  C  CG2   . THR C  1 221 ? 66.249  -7.435  -3.786  1.00 45.74  ? 362 THR C CG2   1 
ATOM   7679  N  N     . TRP C  1 222 ? 63.667  -9.256  -2.924  1.00 39.05  ? 363 TRP C N     1 
ATOM   7680  C  CA    . TRP C  1 222 ? 62.292  -8.788  -2.881  1.00 38.08  ? 363 TRP C CA    1 
ATOM   7681  C  C     . TRP C  1 222 ? 62.248  -7.364  -2.341  1.00 40.39  ? 363 TRP C C     1 
ATOM   7682  O  O     . TRP C  1 222 ? 63.208  -6.892  -1.714  1.00 46.19  ? 363 TRP C O     1 
ATOM   7683  C  CB    . TRP C  1 222 ? 61.459  -9.705  -1.990  1.00 39.74  ? 363 TRP C CB    1 
ATOM   7684  C  CG    . TRP C  1 222 ? 61.427  -11.132 -2.452  1.00 35.89  ? 363 TRP C CG    1 
ATOM   7685  C  CD1   . TRP C  1 222 ? 62.396  -12.075 -2.272  1.00 37.35  ? 363 TRP C CD1   1 
ATOM   7686  C  CD2   . TRP C  1 222 ? 60.363  -11.781 -3.161  1.00 32.97  ? 363 TRP C CD2   1 
ATOM   7687  N  NE1   . TRP C  1 222 ? 62.003  -13.270 -2.833  1.00 36.58  ? 363 TRP C NE1   1 
ATOM   7688  C  CE2   . TRP C  1 222 ? 60.758  -13.113 -3.384  1.00 33.55  ? 363 TRP C CE2   1 
ATOM   7689  C  CE3   . TRP C  1 222 ? 59.118  -11.361 -3.629  1.00 32.21  ? 363 TRP C CE3   1 
ATOM   7690  C  CZ2   . TRP C  1 222 ? 59.949  -14.026 -4.059  1.00 29.94  ? 363 TRP C CZ2   1 
ATOM   7691  C  CZ3   . TRP C  1 222 ? 58.320  -12.266 -4.294  1.00 32.22  ? 363 TRP C CZ3   1 
ATOM   7692  C  CH2   . TRP C  1 222 ? 58.736  -13.582 -4.504  1.00 32.27  ? 363 TRP C CH2   1 
ATOM   7693  N  N     . ARG C  1 223 ? 61.121  -6.696  -2.576  1.00 38.65  ? 364 ARG C N     1 
ATOM   7694  C  CA    . ARG C  1 223 ? 60.917  -5.300  -2.198  1.00 38.18  ? 364 ARG C CA    1 
ATOM   7695  C  C     . ARG C  1 223 ? 59.575  -5.128  -1.480  1.00 35.52  ? 364 ARG C C     1 
ATOM   7696  O  O     . ARG C  1 223 ? 58.572  -5.715  -1.882  1.00 35.48  ? 364 ARG C O     1 
ATOM   7697  C  CB    . ARG C  1 223 ? 60.943  -4.419  -3.445  1.00 36.76  ? 364 ARG C CB    1 
ATOM   7698  C  CG    . ARG C  1 223 ? 60.787  -2.936  -3.165  1.00 46.11  ? 364 ARG C CG    1 
ATOM   7699  C  CD    . ARG C  1 223 ? 60.465  -2.178  -4.437  1.00 51.34  ? 364 ARG C CD    1 
ATOM   7700  N  NE    . ARG C  1 223 ? 59.149  -2.536  -4.950  1.00 55.27  ? 364 ARG C NE    1 
ATOM   7701  C  CZ    . ARG C  1 223 ? 58.727  -2.251  -6.175  1.00 57.82  ? 364 ARG C CZ    1 
ATOM   7702  N  NH1   . ARG C  1 223 ? 59.526  -1.612  -7.014  1.00 61.93  ? 364 ARG C NH1   1 
ATOM   7703  N  NH2   . ARG C  1 223 ? 57.511  -2.610  -6.564  1.00 55.78  ? 364 ARG C NH2   1 
ATOM   7704  N  N     . LEU C  1 224 ? 59.552  -4.327  -0.419  1.00 32.96  ? 365 LEU C N     1 
ATOM   7705  C  CA    . LEU C  1 224 ? 58.303  -4.072  0.297   1.00 36.67  ? 365 LEU C CA    1 
ATOM   7706  C  C     . LEU C  1 224 ? 57.320  -3.298  -0.585  1.00 38.24  ? 365 LEU C C     1 
ATOM   7707  O  O     . LEU C  1 224 ? 57.729  -2.465  -1.400  1.00 35.80  ? 365 LEU C O     1 
ATOM   7708  C  CB    . LEU C  1 224 ? 58.559  -3.319  1.609   1.00 36.40  ? 365 LEU C CB    1 
ATOM   7709  C  CG    . LEU C  1 224 ? 59.390  -3.991  2.709   1.00 34.77  ? 365 LEU C CG    1 
ATOM   7710  C  CD1   . LEU C  1 224 ? 59.789  -3.004  3.804   1.00 28.66  ? 365 LEU C CD1   1 
ATOM   7711  C  CD2   . LEU C  1 224 ? 58.651  -5.169  3.317   1.00 36.66  ? 365 LEU C CD2   1 
ATOM   7712  N  N     . SER C  1 225 ? 56.028  -3.595  -0.440  1.00 40.64  ? 366 SER C N     1 
ATOM   7713  C  CA    . SER C  1 225 ? 54.979  -2.830  -1.122  1.00 38.15  ? 366 SER C CA    1 
ATOM   7714  C  C     . SER C  1 225 ? 53.889  -2.430  -0.129  1.00 39.54  ? 366 SER C C     1 
ATOM   7715  O  O     . SER C  1 225 ? 53.497  -3.229  0.724   1.00 42.92  ? 366 SER C O     1 
ATOM   7716  C  CB    . SER C  1 225 ? 54.377  -3.634  -2.276  1.00 37.98  ? 366 SER C CB    1 
ATOM   7717  O  OG    . SER C  1 225 ? 53.507  -2.833  -3.055  1.00 42.11  ? 366 SER C OG    1 
ATOM   7718  N  N     . PHE C  1 226 ? 53.407  -1.195  -0.230  1.00 38.70  ? 367 PHE C N     1 
ATOM   7719  C  CA    . PHE C  1 226 ? 52.396  -0.707  0.699   1.00 32.76  ? 367 PHE C CA    1 
ATOM   7720  C  C     . PHE C  1 226 ? 51.224  -0.088  -0.038  1.00 28.36  ? 367 PHE C C     1 
ATOM   7721  O  O     . PHE C  1 226 ? 50.547  0.787   0.488   1.00 35.86  ? 367 PHE C O     1 
ATOM   7722  C  CB    . PHE C  1 226 ? 53.007  0.303   1.672   1.00 30.97  ? 367 PHE C CB    1 
ATOM   7723  C  CG    . PHE C  1 226 ? 53.977  -0.305  2.638   1.00 33.48  ? 367 PHE C CG    1 
ATOM   7724  C  CD1   . PHE C  1 226 ? 53.526  -1.086  3.692   1.00 33.41  ? 367 PHE C CD1   1 
ATOM   7725  C  CD2   . PHE C  1 226 ? 55.340  -0.104  2.491   1.00 37.77  ? 367 PHE C CD2   1 
ATOM   7726  C  CE1   . PHE C  1 226 ? 54.416  -1.654  4.585   1.00 33.77  ? 367 PHE C CE1   1 
ATOM   7727  C  CE2   . PHE C  1 226 ? 56.236  -0.667  3.381   1.00 38.63  ? 367 PHE C CE2   1 
ATOM   7728  C  CZ    . PHE C  1 226 ? 55.772  -1.443  4.430   1.00 35.22  ? 367 PHE C CZ    1 
ATOM   7729  N  N     . SER C  1 227 ? 50.985  -0.570  -1.251  1.00 26.71  ? 368 SER C N     1 
ATOM   7730  C  CA    . SER C  1 227 ? 49.938  -0.046  -2.115  1.00 29.63  ? 368 SER C CA    1 
ATOM   7731  C  C     . SER C  1 227 ? 48.544  -0.124  -1.503  1.00 31.69  ? 368 SER C C     1 
ATOM   7732  O  O     . SER C  1 227 ? 47.695  0.724   -1.780  1.00 31.78  ? 368 SER C O     1 
ATOM   7733  C  CB    . SER C  1 227 ? 49.967  -0.776  -3.451  1.00 31.95  ? 368 SER C CB    1 
ATOM   7734  O  OG    . SER C  1 227 ? 51.279  -0.798  -3.979  1.00 29.80  ? 368 SER C OG    1 
ATOM   7735  N  N     . HIS C  1 228 ? 48.315  -1.134  -0.670  1.00 33.87  ? 369 HIS C N     1 
ATOM   7736  C  CA    . HIS C  1 228 ? 47.042  -1.278  0.036   1.00 36.99  ? 369 HIS C CA    1 
ATOM   7737  C  C     . HIS C  1 228 ? 46.843  -0.160  1.058   1.00 38.42  ? 369 HIS C C     1 
ATOM   7738  O  O     . HIS C  1 228 ? 45.782  0.478   1.116   1.00 44.22  ? 369 HIS C O     1 
ATOM   7739  C  CB    . HIS C  1 228 ? 46.936  -2.660  0.704   1.00 39.12  ? 369 HIS C CB    1 
ATOM   7740  C  CG    . HIS C  1 228 ? 48.042  -2.968  1.671   1.00 39.21  ? 369 HIS C CG    1 
ATOM   7741  N  ND1   . HIS C  1 228 ? 49.375  -2.776  1.372   1.00 43.16  ? 369 HIS C ND1   1 
ATOM   7742  C  CD2   . HIS C  1 228 ? 48.011  -3.485  2.923   1.00 38.30  ? 369 HIS C CD2   1 
ATOM   7743  C  CE1   . HIS C  1 228 ? 50.114  -3.139  2.405   1.00 42.84  ? 369 HIS C CE1   1 
ATOM   7744  N  NE2   . HIS C  1 228 ? 49.311  -3.575  3.359   1.00 40.42  ? 369 HIS C NE2   1 
ATOM   7745  N  N     . THR C  1 229 ? 47.883  0.074   1.852   1.00 35.34  ? 370 THR C N     1 
ATOM   7746  C  CA    . THR C  1 229 ? 47.884  1.143   2.837   1.00 29.91  ? 370 THR C CA    1 
ATOM   7747  C  C     . THR C  1 229 ? 47.686  2.491   2.155   1.00 30.22  ? 370 THR C C     1 
ATOM   7748  O  O     . THR C  1 229 ? 46.857  3.292   2.589   1.00 38.65  ? 370 THR C O     1 
ATOM   7749  C  CB    . THR C  1 229 ? 49.194  1.155   3.617   1.00 22.67  ? 370 THR C CB    1 
ATOM   7750  O  OG1   . THR C  1 229 ? 49.492  -0.172  4.063   1.00 24.76  ? 370 THR C OG1   1 
ATOM   7751  C  CG2   . THR C  1 229 ? 49.089  2.067   4.812   1.00 19.76  ? 370 THR C CG2   1 
ATOM   7752  N  N     . GLU C  1 230 ? 48.452  2.736   1.095   1.00 26.47  ? 371 GLU C N     1 
ATOM   7753  C  CA    . GLU C  1 230 ? 48.321  3.954   0.298   1.00 26.48  ? 371 GLU C CA    1 
ATOM   7754  C  C     . GLU C  1 230 ? 46.909  4.136   -0.243  1.00 28.55  ? 371 GLU C C     1 
ATOM   7755  O  O     . GLU C  1 230 ? 46.393  5.245   -0.263  1.00 29.11  ? 371 GLU C O     1 
ATOM   7756  C  CB    . GLU C  1 230 ? 49.305  3.930   -0.871  1.00 25.30  ? 371 GLU C CB    1 
ATOM   7757  C  CG    . GLU C  1 230 ? 50.772  3.925   -0.471  1.00 22.63  ? 371 GLU C CG    1 
ATOM   7758  C  CD    . GLU C  1 230 ? 51.668  3.539   -1.621  1.00 21.59  ? 371 GLU C CD    1 
ATOM   7759  O  OE1   . GLU C  1 230 ? 51.186  3.542   -2.772  1.00 20.83  ? 371 GLU C OE1   1 
ATOM   7760  O  OE2   . GLU C  1 230 ? 52.849  3.231   -1.374  1.00 23.43  ? 371 GLU C OE2   1 
ATOM   7761  N  N     . LYS C  1 231 ? 46.305  3.046   -0.708  1.00 31.60  ? 372 LYS C N     1 
ATOM   7762  C  CA    . LYS C  1 231 ? 44.938  3.074   -1.221  1.00 30.11  ? 372 LYS C CA    1 
ATOM   7763  C  C     . LYS C  1 231 ? 43.999  3.568   -0.128  1.00 26.05  ? 372 LYS C C     1 
ATOM   7764  O  O     . LYS C  1 231 ? 43.258  4.545   -0.324  1.00 24.51  ? 372 LYS C O     1 
ATOM   7765  C  CB    . LYS C  1 231 ? 44.529  1.677   -1.706  1.00 30.53  ? 372 LYS C CB    1 
ATOM   7766  C  CG    . LYS C  1 231 ? 43.156  1.592   -2.382  1.00 31.07  ? 372 LYS C CG    1 
ATOM   7767  C  CD    . LYS C  1 231 ? 42.809  0.147   -2.735  1.00 30.52  ? 372 LYS C CD    1 
ATOM   7768  C  CE    . LYS C  1 231 ? 41.468  0.046   -3.445  1.00 28.27  ? 372 LYS C CE    1 
ATOM   7769  N  NZ    . LYS C  1 231 ? 41.135  -1.352  -3.813  1.00 25.52  ? 372 LYS C NZ    1 
ATOM   7770  N  N     . TYR C  1 232 ? 44.059  2.910   1.032   1.00 27.41  ? 373 TYR C N     1 
ATOM   7771  C  CA    . TYR C  1 232 ? 43.275  3.340   2.192   1.00 28.98  ? 373 TYR C CA    1 
ATOM   7772  C  C     . TYR C  1 232 ? 43.474  4.821   2.502   1.00 29.53  ? 373 TYR C C     1 
ATOM   7773  O  O     . TYR C  1 232 ? 42.505  5.546   2.685   1.00 31.85  ? 373 TYR C O     1 
ATOM   7774  C  CB    . TYR C  1 232 ? 43.613  2.504   3.431   1.00 31.61  ? 373 TYR C CB    1 
ATOM   7775  C  CG    . TYR C  1 232 ? 42.860  2.938   4.677   1.00 34.38  ? 373 TYR C CG    1 
ATOM   7776  C  CD1   . TYR C  1 232 ? 43.398  3.870   5.558   1.00 35.82  ? 373 TYR C CD1   1 
ATOM   7777  C  CD2   . TYR C  1 232 ? 41.612  2.415   4.970   1.00 36.49  ? 373 TYR C CD2   1 
ATOM   7778  C  CE1   . TYR C  1 232 ? 42.710  4.269   6.689   1.00 35.76  ? 373 TYR C CE1   1 
ATOM   7779  C  CE2   . TYR C  1 232 ? 40.920  2.808   6.098   1.00 39.28  ? 373 TYR C CE2   1 
ATOM   7780  C  CZ    . TYR C  1 232 ? 41.474  3.734   6.955   1.00 39.83  ? 373 TYR C CZ    1 
ATOM   7781  O  OH    . TYR C  1 232 ? 40.786  4.126   8.085   1.00 42.73  ? 373 TYR C OH    1 
ATOM   7782  N  N     . ILE C  1 233 ? 44.730  5.254   2.570   1.00 31.30  ? 374 ILE C N     1 
ATOM   7783  C  CA    . ILE C  1 233 ? 45.073  6.650   2.845   1.00 33.30  ? 374 ILE C CA    1 
ATOM   7784  C  C     . ILE C  1 233 ? 44.466  7.618   1.823   1.00 34.52  ? 374 ILE C C     1 
ATOM   7785  O  O     . ILE C  1 233 ? 43.941  8.668   2.191   1.00 37.35  ? 374 ILE C O     1 
ATOM   7786  C  CB    . ILE C  1 233 ? 46.602  6.841   2.892   1.00 33.05  ? 374 ILE C CB    1 
ATOM   7787  C  CG1   . ILE C  1 233 ? 47.194  6.160   4.127   1.00 30.80  ? 374 ILE C CG1   1 
ATOM   7788  C  CG2   . ILE C  1 233 ? 46.968  8.314   2.889   1.00 36.28  ? 374 ILE C CG2   1 
ATOM   7789  C  CD1   . ILE C  1 233 ? 48.710  6.143   4.153   1.00 26.85  ? 374 ILE C CD1   1 
ATOM   7790  N  N     . LEU C  1 234 ? 44.551  7.266   0.544   1.00 33.25  ? 375 LEU C N     1 
ATOM   7791  C  CA    . LEU C  1 234 ? 44.000  8.099   -0.516  1.00 31.94  ? 375 LEU C CA    1 
ATOM   7792  C  C     . LEU C  1 234 ? 42.490  8.242   -0.352  1.00 29.99  ? 375 LEU C C     1 
ATOM   7793  O  O     . LEU C  1 234 ? 41.941  9.337   -0.508  1.00 27.07  ? 375 LEU C O     1 
ATOM   7794  C  CB    . LEU C  1 234 ? 44.319  7.502   -1.886  1.00 29.04  ? 375 LEU C CB    1 
ATOM   7795  C  CG    . LEU C  1 234 ? 45.447  8.107   -2.722  1.00 25.72  ? 375 LEU C CG    1 
ATOM   7796  C  CD1   . LEU C  1 234 ? 45.119  9.537   -3.090  1.00 26.34  ? 375 LEU C CD1   1 
ATOM   7797  C  CD2   . LEU C  1 234 ? 46.766  8.043   -1.999  1.00 20.32  ? 375 LEU C CD2   1 
ATOM   7798  N  N     . ASN C  1 235 ? 41.824  7.138   -0.025  1.00 29.57  ? 376 ASN C N     1 
ATOM   7799  C  CA    . ASN C  1 235 ? 40.376  7.173   0.143   1.00 31.33  ? 376 ASN C CA    1 
ATOM   7800  C  C     . ASN C  1 235 ? 39.924  7.524   1.561   1.00 36.93  ? 376 ASN C C     1 
ATOM   7801  O  O     . ASN C  1 235 ? 38.731  7.485   1.869   1.00 42.34  ? 376 ASN C O     1 
ATOM   7802  C  CB    . ASN C  1 235 ? 39.757  5.862   -0.348  1.00 34.75  ? 376 ASN C CB    1 
ATOM   7803  C  CG    . ASN C  1 235 ? 39.957  5.658   -1.836  1.00 34.31  ? 376 ASN C CG    1 
ATOM   7804  O  OD1   . ASN C  1 235 ? 39.856  6.601   -2.616  1.00 38.60  ? 376 ASN C OD1   1 
ATOM   7805  N  ND2   . ASN C  1 235 ? 40.257  4.431   -2.235  1.00 32.15  ? 376 ASN C ND2   1 
ATOM   7806  N  N     . ASN C  1 236 ? 40.885  7.878   2.410   1.00 40.06  ? 377 ASN C N     1 
ATOM   7807  C  CA    . ASN C  1 236 ? 40.623  8.323   3.775   1.00 37.66  ? 377 ASN C CA    1 
ATOM   7808  C  C     . ASN C  1 236 ? 41.619  9.411   4.149   1.00 36.68  ? 377 ASN C C     1 
ATOM   7809  O  O     . ASN C  1 236 ? 42.284  9.340   5.182   1.00 39.06  ? 377 ASN C O     1 
ATOM   7810  C  CB    . ASN C  1 236 ? 40.722  7.155   4.757   1.00 36.51  ? 377 ASN C CB    1 
ATOM   7811  C  CG    . ASN C  1 236 ? 39.633  6.129   4.552   1.00 33.79  ? 377 ASN C CG    1 
ATOM   7812  O  OD1   . ASN C  1 236 ? 38.569  6.205   5.163   1.00 31.98  ? 377 ASN C OD1   1 
ATOM   7813  N  ND2   . ASN C  1 236 ? 39.894  5.160   3.688   1.00 36.40  ? 377 ASN C ND2   1 
ATOM   7814  N  N     . HIS C  1 237 ? 41.676  10.436  3.305   1.00 39.03  ? 378 HIS C N     1 
ATOM   7815  C  CA    . HIS C  1 237 ? 42.763  11.408  3.290   1.00 39.29  ? 378 HIS C CA    1 
ATOM   7816  C  C     . HIS C  1 237 ? 42.643  12.593  4.256   1.00 41.24  ? 378 HIS C C     1 
ATOM   7817  O  O     . HIS C  1 237 ? 43.639  13.273  4.514   1.00 47.14  ? 378 HIS C O     1 
ATOM   7818  C  CB    . HIS C  1 237 ? 42.934  11.937  1.864   1.00 35.91  ? 378 HIS C CB    1 
ATOM   7819  C  CG    . HIS C  1 237 ? 41.673  12.485  1.273   1.00 35.20  ? 378 HIS C CG    1 
ATOM   7820  N  ND1   . HIS C  1 237 ? 40.890  11.770  0.387   1.00 35.11  ? 378 HIS C ND1   1 
ATOM   7821  C  CD2   . HIS C  1 237 ? 41.048  13.671  1.449   1.00 39.98  ? 378 HIS C CD2   1 
ATOM   7822  C  CE1   . HIS C  1 237 ? 39.841  12.500  0.043   1.00 38.55  ? 378 HIS C CE1   1 
ATOM   7823  N  NE2   . HIS C  1 237 ? 39.916  13.656  0.674   1.00 40.37  ? 378 HIS C NE2   1 
ATOM   7824  N  N     . GLY C  1 238 ? 41.451  12.846  4.791   1.00 35.02  ? 379 GLY C N     1 
ATOM   7825  C  CA    . GLY C  1 238 ? 41.235  14.030  5.611   1.00 33.46  ? 379 GLY C CA    1 
ATOM   7826  C  C     . GLY C  1 238 ? 41.488  13.884  7.104   1.00 37.54  ? 379 GLY C C     1 
ATOM   7827  O  O     . GLY C  1 238 ? 41.481  12.775  7.640   1.00 37.21  ? 379 GLY C O     1 
ATOM   7828  N  N     . ILE C  1 239 ? 41.710  15.007  7.784   1.00 38.96  ? 380 ILE C N     1 
ATOM   7829  C  CA    . ILE C  1 239 ? 41.805  14.987  9.241   1.00 36.51  ? 380 ILE C CA    1 
ATOM   7830  C  C     . ILE C  1 239 ? 40.404  14.856  9.821   1.00 34.07  ? 380 ILE C C     1 
ATOM   7831  O  O     . ILE C  1 239 ? 40.220  14.275  10.891  1.00 39.25  ? 380 ILE C O     1 
ATOM   7832  C  CB    . ILE C  1 239 ? 42.536  16.234  9.822   1.00 46.65  ? 380 ILE C CB    1 
ATOM   7833  C  CG1   . ILE C  1 239 ? 42.954  15.981  11.273  1.00 46.71  ? 380 ILE C CG1   1 
ATOM   7834  C  CG2   . ILE C  1 239 ? 41.673  17.481  9.742   1.00 45.59  ? 380 ILE C CG2   1 
ATOM   7835  C  CD1   . ILE C  1 239 ? 43.770  17.098  11.890  1.00 46.05  ? 380 ILE C CD1   1 
ATOM   7836  N  N     . GLU C  1 240 ? 39.421  15.393  9.102   1.00 33.16  ? 381 GLU C N     1 
ATOM   7837  C  CA    . GLU C  1 240 ? 38.018  15.206  9.453   1.00 37.78  ? 381 GLU C CA    1 
ATOM   7838  C  C     . GLU C  1 240 ? 37.460  14.028  8.670   1.00 36.00  ? 381 GLU C C     1 
ATOM   7839  O  O     . GLU C  1 240 ? 37.758  13.873  7.488   1.00 38.99  ? 381 GLU C O     1 
ATOM   7840  C  CB    . GLU C  1 240 ? 37.193  16.455  9.136   1.00 42.01  ? 381 GLU C CB    1 
ATOM   7841  C  CG    . GLU C  1 240 ? 37.469  17.666  10.020  1.00 41.26  ? 381 GLU C CG    1 
ATOM   7842  C  CD    . GLU C  1 240 ? 36.488  18.790  9.761   1.00 42.30  ? 381 GLU C CD    1 
ATOM   7843  O  OE1   . GLU C  1 240 ? 35.452  18.535  9.112   1.00 43.76  ? 381 GLU C OE1   1 
ATOM   7844  O  OE2   . GLU C  1 240 ? 36.747  19.925  10.209  1.00 42.49  ? 381 GLU C OE2   1 
ATOM   7845  N  N     . LYS C  1 241 ? 36.633  13.219  9.323   1.00 37.45  ? 382 LYS C N     1 
ATOM   7846  C  CA    . LYS C  1 241 ? 36.095  12.005  8.718   1.00 34.80  ? 382 LYS C CA    1 
ATOM   7847  C  C     . LYS C  1 241 ? 35.100  12.297  7.602   1.00 32.58  ? 382 LYS C C     1 
ATOM   7848  O  O     . LYS C  1 241 ? 34.889  11.470  6.717   1.00 32.17  ? 382 LYS C O     1 
ATOM   7849  C  CB    . LYS C  1 241 ? 35.429  11.157  9.792   1.00 37.84  ? 382 LYS C CB    1 
ATOM   7850  C  CG    . LYS C  1 241 ? 36.295  10.952  11.027  1.00 36.47  ? 382 LYS C CG    1 
ATOM   7851  C  CD    . LYS C  1 241 ? 35.474  10.442  12.193  1.00 34.32  ? 382 LYS C CD    1 
ATOM   7852  C  CE    . LYS C  1 241 ? 36.330  10.320  13.436  1.00 33.16  ? 382 LYS C CE    1 
ATOM   7853  N  NZ    . LYS C  1 241 ? 35.503  10.116  14.656  1.00 30.86  ? 382 LYS C NZ    1 
ATOM   7854  N  N     . THR C  1 242 ? 34.502  13.482  7.651   1.00 34.07  ? 383 THR C N     1 
ATOM   7855  C  CA    . THR C  1 242 ? 33.505  13.904  6.672   1.00 36.60  ? 383 THR C CA    1 
ATOM   7856  C  C     . THR C  1 242 ? 34.125  14.485  5.402   1.00 36.72  ? 383 THR C C     1 
ATOM   7857  O  O     . THR C  1 242 ? 33.411  14.884  4.484   1.00 41.82  ? 383 THR C O     1 
ATOM   7858  C  CB    . THR C  1 242 ? 32.571  14.960  7.277   1.00 39.59  ? 383 THR C CB    1 
ATOM   7859  O  OG1   . THR C  1 242 ? 33.352  16.022  7.838   1.00 43.53  ? 383 THR C OG1   1 
ATOM   7860  C  CG2   . THR C  1 242 ? 31.720  14.349  8.374   1.00 38.17  ? 383 THR C CG2   1 
ATOM   7861  N  N     . CYS C  1 243 ? 35.453  14.537  5.361   1.00 34.23  ? 384 CYS C N     1 
ATOM   7862  C  CA    . CYS C  1 243 ? 36.187  15.077  4.218   1.00 28.68  ? 384 CYS C CA    1 
ATOM   7863  C  C     . CYS C  1 243 ? 35.783  14.395  2.910   1.00 28.40  ? 384 CYS C C     1 
ATOM   7864  O  O     . CYS C  1 243 ? 35.995  13.193  2.741   1.00 25.81  ? 384 CYS C O     1 
ATOM   7865  C  CB    . CYS C  1 243 ? 37.695  14.921  4.450   1.00 26.00  ? 384 CYS C CB    1 
ATOM   7866  S  SG    . CYS C  1 243 ? 38.788  15.878  3.337   1.00 43.11  ? 384 CYS C SG    1 
ATOM   7867  N  N     . CYS C  1 244 ? 35.190  15.176  2.006   1.00 29.42  ? 385 CYS C N     1 
ATOM   7868  C  CA    . CYS C  1 244 ? 34.786  14.726  0.668   1.00 30.08  ? 385 CYS C CA    1 
ATOM   7869  C  C     . CYS C  1 244 ? 33.651  13.702  0.688   1.00 33.91  ? 385 CYS C C     1 
ATOM   7870  O  O     . CYS C  1 244 ? 33.475  12.946  -0.270  1.00 36.08  ? 385 CYS C O     1 
ATOM   7871  C  CB    . CYS C  1 244 ? 35.976  14.177  -0.134  1.00 33.44  ? 385 CYS C CB    1 
ATOM   7872  S  SG    . CYS C  1 244 ? 37.305  15.357  -0.503  1.00 36.17  ? 385 CYS C SG    1 
ATOM   7873  N  N     . GLU C  1 245 ? 32.883  13.679  1.774   1.00 33.30  ? 386 GLU C N     1 
ATOM   7874  C  CA    . GLU C  1 245 ? 31.687  12.850  1.832   1.00 32.71  ? 386 GLU C CA    1 
ATOM   7875  C  C     . GLU C  1 245 ? 30.466  13.683  1.469   1.00 33.81  ? 386 GLU C C     1 
ATOM   7876  O  O     . GLU C  1 245 ? 30.574  14.892  1.273   1.00 34.74  ? 386 GLU C O     1 
ATOM   7877  C  CB    . GLU C  1 245 ? 31.505  12.257  3.225   1.00 34.66  ? 386 GLU C CB    1 
ATOM   7878  C  CG    . GLU C  1 245 ? 32.567  11.248  3.617   1.00 37.81  ? 386 GLU C CG    1 
ATOM   7879  C  CD    . GLU C  1 245 ? 32.262  10.600  4.946   1.00 40.62  ? 386 GLU C CD    1 
ATOM   7880  O  OE1   . GLU C  1 245 ? 31.402  11.138  5.672   1.00 40.17  ? 386 GLU C OE1   1 
ATOM   7881  O  OE2   . GLU C  1 245 ? 32.875  9.559   5.259   1.00 41.25  ? 386 GLU C OE2   1 
ATOM   7882  N  N     . SER C  1 246 ? 29.306  13.037  1.403   1.00 34.29  ? 387 SER C N     1 
ATOM   7883  C  CA    . SER C  1 246 ? 28.069  13.714  1.029   1.00 40.69  ? 387 SER C CA    1 
ATOM   7884  C  C     . SER C  1 246 ? 27.681  14.811  2.024   1.00 48.41  ? 387 SER C C     1 
ATOM   7885  O  O     . SER C  1 246 ? 27.138  15.845  1.630   1.00 51.30  ? 387 SER C O     1 
ATOM   7886  C  CB    . SER C  1 246 ? 26.930  12.703  0.905   1.00 42.57  ? 387 SER C CB    1 
ATOM   7887  O  OG    . SER C  1 246 ? 26.543  12.210  2.176   1.00 45.95  ? 387 SER C OG    1 
ATOM   7888  N  N     . SER C  1 247 ? 27.970  14.589  3.305   1.00 48.02  ? 388 SER C N     1 
ATOM   7889  C  CA    . SER C  1 247 ? 27.609  15.540  4.350   1.00 43.03  ? 388 SER C CA    1 
ATOM   7890  C  C     . SER C  1 247 ? 28.834  16.238  4.934   1.00 41.42  ? 388 SER C C     1 
ATOM   7891  O  O     . SER C  1 247 ? 28.853  16.605  6.109   1.00 39.16  ? 388 SER C O     1 
ATOM   7892  C  CB    . SER C  1 247 ? 26.830  14.831  5.454   1.00 43.34  ? 388 SER C CB    1 
ATOM   7893  O  OG    . SER C  1 247 ? 25.697  14.165  4.928   1.00 41.75  ? 388 SER C OG    1 
ATOM   7894  N  N     . GLY C  1 248 ? 29.854  16.421  4.103   1.00 44.82  ? 389 GLY C N     1 
ATOM   7895  C  CA    . GLY C  1 248 ? 31.071  17.083  4.531   1.00 47.53  ? 389 GLY C CA    1 
ATOM   7896  C  C     . GLY C  1 248 ? 31.578  18.017  3.454   1.00 50.55  ? 389 GLY C C     1 
ATOM   7897  O  O     . GLY C  1 248 ? 30.907  18.222  2.442   1.00 51.70  ? 389 GLY C O     1 
ATOM   7898  N  N     . ALA C  1 249 ? 32.760  18.587  3.665   1.00 51.14  ? 390 ALA C N     1 
ATOM   7899  C  CA    . ALA C  1 249 ? 33.333  19.516  2.694   1.00 51.11  ? 390 ALA C CA    1 
ATOM   7900  C  C     . ALA C  1 249 ? 34.441  18.857  1.886   1.00 49.82  ? 390 ALA C C     1 
ATOM   7901  O  O     . ALA C  1 249 ? 35.165  18.005  2.399   1.00 51.95  ? 390 ALA C O     1 
ATOM   7902  C  CB    . ALA C  1 249 ? 33.855  20.763  3.390   1.00 50.28  ? 390 ALA C CB    1 
ATOM   7903  N  N     . LYS C  1 250 ? 34.579  19.266  0.628   1.00 48.94  ? 391 LYS C N     1 
ATOM   7904  C  CA    . LYS C  1 250 ? 35.639  18.748  -0.234  1.00 48.88  ? 391 LYS C CA    1 
ATOM   7905  C  C     . LYS C  1 250 ? 36.995  19.399  0.031   1.00 46.42  ? 391 LYS C C     1 
ATOM   7906  O  O     . LYS C  1 250 ? 37.082  20.455  0.657   1.00 49.50  ? 391 LYS C O     1 
ATOM   7907  C  CB    . LYS C  1 250 ? 35.272  18.929  -1.706  1.00 50.48  ? 391 LYS C CB    1 
ATOM   7908  C  CG    . LYS C  1 250 ? 34.361  17.850  -2.262  1.00 51.33  ? 391 LYS C CG    1 
ATOM   7909  C  CD    . LYS C  1 250 ? 34.427  17.826  -3.778  1.00 55.09  ? 391 LYS C CD    1 
ATOM   7910  C  CE    . LYS C  1 250 ? 33.800  16.556  -4.332  1.00 58.49  ? 391 LYS C CE    1 
ATOM   7911  N  NZ    . LYS C  1 250 ? 33.795  16.528  -5.826  1.00 61.94  ? 391 LYS C NZ    1 
ATOM   7912  N  N     . CYS C  1 251 ? 38.053  18.755  -0.450  1.00 40.22  ? 392 CYS C N     1 
ATOM   7913  C  CA    . CYS C  1 251 ? 39.390  19.328  -0.393  1.00 36.96  ? 392 CYS C CA    1 
ATOM   7914  C  C     . CYS C  1 251 ? 40.005  19.233  -1.783  1.00 37.25  ? 392 CYS C C     1 
ATOM   7915  O  O     . CYS C  1 251 ? 39.386  18.684  -2.696  1.00 36.38  ? 392 CYS C O     1 
ATOM   7916  C  CB    . CYS C  1 251 ? 40.255  18.589  0.627   1.00 35.68  ? 392 CYS C CB    1 
ATOM   7917  S  SG    . CYS C  1 251 ? 40.724  16.922  0.133   1.00 43.63  ? 392 CYS C SG    1 
ATOM   7918  N  N     . CYS C  1 252 ? 41.217  19.753  -1.949  1.00 39.30  ? 393 CYS C N     1 
ATOM   7919  C  CA    . CYS C  1 252 ? 41.865  19.736  -3.260  1.00 38.09  ? 393 CYS C CA    1 
ATOM   7920  C  C     . CYS C  1 252 ? 43.118  18.854  -3.293  1.00 38.23  ? 393 CYS C C     1 
ATOM   7921  O  O     . CYS C  1 252 ? 43.950  18.985  -4.186  1.00 45.54  ? 393 CYS C O     1 
ATOM   7922  C  CB    . CYS C  1 252 ? 42.194  21.160  -3.721  1.00 37.12  ? 393 CYS C CB    1 
ATOM   7923  S  SG    . CYS C  1 252 ? 43.321  22.085  -2.663  1.00 49.61  ? 393 CYS C SG    1 
ATOM   7924  N  N     . ARG C  1 253 ? 43.225  17.949  -2.322  1.00 35.83  ? 394 ARG C N     1 
ATOM   7925  C  CA    . ARG C  1 253 ? 44.366  17.043  -2.178  1.00 31.35  ? 394 ARG C CA    1 
ATOM   7926  C  C     . ARG C  1 253 ? 44.596  16.192  -3.425  1.00 31.60  ? 394 ARG C C     1 
ATOM   7927  O  O     . ARG C  1 253 ? 45.674  16.235  -4.044  1.00 36.99  ? 394 ARG C O     1 
ATOM   7928  C  CB    . ARG C  1 253 ? 44.143  16.113  -0.974  1.00 28.84  ? 394 ARG C CB    1 
ATOM   7929  C  CG    . ARG C  1 253 ? 44.228  16.782  0.409   1.00 28.05  ? 394 ARG C CG    1 
ATOM   7930  C  CD    . ARG C  1 253 ? 44.070  15.757  1.540   1.00 29.88  ? 394 ARG C CD    1 
ATOM   7931  N  NE    . ARG C  1 253 ? 44.468  16.275  2.851   1.00 29.97  ? 394 ARG C NE    1 
ATOM   7932  C  CZ    . ARG C  1 253 ? 43.625  16.771  3.752   1.00 30.52  ? 394 ARG C CZ    1 
ATOM   7933  N  NH1   . ARG C  1 253 ? 42.327  16.825  3.495   1.00 27.81  ? 394 ARG C NH1   1 
ATOM   7934  N  NH2   . ARG C  1 253 ? 44.080  17.218  4.915   1.00 33.92  ? 394 ARG C NH2   1 
ATOM   7935  N  N     . LYS C  1 254 ? 43.575  15.414  -3.779  1.00 29.86  ? 395 LYS C N     1 
ATOM   7936  C  CA    . LYS C  1 254 ? 43.632  14.531  -4.938  1.00 29.74  ? 395 LYS C CA    1 
ATOM   7937  C  C     . LYS C  1 254 ? 43.867  15.330  -6.209  1.00 35.99  ? 395 LYS C C     1 
ATOM   7938  O  O     . LYS C  1 254 ? 44.600  14.897  -7.094  1.00 43.48  ? 395 LYS C O     1 
ATOM   7939  C  CB    . LYS C  1 254 ? 42.341  13.716  -5.056  1.00 30.76  ? 395 LYS C CB    1 
ATOM   7940  C  CG    . LYS C  1 254 ? 42.136  12.683  -3.943  1.00 29.34  ? 395 LYS C CG    1 
ATOM   7941  C  CD    . LYS C  1 254 ? 40.997  11.716  -4.288  1.00 29.20  ? 395 LYS C CD    1 
ATOM   7942  C  CE    . LYS C  1 254 ? 40.858  10.621  -3.235  1.00 29.24  ? 395 LYS C CE    1 
ATOM   7943  N  NZ    . LYS C  1 254 ? 39.834  9.595   -3.578  1.00 33.18  ? 395 LYS C NZ    1 
ATOM   7944  N  N     . GLU C  1 255 ? 43.244  16.502  -6.285  1.00 35.74  ? 396 GLU C N     1 
ATOM   7945  C  CA    . GLU C  1 255 ? 43.408  17.407  -7.420  1.00 36.05  ? 396 GLU C CA    1 
ATOM   7946  C  C     . GLU C  1 255 ? 44.871  17.805  -7.611  1.00 34.62  ? 396 GLU C C     1 
ATOM   7947  O  O     . GLU C  1 255 ? 45.411  17.697  -8.710  1.00 33.35  ? 396 GLU C O     1 
ATOM   7948  C  CB    . GLU C  1 255 ? 42.529  18.652  -7.238  1.00 39.07  ? 396 GLU C CB    1 
ATOM   7949  C  CG    . GLU C  1 255 ? 41.019  18.402  -7.405  1.00 40.27  ? 396 GLU C CG    1 
ATOM   7950  C  CD    . GLU C  1 255 ? 40.420  17.519  -6.314  1.00 42.04  ? 396 GLU C CD    1 
ATOM   7951  O  OE1   . GLU C  1 255 ? 41.043  17.382  -5.244  1.00 47.32  ? 396 GLU C OE1   1 
ATOM   7952  O  OE2   . GLU C  1 255 ? 39.324  16.961  -6.526  1.00 36.31  ? 396 GLU C OE2   1 
ATOM   7953  N  N     . CYS C  1 256 ? 45.514  18.246  -6.534  1.00 35.85  ? 397 CYS C N     1 
ATOM   7954  C  CA    . CYS C  1 256 ? 46.924  18.606  -6.593  1.00 35.28  ? 397 CYS C CA    1 
ATOM   7955  C  C     . CYS C  1 256 ? 47.792  17.413  -6.981  1.00 34.37  ? 397 CYS C C     1 
ATOM   7956  O  O     . CYS C  1 256 ? 48.722  17.557  -7.781  1.00 40.68  ? 397 CYS C O     1 
ATOM   7957  C  CB    . CYS C  1 256 ? 47.376  19.200  -5.266  1.00 36.68  ? 397 CYS C CB    1 
ATOM   7958  S  SG    . CYS C  1 256 ? 46.503  20.719  -4.850  1.00 36.32  ? 397 CYS C SG    1 
ATOM   7959  N  N     . LEU C  1 257 ? 47.477  16.235  -6.444  1.00 33.08  ? 398 LEU C N     1 
ATOM   7960  C  CA    . LEU C  1 257 ? 48.169  15.021  -6.880  1.00 33.56  ? 398 LEU C CA    1 
ATOM   7961  C  C     . LEU C  1 257 ? 48.040  14.822  -8.396  1.00 40.55  ? 398 LEU C C     1 
ATOM   7962  O  O     . LEU C  1 257 ? 49.026  14.509  -9.074  1.00 45.12  ? 398 LEU C O     1 
ATOM   7963  C  CB    . LEU C  1 257 ? 47.658  13.787  -6.129  1.00 27.56  ? 398 LEU C CB    1 
ATOM   7964  C  CG    . LEU C  1 257 ? 48.324  12.457  -6.505  1.00 24.12  ? 398 LEU C CG    1 
ATOM   7965  C  CD1   . LEU C  1 257 ? 49.831  12.597  -6.527  1.00 21.87  ? 398 LEU C CD1   1 
ATOM   7966  C  CD2   . LEU C  1 257 ? 47.931  11.329  -5.565  1.00 16.77  ? 398 LEU C CD2   1 
ATOM   7967  N  N     . LYS C  1 258 ? 46.833  15.025  -8.920  1.00 37.77  ? 399 LYS C N     1 
ATOM   7968  C  CA    . LYS C  1 258 ? 46.569  14.870  -10.350 1.00 37.39  ? 399 LYS C CA    1 
ATOM   7969  C  C     . LYS C  1 258 ? 47.359  15.851  -11.211 1.00 39.21  ? 399 LYS C C     1 
ATOM   7970  O  O     . LYS C  1 258 ? 47.974  15.460  -12.204 1.00 41.13  ? 399 LYS C O     1 
ATOM   7971  C  CB    . LYS C  1 258 ? 45.082  15.061  -10.637 1.00 36.89  ? 399 LYS C CB    1 
ATOM   7972  C  CG    . LYS C  1 258 ? 44.176  13.974  -10.098 1.00 33.73  ? 399 LYS C CG    1 
ATOM   7973  C  CD    . LYS C  1 258 ? 42.757  14.253  -10.546 1.00 32.04  ? 399 LYS C CD    1 
ATOM   7974  C  CE    . LYS C  1 258 ? 41.816  13.155  -10.118 1.00 37.39  ? 399 LYS C CE    1 
ATOM   7975  N  NZ    . LYS C  1 258 ? 40.485  13.334  -10.761 1.00 41.47  ? 399 LYS C NZ    1 
ATOM   7976  N  N     . LEU C  1 259 ? 47.309  17.130  -10.845 1.00 39.62  ? 400 LEU C N     1 
ATOM   7977  C  CA    . LEU C  1 259 ? 48.030  18.169  -11.576 1.00 38.89  ? 400 LEU C CA    1 
ATOM   7978  C  C     . LEU C  1 259 ? 49.524  17.901  -11.570 1.00 39.38  ? 400 LEU C C     1 
ATOM   7979  O  O     . LEU C  1 259 ? 50.179  18.021  -12.602 1.00 42.62  ? 400 LEU C O     1 
ATOM   7980  C  CB    . LEU C  1 259 ? 47.750  19.549  -10.982 1.00 39.22  ? 400 LEU C CB    1 
ATOM   7981  C  CG    . LEU C  1 259 ? 46.316  20.060  -11.082 1.00 38.13  ? 400 LEU C CG    1 
ATOM   7982  C  CD1   . LEU C  1 259 ? 46.181  21.411  -10.411 1.00 37.37  ? 400 LEU C CD1   1 
ATOM   7983  C  CD2   . LEU C  1 259 ? 45.896  20.149  -12.526 1.00 38.56  ? 400 LEU C CD2   1 
ATOM   7984  N  N     . MET C  1 260 ? 50.053  17.526  -10.406 1.00 39.95  ? 401 MET C N     1 
ATOM   7985  C  CA    . MET C  1 260 ? 51.481  17.244  -10.268 1.00 40.87  ? 401 MET C CA    1 
ATOM   7986  C  C     . MET C  1 260 ? 51.882  16.069  -11.164 1.00 42.35  ? 401 MET C C     1 
ATOM   7987  O  O     . MET C  1 260 ? 52.839  16.164  -11.953 1.00 44.65  ? 401 MET C O     1 
ATOM   7988  C  CB    . MET C  1 260 ? 51.817  16.958  -8.802  1.00 39.66  ? 401 MET C CB    1 
ATOM   7989  C  CG    . MET C  1 260 ? 53.283  17.115  -8.435  1.00 39.96  ? 401 MET C CG    1 
ATOM   7990  S  SD    . MET C  1 260 ? 53.933  18.763  -8.757  1.00 49.76  ? 401 MET C SD    1 
ATOM   7991  C  CE    . MET C  1 260 ? 55.551  18.640  -7.996  1.00 67.83  ? 401 MET C CE    1 
ATOM   7992  N  N     . LYS C  1 261 ? 51.127  14.977  -11.053 1.00 41.11  ? 402 LYS C N     1 
ATOM   7993  C  CA    . LYS C  1 261 ? 51.312  13.810  -11.914 1.00 38.14  ? 402 LYS C CA    1 
ATOM   7994  C  C     . LYS C  1 261 ? 51.279  14.189  -13.392 1.00 36.52  ? 402 LYS C C     1 
