data_4LG8
# 
_entry.id   4LG8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.288 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4LG8         
RCSB  RCSB080590   
WWPDB D_1000080590 
# 
_pdbx_database_status.entry_id                        4LG8 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-06-27 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xu, C.'                               1  
'Tempel, W.'                           2  
'He, H.'                               3  
'Dobrovetsky, E.'                      4  
'Seitova, A.'                          5  
'Bountra, C.'                          6  
'Arrowsmith, C.H.'                     7  
'Edwards, A.M.'                        8  
'Min, J.'                              9  
'Structural Genomics Consortium (SGC)' 10 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the WD40 domain of human PRPF19.' 
_citation.journal_abbrev            'Biochem. Biophys. Res. Commun.' 
_citation.journal_volume            493 
_citation.page_first                1250 
_citation.page_last                 1253 
_citation.year                      2017 
_citation.journal_id_ASTM           BBRCA9 
_citation.country                   US 
_citation.journal_id_ISSN           1090-2104 
_citation.journal_id_CSD            0146 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   28962858 
_citation.pdbx_database_id_DOI      10.1016/j.bbrc.2017.09.145 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, Y.' 1 
primary 'Li, Y.'    2 
primary 'Liang, X.' 3 
primary 'Zhu, Z.'   4 
primary 'Sun, H.'   5 
primary 'He, H.'    6 
primary 'Min, J.'   7 
primary 'Liao, S.'  8 
primary 'Liu, Y.'   9 
# 
_cell.entry_id           4LG8 
_cell.length_a           83.055 
_cell.length_b           83.055 
_cell.length_c           75.533 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              6 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4LG8 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.Int_Tables_number                152 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Pre-mRNA-processing factor 19' 39059.914 1   ? K189E 'UNP residues 169-504' ? 
2 non-polymer syn 'SODIUM ION'                    22.990    2   ? ?     ?                      ? 
3 non-polymer syn 'UNKNOWN ATOM OR ION'           ?         14  ? ?     ?                      ? 
4 water       nat water                           18.015    135 ? ?     ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Nuclear matrix protein 200, PRP19/PSO4 homolog, hPso4, Senescence evasion factor' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGRENLYFQGTPEIIQKLQDKATVLTTERKERGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLC
PSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVT
GLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPG
HSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILH
FTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGRENLYFQGTPEIIQKLQDKATVLTTERKERGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLC
PSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVT
GLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPG
HSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILH
FTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  ARG n 
1 12  GLU n 
1 13  ASN n 
1 14  LEU n 
1 15  TYR n 
1 16  PHE n 
1 17  GLN n 
1 18  GLY n 
1 19  THR n 
1 20  PRO n 
1 21  GLU n 
1 22  ILE n 
1 23  ILE n 
1 24  GLN n 
1 25  LYS n 
1 26  LEU n 
1 27  GLN n 
1 28  ASP n 
1 29  LYS n 
1 30  ALA n 
1 31  THR n 
1 32  VAL n 
1 33  LEU n 
1 34  THR n 
1 35  THR n 
1 36  GLU n 
1 37  ARG n 
1 38  LYS n 
1 39  GLU n 
1 40  ARG n 
1 41  GLY n 
1 42  LYS n 
1 43  THR n 
1 44  VAL n 
1 45  PRO n 
1 46  GLU n 
1 47  GLU n 
1 48  LEU n 
1 49  VAL n 
1 50  LYS n 
1 51  PRO n 
1 52  GLU n 
1 53  GLU n 
1 54  LEU n 
1 55  SER n 
1 56  LYS n 
1 57  TYR n 
1 58  ARG n 
1 59  GLN n 
1 60  VAL n 
1 61  ALA n 
1 62  SER n 
1 63  HIS n 
1 64  VAL n 
1 65  GLY n 
1 66  LEU n 
1 67  HIS n 
1 68  SER n 
1 69  ALA n 
1 70  SER n 
1 71  ILE n 
1 72  PRO n 
1 73  GLY n 
1 74  ILE n 
1 75  LEU n 
1 76  ALA n 
1 77  LEU n 
1 78  ASP n 
1 79  LEU n 
1 80  CYS n 
1 81  PRO n 
1 82  SER n 
1 83  ASP n 
1 84  THR n 
1 85  ASN n 
1 86  LYS n 
1 87  ILE n 
1 88  LEU n 
1 89  THR n 
1 90  GLY n 
1 91  GLY n 
1 92  ALA n 
1 93  ASP n 
1 94  LYS n 
1 95  ASN n 
1 96  VAL n 
1 97  VAL n 
1 98  VAL n 
1 99  PHE n 
1 100 ASP n 
1 101 LYS n 
1 102 SER n 
1 103 SER n 
1 104 GLU n 
1 105 GLN n 
1 106 ILE n 
1 107 LEU n 
1 108 ALA n 
1 109 THR n 
1 110 LEU n 
1 111 LYS n 
1 112 GLY n 
1 113 HIS n 
1 114 THR n 
1 115 LYS n 
1 116 LYS n 
1 117 VAL n 
1 118 THR n 
1 119 SER n 
1 120 VAL n 
1 121 VAL n 
1 122 PHE n 
1 123 HIS n 
1 124 PRO n 
1 125 SER n 
1 126 GLN n 
1 127 ASP n 
1 128 LEU n 
1 129 VAL n 
1 130 PHE n 
1 131 SER n 
1 132 ALA n 
1 133 SER n 
1 134 PRO n 
1 135 ASP n 
1 136 ALA n 
1 137 THR n 
1 138 ILE n 
1 139 ARG n 
1 140 ILE n 
1 141 TRP n 
1 142 SER n 
1 143 VAL n 
1 144 PRO n 
1 145 ASN n 
1 146 ALA n 
1 147 SER n 
1 148 CYS n 
1 149 VAL n 
1 150 GLN n 
1 151 VAL n 
1 152 VAL n 
1 153 ARG n 
1 154 ALA n 
1 155 HIS n 
1 156 GLU n 
1 157 SER n 
1 158 ALA n 
1 159 VAL n 
1 160 THR n 
1 161 GLY n 
1 162 LEU n 
1 163 SER n 
1 164 LEU n 
1 165 HIS n 
1 166 ALA n 
1 167 THR n 
1 168 GLY n 
1 169 ASP n 
1 170 TYR n 
1 171 LEU n 
1 172 LEU n 
1 173 SER n 
1 174 SER n 
1 175 SER n 
1 176 ASP n 
1 177 ASP n 
1 178 GLN n 
1 179 TYR n 
1 180 TRP n 
1 181 ALA n 
1 182 PHE n 
1 183 SER n 
1 184 ASP n 
1 185 ILE n 
1 186 GLN n 
1 187 THR n 
1 188 GLY n 
1 189 ARG n 
1 190 VAL n 
1 191 LEU n 
1 192 THR n 
1 193 LYS n 
1 194 VAL n 
1 195 THR n 
1 196 ASP n 
1 197 GLU n 
1 198 THR n 
1 199 SER n 
1 200 GLY n 
1 201 CYS n 
1 202 SER n 
1 203 LEU n 
1 204 THR n 
1 205 CYS n 
1 206 ALA n 
1 207 GLN n 
1 208 PHE n 
1 209 HIS n 
1 210 PRO n 
1 211 ASP n 
1 212 GLY n 
1 213 LEU n 
1 214 ILE n 
1 215 PHE n 
1 216 GLY n 
1 217 THR n 
1 218 GLY n 
1 219 THR n 
1 220 MET n 
1 221 ASP n 
1 222 SER n 
1 223 GLN n 
1 224 ILE n 
1 225 LYS n 
1 226 ILE n 
1 227 TRP n 
1 228 ASP n 
1 229 LEU n 
1 230 LYS n 
1 231 GLU n 
1 232 ARG n 
1 233 THR n 
1 234 ASN n 
1 235 VAL n 
1 236 ALA n 
1 237 ASN n 
1 238 PHE n 
1 239 PRO n 
1 240 GLY n 
1 241 HIS n 
1 242 SER n 
1 243 GLY n 
1 244 PRO n 
1 245 ILE n 
1 246 THR n 
1 247 SER n 
1 248 ILE n 
1 249 ALA n 
1 250 PHE n 
1 251 SER n 
1 252 GLU n 
1 253 ASN n 
1 254 GLY n 
1 255 TYR n 
1 256 TYR n 
1 257 LEU n 
1 258 ALA n 
1 259 THR n 
1 260 ALA n 
1 261 ALA n 
1 262 ASP n 
1 263 ASP n 
1 264 SER n 
1 265 SER n 
1 266 VAL n 
1 267 LYS n 
1 268 LEU n 
1 269 TRP n 
1 270 ASP n 
1 271 LEU n 
1 272 ARG n 
1 273 LYS n 
1 274 LEU n 
1 275 LYS n 
1 276 ASN n 
1 277 PHE n 
1 278 LYS n 
1 279 THR n 
1 280 LEU n 
1 281 GLN n 
1 282 LEU n 
1 283 ASP n 
1 284 ASN n 
1 285 ASN n 
1 286 PHE n 
1 287 GLU n 
1 288 VAL n 
1 289 LYS n 
1 290 SER n 
1 291 LEU n 
1 292 ILE n 
1 293 PHE n 
1 294 ASP n 
1 295 GLN n 
1 296 SER n 
1 297 GLY n 
1 298 THR n 
1 299 TYR n 
1 300 LEU n 
1 301 ALA n 
1 302 LEU n 
1 303 GLY n 
1 304 GLY n 
1 305 THR n 
1 306 ASP n 
1 307 VAL n 
1 308 GLN n 
1 309 ILE n 
1 310 TYR n 
1 311 ILE n 
1 312 CYS n 
1 313 LYS n 
1 314 GLN n 
1 315 TRP n 
1 316 THR n 
1 317 GLU n 
1 318 ILE n 