ATOM   7995  O  O     . LYS C  1 261 ? 52.036  13.644  -14.192 1.00 34.55  ? 402 LYS C O     1 
ATOM   7996  C  CB    . LYS C  1 261 ? 50.227  12.766  -11.638 1.00 38.20  ? 402 LYS C CB    1 
ATOM   7997  C  CG    . LYS C  1 261 ? 50.451  11.909  -10.396 1.00 37.96  ? 402 LYS C CG    1 
ATOM   7998  C  CD    . LYS C  1 261 ? 49.146  11.266  -9.916  1.00 37.99  ? 402 LYS C CD    1 
ATOM   7999  C  CE    . LYS C  1 261 ? 48.595  10.247  -10.900 1.00 37.48  ? 402 LYS C CE    1 
ATOM   8000  N  NZ    . LYS C  1 261 ? 49.374  8.984   -10.915 1.00 37.71  ? 402 LYS C NZ    1 
ATOM   8001  N  N     . TYR C  1 262 ? 50.401  15.125  -13.748 1.00 35.13  ? 403 TYR C N     1 
ATOM   8002  C  CA    . TYR C  1 262 ? 50.241  15.533  -15.140 1.00 35.61  ? 403 TYR C CA    1 
ATOM   8003  C  C     . TYR C  1 262 ? 51.443  16.326  -15.632 1.00 37.49  ? 403 TYR C C     1 
ATOM   8004  O  O     . TYR C  1 262 ? 51.951  16.065  -16.720 1.00 36.80  ? 403 TYR C O     1 
ATOM   8005  C  CB    . TYR C  1 262 ? 48.962  16.351  -15.326 1.00 37.99  ? 403 TYR C CB    1 
ATOM   8006  C  CG    . TYR C  1 262 ? 48.706  16.728  -16.763 1.00 39.38  ? 403 TYR C CG    1 
ATOM   8007  C  CD1   . TYR C  1 262 ? 48.772  15.774  -17.767 1.00 37.60  ? 403 TYR C CD1   1 
ATOM   8008  C  CD2   . TYR C  1 262 ? 48.402  18.034  -17.121 1.00 41.44  ? 403 TYR C CD2   1 
ATOM   8009  C  CE1   . TYR C  1 262 ? 48.543  16.105  -19.083 1.00 37.92  ? 403 TYR C CE1   1 
ATOM   8010  C  CE2   . TYR C  1 262 ? 48.170  18.377  -18.445 1.00 38.70  ? 403 TYR C CE2   1 
ATOM   8011  C  CZ    . TYR C  1 262 ? 48.244  17.405  -19.416 1.00 38.48  ? 403 TYR C CZ    1 
ATOM   8012  O  OH    . TYR C  1 262 ? 48.016  17.730  -20.728 1.00 40.19  ? 403 TYR C OH    1 
ATOM   8013  N  N     . LEU C  1 263 ? 51.880  17.298  -14.836 1.00 41.65  ? 404 LEU C N     1 
ATOM   8014  C  CA    . LEU C  1 263 ? 53.079  18.068  -15.146 1.00 45.11  ? 404 LEU C CA    1 
ATOM   8015  C  C     . LEU C  1 263 ? 54.253  17.130  -15.382 1.00 46.68  ? 404 LEU C C     1 
ATOM   8016  O  O     . LEU C  1 263 ? 54.945  17.228  -16.405 1.00 52.18  ? 404 LEU C O     1 
ATOM   8017  C  CB    . LEU C  1 263 ? 53.399  19.037  -14.006 1.00 48.39  ? 404 LEU C CB    1 
ATOM   8018  C  CG    . LEU C  1 263 ? 54.691  19.851  -14.123 1.00 50.93  ? 404 LEU C CG    1 
ATOM   8019  C  CD1   . LEU C  1 263 ? 54.640  20.811  -15.305 1.00 50.15  ? 404 LEU C CD1   1 
ATOM   8020  C  CD2   . LEU C  1 263 ? 54.981  20.604  -12.832 1.00 51.13  ? 404 LEU C CD2   1 
ATOM   8021  N  N     . LEU C  1 264 ? 54.459  16.208  -14.443 1.00 45.74  ? 405 LEU C N     1 
ATOM   8022  C  CA    . LEU C  1 264 ? 55.537  15.231  -14.575 1.00 46.71  ? 405 LEU C CA    1 
ATOM   8023  C  C     . LEU C  1 264 ? 55.383  14.377  -15.834 1.00 45.36  ? 405 LEU C C     1 
ATOM   8024  O  O     . LEU C  1 264 ? 56.370  14.075  -16.503 1.00 45.86  ? 405 LEU C O     1 
ATOM   8025  C  CB    . LEU C  1 264 ? 55.630  14.334  -13.335 1.00 50.50  ? 405 LEU C CB    1 
ATOM   8026  C  CG    . LEU C  1 264 ? 56.814  13.360  -13.349 1.00 54.24  ? 405 LEU C CG    1 
ATOM   8027  C  CD1   . LEU C  1 264 ? 58.125  14.124  -13.394 1.00 57.86  ? 405 LEU C CD1   1 
ATOM   8028  C  CD2   . LEU C  1 264 ? 56.805  12.407  -12.170 1.00 52.16  ? 405 LEU C CD2   1 
ATOM   8029  N  N     . GLU C  1 265 ? 54.150  13.994  -16.155 1.00 47.55  ? 406 GLU C N     1 
ATOM   8030  C  CA    . GLU C  1 265 ? 53.890  13.169  -17.332 1.00 49.54  ? 406 GLU C CA    1 
ATOM   8031  C  C     . GLU C  1 265 ? 54.249  13.899  -18.615 1.00 49.44  ? 406 GLU C C     1 
ATOM   8032  O  O     . GLU C  1 265 ? 54.853  13.324  -19.517 1.00 50.27  ? 406 GLU C O     1 
ATOM   8033  C  CB    . GLU C  1 265 ? 52.424  12.736  -17.390 1.00 55.59  ? 406 GLU C CB    1 
ATOM   8034  C  CG    . GLU C  1 265 ? 52.088  11.492  -16.574 1.00 61.81  ? 406 GLU C CG    1 
ATOM   8035  C  CD    . GLU C  1 265 ? 50.743  10.896  -16.959 1.00 67.63  ? 406 GLU C CD    1 
ATOM   8036  O  OE1   . GLU C  1 265 ? 50.384  10.961  -18.156 1.00 68.33  ? 406 GLU C OE1   1 
ATOM   8037  O  OE2   . GLU C  1 265 ? 50.050  10.362  -16.067 1.00 71.29  ? 406 GLU C OE2   1 
ATOM   8038  N  N     . GLN C  1 266 ? 53.860  15.167  -18.694 1.00 49.37  ? 407 GLN C N     1 
ATOM   8039  C  CA    . GLN C  1 266 ? 54.148  15.994  -19.860 1.00 48.17  ? 407 GLN C CA    1 
ATOM   8040  C  C     . GLN C  1 266 ? 55.645  16.199  -20.037 1.00 49.66  ? 407 GLN C C     1 
ATOM   8041  O  O     . GLN C  1 266 ? 56.185  16.019  -21.136 1.00 53.81  ? 407 GLN C O     1 
ATOM   8042  C  CB    . GLN C  1 266 ? 53.466  17.352  -19.717 1.00 47.80  ? 407 GLN C CB    1 
ATOM   8043  C  CG    . GLN C  1 266 ? 51.952  17.298  -19.721 1.00 47.23  ? 407 GLN C CG    1 
ATOM   8044  C  CD    . GLN C  1 266 ? 51.394  16.871  -21.056 1.00 46.80  ? 407 GLN C CD    1 
ATOM   8045  O  OE1   . GLN C  1 266 ? 51.221  15.681  -21.317 1.00 44.58  ? 407 GLN C OE1   1 
ATOM   8046  N  NE2   . GLN C  1 266 ? 51.109  17.841  -21.914 1.00 49.64  ? 407 GLN C NE2   1 
ATOM   8047  N  N     . LEU C  1 267 ? 56.311  16.580  -18.950 1.00 48.98  ? 408 LEU C N     1 
ATOM   8048  C  CA    . LEU C  1 267 ? 57.757  16.777  -18.980 1.00 44.19  ? 408 LEU C CA    1 
ATOM   8049  C  C     . LEU C  1 267 ? 58.492  15.494  -19.385 1.00 43.93  ? 408 LEU C C     1 
ATOM   8050  O  O     . LEU C  1 267 ? 59.409  15.539  -20.205 1.00 48.66  ? 408 LEU C O     1 
ATOM   8051  C  CB    . LEU C  1 267 ? 58.263  17.298  -17.631 1.00 38.77  ? 408 LEU C CB    1 
ATOM   8052  C  CG    . LEU C  1 267 ? 57.849  18.708  -17.212 1.00 32.56  ? 408 LEU C CG    1 
ATOM   8053  C  CD1   . LEU C  1 267 ? 58.150  18.943  -15.741 1.00 27.58  ? 408 LEU C CD1   1 
ATOM   8054  C  CD2   . LEU C  1 267 ? 58.551  19.753  -18.061 1.00 31.11  ? 408 LEU C CD2   1 
ATOM   8055  N  N     . LYS C  1 268 ? 58.081  14.356  -18.827 1.00 39.76  ? 409 LYS C N     1 
ATOM   8056  C  CA    . LYS C  1 268 ? 58.680  13.066  -19.183 1.00 40.66  ? 409 LYS C CA    1 
ATOM   8057  C  C     . LYS C  1 268 ? 58.375  12.684  -20.624 1.00 46.78  ? 409 LYS C C     1 
ATOM   8058  O  O     . LYS C  1 268 ? 59.143  11.959  -21.258 1.00 49.64  ? 409 LYS C O     1 
ATOM   8059  C  CB    . LYS C  1 268 ? 58.179  11.955  -18.258 1.00 35.71  ? 409 LYS C CB    1 
ATOM   8060  C  CG    . LYS C  1 268 ? 58.746  11.983  -16.857 1.00 32.03  ? 409 LYS C CG    1 
ATOM   8061  C  CD    . LYS C  1 268 ? 58.070  10.941  -15.982 1.00 33.16  ? 409 LYS C CD    1 
ATOM   8062  C  CE    . LYS C  1 268 ? 58.154  9.560   -16.603 1.00 35.47  ? 409 LYS C CE    1 
ATOM   8063  N  NZ    . LYS C  1 268 ? 59.558  9.175   -16.895 1.00 35.57  ? 409 LYS C NZ    1 
ATOM   8064  N  N     . LYS C  1 269 ? 57.246  13.170  -21.129 1.00 50.65  ? 410 LYS C N     1 
ATOM   8065  C  CA    . LYS C  1 269 ? 56.818  12.890  -22.493 1.00 53.30  ? 410 LYS C CA    1 
ATOM   8066  C  C     . LYS C  1 269 ? 57.703  13.652  -23.465 1.00 52.35  ? 410 LYS C C     1 
ATOM   8067  O  O     . LYS C  1 269 ? 58.013  13.167  -24.552 1.00 47.98  ? 410 LYS C O     1 
ATOM   8068  C  CB    . LYS C  1 269 ? 55.363  13.314  -22.673 1.00 55.04  ? 410 LYS C CB    1 
ATOM   8069  C  CG    . LYS C  1 269 ? 54.615  12.611  -23.791 1.00 58.53  ? 410 LYS C CG    1 
ATOM   8070  C  CD    . LYS C  1 269 ? 53.130  12.928  -23.676 1.00 65.41  ? 410 LYS C CD    1 
ATOM   8071  C  CE    . LYS C  1 269 ? 52.298  12.240  -24.740 1.00 70.16  ? 410 LYS C CE    1 
ATOM   8072  N  NZ    . LYS C  1 269 ? 50.846  12.500  -24.519 1.00 73.78  ? 410 LYS C NZ    1 
ATOM   8073  N  N     . GLU C  1 270 ? 58.115  14.848  -23.059 1.00 56.43  ? 411 GLU C N     1 
ATOM   8074  C  CA    . GLU C  1 270 ? 58.962  15.679  -23.902 1.00 57.30  ? 411 GLU C CA    1 
ATOM   8075  C  C     . GLU C  1 270 ? 60.436  15.288  -23.788 1.00 57.84  ? 411 GLU C C     1 
ATOM   8076  O  O     . GLU C  1 270 ? 61.130  15.135  -24.799 1.00 58.81  ? 411 GLU C O     1 
ATOM   8077  C  CB    . GLU C  1 270 ? 58.772  17.146  -23.530 1.00 59.78  ? 411 GLU C CB    1 
ATOM   8078  C  CG    . GLU C  1 270 ? 59.160  18.126  -24.616 1.00 65.46  ? 411 GLU C CG    1 
ATOM   8079  C  CD    . GLU C  1 270 ? 58.537  19.488  -24.405 1.00 71.56  ? 411 GLU C CD    1 
ATOM   8080  O  OE1   . GLU C  1 270 ? 57.302  19.557  -24.230 1.00 72.39  ? 411 GLU C OE1   1 
ATOM   8081  O  OE2   . GLU C  1 270 ? 59.283  20.488  -24.412 1.00 74.63  ? 411 GLU C OE2   1 
ATOM   8082  N  N     . PHE C  1 271 ? 60.909  15.107  -22.560 1.00 57.51  ? 412 PHE C N     1 
ATOM   8083  C  CA    . PHE C  1 271 ? 62.338  14.907  -22.341 1.00 58.13  ? 412 PHE C CA    1 
ATOM   8084  C  C     . PHE C  1 271 ? 62.746  13.498  -21.917 1.00 61.03  ? 412 PHE C C     1 
ATOM   8085  O  O     . PHE C  1 271 ? 62.093  12.863  -21.085 1.00 64.40  ? 412 PHE C O     1 
ATOM   8086  C  CB    . PHE C  1 271 ? 62.863  15.947  -21.353 1.00 56.10  ? 412 PHE C CB    1 
ATOM   8087  C  CG    . PHE C  1 271 ? 62.652  17.356  -21.809 1.00 56.52  ? 412 PHE C CG    1 
ATOM   8088  C  CD1   . PHE C  1 271 ? 63.588  17.979  -22.616 1.00 57.46  ? 412 PHE C CD1   1 
ATOM   8089  C  CD2   . PHE C  1 271 ? 61.508  18.052  -21.449 1.00 55.93  ? 412 PHE C CD2   1 
ATOM   8090  C  CE1   . PHE C  1 271 ? 63.393  19.277  -23.051 1.00 58.99  ? 412 PHE C CE1   1 
ATOM   8091  C  CE2   . PHE C  1 271 ? 61.303  19.349  -21.879 1.00 57.30  ? 412 PHE C CE2   1 
ATOM   8092  C  CZ    . PHE C  1 271 ? 62.246  19.962  -22.683 1.00 58.58  ? 412 PHE C CZ    1 
ATOM   8093  N  N     . GLN C  1 272 ? 63.842  13.032  -22.509 1.00 59.50  ? 413 GLN C N     1 
ATOM   8094  C  CA    . GLN C  1 272 ? 64.416  11.724  -22.222 1.00 55.87  ? 413 GLN C CA    1 
ATOM   8095  C  C     . GLN C  1 272 ? 65.296  11.803  -20.968 1.00 47.40  ? 413 GLN C C     1 
ATOM   8096  O  O     . GLN C  1 272 ? 65.657  10.783  -20.381 1.00 45.35  ? 413 GLN C O     1 
ATOM   8097  C  CB    . GLN C  1 272 ? 65.233  11.263  -23.438 1.00 58.99  ? 413 GLN C CB    1 
ATOM   8098  C  CG    . GLN C  1 272 ? 65.807  9.848   -23.366 1.00 59.24  ? 413 GLN C CG    1 
ATOM   8099  C  CD    . GLN C  1 272 ? 66.672  9.511   -24.564 1.00 58.80  ? 413 GLN C CD    1 
ATOM   8100  O  OE1   . GLN C  1 272 ? 66.382  9.916   -25.689 1.00 57.89  ? 413 GLN C OE1   1 
ATOM   8101  N  NE2   . GLN C  1 272 ? 67.745  8.768   -24.326 1.00 59.17  ? 413 GLN C NE2   1 
ATOM   8102  N  N     . GLU C  1 273 ? 65.622  13.025  -20.554 1.00 44.19  ? 414 GLU C N     1 
ATOM   8103  C  CA    . GLU C  1 273 ? 66.476  13.246  -19.390 1.00 44.18  ? 414 GLU C CA    1 
ATOM   8104  C  C     . GLU C  1 273 ? 65.734  12.989  -18.081 1.00 46.47  ? 414 GLU C C     1 
ATOM   8105  O  O     . GLU C  1 273 ? 66.298  13.154  -16.998 1.00 49.52  ? 414 GLU C O     1 
ATOM   8106  C  CB    . GLU C  1 273 ? 67.025  14.676  -19.387 1.00 42.44  ? 414 GLU C CB    1 
ATOM   8107  C  CG    . GLU C  1 273 ? 67.959  15.019  -20.544 1.00 44.53  ? 414 GLU C CG    1 
ATOM   8108  C  CD    . GLU C  1 273 ? 67.224  15.563  -21.755 1.00 48.63  ? 414 GLU C CD    1 
ATOM   8109  O  OE1   . GLU C  1 273 ? 67.767  16.468  -22.420 1.00 52.39  ? 414 GLU C OE1   1 
ATOM   8110  O  OE2   . GLU C  1 273 ? 66.111  15.082  -22.053 1.00 47.54  ? 414 GLU C OE2   1 
ATOM   8111  N  N     . LEU C  1 274 ? 64.475  12.581  -18.184 1.00 43.90  ? 415 LEU C N     1 
ATOM   8112  C  CA    . LEU C  1 274 ? 63.637  12.407  -17.009 1.00 43.05  ? 415 LEU C CA    1 
ATOM   8113  C  C     . LEU C  1 274 ? 63.134  10.971  -16.880 1.00 39.08  ? 415 LEU C C     1 
ATOM   8114  O  O     . LEU C  1 274 ? 62.141  10.720  -16.208 1.00 39.42  ? 415 LEU C O     1 
ATOM   8115  C  CB    . LEU C  1 274 ? 62.462  13.389  -17.061 1.00 43.56  ? 415 LEU C CB    1 
ATOM   8116  C  CG    . LEU C  1 274 ? 62.861  14.855  -17.253 1.00 43.46  ? 415 LEU C CG    1 
ATOM   8117  C  CD1   . LEU C  1 274 ? 61.658  15.752  -17.516 1.00 43.25  ? 415 LEU C CD1   1 
ATOM   8118  C  CD2   . LEU C  1 274 ? 63.646  15.355  -16.050 1.00 39.98  ? 415 LEU C CD2   1 
ATOM   8119  N  N     . ASP C  1 275 ? 63.835  10.030  -17.504 1.00 40.51  ? 416 ASP C N     1 
ATOM   8120  C  CA    . ASP C  1 275 ? 63.404  8.632   -17.500 1.00 42.95  ? 416 ASP C CA    1 
ATOM   8121  C  C     . ASP C  1 275 ? 63.475  7.952   -16.121 1.00 43.97  ? 416 ASP C C     1 
ATOM   8122  O  O     . ASP C  1 275 ? 62.818  6.939   -15.885 1.00 45.16  ? 416 ASP C O     1 
ATOM   8123  C  CB    . ASP C  1 275 ? 64.185  7.827   -18.546 1.00 44.21  ? 416 ASP C CB    1 
ATOM   8124  C  CG    . ASP C  1 275 ? 63.792  8.184   -19.973 1.00 49.55  ? 416 ASP C CG    1 
ATOM   8125  O  OD1   . ASP C  1 275 ? 62.770  8.877   -20.154 1.00 51.67  ? 416 ASP C OD1   1 
ATOM   8126  O  OD2   . ASP C  1 275 ? 64.501  7.762   -20.913 1.00 50.76  ? 416 ASP C OD2   1 
ATOM   8127  N  N     . ALA C  1 276 ? 64.262  8.516   -15.211 1.00 41.91  ? 417 ALA C N     1 
ATOM   8128  C  CA    . ALA C  1 276 ? 64.434  7.930   -13.882 1.00 36.14  ? 417 ALA C CA    1 
ATOM   8129  C  C     . ALA C  1 276 ? 63.306  8.332   -12.936 1.00 34.82  ? 417 ALA C C     1 
ATOM   8130  O  O     . ALA C  1 276 ? 63.235  7.847   -11.806 1.00 33.84  ? 417 ALA C O     1 
ATOM   8131  C  CB    . ALA C  1 276 ? 65.773  8.335   -13.300 1.00 30.53  ? 417 ALA C CB    1 
ATOM   8132  N  N     . PHE C  1 277 ? 62.430  9.216   -13.403 1.00 36.92  ? 418 PHE C N     1 
ATOM   8133  C  CA    . PHE C  1 277 ? 61.350  9.742   -12.576 1.00 34.01  ? 418 PHE C CA    1 
ATOM   8134  C  C     . PHE C  1 277 ? 60.013  9.047   -12.832 1.00 31.55  ? 418 PHE C C     1 
ATOM   8135  O  O     . PHE C  1 277 ? 59.681  8.720   -13.972 1.00 28.41  ? 418 PHE C O     1 
ATOM   8136  C  CB    . PHE C  1 277 ? 61.216  11.248  -12.795 1.00 34.70  ? 418 PHE C CB    1 
ATOM   8137  C  CG    . PHE C  1 277 ? 62.413  12.030  -12.343 1.00 37.23  ? 418 PHE C CG    1 
ATOM   8138  C  CD1   . PHE C  1 277 ? 62.575  12.357  -11.005 1.00 40.44  ? 418 PHE C CD1   1 
ATOM   8139  C  CD2   . PHE C  1 277 ? 63.369  12.449  -13.252 1.00 38.77  ? 418 PHE C CD2   1 
ATOM   8140  C  CE1   . PHE C  1 277 ? 63.674  13.080  -10.579 1.00 43.49  ? 418 PHE C CE1   1 
ATOM   8141  C  CE2   . PHE C  1 277 ? 64.470  13.173  -12.834 1.00 42.10  ? 418 PHE C CE2   1 
ATOM   8142  C  CZ    . PHE C  1 277 ? 64.621  13.490  -11.495 1.00 45.43  ? 418 PHE C CZ    1 
ATOM   8143  N  N     . CYS C  1 278 ? 59.251  8.824   -11.765 1.00 32.70  ? 419 CYS C N     1 
ATOM   8144  C  CA    . CYS C  1 278 ? 57.949  8.183   -11.875 1.00 32.12  ? 419 CYS C CA    1 
ATOM   8145  C  C     . CYS C  1 278 ? 56.944  8.919   -11.013 1.00 37.28  ? 419 CYS C C     1 
ATOM   8146  O  O     . CYS C  1 278 ? 57.312  9.775   -10.210 1.00 40.16  ? 419 CYS C O     1 
ATOM   8147  C  CB    . CYS C  1 278 ? 58.029  6.720   -11.440 1.00 33.31  ? 419 CYS C CB    1 
ATOM   8148  S  SG    . CYS C  1 278 ? 58.623  6.451   -9.760  1.00 33.74  ? 419 CYS C SG    1 
ATOM   8149  N  N     . SER C  1 279 ? 55.674  8.569   -11.171 1.00 40.13  ? 420 SER C N     1 
ATOM   8150  C  CA    . SER C  1 279 ? 54.612  9.193   -10.403 1.00 37.77  ? 420 SER C CA    1 
ATOM   8151  C  C     . SER C  1 279 ? 54.731  8.906   -8.905  1.00 38.85  ? 420 SER C C     1 
ATOM   8152  O  O     . SER C  1 279 ? 54.114  9.596   -8.092  1.00 43.37  ? 420 SER C O     1 
ATOM   8153  C  CB    . SER C  1 279 ? 53.251  8.743   -10.931 1.00 38.61  ? 420 SER C CB    1 
ATOM   8154  O  OG    . SER C  1 279 ? 53.214  7.343   -11.144 1.00 38.69  ? 420 SER C OG    1 
ATOM   8155  N  N     . TYR C  1 280 ? 55.534  7.911   -8.534  1.00 35.78  ? 421 TYR C N     1 
ATOM   8156  C  CA    . TYR C  1 280 ? 55.679  7.561   -7.123  1.00 33.66  ? 421 TYR C CA    1 
ATOM   8157  C  C     . TYR C  1 280 ? 56.476  8.605   -6.349  1.00 35.49  ? 421 TYR C C     1 
ATOM   8158  O  O     . TYR C  1 280 ? 56.255  8.797   -5.152  1.00 40.63  ? 421 TYR C O     1 
ATOM   8159  C  CB    . TYR C  1 280 ? 56.304  6.177   -6.942  1.00 33.14  ? 421 TYR C CB    1 
ATOM   8160  C  CG    . TYR C  1 280 ? 56.068  5.622   -5.556  1.00 33.00  ? 421 TYR C CG    1 
ATOM   8161  C  CD1   . TYR C  1 280 ? 54.784  5.538   -5.043  1.00 31.39  ? 421 TYR C CD1   1 
ATOM   8162  C  CD2   . TYR C  1 280 ? 57.119  5.194   -4.758  1.00 31.16  ? 421 TYR C CD2   1 
ATOM   8163  C  CE1   . TYR C  1 280 ? 54.550  5.045   -3.781  1.00 28.99  ? 421 TYR C CE1   1 
ATOM   8164  C  CE2   . TYR C  1 280 ? 56.890  4.693   -3.486  1.00 29.20  ? 421 TYR C CE2   1 
ATOM   8165  C  CZ    . TYR C  1 280 ? 55.600  4.624   -3.009  1.00 31.26  ? 421 TYR C CZ    1 
ATOM   8166  O  OH    . TYR C  1 280 ? 55.351  4.130   -1.754  1.00 36.86  ? 421 TYR C OH    1 
ATOM   8167  N  N     . HIS C  1 281 ? 57.407  9.270   -7.028  1.00 33.95  ? 422 HIS C N     1 
ATOM   8168  C  CA    . HIS C  1 281 ? 58.154  10.366  -6.422  1.00 31.10  ? 422 HIS C CA    1 
ATOM   8169  C  C     . HIS C  1 281 ? 57.180  11.469  -6.022  1.00 36.12  ? 422 HIS C C     1 
ATOM   8170  O  O     . HIS C  1 281 ? 57.247  12.019  -4.916  1.00 47.44  ? 422 HIS C O     1 
ATOM   8171  C  CB    . HIS C  1 281 ? 59.184  10.924  -7.407  1.00 33.62  ? 422 HIS C CB    1 
ATOM   8172  C  CG    . HIS C  1 281 ? 60.234  9.939   -7.820  1.00 34.90  ? 422 HIS C CG    1 
ATOM   8173  N  ND1   . HIS C  1 281 ? 60.591  9.746   -9.138  1.00 37.19  ? 422 HIS C ND1   1 
ATOM   8174  C  CD2   . HIS C  1 281 ? 61.014  9.105   -7.093  1.00 34.33  ? 422 HIS C CD2   1 
ATOM   8175  C  CE1   . HIS C  1 281 ? 61.538  8.827   -9.204  1.00 36.54  ? 422 HIS C CE1   1 
ATOM   8176  N  NE2   . HIS C  1 281 ? 61.814  8.423   -7.977  1.00 35.75  ? 422 HIS C NE2   1 
ATOM   8177  N  N     . VAL C  1 282 ? 56.273  11.778  -6.944  1.00 34.09  ? 423 VAL C N     1 
ATOM   8178  C  CA    . VAL C  1 282 ? 55.207  12.750  -6.731  1.00 34.15  ? 423 VAL C CA    1 
ATOM   8179  C  C     . VAL C  1 282 ? 54.283  12.352  -5.578  1.00 35.62  ? 423 VAL C C     1 
ATOM   8180  O  O     . VAL C  1 282 ? 54.026  13.152  -4.675  1.00 39.03  ? 423 VAL C O     1 
ATOM   8181  C  CB    . VAL C  1 282 ? 54.368  12.914  -8.012  1.00 32.75  ? 423 VAL C CB    1 
ATOM   8182  C  CG1   . VAL C  1 282 ? 53.122  13.714  -7.734  1.00 33.96  ? 423 VAL C CG1   1 
ATOM   8183  C  CG2   . VAL C  1 282 ? 55.182  13.571  -9.096  1.00 33.09  ? 423 VAL C CG2   1 
ATOM   8184  N  N     . LYS C  1 283 ? 53.786  11.118  -5.623  1.00 32.51  ? 424 LYS C N     1 
ATOM   8185  C  CA    . LYS C  1 283 ? 52.887  10.590  -4.598  1.00 28.98  ? 424 LYS C CA    1 
ATOM   8186  C  C     . LYS C  1 283 ? 53.515  10.658  -3.204  1.00 30.51  ? 424 LYS C C     1 
ATOM   8187  O  O     . LYS C  1 283 ? 52.886  11.125  -2.260  1.00 38.20  ? 424 LYS C O     1 
ATOM   8188  C  CB    . LYS C  1 283 ? 52.508  9.150   -4.942  1.00 25.34  ? 424 LYS C CB    1 
ATOM   8189  C  CG    . LYS C  1 283 ? 51.343  8.573   -4.146  1.00 24.60  ? 424 LYS C CG    1 
ATOM   8190  C  CD    . LYS C  1 283 ? 51.158  7.100   -4.503  1.00 25.02  ? 424 LYS C CD    1 
ATOM   8191  C  CE    . LYS C  1 283 ? 49.899  6.509   -3.899  1.00 27.52  ? 424 LYS C CE    1 
ATOM   8192  N  NZ    . LYS C  1 283 ? 49.795  5.055   -4.202  1.00 29.22  ? 424 LYS C NZ    1 
ATOM   8193  N  N     . THR C  1 284 ? 54.757  10.191  -3.090  1.00 25.72  ? 425 THR C N     1 
ATOM   8194  C  CA    . THR C  1 284 ? 55.530  10.288  -1.855  1.00 25.21  ? 425 THR C CA    1 
ATOM   8195  C  C     . THR C  1 284 ? 55.606  11.738  -1.390  1.00 25.91  ? 425 THR C C     1 
ATOM   8196  O  O     . THR C  1 284 ? 55.314  12.057  -0.231  1.00 33.26  ? 425 THR C O     1 
ATOM   8197  C  CB    . THR C  1 284 ? 56.968  9.778   -2.068  1.00 26.93  ? 425 THR C CB    1 
ATOM   8198  O  OG1   . THR C  1 284 ? 56.941  8.442   -2.588  1.00 26.14  ? 425 THR C OG1   1 
ATOM   8199  C  CG2   . THR C  1 284 ? 57.743  9.793   -0.766  1.00 27.03  ? 425 THR C CG2   1 
ATOM   8200  N  N     . ALA C  1 285 ? 56.006  12.610  -2.307  1.00 25.49  ? 426 ALA C N     1 
ATOM   8201  C  CA    . ALA C  1 285 ? 56.133  14.027  -2.009  1.00 27.52  ? 426 ALA C CA    1 
ATOM   8202  C  C     . ALA C  1 285 ? 54.852  14.595  -1.407  1.00 26.87  ? 426 ALA C C     1 
ATOM   8203  O  O     . ALA C  1 285 ? 54.895  15.296  -0.392  1.00 35.14  ? 426 ALA C O     1 
ATOM   8204  C  CB    . ALA C  1 285 ? 56.523  14.786  -3.255  1.00 29.40  ? 426 ALA C CB    1 
ATOM   8205  N  N     . ILE C  1 286 ? 53.711  14.296  -2.023  1.00 21.47  ? 427 ILE C N     1 
ATOM   8206  C  CA    . ILE C  1 286 ? 52.440  14.815  -1.513  1.00 22.31  ? 427 ILE C CA    1 
ATOM   8207  C  C     . ILE C  1 286 ? 51.983  14.112  -0.236  1.00 24.53  ? 427 ILE C C     1 
ATOM   8208  O  O     . ILE C  1 286 ? 51.218  14.681  0.531   1.00 30.76  ? 427 ILE C O     1 
ATOM   8209  C  CB    . ILE C  1 286 ? 51.322  14.832  -2.592  1.00 26.83  ? 427 ILE C CB    1 
ATOM   8210  C  CG1   . ILE C  1 286 ? 50.253  15.871  -2.236  1.00 28.16  ? 427 ILE C CG1   1 
ATOM   8211  C  CG2   . ILE C  1 286 ? 50.709  13.456  -2.781  1.00 25.92  ? 427 ILE C CG2   1 
ATOM   8212  C  CD1   . ILE C  1 286 ? 49.201  16.066  -3.306  1.00 29.47  ? 427 ILE C CD1   1 
ATOM   8213  N  N     . PHE C  1 287 ? 52.445  12.884  -0.009  1.00 28.39  ? 428 PHE C N     1 
ATOM   8214  C  CA    . PHE C  1 287 ? 52.238  12.232  1.279   1.00 26.74  ? 428 PHE C CA    1 
ATOM   8215  C  C     . PHE C  1 287 ? 52.888  13.090  2.361   1.00 28.18  ? 428 PHE C C     1 
ATOM   8216  O  O     . PHE C  1 287 ? 52.242  13.471  3.347   1.00 29.02  ? 428 PHE C O     1 
ATOM   8217  C  CB    . PHE C  1 287 ? 52.850  10.829  1.283   1.00 30.70  ? 428 PHE C CB    1 
ATOM   8218  C  CG    . PHE C  1 287 ? 51.935  9.751   0.756   1.00 35.66  ? 428 PHE C CG    1 
ATOM   8219  C  CD1   . PHE C  1 287 ? 50.556  9.914   0.767   1.00 38.68  ? 428 PHE C CD1   1 
ATOM   8220  C  CD2   . PHE C  1 287 ? 52.462  8.564   0.256   1.00 34.94  ? 428 PHE C CD2   1 
ATOM   8221  C  CE1   . PHE C  1 287 ? 49.716  8.915   0.283   1.00 39.38  ? 428 PHE C CE1   1 
ATOM   8222  C  CE2   . PHE C  1 287 ? 51.631  7.568   -0.225  1.00 36.18  ? 428 PHE C CE2   1 
ATOM   8223  C  CZ    . PHE C  1 287 ? 50.255  7.744   -0.211  1.00 38.51  ? 428 PHE C CZ    1 
ATOM   8224  N  N     . HIS C  1 288 ? 54.169  13.404  2.167   1.00 28.03  ? 429 HIS C N     1 
ATOM   8225  C  CA    . HIS C  1 288 ? 54.878  14.276  3.098   1.00 26.36  ? 429 HIS C CA    1 
ATOM   8226  C  C     . HIS C  1 288 ? 54.217  15.657  3.224   1.00 28.38  ? 429 HIS C C     1 
ATOM   8227  O  O     . HIS C  1 288 ? 54.183  16.234  4.314   1.00 29.06  ? 429 HIS C O     1 
ATOM   8228  C  CB    . HIS C  1 288 ? 56.350  14.417  2.692   1.00 30.50  ? 429 HIS C CB    1 
ATOM   8229  C  CG    . HIS C  1 288 ? 57.173  13.192  2.950   1.00 29.65  ? 429 HIS C CG    1 
ATOM   8230  N  ND1   . HIS C  1 288 ? 57.512  12.780  4.222   1.00 30.97  ? 429 HIS C ND1   1 
ATOM   8231  C  CD2   . HIS C  1 288 ? 57.734  12.299  2.103   1.00 26.63  ? 429 HIS C CD2   1 
ATOM   8232  C  CE1   . HIS C  1 288 ? 58.242  11.681  4.145   1.00 28.10  ? 429 HIS C CE1   1 
ATOM   8233  N  NE2   . HIS C  1 288 ? 58.391  11.369  2.870   1.00 27.75  ? 429 HIS C NE2   1 
ATOM   8234  N  N     . MET C  1 289 ? 53.681  16.178  2.123   1.00 29.38  ? 430 MET C N     1 
ATOM   8235  C  CA    . MET C  1 289 ? 52.981  17.461  2.171   1.00 29.70  ? 430 MET C CA    1 
ATOM   8236  C  C     . MET C  1 289 ? 51.723  17.400  3.042   1.00 34.93  ? 430 MET C C     1 
ATOM   8237  O  O     . MET C  1 289 ? 51.538  18.237  3.925   1.00 42.32  ? 430 MET C O     1 
ATOM   8238  C  CB    . MET C  1 289 ? 52.632  17.953  0.764   1.00 31.80  ? 430 MET C CB    1 
ATOM   8239  C  CG    . MET C  1 289 ? 53.604  18.978  0.179   1.00 29.71  ? 430 MET C CG    1 
ATOM   8240  S  SD    . MET C  1 289 ? 53.452  20.611  0.937   1.00 37.81  ? 430 MET C SD    1 
ATOM   8241  C  CE    . MET C  1 289 ? 54.835  20.582  2.069   1.00 67.25  ? 430 MET C CE    1 
ATOM   8242  N  N     . TRP C  1 290 ? 50.873  16.405  2.795   1.00 31.59  ? 431 TRP C N     1 
ATOM   8243  C  CA    . TRP C  1 290 ? 49.659  16.187  3.583   1.00 30.19  ? 431 TRP C CA    1 
ATOM   8244  C  C     . TRP C  1 290 ? 49.985  16.009  5.060   1.00 30.12  ? 431 TRP C C     1 
ATOM   8245  O  O     . TRP C  1 290 ? 49.236  16.443  5.933   1.00 32.44  ? 431 TRP C O     1 
ATOM   8246  C  CB    . TRP C  1 290 ? 48.910  14.953  3.074   1.00 28.92  ? 431 TRP C CB    1 
ATOM   8247  C  CG    . TRP C  1 290 ? 48.318  15.120  1.714   1.00 26.83  ? 431 TRP C CG    1 
ATOM   8248  C  CD1   . TRP C  1 290 ? 48.047  16.293  1.079   1.00 29.20  ? 431 TRP C CD1   1 
ATOM   8249  C  CD2   . TRP C  1 290 ? 47.927  14.077  0.812   1.00 29.32  ? 431 TRP C CD2   1 
ATOM   8250  N  NE1   . TRP C  1 290 ? 47.506  16.047  -0.160  1.00 29.42  ? 431 TRP C NE1   1 
ATOM   8251  C  CE2   . TRP C  1 290 ? 47.423  14.689  -0.349  1.00 31.17  ? 431 TRP C CE2   1 
ATOM   8252  C  CE3   . TRP C  1 290 ? 47.952  12.682  0.875   1.00 30.85  ? 431 TRP C CE3   1 
ATOM   8253  C  CZ2   . TRP C  1 290 ? 46.948  13.955  -1.442  1.00 32.90  ? 431 TRP C CZ2   1 
ATOM   8254  C  CZ3   . TRP C  1 290 ? 47.479  11.955  -0.206  1.00 32.98  ? 431 TRP C CZ3   1 
ATOM   8255  C  CH2   . TRP C  1 290 ? 46.987  12.591  -1.348  1.00 33.82  ? 431 TRP C CH2   1 
ATOM   8256  N  N     . THR C  1 291 ? 51.112  15.361  5.325   1.00 30.89  ? 432 THR C N     1 
ATOM   8257  C  CA    . THR C  1 291 ? 51.607  15.193  6.682   1.00 31.24  ? 432 THR C CA    1 
ATOM   8258  C  C     . THR C  1 291 ? 52.022  16.534  7.299   1.00 34.09  ? 432 THR C C     1 
ATOM   8259  O  O     . THR C  1 291 ? 51.794  16.772  8.486   1.00 36.42  ? 432 THR C O     1 
ATOM   8260  C  CB    . THR C  1 291 ? 52.787  14.223  6.689   1.00 30.49  ? 432 THR C CB    1 
ATOM   8261  O  OG1   . THR C  1 291 ? 52.361  12.964  6.151   1.00 28.76  ? 432 THR C OG1   1 
ATOM   8262  C  CG2   . THR C  1 291 ? 53.313  14.023  8.088   1.00 29.81  ? 432 THR C CG2   1 
ATOM   8263  N  N     . GLN C  1 292 ? 52.634  17.404  6.497   1.00 35.16  ? 433 GLN C N     1 
ATOM   8264  C  CA    . GLN C  1 292 ? 53.033  18.720  6.985   1.00 33.58  ? 433 GLN C CA    1 
ATOM   8265  C  C     . GLN C  1 292 ? 51.811  19.590  7.207   1.00 33.72  ? 433 GLN C C     1 
ATOM   8266  O  O     . GLN C  1 292 ? 51.730  20.320  8.195   1.00 34.40  ? 433 GLN C O     1 
ATOM   8267  C  CB    . GLN C  1 292 ? 53.970  19.421  6.001   1.00 36.94  ? 433 GLN C CB    1 
ATOM   8268  C  CG    . GLN C  1 292 ? 55.330  18.761  5.819   1.00 39.99  ? 433 GLN C CG    1 
ATOM   8269  C  CD    . GLN C  1 292 ? 56.367  19.711  5.244   1.00 42.99  ? 433 GLN C CD    1 
ATOM   8270  O  OE1   . GLN C  1 292 ? 56.147  20.920  5.166   1.00 46.42  ? 433 GLN C OE1   1 
ATOM   8271  N  NE2   . GLN C  1 292 ? 57.508  19.167  4.848   1.00 43.47  ? 433 GLN C NE2   1 
ATOM   8272  N  N     . ASP C  1 293 ? 50.871  19.523  6.269   1.00 32.60  ? 434 ASP C N     1 
ATOM   8273  C  CA    . ASP C  1 293 ? 49.639  20.296  6.356   1.00 33.25  ? 434 ASP C CA    1 
ATOM   8274  C  C     . ASP C  1 293 ? 48.447  19.372  6.594   1.00 33.40  ? 434 ASP C C     1 
ATOM   8275  O  O     . ASP C  1 293 ? 47.740  19.017  5.647   1.00 34.32  ? 434 ASP C O     1 
ATOM   8276  C  CB    . ASP C  1 293 ? 49.434  21.100  5.071   1.00 35.83  ? 434 ASP C CB    1 
ATOM   8277  C  CG    . ASP C  1 293 ? 50.540  22.111  4.832   1.00 38.32  ? 434 ASP C CG    1 
ATOM   8278  O  OD1   . ASP C  1 293 ? 50.411  22.926  3.899   1.00 37.75  ? 434 ASP C OD1   1 
ATOM   8279  O  OD2   . ASP C  1 293 ? 51.534  22.098  5.583   1.00 42.61  ? 434 ASP C OD2   1 
ATOM   8280  N  N     . PRO C  1 294 ? 48.218  18.981  7.863   1.00 31.31  ? 435 PRO C N     1 
ATOM   8281  C  CA    . PRO C  1 294 ? 47.175  17.999  8.172   1.00 31.38  ? 435 PRO C CA    1 
ATOM   8282  C  C     . PRO C  1 294 ? 45.767  18.543  7.990   1.00 36.24  ? 435 PRO C C     1 
ATOM   8283  O  O     . PRO C  1 294 ? 44.865  17.766  7.667   1.00 41.27  ? 435 PRO C O     1 
ATOM   8284  C  CB    . PRO C  1 294 ? 47.411  17.689  9.655   1.00 29.33  ? 435 PRO C CB    1 
ATOM   8285  C  CG    . PRO C  1 294 ? 48.792  18.185  9.957   1.00 32.85  ? 435 PRO C CG    1 
ATOM   8286  C  CD    . PRO C  1 294 ? 48.957  19.377  9.072   1.00 32.13  ? 435 PRO C CD    1 
ATOM   8287  N  N     . GLN C  1 295 ? 45.576  19.844  8.186   1.00 37.52  ? 436 GLN C N     1 
ATOM   8288  C  CA    . GLN C  1 295 ? 44.229  20.425  8.154   1.00 40.04  ? 436 GLN C CA    1 
ATOM   8289  C  C     . GLN C  1 295 ? 43.557  20.386  6.790   1.00 40.61  ? 436 GLN C C     1 
ATOM   8290  O  O     . GLN C  1 295 ? 44.185  20.692  5.778   1.00 45.20  ? 436 GLN C O     1 
ATOM   8291  C  CB    . GLN C  1 295 ? 44.252  21.866  8.656   1.00 47.24  ? 436 GLN C CB    1 
ATOM   8292  C  CG    . GLN C  1 295 ? 44.378  21.975  10.161  1.00 53.16  ? 436 GLN C CG    1 
ATOM   8293  C  CD    . GLN C  1 295 ? 43.288  21.215  10.880  1.00 61.78  ? 436 GLN C CD    1 
ATOM   8294  O  OE1   . GLN C  1 295 ? 42.123  21.254  10.481  1.00 63.98  ? 436 GLN C OE1   1 
ATOM   8295  N  NE2   . GLN C  1 295 ? 43.659  20.508  11.941  1.00 65.07  ? 436 GLN C NE2   1 
ATOM   8296  N  N     . ASP C  1 296 ? 42.275  20.026  6.776   1.00 41.10  ? 437 ASP C N     1 
ATOM   8297  C  CA    . ASP C  1 296 ? 41.495  20.011  5.542   1.00 36.73  ? 437 ASP C CA    1 
ATOM   8298  C  C     . ASP C  1 296 ? 41.339  21.426  4.998   1.00 33.24  ? 437 ASP C C     1 
ATOM   8299  O  O     . ASP C  1 296 ? 41.234  21.634  3.792   1.00 36.86  ? 437 ASP C O     1 
ATOM   8300  C  CB    . ASP C  1 296 ? 40.114  19.402  5.787   1.00 32.26  ? 437 ASP C CB    1 
ATOM   8301  C  CG    . ASP C  1 296 ? 40.182  18.007  6.368   1.00 29.88  ? 437 ASP C CG    1 
ATOM   8302  O  OD1   . ASP C  1 296 ? 40.939  17.172  5.844   1.00 30.08  ? 437 ASP C OD1   1 
ATOM   8303  O  OD2   . ASP C  1 296 ? 39.471  17.745  7.353   1.00 32.95  ? 437 ASP C OD2   1 
ATOM   8304  N  N     . SER C  1 297 ? 41.332  22.397  5.904   1.00 36.24  ? 438 SER C N     1 
ATOM   8305  C  CA    . SER C  1 297 ? 41.237  23.802  5.539   1.00 40.48  ? 438 SER C CA    1 
ATOM   8306  C  C     . SER C  1 297 ? 42.561  24.315  4.978   1.00 45.85  ? 438 SER C C     1 
ATOM   8307  O  O     . SER C  1 297 ? 42.610  25.387  4.378   1.00 51.73  ? 438 SER C O     1 
ATOM   8308  C  CB    . SER C  1 297 ? 40.821  24.632  6.749   1.00 44.78  ? 438 SER C CB    1 
ATOM   8309  O  OG    . SER C  1 297 ? 41.735  24.458  7.819   1.00 48.05  ? 438 SER C OG    1 
ATOM   8310  N  N     . GLN C  1 298 ? 43.632  23.547  5.173   1.00 44.61  ? 439 GLN C N     1 