1 319 LEU n 
1 320 HIS n 
1 321 PHE n 
1 322 THR n 
1 323 GLU n 
1 324 HIS n 
1 325 SER n 
1 326 GLY n 
1 327 LEU n 
1 328 THR n 
1 329 THR n 
1 330 GLY n 
1 331 VAL n 
1 332 ALA n 
1 333 PHE n 
1 334 GLY n 
1 335 HIS n 
1 336 HIS n 
1 337 ALA n 
1 338 LYS n 
1 339 PHE n 
1 340 ILE n 
1 341 ALA n 
1 342 SER n 
1 343 THR n 
1 344 GLY n 
1 345 MET n 
1 346 ASP n 
1 347 ARG n 
1 348 SER n 
1 349 LEU n 
1 350 LYS n 
1 351 PHE n 
1 352 TYR n 
1 353 SER n 
1 354 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PRPF19, NMP200, PRP19, SNEV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            sf9 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            SF9 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pFBOH-MHL 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PRP19_HUMAN 
_struct_ref.pdbx_db_accession          Q9UMS4 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVV
FDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQ
YWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLA
TAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAK
FIASTGMDRSLKFYSL
;
_struct_ref.pdbx_align_begin           169 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4LG8 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 19 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 354 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UMS4 
_struct_ref_seq.db_align_beg                  169 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  504 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       169 
_struct_ref_seq.pdbx_auth_seq_align_end       504 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4LG8 MET A 1  ? UNP Q9UMS4 ?   ?   'EXPRESSION TAG'      151 1  
1 4LG8 HIS A 2  ? UNP Q9UMS4 ?   ?   'EXPRESSION TAG'      152 2  
1 4LG8 HIS A 3  ? UNP Q9UMS4 ?   ?   'EXPRESSION TAG'      153 3  
1 4LG8 HIS A 4  ? UNP Q9UMS4 ?   ?   'EXPRESSION TAG'      154 4  
1 4LG8 HIS A 5  ? UNP Q9UMS4 ?   ?   'EXPRESSION TAG'      155 5  
1 4LG8 HIS A 6  ? UNP Q9UMS4 ?   ?   'EXPRESSION TAG'      156 6  
1 4LG8 HIS A 7  ? UNP Q9UMS4 ?   ?   'EXPRESSION TAG'      157 7  
1 4LG8 SER A 8  ? UNP Q9UMS4 ?   ?   'EXPRESSION TAG'      158 8  
1 4LG8 SER A 9  ? UNP Q9UMS4 ?   ?   'EXPRESSION TAG'      159 9  
1 4LG8 GLY A 10 ? UNP Q9UMS4 ?   ?   'EXPRESSION TAG'      160 10 
1 4LG8 ARG A 11 ? UNP Q9UMS4 ?   ?   'EXPRESSION TAG'      161 11 
1 4LG8 GLU A 12 ? UNP Q9UMS4 ?   ?   'EXPRESSION TAG'      162 12 
1 4LG8 ASN A 13 ? UNP Q9UMS4 ?   ?   'EXPRESSION TAG'      163 13 
1 4LG8 LEU A 14 ? UNP Q9UMS4 ?   ?   'EXPRESSION TAG'      164 14 
1 4LG8 TYR A 15 ? UNP Q9UMS4 ?   ?   'EXPRESSION TAG'      165 15 
1 4LG8 PHE A 16 ? UNP Q9UMS4 ?   ?   'EXPRESSION TAG'      166 16 
1 4LG8 GLN A 17 ? UNP Q9UMS4 ?   ?   'EXPRESSION TAG'      167 17 
1 4LG8 GLY A 18 ? UNP Q9UMS4 ?   ?   'EXPRESSION TAG'      168 18 
1 4LG8 GLU A 39 ? UNP Q9UMS4 LYS 189 'ENGINEERED MUTATION' 189 19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'       ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE              ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE             ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                 ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE            ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE            ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'          ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE               ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE              ? 'C9 H11 N O3'    181.189 
UNX non-polymer         . 'UNKNOWN ATOM OR ION' ? ?                ?       
VAL 'L-peptide linking' y VALINE                ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4LG8 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   44.2 
_exptl_crystal.density_Matthews      2.2 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    '20% PEG-3350, 0.2 M disodium tartrate, vapor diffusion, temperature 291K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS' 
_diffrn_detector.pdbx_collection_date   2013-03-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'Rigaku FR-E' 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     4LG8 
_reflns.d_resolution_high            1.890 
_reflns.d_resolution_low             40.000 
_reflns.number_obs                   24511 
_reflns.pdbx_Rmerge_I_obs            0.088 
_reflns.pdbx_netI_over_sigmaI        10.600 
_reflns.pdbx_chi_squared             1.936 
_reflns.pdbx_redundancy              10.300 
_reflns.percent_possible_obs         100.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.890 1.920  ? ? ? 0.986 ? ? 1.355 9.900  ? 1181 100.000 1  1 
1.920 1.960  ? ? ? 0.895 ? ? 1.381 9.900  ? 1213 100.000 2  1 
1.960 2.000  ? ? ? 0.724 ? ? 1.491 10.000 ? 1205 100.000 3  1 
2.000 2.040  ? ? ? 0.634 ? ? 1.494 10.200 ? 1225 100.000 4  1 
2.040 2.080  ? ? ? 0.511 ? ? 1.543 10.200 ? 1205 100.000 5  1 
2.080 2.130  ? ? ? 0.443 ? ? 1.635 10.200 ? 1214 100.000 6  1 
2.130 2.180  ? ? ? 0.384 ? ? 1.703 10.200 ? 1198 100.000 7  1 
2.180 2.240  ? ? ? 0.311 ? ? 1.830 10.300 ? 1240 100.000 8  1 
2.240 2.310  ? ? ? 0.284 ? ? 1.820 10.300 ? 1190 100.000 9  1 
2.310 2.380  ? ? ? 0.257 ? ? 1.843 10.400 ? 1214 100.000 10 1 
2.380 2.470  ? ? ? 0.216 ? ? 1.885 10.400 ? 1233 100.000 11 1 
2.470 2.560  ? ? ? 0.188 ? ? 1.914 10.500 ? 1206 100.000 12 1 
2.560 2.680  ? ? ? 0.163 ? ? 1.956 10.500 ? 1238 100.000 13 1 
2.680 2.820  ? ? ? 0.119 ? ? 2.026 10.500 ? 1204 100.000 14 1 
2.820 3.000  ? ? ? 0.101 ? ? 2.127 10.500 ? 1228 100.000 15 1 
3.000 3.230  ? ? ? 0.078 ? ? 2.211 10.500 ? 1225 100.000 16 1 
3.230 3.560  ? ? ? 0.056 ? ? 2.281 10.500 ? 1246 100.000 17 1 
3.560 4.070  ? ? ? 0.048 ? ? 2.489 10.400 ? 1247 100.000 18 1 
4.070 5.130  ? ? ? 0.041 ? ? 2.553 10.300 ? 1269 100.000 19 1 
5.130 40.000 ? ? ? 0.052 ? ? 2.980 9.600  ? 1330 100.000 20 1 
# 
_refine.entry_id                                 4LG8 
_refine.ls_d_res_high                            1.8900 
_refine.ls_d_res_low                             30.0000 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.7100 
_refine.ls_number_reflns_obs                     24457 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
'phenix, arp/warp, coot and the molprobity server were also used during refinement.' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1581 
_refine.ls_R_factor_R_work                       0.1560 
_refine.ls_wR_factor_R_work                      0.1418 
_refine.ls_R_factor_R_free                       0.1968 
_refine.ls_wR_factor_R_free                      0.1761 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  1231 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               33.7748 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.8000 
_refine.aniso_B[2][2]                            -0.8000 
_refine.aniso_B[3][3]                            2.6100 
_refine.aniso_B[1][2]                            -0.8000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9740 
_refine.correlation_coeff_Fo_to_Fc_free          0.9620 
_refine.overall_SU_R_Cruickshank_DPI             0.1321 
_refine.overall_SU_R_free                        0.1251 
_refine.pdbx_overall_ESU_R                       0.1320 
_refine.pdbx_overall_ESU_R_Free                  0.1250 
_refine.overall_SU_ML                            0.0870 
_refine.overall_SU_B                             5.8560 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3OW8, 2YMU, 2CO0' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8726 
_refine.B_iso_max                                92.500 
_refine.B_iso_min                                18.760 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2353 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         16 
_refine_hist.number_atoms_solvent             135 
_refine_hist.number_atoms_total               2504 
_refine_hist.d_res_high                       1.8900 
_refine_hist.d_res_low                        30.0000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       2439 0.016  0.019  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         2269 0.002  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    3325 1.458  1.937  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      5230 0.807  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 315  7.198  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 99   35.020 24.646 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 391  12.098 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 6    26.350 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         389  0.094  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   2774 0.006  0.020  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     558  0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            1245 1.890  2.140  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_other         1244 1.884  2.139  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           1556 2.596  3.201  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       1.8900 
_refine_ls_shell.d_res_low                        1.9390 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               97.8100 
_refine_ls_shell.number_reflns_R_work             1649 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2310 
_refine_ls_shell.R_factor_R_free                  0.2650 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             95 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1744 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4LG8 
_struct.title                     'Crystal structure of PRPF19 WD40 repeats' 
_struct.pdbx_descriptor           'Pre-mRNA-processing factor 19' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4LG8 
_struct_keywords.text            'Structural Genomics Consortium, SGC, wd40 repeat, DNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 3 ? 