ATOM   8311  C  CA    . GLN C  1 298 ? 44.908  23.836  4.528   1.00 38.38  ? 439 GLN C CA    1 
ATOM   8312  C  C     . GLN C  1 298 ? 44.867  23.282  3.111   1.00 42.56  ? 439 GLN C C     1 
ATOM   8313  O  O     . GLN C  1 298 ? 45.854  23.351  2.382   1.00 43.94  ? 439 GLN C O     1 
ATOM   8314  C  CB    . GLN C  1 298 ? 46.079  23.203  5.292   1.00 31.61  ? 439 GLN C CB    1 
ATOM   8315  C  CG    . GLN C  1 298 ? 46.466  23.912  6.586   1.00 31.98  ? 439 GLN C CG    1 
ATOM   8316  C  CD    . GLN C  1 298 ? 47.690  23.308  7.267   1.00 32.89  ? 439 GLN C CD    1 
ATOM   8317  O  OE1   . GLN C  1 298 ? 47.573  22.460  8.150   1.00 36.47  ? 439 GLN C OE1   1 
ATOM   8318  N  NE2   . GLN C  1 298 ? 48.868  23.762  6.869   1.00 34.12  ? 439 GLN C NE2   1 
ATOM   8319  N  N     . TRP C  1 299 ? 43.720  22.726  2.728   1.00 41.97  ? 440 TRP C N     1 
ATOM   8320  C  CA    . TRP C  1 299 ? 43.545  22.161  1.398   1.00 41.15  ? 440 TRP C CA    1 
ATOM   8321  C  C     . TRP C  1 299 ? 42.174  22.509  0.838   1.00 43.89  ? 440 TRP C C     1 
ATOM   8322  O  O     . TRP C  1 299 ? 41.472  21.647  0.309   1.00 42.79  ? 440 TRP C O     1 
ATOM   8323  C  CB    . TRP C  1 299 ? 43.754  20.644  1.440   1.00 38.44  ? 440 TRP C CB    1 
ATOM   8324  C  CG    . TRP C  1 299 ? 45.129  20.272  1.915   1.00 37.20  ? 440 TRP C CG    1 
ATOM   8325  C  CD1   . TRP C  1 299 ? 45.522  20.060  3.202   1.00 38.65  ? 440 TRP C CD1   1 
ATOM   8326  C  CD2   . TRP C  1 299 ? 46.297  20.095  1.103   1.00 32.41  ? 440 TRP C CD2   1 
ATOM   8327  N  NE1   . TRP C  1 299 ? 46.863  19.755  3.242   1.00 36.37  ? 440 TRP C NE1   1 
ATOM   8328  C  CE2   . TRP C  1 299 ? 47.361  19.770  1.966   1.00 29.27  ? 440 TRP C CE2   1 
ATOM   8329  C  CE3   . TRP C  1 299 ? 46.543  20.177  -0.270  1.00 33.28  ? 440 TRP C CE3   1 
ATOM   8330  C  CZ2   . TRP C  1 299 ? 48.653  19.524  1.496   1.00 26.70  ? 440 TRP C CZ2   1 
ATOM   8331  C  CZ3   . TRP C  1 299 ? 47.825  19.934  -0.735  1.00 29.25  ? 440 TRP C CZ3   1 
ATOM   8332  C  CH2   . TRP C  1 299 ? 48.861  19.609  0.143   1.00 29.62  ? 440 TRP C CH2   1 
ATOM   8333  N  N     . ASP C  1 300 ? 41.805  23.782  0.954   1.00 46.23  ? 441 ASP C N     1 
ATOM   8334  C  CA    . ASP C  1 300 ? 40.511  24.245  0.473   1.00 47.41  ? 441 ASP C CA    1 
ATOM   8335  C  C     . ASP C  1 300 ? 40.527  24.378  -1.043  1.00 45.24  ? 441 ASP C C     1 
ATOM   8336  O  O     . ASP C  1 300 ? 41.481  24.901  -1.619  1.00 45.30  ? 441 ASP C O     1 
ATOM   8337  C  CB    . ASP C  1 300 ? 40.147  25.586  1.110   1.00 50.94  ? 441 ASP C CB    1 
ATOM   8338  C  CG    . ASP C  1 300 ? 38.645  25.818  1.171   1.00 51.67  ? 441 ASP C CG    1 
ATOM   8339  O  OD1   . ASP C  1 300 ? 38.060  26.256  0.159   1.00 51.87  ? 441 ASP C OD1   1 
ATOM   8340  O  OD2   . ASP C  1 300 ? 38.049  25.570  2.240   1.00 53.15  ? 441 ASP C OD2   1 
ATOM   8341  N  N     . PRO C  1 301 ? 39.462  23.898  -1.697  1.00 45.45  ? 442 PRO C N     1 
ATOM   8342  C  CA    . PRO C  1 301 ? 39.329  23.942  -3.156  1.00 47.29  ? 442 PRO C CA    1 
ATOM   8343  C  C     . PRO C  1 301 ? 39.359  25.367  -3.706  1.00 49.71  ? 442 PRO C C     1 
ATOM   8344  O  O     . PRO C  1 301 ? 39.449  25.538  -4.922  1.00 49.96  ? 442 PRO C O     1 
ATOM   8345  C  CB    . PRO C  1 301 ? 37.953  23.313  -3.389  1.00 45.46  ? 442 PRO C CB    1 
ATOM   8346  C  CG    . PRO C  1 301 ? 37.755  22.404  -2.214  1.00 42.50  ? 442 PRO C CG    1 
ATOM   8347  C  CD    . PRO C  1 301 ? 38.369  23.138  -1.064  1.00 43.71  ? 442 PRO C CD    1 
ATOM   8348  N  N     . ARG C  1 302 ? 39.280  26.362  -2.825  1.00 51.48  ? 443 ARG C N     1 
ATOM   8349  C  CA    . ARG C  1 302 ? 39.367  27.765  -3.217  1.00 52.28  ? 443 ARG C CA    1 
ATOM   8350  C  C     . ARG C  1 302 ? 40.813  28.249  -3.257  1.00 52.07  ? 443 ARG C C     1 
ATOM   8351  O  O     . ARG C  1 302 ? 41.109  29.270  -3.876  1.00 53.54  ? 443 ARG C O     1 
ATOM   8352  C  CB    . ARG C  1 302 ? 38.576  28.636  -2.244  1.00 55.80  ? 443 ARG C CB    1 
ATOM   8353  C  CG    . ARG C  1 302 ? 37.065  28.525  -2.361  1.00 59.59  ? 443 ARG C CG    1 
ATOM   8354  C  CD    . ARG C  1 302 ? 36.400  29.202  -1.178  1.00 65.95  ? 443 ARG C CD    1 
ATOM   8355  N  NE    . ARG C  1 302 ? 36.825  28.591  0.077   1.00 74.20  ? 443 ARG C NE    1 
ATOM   8356  C  CZ    . ARG C  1 302 ? 36.515  29.050  1.285   1.00 80.59  ? 443 ARG C CZ    1 
ATOM   8357  N  NH1   . ARG C  1 302 ? 35.771  30.139  1.419   1.00 83.07  ? 443 ARG C NH1   1 
ATOM   8358  N  NH2   . ARG C  1 302 ? 36.953  28.419  2.365   1.00 82.67  ? 443 ARG C NH2   1 
ATOM   8359  N  N     . ASN C  1 303 ? 41.705  27.524  -2.585  1.00 50.80  ? 444 ASN C N     1 
ATOM   8360  C  CA    . ASN C  1 303 ? 43.119  27.883  -2.554  1.00 50.09  ? 444 ASN C CA    1 
ATOM   8361  C  C     . ASN C  1 303 ? 43.964  26.945  -3.412  1.00 52.21  ? 444 ASN C C     1 
ATOM   8362  O  O     . ASN C  1 303 ? 45.190  26.913  -3.277  1.00 55.62  ? 444 ASN C O     1 
ATOM   8363  C  CB    . ASN C  1 303 ? 43.651  27.898  -1.113  1.00 48.16  ? 444 ASN C CB    1 
ATOM   8364  C  CG    . ASN C  1 303 ? 43.048  29.006  -0.276  1.00 48.84  ? 444 ASN C CG    1 
ATOM   8365  O  OD1   . ASN C  1 303 ? 43.480  30.158  -0.343  1.00 52.23  ? 444 ASN C OD1   1 
ATOM   8366  N  ND2   . ASN C  1 303 ? 42.053  28.661  0.529   1.00 45.56  ? 444 ASN C ND2   1 
ATOM   8367  N  N     . LEU C  1 304 ? 43.289  26.207  -4.294  1.00 47.70  ? 445 LEU C N     1 
ATOM   8368  C  CA    . LEU C  1 304 ? 43.909  25.213  -5.174  1.00 41.68  ? 445 LEU C CA    1 
ATOM   8369  C  C     . LEU C  1 304 ? 45.296  25.613  -5.669  1.00 43.47  ? 445 LEU C C     1 
ATOM   8370  O  O     . LEU C  1 304 ? 46.281  24.927  -5.378  1.00 43.30  ? 445 LEU C O     1 
ATOM   8371  C  CB    . LEU C  1 304 ? 42.989  24.900  -6.360  1.00 35.26  ? 445 LEU C CB    1 
ATOM   8372  C  CG    . LEU C  1 304 ? 43.499  23.923  -7.422  1.00 36.01  ? 445 LEU C CG    1 
ATOM   8373  C  CD1   . LEU C  1 304 ? 43.903  22.613  -6.793  1.00 37.71  ? 445 LEU C CD1   1 
ATOM   8374  C  CD2   . LEU C  1 304 ? 42.453  23.681  -8.493  1.00 37.74  ? 445 LEU C CD2   1 
ATOM   8375  N  N     . SER C  1 305 ? 45.368  26.737  -6.378  1.00 43.47  ? 446 SER C N     1 
ATOM   8376  C  CA    . SER C  1 305 ? 46.621  27.235  -6.933  1.00 42.95  ? 446 SER C CA    1 
ATOM   8377  C  C     . SER C  1 305 ? 47.712  27.311  -5.878  1.00 40.28  ? 446 SER C C     1 
ATOM   8378  O  O     . SER C  1 305 ? 48.774  26.709  -6.030  1.00 44.86  ? 446 SER C O     1 
ATOM   8379  C  CB    . SER C  1 305 ? 46.404  28.611  -7.552  1.00 49.91  ? 446 SER C CB    1 
ATOM   8380  O  OG    . SER C  1 305 ? 45.183  28.647  -8.268  1.00 53.93  ? 446 SER C OG    1 
ATOM   8381  N  N     . SER C  1 306 ? 47.431  28.024  -4.793  1.00 38.71  ? 447 SER C N     1 
ATOM   8382  C  CA    . SER C  1 306 ? 48.400  28.182  -3.718  1.00 39.25  ? 447 SER C CA    1 
ATOM   8383  C  C     . SER C  1 306 ? 48.743  26.842  -3.076  1.00 39.53  ? 447 SER C C     1 
ATOM   8384  O  O     . SER C  1 306 ? 49.863  26.651  -2.604  1.00 37.63  ? 447 SER C O     1 
ATOM   8385  C  CB    . SER C  1 306 ? 47.889  29.163  -2.661  1.00 40.58  ? 447 SER C CB    1 
ATOM   8386  O  OG    . SER C  1 306 ? 46.666  28.729  -2.097  1.00 40.78  ? 447 SER C OG    1 
ATOM   8387  N  N     . CYS C  1 307 ? 47.787  25.917  -3.058  1.00 42.57  ? 448 CYS C N     1 
ATOM   8388  C  CA    . CYS C  1 307 ? 48.090  24.570  -2.594  1.00 42.60  ? 448 CYS C CA    1 
ATOM   8389  C  C     . CYS C  1 307 ? 49.049  23.924  -3.588  1.00 43.05  ? 448 CYS C C     1 
ATOM   8390  O  O     . CYS C  1 307 ? 50.101  23.414  -3.199  1.00 42.44  ? 448 CYS C O     1 
ATOM   8391  C  CB    . CYS C  1 307 ? 46.823  23.726  -2.446  1.00 42.51  ? 448 CYS C CB    1 
ATOM   8392  S  SG    . CYS C  1 307 ? 45.750  24.165  -1.060  1.00 48.02  ? 448 CYS C SG    1 
ATOM   8393  N  N     . PHE C  1 308 ? 48.705  23.989  -4.875  1.00 43.59  ? 449 PHE C N     1 
ATOM   8394  C  CA    . PHE C  1 308 ? 49.515  23.350  -5.909  1.00 42.95  ? 449 PHE C CA    1 
ATOM   8395  C  C     . PHE C  1 308 ? 50.962  23.820  -5.843  1.00 42.74  ? 449 PHE C C     1 
ATOM   8396  O  O     . PHE C  1 308 ? 51.872  23.020  -5.581  1.00 44.60  ? 449 PHE C O     1 
ATOM   8397  C  CB    . PHE C  1 308 ? 48.933  23.612  -7.297  1.00 40.81  ? 449 PHE C CB    1 
ATOM   8398  C  CG    . PHE C  1 308 ? 49.686  22.930  -8.406  1.00 35.73  ? 449 PHE C CG    1 
ATOM   8399  C  CD1   . PHE C  1 308 ? 50.252  21.678  -8.208  1.00 32.56  ? 449 PHE C CD1   1 
ATOM   8400  C  CD2   . PHE C  1 308 ? 49.820  23.532  -9.645  1.00 33.65  ? 449 PHE C CD2   1 
ATOM   8401  C  CE1   . PHE C  1 308 ? 50.946  21.046  -9.220  1.00 32.08  ? 449 PHE C CE1   1 
ATOM   8402  C  CE2   . PHE C  1 308 ? 50.512  22.902  -10.663 1.00 34.86  ? 449 PHE C CE2   1 
ATOM   8403  C  CZ    . PHE C  1 308 ? 51.076  21.658  -10.446 1.00 33.43  ? 449 PHE C CZ    1 
ATOM   8404  N  N     . ASP C  1 309 ? 51.157  25.118  -6.056  1.00 38.09  ? 450 ASP C N     1 
ATOM   8405  C  CA    . ASP C  1 309 ? 52.466  25.736  -5.942  1.00 42.15  ? 450 ASP C CA    1 
ATOM   8406  C  C     . ASP C  1 309 ? 53.171  25.300  -4.660  1.00 42.21  ? 450 ASP C C     1 
ATOM   8407  O  O     . ASP C  1 309 ? 54.363  24.991  -4.687  1.00 45.61  ? 450 ASP C O     1 
ATOM   8408  C  CB    . ASP C  1 309 ? 52.330  27.256  -5.979  1.00 49.10  ? 450 ASP C CB    1 
ATOM   8409  C  CG    . ASP C  1 309 ? 53.655  27.954  -6.204  1.00 54.04  ? 450 ASP C CG    1 
ATOM   8410  O  OD1   . ASP C  1 309 ? 54.452  28.045  -5.242  1.00 49.67  ? 450 ASP C OD1   1 
ATOM   8411  O  OD2   . ASP C  1 309 ? 53.895  28.415  -7.342  1.00 58.73  ? 450 ASP C OD2   1 
ATOM   8412  N  N     . LYS C  1 310 ? 52.429  25.234  -3.553  1.00 40.32  ? 451 LYS C N     1 
ATOM   8413  C  CA    . LYS C  1 310 ? 53.021  24.848  -2.275  1.00 44.49  ? 451 LYS C CA    1 
ATOM   8414  C  C     . LYS C  1 310 ? 53.728  23.509  -2.452  1.00 45.99  ? 451 LYS C C     1 
ATOM   8415  O  O     . LYS C  1 310 ? 54.953  23.415  -2.281  1.00 48.25  ? 451 LYS C O     1 
ATOM   8416  C  CB    . LYS C  1 310 ? 51.946  24.764  -1.188  1.00 49.12  ? 451 LYS C CB    1 
ATOM   8417  C  CG    . LYS C  1 310 ? 52.463  24.698  0.240   1.00 52.60  ? 451 LYS C CG    1 
ATOM   8418  C  CD    . LYS C  1 310 ? 51.306  24.746  1.239   1.00 51.63  ? 451 LYS C CD    1 
ATOM   8419  C  CE    . LYS C  1 310 ? 50.203  23.755  0.869   1.00 49.41  ? 451 LYS C CE    1 
ATOM   8420  N  NZ    . LYS C  1 310 ? 49.067  23.767  1.841   1.00 46.07  ? 451 LYS C NZ    1 
ATOM   8421  N  N     . LEU C  1 311 ? 52.959  22.502  -2.865  1.00 44.32  ? 452 LEU C N     1 
ATOM   8422  C  CA    . LEU C  1 311 ? 53.499  21.173  -3.113  1.00 40.36  ? 452 LEU C CA    1 
ATOM   8423  C  C     . LEU C  1 311 ? 54.695  21.285  -4.045  1.00 39.42  ? 452 LEU C C     1 
ATOM   8424  O  O     . LEU C  1 311 ? 55.763  20.728  -3.763  1.00 45.57  ? 452 LEU C O     1 
ATOM   8425  C  CB    . LEU C  1 311 ? 52.422  20.265  -3.713  1.00 38.40  ? 452 LEU C CB    1 
ATOM   8426  C  CG    . LEU C  1 311 ? 52.852  18.932  -4.329  1.00 35.71  ? 452 LEU C CG    1 
ATOM   8427  C  CD1   . LEU C  1 311 ? 53.469  18.009  -3.297  1.00 35.01  ? 452 LEU C CD1   1 
ATOM   8428  C  CD2   . LEU C  1 311 ? 51.682  18.251  -5.012  1.00 36.19  ? 452 LEU C CD2   1 
ATOM   8429  N  N     . LEU C  1 312 ? 54.517  22.058  -5.118  1.00 34.90  ? 453 LEU C N     1 
ATOM   8430  C  CA    . LEU C  1 312 ? 55.548  22.248  -6.137  1.00 35.91  ? 453 LEU C CA    1 
ATOM   8431  C  C     . LEU C  1 312 ? 56.860  22.671  -5.482  1.00 35.87  ? 453 LEU C C     1 
ATOM   8432  O  O     . LEU C  1 312 ? 57.907  22.057  -5.707  1.00 33.02  ? 453 LEU C O     1 
ATOM   8433  C  CB    . LEU C  1 312 ? 55.085  23.310  -7.134  1.00 33.45  ? 453 LEU C CB    1 
ATOM   8434  C  CG    . LEU C  1 312 ? 55.533  23.280  -8.587  1.00 31.22  ? 453 LEU C CG    1 
ATOM   8435  C  CD1   . LEU C  1 312 ? 55.040  22.028  -9.267  1.00 34.86  ? 453 LEU C CD1   1 
ATOM   8436  C  CD2   . LEU C  1 312 ? 54.998  24.492  -9.300  1.00 30.22  ? 453 LEU C CD2   1 
ATOM   8437  N  N     . ALA C  1 313 ? 56.780  23.688  -4.628  1.00 40.98  ? 454 ALA C N     1 
ATOM   8438  C  CA    . ALA C  1 313 ? 57.964  24.202  -3.952  1.00 44.34  ? 454 ALA C CA    1 
ATOM   8439  C  C     . ALA C  1 313 ? 58.634  23.098  -3.147  1.00 46.92  ? 454 ALA C C     1 
ATOM   8440  O  O     . ALA C  1 313 ? 59.854  22.912  -3.238  1.00 48.34  ? 454 ALA C O     1 
ATOM   8441  C  CB    . ALA C  1 313 ? 57.601  25.370  -3.060  1.00 42.40  ? 454 ALA C CB    1 
ATOM   8442  N  N     . PHE C  1 314 ? 57.828  22.364  -2.378  1.00 45.67  ? 455 PHE C N     1 
ATOM   8443  C  CA    . PHE C  1 314 ? 58.335  21.267  -1.566  1.00 46.18  ? 455 PHE C CA    1 
ATOM   8444  C  C     . PHE C  1 314 ? 59.105  20.313  -2.460  1.00 47.58  ? 455 PHE C C     1 
ATOM   8445  O  O     . PHE C  1 314 ? 60.215  19.892  -2.120  1.00 51.16  ? 455 PHE C O     1 
ATOM   8446  C  CB    . PHE C  1 314 ? 57.185  20.544  -0.859  1.00 49.86  ? 455 PHE C CB    1 
ATOM   8447  C  CG    . PHE C  1 314 ? 57.611  19.325  -0.075  1.00 53.52  ? 455 PHE C CG    1 
ATOM   8448  C  CD1   . PHE C  1 314 ? 58.545  19.423  0.950   1.00 54.98  ? 455 PHE C CD1   1 
ATOM   8449  C  CD2   . PHE C  1 314 ? 57.051  18.082  -0.346  1.00 53.79  ? 455 PHE C CD2   1 
ATOM   8450  C  CE1   . PHE C  1 314 ? 58.928  18.298  1.670   1.00 56.42  ? 455 PHE C CE1   1 
ATOM   8451  C  CE2   . PHE C  1 314 ? 57.430  16.955  0.372   1.00 53.38  ? 455 PHE C CE2   1 
ATOM   8452  C  CZ    . PHE C  1 314 ? 58.368  17.065  1.378   1.00 54.13  ? 455 PHE C CZ    1 
ATOM   8453  N  N     . PHE C  1 315 ? 58.539  20.021  -3.628  1.00 46.50  ? 456 PHE C N     1 
ATOM   8454  C  CA    . PHE C  1 315 ? 59.166  19.082  -4.537  1.00 44.55  ? 456 PHE C CA    1 
ATOM   8455  C  C     . PHE C  1 315 ? 60.546  19.599  -4.893  1.00 43.02  ? 456 PHE C C     1 
ATOM   8456  O  O     . PHE C  1 315 ? 61.531  18.861  -4.804  1.00 46.03  ? 456 PHE C O     1 
ATOM   8457  C  CB    . PHE C  1 315 ? 58.319  18.893  -5.789  1.00 41.81  ? 456 PHE C CB    1 
ATOM   8458  C  CG    . PHE C  1 315 ? 58.750  17.733  -6.635  1.00 37.84  ? 456 PHE C CG    1 
ATOM   8459  C  CD1   . PHE C  1 315 ? 58.413  16.430  -6.282  1.00 31.03  ? 456 PHE C CD1   1 
ATOM   8460  C  CD2   . PHE C  1 315 ? 59.490  17.941  -7.786  1.00 39.83  ? 456 PHE C CD2   1 
ATOM   8461  C  CE1   . PHE C  1 315 ? 58.811  15.359  -7.063  1.00 29.59  ? 456 PHE C CE1   1 
ATOM   8462  C  CE2   . PHE C  1 315 ? 59.891  16.875  -8.570  1.00 39.10  ? 456 PHE C CE2   1 
ATOM   8463  C  CZ    . PHE C  1 315 ? 59.550  15.582  -8.206  1.00 34.15  ? 456 PHE C CZ    1 
ATOM   8464  N  N     . LEU C  1 316 ? 60.616  20.879  -5.250  1.00 42.22  ? 457 LEU C N     1 
ATOM   8465  C  CA    . LEU C  1 316 ? 61.893  21.497  -5.583  1.00 41.32  ? 457 LEU C CA    1 
ATOM   8466  C  C     . LEU C  1 316 ? 62.909  21.293  -4.466  1.00 42.80  ? 457 LEU C C     1 
ATOM   8467  O  O     . LEU C  1 316 ? 64.062  20.941  -4.733  1.00 47.15  ? 457 LEU C O     1 
ATOM   8468  C  CB    . LEU C  1 316 ? 61.723  22.985  -5.884  1.00 40.53  ? 457 LEU C CB    1 
ATOM   8469  C  CG    . LEU C  1 316 ? 61.752  23.431  -7.349  1.00 40.16  ? 457 LEU C CG    1 
ATOM   8470  C  CD1   . LEU C  1 316 ? 62.086  22.274  -8.281  1.00 39.80  ? 457 LEU C CD1   1 
ATOM   8471  C  CD2   . LEU C  1 316 ? 60.444  24.093  -7.752  1.00 39.20  ? 457 LEU C CD2   1 
ATOM   8472  N  N     . GLU C  1 317 ? 62.475  21.473  -3.220  1.00 40.01  ? 458 GLU C N     1 
ATOM   8473  C  CA    . GLU C  1 317 ? 63.382  21.311  -2.091  1.00 41.09  ? 458 GLU C CA    1 
ATOM   8474  C  C     . GLU C  1 317 ? 63.886  19.871  -2.008  1.00 43.25  ? 458 GLU C C     1 
ATOM   8475  O  O     . GLU C  1 317 ? 65.076  19.642  -1.763  1.00 44.72  ? 458 GLU C O     1 
ATOM   8476  C  CB    . GLU C  1 317 ? 62.723  21.751  -0.781  1.00 40.78  ? 458 GLU C CB    1 
ATOM   8477  C  CG    . GLU C  1 317 ? 63.404  22.943  -0.097  1.00 42.44  ? 458 GLU C CG    1 
ATOM   8478  C  CD    . GLU C  1 317 ? 64.610  22.546  0.740   1.00 42.72  ? 458 GLU C CD    1 
ATOM   8479  O  OE1   . GLU C  1 317 ? 65.653  23.218  0.635   1.00 43.28  ? 458 GLU C OE1   1 
ATOM   8480  O  OE2   . GLU C  1 317 ? 64.512  21.579  1.521   1.00 43.59  ? 458 GLU C OE2   1 
ATOM   8481  N  N     . CYS C  1 318 ? 62.994  18.908  -2.250  1.00 39.09  ? 459 CYS C N     1 
ATOM   8482  C  CA    . CYS C  1 318 ? 63.390  17.501  -2.264  1.00 35.90  ? 459 CYS C CA    1 
ATOM   8483  C  C     . CYS C  1 318 ? 64.422  17.265  -3.353  1.00 37.69  ? 459 CYS C C     1 
ATOM   8484  O  O     . CYS C  1 318 ? 65.288  16.404  -3.221  1.00 40.68  ? 459 CYS C O     1 
ATOM   8485  C  CB    . CYS C  1 318 ? 62.190  16.597  -2.521  1.00 33.09  ? 459 CYS C CB    1 
ATOM   8486  S  SG    . CYS C  1 318 ? 60.973  16.571  -1.217  1.00 35.02  ? 459 CYS C SG    1 
ATOM   8487  N  N     . LEU C  1 319 ? 64.318  18.041  -4.429  1.00 37.23  ? 460 LEU C N     1 
ATOM   8488  C  CA    . LEU C  1 319 ? 65.267  17.962  -5.528  1.00 38.44  ? 460 LEU C CA    1 
ATOM   8489  C  C     . LEU C  1 319 ? 66.568  18.653  -5.141  1.00 44.69  ? 460 LEU C C     1 
ATOM   8490  O  O     . LEU C  1 319 ? 67.649  18.212  -5.532  1.00 47.25  ? 460 LEU C O     1 
ATOM   8491  C  CB    . LEU C  1 319 ? 64.681  18.611  -6.784  1.00 35.32  ? 460 LEU C CB    1 
ATOM   8492  C  CG    . LEU C  1 319 ? 63.606  17.829  -7.536  1.00 34.50  ? 460 LEU C CG    1 
ATOM   8493  C  CD1   . LEU C  1 319 ? 62.967  18.685  -8.605  1.00 36.60  ? 460 LEU C CD1   1 
ATOM   8494  C  CD2   . LEU C  1 319 ? 64.205  16.588  -8.154  1.00 30.45  ? 460 LEU C CD2   1 
ATOM   8495  N  N     . ARG C  1 320 ? 66.456  19.729  -4.363  1.00 45.80  ? 461 ARG C N     1 
ATOM   8496  C  CA    . ARG C  1 320 ? 67.614  20.543  -3.999  1.00 42.47  ? 461 ARG C CA    1 
ATOM   8497  C  C     . ARG C  1 320 ? 68.494  19.824  -2.990  1.00 40.71  ? 461 ARG C C     1 
ATOM   8498  O  O     . ARG C  1 320 ? 69.723  19.855  -3.078  1.00 37.34  ? 461 ARG C O     1 
ATOM   8499  C  CB    . ARG C  1 320 ? 67.165  21.883  -3.411  1.00 40.17  ? 461 ARG C CB    1 
ATOM   8500  C  CG    . ARG C  1 320 ? 68.309  22.867  -3.218  1.00 39.32  ? 461 ARG C CG    1 
ATOM   8501  C  CD    . ARG C  1 320 ? 67.916  24.090  -2.391  1.00 38.26  ? 461 ARG C CD    1 
ATOM   8502  N  NE    . ARG C  1 320 ? 67.858  23.810  -0.957  1.00 37.93  ? 461 ARG C NE    1 
ATOM   8503  C  CZ    . ARG C  1 320 ? 68.926  23.676  -0.173  1.00 38.79  ? 461 ARG C CZ    1 
ATOM   8504  N  NH1   . ARG C  1 320 ? 70.150  23.773  -0.676  1.00 44.85  ? 461 ARG C NH1   1 
ATOM   8505  N  NH2   . ARG C  1 320 ? 68.777  23.429  1.117   1.00 37.79  ? 461 ARG C NH2   1 
ATOM   8506  N  N     . THR C  1 321 ? 67.846  19.180  -2.026  1.00 43.86  ? 462 THR C N     1 
ATOM   8507  C  CA    . THR C  1 321 ? 68.544  18.502  -0.950  1.00 45.26  ? 462 THR C CA    1 
ATOM   8508  C  C     . THR C  1 321 ? 68.888  17.072  -1.334  1.00 45.37  ? 462 THR C C     1 
ATOM   8509  O  O     . THR C  1 321 ? 69.528  16.357  -0.558  1.00 48.91  ? 462 THR C O     1 
ATOM   8510  C  CB    . THR C  1 321 ? 67.699  18.490  0.332   1.00 44.63  ? 462 THR C CB    1 
ATOM   8511  O  OG1   . THR C  1 321 ? 66.468  17.798  0.092   1.00 48.61  ? 462 THR C OG1   1 
ATOM   8512  C  CG2   . THR C  1 321 ? 67.389  19.908  0.777   1.00 40.66  ? 462 THR C CG2   1 
ATOM   8513  N  N     . GLU C  1 322 ? 68.470  16.677  -2.536  1.00 41.57  ? 463 GLU C N     1 
ATOM   8514  C  CA    . GLU C  1 322 ? 68.642  15.314  -3.027  1.00 39.08  ? 463 GLU C CA    1 
ATOM   8515  C  C     . GLU C  1 322 ? 68.181  14.307  -1.989  1.00 35.65  ? 463 GLU C C     1 
ATOM   8516  O  O     . GLU C  1 322 ? 68.957  13.467  -1.533  1.00 39.89  ? 463 GLU C O     1 
ATOM   8517  C  CB    . GLU C  1 322 ? 70.096  15.052  -3.418  1.00 42.41  ? 463 GLU C CB    1 
ATOM   8518  C  CG    . GLU C  1 322 ? 70.576  15.887  -4.586  1.00 46.96  ? 463 GLU C CG    1 
ATOM   8519  C  CD    . GLU C  1 322 ? 72.036  15.648  -4.901  1.00 50.70  ? 463 GLU C CD    1 
ATOM   8520  O  OE1   . GLU C  1 322 ? 72.879  16.440  -4.436  1.00 49.51  ? 463 GLU C OE1   1 
ATOM   8521  O  OE2   . GLU C  1 322 ? 72.340  14.670  -5.617  1.00 54.66  ? 463 GLU C OE2   1 
ATOM   8522  N  N     . LYS C  1 323 ? 66.912  14.401  -1.614  1.00 34.63  ? 464 LYS C N     1 
ATOM   8523  C  CA    . LYS C  1 323 ? 66.390  13.573  -0.541  1.00 35.06  ? 464 LYS C CA    1 
ATOM   8524  C  C     . LYS C  1 323 ? 64.877  13.490  -0.623  1.00 30.47  ? 464 LYS C C     1 
ATOM   8525  O  O     . LYS C  1 323 ? 64.177  14.463  -0.327  1.00 34.72  ? 464 LYS C O     1 
ATOM   8526  C  CB    . LYS C  1 323 ? 66.823  14.146  0.813   1.00 43.58  ? 464 LYS C CB    1 
ATOM   8527  C  CG    . LYS C  1 323 ? 66.432  13.302  2.020   1.00 48.56  ? 464 LYS C CG    1 
ATOM   8528  C  CD    . LYS C  1 323 ? 67.210  13.728  3.261   1.00 51.57  ? 464 LYS C CD    1 
ATOM   8529  C  CE    . LYS C  1 323 ? 66.778  12.935  4.475   1.00 53.79  ? 464 LYS C CE    1 
ATOM   8530  N  NZ    . LYS C  1 323 ? 65.345  13.166  4.760   1.00 55.47  ? 464 LYS C NZ    1 
ATOM   8531  N  N     . LEU C  1 324 ? 64.379  12.336  -1.053  1.00 25.57  ? 465 LEU C N     1 
ATOM   8532  C  CA    . LEU C  1 324 ? 62.956  12.043  -0.971  1.00 23.94  ? 465 LEU C CA    1 
ATOM   8533  C  C     . LEU C  1 324 ? 62.799  10.761  -0.178  1.00 29.93  ? 465 LEU C C     1 
ATOM   8534  O  O     . LEU C  1 324 ? 62.831  9.668   -0.740  1.00 36.02  ? 465 LEU C O     1 
ATOM   8535  C  CB    . LEU C  1 324 ? 62.329  11.884  -2.355  1.00 22.29  ? 465 LEU C CB    1 
ATOM   8536  C  CG    . LEU C  1 324 ? 60.811  11.684  -2.412  1.00 23.59  ? 465 LEU C CG    1 
ATOM   8537  C  CD1   . LEU C  1 324 ? 60.102  12.700  -1.537  1.00 26.48  ? 465 LEU C CD1   1 
ATOM   8538  C  CD2   . LEU C  1 324 ? 60.301  11.779  -3.838  1.00 24.92  ? 465 LEU C CD2   1 
ATOM   8539  N  N     . ASP C  1 325 ? 62.649  10.893  1.134   1.00 30.99  ? 466 ASP C N     1 
ATOM   8540  C  CA    . ASP C  1 325 ? 62.507  9.724   1.977   1.00 29.72  ? 466 ASP C CA    1 
ATOM   8541  C  C     . ASP C  1 325 ? 61.232  8.988   1.616   1.00 36.03  ? 466 ASP C C     1 
ATOM   8542  O  O     . ASP C  1 325 ? 60.173  9.601   1.468   1.00 35.51  ? 466 ASP C O     1 
ATOM   8543  C  CB    . ASP C  1 325 ? 62.481  10.121  3.450   1.00 28.00  ? 466 ASP C CB    1 
ATOM   8544  C  CG    . ASP C  1 325 ? 63.817  10.648  3.938   1.00 37.81  ? 466 ASP C CG    1 
ATOM   8545  O  OD1   . ASP C  1 325 ? 64.869  10.245  3.390   1.00 37.28  ? 466 ASP C OD1   1 
ATOM   8546  O  OD2   . ASP C  1 325 ? 63.814  11.467  4.883   1.00 44.89  ? 466 ASP C OD2   1 
ATOM   8547  N  N     . HIS C  1 326 ? 61.345  7.676   1.445   1.00 38.69  ? 467 HIS C N     1 
ATOM   8548  C  CA    . HIS C  1 326 ? 60.170  6.833   1.282   1.00 36.93  ? 467 HIS C CA    1 
ATOM   8549  C  C     . HIS C  1 326 ? 59.257  7.045   2.483   1.00 37.42  ? 467 HIS C C     1 
ATOM   8550  O  O     . HIS C  1 326 ? 59.731  7.151   3.613   1.00 39.37  ? 467 HIS C O     1 
ATOM   8551  C  CB    . HIS C  1 326 ? 60.586  5.369   1.192   1.00 38.74  ? 467 HIS C CB    1 
ATOM   8552  C  CG    . HIS C  1 326 ? 59.487  4.453   0.756   1.00 38.44  ? 467 HIS C CG    1 
ATOM   8553  N  ND1   . HIS C  1 326 ? 58.544  3.954   1.629   1.00 38.26  ? 467 HIS C ND1   1 
ATOM   8554  C  CD2   . HIS C  1 326 ? 59.183  3.942   -0.459  1.00 38.14  ? 467 HIS C CD2   1 
ATOM   8555  C  CE1   . HIS C  1 326 ? 57.703  3.179   0.967   1.00 36.66  ? 467 HIS C CE1   1 
ATOM   8556  N  NE2   . HIS C  1 326 ? 58.070  3.153   -0.301  1.00 36.97  ? 467 HIS C NE2   1 
ATOM   8557  N  N     . TYR C  1 327 ? 57.953  7.111   2.236   1.00 35.78  ? 468 TYR C N     1 
ATOM   8558  C  CA    . TYR C  1 327 ? 56.991  7.452   3.278   1.00 29.36  ? 468 TYR C CA    1 
ATOM   8559  C  C     . TYR C  1 327 ? 56.841  6.375   4.352   1.00 27.53  ? 468 TYR C C     1 
ATOM   8560  O  O     . TYR C  1 327 ? 56.417  6.668   5.467   1.00 27.58  ? 468 TYR C O     1 
ATOM   8561  C  CB    . TYR C  1 327 ? 55.630  7.770   2.653   1.00 26.18  ? 468 TYR C CB    1 
ATOM   8562  C  CG    . TYR C  1 327 ? 54.682  8.478   3.593   1.00 23.01  ? 468 TYR C CG    1 
ATOM   8563  C  CD1   . TYR C  1 327 ? 54.975  9.744   4.080   1.00 20.46  ? 468 TYR C CD1   1 
ATOM   8564  C  CD2   . TYR C  1 327 ? 53.492  7.886   3.989   1.00 23.88  ? 468 TYR C CD2   1 
ATOM   8565  C  CE1   . TYR C  1 327 ? 54.118  10.394  4.937   1.00 18.87  ? 468 TYR C CE1   1 
ATOM   8566  C  CE2   . TYR C  1 327 ? 52.627  8.533   4.851   1.00 25.15  ? 468 TYR C CE2   1 
ATOM   8567  C  CZ    . TYR C  1 327 ? 52.948  9.785   5.318   1.00 21.79  ? 468 TYR C CZ    1 
ATOM   8568  O  OH    . TYR C  1 327 ? 52.089  10.428  6.173   1.00 24.46  ? 468 TYR C OH    1 
ATOM   8569  N  N     . PHE C  1 328 ? 57.198  5.139   4.018   1.00 31.79  ? 469 PHE C N     1 
ATOM   8570  C  CA    . PHE C  1 328 ? 57.030  4.017   4.936   1.00 30.75  ? 469 PHE C CA    1 
ATOM   8571  C  C     . PHE C  1 328 ? 58.360  3.492   5.479   1.00 36.07  ? 469 PHE C C     1 
ATOM   8572  O  O     . PHE C  1 328 ? 58.388  2.807   6.501   1.00 43.58  ? 469 PHE C O     1 
ATOM   8573  C  CB    . PHE C  1 328 ? 56.282  2.878   4.241   1.00 28.17  ? 469 PHE C CB    1 
ATOM   8574  C  CG    . PHE C  1 328 ? 54.891  3.241   3.787   1.00 27.23  ? 469 PHE C CG    1 
ATOM   8575  C  CD1   . PHE C  1 328 ? 54.676  3.844   2.556   1.00 25.16  ? 469 PHE C CD1   1 
ATOM   8576  C  CD2   . PHE C  1 328 ? 53.795  2.948   4.583   1.00 29.36  ? 469 PHE C CD2   1 
ATOM   8577  C  CE1   . PHE C  1 328 ? 53.396  4.165   2.140   1.00 24.60  ? 469 PHE C CE1   1 
ATOM   8578  C  CE2   . PHE C  1 328 ? 52.511  3.267   4.172   1.00 27.90  ? 469 PHE C CE2   1 
ATOM   8579  C  CZ    . PHE C  1 328 ? 52.312  3.875   2.950   1.00 24.73  ? 469 PHE C CZ    1 
ATOM   8580  N  N     . ILE C  1 329 ? 59.450  3.800   4.778   1.00 37.36  ? 470 ILE C N     1 
ATOM   8581  C  CA    . ILE C  1 329 ? 60.793  3.379   5.170   1.00 35.53  ? 470 ILE C CA    1 
ATOM   8582  C  C     . ILE C  1 329 ? 61.726  4.586   5.094   1.00 36.14  ? 470 ILE C C     1 
ATOM   8583  O  O     . ILE C  1 329 ? 62.294  4.863   4.039   1.00 37.61  ? 470 ILE C O     1 
ATOM   8584  C  CB    . ILE C  1 329 ? 61.334  2.274   4.235   1.00 32.76  ? 470 ILE C CB    1 
ATOM   8585  C  CG1   . ILE C  1 329 ? 60.275  1.208   3.968   1.00 28.75  ? 470 ILE C CG1   1 
ATOM   8586  C  CG2   . ILE C  1 329 ? 62.564  1.620   4.830   1.00 36.04  ? 470 ILE C CG2   1 
ATOM   8587  C  CD1   . ILE C  1 329 ? 60.372  0.570   2.602   1.00 29.39  ? 470 ILE C CD1   1 
ATOM   8588  N  N     . PRO C  1 330 ? 61.886  5.305   6.218   1.00 38.14  ? 471 PRO C N     1 
ATOM   8589  C  CA    . PRO C  1 330 ? 62.627  6.574   6.286   1.00 39.80  ? 471 PRO C CA    1 
ATOM   8590  C  C     . PRO C  1 330 ? 64.096  6.471   5.862   1.00 44.96  ? 471 PRO C C     1 
ATOM   8591  O  O     . PRO C  1 330 ? 64.610  7.426   5.279   1.00 48.34  ? 471 PRO C O     1 
ATOM   8592  C  CB    . PRO C  1 330 ? 62.555  6.941   7.772   1.00 38.55  ? 471 PRO C CB    1 
ATOM   8593  C  CG    . PRO C  1 330 ? 61.371  6.217   8.299   1.00 37.96  ? 471 PRO C CG    1 
ATOM   8594  C  CD    . PRO C  1 330 ? 61.308  4.936   7.524   1.00 38.46  ? 471 PRO C CD    1 
ATOM   8595  N  N     . LYS C  1 331 ? 64.754  5.351   6.163   1.00 47.49  ? 472 LYS C N     1 
ATOM   8596  C  CA    . LYS C  1 331 ? 66.163  5.157   5.808   1.00 48.74  ? 472 LYS C CA    1 
ATOM   8597  C  C     . LYS C  1 331 ? 66.369  4.937   4.310   1.00 44.08  ? 472 LYS C C     1 
ATOM   8598  O  O     . LYS C  1 331 ? 67.505  4.827   3.845   1.00 44.23  ? 472 LYS C O     1 
ATOM   8599  C  CB    . LYS C  1 331 ? 66.757  3.967   6.570   1.00 54.56  ? 472 LYS C CB    1 
ATOM   8600  C  CG    . LYS C  1 331 ? 66.529  2.625   5.880   1.00 58.65  ? 472 LYS C CG    1 
ATOM   8601  C  CD    . LYS C  1 331 ? 67.577  1.577   6.247   1.00 60.19  ? 472 LYS C CD    1 
ATOM   8602  C  CE    . LYS C  1 331 ? 67.395  1.057   7.661   1.00 62.73  ? 472 LYS C CE    1 
ATOM   8603  N  NZ    . LYS C  1 331 ? 68.192  -0.177  7.932   1.00 64.11  ? 472 LYS C NZ    1 
ATOM   8604  N  N     . PHE C  1 332 ? 65.271  4.867   3.566   1.00 41.47  ? 473 PHE C N     1 
ATOM   8605  C  CA    . PHE C  1 332 ? 65.323  4.633   2.131   1.00 40.42  ? 473 PHE C CA    1 
ATOM   8606  C  C     . PHE C  1 332 ? 65.128  5.924   1.344   1.00 41.39  ? 473 PHE C C     1 
ATOM   8607  O  O     . PHE C  1 332 ? 63.998  6.399   1.193   1.00 40.99  ? 473 PHE C O     1 
ATOM   8608  C  CB    . PHE C  1 332 ? 64.250  3.621   1.739   1.00 39.14  ? 473 PHE C CB    1 
ATOM   8609  C  CG    . PHE C  1 332 ? 64.305  3.208   0.304   1.00 37.41  ? 473 PHE C CG    1 
ATOM   8610  C  CD1   . PHE C  1 332 ? 65.510  2.859   -0.281  1.00 36.85  ? 473 PHE C CD1   1 
ATOM   8611  C  CD2   . PHE C  1 332 ? 63.152  3.148   -0.457  1.00 36.25  ? 473 PHE C CD2   1 
ATOM   8612  C  CE1   . PHE C  1 332 ? 65.568  2.469   -1.605  1.00 36.00  ? 473 PHE C CE1   1 
ATOM   8613  C  CE2   . PHE C  1 332 ? 63.200  2.754   -1.784  1.00 35.51  ? 473 PHE C CE2   1 
ATOM   8614  C  CZ    . PHE C  1 332 ? 64.410  2.417   -2.358  1.00 33.05  ? 473 PHE C CZ    1 
ATOM   8615  N  N     . ASN C  1 333 ? 66.228  6.479   0.835   1.00 39.65  ? 474 ASN C N     1 
ATOM   8616  C  CA    . ASN C  1 333 ? 66.181  7.719   0.062   1.00 32.58  ? 474 ASN C CA    1 
ATOM   8617  C  C     . ASN C  1 333 ? 65.865  7.483   -1.418  1.00 33.16  ? 474 ASN C C     1 
ATOM   8618  O  O     . ASN C  1 333 ? 66.619  6.814   -2.123  1.00 34.61  ? 474 ASN C O     1 
ATOM   8619  C  CB    . ASN C  1 333 ? 67.498  8.478   0.209   1.00 27.28  ? 474 ASN C CB    1 
ATOM   8620  C  CG    . ASN C  1 333 ? 67.459  9.849   -0.434  1.00 33.14  ? 474 ASN C CG    1 
ATOM   8621  O  OD1   . ASN C  1 333 ? 66.417  10.305  -0.897  1.00 38.23  ? 474 ASN C OD1   1 
ATOM   8622  N  ND2   . ASN C  1 333 ? 68.601  10.518  -0.458  1.00 34.94  ? 474 ASN C ND2   1 
ATOM   8623  N  N     . LEU C  1 334 ? 64.755  8.052   -1.882  1.00 32.16  ? 475 LEU C N     1 
ATOM   8624  C  CA    . LEU C  1 334 ? 64.319  7.899   -3.270  1.00 31.16  ? 475 LEU C CA    1 
ATOM   8625  C  C     . LEU C  1 334 ? 65.138  8.730   -4.269  1.00 33.62  ? 475 LEU C C     1 
ATOM   8626  O  O     . LEU C  1 334 ? 65.318  8.318   -5.416  1.00 36.05  ? 475 LEU C O     1 
ATOM   8627  C  CB    . LEU C  1 334 ? 62.828  8.238   -3.404  1.00 29.57  ? 475 LEU C CB    1 