R N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 50  ? SER A 55  ? LYS A 200 SER A 205 1 ? 6 
HELX_P HELX_P2 2 HIS A 335 ? LYS A 338 ? HIS A 485 LYS A 488 5 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B NA  .   NA ? ? ? 1_555 R HOH . O  ? ? A NA  601 A HOH 702 1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc2 metalc ? ? A THR 322 O  ? ? ? 1_555 C NA  . NA ? ? A THR 472 A NA  602 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc3 metalc ? ? A ASP 262 O  ? ? ? 1_555 B NA  . NA ? ? A ASP 412 A NA  601 1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc4 metalc ? ? B NA  .   NA ? ? ? 1_555 R HOH . O  ? ? A NA  601 A HOH 701 1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc5 metalc ? ? A SER 264 OG ? ? ? 1_555 B NA  . NA ? ? A SER 414 A NA  601 1_555 ? ? ? ? ? ? ? 2.389 ? 
metalc6 metalc ? ? B NA  .   NA ? ? ? 1_555 R HOH . O  ? ? A NA  601 A HOH 703 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc7 metalc ? ? C NA  .   NA ? ? ? 1_555 R HOH . O  ? ? A NA  602 A HOH 726 1_555 ? ? ? ? ? ? ? 2.506 ? 
metalc8 metalc ? ? A ASN 284 O  ? ? ? 1_555 B NA  . NA ? ? A ASN 434 A NA  601 1_555 ? ? ? ? ? ? ? 2.541 ? 
metalc9 metalc ? ? C NA  .   NA ? ? ? 1_555 R HOH . O  ? ? A NA  602 A HOH 809 1_555 ? ? ? ? ? ? ? 2.622 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 58  ? HIS A 63  ? ARG A 208 HIS A 213 
A 2 LEU A 349 ? SER A 353 ? LEU A 499 SER A 503 
A 3 ILE A 340 ? GLY A 344 ? ILE A 490 GLY A 494 
A 4 THR A 328 ? PHE A 333 ? THR A 478 PHE A 483 
B 1 ILE A 74  ? CYS A 80  ? ILE A 224 CYS A 230 
B 2 ASP A 83  ? GLY A 91  ? ASP A 233 GLY A 241 
B 3 VAL A 96  ? ASP A 100 ? VAL A 246 ASP A 250 
B 4 GLN A 105 ? LEU A 110 ? GLN A 255 LEU A 260 
C 1 SER A 119 ? PHE A 122 ? SER A 269 PHE A 272 
C 2 LEU A 128 ? ALA A 132 ? LEU A 278 ALA A 282 
C 3 ILE A 138 ? SER A 142 ? ILE A 288 SER A 292 
C 4 SER A 147 ? VAL A 152 ? SER A 297 VAL A 302 
D 1 VAL A 159 ? LEU A 164 ? VAL A 309 LEU A 314 
D 2 TYR A 170 ? SER A 175 ? TYR A 320 SER A 325 
D 3 TYR A 179 ? ASP A 184 ? TYR A 329 ASP A 334 
D 4 VAL A 190 ? THR A 195 ? VAL A 340 THR A 345 