ATOM   8628  C  CG    . LEU C  1 334 ? 61.783  7.121   -3.485  1.00 31.18  ? 475 LEU C CG    1 
ATOM   8629  C  CD1   . LEU C  1 334 ? 62.080  6.024   -2.498  1.00 30.71  ? 475 LEU C CD1   1 
ATOM   8630  C  CD2   . LEU C  1 334 ? 60.388  7.667   -3.233  1.00 31.52  ? 475 LEU C CD2   1 
ATOM   8631  N  N     . PHE C  1 335 ? 65.619  9.896   -3.848  1.00 32.35  ? 476 PHE C N     1 
ATOM   8632  C  CA    . PHE C  1 335 ? 66.360  10.766  -4.754  1.00 30.83  ? 476 PHE C CA    1 
ATOM   8633  C  C     . PHE C  1 335 ? 67.866  10.599  -4.621  1.00 35.20  ? 476 PHE C C     1 
ATOM   8634  O  O     . PHE C  1 335 ? 68.628  11.461  -5.050  1.00 37.16  ? 476 PHE C O     1 
ATOM   8635  C  CB    . PHE C  1 335 ? 65.987  12.232  -4.528  1.00 27.38  ? 476 PHE C CB    1 
ATOM   8636  C  CG    . PHE C  1 335 ? 64.719  12.646  -5.210  1.00 27.83  ? 476 PHE C CG    1 
ATOM   8637  C  CD1   . PHE C  1 335 ? 64.061  11.778  -6.067  1.00 27.62  ? 476 PHE C CD1   1 
ATOM   8638  C  CD2   . PHE C  1 335 ? 64.186  13.907  -5.001  1.00 30.35  ? 476 PHE C CD2   1 
ATOM   8639  C  CE1   . PHE C  1 335 ? 62.894  12.158  -6.699  1.00 29.86  ? 476 PHE C CE1   1 
ATOM   8640  C  CE2   . PHE C  1 335 ? 63.016  14.293  -5.631  1.00 32.69  ? 476 PHE C CE2   1 
ATOM   8641  C  CZ    . PHE C  1 335 ? 62.371  13.420  -6.480  1.00 32.40  ? 476 PHE C CZ    1 
ATOM   8642  N  N     . SER C  1 336 ? 68.298  9.488   -4.036  1.00 37.19  ? 477 SER C N     1 
ATOM   8643  C  CA    . SER C  1 336 ? 69.718  9.277   -3.792  1.00 38.50  ? 477 SER C CA    1 
ATOM   8644  C  C     . SER C  1 336 ? 70.512  9.258   -5.090  1.00 44.94  ? 477 SER C C     1 
ATOM   8645  O  O     . SER C  1 336 ? 69.959  9.027   -6.164  1.00 48.59  ? 477 SER C O     1 
ATOM   8646  C  CB    . SER C  1 336 ? 69.950  7.990   -3.003  1.00 39.32  ? 477 SER C CB    1 
ATOM   8647  O  OG    . SER C  1 336 ? 69.466  6.853   -3.693  1.00 41.86  ? 477 SER C OG    1 
ATOM   8648  N  N     . GLN C  1 337 ? 71.806  9.540   -4.985  1.00 49.88  ? 478 GLN C N     1 
ATOM   8649  C  CA    . GLN C  1 337 ? 72.695  9.534   -6.140  1.00 49.11  ? 478 GLN C CA    1 
ATOM   8650  C  C     . GLN C  1 337 ? 72.707  8.158   -6.805  1.00 48.29  ? 478 GLN C C     1 
ATOM   8651  O  O     . GLN C  1 337 ? 72.784  8.047   -8.030  1.00 48.00  ? 478 GLN C O     1 
ATOM   8652  C  CB    . GLN C  1 337 ? 74.104  9.937   -5.705  1.00 52.42  ? 478 GLN C CB    1 
ATOM   8653  C  CG    . GLN C  1 337 ? 75.164  9.809   -6.790  1.00 56.96  ? 478 GLN C CG    1 
ATOM   8654  C  CD    . GLN C  1 337 ? 74.913  10.732  -7.964  1.00 59.57  ? 478 GLN C CD    1 
ATOM   8655  O  OE1   . GLN C  1 337 ? 74.372  11.826  -7.804  1.00 61.41  ? 478 GLN C OE1   1 
ATOM   8656  N  NE2   . GLN C  1 337 ? 75.303  10.295  -9.153  1.00 59.42  ? 478 GLN C NE2   1 
ATOM   8657  N  N     . GLU C  1 338 ? 72.607  7.115   -5.987  1.00 50.92  ? 479 GLU C N     1 
ATOM   8658  C  CA    . GLU C  1 338 ? 72.595  5.739   -6.470  1.00 51.18  ? 479 GLU C CA    1 
ATOM   8659  C  C     . GLU C  1 338 ? 71.415  5.488   -7.400  1.00 48.41  ? 479 GLU C C     1 
ATOM   8660  O  O     . GLU C  1 338 ? 71.474  4.624   -8.277  1.00 46.95  ? 479 GLU C O     1 
ATOM   8661  C  CB    . GLU C  1 338 ? 72.519  4.766   -5.291  1.00 54.87  ? 479 GLU C CB    1 
ATOM   8662  C  CG    . GLU C  1 338 ? 73.673  4.852   -4.294  1.00 59.56  ? 479 GLU C CG    1 
ATOM   8663  C  CD    . GLU C  1 338 ? 73.470  5.918   -3.228  1.00 63.70  ? 479 GLU C CD    1 
ATOM   8664  O  OE1   . GLU C  1 338 ? 72.957  7.008   -3.555  1.00 66.72  ? 479 GLU C OE1   1 
ATOM   8665  O  OE2   . GLU C  1 338 ? 73.830  5.664   -2.060  1.00 62.94  ? 479 GLU C OE2   1 
ATOM   8666  N  N     . LEU C  1 339 ? 70.347  6.255   -7.199  1.00 47.06  ? 480 LEU C N     1 
ATOM   8667  C  CA    . LEU C  1 339 ? 69.101  6.052   -7.926  1.00 42.08  ? 480 LEU C CA    1 
ATOM   8668  C  C     . LEU C  1 339 ? 68.917  7.067   -9.049  1.00 42.49  ? 480 LEU C C     1 
ATOM   8669  O  O     . LEU C  1 339 ? 68.632  6.701   -10.190 1.00 45.98  ? 480 LEU C O     1 
ATOM   8670  C  CB    . LEU C  1 339 ? 67.916  6.110   -6.962  1.00 35.31  ? 480 LEU C CB    1 
ATOM   8671  C  CG    . LEU C  1 339 ? 67.914  5.013   -5.904  1.00 35.32  ? 480 LEU C CG    1 
ATOM   8672  C  CD1   . LEU C  1 339 ? 66.789  5.200   -4.912  1.00 36.85  ? 480 LEU C CD1   1 
ATOM   8673  C  CD2   . LEU C  1 339 ? 67.794  3.673   -6.584  1.00 38.18  ? 480 LEU C CD2   1 
ATOM   8674  N  N     . ILE C  1 340 ? 69.066  8.345   -8.725  1.00 36.50  ? 481 ILE C N     1 
ATOM   8675  C  CA    . ILE C  1 340 ? 68.933  9.385   -9.734  1.00 32.66  ? 481 ILE C CA    1 
ATOM   8676  C  C     . ILE C  1 340 ? 70.169  10.279  -9.733  1.00 35.97  ? 481 ILE C C     1 
ATOM   8677  O  O     . ILE C  1 340 ? 70.499  10.881  -8.704  1.00 31.49  ? 481 ILE C O     1 
ATOM   8678  C  CB    . ILE C  1 340 ? 67.667  10.238  -9.502  1.00 28.36  ? 481 ILE C CB    1 
ATOM   8679  C  CG1   . ILE C  1 340 ? 66.456  9.340   -9.224  1.00 24.70  ? 481 ILE C CG1   1 
ATOM   8680  C  CG2   . ILE C  1 340 ? 67.409  11.142  -10.695 1.00 25.76  ? 481 ILE C CG2   1 
ATOM   8681  C  CD1   . ILE C  1 340 ? 65.168  10.084  -9.005  1.00 20.94  ? 481 ILE C CD1   1 
ATOM   8682  N  N     . ASP C  1 341 ? 70.848  10.352  -10.880 1.00 41.58  ? 482 ASP C N     1 
ATOM   8683  C  CA    . ASP C  1 341 ? 72.016  11.212  -11.040 1.00 44.69  ? 482 ASP C CA    1 
ATOM   8684  C  C     . ASP C  1 341 ? 71.668  12.659  -10.744 1.00 47.24  ? 482 ASP C C     1 
ATOM   8685  O  O     . ASP C  1 341 ? 70.598  13.132  -11.121 1.00 52.24  ? 482 ASP C O     1 
ATOM   8686  C  CB    . ASP C  1 341 ? 72.578  11.114  -12.459 1.00 48.73  ? 482 ASP C CB    1 
ATOM   8687  C  CG    . ASP C  1 341 ? 73.753  12.060  -12.689 1.00 56.70  ? 482 ASP C CG    1 
ATOM   8688  O  OD1   . ASP C  1 341 ? 74.484  12.359  -11.719 1.00 58.69  ? 482 ASP C OD1   1 
ATOM   8689  O  OD2   . ASP C  1 341 ? 73.947  12.506  -13.840 1.00 60.75  ? 482 ASP C OD2   1 
ATOM   8690  N  N     . ARG C  1 342 ? 72.586  13.347  -10.071 1.00 45.70  ? 483 ARG C N     1 
ATOM   8691  C  CA    . ARG C  1 342 ? 72.448  14.758  -9.739  1.00 49.12  ? 483 ARG C CA    1 
ATOM   8692  C  C     . ARG C  1 342 ? 72.005  15.605  -10.928 1.00 55.01  ? 483 ARG C C     1 
ATOM   8693  O  O     . ARG C  1 342 ? 71.192  16.517  -10.773 1.00 57.42  ? 483 ARG C O     1 
ATOM   8694  C  CB    . ARG C  1 342 ? 73.781  15.274  -9.203  1.00 54.07  ? 483 ARG C CB    1 
ATOM   8695  C  CG    . ARG C  1 342 ? 73.776  16.706  -8.698  1.00 57.16  ? 483 ARG C CG    1 
ATOM   8696  C  CD    . ARG C  1 342 ? 75.013  16.979  -7.848  1.00 61.58  ? 483 ARG C CD    1 
ATOM   8697  N  NE    . ARG C  1 342 ? 75.034  16.160  -6.638  1.00 66.57  ? 483 ARG C NE    1 
ATOM   8698  C  CZ    . ARG C  1 342 ? 75.705  15.018  -6.516  1.00 69.06  ? 483 ARG C CZ    1 
ATOM   8699  N  NH1   . ARG C  1 342 ? 76.422  14.550  -7.531  1.00 69.63  ? 483 ARG C NH1   1 
ATOM   8700  N  NH2   . ARG C  1 342 ? 75.658  14.339  -5.377  1.00 68.35  ? 483 ARG C NH2   1 
ATOM   8701  N  N     . LYS C  1 343 ? 72.530  15.292  -12.111 1.00 57.67  ? 484 LYS C N     1 
ATOM   8702  C  CA    . LYS C  1 343 ? 72.224  16.061  -13.315 1.00 59.06  ? 484 LYS C CA    1 
ATOM   8703  C  C     . LYS C  1 343 ? 70.756  15.961  -13.717 1.00 57.17  ? 484 LYS C C     1 
ATOM   8704  O  O     . LYS C  1 343 ? 70.177  16.928  -14.210 1.00 57.30  ? 484 LYS C O     1 
ATOM   8705  C  CB    . LYS C  1 343 ? 73.119  15.627  -14.475 1.00 63.84  ? 484 LYS C CB    1 
ATOM   8706  C  CG    . LYS C  1 343 ? 74.605  15.673  -14.153 1.00 68.16  ? 484 LYS C CG    1 
ATOM   8707  C  CD    . LYS C  1 343 ? 75.458  15.550  -15.410 1.00 69.15  ? 484 LYS C CD    1 
ATOM   8708  C  CE    . LYS C  1 343 ? 76.938  15.455  -15.064 1.00 68.02  ? 484 LYS C CE    1 
ATOM   8709  N  NZ    . LYS C  1 343 ? 77.239  14.265  -14.225 1.00 66.55  ? 484 LYS C NZ    1 
ATOM   8710  N  N     . SER C  1 344 ? 70.159  14.792  -13.506 1.00 54.67  ? 485 SER C N     1 
ATOM   8711  C  CA    . SER C  1 344 ? 68.741  14.605  -13.780 1.00 54.91  ? 485 SER C CA    1 
ATOM   8712  C  C     . SER C  1 344 ? 67.920  15.427  -12.795 1.00 52.55  ? 485 SER C C     1 
ATOM   8713  O  O     . SER C  1 344 ? 66.941  16.090  -13.173 1.00 51.79  ? 485 SER C O     1 
ATOM   8714  C  CB    . SER C  1 344 ? 68.375  13.128  -13.662 1.00 59.61  ? 485 SER C CB    1 
ATOM   8715  O  OG    . SER C  1 344 ? 69.177  12.337  -14.519 1.00 61.90  ? 485 SER C OG    1 
ATOM   8716  N  N     . LYS C  1 345 ? 68.352  15.390  -11.535 1.00 52.27  ? 486 LYS C N     1 
ATOM   8717  C  CA    . LYS C  1 345 ? 67.705  16.114  -10.445 1.00 51.72  ? 486 LYS C CA    1 
ATOM   8718  C  C     . LYS C  1 345 ? 67.955  17.619  -10.486 1.00 52.12  ? 486 LYS C C     1 
ATOM   8719  O  O     . LYS C  1 345 ? 67.427  18.354  -9.653  1.00 54.54  ? 486 LYS C O     1 
ATOM   8720  C  CB    . LYS C  1 345 ? 68.153  15.567  -9.085  1.00 51.62  ? 486 LYS C CB    1 
ATOM   8721  C  CG    . LYS C  1 345 ? 67.661  14.168  -8.767  1.00 45.27  ? 486 LYS C CG    1 
ATOM   8722  C  CD    . LYS C  1 345 ? 68.048  13.759  -7.355  1.00 36.54  ? 486 LYS C CD    1 
ATOM   8723  C  CE    . LYS C  1 345 ? 69.542  13.592  -7.205  1.00 31.80  ? 486 LYS C CE    1 
ATOM   8724  N  NZ    . LYS C  1 345 ? 69.911  12.192  -6.865  1.00 32.66  ? 486 LYS C NZ    1 
ATOM   8725  N  N     . GLU C  1 346 ? 68.736  18.087  -11.454 1.00 53.55  ? 487 GLU C N     1 
ATOM   8726  C  CA    . GLU C  1 346 ? 68.894  19.523  -11.667 1.00 50.68  ? 487 GLU C CA    1 
ATOM   8727  C  C     . GLU C  1 346 ? 68.113  19.927  -12.916 1.00 46.29  ? 487 GLU C C     1 
ATOM   8728  O  O     . GLU C  1 346 ? 67.475  20.989  -12.959 1.00 46.47  ? 487 GLU C O     1 
ATOM   8729  C  CB    . GLU C  1 346 ? 70.375  19.901  -11.776 1.00 52.11  ? 487 GLU C CB    1 
ATOM   8730  C  CG    . GLU C  1 346 ? 71.155  19.657  -10.486 1.00 56.75  ? 487 GLU C CG    1 
ATOM   8731  C  CD    . GLU C  1 346 ? 72.611  20.072  -10.578 1.00 60.71  ? 487 GLU C CD    1 
ATOM   8732  O  OE1   . GLU C  1 346 ? 72.996  20.701  -11.586 1.00 61.87  ? 487 GLU C OE1   1 
ATOM   8733  O  OE2   . GLU C  1 346 ? 73.369  19.769  -9.633  1.00 62.30  ? 487 GLU C OE2   1 
ATOM   8734  N  N     . PHE C  1 347 ? 68.153  19.052  -13.917 1.00 42.65  ? 488 PHE C N     1 
ATOM   8735  C  CA    . PHE C  1 347 ? 67.374  19.220  -15.133 1.00 47.15  ? 488 PHE C CA    1 
ATOM   8736  C  C     . PHE C  1 347 ? 65.902  19.398  -14.785 1.00 49.40  ? 488 PHE C C     1 
ATOM   8737  O  O     . PHE C  1 347 ? 65.279  20.402  -15.162 1.00 55.23  ? 488 PHE C O     1 
ATOM   8738  C  CB    . PHE C  1 347 ? 67.553  18.006  -16.051 1.00 47.66  ? 488 PHE C CB    1 
ATOM   8739  C  CG    . PHE C  1 347 ? 66.931  18.176  -17.407 1.00 44.49  ? 488 PHE C CG    1 
ATOM   8740  C  CD1   . PHE C  1 347 ? 67.659  18.727  -18.450 1.00 46.03  ? 488 PHE C CD1   1 
ATOM   8741  C  CD2   . PHE C  1 347 ? 65.618  17.795  -17.638 1.00 43.03  ? 488 PHE C CD2   1 
ATOM   8742  C  CE1   . PHE C  1 347 ? 67.092  18.894  -19.700 1.00 46.16  ? 488 PHE C CE1   1 
ATOM   8743  C  CE2   . PHE C  1 347 ? 65.044  17.959  -18.886 1.00 44.86  ? 488 PHE C CE2   1 
ATOM   8744  C  CZ    . PHE C  1 347 ? 65.783  18.510  -19.918 1.00 46.34  ? 488 PHE C CZ    1 
ATOM   8745  N  N     . LEU C  1 348 ? 65.356  18.430  -14.049 1.00 47.98  ? 489 LEU C N     1 
ATOM   8746  C  CA    . LEU C  1 348 ? 63.948  18.480  -13.658 1.00 46.24  ? 489 LEU C CA    1 
ATOM   8747  C  C     . LEU C  1 348 ? 63.579  19.764  -12.904 1.00 48.28  ? 489 LEU C C     1 
ATOM   8748  O  O     . LEU C  1 348 ? 62.530  20.346  -13.164 1.00 52.80  ? 489 LEU C O     1 
ATOM   8749  C  CB    . LEU C  1 348 ? 63.564  17.241  -12.843 1.00 45.59  ? 489 LEU C CB    1 
ATOM   8750  C  CG    . LEU C  1 348 ? 62.150  17.212  -12.268 1.00 44.45  ? 489 LEU C CG    1 
ATOM   8751  C  CD1   . LEU C  1 348 ? 61.138  17.326  -13.383 1.00 44.03  ? 489 LEU C CD1   1 
ATOM   8752  C  CD2   . LEU C  1 348 ? 61.905  15.953  -11.456 1.00 45.37  ? 489 LEU C CD2   1 
ATOM   8753  N  N     . SER C  1 349 ? 64.439  20.205  -11.987 1.00 47.23  ? 490 SER C N     1 
ATOM   8754  C  CA    . SER C  1 349 ? 64.170  21.407  -11.198 1.00 48.26  ? 490 SER C CA    1 
ATOM   8755  C  C     . SER C  1 349 ? 64.088  22.609  -12.105 1.00 48.72  ? 490 SER C C     1 
ATOM   8756  O  O     . SER C  1 349 ? 63.206  23.457  -11.955 1.00 52.93  ? 490 SER C O     1 
ATOM   8757  C  CB    . SER C  1 349 ? 65.274  21.651  -10.174 1.00 50.26  ? 490 SER C CB    1 
ATOM   8758  O  OG    . SER C  1 349 ? 65.646  20.457  -9.518  1.00 51.61  ? 490 SER C OG    1 
ATOM   8759  N  N     . LYS C  1 350 ? 65.027  22.677  -13.043 1.00 47.00  ? 491 LYS C N     1 
ATOM   8760  C  CA    . LYS C  1 350 ? 65.039  23.757  -14.017 1.00 49.69  ? 491 LYS C CA    1 
ATOM   8761  C  C     . LYS C  1 350 ? 63.747  23.792  -14.839 1.00 50.89  ? 491 LYS C C     1 
ATOM   8762  O  O     . LYS C  1 350 ? 63.131  24.856  -14.993 1.00 53.79  ? 491 LYS C O     1 
ATOM   8763  C  CB    . LYS C  1 350 ? 66.279  23.648  -14.911 1.00 54.92  ? 491 LYS C CB    1 
ATOM   8764  C  CG    . LYS C  1 350 ? 67.588  23.906  -14.150 1.00 58.72  ? 491 LYS C CG    1 
ATOM   8765  C  CD    . LYS C  1 350 ? 68.821  23.391  -14.902 1.00 63.48  ? 491 LYS C CD    1 
ATOM   8766  C  CE    . LYS C  1 350 ? 70.084  23.506  -14.043 1.00 64.61  ? 491 LYS C CE    1 
ATOM   8767  N  NZ    . LYS C  1 350 ? 71.296  22.983  -14.738 1.00 62.53  ? 491 LYS C NZ    1 
ATOM   8768  N  N     . LYS C  1 351 ? 63.320  22.634  -15.343 1.00 48.60  ? 492 LYS C N     1 
ATOM   8769  C  CA    . LYS C  1 351 ? 62.085  22.580  -16.132 1.00 48.26  ? 492 LYS C CA    1 
ATOM   8770  C  C     . LYS C  1 351 ? 60.862  22.974  -15.297 1.00 50.91  ? 492 LYS C C     1 
ATOM   8771  O  O     . LYS C  1 351 ? 59.967  23.684  -15.771 1.00 53.38  ? 492 LYS C O     1 
ATOM   8772  C  CB    . LYS C  1 351 ? 61.872  21.192  -16.744 1.00 45.53  ? 492 LYS C CB    1 
ATOM   8773  C  CG    . LYS C  1 351 ? 63.100  20.582  -17.403 1.00 44.32  ? 492 LYS C CG    1 
ATOM   8774  C  CD    . LYS C  1 351 ? 63.775  21.534  -18.376 1.00 42.77  ? 492 LYS C CD    1 
ATOM   8775  C  CE    . LYS C  1 351 ? 63.040  21.619  -19.694 1.00 42.28  ? 492 LYS C CE    1 
ATOM   8776  N  NZ    . LYS C  1 351 ? 63.907  22.205  -20.758 1.00 43.41  ? 492 LYS C NZ    1 
ATOM   8777  N  N     . ILE C  1 352 ? 60.846  22.517  -14.048 1.00 53.50  ? 493 ILE C N     1 
ATOM   8778  C  CA    . ILE C  1 352 ? 59.749  22.791  -13.124 1.00 50.79  ? 493 ILE C CA    1 
ATOM   8779  C  C     . ILE C  1 352 ? 59.622  24.282  -12.841 1.00 50.64  ? 493 ILE C C     1 
ATOM   8780  O  O     . ILE C  1 352 ? 58.547  24.854  -13.003 1.00 48.46  ? 493 ILE C O     1 
ATOM   8781  C  CB    . ILE C  1 352 ? 59.910  22.003  -11.812 1.00 49.29  ? 493 ILE C CB    1 
ATOM   8782  C  CG1   . ILE C  1 352 ? 59.590  20.531  -12.053 1.00 51.13  ? 493 ILE C CG1   1 
ATOM   8783  C  CG2   . ILE C  1 352 ? 59.000  22.552  -10.731 1.00 47.37  ? 493 ILE C CG2   1 
ATOM   8784  C  CD1   . ILE C  1 352 ? 59.706  19.662  -10.829 1.00 52.10  ? 493 ILE C CD1   1 
ATOM   8785  N  N     . GLU C  1 353 ? 60.722  24.904  -12.423 1.00 53.66  ? 494 GLU C N     1 
ATOM   8786  C  CA    . GLU C  1 353 ? 60.748  26.346  -12.205 1.00 57.70  ? 494 GLU C CA    1 
ATOM   8787  C  C     . GLU C  1 353 ? 60.308  27.092  -13.462 1.00 60.15  ? 494 GLU C C     1 
ATOM   8788  O  O     . GLU C  1 353 ? 59.529  28.056  -13.385 1.00 61.26  ? 494 GLU C O     1 
ATOM   8789  C  CB    . GLU C  1 353 ? 62.144  26.804  -11.779 1.00 58.71  ? 494 GLU C CB    1 
ATOM   8790  C  CG    . GLU C  1 353 ? 62.552  26.397  -10.365 1.00 61.76  ? 494 GLU C CG    1 
ATOM   8791  C  CD    . GLU C  1 353 ? 62.001  27.323  -9.290  1.00 67.30  ? 494 GLU C CD    1 
ATOM   8792  O  OE1   . GLU C  1 353 ? 62.744  27.622  -8.332  1.00 67.01  ? 494 GLU C OE1   1 
ATOM   8793  O  OE2   . GLU C  1 353 ? 60.828  27.744  -9.389  1.00 70.23  ? 494 GLU C OE2   1 
ATOM   8794  N  N     . TYR C  1 354 ? 60.793  26.637  -14.618 1.00 60.36  ? 495 TYR C N     1 
ATOM   8795  C  CA    . TYR C  1 354 ? 60.392  27.248  -15.880 1.00 57.86  ? 495 TYR C CA    1 
ATOM   8796  C  C     . TYR C  1 354 ? 58.879  27.256  -16.058 1.00 56.15  ? 495 TYR C C     1 
ATOM   8797  O  O     . TYR C  1 354 ? 58.274  28.317  -16.206 1.00 58.90  ? 495 TYR C O     1 
ATOM   8798  C  CB    . TYR C  1 354 ? 61.026  26.550  -17.079 1.00 57.72  ? 495 TYR C CB    1 
ATOM   8799  C  CG    . TYR C  1 354 ? 60.425  27.041  -18.372 1.00 60.16  ? 495 TYR C CG    1 
ATOM   8800  C  CD1   . TYR C  1 354 ? 60.739  28.298  -18.865 1.00 62.26  ? 495 TYR C CD1   1 
ATOM   8801  C  CD2   . TYR C  1 354 ? 59.517  26.265  -19.082 1.00 60.11  ? 495 TYR C CD2   1 
ATOM   8802  C  CE1   . TYR C  1 354 ? 60.182  28.763  -20.036 1.00 64.29  ? 495 TYR C CE1   1 
ATOM   8803  C  CE2   . TYR C  1 354 ? 58.954  26.723  -20.256 1.00 61.86  ? 495 TYR C CE2   1 
ATOM   8804  C  CZ    . TYR C  1 354 ? 59.292  27.973  -20.728 1.00 64.49  ? 495 TYR C CZ    1 
ATOM   8805  O  OH    . TYR C  1 354 ? 58.737  28.438  -21.897 1.00 65.21  ? 495 TYR C OH    1 
ATOM   8806  N  N     . GLU C  1 355 ? 58.277  26.070  -16.056 1.00 52.38  ? 496 GLU C N     1 
ATOM   8807  C  CA    . GLU C  1 355 ? 56.832  25.946  -16.229 1.00 51.55  ? 496 GLU C CA    1 
ATOM   8808  C  C     . GLU C  1 355 ? 56.061  26.727  -15.162 1.00 50.85  ? 496 GLU C C     1 
ATOM   8809  O  O     . GLU C  1 355 ? 54.990  27.273  -15.426 1.00 48.22  ? 496 GLU C O     1 
ATOM   8810  C  CB    . GLU C  1 355 ? 56.426  24.471  -16.194 1.00 52.47  ? 496 GLU C CB    1 
ATOM   8811  C  CG    . GLU C  1 355 ? 56.983  23.639  -17.340 1.00 53.42  ? 496 GLU C CG    1 
ATOM   8812  C  CD    . GLU C  1 355 ? 56.217  23.841  -18.629 1.00 56.00  ? 496 GLU C CD    1 
ATOM   8813  O  OE1   . GLU C  1 355 ? 55.036  24.234  -18.563 1.00 57.75  ? 496 GLU C OE1   1 
ATOM   8814  O  OE2   . GLU C  1 355 ? 56.791  23.600  -19.709 1.00 57.14  ? 496 GLU C OE2   1 
ATOM   8815  N  N     . ARG C  1 356 ? 56.633  26.784  -13.964 1.00 55.37  ? 497 ARG C N     1 
ATOM   8816  C  CA    . ARG C  1 356 ? 56.016  27.427  -12.808 1.00 59.04  ? 497 ARG C CA    1 
ATOM   8817  C  C     . ARG C  1 356 ? 55.898  28.931  -12.999 1.00 61.03  ? 497 ARG C C     1 
ATOM   8818  O  O     . ARG C  1 356 ? 54.877  29.531  -12.651 1.00 61.62  ? 497 ARG C O     1 
ATOM   8819  C  CB    . ARG C  1 356 ? 56.849  27.136  -11.557 1.00 57.93  ? 497 ARG C CB    1 
ATOM   8820  C  CG    . ARG C  1 356 ? 56.293  27.683  -10.252 1.00 53.46  ? 497 ARG C CG    1 
ATOM   8821  C  CD    . ARG C  1 356 ? 57.285  27.435  -9.127  1.00 50.52  ? 497 ARG C CD    1 
ATOM   8822  N  NE    . ARG C  1 356 ? 56.738  27.732  -7.807  1.00 48.85  ? 497 ARG C NE    1 
ATOM   8823  C  CZ    . ARG C  1 356 ? 57.446  27.685  -6.683  1.00 48.54  ? 497 ARG C CZ    1 
ATOM   8824  N  NH1   . ARG C  1 356 ? 58.731  27.359  -6.720  1.00 49.54  ? 497 ARG C NH1   1 
ATOM   8825  N  NH2   . ARG C  1 356 ? 56.872  27.966  -5.521  1.00 46.36  ? 497 ARG C NH2   1 
ATOM   8826  N  N     . ASN C  1 357 ? 56.948  29.535  -13.548 1.00 62.37  ? 498 ASN C N     1 
ATOM   8827  C  CA    . ASN C  1 357 ? 56.972  30.984  -13.728 1.00 62.93  ? 498 ASN C CA    1 
ATOM   8828  C  C     . ASN C  1 357 ? 56.299  31.477  -15.019 1.00 60.84  ? 498 ASN C C     1 
ATOM   8829  O  O     . ASN C  1 357 ? 56.033  32.672  -15.169 1.00 60.14  ? 498 ASN C O     1 
ATOM   8830  C  CB    . ASN C  1 357 ? 58.413  31.499  -13.644 1.00 63.26  ? 498 ASN C CB    1 
ATOM   8831  C  CG    . ASN C  1 357 ? 59.066  31.192  -12.312 1.00 62.76  ? 498 ASN C CG    1 
ATOM   8832  O  OD1   . ASN C  1 357 ? 58.462  31.371  -11.257 1.00 63.04  ? 498 ASN C OD1   1 
ATOM   8833  N  ND2   . ASN C  1 357 ? 60.306  30.721  -12.355 1.00 62.11  ? 498 ASN C ND2   1 
ATOM   8834  N  N     . ASN C  1 358 ? 56.019  30.559  -15.938 1.00 58.22  ? 499 ASN C N     1 
ATOM   8835  C  CA    . ASN C  1 358 ? 55.493  30.932  -17.244 1.00 55.68  ? 499 ASN C CA    1 
ATOM   8836  C  C     . ASN C  1 358 ? 54.069  30.443  -17.503 1.00 53.24  ? 499 ASN C C     1 
ATOM   8837  O  O     . ASN C  1 358 ? 53.653  30.311  -18.653 1.00 52.39  ? 499 ASN C O     1 
ATOM   8838  C  CB    . ASN C  1 358 ? 56.434  30.436  -18.342 1.00 56.82  ? 499 ASN C CB    1 
ATOM   8839  C  CG    . ASN C  1 358 ? 57.809  31.064  -18.255 1.00 60.19  ? 499 ASN C CG    1 
ATOM   8840  O  OD1   . ASN C  1 358 ? 58.606  30.723  -17.383 1.00 59.85  ? 499 ASN C OD1   1 
ATOM   8841  N  ND2   . ASN C  1 358 ? 58.097  31.984  -19.167 1.00 63.88  ? 499 ASN C ND2   1 
ATOM   8842  N  N     . GLY C  1 359 ? 53.328  30.181  -16.431 1.00 53.49  ? 500 GLY C N     1 
ATOM   8843  C  CA    . GLY C  1 359 ? 51.941  29.764  -16.541 1.00 55.70  ? 500 GLY C CA    1 
ATOM   8844  C  C     . GLY C  1 359 ? 51.738  28.355  -17.072 1.00 57.70  ? 500 GLY C C     1 
ATOM   8845  O  O     . GLY C  1 359 ? 50.714  28.070  -17.695 1.00 59.63  ? 500 GLY C O     1 
ATOM   8846  N  N     . PHE C  1 360 ? 52.713  27.483  -16.824 1.00 55.35  ? 501 PHE C N     1 
ATOM   8847  C  CA    . PHE C  1 360 ? 52.647  26.074  -17.217 1.00 52.94  ? 501 PHE C CA    1 
ATOM   8848  C  C     . PHE C  1 360 ? 52.195  25.845  -18.661 1.00 53.92  ? 501 PHE C C     1 
ATOM   8849  O  O     . PHE C  1 360 ? 51.153  25.228  -18.884 1.00 57.06  ? 501 PHE C O     1 
ATOM   8850  C  CB    . PHE C  1 360 ? 51.724  25.296  -16.270 1.00 52.79  ? 501 PHE C CB    1 
ATOM   8851  C  CG    . PHE C  1 360 ? 51.947  25.596  -14.809 1.00 47.95  ? 501 PHE C CG    1 
ATOM   8852  C  CD1   . PHE C  1 360 ? 52.815  24.824  -14.050 1.00 46.22  ? 501 PHE C CD1   1 
ATOM   8853  C  CD2   . PHE C  1 360 ? 51.266  26.637  -14.191 1.00 46.41  ? 501 PHE C CD2   1 
ATOM   8854  C  CE1   . PHE C  1 360 ? 53.012  25.096  -12.708 1.00 47.74  ? 501 PHE C CE1   1 
ATOM   8855  C  CE2   . PHE C  1 360 ? 51.457  26.916  -12.851 1.00 45.96  ? 501 PHE C CE2   1 
ATOM   8856  C  CZ    . PHE C  1 360 ? 52.330  26.145  -12.108 1.00 48.32  ? 501 PHE C CZ    1 
ATOM   8857  N  N     . PRO C  1 361 ? 52.976  26.331  -19.644 1.00 52.94  ? 502 PRO C N     1 
ATOM   8858  C  CA    . PRO C  1 361 ? 52.579  26.156  -21.048 1.00 49.00  ? 502 PRO C CA    1 
ATOM   8859  C  C     . PRO C  1 361 ? 52.407  24.686  -21.445 1.00 49.02  ? 502 PRO C C     1 
ATOM   8860  O  O     . PRO C  1 361 ? 51.585  24.380  -22.311 1.00 50.68  ? 502 PRO C O     1 
ATOM   8861  C  CB    . PRO C  1 361 ? 53.743  26.787  -21.821 1.00 50.34  ? 502 PRO C CB    1 
ATOM   8862  C  CG    . PRO C  1 361 ? 54.885  26.840  -20.852 1.00 49.98  ? 502 PRO C CG    1 
ATOM   8863  C  CD    . PRO C  1 361 ? 54.252  27.060  -19.523 1.00 50.82  ? 502 PRO C CD    1 
ATOM   8864  N  N     . ILE C  1 362 ? 53.155  23.793  -20.802 1.00 48.38  ? 503 ILE C N     1 
ATOM   8865  C  CA    . ILE C  1 362 ? 53.112  22.364  -21.115 1.00 45.81  ? 503 ILE C CA    1 
ATOM   8866  C  C     . ILE C  1 362 ? 51.763  21.721  -20.789 1.00 47.35  ? 503 ILE C C     1 
ATOM   8867  O  O     . ILE C  1 362 ? 51.424  20.664  -21.331 1.00 45.21  ? 503 ILE C O     1 
ATOM   8868  C  CB    . ILE C  1 362 ? 54.243  21.596  -20.386 1.00 43.59  ? 503 ILE C CB    1 
ATOM   8869  C  CG1   . ILE C  1 362 ? 54.659  20.359  -21.184 1.00 42.74  ? 503 ILE C CG1   1 
ATOM   8870  C  CG2   . ILE C  1 362 ? 53.834  21.234  -18.958 1.00 40.78  ? 503 ILE C CG2   1 
ATOM   8871  C  CD1   . ILE C  1 362 ? 55.941  19.723  -20.702 1.00 41.68  ? 503 ILE C CD1   1 
ATOM   8872  N  N     . PHE C  1 363 ? 51.007  22.356  -19.896 1.00 52.16  ? 504 PHE C N     1 
ATOM   8873  C  CA    . PHE C  1 363 ? 49.660  21.903  -19.570 1.00 59.13  ? 504 PHE C CA    1 
ATOM   8874  C  C     . PHE C  1 363 ? 48.751  22.105  -20.776 1.00 67.35  ? 504 PHE C C     1 
ATOM   8875  O  O     . PHE C  1 363 ? 47.820  21.331  -21.009 1.00 69.15  ? 504 PHE C O     1 
ATOM   8876  C  CB    . PHE C  1 363 ? 49.091  22.698  -18.389 1.00 56.41  ? 504 PHE C CB    1 
ATOM   8877  C  CG    . PHE C  1 363 ? 49.539  22.211  -17.035 1.00 55.04  ? 504 PHE C CG    1 
ATOM   8878  C  CD1   . PHE C  1 363 ? 50.330  21.080  -16.903 1.00 51.98  ? 504 PHE C CD1   1 
ATOM   8879  C  CD2   . PHE C  1 363 ? 49.149  22.888  -15.885 1.00 53.92  ? 504 PHE C CD2   1 
ATOM   8880  C  CE1   . PHE C  1 363 ? 50.733  20.641  -15.653 1.00 48.83  ? 504 PHE C CE1   1 
ATOM   8881  C  CE2   . PHE C  1 363 ? 49.549  22.451  -14.630 1.00 51.26  ? 504 PHE C CE2   1 
ATOM   8882  C  CZ    . PHE C  1 363 ? 50.341  21.327  -14.516 1.00 49.50  ? 504 PHE C CZ    1 
ATOM   8883  N  N     . ASP C  1 364 ? 49.049  23.149  -21.545 1.00 71.82  ? 505 ASP C N     1 
ATOM   8884  C  CA    . ASP C  1 364 ? 48.152  23.651  -22.577 1.00 73.88  ? 505 ASP C CA    1 
ATOM   8885  C  C     . ASP C  1 364 ? 48.318  22.945  -23.920 1.00 72.80  ? 505 ASP C C     1 
ATOM   8886  O  O     . ASP C  1 364 ? 47.834  23.436  -24.941 1.00 74.28  ? 505 ASP C O     1 
ATOM   8887  C  CB    . ASP C  1 364 ? 48.390  25.155  -22.758 1.00 76.78  ? 505 ASP C CB    1 
ATOM   8888  C  CG    . ASP C  1 364 ? 47.107  25.935  -22.950 1.00 79.77  ? 505 ASP C CG    1 
ATOM   8889  O  OD1   . ASP C  1 364 ? 46.089  25.330  -23.345 1.00 81.49  ? 505 ASP C OD1   1 
ATOM   8890  O  OD2   . ASP C  1 364 ? 47.120  27.161  -22.713 1.00 79.90  ? 505 ASP C OD2   1 
ATOM   8891  N  N     . LYS C  1 365 ? 48.980  21.790  -23.928 1.00 70.77  ? 506 LYS C N     1 
ATOM   8892  C  CA    . LYS C  1 365 ? 49.316  21.154  -25.200 1.00 72.03  ? 506 LYS C CA    1 
ATOM   8893  C  C     . LYS C  1 365 ? 49.164  19.636  -25.252 1.00 71.98  ? 506 LYS C C     1 
ATOM   8894  O  O     . LYS C  1 365 ? 49.222  18.945  -24.233 1.00 73.51  ? 506 LYS C O     1 
ATOM   8895  C  CB    . LYS C  1 365 ? 50.729  21.548  -25.631 1.00 73.09  ? 506 LYS C CB    1 
ATOM   8896  C  CG    . LYS C  1 365 ? 51.824  21.066  -24.699 1.00 73.36  ? 506 LYS C CG    1 
ATOM   8897  C  CD    . LYS C  1 365 ? 53.108  21.830  -24.971 1.00 75.11  ? 506 LYS C CD    1 
ATOM   8898  C  CE    . LYS C  1 365 ? 54.323  20.930  -24.848 1.00 76.84  ? 506 LYS C CE    1 
ATOM   8899  N  NZ    . LYS C  1 365 ? 55.536  21.550  -25.454 1.00 78.33  ? 506 LYS C NZ    1 
ATOM   8900  N  N     . LEU C  1 366 ? 48.968  19.140  -26.469 1.00 71.20  ? 507 LEU C N     1 
ATOM   8901  C  CA    . LEU C  1 366 ? 48.894  17.714  -26.742 1.00 71.25  ? 507 LEU C CA    1 
ATOM   8902  C  C     . LEU C  1 366 ? 49.490  17.443  -28.116 1.00 71.63  ? 507 LEU C C     1 
ATOM   8903  O  O     . LEU C  1 366 ? 49.244  16.400  -28.717 1.00 71.97  ? 507 LEU C O     1 
ATOM   8904  C  CB    . LEU C  1 366 ? 47.445  17.227  -26.695 1.00 70.96  ? 507 LEU C CB    1 
ATOM   8905  C  CG    . LEU C  1 366 ? 47.170  16.046  -25.762 1.00 68.18  ? 507 LEU C CG    1 
ATOM   8906  C  CD1   . LEU C  1 366 ? 45.700  15.653  -25.797 1.00 66.62  ? 507 LEU C CD1   1 
ATOM   8907  C  CD2   . LEU C  1 366 ? 48.053  14.864  -26.118 1.00 65.08  ? 507 LEU C CD2   1 
ATOM   8908  N  N     . LYS D  1 8   ? -3.375  16.702  14.526  1.00 58.41  ? 149 LYS D N     1 
ATOM   8909  C  CA    . LYS D  1 8   ? -4.695  17.017  13.989  1.00 63.33  ? 149 LYS D CA    1 
ATOM   8910  C  C     . LYS D  1 8   ? -5.039  18.498  14.163  1.00 64.21  ? 149 LYS D C     1 
ATOM   8911  O  O     . LYS D  1 8   ? -5.404  19.175  13.199  1.00 66.42  ? 149 LYS D O     1 
ATOM   8912  C  CB    . LYS D  1 8   ? -5.764  16.124  14.628  1.00 65.12  ? 149 LYS D CB    1 
ATOM   8913  C  CG    . LYS D  1 8   ? -5.622  15.960  16.140  1.00 65.23  ? 149 LYS D CG    1 
ATOM   8914  C  CD    . LYS D  1 8   ? -6.341  14.715  16.630  1.00 64.72  ? 149 LYS D CD    1 
ATOM   8915  C  CE    . LYS D  1 8   ? -5.976  14.419  18.072  1.00 64.66  ? 149 LYS D CE    1 
ATOM   8916  N  NZ    . LYS D  1 8   ? -4.503  14.474  18.294  1.00 68.17  ? 149 LYS D NZ    1 
ATOM   8917  N  N     . LEU D  1 9   ? -4.910  18.997  15.389  1.00 59.43  ? 150 LEU D N     1 
ATOM   8918  C  CA    . LEU D  1 9   ? -5.261  20.376  15.704  1.00 53.26  ? 150 LEU D CA    1 
ATOM   8919  C  C     . LEU D  1 9   ? -4.007  21.243  15.766  1.00 53.14  ? 150 LEU D C     1 
ATOM   8920  O  O     . LEU D  1 9   ? -4.083  22.473  15.790  1.00 54.79  ? 150 LEU D O     1 
ATOM   8921  C  CB    . LEU D  1 9   ? -6.019  20.435  17.032  1.00 46.37  ? 150 LEU D CB    1 
ATOM   8922  C  CG    . LEU D  1 9   ? -7.313  19.621  17.103  1.00 38.26  ? 150 LEU D CG    1 
ATOM   8923  C  CD1   . LEU D  1 9   ? -7.908  19.625  18.496  1.00 37.37  ? 150 LEU D CD1   1 
ATOM   8924  C  CD2   . LEU D  1 9   ? -8.313  20.163  16.121  1.00 32.37  ? 150 LEU D CD2   1 
ATOM   8925  N  N     . LYS D  1 10  ? -2.853  20.585  15.781  1.00 51.50  ? 151 LYS D N     1 
ATOM   8926  C  CA    . LYS D  1 10  ? -1.567  21.262  15.841  1.00 51.10  ? 151 LYS D CA    1 
ATOM   8927  C  C     . LYS D  1 10  ? -1.208  21.852  14.480  1.00 52.80  ? 151 LYS D C     1 
ATOM   8928  O  O     . LYS D  1 10  ? -0.567  22.905  14.393  1.00 52.79  ? 151 LYS D O     1 
ATOM   8929  C  CB    . LYS D  1 10  ? -0.512  20.274  16.323  1.00 53.68  ? 151 LYS D CB    1 
ATOM   8930  C  CG    . LYS D  1 10  ? -1.003  19.491  17.537  1.00 60.36  ? 151 LYS D CG    1 
ATOM   8931  C  CD    . LYS D  1 10  ? -0.017  18.443  18.029  1.00 67.94  ? 151 LYS D CD    1 
ATOM   8932  C  CE    . LYS D  1 10  ? -0.565  17.759  19.285  1.00 72.87  ? 151 LYS D CE    1 
ATOM   8933  N  NZ    . LYS D  1 10  ? 0.257   16.595  19.731  1.00 75.36  ? 151 LYS D NZ    1 
ATOM   8934  N  N     . LYS D  1 11  ? -1.640  21.176  13.420  1.00 54.68  ? 152 LYS D N     1 
ATOM   8935  C  CA    . LYS D  1 11  ? -1.469  21.683  12.062  1.00 55.27  ? 152 LYS D CA    1 
ATOM   8936  C  C     . LYS D  1 11  ? -2.350  22.917  11.844  1.00 51.66  ? 152 LYS D C     1 
ATOM   8937  O  O     . LYS D  1 11  ? -1.947  23.879  11.178  1.00 48.95  ? 152 LYS D O     1 
ATOM   8938  C  CB    . LYS D  1 11  ? -1.798  20.589  11.042  1.00 55.41  ? 152 LYS D CB    1 
ATOM   8939  C  CG    . LYS D  1 11  ? -0.829  19.406  11.061  1.00 55.08  ? 152 LYS D CG    1 
ATOM   8940  C  CD    . LYS D  1 11  ? -1.431  18.180  10.374  1.00 57.85  ? 152 LYS D CD    1 
ATOM   8941  C  CE    . LYS D  1 11  ? -0.529  16.956  10.522  1.00 57.67  ? 152 LYS D CE    1 
ATOM   8942  N  NZ    . LYS D  1 11  ? -1.248  15.791  11.115  1.00 56.95  ? 152 LYS D NZ    1 
ATOM   8943  N  N     . VAL D  1 12  ? -3.550  22.883  12.421  1.00 50.70  ? 153 VAL D N     1 
ATOM   8944  C  CA    . VAL D  1 12  ? -4.465  24.021  12.380  1.00 49.77  ? 153 VAL D CA    1 