E 1 LEU A 203 ? PHE A 208 ? LEU A 353 PHE A 358 
E 2 ILE A 214 ? THR A 219 ? ILE A 364 THR A 369 
E 3 ILE A 224 ? ASP A 228 ? ILE A 374 ASP A 378 
E 4 THR A 233 ? PHE A 238 ? THR A 383 PHE A 388 
F 1 ILE A 245 ? PHE A 250 ? ILE A 395 PHE A 400 
F 2 TYR A 256 ? ALA A 261 ? TYR A 406 ALA A 411 
F 3 SER A 265 ? ASP A 270 ? SER A 415 ASP A 420 
F 4 LYS A 275 ? GLN A 281 ? LYS A 425 GLN A 431 
G 1 VAL A 288 ? PHE A 293 ? VAL A 438 PHE A 443 
G 2 TYR A 299 ? GLY A 304 ? TYR A 449 GLY A 454 
G 3 VAL A 307 ? ILE A 311 ? VAL A 457 ILE A 461 
G 4 THR A 316 ? PHE A 321 ? THR A 466 PHE A 471 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N HIS A 63  ? N HIS A 213 O LEU A 349 ? O LEU A 499 
A 2 3 O LYS A 350 ? O LYS A 500 N SER A 342 ? N SER A 492 
A 3 4 O ALA A 341 ? O ALA A 491 N ALA A 332 ? N ALA A 482 
B 1 2 N ASP A 78  ? N ASP A 228 O LEU A 88  ? O LEU A 238 
B 2 3 N ILE A 87  ? N ILE A 237 O PHE A 99  ? O PHE A 249 
B 3 4 N VAL A 96  ? N VAL A 246 O LEU A 110 ? O LEU A 260 
C 1 2 N VAL A 121 ? N VAL A 271 O PHE A 130 ? O PHE A 280 
C 2 3 N VAL A 129 ? N VAL A 279 O TRP A 141 ? O TRP A 291 
C 3 4 N ILE A 138 ? N ILE A 288 O VAL A 152 ? O VAL A 302 
D 1 2 N SER A 163 ? N SER A 313 O LEU A 172 ? O LEU A 322 
D 2 3 N SER A 173 ? N SER A 323 O ALA A 181 ? O ALA A 331 
D 3 4 N TRP A 180 ? N TRP A 330 O VAL A 194 ? O VAL A 344 
E 1 2 N GLN A 207 ? N GLN A 357 O GLY A 216 ? O GLY A 366 
E 2 3 N PHE A 215 ? N PHE A 365 O TRP A 227 ? O TRP A 377 
E 3 4 N ILE A 226 ? N ILE A 376 O ALA A 236 ? O ALA A 386 
F 1 2 N THR A 246 ? N THR A 396 O ALA A 260 ? O ALA A 410 
F 2 3 N LEU A 257 ? N LEU A 407 O TRP A 269 ? O TRP A 419 
F 3 4 N VAL A 266 ? N VAL A 416 O LEU A 280 ? O LEU A 430 
G 1 2 N ILE A 292 ? N ILE A 442 O ALA A 301 ? O ALA A 451 
G 2 3 N LEU A 302 ? N LEU A 452 O GLN A 308 ? O GLN A 458 
G 3 4 N ILE A 309 ? N ILE A 459 O ILE A 318 ? O ILE A 468 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 601' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 602' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 262 ? ASP A 412 . ? 1_555 ? 