ATOM   8945  C  C     . VAL D  1 12  ? -3.840  25.212  13.098  1.00 47.86  ? 153 VAL D C     1 
ATOM   8946  O  O     . VAL D  1 12  ? -3.906  26.345  12.621  1.00 50.29  ? 153 VAL D O     1 
ATOM   8947  C  CB    . VAL D  1 12  ? -5.806  23.686  13.052  1.00 51.43  ? 153 VAL D CB    1 
ATOM   8948  C  CG1   . VAL D  1 12  ? -6.804  24.803  12.832  1.00 51.82  ? 153 VAL D CG1   1 
ATOM   8949  C  CG2   . VAL D  1 12  ? -6.359  22.386  12.509  1.00 53.64  ? 153 VAL D CG2   1 
ATOM   8950  N  N     . LEU D  1 13  ? -3.228  24.942  14.246  1.00 41.97  ? 154 LEU D N     1 
ATOM   8951  C  CA    . LEU D  1 13  ? -2.591  25.980  15.042  1.00 37.67  ? 154 LEU D CA    1 
ATOM   8952  C  C     . LEU D  1 13  ? -1.384  26.568  14.314  1.00 42.61  ? 154 LEU D C     1 
ATOM   8953  O  O     . LEU D  1 13  ? -1.150  27.777  14.372  1.00 43.10  ? 154 LEU D O     1 
ATOM   8954  C  CB    . LEU D  1 13  ? -2.199  25.430  16.413  1.00 36.67  ? 154 LEU D CB    1 
ATOM   8955  C  CG    . LEU D  1 13  ? -3.338  25.382  17.435  1.00 34.61  ? 154 LEU D CG    1 
ATOM   8956  C  CD1   . LEU D  1 13  ? -3.065  24.392  18.549  1.00 35.22  ? 154 LEU D CD1   1 
ATOM   8957  C  CD2   . LEU D  1 13  ? -3.571  26.758  18.019  1.00 28.98  ? 154 LEU D CD2   1 
ATOM   8958  N  N     . ASP D  1 14  ? -0.632  25.716  13.620  1.00 48.92  ? 155 ASP D N     1 
ATOM   8959  C  CA    . ASP D  1 14  ? 0.495   26.176  12.813  1.00 50.96  ? 155 ASP D CA    1 
ATOM   8960  C  C     . ASP D  1 14  ? 0.004   27.061  11.677  1.00 51.22  ? 155 ASP D C     1 
ATOM   8961  O  O     . ASP D  1 14  ? 0.656   28.040  11.306  1.00 51.31  ? 155 ASP D O     1 
ATOM   8962  C  CB    . ASP D  1 14  ? 1.271   24.987  12.255  1.00 54.85  ? 155 ASP D CB    1 
ATOM   8963  C  CG    . ASP D  1 14  ? 2.042   24.249  13.322  1.00 59.20  ? 155 ASP D CG    1 
ATOM   8964  O  OD1   . ASP D  1 14  ? 2.469   24.902  14.297  1.00 60.84  ? 155 ASP D OD1   1 
ATOM   8965  O  OD2   . ASP D  1 14  ? 2.222   23.021  13.184  1.00 59.60  ? 155 ASP D OD2   1 
ATOM   8966  N  N     . LYS D  1 15  ? -1.158  26.709  11.137  1.00 51.28  ? 156 LYS D N     1 
ATOM   8967  C  CA    . LYS D  1 15  ? -1.777  27.469  10.059  1.00 50.80  ? 156 LYS D CA    1 
ATOM   8968  C  C     . LYS D  1 15  ? -2.282  28.834  10.540  1.00 49.59  ? 156 LYS D C     1 
ATOM   8969  O  O     . LYS D  1 15  ? -2.217  29.824  9.809   1.00 54.06  ? 156 LYS D O     1 
ATOM   8970  C  CB    . LYS D  1 15  ? -2.929  26.658  9.462   1.00 53.03  ? 156 LYS D CB    1 
ATOM   8971  C  CG    . LYS D  1 15  ? -3.682  27.349  8.344   1.00 55.52  ? 156 LYS D CG    1 
ATOM   8972  C  CD    . LYS D  1 15  ? -4.899  26.538  7.946   1.00 58.50  ? 156 LYS D CD    1 
ATOM   8973  C  CE    . LYS D  1 15  ? -5.854  27.360  7.103   1.00 62.77  ? 156 LYS D CE    1 
ATOM   8974  N  NZ    . LYS D  1 15  ? -7.165  26.673  6.915   1.00 65.07  ? 156 LYS D NZ    1 
ATOM   8975  N  N     . LEU D  1 16  ? -2.773  28.880  11.776  1.00 44.12  ? 157 LEU D N     1 
ATOM   8976  C  CA    . LEU D  1 16  ? -3.368  30.093  12.330  1.00 41.89  ? 157 LEU D CA    1 
ATOM   8977  C  C     . LEU D  1 16  ? -2.312  31.056  12.867  1.00 43.26  ? 157 LEU D C     1 
ATOM   8978  O  O     . LEU D  1 16  ? -2.573  32.251  13.042  1.00 42.57  ? 157 LEU D O     1 
ATOM   8979  C  CB    . LEU D  1 16  ? -4.350  29.729  13.445  1.00 39.96  ? 157 LEU D CB    1 
ATOM   8980  C  CG    . LEU D  1 16  ? -5.641  29.021  13.040  1.00 33.46  ? 157 LEU D CG    1 
ATOM   8981  C  CD1   . LEU D  1 16  ? -6.385  28.546  14.264  1.00 29.62  ? 157 LEU D CD1   1 
ATOM   8982  C  CD2   . LEU D  1 16  ? -6.508  29.959  12.234  1.00 28.23  ? 157 LEU D CD2   1 
ATOM   8983  N  N     . ARG D  1 17  ? -1.123  30.519  13.121  1.00 43.14  ? 158 ARG D N     1 
ATOM   8984  C  CA    . ARG D  1 17  ? -0.019  31.270  13.708  1.00 41.40  ? 158 ARG D CA    1 
ATOM   8985  C  C     . ARG D  1 17  ? 0.387   32.475  12.866  1.00 42.19  ? 158 ARG D C     1 
ATOM   8986  O  O     . ARG D  1 17  ? 0.429   32.400  11.638  1.00 44.78  ? 158 ARG D O     1 
ATOM   8987  C  CB    . ARG D  1 17  ? 1.175   30.336  13.908  1.00 42.59  ? 158 ARG D CB    1 
ATOM   8988  C  CG    . ARG D  1 17  ? 2.398   30.969  14.540  1.00 44.98  ? 158 ARG D CG    1 
ATOM   8989  C  CD    . ARG D  1 17  ? 3.251   29.900  15.186  1.00 47.86  ? 158 ARG D CD    1 
ATOM   8990  N  NE    . ARG D  1 17  ? 2.453   29.077  16.092  1.00 53.00  ? 158 ARG D NE    1 
ATOM   8991  C  CZ    . ARG D  1 17  ? 2.579   27.759  16.214  1.00 57.74  ? 158 ARG D CZ    1 
ATOM   8992  N  NH1   . ARG D  1 17  ? 3.471   27.106  15.484  1.00 60.80  ? 158 ARG D NH1   1 
ATOM   8993  N  NH2   . ARG D  1 17  ? 1.810   27.089  17.061  1.00 56.97  ? 158 ARG D NH2   1 
ATOM   8994  N  N     . LEU D  1 18  ? 0.672   33.588  13.536  1.00 43.38  ? 159 LEU D N     1 
ATOM   8995  C  CA    . LEU D  1 18  ? 1.124   34.802  12.865  1.00 44.19  ? 159 LEU D CA    1 
ATOM   8996  C  C     . LEU D  1 18  ? 2.609   34.708  12.512  1.00 46.99  ? 159 LEU D C     1 
ATOM   8997  O  O     . LEU D  1 18  ? 3.378   34.057  13.220  1.00 48.92  ? 159 LEU D O     1 
ATOM   8998  C  CB    . LEU D  1 18  ? 0.891   36.019  13.761  1.00 41.37  ? 159 LEU D CB    1 
ATOM   8999  C  CG    . LEU D  1 18  ? -0.516  36.261  14.302  1.00 34.19  ? 159 LEU D CG    1 
ATOM   9000  C  CD1   . LEU D  1 18  ? -0.551  37.510  15.165  1.00 32.38  ? 159 LEU D CD1   1 
ATOM   9001  C  CD2   . LEU D  1 18  ? -1.494  36.386  13.164  1.00 32.55  ? 159 LEU D CD2   1 
ATOM   9002  N  N     . LYS D  1 19  ? 3.008   35.349  11.417  1.00 45.57  ? 160 LYS D N     1 
ATOM   9003  C  CA    . LYS D  1 19  ? 4.421   35.415  11.056  1.00 44.65  ? 160 LYS D CA    1 
ATOM   9004  C  C     . LYS D  1 19  ? 5.027   36.729  11.546  1.00 44.70  ? 160 LYS D C     1 
ATOM   9005  O  O     . LYS D  1 19  ? 4.365   37.767  11.521  1.00 44.52  ? 160 LYS D O     1 
ATOM   9006  C  CB    . LYS D  1 19  ? 4.625   35.271  9.542   1.00 45.96  ? 160 LYS D CB    1 
ATOM   9007  C  CG    . LYS D  1 19  ? 4.266   33.898  8.955   1.00 46.73  ? 160 LYS D CG    1 
ATOM   9008  C  CD    . LYS D  1 19  ? 2.776   33.799  8.647   1.00 50.69  ? 160 LYS D CD    1 
ATOM   9009  C  CE    . LYS D  1 19  ? 2.387   32.447  8.063   1.00 53.44  ? 160 LYS D CE    1 
ATOM   9010  N  NZ    . LYS D  1 19  ? 2.562   32.387  6.585   1.00 56.31  ? 160 LYS D NZ    1 
ATOM   9011  N  N     . ARG D  1 20  ? 6.281   36.670  11.992  1.00 46.84  ? 161 ARG D N     1 
ATOM   9012  C  CA    . ARG D  1 20  ? 7.003   37.843  12.486  1.00 53.22  ? 161 ARG D CA    1 
ATOM   9013  C  C     . ARG D  1 20  ? 6.982   39.008  11.506  1.00 57.83  ? 161 ARG D C     1 
ATOM   9014  O  O     . ARG D  1 20  ? 6.700   40.146  11.880  1.00 62.36  ? 161 ARG D O     1 
ATOM   9015  C  CB    . ARG D  1 20  ? 8.461   37.483  12.760  1.00 58.10  ? 161 ARG D CB    1 
ATOM   9016  C  CG    . ARG D  1 20  ? 8.788   37.131  14.199  1.00 63.92  ? 161 ARG D CG    1 
ATOM   9017  C  CD    . ARG D  1 20  ? 10.153  37.688  14.578  1.00 68.40  ? 161 ARG D CD    1 
ATOM   9018  N  NE    . ARG D  1 20  ? 10.996  36.705  15.251  1.00 71.21  ? 161 ARG D NE    1 
ATOM   9019  C  CZ    . ARG D  1 20  ? 12.045  36.115  14.686  1.00 71.64  ? 161 ARG D CZ    1 
ATOM   9020  N  NH1   . ARG D  1 20  ? 12.383  36.405  13.437  1.00 72.42  ? 161 ARG D NH1   1 
ATOM   9021  N  NH2   . ARG D  1 20  ? 12.758  35.231  15.368  1.00 70.20  ? 161 ARG D NH2   1 
ATOM   9022  N  N     . LYS D  1 21  ? 7.306   38.704  10.254  1.00 54.53  ? 162 LYS D N     1 
ATOM   9023  C  CA    . LYS D  1 21  ? 7.379   39.689  9.185   1.00 52.19  ? 162 LYS D CA    1 
ATOM   9024  C  C     . LYS D  1 21  ? 6.065   40.458  9.066   1.00 48.71  ? 162 LYS D C     1 
ATOM   9025  O  O     . LYS D  1 21  ? 6.051   41.701  9.086   1.00 54.21  ? 162 LYS D O     1 
ATOM   9026  C  CB    . LYS D  1 21  ? 7.700   38.971  7.873   1.00 57.01  ? 162 LYS D CB    1 
ATOM   9027  C  CG    . LYS D  1 21  ? 8.084   39.879  6.724   1.00 59.41  ? 162 LYS D CG    1 
ATOM   9028  C  CD    . LYS D  1 21  ? 8.365   39.072  5.462   1.00 59.82  ? 162 LYS D CD    1 
ATOM   9029  C  CE    . LYS D  1 21  ? 8.674   39.980  4.284   1.00 59.61  ? 162 LYS D CE    1 
ATOM   9030  N  NZ    . LYS D  1 21  ? 7.496   40.808  3.910   1.00 59.95  ? 162 LYS D NZ    1 
ATOM   9031  N  N     . ASP D  1 22  ? 4.967   39.707  8.965   1.00 43.70  ? 163 ASP D N     1 
ATOM   9032  C  CA    . ASP D  1 22  ? 3.621   40.271  8.888   1.00 38.50  ? 163 ASP D CA    1 
ATOM   9033  C  C     . ASP D  1 22  ? 3.338   41.194  10.070  1.00 35.99  ? 163 ASP D C     1 
ATOM   9034  O  O     . ASP D  1 22  ? 2.753   42.274  9.922   1.00 38.89  ? 163 ASP D O     1 
ATOM   9035  C  CB    . ASP D  1 22  ? 2.591   39.143  8.905   1.00 37.23  ? 163 ASP D CB    1 
ATOM   9036  C  CG    . ASP D  1 22  ? 2.688   38.232  7.698   1.00 39.52  ? 163 ASP D CG    1 
ATOM   9037  O  OD1   . ASP D  1 22  ? 3.696   38.293  6.970   1.00 42.33  ? 163 ASP D OD1   1 
ATOM   9038  O  OD2   . ASP D  1 22  ? 1.747   37.436  7.490   1.00 41.15  ? 163 ASP D OD2   1 
ATOM   9039  N  N     . ILE D  1 23  ? 3.763   40.747  11.247  1.00 32.97  ? 164 ILE D N     1 
ATOM   9040  C  CA    . ILE D  1 23  ? 3.506   41.452  12.495  1.00 31.71  ? 164 ILE D CA    1 
ATOM   9041  C  C     . ILE D  1 23  ? 4.234   42.788  12.539  1.00 34.99  ? 164 ILE D C     1 
ATOM   9042  O  O     . ILE D  1 23  ? 3.644   43.804  12.890  1.00 34.01  ? 164 ILE D O     1 
ATOM   9043  C  CB    . ILE D  1 23  ? 3.922   40.605  13.713  1.00 27.75  ? 164 ILE D CB    1 
ATOM   9044  C  CG1   . ILE D  1 23  ? 2.980   39.414  13.893  1.00 22.40  ? 164 ILE D CG1   1 
ATOM   9045  C  CG2   . ILE D  1 23  ? 3.944   41.448  14.970  1.00 28.03  ? 164 ILE D CG2   1 
ATOM   9046  C  CD1   . ILE D  1 23  ? 3.364   38.497  15.043  1.00 21.28  ? 164 ILE D CD1   1 
ATOM   9047  N  N     . SER D  1 24  ? 5.514   42.783  12.183  1.00 39.55  ? 165 SER D N     1 
ATOM   9048  C  CA    . SER D  1 24  ? 6.317   44.000  12.213  1.00 41.10  ? 165 SER D CA    1 
ATOM   9049  C  C     . SER D  1 24  ? 5.797   44.999  11.188  1.00 38.41  ? 165 SER D C     1 
ATOM   9050  O  O     . SER D  1 24  ? 5.631   46.193  11.484  1.00 38.31  ? 165 SER D O     1 
ATOM   9051  C  CB    . SER D  1 24  ? 7.778   43.671  11.919  1.00 46.07  ? 165 SER D CB    1 
ATOM   9052  O  OG    . SER D  1 24  ? 8.214   42.558  12.674  1.00 49.26  ? 165 SER D OG    1 
ATOM   9053  N  N     . GLU D  1 25  ? 5.533   44.492  9.986   1.00 37.78  ? 166 GLU D N     1 
ATOM   9054  C  CA    . GLU D  1 25  ? 5.003   45.310  8.906   1.00 38.94  ? 166 GLU D CA    1 
ATOM   9055  C  C     . GLU D  1 25  ? 3.660   45.963  9.265   1.00 43.38  ? 166 GLU D C     1 
ATOM   9056  O  O     . GLU D  1 25  ? 3.446   47.141  8.986   1.00 45.28  ? 166 GLU D O     1 
ATOM   9057  C  CB    . GLU D  1 25  ? 4.886   44.476  7.628   1.00 43.44  ? 166 GLU D CB    1 
ATOM   9058  C  CG    . GLU D  1 25  ? 6.238   44.042  7.040   1.00 50.38  ? 166 GLU D CG    1 
ATOM   9059  C  CD    . GLU D  1 25  ? 6.095   42.996  5.943   1.00 57.60  ? 166 GLU D CD    1 
ATOM   9060  O  OE1   . GLU D  1 25  ? 4.949   42.607  5.629   1.00 60.33  ? 166 GLU D OE1   1 
ATOM   9061  O  OE2   . GLU D  1 25  ? 7.131   42.565  5.395   1.00 58.18  ? 166 GLU D OE2   1 
ATOM   9062  N  N     . ALA D  1 26  ? 2.761   45.207  9.890   1.00 42.07  ? 167 ALA D N     1 
ATOM   9063  C  CA    . ALA D  1 26  ? 1.455   45.746  10.273  1.00 36.04  ? 167 ALA D CA    1 
ATOM   9064  C  C     . ALA D  1 26  ? 1.563   46.734  11.439  1.00 38.90  ? 167 ALA D C     1 
ATOM   9065  O  O     . ALA D  1 26  ? 1.114   47.888  11.358  1.00 43.19  ? 167 ALA D O     1 
ATOM   9066  C  CB    . ALA D  1 26  ? 0.512   44.615  10.627  1.00 33.04  ? 167 ALA D CB    1 
ATOM   9067  N  N     . ALA D  1 27  ? 2.155   46.254  12.528  1.00 38.16  ? 168 ALA D N     1 
ATOM   9068  C  CA    . ALA D  1 27  ? 2.322   47.025  13.753  1.00 33.98  ? 168 ALA D CA    1 
ATOM   9069  C  C     . ALA D  1 27  ? 3.033   48.363  13.554  1.00 38.92  ? 168 ALA D C     1 
ATOM   9070  O  O     . ALA D  1 27  ? 2.698   49.335  14.222  1.00 42.93  ? 168 ALA D O     1 
ATOM   9071  C  CB    . ALA D  1 27  ? 3.047   46.199  14.785  1.00 34.01  ? 168 ALA D CB    1 
ATOM   9072  N  N     . GLU D  1 28  ? 4.025   48.410  12.668  1.00 40.74  ? 169 GLU D N     1 
ATOM   9073  C  CA    . GLU D  1 28  ? 4.718   49.669  12.387  1.00 42.95  ? 169 GLU D CA    1 
ATOM   9074  C  C     . GLU D  1 28  ? 3.742   50.767  11.927  1.00 43.78  ? 169 GLU D C     1 
ATOM   9075  O  O     . GLU D  1 28  ? 3.620   51.830  12.560  1.00 48.28  ? 169 GLU D O     1 
ATOM   9076  C  CB    . GLU D  1 28  ? 5.812   49.438  11.339  1.00 46.56  ? 169 GLU D CB    1 
ATOM   9077  C  CG    . GLU D  1 28  ? 6.704   50.649  11.065  1.00 51.32  ? 169 GLU D CG    1 
ATOM   9078  C  CD    . GLU D  1 28  ? 7.842   50.330  10.109  1.00 55.36  ? 169 GLU D CD    1 
ATOM   9079  O  OE1   . GLU D  1 28  ? 8.621   51.249  9.786   1.00 57.34  ? 169 GLU D OE1   1 
ATOM   9080  O  OE2   . GLU D  1 28  ? 7.956   49.162  9.681   1.00 57.46  ? 169 GLU D OE2   1 
ATOM   9081  N  N     . THR D  1 29  ? 3.040   50.491  10.833  1.00 41.57  ? 170 THR D N     1 
ATOM   9082  C  CA    . THR D  1 29  ? 2.062   51.417  10.273  1.00 38.30  ? 170 THR D CA    1 
ATOM   9083  C  C     . THR D  1 29  ? 0.977   51.763  11.283  1.00 37.55  ? 170 THR D C     1 
ATOM   9084  O  O     . THR D  1 29  ? 0.691   52.949  11.520  1.00 38.42  ? 170 THR D O     1 
ATOM   9085  C  CB    . THR D  1 29  ? 1.393   50.817  9.039   1.00 36.09  ? 170 THR D CB    1 
ATOM   9086  O  OG1   . THR D  1 29  ? 2.389   50.484  8.067   1.00 36.19  ? 170 THR D OG1   1 
ATOM   9087  C  CG2   . THR D  1 29  ? 0.431   51.800  8.433   1.00 35.21  ? 170 THR D CG2   1 
ATOM   9088  N  N     . VAL D  1 30  ? 0.373   50.723  11.862  1.00 39.14  ? 171 VAL D N     1 
ATOM   9089  C  CA    . VAL D  1 30  ? -0.677  50.906  12.866  1.00 38.92  ? 171 VAL D CA    1 
ATOM   9090  C  C     . VAL D  1 30  ? -0.221  51.863  13.963  1.00 43.92  ? 171 VAL D C     1 
ATOM   9091  O  O     . VAL D  1 30  ? -0.936  52.807  14.301  1.00 48.11  ? 171 VAL D O     1 
ATOM   9092  C  CB    . VAL D  1 30  ? -1.123  49.569  13.490  1.00 32.49  ? 171 VAL D CB    1 
ATOM   9093  C  CG1   . VAL D  1 30  ? -2.044  49.814  14.672  1.00 27.25  ? 171 VAL D CG1   1 
ATOM   9094  C  CG2   . VAL D  1 30  ? -1.822  48.707  12.453  1.00 33.20  ? 171 VAL D CG2   1 
ATOM   9095  N  N     . ASN D  1 31  ? 0.974   51.627  14.499  1.00 41.18  ? 172 ASN D N     1 
ATOM   9096  C  CA    . ASN D  1 31  ? 1.523   52.484  15.543  1.00 38.77  ? 172 ASN D CA    1 
ATOM   9097  C  C     . ASN D  1 31  ? 1.726   53.924  15.089  1.00 42.21  ? 172 ASN D C     1 
ATOM   9098  O  O     . ASN D  1 31  ? 1.444   54.854  15.849  1.00 50.56  ? 172 ASN D O     1 
ATOM   9099  C  CB    . ASN D  1 31  ? 2.831   51.914  16.084  1.00 38.80  ? 172 ASN D CB    1 
ATOM   9100  C  CG    . ASN D  1 31  ? 2.624   50.657  16.895  1.00 40.56  ? 172 ASN D CG    1 
ATOM   9101  O  OD1   . ASN D  1 31  ? 1.510   50.346  17.308  1.00 39.08  ? 172 ASN D OD1   1 
ATOM   9102  N  ND2   . ASN D  1 31  ? 3.705   49.927  17.134  1.00 45.72  ? 172 ASN D ND2   1 
ATOM   9103  N  N     . LYS D  1 32  ? 2.225   54.110  13.866  1.00 37.60  ? 173 LYS D N     1 
ATOM   9104  C  CA    . LYS D  1 32  ? 2.324   55.456  13.291  1.00 37.99  ? 173 LYS D CA    1 
ATOM   9105  C  C     . LYS D  1 32  ? 0.982   56.187  13.350  1.00 36.53  ? 173 LYS D C     1 
ATOM   9106  O  O     . LYS D  1 32  ? 0.868   57.286  13.930  1.00 37.07  ? 173 LYS D O     1 
ATOM   9107  C  CB    . LYS D  1 32  ? 2.777   55.392  11.834  1.00 41.69  ? 173 LYS D CB    1 
ATOM   9108  C  CG    . LYS D  1 32  ? 4.263   55.163  11.627  1.00 44.40  ? 173 LYS D CG    1 
ATOM   9109  C  CD    . LYS D  1 32  ? 4.616   55.345  10.150  1.00 45.56  ? 173 LYS D CD    1 
ATOM   9110  C  CE    . LYS D  1 32  ? 6.085   55.064  9.880   1.00 46.76  ? 173 LYS D CE    1 
ATOM   9111  N  NZ    . LYS D  1 32  ? 6.414   55.250  8.440   1.00 48.38  ? 173 LYS D NZ    1 
ATOM   9112  N  N     . VAL D  1 33  ? -0.032  55.562  12.752  1.00 36.95  ? 174 VAL D N     1 
ATOM   9113  C  CA    . VAL D  1 33  ? -1.379  56.145  12.701  1.00 39.62  ? 174 VAL D CA    1 
ATOM   9114  C  C     . VAL D  1 33  ? -1.949  56.440  14.097  1.00 39.01  ? 174 VAL D C     1 
ATOM   9115  O  O     . VAL D  1 33  ? -2.401  57.561  14.372  1.00 42.53  ? 174 VAL D O     1 
ATOM   9116  C  CB    . VAL D  1 33  ? -2.354  55.244  11.920  1.00 38.47  ? 174 VAL D CB    1 
ATOM   9117  C  CG1   . VAL D  1 33  ? -3.679  55.945  11.719  1.00 39.59  ? 174 VAL D CG1   1 
ATOM   9118  C  CG2   . VAL D  1 33  ? -1.759  54.872  10.576  1.00 34.64  ? 174 VAL D CG2   1 
ATOM   9119  N  N     . VAL D  1 34  ? -1.916  55.433  14.969  1.00 32.38  ? 175 VAL D N     1 
ATOM   9120  C  CA    . VAL D  1 34  ? -2.403  55.574  16.340  1.00 31.53  ? 175 VAL D CA    1 
ATOM   9121  C  C     . VAL D  1 34  ? -1.734  56.743  17.051  1.00 34.26  ? 175 VAL D C     1 
ATOM   9122  O  O     . VAL D  1 34  ? -2.400  57.537  17.713  1.00 34.41  ? 175 VAL D O     1 
ATOM   9123  C  CB    . VAL D  1 34  ? -2.171  54.291  17.161  1.00 27.07  ? 175 VAL D CB    1 
ATOM   9124  C  CG1   . VAL D  1 34  ? -2.496  54.534  18.624  1.00 25.49  ? 175 VAL D CG1   1 
ATOM   9125  C  CG2   . VAL D  1 34  ? -3.012  53.149  16.621  1.00 24.98  ? 175 VAL D CG2   1 
ATOM   9126  N  N     . GLU D  1 35  ? -0.416  56.844  16.908  1.00 39.63  ? 176 GLU D N     1 
ATOM   9127  C  CA    . GLU D  1 35  ? 0.338   57.921  17.539  1.00 42.97  ? 176 GLU D CA    1 
ATOM   9128  C  C     . GLU D  1 35  ? -0.098  59.284  17.020  1.00 44.03  ? 176 GLU D C     1 
ATOM   9129  O  O     . GLU D  1 35  ? -0.223  60.239  17.794  1.00 46.39  ? 176 GLU D O     1 
ATOM   9130  C  CB    . GLU D  1 35  ? 1.837   57.733  17.310  1.00 44.65  ? 176 GLU D CB    1 
ATOM   9131  C  CG    . GLU D  1 35  ? 2.672   58.948  17.689  1.00 47.55  ? 176 GLU D CG    1 
ATOM   9132  C  CD    . GLU D  1 35  ? 4.133   58.802  17.309  1.00 57.50  ? 176 GLU D CD    1 
ATOM   9133  O  OE1   . GLU D  1 35  ? 4.736   59.802  16.868  1.00 61.97  ? 176 GLU D OE1   1 
ATOM   9134  O  OE2   . GLU D  1 35  ? 4.685   57.694  17.463  1.00 61.67  ? 176 GLU D OE2   1 
ATOM   9135  N  N     . ARG D  1 36  ? -0.327  59.375  15.712  1.00 40.71  ? 177 ARG D N     1 
ATOM   9136  C  CA    . ARG D  1 36  ? -0.785  60.633  15.126  1.00 37.46  ? 177 ARG D CA    1 
ATOM   9137  C  C     . ARG D  1 36  ? -2.153  61.053  15.671  1.00 39.83  ? 177 ARG D C     1 
ATOM   9138  O  O     . ARG D  1 36  ? -2.328  62.184  16.135  1.00 40.21  ? 177 ARG D O     1 
ATOM   9139  C  CB    . ARG D  1 36  ? -0.811  60.537  13.601  1.00 33.07  ? 177 ARG D CB    1 
ATOM   9140  C  CG    . ARG D  1 36  ? -1.038  61.870  12.905  1.00 33.84  ? 177 ARG D CG    1 
ATOM   9141  C  CD    . ARG D  1 36  ? -0.476  61.866  11.492  1.00 36.06  ? 177 ARG D CD    1 
ATOM   9142  N  NE    . ARG D  1 36  ? -0.655  63.156  10.833  1.00 41.44  ? 177 ARG D NE    1 
ATOM   9143  C  CZ    . ARG D  1 36  ? -0.068  63.504  9.691   1.00 47.55  ? 177 ARG D CZ    1 
ATOM   9144  N  NH1   . ARG D  1 36  ? 0.744   62.660  9.067   1.00 49.54  ? 177 ARG D NH1   1 
ATOM   9145  N  NH2   . ARG D  1 36  ? -0.291  64.701  9.171   1.00 48.70  ? 177 ARG D NH2   1 
ATOM   9146  N  N     . LEU D  1 37  ? -3.115  60.138  15.626  1.00 41.39  ? 178 LEU D N     1 
ATOM   9147  C  CA    . LEU D  1 37  ? -4.444  60.431  16.148  1.00 40.65  ? 178 LEU D CA    1 
ATOM   9148  C  C     . LEU D  1 37  ? -4.402  60.809  17.626  1.00 38.09  ? 178 LEU D C     1 
ATOM   9149  O  O     . LEU D  1 37  ? -5.046  61.775  18.039  1.00 38.29  ? 178 LEU D O     1 
ATOM   9150  C  CB    . LEU D  1 37  ? -5.365  59.238  15.934  1.00 41.11  ? 178 LEU D CB    1 
ATOM   9151  C  CG    . LEU D  1 37  ? -5.423  58.795  14.477  1.00 41.18  ? 178 LEU D CG    1 
ATOM   9152  C  CD1   . LEU D  1 37  ? -6.243  57.535  14.345  1.00 41.48  ? 178 LEU D CD1   1 
ATOM   9153  C  CD2   . LEU D  1 37  ? -5.990  59.901  13.606  1.00 36.64  ? 178 LEU D CD2   1 
ATOM   9154  N  N     . LEU D  1 38  ? -3.636  60.054  18.410  1.00 37.43  ? 179 LEU D N     1 
ATOM   9155  C  CA    . LEU D  1 38  ? -3.509  60.318  19.841  1.00 33.82  ? 179 LEU D CA    1 
ATOM   9156  C  C     . LEU D  1 38  ? -2.969  61.722  20.064  1.00 36.91  ? 179 LEU D C     1 
ATOM   9157  O  O     . LEU D  1 38  ? -3.507  62.477  20.872  1.00 38.10  ? 179 LEU D O     1 
ATOM   9158  C  CB    . LEU D  1 38  ? -2.601  59.285  20.510  1.00 26.49  ? 179 LEU D CB    1 
ATOM   9159  C  CG    . LEU D  1 38  ? -2.426  59.434  22.020  1.00 27.26  ? 179 LEU D CG    1 
ATOM   9160  C  CD1   . LEU D  1 38  ? -3.729  59.149  22.748  1.00 28.10  ? 179 LEU D CD1   1 
ATOM   9161  C  CD2   . LEU D  1 38  ? -1.309  58.551  22.552  1.00 20.68  ? 179 LEU D CD2   1 
ATOM   9162  N  N     . ARG D  1 39  ? -1.913  62.064  19.328  1.00 42.77  ? 180 ARG D N     1 
ATOM   9163  C  CA    . ARG D  1 39  ? -1.298  63.389  19.390  1.00 44.74  ? 180 ARG D CA    1 
ATOM   9164  C  C     . ARG D  1 39  ? -2.311  64.484  19.086  1.00 39.52  ? 180 ARG D C     1 
ATOM   9165  O  O     . ARG D  1 39  ? -2.392  65.483  19.799  1.00 37.12  ? 180 ARG D O     1 
ATOM   9166  C  CB    . ARG D  1 39  ? -0.146  63.470  18.388  1.00 49.91  ? 180 ARG D CB    1 
ATOM   9167  C  CG    . ARG D  1 39  ? 1.199   63.849  18.989  1.00 55.65  ? 180 ARG D CG    1 
ATOM   9168  C  CD    . ARG D  1 39  ? 2.318   63.582  17.996  1.00 63.20  ? 180 ARG D CD    1 
ATOM   9169  N  NE    . ARG D  1 39  ? 3.638   63.657  18.613  1.00 71.19  ? 180 ARG D NE    1 
ATOM   9170  C  CZ    . ARG D  1 39  ? 4.530   64.614  18.371  1.00 77.30  ? 180 ARG D CZ    1 
ATOM   9171  N  NH1   . ARG D  1 39  ? 4.251   65.590  17.518  1.00 80.60  ? 180 ARG D NH1   1 
ATOM   9172  N  NH2   . ARG D  1 39  ? 5.707   64.593  18.983  1.00 76.43  ? 180 ARG D NH2   1 
ATOM   9173  N  N     . ARG D  1 40  ? -3.073  64.285  18.016  1.00 38.99  ? 181 ARG D N     1 
ATOM   9174  C  CA    . ARG D  1 40  ? -4.134  65.208  17.642  1.00 44.14  ? 181 ARG D CA    1 
ATOM   9175  C  C     . ARG D  1 40  ? -5.141  65.392  18.774  1.00 49.86  ? 181 ARG D C     1 
ATOM   9176  O  O     . ARG D  1 40  ? -5.594  66.507  19.046  1.00 56.11  ? 181 ARG D O     1 
ATOM   9177  C  CB    . ARG D  1 40  ? -4.846  64.684  16.395  1.00 43.87  ? 181 ARG D CB    1 
ATOM   9178  C  CG    . ARG D  1 40  ? -6.150  65.390  16.063  1.00 45.03  ? 181 ARG D CG    1 
ATOM   9179  C  CD    . ARG D  1 40  ? -5.932  66.848  15.677  1.00 48.17  ? 181 ARG D CD    1 
ATOM   9180  N  NE    . ARG D  1 40  ? -7.152  67.462  15.158  1.00 49.23  ? 181 ARG D NE    1 
ATOM   9181  C  CZ    . ARG D  1 40  ? -8.011  68.159  15.894  1.00 51.57  ? 181 ARG D CZ    1 
ATOM   9182  N  NH1   . ARG D  1 40  ? -7.787  68.341  17.189  1.00 50.49  ? 181 ARG D NH1   1 
ATOM   9183  N  NH2   . ARG D  1 40  ? -9.096  68.678  15.337  1.00 53.23  ? 181 ARG D NH2   1 
ATOM   9184  N  N     . MET D  1 41  ? -5.474  64.294  19.442  1.00 48.22  ? 182 MET D N     1 
ATOM   9185  C  CA    . MET D  1 41  ? -6.539  64.292  20.436  1.00 48.20  ? 182 MET D CA    1 
ATOM   9186  C  C     . MET D  1 41  ? -6.223  65.190  21.634  1.00 49.58  ? 182 MET D C     1 
ATOM   9187  O  O     . MET D  1 41  ? -7.131  65.722  22.279  1.00 51.11  ? 182 MET D O     1 
ATOM   9188  C  CB    . MET D  1 41  ? -6.812  62.857  20.889  1.00 49.58  ? 182 MET D CB    1 
ATOM   9189  C  CG    . MET D  1 41  ? -8.246  62.581  21.250  1.00 50.82  ? 182 MET D CG    1 
ATOM   9190  S  SD    . MET D  1 41  ? -9.409  63.026  19.944  1.00 60.24  ? 182 MET D SD    1 
ATOM   9191  C  CE    . MET D  1 41  ? -9.099  61.714  18.769  1.00 22.51  ? 182 MET D CE    1 
ATOM   9192  N  N     . GLN D  1 42  ? -4.937  65.370  21.920  1.00 50.84  ? 183 GLN D N     1 
ATOM   9193  C  CA    . GLN D  1 42  ? -4.526  66.195  23.050  1.00 55.06  ? 183 GLN D CA    1 
ATOM   9194  C  C     . GLN D  1 42  ? -4.102  67.599  22.648  1.00 55.69  ? 183 GLN D C     1 
ATOM   9195  O  O     . GLN D  1 42  ? -3.359  68.248  23.382  1.00 49.74  ? 183 GLN D O     1 
ATOM   9196  C  CB    . GLN D  1 42  ? -3.374  65.538  23.807  1.00 57.23  ? 183 GLN D CB    1 
ATOM   9197  C  CG    . GLN D  1 42  ? -3.801  64.684  24.981  1.00 59.99  ? 183 GLN D CG    1 
ATOM   9198  C  CD    . GLN D  1 42  ? -3.607  63.217  24.712  1.00 63.35  ? 183 GLN D CD    1 
ATOM   9199  O  OE1   . GLN D  1 42  ? -3.410  62.807  23.570  1.00 64.55  ? 183 GLN D OE1   1 
ATOM   9200  N  NE2   . GLN D  1 42  ? -3.654  62.412  25.764  1.00 64.16  ? 183 GLN D NE2   1 
ATOM   9201  N  N     . LYS D  1 43  ? -4.567  68.076  21.499  1.00 62.17  ? 184 LYS D N     1 
ATOM   9202  C  CA    . LYS D  1 43  ? -4.158  69.397  21.038  1.00 68.33  ? 184 LYS D CA    1 
ATOM   9203  C  C     . LYS D  1 43  ? -5.321  70.368  20.890  1.00 67.64  ? 184 LYS D C     1 
ATOM   9204  O  O     . LYS D  1 43  ? -6.467  69.952  20.724  1.00 65.92  ? 184 LYS D O     1 
ATOM   9205  C  CB    . LYS D  1 43  ? -3.342  69.299  19.747  1.00 73.38  ? 184 LYS D CB    1 
ATOM   9206  C  CG    . LYS D  1 43  ? -1.949  68.727  19.981  1.00 76.82  ? 184 LYS D CG    1 
ATOM   9207  C  CD    . LYS D  1 43  ? -1.041  68.904  18.780  1.00 79.40  ? 184 LYS D CD    1 
ATOM   9208  C  CE    . LYS D  1 43  ? 0.408   68.667  19.178  1.00 80.78  ? 184 LYS D CE    1 
ATOM   9209  N  NZ    . LYS D  1 43  ? 1.339   68.790  18.020  1.00 81.27  ? 184 LYS D NZ    1 
ATOM   9210  N  N     . ARG D  1 44  ? -5.000  71.660  20.965  1.00 69.17  ? 185 ARG D N     1 
ATOM   9211  C  CA    . ARG D  1 44  ? -5.975  72.752  20.911  1.00 69.87  ? 185 ARG D CA    1 
ATOM   9212  C  C     . ARG D  1 44  ? -6.908  72.759  22.113  1.00 66.63  ? 185 ARG D C     1 
ATOM   9213  O  O     . ARG D  1 44  ? -6.547  72.314  23.203  1.00 64.82  ? 185 ARG D O     1 
ATOM   9214  C  CB    . ARG D  1 44  ? -6.790  72.709  19.613  1.00 75.81  ? 185 ARG D CB    1 
ATOM   9215  C  CG    . ARG D  1 44  ? -5.936  72.639  18.362  1.00 81.71  ? 185 ARG D CG    1 
ATOM   9216  C  CD    . ARG D  1 44  ? -6.761  72.291  17.138  1.00 86.00  ? 185 ARG D CD    1 
ATOM   9217  N  NE    . ARG D  1 44  ? -5.917  71.810  16.048  1.00 88.72  ? 185 ARG D NE    1 
ATOM   9218  C  CZ    . ARG D  1 44  ? -6.377  71.417  14.866  1.00 92.27  ? 185 ARG D CZ    1 
ATOM   9219  N  NH1   . ARG D  1 44  ? -7.677  71.449  14.616  1.00 93.80  ? 185 ARG D NH1   1 
ATOM   9220  N  NH2   . ARG D  1 44  ? -5.537  70.990  13.933  1.00 93.42  ? 185 ARG D NH2   1 
ATOM   9221  N  N     . GLU D  1 45  ? -8.114  73.273  21.900  1.00 64.27  ? 186 GLU D N     1 
ATOM   9222  C  CA    . GLU D  1 45  ? -9.125  73.298  22.940  1.00 64.04  ? 186 GLU D CA    1 
ATOM   9223  C  C     . GLU D  1 45  ? -9.989  72.052  22.820  1.00 59.54  ? 186 GLU D C     1 
ATOM   9224  O  O     . GLU D  1 45  ? -11.189 72.079  23.104  1.00 59.14  ? 186 GLU D O     1 
ATOM   9225  C  CB    . GLU D  1 45  ? -9.974  74.562  22.822  1.00 67.79  ? 186 GLU D CB    1 
ATOM   9226  C  CG    . GLU D  1 45  ? -9.153  75.818  22.560  1.00 69.29  ? 186 GLU D CG    1 
ATOM   9227  C  CD    . GLU D  1 45  ? -9.990  77.080  22.545  1.00 73.11  ? 186 GLU D CD    1 
ATOM   9228  O  OE1   . GLU D  1 45  ? -10.879 77.217  23.410  1.00 73.06  ? 186 GLU D OE1   1 
ATOM   9229  O  OE2   . GLU D  1 45  ? -9.758  77.940  21.669  1.00 76.65  ? 186 GLU D OE2   1 
ATOM   9230  N  N     . SER D  1 46  ? -9.363  70.962  22.384  1.00 54.85  ? 187 SER D N     1 
ATOM   9231  C  CA    . SER D  1 46  ? -10.034 69.675  22.274  1.00 53.24  ? 187 SER D CA    1 
ATOM   9232  C  C     . SER D  1 46  ? -10.557 69.242  23.629  1.00 52.23  ? 187 SER D C     1 
ATOM   9233  O  O     . SER D  1 46  ? -9.889  69.408  24.647  1.00 54.92  ? 187 SER D O     1 
ATOM   9234  C  CB    . SER D  1 46  ? -9.079  68.614  21.729  1.00 55.07  ? 187 SER D CB    1 
ATOM   9235  O  OG    . SER D  1 46  ? -9.624  67.316  21.874  1.00 57.32  ? 187 SER D OG    1 
ATOM   9236  N  N     . GLU D  1 47  ? -11.763 68.692  23.629  1.00 49.07  ? 188 GLU D N     1 
ATOM   9237  C  CA    . GLU D  1 47  ? -12.413 68.233  24.844  1.00 42.71  ? 188 GLU D CA    1 
ATOM   9238  C  C     . GLU D  1 47  ? -12.005 66.794  25.114  1.00 40.51  ? 188 GLU D C     1 
ATOM   9239  O  O     . GLU D  1 47  ? -12.434 66.182  26.094  1.00 37.96  ? 188 GLU D O     1 
ATOM   9240  C  CB    . GLU D  1 47  ? -13.931 68.345  24.698  1.00 42.20  ? 188 GLU D CB    1 
ATOM   9241  C  CG    . GLU D  1 47  ? -14.483 67.842  23.369  1.00 42.12  ? 188 GLU D CG    1 
ATOM   9242  C  CD    . GLU D  1 47  ? -14.357 68.861  22.248  1.00 43.12  ? 188 GLU D CD    1 
ATOM   9243  O  OE1   . GLU D  1 47  ? -13.236 69.061  21.740  1.00 48.59  ? 188 GLU D OE1   1 
ATOM   9244  O  OE2   . GLU D  1 47  ? -15.380 69.460  21.870  1.00 42.43  ? 188 GLU D OE2   1 
ATOM   9245  N  N     . PHE D  1 48  ? -11.168 66.263  24.230  1.00 41.60  ? 189 PHE D N     1 
ATOM   9246  C  CA    . PHE D  1 48  ? -10.639 64.926  24.392  1.00 43.02  ? 189 PHE D CA    1 
ATOM   9247  C  C     . PHE D  1 48  ? -9.190  65.013  24.840  1.00 44.01  ? 189 PHE D C     1 
ATOM   9248  O  O     . PHE D  1 48  ? -8.519  63.994  25.028  1.00 42.56  ? 189 PHE D O     1 
ATOM   9249  C  CB    . PHE D  1 48  ? -10.757 64.159  23.083  1.00 44.11  ? 189 PHE D CB    1 
ATOM   9250  C  CG    . PHE D  1 48  ? -12.173 63.929  22.646  1.00 43.95  ? 189 PHE D CG    1 
ATOM   9251  C  CD1   . PHE D  1 48  ? -12.970 63.007  23.307  1.00 41.88  ? 189 PHE D CD1   1 
ATOM   9252  C  CD2   . PHE D  1 48  ? -12.707 64.627  21.575  1.00 43.11  ? 189 PHE D CD2   1 
ATOM   9253  C  CE1   . PHE D  1 48  ? -14.276 62.787  22.909  1.00 40.85  ? 189 PHE D CE1   1 
ATOM   9254  C  CE2   . PHE D  1 48  ? -14.011 64.411  21.174  1.00 43.08  ? 189 PHE D CE2   1 
ATOM   9255  C  CZ    . PHE D  1 48  ? -14.795 63.491  21.841  1.00 42.15  ? 189 PHE D CZ    1 
ATOM   9256  N  N     . LYS D  1 49  ? -8.718  66.247  24.994  1.00 47.13  ? 190 LYS D N     1 
ATOM   9257  C  CA    . LYS D  1 49  ? -7.419  66.513  25.596  1.00 51.81  ? 190 LYS D CA    1 
ATOM   9258  C  C     . LYS D  1 49  ? -7.358  65.846  26.967  1.00 51.70  ? 190 LYS D C     1 
ATOM   9259  O  O     . LYS D  1 49  ? -8.185  66.114  27.841  1.00 55.24  ? 190 LYS D O     1 
ATOM   9260  C  CB    . LYS D  1 49  ? -7.193  68.024  25.707  1.00 56.16  ? 190 LYS D CB    1 
ATOM   9261  C  CG    . LYS D  1 49  ? -6.241  68.465  26.811  1.00 61.37  ? 190 LYS D CG    1 