2  AC1 6 SER A 264 ? SER A 414 . ? 1_555 ? 
3  AC1 6 ASN A 284 ? ASN A 434 . ? 1_555 ? 
4  AC1 6 HOH R .   ? HOH A 701 . ? 1_555 ? 
5  AC1 6 HOH R .   ? HOH A 702 . ? 1_555 ? 
6  AC1 6 HOH R .   ? HOH A 703 . ? 1_555 ? 
7  AC2 5 GLN A 150 ? GLN A 300 . ? 6_655 ? 
8  AC2 5 THR A 187 ? THR A 337 . ? 6_655 ? 
9  AC2 5 THR A 322 ? THR A 472 . ? 1_555 ? 
10 AC2 5 HOH R .   ? HOH A 726 . ? 1_555 ? 
11 AC2 5 HOH R .   ? HOH A 809 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4LG8 
_atom_sites.fract_transf_matrix[1][1]   0.012040 
_atom_sites.fract_transf_matrix[1][2]   0.006951 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013903 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013239 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
X  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 45  ? 38.271 -7.816  -12.652 1.00 79.42 ? 195 PRO A N   1 
ATOM   2    C  CA  . PRO A 1 45  ? 39.063 -6.584  -12.800 1.00 75.71 ? 195 PRO A CA  1 
ATOM   3    C  C   . PRO A 1 45  ? 40.568 -6.876  -12.798 1.00 70.83 ? 195 PRO A C   1 
ATOM   4    O  O   . PRO A 1 45  ? 41.113 -7.229  -11.765 1.00 61.14 ? 195 PRO A O   1 
ATOM   5    C  CB  . PRO A 1 45  ? 38.646 -5.742  -11.569 1.00 77.83 ? 195 PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 45  ? 37.926 -6.692  -10.627 1.00 78.99 ? 195 PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 45  ? 37.915 -8.075  -11.247 1.00 80.20 ? 195 PRO A CD  1 
ATOM   8    N  N   . GLU A 1 46  ? 41.228 -6.746  -13.955 1.00 68.28 ? 196 GLU A N   1 
ATOM   9    C  CA  . GLU A 1 46  ? 42.652 -7.142  -14.094 1.00 65.64 ? 196 GLU A CA  1 
ATOM   10   C  C   . GLU A 1 46  ? 43.561 -6.482  -13.054 1.00 60.74 ? 196 GLU A C   1 
ATOM   11   O  O   . GLU A 1 46  ? 44.550 -7.060  -12.634 1.00 63.73 ? 196 GLU A O   1 
ATOM   12   C  CB  . GLU A 1 46  ? 43.182 -6.838  -15.521 1.00 66.79 ? 196 GLU A CB  1 
ATOM   13   N  N   . GLU A 1 47  ? 43.207 -5.268  -12.644 1.00 59.96 ? 197 GLU A N   1 
ATOM   14   C  CA  . GLU A 1 47  ? 44.024 -4.469  -11.725 1.00 54.91 ? 197 GLU A CA  1 
ATOM   15   C  C   . GLU A 1 47  ? 43.919 -4.925  -10.247 1.00 44.98 ? 197 GLU A C   1 
ATOM   16   O  O   . GLU A 1 47  ? 44.754 -4.570  -9.408  1.00 41.89 ? 197 GLU A O   1 
ATOM   17   C  CB  . GLU A 1 47  ? 43.593 -2.990  -11.829 1.00 60.27 ? 197 GLU A CB  1 
ATOM   18   C  CG  . GLU A 1 47  ? 44.718 -1.986  -11.687 1.00 66.23 ? 197 GLU A CG  1 
ATOM   19   C  CD  . GLU A 1 47  ? 45.704 -2.077  -12.818 1.00 74.13 ? 197 GLU A CD  1 
ATOM   20   O  OE1 . GLU A 1 47  ? 45.285 -2.455  -13.936 1.00 83.49 ? 197 GLU A OE1 1 
ATOM   21   O  OE2 . GLU A 1 47  ? 46.896 -1.777  -12.589 1.00 79.89 ? 197 GLU A OE2 1 
ATOM   22   N  N   . LEU A 1 48  ? 42.869 -5.639  -9.911  1.00 40.44 ? 198 LEU A N   1 
ATOM   23   C  CA  . LEU A 1 48  ? 42.684 -6.025  -8.505  1.00 37.01 ? 198 LEU A CA  1 
ATOM   24   C  C   . LEU A 1 48  ? 43.818 -6.911  -7.974  1.00 35.42 ? 198 LEU A C   1 
ATOM   25   O  O   . LEU A 1 48  ? 44.202 -7.884  -8.621  1.00 32.98 ? 198 LEU A O   1 
ATOM   26   C  CB  . LEU A 1 48  ? 41.381 -6.770  -8.320  1.00 40.60 ? 198 LEU A CB  1 
ATOM   27   C  CG  . LEU A 1 48  ? 41.126 -7.279  -6.897  1.00 38.00 ? 198 LEU A CG  1 