ATOM   9262  C  CD    . LYS D  1 49  ? -4.823  67.956  26.591  1.00 66.75  ? 190 LYS D CD    1 
ATOM   9263  C  CE    . LYS D  1 49  ? -3.893  68.427  27.697  1.00 69.34  ? 190 LYS D CE    1 
ATOM   9264  N  NZ    . LYS D  1 49  ? -3.736  69.906  27.698  1.00 71.53  ? 190 LYS D NZ    1 
ATOM   9265  N  N     . GLY D  1 50  ? -6.389  64.956  27.143  1.00 47.83  ? 191 GLY D N     1 
ATOM   9266  C  CA    . GLY D  1 50  ? -6.282  64.187  28.369  1.00 46.29  ? 191 GLY D CA    1 
ATOM   9267  C  C     . GLY D  1 50  ? -6.512  62.703  28.142  1.00 47.59  ? 191 GLY D C     1 
ATOM   9268  O  O     . GLY D  1 50  ? -6.378  61.900  29.068  1.00 50.80  ? 191 GLY D O     1 
ATOM   9269  N  N     . VAL D  1 51  ? -6.862  62.342  26.910  1.00 43.19  ? 192 VAL D N     1 
ATOM   9270  C  CA    . VAL D  1 51  ? -7.089  60.947  26.543  1.00 42.15  ? 192 VAL D CA    1 
ATOM   9271  C  C     . VAL D  1 51  ? -5.802  60.125  26.635  1.00 46.45  ? 192 VAL D C     1 
ATOM   9272  O  O     . VAL D  1 51  ? -4.745  60.559  26.173  1.00 49.54  ? 192 VAL D O     1 
ATOM   9273  C  CB    . VAL D  1 51  ? -7.697  60.845  25.124  1.00 42.64  ? 192 VAL D CB    1 
ATOM   9274  C  CG1   . VAL D  1 51  ? -7.154  59.653  24.366  1.00 41.13  ? 192 VAL D CG1   1 
ATOM   9275  C  CG2   . VAL D  1 51  ? -9.210  60.768  25.202  1.00 42.73  ? 192 VAL D CG2   1 
ATOM   9276  N  N     . GLU D  1 52  ? -5.889  58.944  27.241  1.00 45.63  ? 193 GLU D N     1 
ATOM   9277  C  CA    . GLU D  1 52  ? -4.737  58.051  27.334  1.00 40.33  ? 193 GLU D CA    1 
ATOM   9278  C  C     . GLU D  1 52  ? -4.985  56.773  26.536  1.00 32.48  ? 193 GLU D C     1 
ATOM   9279  O  O     . GLU D  1 52  ? -6.133  56.411  26.271  1.00 31.40  ? 193 GLU D O     1 
ATOM   9280  C  CB    . GLU D  1 52  ? -4.404  57.749  28.800  1.00 41.82  ? 193 GLU D CB    1 
ATOM   9281  C  CG    . GLU D  1 52  ? -3.931  58.975  29.573  1.00 48.08  ? 193 GLU D CG    1 
ATOM   9282  C  CD    . GLU D  1 52  ? -3.867  58.751  31.075  1.00 52.12  ? 193 GLU D CD    1 
ATOM   9283  O  OE1   . GLU D  1 52  ? -4.685  57.968  31.601  1.00 56.03  ? 193 GLU D OE1   1 
ATOM   9284  O  OE2   . GLU D  1 52  ? -3.004  59.372  31.731  1.00 47.30  ? 193 GLU D OE2   1 
ATOM   9285  N  N     . GLN D  1 53  ? -3.907  56.096  26.154  1.00 29.30  ? 194 GLN D N     1 
ATOM   9286  C  CA    . GLN D  1 53  ? -4.002  54.925  25.288  1.00 29.80  ? 194 GLN D CA    1 
ATOM   9287  C  C     . GLN D  1 53  ? -3.961  53.610  26.069  1.00 32.66  ? 194 GLN D C     1 
ATOM   9288  O  O     . GLN D  1 53  ? -3.213  53.466  27.040  1.00 34.00  ? 194 GLN D O     1 
ATOM   9289  C  CB    . GLN D  1 53  ? -2.883  54.946  24.239  1.00 29.25  ? 194 GLN D CB    1 
ATOM   9290  C  CG    . GLN D  1 53  ? -2.854  53.729  23.313  1.00 28.93  ? 194 GLN D CG    1 
ATOM   9291  C  CD    . GLN D  1 53  ? -1.665  53.733  22.369  1.00 33.93  ? 194 GLN D CD    1 
ATOM   9292  O  OE1   . GLN D  1 53  ? -0.862  54.663  22.370  1.00 34.08  ? 194 GLN D OE1   1 
ATOM   9293  N  NE2   . GLN D  1 53  ? -1.548  52.689  21.557  1.00 35.00  ? 194 GLN D NE2   1 
ATOM   9294  N  N     . LEU D  1 54  ? -4.777  52.656  25.631  1.00 33.62  ? 195 LEU D N     1 
ATOM   9295  C  CA    . LEU D  1 54  ? -4.803  51.322  26.216  1.00 29.89  ? 195 LEU D CA    1 
ATOM   9296  C  C     . LEU D  1 54  ? -4.951  50.274  25.100  1.00 28.43  ? 195 LEU D C     1 
ATOM   9297  O  O     . LEU D  1 54  ? -6.011  50.153  24.484  1.00 19.76  ? 195 LEU D O     1 
ATOM   9298  C  CB    . LEU D  1 54  ? -5.957  51.223  27.218  1.00 29.13  ? 195 LEU D CB    1 
ATOM   9299  C  CG    . LEU D  1 54  ? -5.654  50.609  28.581  1.00 33.96  ? 195 LEU D CG    1 
ATOM   9300  C  CD1   . LEU D  1 54  ? -6.892  50.615  29.473  1.00 29.88  ? 195 LEU D CD1   1 
ATOM   9301  C  CD2   . LEU D  1 54  ? -5.114  49.199  28.414  1.00 37.97  ? 195 LEU D CD2   1 
ATOM   9302  N  N     . ASN D  1 55  ? -3.888  49.523  24.832  1.00 32.42  ? 196 ASN D N     1 
ATOM   9303  C  CA    . ASN D  1 55  ? -3.942  48.497  23.796  1.00 30.78  ? 196 ASN D CA    1 
ATOM   9304  C  C     . ASN D  1 55  ? -4.670  47.241  24.269  1.00 27.62  ? 196 ASN D C     1 
ATOM   9305  O  O     . ASN D  1 55  ? -4.212  46.573  25.196  1.00 27.73  ? 196 ASN D O     1 
ATOM   9306  C  CB    . ASN D  1 55  ? -2.532  48.148  23.329  1.00 30.31  ? 196 ASN D CB    1 
ATOM   9307  C  CG    . ASN D  1 55  ? -1.851  49.304  22.618  1.00 31.19  ? 196 ASN D CG    1 
ATOM   9308  O  OD1   . ASN D  1 55  ? -2.509  50.161  22.029  1.00 28.53  ? 196 ASN D OD1   1 
ATOM   9309  N  ND2   . ASN D  1 55  ? -0.523  49.330  22.666  1.00 31.86  ? 196 ASN D ND2   1 
ATOM   9310  N  N     . THR D  1 56  ? -5.798  46.923  23.633  1.00 25.55  ? 197 THR D N     1 
ATOM   9311  C  CA    . THR D  1 56  ? -6.628  45.788  24.049  1.00 28.03  ? 197 THR D CA    1 
ATOM   9312  C  C     . THR D  1 56  ? -6.965  44.850  22.889  1.00 31.43  ? 197 THR D C     1 
ATOM   9313  O  O     . THR D  1 56  ? -6.638  45.136  21.734  1.00 32.04  ? 197 THR D O     1 
ATOM   9314  C  CB    . THR D  1 56  ? -7.944  46.267  24.708  1.00 29.18  ? 197 THR D CB    1 
ATOM   9315  O  OG1   . THR D  1 56  ? -8.679  47.083  23.787  1.00 25.93  ? 197 THR D OG1   1 
ATOM   9316  C  CG2   . THR D  1 56  ? -7.658  47.074  25.964  1.00 26.06  ? 197 THR D CG2   1 
ATOM   9317  N  N     . GLY D  1 57  ? -7.604  43.724  23.193  1.00 34.62  ? 198 GLY D N     1 
ATOM   9318  C  CA    . GLY D  1 57  ? -8.064  42.831  22.142  1.00 37.82  ? 198 GLY D CA    1 
ATOM   9319  C  C     . GLY D  1 57  ? -7.163  41.644  21.853  1.00 38.70  ? 198 GLY D C     1 
ATOM   9320  O  O     . GLY D  1 57  ? -6.114  41.484  22.478  1.00 39.01  ? 198 GLY D O     1 
ATOM   9321  N  N     . SER D  1 58  ? -7.579  40.826  20.886  1.00 39.30  ? 199 SER D N     1 
ATOM   9322  C  CA    . SER D  1 58  ? -6.905  39.574  20.552  1.00 38.77  ? 199 SER D CA    1 
ATOM   9323  C  C     . SER D  1 58  ? -5.402  39.714  20.334  1.00 38.82  ? 199 SER D C     1 
ATOM   9324  O  O     . SER D  1 58  ? -4.617  38.943  20.886  1.00 42.05  ? 199 SER D O     1 
ATOM   9325  C  CB    . SER D  1 58  ? -7.543  38.943  19.312  1.00 39.19  ? 199 SER D CB    1 
ATOM   9326  O  OG    . SER D  1 58  ? -8.933  38.744  19.480  1.00 38.93  ? 199 SER D OG    1 
ATOM   9327  N  N     . TYR D  1 59  ? -5.011  40.693  19.528  1.00 34.31  ? 200 TYR D N     1 
ATOM   9328  C  CA    . TYR D  1 59  ? -3.609  40.884  19.173  1.00 33.76  ? 200 TYR D CA    1 
ATOM   9329  C  C     . TYR D  1 59  ? -2.715  41.104  20.390  1.00 33.14  ? 200 TYR D C     1 
ATOM   9330  O  O     . TYR D  1 59  ? -1.676  40.458  20.527  1.00 37.99  ? 200 TYR D O     1 
ATOM   9331  C  CB    . TYR D  1 59  ? -3.468  42.050  18.195  1.00 33.47  ? 200 TYR D CB    1 
ATOM   9332  C  CG    . TYR D  1 59  ? -2.042  42.394  17.853  1.00 33.85  ? 200 TYR D CG    1 
ATOM   9333  C  CD1   . TYR D  1 59  ? -1.317  41.620  16.963  1.00 35.35  ? 200 TYR D CD1   1 
ATOM   9334  C  CD2   . TYR D  1 59  ? -1.423  43.501  18.413  1.00 36.12  ? 200 TYR D CD2   1 
ATOM   9335  C  CE1   . TYR D  1 59  ? -0.010  41.936  16.648  1.00 38.44  ? 200 TYR D CE1   1 
ATOM   9336  C  CE2   . TYR D  1 59  ? -0.121  43.821  18.108  1.00 35.28  ? 200 TYR D CE2   1 
ATOM   9337  C  CZ    . TYR D  1 59  ? 0.579   43.039  17.224  1.00 38.57  ? 200 TYR D CZ    1 
ATOM   9338  O  OH    . TYR D  1 59  ? 1.878   43.361  16.922  1.00 41.88  ? 200 TYR D OH    1 
ATOM   9339  N  N     . TYR D  1 60  ? -3.126  42.013  21.268  1.00 28.62  ? 201 TYR D N     1 
ATOM   9340  C  CA    . TYR D  1 60  ? -2.338  42.343  22.449  1.00 27.18  ? 201 TYR D CA    1 
ATOM   9341  C  C     . TYR D  1 60  ? -2.469  41.288  23.544  1.00 28.96  ? 201 TYR D C     1 
ATOM   9342  O  O     . TYR D  1 60  ? -1.740  41.319  24.535  1.00 30.35  ? 201 TYR D O     1 
ATOM   9343  C  CB    . TYR D  1 60  ? -2.728  43.726  22.964  1.00 23.16  ? 201 TYR D CB    1 
ATOM   9344  C  CG    . TYR D  1 60  ? -2.478  44.804  21.938  1.00 23.72  ? 201 TYR D CG    1 
ATOM   9345  C  CD1   . TYR D  1 60  ? -1.203  45.293  21.719  1.00 24.64  ? 201 TYR D CD1   1 
ATOM   9346  C  CD2   . TYR D  1 60  ? -3.511  45.315  21.175  1.00 26.72  ? 201 TYR D CD2   1 
ATOM   9347  C  CE1   . TYR D  1 60  ? -0.967  46.262  20.778  1.00 26.46  ? 201 TYR D CE1   1 
ATOM   9348  C  CE2   . TYR D  1 60  ? -3.281  46.288  20.227  1.00 27.59  ? 201 TYR D CE2   1 
ATOM   9349  C  CZ    . TYR D  1 60  ? -2.010  46.756  20.035  1.00 29.30  ? 201 TYR D CZ    1 
ATOM   9350  O  OH    . TYR D  1 60  ? -1.776  47.728  19.094  1.00 37.49  ? 201 TYR D OH    1 
ATOM   9351  N  N     . GLU D  1 61  ? -3.403  40.359  23.352  1.00 33.41  ? 202 GLU D N     1 
ATOM   9352  C  CA    . GLU D  1 61  ? -3.568  39.213  24.241  1.00 32.50  ? 202 GLU D CA    1 
ATOM   9353  C  C     . GLU D  1 61  ? -2.845  37.983  23.678  1.00 32.39  ? 202 GLU D C     1 
ATOM   9354  O  O     . GLU D  1 61  ? -2.723  36.966  24.363  1.00 31.02  ? 202 GLU D O     1 
ATOM   9355  C  CB    . GLU D  1 61  ? -5.056  38.894  24.432  1.00 30.89  ? 202 GLU D CB    1 
ATOM   9356  C  CG    . GLU D  1 61  ? -5.838  39.921  25.251  1.00 30.73  ? 202 GLU D CG    1 
ATOM   9357  C  CD    . GLU D  1 61  ? -7.337  39.656  25.247  1.00 35.52  ? 202 GLU D CD    1 
ATOM   9358  O  OE1   . GLU D  1 61  ? -7.788  38.772  24.488  1.00 41.80  ? 202 GLU D OE1   1 
ATOM   9359  O  OE2   . GLU D  1 61  ? -8.068  40.339  25.996  1.00 33.81  ? 202 GLU D OE2   1 
ATOM   9360  N  N     . HIS D  1 62  ? -2.370  38.101  22.437  1.00 32.67  ? 203 HIS D N     1 
ATOM   9361  C  CA    . HIS D  1 62  ? -1.732  37.011  21.694  1.00 34.12  ? 203 HIS D CA    1 
ATOM   9362  C  C     . HIS D  1 62  ? -2.720  35.906  21.345  1.00 32.51  ? 203 HIS D C     1 
ATOM   9363  O  O     . HIS D  1 62  ? -2.359  34.732  21.317  1.00 32.41  ? 203 HIS D O     1 
ATOM   9364  C  CB    . HIS D  1 62  ? -0.527  36.427  22.441  1.00 40.25  ? 203 HIS D CB    1 
ATOM   9365  C  CG    . HIS D  1 62  ? 0.372   37.455  23.053  1.00 42.87  ? 203 HIS D CG    1 
ATOM   9366  N  ND1   . HIS D  1 62  ? 1.375   38.095  22.329  1.00 44.12  ? 203 HIS D ND1   1 
ATOM   9367  C  CD2   . HIS D  1 62  ? 0.449   37.944  24.301  1.00 39.86  ? 203 HIS D CD2   1 
ATOM   9368  C  CE1   . HIS D  1 62  ? 2.003   38.931  23.121  1.00 44.72  ? 203 HIS D CE1   1 
ATOM   9369  N  NE2   . HIS D  1 62  ? 1.470   38.868  24.332  1.00 40.28  ? 203 HIS D NE2   1 
ATOM   9370  N  N     . VAL D  1 63  ? -3.966  36.287  21.083  1.00 35.46  ? 204 VAL D N     1 
ATOM   9371  C  CA    . VAL D  1 63  ? -4.968  35.335  20.614  1.00 36.85  ? 204 VAL D CA    1 
ATOM   9372  C  C     . VAL D  1 63  ? -5.566  35.748  19.263  1.00 36.32  ? 204 VAL D C     1 
ATOM   9373  O  O     . VAL D  1 63  ? -6.621  35.260  18.865  1.00 36.68  ? 204 VAL D O     1 
ATOM   9374  C  CB    . VAL D  1 63  ? -6.063  35.069  21.674  1.00 36.94  ? 204 VAL D CB    1 
ATOM   9375  C  CG1   . VAL D  1 63  ? -5.457  34.404  22.897  1.00 32.90  ? 204 VAL D CG1   1 
ATOM   9376  C  CG2   . VAL D  1 63  ? -6.757  36.361  22.060  1.00 40.33  ? 204 VAL D CG2   1 
ATOM   9377  N  N     . LYS D  1 64  ? -4.873  36.644  18.565  1.00 36.92  ? 205 LYS D N     1 
ATOM   9378  C  CA    . LYS D  1 64  ? -5.224  36.994  17.194  1.00 34.05  ? 205 LYS D CA    1 
ATOM   9379  C  C     . LYS D  1 64  ? -4.719  35.911  16.251  1.00 35.53  ? 205 LYS D C     1 
ATOM   9380  O  O     . LYS D  1 64  ? -3.554  35.520  16.309  1.00 36.96  ? 205 LYS D O     1 
ATOM   9381  C  CB    . LYS D  1 64  ? -4.602  38.332  16.810  1.00 34.11  ? 205 LYS D CB    1 
ATOM   9382  C  CG    . LYS D  1 64  ? -5.067  38.856  15.468  1.00 33.79  ? 205 LYS D CG    1 
ATOM   9383  C  CD    . LYS D  1 64  ? -6.561  39.094  15.499  1.00 34.53  ? 205 LYS D CD    1 
ATOM   9384  C  CE    . LYS D  1 64  ? -7.129  39.306  14.111  1.00 36.40  ? 205 LYS D CE    1 
ATOM   9385  N  NZ    . LYS D  1 64  ? -7.151  38.062  13.303  1.00 40.33  ? 205 LYS D NZ    1 
ATOM   9386  N  N     . ILE D  1 65  ? -5.599  35.426  15.384  1.00 36.67  ? 206 ILE D N     1 
ATOM   9387  C  CA    . ILE D  1 65  ? -5.273  34.305  14.512  1.00 31.55  ? 206 ILE D CA    1 
ATOM   9388  C  C     . ILE D  1 65  ? -5.126  34.730  13.056  1.00 34.93  ? 206 ILE D C     1 
ATOM   9389  O  O     . ILE D  1 65  ? -5.496  35.850  12.686  1.00 34.47  ? 206 ILE D O     1 
ATOM   9390  C  CB    . ILE D  1 65  ? -6.346  33.219  14.606  1.00 27.32  ? 206 ILE D CB    1 
ATOM   9391  C  CG1   . ILE D  1 65  ? -7.686  33.752  14.096  1.00 31.95  ? 206 ILE D CG1   1 
ATOM   9392  C  CG2   . ILE D  1 65  ? -6.485  32.730  16.044  1.00 22.94  ? 206 ILE D CG2   1 
ATOM   9393  C  CD1   . ILE D  1 65  ? -8.852  32.837  14.377  1.00 28.67  ? 206 ILE D CD1   1 
ATOM   9394  N  N     . SER D  1 66  ? -4.572  33.825  12.248  1.00 38.75  ? 207 SER D N     1 
ATOM   9395  C  CA    . SER D  1 66  ? -4.409  34.018  10.804  1.00 35.48  ? 207 SER D CA    1 
ATOM   9396  C  C     . SER D  1 66  ? -3.509  35.195  10.430  1.00 35.60  ? 207 SER D C     1 
ATOM   9397  O  O     . SER D  1 66  ? -2.403  34.998  9.920   1.00 35.30  ? 207 SER D O     1 
ATOM   9398  C  CB    . SER D  1 66  ? -5.767  34.161  10.118  1.00 34.06  ? 207 SER D CB    1 
ATOM   9399  O  OG    . SER D  1 66  ? -6.583  33.042  10.386  1.00 39.01  ? 207 SER D OG    1 
ATOM   9400  N  N     . ALA D  1 67  ? -3.989  36.411  10.679  1.00 35.75  ? 208 ALA D N     1 
ATOM   9401  C  CA    . ALA D  1 67  ? -3.280  37.618  10.267  1.00 36.99  ? 208 ALA D CA    1 
ATOM   9402  C  C     . ALA D  1 67  ? -3.422  38.731  11.290  1.00 35.57  ? 208 ALA D C     1 
ATOM   9403  O  O     . ALA D  1 67  ? -4.405  38.767  12.030  1.00 31.33  ? 208 ALA D O     1 
ATOM   9404  C  CB    . ALA D  1 67  ? -3.789  38.093  8.914   1.00 38.32  ? 208 ALA D CB    1 
ATOM   9405  N  N     . PRO D  1 68  ? -2.436  39.647  11.329  1.00 41.25  ? 209 PRO D N     1 
ATOM   9406  C  CA    . PRO D  1 68  ? -2.505  40.869  12.136  1.00 41.54  ? 209 PRO D CA    1 
ATOM   9407  C  C     . PRO D  1 68  ? -3.306  41.940  11.403  1.00 42.31  ? 209 PRO D C     1 
ATOM   9408  O  O     . PRO D  1 68  ? -2.743  42.960  10.987  1.00 44.51  ? 209 PRO D O     1 
ATOM   9409  C  CB    . PRO D  1 68  ? -1.038  41.310  12.239  1.00 42.86  ? 209 PRO D CB    1 
ATOM   9410  C  CG    . PRO D  1 68  ? -0.219  40.175  11.694  1.00 44.22  ? 209 PRO D CG    1 
ATOM   9411  C  CD    . PRO D  1 68  ? -1.104  39.471  10.727  1.00 43.31  ? 209 PRO D CD    1 
ATOM   9412  N  N     . ASN D  1 69  ? -4.608  41.706  11.267  1.00 39.95  ? 210 ASN D N     1 
ATOM   9413  C  CA    . ASN D  1 69  ? -5.481  42.577  10.492  1.00 40.40  ? 210 ASN D CA    1 
ATOM   9414  C  C     . ASN D  1 69  ? -6.496  43.323  11.355  1.00 37.51  ? 210 ASN D C     1 
ATOM   9415  O  O     . ASN D  1 69  ? -7.268  44.137  10.847  1.00 38.17  ? 210 ASN D O     1 
ATOM   9416  C  CB    . ASN D  1 69  ? -6.212  41.764  9.422   1.00 43.55  ? 210 ASN D CB    1 
ATOM   9417  C  CG    . ASN D  1 69  ? -6.766  40.455  9.964   1.00 44.38  ? 210 ASN D CG    1 
ATOM   9418  O  OD1   . ASN D  1 69  ? -6.739  40.209  11.167  1.00 43.61  ? 210 ASN D OD1   1 
ATOM   9419  N  ND2   . ASN D  1 69  ? -7.278  39.615  9.075   1.00 44.79  ? 210 ASN D ND2   1 
ATOM   9420  N  N     . GLU D  1 70  ? -6.495  43.039  12.655  1.00 35.87  ? 211 GLU D N     1 
ATOM   9421  C  CA    . GLU D  1 70  ? -7.409  43.694  13.586  1.00 34.93  ? 211 GLU D CA    1 
ATOM   9422  C  C     . GLU D  1 70  ? -6.667  44.171  14.827  1.00 34.98  ? 211 GLU D C     1 
ATOM   9423  O  O     . GLU D  1 70  ? -6.079  43.366  15.554  1.00 34.56  ? 211 GLU D O     1 
ATOM   9424  C  CB    . GLU D  1 70  ? -8.531  42.741  14.008  1.00 38.63  ? 211 GLU D CB    1 
ATOM   9425  C  CG    . GLU D  1 70  ? -9.455  42.298  12.887  1.00 42.57  ? 211 GLU D CG    1 
ATOM   9426  C  CD    . GLU D  1 70  ? -10.548 41.365  13.381  1.00 48.61  ? 211 GLU D CD    1 
ATOM   9427  O  OE1   . GLU D  1 70  ? -11.413 40.977  12.567  1.00 46.72  ? 211 GLU D OE1   1 
ATOM   9428  O  OE2   . GLU D  1 70  ? -10.542 41.017  14.584  1.00 52.21  ? 211 GLU D OE2   1 
ATOM   9429  N  N     . PHE D  1 71  ? -6.708  45.477  15.074  1.00 35.04  ? 212 PHE D N     1 
ATOM   9430  C  CA    . PHE D  1 71  ? -6.101  46.056  16.266  1.00 33.86  ? 212 PHE D CA    1 
ATOM   9431  C  C     . PHE D  1 71  ? -7.149  46.851  17.033  1.00 38.21  ? 212 PHE D C     1 
ATOM   9432  O  O     . PHE D  1 71  ? -7.921  47.604  16.437  1.00 38.65  ? 212 PHE D O     1 
ATOM   9433  C  CB    . PHE D  1 71  ? -4.929  46.962  15.885  1.00 35.83  ? 212 PHE D CB    1 
ATOM   9434  C  CG    . PHE D  1 71  ? -3.804  46.242  15.199  1.00 36.47  ? 212 PHE D CG    1 
ATOM   9435  C  CD1   . PHE D  1 71  ? -2.695  45.821  15.918  1.00 34.58  ? 212 PHE D CD1   1 
ATOM   9436  C  CD2   . PHE D  1 71  ? -3.858  45.981  13.837  1.00 36.84  ? 212 PHE D CD2   1 
ATOM   9437  C  CE1   . PHE D  1 71  ? -1.662  45.154  15.296  1.00 35.95  ? 212 PHE D CE1   1 
ATOM   9438  C  CE2   . PHE D  1 71  ? -2.825  45.309  13.205  1.00 37.58  ? 212 PHE D CE2   1 
ATOM   9439  C  CZ    . PHE D  1 71  ? -1.725  44.897  13.937  1.00 37.66  ? 212 PHE D CZ    1 
ATOM   9440  N  N     . ASP D  1 72  ? -7.194  46.670  18.349  1.00 43.13  ? 213 ASP D N     1 
ATOM   9441  C  CA    . ASP D  1 72  ? -8.159  47.384  19.176  1.00 45.55  ? 213 ASP D CA    1 
ATOM   9442  C  C     . ASP D  1 72  ? -7.430  48.331  20.125  1.00 42.75  ? 213 ASP D C     1 
ATOM   9443  O  O     . ASP D  1 72  ? -6.689  47.890  21.010  1.00 46.49  ? 213 ASP D O     1 
ATOM   9444  C  CB    . ASP D  1 72  ? -9.040  46.403  19.962  1.00 49.52  ? 213 ASP D CB    1 
ATOM   9445  C  CG    . ASP D  1 72  ? -9.966  45.588  19.068  1.00 50.92  ? 213 ASP D CG    1 
ATOM   9446  O  OD1   . ASP D  1 72  ? -10.952 45.021  19.585  1.00 55.23  ? 213 ASP D OD1   1 
ATOM   9447  O  OD2   . ASP D  1 72  ? -9.714  45.509  17.852  1.00 46.19  ? 213 ASP D OD2   1 
ATOM   9448  N  N     . VAL D  1 73  ? -7.628  49.633  19.929  1.00 39.98  ? 214 VAL D N     1 
ATOM   9449  C  CA    . VAL D  1 73  ? -6.984  50.631  20.782  1.00 39.06  ? 214 VAL D CA    1 
ATOM   9450  C  C     . VAL D  1 73  ? -7.999  51.496  21.519  1.00 38.55  ? 214 VAL D C     1 
ATOM   9451  O  O     . VAL D  1 73  ? -8.864  52.116  20.902  1.00 39.79  ? 214 VAL D O     1 
ATOM   9452  C  CB    . VAL D  1 73  ? -6.049  51.549  19.987  1.00 39.46  ? 214 VAL D CB    1 
ATOM   9453  C  CG1   . VAL D  1 73  ? -5.280  52.451  20.934  1.00 33.25  ? 214 VAL D CG1   1 
ATOM   9454  C  CG2   . VAL D  1 73  ? -5.093  50.724  19.147  1.00 43.24  ? 214 VAL D CG2   1 
ATOM   9455  N  N     . MET D  1 74  ? -7.881  51.535  22.843  1.00 36.16  ? 215 MET D N     1 
ATOM   9456  C  CA    . MET D  1 74  ? -8.777  52.313  23.691  1.00 32.77  ? 215 MET D CA    1 
ATOM   9457  C  C     . MET D  1 74  ? -8.237  53.715  23.942  1.00 33.33  ? 215 MET D C     1 
ATOM   9458  O  O     . MET D  1 74  ? -7.146  53.879  24.491  1.00 29.99  ? 215 MET D O     1 
ATOM   9459  C  CB    . MET D  1 74  ? -8.970  51.625  25.041  1.00 30.22  ? 215 MET D CB    1 
ATOM   9460  C  CG    . MET D  1 74  ? -10.310 50.934  25.218  1.00 30.55  ? 215 MET D CG    1 
ATOM   9461  S  SD    . MET D  1 74  ? -10.571 50.529  26.955  1.00 39.52  ? 215 MET D SD    1 
ATOM   9462  C  CE    . MET D  1 74  ? -12.241 49.873  26.907  1.00 118.07 ? 215 MET D CE    1 
ATOM   9463  N  N     . PHE D  1 75  ? -8.999  54.719  23.524  1.00 37.42  ? 216 PHE D N     1 
ATOM   9464  C  CA    . PHE D  1 75  ? -8.769  56.090  23.947  1.00 36.77  ? 216 PHE D CA    1 
ATOM   9465  C  C     . PHE D  1 75  ? -9.665  56.338  25.150  1.00 39.08  ? 216 PHE D C     1 
ATOM   9466  O  O     . PHE D  1 75  ? -10.892 56.454  25.014  1.00 40.90  ? 216 PHE D O     1 
ATOM   9467  C  CB    . PHE D  1 75  ? -9.079  57.075  22.819  1.00 33.46  ? 216 PHE D CB    1 
ATOM   9468  C  CG    . PHE D  1 75  ? -7.981  57.194  21.803  1.00 31.28  ? 216 PHE D CG    1 
ATOM   9469  C  CD1   . PHE D  1 75  ? -7.009  56.211  21.694  1.00 33.55  ? 216 PHE D CD1   1 
ATOM   9470  C  CD2   . PHE D  1 75  ? -7.908  58.296  20.968  1.00 31.11  ? 216 PHE D CD2   1 
ATOM   9471  C  CE1   . PHE D  1 75  ? -5.993  56.316  20.761  1.00 30.18  ? 216 PHE D CE1   1 
ATOM   9472  C  CE2   . PHE D  1 75  ? -6.892  58.409  20.034  1.00 29.96  ? 216 PHE D CE2   1 
ATOM   9473  C  CZ    . PHE D  1 75  ? -5.936  57.418  19.932  1.00 31.23  ? 216 PHE D CZ    1 
ATOM   9474  N  N     . LYS D  1 76  ? -9.050  56.388  26.330  1.00 39.12  ? 217 LYS D N     1 
ATOM   9475  C  CA    . LYS D  1 76  ? -9.800  56.497  27.581  1.00 35.56  ? 217 LYS D CA    1 
ATOM   9476  C  C     . LYS D  1 76  ? -9.647  57.883  28.206  1.00 34.41  ? 217 LYS D C     1 
ATOM   9477  O  O     . LYS D  1 76  ? -8.534  58.395  28.351  1.00 37.31  ? 217 LYS D O     1 
ATOM   9478  C  CB    . LYS D  1 76  ? -9.355  55.410  28.564  1.00 33.50  ? 217 LYS D CB    1 
ATOM   9479  C  CG    . LYS D  1 76  ? -7.852  55.405  28.830  1.00 36.44  ? 217 LYS D CG    1 
ATOM   9480  C  CD    . LYS D  1 76  ? -7.439  54.337  29.832  1.00 37.03  ? 217 LYS D CD    1 
ATOM   9481  C  CE    . LYS D  1 76  ? -6.100  54.680  30.477  1.00 34.30  ? 217 LYS D CE    1 
ATOM   9482  N  NZ    . LYS D  1 76  ? -6.186  55.884  31.344  1.00 36.46  ? 217 LYS D NZ    1 
ATOM   9483  N  N     . LEU D  1 77  ? -10.774 58.494  28.555  1.00 35.67  ? 218 LEU D N     1 
ATOM   9484  C  CA    . LEU D  1 77  ? -10.779 59.806  29.193  1.00 37.21  ? 218 LEU D CA    1 
ATOM   9485  C  C     . LEU D  1 77  ? -11.316 59.667  30.613  1.00 38.21  ? 218 LEU D C     1 
ATOM   9486  O  O     . LEU D  1 77  ? -12.466 59.261  30.814  1.00 37.13  ? 218 LEU D O     1 
ATOM   9487  C  CB    . LEU D  1 77  ? -11.632 60.795  28.388  1.00 37.12  ? 218 LEU D CB    1 
ATOM   9488  C  CG    . LEU D  1 77  ? -11.679 62.252  28.859  1.00 33.18  ? 218 LEU D CG    1 
ATOM   9489  C  CD1   . LEU D  1 77  ? -10.292 62.853  28.870  1.00 30.33  ? 218 LEU D CD1   1 
ATOM   9490  C  CD2   . LEU D  1 77  ? -12.589 63.072  27.978  1.00 30.93  ? 218 LEU D CD2   1 
ATOM   9491  N  N     . GLU D  1 78  ? -10.476 59.975  31.597  1.00 37.10  ? 219 GLU D N     1 
ATOM   9492  C  CA    . GLU D  1 78  ? -10.886 59.863  32.990  1.00 39.69  ? 219 GLU D CA    1 
ATOM   9493  C  C     . GLU D  1 78  ? -11.920 60.935  33.287  1.00 43.96  ? 219 GLU D C     1 
ATOM   9494  O  O     . GLU D  1 78  ? -11.685 62.118  33.042  1.00 45.88  ? 219 GLU D O     1 
ATOM   9495  C  CB    . GLU D  1 78  ? -9.690  60.007  33.932  1.00 40.56  ? 219 GLU D CB    1 
ATOM   9496  C  CG    . GLU D  1 78  ? -9.941  59.455  35.333  1.00 43.43  ? 219 GLU D CG    1 
ATOM   9497  C  CD    . GLU D  1 78  ? -9.541  60.422  36.435  1.00 46.96  ? 219 GLU D CD    1 
ATOM   9498  O  OE1   . GLU D  1 78  ? -8.541  61.150  36.258  1.00 49.77  ? 219 GLU D OE1   1 
ATOM   9499  O  OE2   . GLU D  1 78  ? -10.229 60.450  37.479  1.00 42.05  ? 219 GLU D OE2   1 
ATOM   9500  N  N     . VAL D  1 79  ? -13.073 60.519  33.798  1.00 48.22  ? 220 VAL D N     1 
ATOM   9501  C  CA    . VAL D  1 79  ? -14.148 61.456  34.095  1.00 49.61  ? 220 VAL D CA    1 
ATOM   9502  C  C     . VAL D  1 79  ? -14.498 61.396  35.582  1.00 51.08  ? 220 VAL D C     1 
ATOM   9503  O  O     . VAL D  1 79  ? -15.299 60.566  36.011  1.00 51.93  ? 220 VAL D O     1 
ATOM   9504  C  CB    . VAL D  1 79  ? -15.383 61.191  33.209  1.00 47.78  ? 220 VAL D CB    1 
ATOM   9505  C  CG1   . VAL D  1 79  ? -16.415 62.273  33.407  1.00 52.16  ? 220 VAL D CG1   1 
ATOM   9506  C  CG2   . VAL D  1 79  ? -14.978 61.154  31.753  1.00 44.85  ? 220 VAL D CG2   1 
ATOM   9507  N  N     . PRO D  1 80  ? -13.879 62.284  36.376  1.00 53.42  ? 221 PRO D N     1 
ATOM   9508  C  CA    . PRO D  1 80  ? -14.046 62.312  37.834  1.00 54.71  ? 221 PRO D CA    1 
ATOM   9509  C  C     . PRO D  1 80  ? -15.435 62.785  38.233  1.00 56.03  ? 221 PRO D C     1 
ATOM   9510  O  O     . PRO D  1 80  ? -16.119 63.390  37.408  1.00 55.42  ? 221 PRO D O     1 
ATOM   9511  C  CB    . PRO D  1 80  ? -13.003 63.341  38.280  1.00 54.01  ? 221 PRO D CB    1 
ATOM   9512  C  CG    . PRO D  1 80  ? -12.808 64.230  37.090  1.00 53.76  ? 221 PRO D CG    1 
ATOM   9513  C  CD    . PRO D  1 80  ? -12.947 63.325  35.902  1.00 54.00  ? 221 PRO D CD    1 
ATOM   9514  N  N     . ARG D  1 81  ? -15.842 62.491  39.467  1.00 56.03  ? 222 ARG D N     1 
ATOM   9515  C  CA    . ARG D  1 81  ? -17.091 63.003  40.031  1.00 55.06  ? 222 ARG D CA    1 
ATOM   9516  C  C     . ARG D  1 81  ? -18.348 62.696  39.217  1.00 53.50  ? 222 ARG D C     1 
ATOM   9517  O  O     . ARG D  1 81  ? -19.115 63.609  38.897  1.00 56.83  ? 222 ARG D O     1 
ATOM   9518  C  CB    . ARG D  1 81  ? -16.995 64.515  40.248  1.00 57.66  ? 222 ARG D CB    1 
ATOM   9519  C  CG    . ARG D  1 81  ? -16.205 64.929  41.481  1.00 61.53  ? 222 ARG D CG    1 
ATOM   9520  C  CD    . ARG D  1 81  ? -16.156 66.442  41.605  1.00 64.97  ? 222 ARG D CD    1 
ATOM   9521  N  NE    . ARG D  1 81  ? -15.952 66.868  42.986  1.00 67.46  ? 222 ARG D NE    1 
ATOM   9522  C  CZ    . ARG D  1 81  ? -16.939 67.092  43.848  1.00 68.10  ? 222 ARG D CZ    1 
ATOM   9523  N  NH1   . ARG D  1 81  ? -18.201 66.933  43.470  1.00 68.98  ? 222 ARG D NH1   1 
ATOM   9524  N  NH2   . ARG D  1 81  ? -16.669 67.476  45.088  1.00 67.86  ? 222 ARG D NH2   1 
ATOM   9525  N  N     . ILE D  1 82  ? -18.582 61.426  38.899  1.00 49.70  ? 223 ILE D N     1 
ATOM   9526  C  CA    . ILE D  1 82  ? -19.790 61.075  38.152  1.00 50.22  ? 223 ILE D CA    1 
ATOM   9527  C  C     . ILE D  1 82  ? -20.755 60.173  38.912  1.00 45.60  ? 223 ILE D C     1 
ATOM   9528  O  O     . ILE D  1 82  ? -20.360 59.424  39.813  1.00 43.36  ? 223 ILE D O     1 
ATOM   9529  C  CB    . ILE D  1 82  ? -19.469 60.439  36.791  1.00 56.62  ? 223 ILE D CB    1 
ATOM   9530  C  CG1   . ILE D  1 82  ? -18.979 59.001  36.954  1.00 59.31  ? 223 ILE D CG1   1 
ATOM   9531  C  CG2   . ILE D  1 82  ? -18.453 61.278  36.048  1.00 56.86  ? 223 ILE D CG2   1 
ATOM   9532  C  CD1   . ILE D  1 82  ? -18.769 58.298  35.628  1.00 61.18  ? 223 ILE D CD1   1 
ATOM   9533  N  N     . GLU D  1 83  ? -22.025 60.260  38.531  1.00 45.54  ? 224 GLU D N     1 
ATOM   9534  C  CA    . GLU D  1 83  ? -23.090 59.501  39.166  1.00 47.57  ? 224 GLU D CA    1 
ATOM   9535  C  C     . GLU D  1 83  ? -23.709 58.574  38.122  1.00 42.24  ? 224 GLU D C     1 
ATOM   9536  O  O     . GLU D  1 83  ? -24.240 59.033  37.101  1.00 42.42  ? 224 GLU D O     1 
ATOM   9537  C  CB    . GLU D  1 83  ? -24.144 60.456  39.738  1.00 55.56  ? 224 GLU D CB    1 
ATOM   9538  C  CG    . GLU D  1 83  ? -25.135 59.824  40.717  1.00 65.32  ? 224 GLU D CG    1 
ATOM   9539  C  CD    . GLU D  1 83  ? -24.748 60.027  42.177  1.00 71.58  ? 224 GLU D CD    1 
ATOM   9540  O  OE1   . GLU D  1 83  ? -23.632 60.521  42.439  1.00 74.32  ? 224 GLU D OE1   1 
ATOM   9541  O  OE2   . GLU D  1 83  ? -25.564 59.697  43.064  1.00 71.41  ? 224 GLU D OE2   1 
ATOM   9542  N  N     . LEU D  1 84  ? -23.619 57.270  38.373  1.00 39.04  ? 225 LEU D N     1 
ATOM   9543  C  CA    . LEU D  1 84  ? -24.083 56.261  37.422  1.00 39.00  ? 225 LEU D CA    1 
ATOM   9544  C  C     . LEU D  1 84  ? -25.518 55.829  37.706  1.00 37.37  ? 225 LEU D C     1 
ATOM   9545  O  O     . LEU D  1 84  ? -25.856 55.472  38.837  1.00 37.77  ? 225 LEU D O     1 
ATOM   9546  C  CB    . LEU D  1 84  ? -23.161 55.036  37.454  1.00 41.05  ? 225 LEU D CB    1 
ATOM   9547  C  CG    . LEU D  1 84  ? -22.379 54.718  36.177  1.00 38.15  ? 225 LEU D CG    1 
ATOM   9548  C  CD1   . LEU D  1 84  ? -21.523 55.896  35.790  1.00 36.73  ? 225 LEU D CD1   1 
ATOM   9549  C  CD2   . LEU D  1 84  ? -21.521 53.469  36.332  1.00 34.44  ? 225 LEU D CD2   1 
ATOM   9550  N  N     . GLN D  1 85  ? -26.358 55.856  36.676  1.00 38.43  ? 226 GLN D N     1 
ATOM   9551  C  CA    . GLN D  1 85  ? -27.742 55.416  36.817  1.00 39.49  ? 226 GLN D CA    1 
ATOM   9552  C  C     . GLN D  1 85  ? -27.993 54.183  35.960  1.00 35.67  ? 226 GLN D C     1 
ATOM   9553  O  O     . GLN D  1 85  ? -28.088 54.284  34.744  1.00 35.89  ? 226 GLN D O     1 
ATOM   9554  C  CB    . GLN D  1 85  ? -28.706 56.535  36.416  1.00 43.40  ? 226 GLN D CB    1 
ATOM   9555  C  CG    . GLN D  1 85  ? -30.178 56.187  36.592  1.00 45.41  ? 226 GLN D CG    1 
ATOM   9556  C  CD    . GLN D  1 85  ? -31.100 57.304  36.145  1.00 50.02  ? 226 GLN D CD    1 
ATOM   9557  O  OE1   . GLN D  1 85  ? -30.726 58.149  35.328  1.00 53.35  ? 226 GLN D OE1   1 
ATOM   9558  N  NE2   . GLN D  1 85  ? -32.313 57.314  36.678  1.00 50.31  ? 226 GLN D NE2   1 
ATOM   9559  N  N     . GLU D  1 86  ? -28.109 53.025  36.599  1.00 35.81  ? 227 GLU D N     1 
ATOM   9560  C  CA    . GLU D  1 86  ? -28.306 51.773  35.881  1.00 41.43  ? 227 GLU D CA    1 
ATOM   9561  C  C     . GLU D  1 86  ? -29.523 51.836  34.969  1.00 47.72  ? 227 GLU D C     1 
ATOM   9562  O  O     . GLU D  1 86  ? -30.635 52.106  35.417  1.00 52.60  ? 227 GLU D O     1 
ATOM   9563  C  CB    . GLU D  1 86  ? -28.442 50.611  36.863  1.00 43.89  ? 227 GLU D CB    1 
ATOM   9564  C  CG    . GLU D  1 86  ? -28.605 49.256  36.197  1.00 44.92  ? 227 GLU D CG    1 
ATOM   9565  C  CD    . GLU D  1 86  ? -28.761 48.135  37.203  1.00 47.17  ? 227 GLU D CD    1 
ATOM   9566  O  OE1   . GLU D  1 86  ? -28.406 48.336  38.384  1.00 45.55  ? 227 GLU D OE1   1 
ATOM   9567  O  OE2   . GLU D  1 86  ? -29.238 47.052  36.810  1.00 49.50  ? 227 GLU D OE2   1 
ATOM   9568  N  N     . TYR D  1 87  ? -29.293 51.603  33.682  1.00 51.27  ? 228 TYR D N     1 
ATOM   9569  C  CA    . TYR D  1 87  ? -30.359 51.598  32.689  1.00 52.74  ? 228 TYR D CA    1 
ATOM   9570  C  C     . TYR D  1 87  ? -31.199 50.345  32.866  1.00 53.85  ? 228 TYR D C     1 
ATOM   9571  O  O     . TYR D  1 87  ? -30.897 49.300  32.285  1.00 53.30  ? 228 TYR D O     1 
ATOM   9572  C  CB    . TYR D  1 87  ? -29.765 51.662  31.283  1.00 55.14  ? 228 TYR D CB    1 
ATOM   9573  C  CG    . TYR D  1 87  ? -30.777 51.654  30.165  1.00 59.79  ? 228 TYR D CG    1 
ATOM   9574  C  CD1   . TYR D  1 87  ? -31.715 52.668  30.041  1.00 62.05  ? 228 TYR D CD1   1 
ATOM   9575  C  CD2   . TYR D  1 87  ? -30.776 50.644  29.213  1.00 62.85  ? 228 TYR D CD2   1 
ATOM   9576  C  CE1   . TYR D  1 87  ? -32.641 52.666  29.011  1.00 64.81  ? 228 TYR D CE1   1 
ATOM   9577  C  CE2   . TYR D  1 87  ? -31.693 50.636  28.178  1.00 65.95  ? 228 TYR D CE2   1 
ATOM   9578  C  CZ    . TYR D  1 87  ? -32.625 51.649  28.082  1.00 67.37  ? 228 TYR D CZ    1 
ATOM   9579  O  OH    . TYR D  1 87  ? -33.543 51.645  27.054  1.00 69.18  ? 228 TYR D OH    1 
ATOM   9580  N  N     . TYR D  1 88  ? -32.245 50.477  33.682  1.00 59.25  ? 229 TYR D N     1 
ATOM   9581  C  CA    . TYR D  1 88  ? -33.122 49.373  34.079  1.00 60.59  ? 229 TYR D CA    1 
ATOM   9582  C  C     . TYR D  1 88  ? -32.404 48.376  34.978  1.00 56.72  ? 229 TYR D C     1 
ATOM   9583  O  O     . TYR D  1 88  ? -31.696 48.765  35.905  1.00 56.91  ? 229 TYR D O     1 
ATOM   9584  C  CB    . TYR D  1 88  ? -33.738 48.678  32.861  1.00 65.14  ? 229 TYR D CB    1 
ATOM   9585  C  CG    . TYR D  1 88  ? -34.564 49.605  32.003  1.00 69.76  ? 229 TYR D CG    1 
ATOM   9586  C  CD1   . TYR D  1 88  ? -35.427 50.527  32.580  1.00 70.89  ? 229 TYR D CD1   1 
ATOM   9587  C  CD2   . TYR D  1 88  ? -34.474 49.571  30.619  1.00 72.04  ? 229 TYR D CD2   1 
ATOM   9588  C  CE1   . TYR D  1 88  ? -36.184 51.381  31.803  1.00 72.78  ? 229 TYR D CE1   1 
ATOM   9589  C  CE2   . TYR D  1 88  ? -35.228 50.425  29.834  1.00 73.28  ? 229 TYR D CE2   1 
ATOM   9590  C  CZ    . TYR D  1 88  ? -36.081 51.325  30.430  1.00 73.72  ? 229 TYR D CZ    1 
ATOM   9591  O  OH    . TYR D  1 88  ? -36.832 52.175  29.653  1.00 74.81  ? 229 TYR D OH    1 
ATOM   9592  N  N     . GLU D  1 89  ? -32.597 47.092  34.711  1.00 55.38  ? 230 GLU D N     1 
ATOM   9593  C  CA    . GLU D  1 89  ? -31.966 46.058  35.513  1.00 56.07  ? 230 GLU D CA    1 
ATOM   9594  C  C     . GLU D  1 89  ? -31.109 45.193  34.609  1.00 54.13  ? 230 GLU D C     1 
ATOM   9595  O  O     . GLU D  1 89  ? -30.961 43.990  34.817  1.00 51.51  ? 230 GLU D O     1 
ATOM   9596  C  CB    . GLU D  1 89  ? -33.024 45.232  36.236  1.00 60.82  ? 230 GLU D CB    1 
ATOM   9597  C  CG    . GLU D  1 89  ? -33.844 46.049  37.216  1.00 65.67  ? 230 GLU D CG    1 
ATOM   9598  C  CD    . GLU D  1 89  ? -34.956 45.254  37.855  1.00 72.25  ? 230 GLU D CD    1 
ATOM   9599  O  OE1   . GLU D  1 89  ? -35.659 45.811  38.723  1.00 72.97  ? 230 GLU D OE1   1 
ATOM   9600  O  OE2   . GLU D  1 89  ? -35.132 44.073  37.488  1.00 74.99  ? 230 GLU D OE2   1 
ATOM   9601  N  N     . THR D  1 90  ? -30.547 45.839  33.594  1.00 57.58  ? 231 THR D N     1 
ATOM   9602  C  CA    . THR D  1 90  ? -29.688 45.189  32.618  1.00 57.24  ? 231 THR D CA    1 
ATOM   9603  C  C     . THR D  1 90  ? -28.363 44.772  33.244  1.00 55.89  ? 231 THR D C     1 
ATOM   9604  O  O     . THR D  1 90  ? -27.828 43.705  32.935  1.00 56.98  ? 231 THR D O     1 
ATOM   9605  C  CB    . THR D  1 90  ? -29.412 46.121  31.427  1.00 58.50  ? 231 THR D CB    1 
ATOM   9606  O  OG1   . THR D  1 90  ? -29.028 47.416  31.909  1.00 58.64  ? 231 THR D OG1   1 
ATOM   9607  C  CG2   . THR D  1 90  ? -30.653 46.268  30.573  1.00 57.99  ? 231 THR D CG2   1 
ATOM   9608  N  N     . GLY D  1 91  ? -27.836 45.621  34.121  1.00 52.80  ? 232 GLY D N     1 
ATOM   9609  C  CA    . GLY D  1 91  ? -26.598 45.326  34.819  1.00 48.07  ? 232 GLY D CA    1 
ATOM   9610  C  C     . GLY D  1 91  ? -25.382 45.850  34.084  1.00 44.76  ? 232 GLY D C     1 
ATOM   9611  O  O     . GLY D  1 91  ? -24.392 46.240  34.705  1.00 42.91  ? 232 GLY D O     1 
ATOM   9612  N  N     . ALA D  1 92  ? -25.460 45.867  32.756  1.00 40.36  ? 233 ALA D N     1 
ATOM   9613  C  CA    . ALA D  1 92  ? -24.330 46.267  31.931  1.00 39.73  ? 233 ALA D CA    1 
ATOM   9614  C  C     . ALA D  1 92  ? -24.480 47.678  31.379  1.00 41.11  ? 233 ALA D C     1 
ATOM   9615  O  O     . ALA D  1 92  ? -23.487 48.316  31.034  1.00 45.23  ? 233 ALA D O     1 
ATOM   9616  C  CB    . ALA D  1 92  ? -24.134 45.280  30.798  1.00 37.30  ? 233 ALA D CB    1 
ATOM   9617  N  N     . PHE D  1 93  ? -25.714 48.162  31.281  1.00 39.98  ? 234 PHE D N     1 
ATOM   9618  C  CA    . PHE D  1 93  ? -25.954 49.458  30.651  1.00 39.87  ? 234 PHE D CA    1 
ATOM   9619  C  C     . PHE D  1 93  ? -26.288 50.567  31.657  1.00 37.52  ? 234 PHE D C     1 
ATOM   9620  O  O     . PHE D  1 93  ? -27.008 50.342  32.633  1.00 30.74  ? 234 PHE D O     1 
ATOM   9621  C  CB    . PHE D  1 93  ? -27.029 49.326  29.574  1.00 37.75  ? 234 PHE D CB    1 
ATOM   9622  C  CG    . PHE D  1 93  ? -26.775 48.201  28.611  1.00 33.24  ? 234 PHE D CG    1 
ATOM   9623  C  CD1   . PHE D  1 93  ? -25.827 48.330  27.611  1.00 34.85  ? 234 PHE D CD1   1 
ATOM   9624  C  CD2   . PHE D  1 93  ? -27.477 47.012  28.712  1.00 32.36  ? 234 PHE D CD2   1 
ATOM   9625  C  CE1   . PHE D  1 93  ? -25.585 47.291  26.729  1.00 36.36  ? 234 PHE D CE1   1 
ATOM   9626  C  CE2   . PHE D  1 93  ? -27.239 45.971  27.838  1.00 33.30  ? 234 PHE D CE2   1 
ATOM   9627  C  CZ    . PHE D  1 93  ? -26.296 46.110  26.845  1.00 34.50  ? 234 PHE D CZ    1 
ATOM   9628  N  N     . TYR D  1 94  ? -25.740 51.757  31.418  1.00 35.53  ? 235 TYR D N     1 
ATOM   9629  C  CA    . TYR D  1 94  ? -25.794 52.845  32.390  1.00 39.35  ? 235 TYR D CA    1 
ATOM   9630  C  C     . TYR D  1 94  ? -25.957 54.214  31.742  1.00 40.13  ? 235 TYR D C     1 
ATOM   9631  O  O     . TYR D  1 94  ? -25.563 54.425  30.598  1.00 41.21  ? 235 TYR D O     1 
ATOM   9632  C  CB    . TYR D  1 94  ? -24.530 52.844  33.261  1.00 43.13  ? 235 TYR D CB    1 
ATOM   9633  C  CG    . TYR D  1 94  ? -24.439 51.651  34.178  1.00 44.14  ? 235 TYR D CG    1 
ATOM   9634  C  CD1   . TYR D  1 94  ? -24.854 51.732  35.494  1.00 42.22  ? 235 TYR D CD1   1 
ATOM   9635  C  CD2   . TYR D  1 94  ? -23.951 50.438  33.721  1.00 45.51  ? 235 TYR D CD2   1 
ATOM   9636  C  CE1   . TYR D  1 94  ? -24.789 50.641  36.325  1.00 45.37  ? 235 TYR D CE1   1 
ATOM   9637  C  CE2   . TYR D  1 94  ? -23.885 49.342  34.543  1.00 45.43  ? 235 TYR D CE2   1 
ATOM   9638  C  CZ    . TYR D  1 94  ? -24.302 49.446  35.843  1.00 46.13  ? 235 TYR D CZ    1 
ATOM   9639  O  OH    . TYR D  1 94  ? -24.228 48.345  36.664  1.00 49.60  ? 235 TYR D OH    1 
ATOM   9640  N  N     . LEU D  1 95  ? -26.552 55.135  32.491  1.00 39.17  ? 236 LEU D N     1 
ATOM   9641  C  CA    . LEU D  1 95  ? -26.618 56.537  32.112  1.00 37.28  ? 236 LEU D CA    1 
ATOM   9642  C  C     . LEU D  1 95  ? -25.611 57.266  32.987  1.00 32.80  ? 236 LEU D C     1 
ATOM   9643  O  O     . LEU D  1 95  ? -25.401 56.883  34.138  1.00 27.80  ? 236 LEU D O     1 
ATOM   9644  C  CB    . LEU D  1 95  ? -28.025 57.089  32.330  1.00 36.44  ? 236 LEU D CB    1 
ATOM   9645  C  CG    . LEU D  1 95  ? -28.936 57.147  31.106  1.00 38.88  ? 236 LEU D CG    1 
ATOM   9646  C  CD1   . LEU D  1 95  ? -28.802 55.898  30.268  1.00 40.12  ? 236 LEU D CD1   1 
ATOM   9647  C  CD2   . LEU D  1 95  ? -30.381 57.335  31.526  1.00 40.92  ? 236 LEU D CD2   1 
ATOM   9648  N  N     . VAL D  1 96  ? -24.968 58.293  32.442  1.00 37.11  ? 237 VAL D N     1 
ATOM   9649  C  CA    . VAL D  1 96  ? -23.909 58.983  33.174  1.00 43.92  ? 237 VAL D CA    1 
ATOM   9650  C  C     . VAL D  1 96  ? -24.259 60.436  33.459  1.00 49.45  ? 237 VAL D C     1 
ATOM   9651  O  O     . VAL D  1 96  ? -24.412 61.240  32.536  1.00 54.52  ? 237 VAL D O     1 
ATOM   9652  C  CB    . VAL D  1 96  ? -22.573 58.933  32.416  1.00 42.01  ? 237 VAL D CB    1 
ATOM   9653  C  CG1   . VAL D  1 96  ? -21.511 59.720  33.166  1.00 43.69  ? 237 VAL D CG1   1 
ATOM   9654  C  CG2   . VAL D  1 96  ? -22.129 57.497  32.227  1.00 40.15  ? 237 VAL D CG2   1 
ATOM   9655  N  N     . LYS D  1 97  ? -24.377 60.774  34.738  1.00 48.61  ? 238 LYS D N     1 
ATOM   9656  C  CA    . LYS D  1 97  ? -24.688 62.146  35.120  1.00 49.50  ? 238 LYS D CA    1 
ATOM   9657  C  C     . LYS D  1 97  ? -23.506 62.740  35.870  1.00 54.06  ? 238 LYS D C     1 
ATOM   9658  O  O     . LYS D  1 97  ? -22.621 62.013  36.321  1.00 52.44  ? 238 LYS D O     1 
ATOM   9659  C  CB    . LYS D  1 97  ? -25.943 62.183  35.988  1.00 47.68  ? 238 LYS D CB    1 
ATOM   9660  C  CG    . LYS D  1 97  ? -26.943 61.091  35.649  1.00 50.98  ? 238 LYS D CG    1 
ATOM   9661  C  CD    . LYS D  1 97  ? -28.123 61.081  36.607  1.00 54.79  ? 238 LYS D CD    1 
ATOM   9662  C  CE    . LYS D  1 97  ? -29.151 62.138  36.241  1.00 58.63  ? 238 LYS D CE    1 
ATOM   9663  N  NZ    . LYS D  1 97  ? -30.324 62.115  37.161  1.00 58.99  ? 238 LYS D NZ    1 
ATOM   9664  N  N     . PHE D  1 98  ? -23.485 64.060  36.002  1.00 61.75  ? 239 PHE D N     1 
ATOM   9665  C  CA    . PHE D  1 98  ? -22.410 64.713  36.738  1.00 71.21  ? 239 PHE D CA    1 
ATOM   9666  C  C     . PHE D  1 98  ? -22.887 65.247  38.090  1.00 75.55  ? 239 PHE D C     1 
ATOM   9667  O  O     . PHE D  1 98  ? -24.066 65.567  38.265  1.00 76.87  ? 239 PHE D O     1 
ATOM   9668  C  CB    . PHE D  1 98  ? -21.791 65.834  35.905  1.00 74.91  ? 239 PHE D CB    1 
ATOM   9669  C  CG    . PHE D  1 98  ? -20.974 65.344  34.746  1.00 76.23  ? 239 PHE D CG    1 
ATOM   9670  C  CD1   . PHE D  1 98  ? -19.592 65.291  34.834  1.00 77.32  ? 239 PHE D CD1   1 
ATOM   9671  C  CD2   . PHE D  1 98  ? -21.583 64.936  33.571  1.00 77.47  ? 239 PHE D CD2   1 
ATOM   9672  C  CE1   . PHE D  1 98  ? -18.832 64.843  33.769  1.00 77.98  ? 239 PHE D CE1   1 
ATOM   9673  C  CE2   . PHE D  1 98  ? -20.829 64.485  32.502  1.00 77.55  ? 239 PHE D CE2   1 
ATOM   9674  C  CZ    . PHE D  1 98  ? -19.451 64.438  32.601  1.00 77.98  ? 239 PHE D CZ    1 
ATOM   9675  N  N     . LYS D  1 99  ? -21.964 65.329  39.044  1.00 90.01  ? 240 LYS D N     1 
ATOM   9676  C  CA    . LYS D  1 99  ? -22.282 65.835  40.372  1.00 92.14  ? 240 LYS D CA    1 
ATOM   9677  C  C     . LYS D  1 99  ? -22.249 67.352  40.383  1.00 99.64  ? 240 LYS D C     1 
ATOM   9678  O  O     . LYS D  1 99  ? -23.267 68.004  40.618  1.00 98.41  ? 240 LYS D O     1 
ATOM   9679  C  CB    . LYS D  1 99  ? -21.292 65.296  41.405  1.00 86.96  ? 240 LYS D CB    1 
ATOM   9680  C  CG    . LYS D  1 99  ? -21.372 63.796  41.625  1.00 83.93  ? 240 LYS D CG    1 
ATOM   9681  C  CD    . LYS D  1 99  ? -20.286 63.329  42.581  1.00 81.60  ? 240 LYS D CD    1 
ATOM   9682  C  CE    . LYS D  1 99  ? -20.360 61.831  42.815  1.00 79.17  ? 240 LYS D CE    1 
ATOM   9683  N  NZ    . LYS D  1 99  ? -19.163 61.324  43.544  1.00 77.45  ? 240 LYS D NZ    1 
ATOM   9684  N  N     . ARG D  1 100 ? -21.071 67.910  40.125  1.00 108.30 ? 241 ARG D N     1 
ATOM   9685  C  CA    . ARG D  1 100 ? -20.886 69.352  40.189  1.00 117.08 ? 241 ARG D CA    1 
ATOM   9686  C  C     . ARG D  1 100 ? -20.054 69.891  39.036  1.00 122.40 ? 241 ARG D C     1 
ATOM   9687  O  O     . ARG D  1 100 ? -18.827 69.900  39.115  1.00 123.00 ? 241 ARG D O     1 
ATOM   9688  C  CB    . ARG D  1 100 ? -20.200 69.737  41.499  1.00 119.80 ? 241 ARG D CB    1 
ATOM   9689  C  CG    . ARG D  1 100 ? -21.022 69.494  42.744  1.00 122.55 ? 241 ARG D CG    1 
ATOM   9690  C  CD    . ARG D  1 100 ? -20.267 69.990  43.959  1.00 124.56 ? 241 ARG D CD    1 
ATOM   9691  N  NE    . ARG D  1 100 ? -20.992 69.769  45.205  1.00 125.54 ? 241 ARG D NE    1 
ATOM   9692  C  CZ    . ARG D  1 100 ? -20.513 70.089  46.401  1.00 125.81 ? 241 ARG D CZ    1 
ATOM   9693  N  NH1   . ARG D  1 100 ? -19.311 70.640  46.503  1.00 125.70 ? 241 ARG D NH1   1 
ATOM   9694  N  NH2   . ARG D  1 100 ? -21.229 69.857  47.492  1.00 125.95 ? 241 ARG D NH2   1 
ATOM   9695  N  N     . ILE D  1 101 ? -20.717 70.348  37.976  1.00 126.49 ? 242 ILE D N     1 
ATOM   9696  C  CA    . ILE D  1 101 ? -20.029 71.076  36.913  1.00 129.45 ? 242 ILE D CA    1 
ATOM   9697  C  C     . ILE D  1 101 ? -19.408 72.341  37.507  1.00 131.71 ? 242 ILE D C     1 
ATOM   9698  O  O     . ILE D  1 101 ? -20.121 73.260  37.913  1.00 132.22 ? 242 ILE D O     1 
ATOM   9699  C  CB    . ILE D  1 101 ? -20.975 71.404  35.725  1.00 115.95 ? 242 ILE D CB    1 
ATOM   9700  C  CG1   . ILE D  1 101 ? -20.372 72.486  34.824  1.00 115.73 ? 242 ILE D CG1   1 
ATOM   9701  C  CG2   . ILE D  1 101 ? -22.358 71.812  36.218  1.00 116.42 ? 242 ILE D CG2   1 
ATOM   9702  C  CD1   . ILE D  1 101 ? -21.266 72.903  33.669  1.00 115.63 ? 242 ILE D CD1   1 
ATOM   9703  N  N     . PRO D  1 102 ? -18.068 72.378  37.587  1.00 132.62 ? 243 PRO D N     1 
ATOM   9704  C  CA    . PRO D  1 102 ? -17.382 73.447  38.319  1.00 133.32 ? 243 PRO D CA    1 
ATOM   9705  C  C     . PRO D  1 102 ? -17.047 74.658  37.456  1.00 132.88 ? 243 PRO D C     1 
ATOM   9706  O  O     . PRO D  1 102 ? -16.686 75.706  37.996  1.00 133.82 ? 243 PRO D O     1 
ATOM   9707  C  CB    . PRO D  1 102 ? -16.088 72.767  38.758  1.00 133.82 ? 243 PRO D CB    1 
ATOM   9708  C  CG    . PRO D  1 102 ? -15.779 71.839  37.622  1.00 133.48 ? 243 PRO D CG    1 
ATOM   9709  C  CD    . PRO D  1 102 ? -17.115 71.388  37.052  1.00 132.84 ? 243 PRO D CD    1 
ATOM   9710  N  N     . ARG D  1 103 ? -17.169 74.511  36.140  1.00 131.03 ? 244 ARG D N     1 
ATOM   9711  C  CA    . ARG D  1 103 ? -16.723 75.531  35.197  1.00 127.97 ? 244 ARG D CA    1 
ATOM   9712  C  C     . ARG D  1 103 ? -17.124 75.146  33.780  1.00 123.32 ? 244 ARG D C     1 
ATOM   9713  O  O     . ARG D  1 103 ? -18.111 74.440  33.570  1.00 122.46 ? 244 ARG D O     1 
ATOM   9714  C  CB    . ARG D  1 103 ? -15.201 75.663  35.257  1.00 127.88 ? 244 ARG D CB    1 
ATOM   9715  C  CG    . ARG D  1 103 ? -14.486 74.324  35.154  1.00 127.59 ? 244 ARG D CG    1 
ATOM   9716  C  CD    . ARG D  1 103 ? -13.056 74.468  34.665  1.00 127.53 ? 244 ARG D CD    1 
ATOM   9717  N  NE    . ARG D  1 103 ? -12.462 73.163  34.393  1.00 126.77 ? 244 ARG D NE    1 
ATOM   9718  C  CZ    . ARG D  1 103 ? -12.535 72.545  33.219  1.00 125.75 ? 244 ARG D CZ    1 
ATOM   9719  N  NH1   . ARG D  1 103 ? -13.170 73.119  32.207  1.00 125.31 ? 244 ARG D NH1   1 
ATOM   9720  N  NH2   . ARG D  1 103 ? -11.971 71.357  33.054  1.00 125.29 ? 244 ARG D NH2   1 
ATOM   9721  N  N     . GLY D  1 104 ? -16.342 75.601  32.807  1.00 119.15 ? 245 GLY D N     1 
ATOM   9722  C  CA    . GLY D  1 104 ? -16.543 75.204  31.427  1.00 114.44 ? 245 GLY D CA    1 
ATOM   9723  C  C     . GLY D  1 104 ? -16.005 73.811  31.153  1.00 108.77 ? 245 GLY D C     1 
ATOM   9724  O  O     . GLY D  1 104 ? -15.148 73.634  30.285  1.00 109.62 ? 245 GLY D O     1 
ATOM   9725  N  N     . ASN D  1 105 ? -16.499 72.835  31.915  1.00 101.48 ? 246 ASN D N     1 
ATOM   9726  C  CA    . ASN D  1 105 ? -16.191 71.419  31.724  1.00 93.04  ? 246 ASN D CA    1 
ATOM   9727  C  C     . ASN D  1 105 ? -16.241 71.053  30.246  1.00 85.24  ? 246 ASN D C     1 
ATOM   9728  O  O     . ASN D  1 105 ? -17.285 71.180  29.613  1.00 88.10  ? 246 ASN D O     1 
ATOM   9729  C  CB    . ASN D  1 105 ? -17.183 70.578  32.540  1.00 91.89  ? 246 ASN D CB    1 
ATOM   9730  C  CG    . ASN D  1 105 ? -17.129 69.093  32.213  1.00 90.50  ? 246 ASN D CG    1 
ATOM   9731  O  OD1   . ASN D  1 105 ? -16.102 68.562  31.788  1.00 90.80  ? 246 ASN D OD1   1 
ATOM   9732  N  ND2   . ASN D  1 105 ? -18.248 68.411  32.429  1.00 88.74  ? 246 ASN D ND2   1 
ATOM   9733  N  N     . PRO D  1 106 ? -15.095 70.625  29.688  1.00 73.92  ? 247 PRO D N     1 
ATOM   9734  C  CA    . PRO D  1 106 ? -14.954 70.355  28.253  1.00 68.85  ? 247 PRO D CA    1 
ATOM   9735  C  C     . PRO D  1 106 ? -16.042 69.437  27.699  1.00 65.38  ? 247 PRO D C     1 
ATOM   9736  O  O     . PRO D  1 106 ? -16.311 69.476  26.498  1.00 66.13  ? 247 PRO D O     1 
ATOM   9737  C  CB    . PRO D  1 106 ? -13.588 69.674  28.165  1.00 68.26  ? 247 PRO D CB    1 
ATOM   9738  C  CG    . PRO D  1 106 ? -12.818 70.258  29.299  1.00 68.03  ? 247 PRO D CG    1 
ATOM   9739  C  CD    . PRO D  1 106 ? -13.823 70.429  30.409  1.00 70.71  ? 247 PRO D CD    1 
ATOM   9740  N  N     . LEU D  1 107 ? -16.661 68.637  28.564  1.00 61.41  ? 248 LEU D N     1 
ATOM   9741  C  CA    . LEU D  1 107 ? -17.729 67.733  28.150  1.00 57.36  ? 248 LEU D CA    1 
ATOM   9742  C  C     . LEU D  1 107 ? -19.124 68.333  28.343  1.00 61.62  ? 248 LEU D C     1 
ATOM   9743  O  O     . LEU D  1 107 ? -20.123 67.624  28.221  1.00 64.63  ? 248 LEU D O     1 
ATOM   9744  C  CB    . LEU D  1 107 ? -17.641 66.405  28.907  1.00 52.29  ? 248 LEU D CB    1 
ATOM   9745  C  CG    . LEU D  1 107 ? -16.342 65.598  28.851  1.00 48.88  ? 248 LEU D CG    1 
ATOM   9746  C  CD1   . LEU D  1 107 ? -16.568 64.187  29.376  1.00 45.13  ? 248 LEU D CD1   1 
ATOM   9747  C  CD2   . LEU D  1 107 ? -15.763 65.568  27.448  1.00 49.87  ? 248 LEU D CD2   1 
ATOM   9748  N  N     . SER D  1 108 ? -19.197 69.628  28.643  1.00 64.12  ? 249 SER D N     1 
ATOM   9749  C  CA    . SER D  1 108 ? -20.486 70.294  28.833  1.00 65.40  ? 249 SER D CA    1 
ATOM   9750  C  C     . SER D  1 108 ? -21.258 70.387  27.523  1.00 64.25  ? 249 SER D C     1 
ATOM   9751  O  O     . SER D  1 108 ? -22.481 70.521  27.521  1.00 63.54  ? 249 SER D O     1 
ATOM   9752  C  CB    . SER D  1 108 ? -20.297 71.695  29.416  1.00 67.28  ? 249 SER D CB    1 
ATOM   9753  O  OG    . SER D  1 108 ? -19.654 71.643  30.676  1.00 69.25  ? 249 SER D OG    1 
ATOM   9754  N  N     . HIS D  1 109 ? -20.532 70.317  26.413  1.00 64.20  ? 250 HIS D N     1 
ATOM   9755  C  CA    . HIS D  1 109 ? -21.132 70.420  25.093  1.00 66.14  ? 250 HIS D CA    1 
ATOM   9756  C  C     . HIS D  1 109 ? -21.814 69.109  24.702  1.00 59.83  ? 250 HIS D C     1 
ATOM   9757  O  O     . HIS D  1 109 ? -22.593 69.060  23.749  1.00 57.74  ? 250 HIS D O     1 
ATOM   9758  C  CB    . HIS D  1 109 ? -20.064 70.799  24.065  1.00 72.90  ? 250 HIS D CB    1 
ATOM   9759  C  CG    . HIS D  1 109 ? -19.164 71.911  24.511  1.00 81.52  ? 250 HIS D CG    1 
ATOM   9760  N  ND1   . HIS D  1 109 ? -18.086 71.706  25.346  1.00 84.77  ? 250 HIS D ND1   1 
ATOM   9761  C  CD2   . HIS D  1 109 ? -19.182 73.237  24.239  1.00 84.13  ? 250 HIS D CD2   1 
ATOM   9762  C  CE1   . HIS D  1 109 ? -17.479 72.859  25.569  1.00 85.57  ? 250 HIS D CE1   1 
ATOM   9763  N  NE2   . HIS D  1 109 ? -18.125 73.804  24.909  1.00 84.96  ? 250 HIS D NE2   1 
ATOM   9764  N  N     . PHE D  1 110 ? -21.515 68.055  25.453  1.00 56.98  ? 251 PHE D N     1 
ATOM   9765  C  CA    . PHE D  1 110 ? -22.090 66.737  25.224  1.00 52.07  ? 251 PHE D CA    1 
ATOM   9766  C  C     . PHE D  1 110 ? -23.155 66.455  26.275  1.00 49.01  ? 251 PHE D C     1 
ATOM   9767  O  O     . PHE D  1 110 ? -23.787 65.399  26.271  1.00 48.62  ? 251 PHE D O     1 
ATOM   9768  C  CB    . PHE D  1 110 ? -20.991 65.678  25.271  1.00 51.42  ? 251 PHE D CB    1 
ATOM   9769  C  CG    . PHE D  1 110 ? -19.861 65.944  24.319  1.00 44.52  ? 251 PHE D CG    1 
ATOM   9770  C  CD1   . PHE D  1 110 ? -20.114 66.420  23.041  1.00 41.06  ? 251 PHE D CD1   1 
ATOM   9771  C  CD2   . PHE D  1 110 ? -18.546 65.733  24.705  1.00 43.39  ? 251 PHE D CD2   1 
ATOM   9772  C  CE1   . PHE D  1 110 ? -19.077 66.672  22.161  1.00 40.65  ? 251 PHE D CE1   1 
ATOM   9773  C  CE2   . PHE D  1 110 ? -17.506 65.982  23.830  1.00 43.52  ? 251 PHE D CE2   1 
ATOM   9774  C  CZ    . PHE D  1 110 ? -17.771 66.454  22.558  1.00 41.84  ? 251 PHE D CZ    1 
ATOM   9775  N  N     . LEU D  1 111 ? -23.344 67.418  27.171  1.00 49.85  ? 252 LEU D N     1 
ATOM   9776  C  CA    . LEU D  1 111 ? -24.401 67.360  28.172  1.00 54.54  ? 252 LEU D CA    1 
ATOM   9777  C  C     . LEU D  1 111 ? -25.758 67.702  27.570  1.00 58.40  ? 252 LEU D C     1 
ATOM   9778  O  O     . LEU D  1 111 ? -25.854 68.527  26.659  1.00 58.91  ? 252 LEU D O     1 
ATOM   9779  C  CB    . LEU D  1 111 ? -24.109 68.335  29.315  1.00 57.13  ? 252 LEU D CB    1 
ATOM   9780  C  CG    . LEU D  1 111 ? -23.072 67.941  30.362  1.00 59.17  ? 252 LEU D CG    1 
ATOM   9781  C  CD1   . LEU D  1 111 ? -22.895 69.057  31.379  1.00 58.41  ? 252 LEU D CD1   1 
ATOM   9782  C  CD2   . LEU D  1 111 ? -23.498 66.661  31.048  1.00 60.22  ? 252 LEU D CD2   1 
ATOM   9783  N  N     . GLU D  1 112 ? -26.802 67.061  28.085  1.00 59.61  ? 253 GLU D N     1 
ATOM   9784  C  CA    . GLU D  1 112 ? -28.174 67.448  27.777  1.00 61.19  ? 253 GLU D CA    1 
ATOM   9785  C  C     . GLU D  1 112 ? -29.072 67.167  28.982  1.00 65.01  ? 253 GLU D C     1 
ATOM   9786  O  O     . GLU D  1 112 ? -29.818 66.185  29.009  1.00 65.22  ? 253 GLU D O     1 
ATOM   9787  C  CB    . GLU D  1 112 ? -28.690 66.769  26.497  1.00 58.52  ? 253 GLU D CB    1 
ATOM   9788  C  CG    . GLU D  1 112 ? -28.328 65.298  26.339  1.00 55.92  ? 253 GLU D CG    1 
ATOM   9789  C  CD    . GLU D  1 112 ? -28.864 64.699  25.052  1.00 56.79  ? 253 GLU D CD    1 
ATOM   9790  O  OE1   . GLU D  1 112 ? -28.063 64.156  24.267  1.00 58.92  ? 253 GLU D OE1   1 
ATOM   9791  O  OE2   . GLU D  1 112 ? -30.090 64.760  24.828  1.00 56.32  ? 253 GLU D OE2   1 
ATOM   9792  N  N     . GLY D  1 113 ? -28.978 68.036  29.985  1.00 66.95  ? 254 GLY D N     1 
ATOM   9793  C  CA    . GLY D  1 113 ? -29.738 67.878  31.210  1.00 69.67  ? 254 GLY D CA    1 
ATOM   9794  C  C     . GLY D  1 113 ? -29.066 66.916  32.167  1.00 71.41  ? 254 GLY D C     1 
ATOM   9795  O  O     . GLY D  1 113 ? -29.581 65.823  32.416  1.00 74.86  ? 254 GLY D O     1 
ATOM   9796  N  N     . GLU D  1 114 ? -27.906 67.320  32.685  1.00 68.03  ? 255 GLU D N     1 
ATOM   9797  C  CA    . GLU D  1 114 ? -27.117 66.512  33.619  1.00 63.99  ? 255 GLU D CA    1 
ATOM   9798  C  C     . GLU D  1 114 ? -26.555 65.235  32.984  1.00 58.91  ? 255 GLU D C     1 
ATOM   9799  O  O     . GLU D  1 114 ? -25.409 64.865  33.239  1.00 63.35  ? 255 GLU D O     1 
ATOM   9800  C  CB    . GLU D  1 114 ? -27.927 66.194  34.883  1.00 66.02  ? 255 GLU D CB    1 
ATOM   9801  C  CG    . GLU D  1 114 ? -27.115 65.674  36.055  1.00 67.83  ? 255 GLU D CG    1 
ATOM   9802  C  CD    . GLU D  1 114 ? -27.957 65.524  37.308  1.00 71.49  ? 255 GLU D CD    1 
ATOM   9803  O  OE1   . GLU D  1 114 ? -28.870 66.353  37.513  1.00 74.63  ? 255 GLU D OE1   1 
ATOM   9804  O  OE2   . GLU D  1 114 ? -27.715 64.576  38.084  1.00 71.50  ? 255 GLU D OE2   1 
ATOM   9805  N  N     . VAL D  1 115 ? -27.357 64.572  32.156  1.00 52.34  ? 256 VAL D N     1 
ATOM   9806  C  CA    . VAL D  1 115 ? -26.938 63.341  31.491  1.00 47.49  ? 256 VAL D CA    1 
ATOM   9807  C  C     . VAL D  1 115 ? -25.942 63.613  30.358  1.00 46.69  ? 256 VAL D C     1 
ATOM   9808  O  O     . VAL D  1 115 ? -26.060 64.612  29.641  1.00 49.64  ? 256 VAL D O     1 
ATOM   9809  C  CB    . VAL D  1 115 ? -28.161 62.536  30.991  1.00 42.88  ? 256 VAL D CB    1 
ATOM   9810  C  CG1   . VAL D  1 115 ? -28.076 62.261  29.511  1.00 44.10  ? 256 VAL D CG1   1 
ATOM   9811  C  CG2   . VAL D  1 115 ? -28.278 61.229  31.750  1.00 41.29  ? 256 VAL D CG2   1 
ATOM   9812  N  N     . LEU D  1 116 ? -24.957 62.726  30.217  1.00 41.36  ? 257 LEU D N     1 
ATOM   9813  C  CA    . LEU D  1 116 ? -23.913 62.868  29.202  1.00 37.50  ? 257 LEU D CA    1 
ATOM   9814  C  C     . LEU D  1 116 ? -24.251 62.065  27.951  1.00 37.51  ? 257 LEU D C     1 
ATOM   9815  O  O     . LEU D  1 116 ? -24.509 60.863  28.030  1.00 34.03  ? 257 LEU D O     1 
ATOM   9816  C  CB    . LEU D  1 116 ? -22.569 62.408  29.771  1.00 36.11  ? 257 LEU D CB    1 
ATOM   9817  C  CG    . LEU D  1 116 ? -21.300 62.526  28.925  1.00 32.34  ? 257 LEU D CG    1 
ATOM   9818  C  CD1   . LEU D  1 116 ? -20.848 63.965  28.824  1.00 34.26  ? 257 LEU D CD1   1 
ATOM   9819  C  CD2   . LEU D  1 116 ? -20.201 61.672  29.519  1.00 33.20  ? 257 LEU D CD2   1 
ATOM   9820  N  N     . SER D  1 117 ? -24.244 62.729  26.798  1.00 41.94  ? 258 SER D N     1 
ATOM   9821  C  CA    . SER D  1 117 ? -24.588 62.075  25.538  1.00 46.29  ? 258 SER D CA    1 
ATOM   9822  C  C     . SER D  1 117 ? -23.412 61.328  24.916  1.00 46.06  ? 258 SER D C     1 
ATOM   9823  O  O     . SER D  1 117 ? -22.436 61.936  24.478  1.00 46.85  ? 258 SER D O     1 
ATOM   9824  C  CB    . SER D  1 117 ? -25.123 63.096  24.535  1.00 48.97  ? 258 SER D CB    1 
ATOM   9825  O  OG    . SER D  1 117 ? -25.361 62.492  23.277  1.00 50.92  ? 258 SER D OG    1 
ATOM   9826  N  N     . ALA D  1 118 ? -23.527 60.005  24.874  1.00 31.95  ? 259 ALA D N     1 
ATOM   9827  C  CA    . ALA D  1 118 ? -22.544 59.151  24.220  1.00 32.75  ? 259 ALA D CA    1 
ATOM   9828  C  C     . ALA D  1 118 ? -22.471 59.446  22.728  1.00 37.66  ? 259 ALA D C     1 
ATOM   9829  O  O     . ALA D  1 118 ? -21.383 59.505  22.150  1.00 39.89  ? 259 ALA D O     1 
ATOM   9830  C  CB    . ALA D  1 118 ? -22.892 57.693  24.456  1.00 33.29  ? 259 ALA D CB    1 
ATOM   9831  N  N     . THR D  1 119 ? -23.637 59.630  22.115  1.00 38.23  ? 260 THR D N     1 
ATOM   9832  C  CA    . THR D  1 119 ? -23.734 59.900  20.683  1.00 38.01  ? 260 THR D CA    1 
ATOM   9833  C  C     . THR D  1 119 ? -23.016 61.181  20.233  1.00 40.72  ? 260 THR D C     1 
ATOM   9834  O  O     . THR D  1 119 ? -22.309 61.169  19.221  1.00 46.14  ? 260 THR D O     1 
ATOM   9835  C  CB    . THR D  1 119 ? -25.202 59.914  20.219  1.00 40.02  ? 260 THR D CB    1 
ATOM   9836  O  OG1   . THR D  1 119 ? -25.660 58.566  20.053  1.00 43.18  ? 260 THR D OG1   1 
ATOM   9837  C  CG2   . THR D  1 119 ? -25.348 60.632  18.892  1.00 42.90  ? 260 THR D CG2   1 
ATOM   9838  N  N     . LYS D  1 120 ? -23.194 62.276  20.968  1.00 41.31  ? 261 LYS D N     1 
ATOM   9839  C  CA    . LYS D  1 120 ? -22.558 63.543  20.604  1.00 42.06  ? 261 LYS D CA    1 
ATOM   9840  C  C     . LYS D  1 120 ? -21.047 63.481  20.774  1.00 43.55  ? 261 LYS D C     1 
ATOM   9841  O  O     . LYS D  1 120 ? -20.290 63.927  19.906  1.00 47.94  ? 261 LYS D O     1 
ATOM   9842  C  CB    . LYS D  1 120 ? -23.106 64.679  21.458  1.00 42.04  ? 261 LYS D CB    1 
ATOM   9843  C  CG    . LYS D  1 120 ? -24.584 64.940  21.288  1.00 42.90  ? 261 LYS D CG    1 
ATOM   9844  C  CD    . LYS D  1 120 ? -25.031 66.046  22.233  1.00 44.74  ? 261 LYS D CD    1 
ATOM   9845  C  CE    . LYS D  1 120 ? -26.525 66.286  22.122  1.00 47.72  ? 261 LYS D CE    1 
ATOM   9846  N  NZ    . LYS D  1 120 ? -27.010 67.266  23.131  1.00 51.31  ? 261 LYS D NZ    1 
ATOM   9847  N  N     . MET D  1 121 ? -20.626 62.938  21.913  1.00 40.27  ? 262 MET D N     1 
ATOM   9848  C  CA    . MET D  1 121 ? -19.217 62.789  22.254  1.00 41.52  ? 262 MET D CA    1 
ATOM   9849  C  C     . MET D  1 121 ? -18.525 61.950  21.185  1.00 42.87  ? 262 MET D C     1 
ATOM   9850  O  O     . MET D  1 121 ? -17.445 62.306  20.689  1.00 48.41  ? 262 MET D O     1 
ATOM   9851  C  CB    . MET D  1 121 ? -19.107 62.123  23.630  1.00 41.97  ? 262 MET D CB    1 
ATOM   9852  C  CG    . MET D  1 121 ? -17.757 62.255  24.325  1.00 42.52  ? 262 MET D CG    1 
ATOM   9853  S  SD    . MET D  1 121 ? -17.824 61.601  26.010  1.00 47.51  ? 262 MET D SD    1 
ATOM   9854  C  CE    . MET D  1 121 ? -16.121 61.824  26.539  1.00 44.63  ? 262 MET D CE    1 
ATOM   9855  N  N     . LEU D  1 122 ? -19.180 60.851  20.813  1.00 41.58  ? 263 LEU D N     1 
ATOM   9856  C  CA    . LEU D  1 122 ? -18.686 59.958  19.771  1.00 41.71  ? 263 LEU D CA    1 
ATOM   9857  C  C     . LEU D  1 122 ? -18.632 60.675  18.428  1.00 41.63  ? 263 LEU D C     1 
ATOM   9858  O  O     . LEU D  1 122 ? -17.688 60.492  17.663  1.00 39.61  ? 263 LEU D O     1 
ATOM   9859  C  CB    . LEU D  1 122 ? -19.570 58.711  19.676  1.00 42.67  ? 263 LEU D CB    1 
ATOM   9860  C  CG    . LEU D  1 122 ? -19.002 57.501  18.934  1.00 42.34  ? 263 LEU D CG    1 
ATOM   9861  C  CD1   . LEU D  1 122 ? -17.664 57.116  19.524  1.00 42.84  ? 263 LEU D CD1   1 
ATOM   9862  C  CD2   . LEU D  1 122 ? -19.959 56.324  18.980  1.00 40.46  ? 263 LEU D CD2   1 
ATOM   9863  N  N     . SER D  1 123 ? -19.643 61.496  18.153  1.00 43.33  ? 264 SER D N     1 
ATOM   9864  C  CA    . SER D  1 123 ? -19.695 62.269  16.918  1.00 43.46  ? 264 SER D CA    1 
ATOM   9865  C  C     . SER D  1 123 ? -18.484 63.182  16.787  1.00 44.36  ? 264 SER D C     1 
ATOM   9866  O  O     . SER D  1 123 ? -17.811 63.182  15.755  1.00 46.47  ? 264 SER D O     1 
ATOM   9867  C  CB    . SER D  1 123 ? -20.978 63.098  16.861  1.00 43.97  ? 264 SER D CB    1 
ATOM   9868  O  OG    . SER D  1 123 ? -22.123 62.270  16.908  1.00 48.63  ? 264 SER D OG    1 
ATOM   9869  N  N     . LYS D  1 124 ? -18.211 63.954  17.836  1.00 42.79  ? 265 LYS D N     1 
ATOM   9870  C  CA    . LYS D  1 124 ? -17.074 64.865  17.834  1.00 43.04  ? 265 LYS D CA    1 
ATOM   9871  C  C     . LYS D  1 124 ? -15.760 64.096  17.675  1.00 47.79  ? 265 LYS D C     1 
ATOM   9872  O  O     . LYS D  1 124 ? -14.932 64.438  16.824  1.00 51.45  ? 265 LYS D O     1 
ATOM   9873  C  CB    . LYS D  1 124 ? -17.069 65.702  19.112  1.00 43.83  ? 265 LYS D CB    1 
ATOM   9874  C  CG    . LYS D  1 124 ? -16.022 66.809  19.145  1.00 47.68  ? 265 LYS D CG    1 
ATOM   9875  C  CD    . LYS D  1 124 ? -16.148 67.740  17.949  1.00 48.26  ? 265 LYS D CD    1 
ATOM   9876  C  CE    . LYS D  1 124 ? -15.348 69.016  18.155  1.00 50.71  ? 265 LYS D CE    1 
ATOM   9877  N  NZ    . LYS D  1 124 ? -15.869 69.828  19.293  1.00 51.85  ? 265 LYS D NZ    1 
ATOM   9878  N  N     . PHE D  1 125 ? -15.592 63.055  18.491  1.00 45.30  ? 266 PHE D N     1 
ATOM   9879  C  CA    . PHE D  1 125 ? -14.443 62.155  18.408  1.00 42.04  ? 266 PHE D CA    1 
ATOM   9880  C  C     . PHE D  1 125 ? -14.191 61.721  16.962  1.00 45.76  ? 266 PHE D C     1 
ATOM   9881  O  O     . PHE D  1 125 ? -13.074 61.845  16.439  1.00 50.97  ? 266 PHE D O     1 
ATOM   9882  C  CB    . PHE D  1 125 ? -14.736 60.930  19.273  1.00 42.40  ? 266 PHE D CB    1 
ATOM   9883  C  CG    . PHE D  1 125 ? -13.525 60.117  19.634  1.00 41.38  ? 266 PHE D CG    1 
ATOM   9884  C  CD1   . PHE D  1 125 ? -12.573 60.616  20.508  1.00 42.16  ? 266 PHE D CD1   1 
ATOM   9885  C  CD2   . PHE D  1 125 ? -13.366 58.831  19.141  1.00 42.37  ? 266 PHE D CD2   1 
ATOM   9886  C  CE1   . PHE D  1 125 ? -11.464 59.859  20.857  1.00 44.21  ? 266 PHE D CE1   1 
ATOM   9887  C  CE2   . PHE D  1 125 ? -12.261 58.070  19.488  1.00 44.21  ? 266 PHE D CE2   1 
ATOM   9888  C  CZ    . PHE D  1 125 ? -11.312 58.586  20.347  1.00 43.86  ? 266 PHE D CZ    1 
ATOM   9889  N  N     . ARG D  1 126 ? -15.251 61.231  16.325  1.00 44.01  ? 267 ARG D N     1 
ATOM   9890  C  CA    . ARG D  1 126 ? -15.207 60.733  14.956  1.00 42.94  ? 267 ARG D CA    1 
ATOM   9891  C  C     . ARG D  1 126 ? -14.825 61.833  13.982  1.00 46.39  ? 267 ARG D C     1 
ATOM   9892  O  O     . ARG D  1 126 ? -14.049 61.608  13.058  1.00 51.48  ? 267 ARG D O     1 
ATOM   9893  C  CB    . ARG D  1 126 ? -16.570 60.151  14.568  1.00 40.25  ? 267 ARG D CB    1 
ATOM   9894  C  CG    . ARG D  1 126 ? -16.620 59.522  13.182  1.00 36.96  ? 267 ARG D CG    1 
ATOM   9895  C  CD    . ARG D  1 126 ? -17.932 58.789  12.943  1.00 34.36  ? 267 ARG D CD    1 
ATOM   9896  N  NE    . ARG D  1 126 ? -17.766 57.730  11.954  1.00 39.52  ? 267 ARG D NE    1 
ATOM   9897  C  CZ    . ARG D  1 126 ? -17.467 56.472  12.260  1.00 42.12  ? 267 ARG D CZ    1 
ATOM   9898  N  NH1   . ARG D  1 126 ? -17.313 56.119  13.526  1.00 42.34  ? 267 ARG D NH1   1 
ATOM   9899  N  NH2   . ARG D  1 126 ? -17.325 55.563  11.305  1.00 44.05  ? 267 ARG D NH2   1 
ATOM   9900  N  N     . LYS D  1 127 ? -15.379 63.022  14.194  1.00 46.06  ? 268 LYS D N     1 
ATOM   9901  C  CA    . LYS D  1 127 ? -15.092 64.163  13.342  1.00 46.66  ? 268 LYS D CA    1 
ATOM   9902  C  C     . LYS D  1 127 ? -13.596 64.483  13.380  1.00 49.41  ? 268 LYS D C     1 
ATOM   9903  O  O     . LYS D  1 127 ? -12.942 64.546  12.335  1.00 54.66  ? 268 LYS D O     1 
ATOM   9904  C  CB    . LYS D  1 127 ? -15.932 65.361  13.787  1.00 46.85  ? 268 LYS D CB    1 
ATOM   9905  C  CG    . LYS D  1 127 ? -15.780 66.606  12.925  1.00 49.27  ? 268 LYS D CG    1 
ATOM   9906  C  CD    . LYS D  1 127 ? -16.842 67.637  13.279  1.00 51.01  ? 268 LYS D CD    1 
ATOM   9907  C  CE    . LYS D  1 127 ? -16.429 69.041  12.862  1.00 51.20  ? 268 LYS D CE    1 
ATOM   9908  N  NZ    . LYS D  1 127 ? -15.264 69.521  13.651  1.00 50.83  ? 268 LYS D NZ    1 
ATOM   9909  N  N     . ILE D  1 128 ? -13.062 64.655  14.590  1.00 46.43  ? 269 ILE D N     1 
ATOM   9910  C  CA    . ILE D  1 128 ? -11.634 64.908  14.795  1.00 40.21  ? 269 ILE D CA    1 
ATOM   9911  C  C     . ILE D  1 128 ? -10.757 63.825  14.160  1.00 41.35  ? 269 ILE D C     1 
ATOM   9912  O  O     . ILE D  1 128 ? -9.745  64.130  13.519  1.00 41.44  ? 269 ILE D O     1 
ATOM   9913  C  CB    . ILE D  1 128 ? -11.297 65.027  16.294  1.00 29.73  ? 269 ILE D CB    1 
ATOM   9914  C  CG1   . ILE D  1 128 ? -12.065 66.178  16.934  1.00 27.18  ? 269 ILE D CG1   1 
ATOM   9915  C  CG2   . ILE D  1 128 ? -9.818  65.249  16.496  1.00 26.17  ? 269 ILE D CG2   1 
ATOM   9916  C  CD1   . ILE D  1 128 ? -11.824 66.305  18.427  1.00 32.06  ? 269 ILE D CD1   1 
ATOM   9917  N  N     . ILE D  1 129 ? -11.145 62.563  14.335  1.00 43.58  ? 270 ILE D N     1 
ATOM   9918  C  CA    . ILE D  1 129 ? -10.410 61.466  13.707  1.00 40.77  ? 270 ILE D CA    1 
ATOM   9919  C  C     . ILE D  1 129 ? -10.423 61.565  12.175  1.00 41.96  ? 270 ILE D C     1 
ATOM   9920  O  O     . ILE D  1 129 ? -9.389  61.381  11.543  1.00 49.39  ? 270 ILE D O     1 
ATOM   9921  C  CB    . ILE D  1 129 ? -10.904 60.081  14.185  1.00 39.39  ? 270 ILE D CB    1 
ATOM   9922  C  CG1   . ILE D  1 129 ? -10.510 59.846  15.643  1.00 34.54  ? 270 ILE D CG1   1 
ATOM   9923  C  CG2   . ILE D  1 129 ? -10.335 58.975  13.316  1.00 36.20  ? 270 ILE D CG2   1 
ATOM   9924  C  CD1   . ILE D  1 129 ? -10.876 58.478  16.167  1.00 33.81  ? 270 ILE D CD1   1 
ATOM   9925  N  N     . LYS D  1 130 ? -11.579 61.871  11.587  1.00 39.73  ? 271 LYS D N     1 
ATOM   9926  C  CA    . LYS D  1 130 ? -11.689 62.065  10.140  1.00 39.40  ? 271 LYS D CA    1 
ATOM   9927  C  C     . LYS D  1 130 ? -10.771 63.177  9.657   1.00 42.35  ? 271 LYS D C     1 
ATOM   9928  O  O     . LYS D  1 130 ? -10.087 63.039  8.638   1.00 41.87  ? 271 LYS D O     1 
ATOM   9929  C  CB    . LYS D  1 130 ? -13.120 62.426  9.759   1.00 39.10  ? 271 LYS D CB    1 
ATOM   9930  C  CG    . LYS D  1 130 ? -14.078 61.249  9.695   1.00 42.37  ? 271 LYS D CG    1 
ATOM   9931  C  CD    . LYS D  1 130 ? -15.486 61.715  9.360   1.00 39.14  ? 271 LYS D CD    1 
ATOM   9932  C  CE    . LYS D  1 130 ? -16.411 60.530  9.191   1.00 44.17  ? 271 LYS D CE    1 
ATOM   9933  N  NZ    . LYS D  1 130 ? -17.838 60.943  9.038   1.00 48.04  ? 271 LYS D NZ    1 
ATOM   9934  N  N     . GLU D  1 131 ? -10.773 64.286  10.394  1.00 45.42  ? 272 GLU D N     1 
ATOM   9935  C  CA    . GLU D  1 131 ? -9.951  65.440  10.052  1.00 47.16  ? 272 GLU D CA    1 
ATOM   9936  C  C     . GLU D  1 131 ? -8.459  65.123  10.113  1.00 49.54  ? 272 GLU D C     1 
ATOM   9937  O  O     . GLU D  1 131 ? -7.695  65.564  9.255   1.00 54.56  ? 272 GLU D O     1 
ATOM   9938  C  CB    . GLU D  1 131 ? -10.284 66.621  10.963  1.00 49.55  ? 272 GLU D CB    1 
ATOM   9939  C  CG    . GLU D  1 131 ? -11.739 67.068  10.877  1.00 55.17  ? 272 GLU D CG    1 
ATOM   9940  C  CD    . GLU D  1 131 ? -11.999 68.340  11.651  1.00 59.33  ? 272 GLU D CD    1 
ATOM   9941  O  OE1   . GLU D  1 131 ? -13.139 68.846  11.588  1.00 59.46  ? 272 GLU D OE1   1 
ATOM   9942  O  OE2   . GLU D  1 131 ? -11.064 68.834  12.318  1.00 61.29  ? 272 GLU D OE2   1 
ATOM   9943  N  N     . GLU D  1 132 ? -8.041  64.360  11.121  1.00 46.70  ? 273 GLU D N     1 
ATOM   9944  C  CA    . GLU D  1 132 ? -6.631  63.980  11.219  1.00 46.29  ? 273 GLU D CA    1 
ATOM   9945  C  C     . GLU D  1 132 ? -6.223  62.932  10.175  1.00 50.09  ? 273 GLU D C     1 
ATOM   9946  O  O     . GLU D  1 132 ? -5.107  62.982  9.644   1.00 50.78  ? 273 GLU D O     1 
ATOM   9947  C  CB    . GLU D  1 132 ? -6.286  63.502  12.629  1.00 43.77  ? 273 GLU D CB    1 
ATOM   9948  C  CG    . GLU D  1 132 ? -4.792  63.331  12.885  1.00 41.81  ? 273 GLU D CG    1 
ATOM   9949  C  CD    . GLU D  1 132 ? -4.004  64.630  12.761  1.00 43.62  ? 273 GLU D CD    1 
ATOM   9950  O  OE1   . GLU D  1 132 ? -4.566  65.711  13.034  1.00 45.97  ? 273 GLU D OE1   1 
ATOM   9951  O  OE2   . GLU D  1 132 ? -2.813  64.568  12.393  1.00 42.64  ? 273 GLU D OE2   1 
ATOM   9952  N  N     . VAL D  1 133 ? -7.126  61.999  9.878   1.00 48.89  ? 274 VAL D N     1 
ATOM   9953  C  CA    . VAL D  1 133 ? -6.876  60.969  8.866   1.00 47.88  ? 274 VAL D CA    1 
ATOM   9954  C  C     . VAL D  1 133 ? -6.770  61.596  7.474   1.00 48.57  ? 274 VAL D C     1 
ATOM   9955  O  O     . VAL D  1 133 ? -6.006  61.135  6.623   1.00 51.59  ? 274 VAL D O     1 
ATOM   9956  C  CB    . VAL D  1 133 ? -7.968  59.869  8.891   1.00 50.18  ? 274 VAL D CB    1 
ATOM   9957  C  CG1   . VAL D  1 133 ? -7.870  58.967  7.666   1.00 50.50  ? 274 VAL D CG1   1 
ATOM   9958  C  CG2   . VAL D  1 133 ? -7.861  59.036  10.154  1.00 50.40  ? 274 VAL D CG2   1 
ATOM   9959  N  N     . LYS D  1 134 ? -7.527  62.668  7.263   1.00 48.27  ? 275 LYS D N     1 
ATOM   9960  C  CA    . LYS D  1 134 ? -7.533  63.382  5.992   1.00 52.15  ? 275 LYS D CA    1 
ATOM   9961  C  C     . LYS D  1 134 ? -6.147  63.911  5.623   1.00 51.98  ? 275 LYS D C     1 
ATOM   9962  O  O     . LYS D  1 134 ? -5.797  63.988  4.446   1.00 55.10  ? 275 LYS D O     1 
ATOM   9963  C  CB    . LYS D  1 134 ? -8.517  64.547  6.072   1.00 55.08  ? 275 LYS D CB    1 
ATOM   9964  C  CG    . LYS D  1 134 ? -9.112  64.974  4.741   1.00 57.48  ? 275 LYS D CG    1 
ATOM   9965  C  CD    . LYS D  1 134 ? -9.962  66.226  4.920   1.00 59.26  ? 275 LYS D CD    1 
ATOM   9966  C  CE    . LYS D  1 134 ? -11.126 66.246  3.942   1.00 60.35  ? 275 LYS D CE    1 
ATOM   9967  N  NZ    . LYS D  1 134 ? -12.091 67.346  4.231   1.00 57.99  ? 275 LYS D NZ    1 
ATOM   9968  N  N     . GLU D  1 135 ? -5.361  64.265  6.635   1.00 50.43  ? 276 GLU D N     1 
ATOM   9969  C  CA    . GLU D  1 135 ? -4.081  64.930  6.419   1.00 46.25  ? 276 GLU D CA    1 
ATOM   9970  C  C     . GLU D  1 135 ? -2.897  63.973  6.343   1.00 44.16  ? 276 GLU D C     1 
ATOM   9971  O  O     . GLU D  1 135 ? -1.773  64.393  6.067   1.00 48.12  ? 276 GLU D O     1 
ATOM   9972  C  CB    . GLU D  1 135 ? -3.847  65.985  7.499   1.00 48.64  ? 276 GLU D CB    1 
ATOM   9973  C  CG    . GLU D  1 135 ? -4.886  67.090  7.485   1.00 51.24  ? 276 GLU D CG    1 
ATOM   9974  C  CD    . GLU D  1 135 ? -5.121  67.630  6.089   1.00 51.92  ? 276 GLU D CD    1 
ATOM   9975  O  OE1   . GLU D  1 135 ? -4.183  68.211  5.507   1.00 49.11  ? 276 GLU D OE1   1 
ATOM   9976  O  OE2   . GLU D  1 135 ? -6.244  67.469  5.570   1.00 54.04  ? 276 GLU D OE2   1 
ATOM   9977  N  N     . ILE D  1 136 ? -3.152  62.689  6.575   1.00 43.12  ? 277 ILE D N     1 
ATOM   9978  C  CA    . ILE D  1 136 ? -2.127  61.660  6.413   1.00 41.10  ? 277 ILE D CA    1 
ATOM   9979  C  C     . ILE D  1 136 ? -1.966  61.322  4.922   1.00 48.75  ? 277 ILE D C     1 
ATOM   9980  O  O     . ILE D  1 136 ? -2.953  61.034  4.234   1.00 52.75  ? 277 ILE D O     1 
ATOM   9981  C  CB    . ILE D  1 136 ? -2.464  60.389  7.234   1.00 36.52  ? 277 ILE D CB    1 
ATOM   9982  C  CG1   . ILE D  1 136 ? -2.761  60.749  8.692   1.00 34.49  ? 277 ILE D CG1   1 
ATOM   9983  C  CG2   . ILE D  1 136 ? -1.327  59.384  7.169   1.00 37.68  ? 277 ILE D CG2   1 
ATOM   9984  C  CD1   . ILE D  1 136 ? -2.993  59.545  9.595   1.00 32.17  ? 277 ILE D CD1   1 
ATOM   9985  N  N     . LYS D  1 137 ? -0.729  61.362  4.427   1.00 50.59  ? 278 LYS D N     1 
ATOM   9986  C  CA    . LYS D  1 137 ? -0.470  61.234  2.994   1.00 48.11  ? 278 LYS D CA    1 
ATOM   9987  C  C     . LYS D  1 137 ? 0.477   60.079  2.665   1.00 47.48  ? 278 LYS D C     1 
ATOM   9988  O  O     . LYS D  1 137 ? 0.590   59.668  1.504   1.00 47.91  ? 278 LYS D O     1 
ATOM   9989  C  CB    . LYS D  1 137 ? 0.100   62.547  2.449   1.00 46.29  ? 278 LYS D CB    1 
ATOM   9990  C  CG    . LYS D  1 137 ? -0.654  63.805  2.890   1.00 43.04  ? 278 LYS D CG    1 
ATOM   9991  C  CD    . LYS D  1 137 ? -2.066  63.853  2.318   1.00 40.80  ? 278 LYS D CD    1 
ATOM   9992  C  CE    . LYS D  1 137 ? -2.819  65.090  2.794   1.00 35.89  ? 278 LYS D CE    1 
ATOM   9993  N  NZ    . LYS D  1 137 ? -4.174  65.180  2.191   1.00 32.11  ? 278 LYS D NZ    1 
ATOM   9994  N  N     . ASP D  1 138 ? 1.145   59.555  3.690   1.00 45.51  ? 279 ASP D N     1 
ATOM   9995  C  CA    . ASP D  1 138 ? 2.137   58.503  3.497   1.00 43.90  ? 279 ASP D CA    1 
ATOM   9996  C  C     . ASP D  1 138 ? 1.598   57.109  3.826   1.00 46.13  ? 279 ASP D C     1 
ATOM   9997  O  O     . ASP D  1 138 ? 2.297   56.106  3.649   1.00 49.47  ? 279 ASP D O     1 
ATOM   9998  C  CB    . ASP D  1 138 ? 3.394   58.797  4.316   1.00 43.95  ? 279 ASP D CB    1 
ATOM   9999  C  CG    . ASP D  1 138 ? 3.089   59.080  5.767   1.00 45.33  ? 279 ASP D CG    1 
ATOM   10000 O  OD1   . ASP D  1 138 ? 1.968   59.539  6.057   1.00 47.62  ? 279 ASP D OD1   1 
ATOM   10001 O  OD2   . ASP D  1 138 ? 3.974   58.854  6.620   1.00 45.10  ? 279 ASP D OD2   1 
ATOM   10002 N  N     . ILE D  1 139 ? 0.356   57.054  4.304   1.00 41.32  ? 280 ILE D N     1 
ATOM   10003 C  CA    . ILE D  1 139 ? -0.326  55.787  4.552   1.00 38.38  ? 280 ILE D CA    1 
ATOM   10004 C  C     . ILE D  1 139 ? -1.687  55.779  3.858   1.00 39.28  ? 280 ILE D C     1 
ATOM   10005 O  O     . ILE D  1 139 ? -2.417  56.770  3.920   1.00 38.54  ? 280 ILE D O     1 
ATOM   10006 C  CB    . ILE D  1 139 ? -0.569  55.553  6.055   1.00 40.24  ? 280 ILE D CB    1 
ATOM   10007 C  CG1   . ILE D  1 139 ? 0.680   55.863  6.891   1.00 43.62  ? 280 ILE D CG1   1 
ATOM   10008 C  CG2   . ILE D  1 139 ? -1.055  54.132  6.289   1.00 38.26  ? 280 ILE D CG2   1 
ATOM   10009 C  CD1   . ILE D  1 139 ? 1.778   54.824  6.791   1.00 46.58  ? 280 ILE D CD1   1 
ATOM   10010 N  N     . ASP D  1 140 ? -2.030  54.670  3.204   1.00 40.10  ? 281 ASP D N     1 
ATOM   10011 C  CA    . ASP D  1 140 ? -3.379  54.488  2.672   1.00 37.67  ? 281 ASP D CA    1 
ATOM   10012 C  C     . ASP D  1 140 ? -4.293  54.079  3.821   1.00 38.05  ? 281 ASP D C     1 
ATOM   10013 O  O     . ASP D  1 140 ? -4.372  52.901  4.179   1.00 37.92  ? 281 ASP D O     1 
ATOM   10014 C  CB    . ASP D  1 140 ? -3.399  53.429  1.566   1.00 41.07  ? 281 ASP D CB    1 
ATOM   10015 C  CG    . ASP D  1 140 ? -4.738  53.354  0.841   1.00 48.10  ? 281 ASP D CG    1 
ATOM   10016 O  OD1   . ASP D  1 140 ? -5.705  54.016  1.278   1.00 50.49  ? 281 ASP D OD1   1 
ATOM   10017 O  OD2   . ASP D  1 140 ? -4.824  52.617  -0.166  1.00 48.38  ? 281 ASP D OD2   1 
ATOM   10018 N  N     . VAL D  1 141 ? -4.968  55.067  4.403   1.00 38.58  ? 282 VAL D N     1 
ATOM   10019 C  CA    . VAL D  1 141 ? -5.867  54.835  5.525   1.00 36.50  ? 282 VAL D CA    1 
ATOM   10020 C  C     . VAL D  1 141 ? -7.157  55.639  5.364   1.00 38.75  ? 282 VAL D C     1 
ATOM   10021 O  O     . VAL D  1 141 ? -7.126  56.784  4.908   1.00 37.94  ? 282 VAL D O     1 
ATOM   10022 C  CB    . VAL D  1 141 ? -5.185  55.171  6.866   1.00 38.92  ? 282 VAL D CB    1 
ATOM   10023 C  CG1   . VAL D  1 141 ? -4.595  56.565  6.835   1.00 39.08  ? 282 VAL D CG1   1 
ATOM   10024 C  CG2   . VAL D  1 141 ? -6.160  55.024  8.022   1.00 39.19  ? 282 VAL D CG2   1 
ATOM   10025 N  N     . SER D  1 142 ? -8.288  55.026  5.719   1.00 40.36  ? 283 SER D N     1 
ATOM   10026 C  CA    . SER D  1 142 ? -9.593  55.677  5.609   1.00 38.95  ? 283 SER D CA    1 
ATOM   10027 C  C     . SER D  1 142 ? -10.495 55.301  6.783   1.00 37.77  ? 283 SER D C     1 
ATOM   10028 O  O     . SER D  1 142 ? -10.280 54.281  7.428   1.00 36.84  ? 283 SER D O     1 
ATOM   10029 C  CB    . SER D  1 142 ? -10.266 55.273  4.300   1.00 39.01  ? 283 SER D CB    1 
ATOM   10030 O  OG    . SER D  1 142 ? -10.389 53.865  4.220   1.00 38.65  ? 283 SER D OG    1 
ATOM   10031 N  N     . VAL D  1 143 ? -11.503 56.125  7.062   1.00 39.57  ? 284 VAL D N     1 
ATOM   10032 C  CA    . VAL D  1 143 ? -12.444 55.828  8.146   1.00 38.27  ? 284 VAL D CA    1 
ATOM   10033 C  C     . VAL D  1 143 ? -13.632 54.997  7.653   1.00 42.99  ? 284 VAL D C     1 
ATOM   10034 O  O     . VAL D  1 143 ? -14.261 55.333  6.648   1.00 42.29  ? 284 VAL D O     1 
ATOM   10035 C  CB    . VAL D  1 143 ? -12.956 57.109  8.836   1.00 31.96  ? 284 VAL D CB    1 
ATOM   10036 C  CG1   . VAL D  1 143 ? -13.835 56.754  10.018  1.00 25.94  ? 284 VAL D CG1   1 
ATOM   10037 C  CG2   . VAL D  1 143 ? -11.793 57.968  9.299   1.00 29.17  ? 284 VAL D CG2   1 
ATOM   10038 N  N     . GLU D  1 144 ? -13.936 53.918  8.371   1.00 47.88  ? 285 GLU D N     1 
ATOM   10039 C  CA    . GLU D  1 144 ? -15.016 53.008  7.993   1.00 47.57  ? 285 GLU D CA    1 
ATOM   10040 C  C     . GLU D  1 144 ? -16.391 53.607  8.294   1.00 46.82  ? 285 GLU D C     1 
ATOM   10041 O  O     . GLU D  1 144 ? -16.518 54.491  9.143   1.00 47.36  ? 285 GLU D O     1 
ATOM   10042 C  CB    . GLU D  1 144 ? -14.860 51.678  8.737   1.00 50.22  ? 285 GLU D CB    1 
ATOM   10043 C  CG    . GLU D  1 144 ? -15.619 50.506  8.118   1.00 54.01  ? 285 GLU D CG    1 
ATOM   10044 C  CD    . GLU D  1 144 ? -15.700 49.308  9.045   1.00 58.74  ? 285 GLU D CD    1 
ATOM   10045 O  OE1   . GLU D  1 144 ? -16.027 49.493  10.235  1.00 58.60  ? 285 GLU D OE1   1 
ATOM   10046 O  OE2   . GLU D  1 144 ? -15.443 48.180  8.580   1.00 61.89  ? 285 GLU D OE2   1 
ATOM   10047 N  N     . LYS D  1 145 ? -17.410 53.124  7.588   1.00 47.48  ? 286 LYS D N     1 
ATOM   10048 C  CA    . LYS D  1 145 ? -18.797 53.491  7.855   1.00 48.30  ? 286 LYS D CA    1 
ATOM   10049 C  C     . LYS D  1 145 ? -19.147 53.083  9.279   1.00 49.56  ? 286 LYS D C     1 
ATOM   10050 O  O     . LYS D  1 145 ? -18.802 51.984  9.709   1.00 50.31  ? 286 LYS D O     1 
ATOM   10051 C  CB    . LYS D  1 145 ? -19.718 52.772  6.867   1.00 48.13  ? 286 LYS D CB    1 
ATOM   10052 C  CG    . LYS D  1 145 ? -21.189 53.159  6.956   1.00 49.23  ? 286 LYS D CG    1 
ATOM   10053 C  CD    . LYS D  1 145 ? -22.016 52.354  5.959   1.00 50.20  ? 286 LYS D CD    1 
ATOM   10054 C  CE    . LYS D  1 145 ? -23.495 52.698  6.038   1.00 52.72  ? 286 LYS D CE    1 
ATOM   10055 N  NZ    . LYS D  1 145 ? -24.300 51.947  5.034   1.00 53.78  ? 286 LYS D NZ    1 
ATOM   10056 N  N     . GLU D  1 146 ? -19.816 53.968  10.011  1.00 50.41  ? 287 GLU D N     1 
ATOM   10057 C  CA    . GLU D  1 146 ? -20.160 53.697  11.403  1.00 53.84  ? 287 GLU D CA    1 
ATOM   10058 C  C     . GLU D  1 146 ? -21.079 52.484  11.537  1.00 58.82  ? 287 GLU D C     1 
ATOM   10059 O  O     . GLU D  1 146 ? -22.168 52.452  10.959  1.00 61.34  ? 287 GLU D O     1 
ATOM   10060 C  CB    . GLU D  1 146 ? -20.815 54.921  12.043  1.00 54.97  ? 287 GLU D CB    1 
ATOM   10061 C  CG    . GLU D  1 146 ? -21.043 54.777  13.545  1.00 55.78  ? 287 GLU D CG    1 
ATOM   10062 C  CD    . GLU D  1 146 ? -21.860 55.916  14.112  1.00 59.66  ? 287 GLU D CD    1 
ATOM   10063 O  OE1   . GLU D  1 146 ? -22.364 56.744  13.325  1.00 64.01  ? 287 GLU D OE1   1 
ATOM   10064 O  OE2   . GLU D  1 146 ? -22.006 55.984  15.346  1.00 60.36  ? 287 GLU D OE2   1 
ATOM   10065 N  N     . LYS D  1 147 ? -20.628 51.491  12.300  1.00 60.51  ? 288 LYS D N     1 
ATOM   10066 C  CA    . LYS D  1 147 ? -21.420 50.296  12.568  1.00 60.42  ? 288 LYS D CA    1 
ATOM   10067 C  C     . LYS D  1 147 ? -22.247 50.482  13.832  1.00 60.12  ? 288 LYS D C     1 
ATOM   10068 O  O     . LYS D  1 147 ? -21.757 51.018  14.827  1.00 63.87  ? 288 LYS D O     1 
ATOM   10069 C  CB    . LYS D  1 147 ? -20.520 49.067  12.726  1.00 62.27  ? 288 LYS D CB    1 
ATOM   10070 C  CG    . LYS D  1 147 ? -19.809 48.638  11.453  1.00 63.97  ? 288 LYS D CG    1 
ATOM   10071 C  CD    . LYS D  1 147 ? -18.971 47.384  11.671  1.00 66.18  ? 288 LYS D CD    1 
ATOM   10072 C  CE    . LYS D  1 147 ? -18.273 46.962  10.381  1.00 70.10  ? 288 LYS D CE    1 
ATOM   10073 N  NZ    . LYS D  1 147 ? -19.236 46.727  9.265   1.00 72.11  ? 288 LYS D NZ    1 
ATOM   10074 N  N     . PRO D  1 148 ? -23.512 50.040  13.793  1.00 57.54  ? 289 PRO D N     1 
ATOM   10075 C  CA    . PRO D  1 148 ? -24.391 50.069  14.967  1.00 55.36  ? 289 PRO D CA    1 
ATOM   10076 C  C     . PRO D  1 148 ? -23.871 49.137  16.051  1.00 53.83  ? 289 PRO D C     1 
ATOM   10077 O  O     . PRO D  1 148 ? -23.388 48.044  15.747  1.00 55.57  ? 289 PRO D O     1 
ATOM   10078 C  CB    . PRO D  1 148 ? -25.718 49.539  14.419  1.00 57.43  ? 289 PRO D CB    1 
ATOM   10079 C  CG    . PRO D  1 148 ? -25.346 48.751  13.199  1.00 57.19  ? 289 PRO D CG    1 
ATOM   10080 C  CD    . PRO D  1 148 ? -24.193 49.496  12.606  1.00 56.99  ? 289 PRO D CD    1 
ATOM   10081 N  N     . GLY D  1 149 ? -23.959 49.564  17.303  1.00 48.58  ? 290 GLY D N     1 
ATOM   10082 C  CA    . GLY D  1 149 ? -23.467 48.752  18.397  1.00 46.09  ? 290 GLY D CA    1 
ATOM   10083 C  C     . GLY D  1 149 ? -21.970 48.872  18.602  1.00 46.58  ? 290 GLY D C     1 
ATOM   10084 O  O     . GLY D  1 149 ? -21.403 48.199  19.468  1.00 49.40  ? 290 GLY D O     1 
ATOM   10085 N  N     . SER D  1 150 ? -21.330 49.732  17.814  1.00 46.95  ? 291 SER D N     1 
ATOM   10086 C  CA    . SER D  1 150 ? -19.881 49.892  17.876  1.00 46.14  ? 291 SER D CA    1 
ATOM   10087 C  C     . SER D  1 150 ? -19.503 51.214  18.527  1.00 45.44  ? 291 SER D C     1 
ATOM   10088 O  O     . SER D  1 150 ? -19.961 52.275  18.102  1.00 48.79  ? 291 SER D O     1 
ATOM   10089 C  CB    . SER D  1 150 ? -19.271 49.807  16.475  1.00 46.54  ? 291 SER D CB    1 
ATOM   10090 O  OG    . SER D  1 150 ? -17.856 49.817  16.525  1.00 48.53  ? 291 SER D OG    1 
ATOM   10091 N  N     . PRO D  1 151 ? -18.660 51.150  19.567  1.00 40.13  ? 292 PRO D N     1 
ATOM   10092 C  CA    . PRO D  1 151 ? -18.155 52.318  20.289  1.00 39.34  ? 292 PRO D CA    1 
ATOM   10093 C  C     . PRO D  1 151 ? -16.872 52.807  19.637  1.00 38.97  ? 292 PRO D C     1 
ATOM   10094 O  O     . PRO D  1 151 ? -16.233 53.743  20.120  1.00 36.75  ? 292 PRO D O     1 
ATOM   10095 C  CB    . PRO D  1 151 ? -17.829 51.739  21.660  1.00 40.38  ? 292 PRO D CB    1 
ATOM   10096 C  CG    . PRO D  1 151 ? -17.363 50.347  21.351  1.00 39.31  ? 292 PRO D CG    1 
ATOM   10097 C  CD    . PRO D  1 151 ? -18.184 49.889  20.166  1.00 39.37  ? 292 PRO D CD    1 
ATOM   10098 N  N     . ALA D  1 152 ? -16.510 52.167  18.530  1.00 39.42  ? 293 ALA D N     1 
ATOM   10099 C  CA    . ALA D  1 152 ? -15.219 52.390  17.902  1.00 35.48  ? 293 ALA D CA    1 
ATOM   10100 C  C     . ALA D  1 152 ? -15.332 53.212  16.635  1.00 36.57  ? 293 ALA D C     1 
ATOM   10101 O  O     . ALA D  1 152 ? -16.297 53.086  15.884  1.00 39.62  ? 293 ALA D O     1 
ATOM   10102 C  CB    . ALA D  1 152 ? -14.563 51.068  17.590  1.00 35.49  ? 293 ALA D CB    1 
ATOM   10103 N  N     . VAL D  1 153 ? -14.332 54.054  16.405  1.00 36.02  ? 294 VAL D N     1 
ATOM   10104 C  CA    . VAL D  1 153 ? -14.130 54.651  15.099  1.00 34.08  ? 294 VAL D CA    1 
ATOM   10105 C  C     . VAL D  1 153 ? -13.134 53.735  14.396  1.00 33.17  ? 294 VAL D C     1 
ATOM   10106 O  O     . VAL D  1 153 ? -11.945 53.736  14.719  1.00 34.44  ? 294 VAL D O     1 
ATOM   10107 C  CB    . VAL D  1 153 ? -13.573 56.075  15.210  1.00 32.74  ? 294 VAL D CB    1 
ATOM   10108 C  CG1   . VAL D  1 153 ? -13.468 56.712  13.839  1.00 34.82  ? 294 VAL D CG1   1 
ATOM   10109 C  CG2   . VAL D  1 153 ? -14.458 56.918  16.103  1.00 29.23  ? 294 VAL D CG2   1 
ATOM   10110 N  N     . THR D  1 154 ? -13.639 52.934  13.459  1.00 32.37  ? 295 THR D N     1 
ATOM   10111 C  CA    . THR D  1 154 ? -12.849 51.908  12.781  1.00 26.12  ? 295 THR D CA    1 
ATOM   10112 C  C     . THR D  1 154 ? -12.131 52.460  11.554  1.00 32.99  ? 295 THR D C     1 
ATOM   10113 O  O     . THR D  1 154 ? -12.728 53.171  10.740  1.00 33.19  ? 295 THR D O     1 
ATOM   10114 C  CB    . THR D  1 154 ? -13.736 50.717  12.378  1.00 23.50  ? 295 THR D CB    1 
ATOM   10115 O  OG1   . THR D  1 154 ? -14.247 50.085  13.558  1.00 25.72  ? 295 THR D OG1   1 
ATOM   10116 C  CG2   . THR D  1 154 ? -12.960 49.695  11.571  1.00 25.63  ? 295 THR D CG2   1 
ATOM   10117 N  N     . LEU D  1 155 ? -10.848 52.129  11.428  1.00 39.44  ? 296 LEU D N     1 
ATOM   10118 C  CA    . LEU D  1 155 ? -10.032 52.592  10.310  1.00 42.48  ? 296 LEU D CA    1 
ATOM   10119 C  C     . LEU D  1 155 ? -9.583  51.417  9.448   1.00 46.90  ? 296 LEU D C     1 
ATOM   10120 O  O     . LEU D  1 155 ? -9.373  50.315  9.953   1.00 49.10  ? 296 LEU D O     1 
ATOM   10121 C  CB    . LEU D  1 155 ? -8.800  53.329  10.829  1.00 43.73  ? 296 LEU D CB    1 
ATOM   10122 C  CG    . LEU D  1 155 ? -8.989  54.325  11.969  1.00 41.85  ? 296 LEU D CG    1 
ATOM   10123 C  CD1   . LEU D  1 155 ? -7.642  54.772  12.511  1.00 40.68  ? 296 LEU D CD1   1 
ATOM   10124 C  CD2   . LEU D  1 155 ? -9.800  55.520  11.513  1.00 38.67  ? 296 LEU D CD2   1 
ATOM   10125 N  N     . LEU D  1 156 ? -9.448  51.656  8.147   1.00 49.71  ? 297 LEU D N     1 
ATOM   10126 C  CA    . LEU D  1 156 ? -8.861  50.682  7.237   1.00 51.88  ? 297 LEU D CA    1 
ATOM   10127 C  C     . LEU D  1 156 ? -7.529  51.193  6.706   1.00 52.27  ? 297 LEU D C     1 
ATOM   10128 O  O     . LEU D  1 156 ? -7.452  52.256  6.088   1.00 53.78  ? 297 LEU D O     1 
ATOM   10129 C  CB    . LEU D  1 156 ? -9.800  50.366  6.075   1.00 54.45  ? 297 LEU D CB    1 
ATOM   10130 C  CG    . LEU D  1 156 ? -11.076 49.620  6.452   1.00 59.54  ? 297 LEU D CG    1 
ATOM   10131 C  CD1   . LEU D  1 156 ? -12.242 50.581  6.597   1.00 60.28  ? 297 LEU D CD1   1 
ATOM   10132 C  CD2   . LEU D  1 156 ? -11.391 48.528  5.438   1.00 62.87  ? 297 LEU D CD2   1 
ATOM   10133 N  N     . ILE D  1 157 ? -6.481  50.424  6.969   1.00 52.51  ? 298 ILE D N     1 
ATOM   10134 C  CA    . ILE D  1 157 ? -5.145  50.736  6.498   1.00 51.70  ? 298 ILE D CA    1 
ATOM   10135 C  C     . ILE D  1 157 ? -4.760  49.701  5.452   1.00 51.90  ? 298 ILE D C     1 
ATOM   10136 O  O     . ILE D  1 157 ? -5.159  48.535  5.542   1.00 50.59  ? 298 ILE D O     1 
ATOM   10137 C  CB    . ILE D  1 157 ? -4.137  50.711  7.660   1.00 49.14  ? 298 ILE D CB    1 
ATOM   10138 C  CG1   . ILE D  1 157 ? -4.459  51.812  8.667   1.00 47.41  ? 298 ILE D CG1   1 
ATOM   10139 C  CG2   . ILE D  1 157 ? -2.722  50.879  7.159   1.00 50.43  ? 298 ILE D CG2   1 
ATOM   10140 C  CD1   . ILE D  1 157 ? -3.680  51.699  9.961   1.00 48.03  ? 298 ILE D CD1   1 
ATOM   10141 N  N     . ARG D  1 158 ? -3.999  50.127  4.450   1.00 52.87  ? 299 ARG D N     1 
ATOM   10142 C  CA    . ARG D  1 158 ? -3.542  49.214  3.417   1.00 52.99  ? 299 ARG D CA    1 
ATOM   10143 C  C     . ARG D  1 158 ? -2.019  49.176  3.347   1.00 57.24  ? 299 ARG D C     1 
ATOM   10144 O  O     . ARG D  1 158 ? -1.403  49.984  2.649   1.00 59.54  ? 299 ARG D O     1 
ATOM   10145 C  CB    . ARG D  1 158 ? -4.143  49.609  2.071   1.00 56.14  ? 299 ARG D CB    1 
ATOM   10146 C  CG    . ARG D  1 158 ? -5.637  49.890  2.152   1.00 63.83  ? 299 ARG D CG    1 
ATOM   10147 C  CD    . ARG D  1 158 ? -6.289  49.813  0.790   1.00 71.33  ? 299 ARG D CD    1 
ATOM   10148 N  NE    . ARG D  1 158 ? -6.128  48.487  0.205   1.00 79.23  ? 299 ARG D NE    1 
ATOM   10149 C  CZ    . ARG D  1 158 ? -7.130  47.655  -0.064  1.00 85.79  ? 299 ARG D CZ    1 
ATOM   10150 N  NH1   . ARG D  1 158 ? -8.385  48.009  0.181   1.00 88.00  ? 299 ARG D NH1   1 
ATOM   10151 N  NH2   . ARG D  1 158 ? -6.874  46.467  -0.591  1.00 88.00  ? 299 ARG D NH2   1 
ATOM   10152 N  N     . ASN D  1 159 ? -1.420  48.252  4.098   1.00 59.47  ? 300 ASN D N     1 
ATOM   10153 C  CA    . ASN D  1 159 ? 0.008   47.970  4.003   1.00 56.91  ? 300 ASN D CA    1 
ATOM   10154 C  C     . ASN D  1 159 ? 0.134   46.873  2.978   1.00 56.26  ? 300 ASN D C     1 
ATOM   10155 O  O     . ASN D  1 159 ? 0.497   45.752  3.333   1.00 57.62  ? 300 ASN D O     1 
ATOM   10156 C  CB    . ASN D  1 159 ? 0.537   47.438  5.333   1.00 56.25  ? 300 ASN D CB    1 
ATOM   10157 C  CG    . ASN D  1 159 ? 1.258   48.490  6.145   1.00 59.66  ? 300 ASN D CG    1 
ATOM   10158 O  OD1   . ASN D  1 159 ? 1.558   48.279  7.320   1.00 61.51  ? 300 ASN D OD1   1 
ATOM   10159 N  ND2   . ASN D  1 159 ? 1.545   49.627  5.527   1.00 62.87  ? 300 ASN D ND2   1 
ATOM   10160 N  N     . PRO D  1 160 ? -0.037  47.216  1.693   1.00 55.56  ? 301 PRO D N     1 
ATOM   10161 C  CA    . PRO D  1 160 ? -0.768  46.400  0.724   1.00 53.39  ? 301 PRO D CA    1 
ATOM   10162 C  C     . PRO D  1 160 ? -1.963  45.655  1.341   1.00 52.95  ? 301 PRO D C     1 
ATOM   10163 O  O     . PRO D  1 160 ? -3.098  46.088  1.137   1.00 48.60  ? 301 PRO D O     1 
ATOM   10164 C  CB    . PRO D  1 160 ? 0.328   45.479  0.195   1.00 47.48  ? 301 PRO D CB    1 
ATOM   10165 C  CG    . PRO D  1 160 ? 1.619   46.405  0.274   1.00 49.56  ? 301 PRO D CG    1 
ATOM   10166 C  CD    . PRO D  1 160 ? 1.215   47.661  1.071   1.00 52.64  ? 301 PRO D CD    1 
ATOM   10167 N  N     . GLU D  1 161 ? -1.709  44.567  2.065   1.00 56.15  ? 302 GLU D N     1 
ATOM   10168 C  CA    . GLU D  1 161 ? -2.714  43.883  2.882   1.00 56.18  ? 302 GLU D CA    1 
ATOM   10169 C  C     . GLU D  1 161 ? -3.622  44.830  3.679   1.00 49.19  ? 302 GLU D C     1 
ATOM   10170 O  O     . GLU D  1 161 ? -3.234  45.955  4.008   1.00 47.28  ? 302 GLU D O     1 
ATOM   10171 C  CB    . GLU D  1 161 ? -2.023  42.910  3.842   1.00 61.32  ? 302 GLU D CB    1 
ATOM   10172 C  CG    . GLU D  1 161 ? -1.135  43.592  4.880   1.00 69.36  ? 302 GLU D CG    1 
ATOM   10173 C  CD    . GLU D  1 161 ? -0.261  42.619  5.653   1.00 79.15  ? 302 GLU D CD    1 
ATOM   10174 O  OE1   . GLU D  1 161 ? -0.279  41.415  5.321   1.00 83.39  ? 302 GLU D OE1   1 
ATOM   10175 O  OE2   . GLU D  1 161 ? 0.447   43.058  6.590   1.00 80.03  ? 302 GLU D OE2   1 
ATOM   10176 N  N     . GLU D  1 162 ? -4.830  44.361  3.987   1.00 49.33  ? 303 GLU D N     1 
ATOM   10177 C  CA    . GLU D  1 162 ? -5.819  45.169  4.702   1.00 51.39  ? 303 GLU D CA    1 
ATOM   10178 C  C     . GLU D  1 162 ? -5.744  44.998  6.217   1.00 46.86  ? 303 GLU D C     1 
ATOM   10179 O  O     . GLU D  1 162 ? -5.539  43.890  6.720   1.00 45.62  ? 303 GLU D O     1 
ATOM   10180 C  CB    . GLU D  1 162 ? -7.227  44.831  4.218   1.00 55.81  ? 303 GLU D CB    1 
ATOM   10181 C  CG    . GLU D  1 162 ? -7.957  45.999  3.579   1.00 62.21  ? 303 GLU D CG    1 
ATOM   10182 C  CD    . GLU D  1 162 ? -8.791  45.563  2.396   1.00 67.11  ? 303 GLU D CD    1 
ATOM   10183 O  OE1   . GLU D  1 162 ? -8.286  44.759  1.585   1.00 69.44  ? 303 GLU D OE1   1 
ATOM   10184 O  OE2   . GLU D  1 162 ? -9.946  46.020  2.278   1.00 67.12  ? 303 GLU D OE2   1 
ATOM   10185 N  N     . ILE D  1 163 ? -5.922  46.104  6.938   1.00 44.19  ? 304 ILE D N     1 
ATOM   10186 C  CA    . ILE D  1 163 ? -5.868  46.098  8.396   1.00 41.89  ? 304 ILE D CA    1 
ATOM   10187 C  C     . ILE D  1 163 ? -6.966  46.977  8.990   1.00 42.24  ? 304 ILE D C     1 
ATOM   10188 O  O     . ILE D  1 163 ? -7.071  48.152  8.644   1.00 40.49  ? 304 ILE D O     1 
ATOM   10189 C  CB    . ILE D  1 163 ? -4.512  46.626  8.903   1.00 38.69  ? 304 ILE D CB    1 
ATOM   10190 C  CG1   . ILE D  1 163 ? -3.364  45.751  8.403   1.00 37.17  ? 304 ILE D CG1   1 
ATOM   10191 C  CG2   . ILE D  1 163 ? -4.494  46.685  10.414  1.00 38.44  ? 304 ILE D CG2   1 
ATOM   10192 C  CD1   . ILE D  1 163 ? -2.001  46.361  8.617   1.00 38.84  ? 304 ILE D CD1   1 
ATOM   10193 N  N     . SER D  1 164 ? -7.773  46.415  9.889   1.00 42.31  ? 305 SER D N     1 
ATOM   10194 C  CA    . SER D  1 164 ? -8.789  47.197  10.593  1.00 39.76  ? 305 SER D CA    1 
ATOM   10195 C  C     . SER D  1 164 ? -8.291  47.617  11.977  1.00 41.75  ? 305 SER D C     1 
ATOM   10196 O  O     . SER D  1 164 ? -7.780  46.791  12.735  1.00 46.34  ? 305 SER D O     1 
ATOM   10197 C  CB    . SER D  1 164 ? -10.088 46.408  10.729  1.00 38.99  ? 305 SER D CB    1 
ATOM   10198 O  OG    . SER D  1 164 ? -9.939  45.319  11.624  1.00 41.00  ? 305 SER D OG    1 
ATOM   10199 N  N     . VAL D  1 165 ? -8.427  48.902  12.296  1.00 36.42  ? 306 VAL D N     1 
ATOM   10200 C  CA    . VAL D  1 165 ? -8.006  49.415  13.595  1.00 35.68  ? 306 VAL D CA    1 
ATOM   10201 C  C     . VAL D  1 165 ? -9.152  50.171  14.275  1.00 36.25  ? 306 VAL D C     1 
ATOM   10202 O  O     . VAL D  1 165 ? -9.517  51.271  13.855  1.00 39.91  ? 306 VAL D O     1 
ATOM   10203 C  CB    . VAL D  1 165 ? -6.760  50.331  13.475  1.00 30.05  ? 306 VAL D CB    1 
ATOM   10204 C  CG1   . VAL D  1 165 ? -6.320  50.819  14.846  1.00 25.87  ? 306 VAL D CG1   1 
ATOM   10205 C  CG2   . VAL D  1 165 ? -5.620  49.601  12.799  1.00 29.70  ? 306 VAL D CG2   1 
ATOM   10206 N  N     . ASP D  1 166 ? -9.720  49.572  15.320  1.00 32.99  ? 307 ASP D N     1 
ATOM   10207 C  CA    . ASP D  1 166 ? -10.797 50.204  16.075  1.00 34.05  ? 307 ASP D CA    1 
ATOM   10208 C  C     . ASP D  1 166 ? -10.253 51.190  17.109  1.00 37.84  ? 307 ASP D C     1 
ATOM   10209 O  O     . ASP D  1 166 ? -9.489  50.805  18.003  1.00 40.40  ? 307 ASP D O     1 
ATOM   10210 C  CB    . ASP D  1 166 ? -11.654 49.150  16.784  1.00 35.07  ? 307 ASP D CB    1 
ATOM   10211 C  CG    . ASP D  1 166 ? -12.435 48.277  15