ATOM   28   C  CD1 . LEU A 1 48  ? 40.739 -6.147  -5.974  1.00 39.67 ? 198 LEU A CD1 1 
ATOM   29   C  CD2 . LEU A 1 48  ? 40.040 -8.326  -6.908  1.00 39.10 ? 198 LEU A CD2 1 
ATOM   30   N  N   . VAL A 1 49  ? 44.306 -6.607  -6.774  1.00 33.00 ? 199 VAL A N   1 
ATOM   31   C  CA  . VAL A 1 49  ? 45.355 -7.399  -6.209  1.00 33.09 ? 199 VAL A CA  1 
ATOM   32   C  C   . VAL A 1 49  ? 44.750 -8.726  -5.706  1.00 32.83 ? 199 VAL A C   1 
ATOM   33   O  O   . VAL A 1 49  ? 43.854 -8.720  -4.843  1.00 32.84 ? 199 VAL A O   1 
ATOM   34   C  CB  . VAL A 1 49  ? 46.109 -6.646  -5.099  1.00 31.11 ? 199 VAL A CB  1 
ATOM   35   C  CG1 . VAL A 1 49  ? 47.141 -7.565  -4.436  1.00 32.09 ? 199 VAL A CG1 1 
ATOM   36   C  CG2 . VAL A 1 49  ? 46.778 -5.393  -5.670  1.00 33.24 ? 199 VAL A CG2 1 
ATOM   37   N  N   . LYS A 1 50  ? 45.285 -9.817  -6.217  1.00 32.34 ? 200 LYS A N   1 
ATOM   38   C  CA  A LYS A 1 50  ? 44.792 -11.178 -5.933  0.50 34.00 ? 200 LYS A CA  1 
ATOM   39   C  CA  B LYS A 1 50  ? 44.772 -11.158 -5.921  0.50 34.27 ? 200 LYS A CA  1 
ATOM   40   C  C   . LYS A 1 50  ? 45.328 -11.694 -4.572  1.00 32.65 ? 200 LYS A C   1 
ATOM   41   O  O   . LYS A 1 50  ? 46.277 -11.161 -4.058  1.00 32.79 ? 200 LYS A O   1 
ATOM   42   C  CB  A LYS A 1 50  ? 45.190 -12.138 -7.066  0.50 35.98 ? 200 LYS A CB  1 
ATOM   43   C  CB  B LYS A 1 50  ? 45.095 -12.106 -7.072  0.50 36.61 ? 200 LYS A CB  1 
ATOM   44   C  CG  A LYS A 1 50  ? 44.171 -12.263 -8.216  0.50 37.35 ? 200 LYS A CG  1 
ATOM   45   C  CG  B LYS A 1 50  ? 44.637 -11.600 -8.448  0.50 38.22 ? 200 LYS A CG  1 
ATOM   46   C  CD  A LYS A 1 50  ? 43.146 -11.139 -8.187  0.50 35.86 ? 200 LYS A CD  1 
ATOM   47   C  CD  B LYS A 1 50  ? 44.340 -12.736 -9.405  0.50 40.31 ? 200 LYS A CD  1 
ATOM   48   N  N   . PRO A 1 51  ? 44.712 -12.772 -4.006  1.00 35.12 ? 201 PRO A N   1 
ATOM   49   C  CA  . PRO A 1 51  ? 45.120 -13.207 -2.638  1.00 35.56 ? 201 PRO A CA  1 
ATOM   50   C  C   . PRO A 1 51  ? 46.600 -13.534 -2.437  1.00 35.35 ? 201 PRO A C   1 
ATOM   51   O  O   . PRO A 1 51  ? 47.150 -13.122 -1.438  1.00 35.57 ? 201 PRO A O   1 
ATOM   52   C  CB  . PRO A 1 51  ? 44.246 -14.433 -2.380  1.00 38.59 ? 201 PRO A CB  1 
ATOM   53   C  CG  . PRO A 1 51  ? 43.022 -14.187 -3.215  1.00 39.76 ? 201 PRO A CG  1 
ATOM   54   C  CD  . PRO A 1 51  ? 43.592 -13.600 -4.502  1.00 37.99 ? 201 PRO A CD  1 
ATOM   55   N  N   . GLU A 1 52  ? 47.247 -14.226 -3.374  1.00 36.28 ? 202 GLU A N   1 
ATOM   56   C  CA  . GLU A 1 52  ? 48.680 -14.538 -3.211  1.00 39.30 ? 202 GLU A CA  1 
ATOM   57   C  C   . GLU A 1 52  ? 49.497 -13.259 -2.916  1.00 38.88 ? 202 GLU A C   1 
ATOM   58   O  O   . GLU A 1 52  ? 50.286 -13.208 -1.941  1.00 35.05 ? 202 GLU A O   1 
ATOM   59   C  CB  . GLU A 1 52  ? 49.254 -15.298 -4.418  1.00 43.43 ? 202 GLU A CB  1 
ATOM   60   C  CG  . GLU A 1 52  ? 50.764 -15.610 -4.322  1.00 46.21 ? 202 GLU A CG  1 
ATOM   61   C  CD  . GLU A 1 52  ? 51.165 -16.391 -3.019  1.00 50.49 ? 202 GLU A CD  1 
ATOM   62   O  OE1 . GLU A 1 52  ? 50.375 -17.255 -2.552  1.00 49.70 ? 202 GLU A OE1 1 
ATOM   63   O  OE2 . GLU A 1 52  ? 52.274 -16.142 -2.466  1.00 50.48 ? 202 GLU A OE2 1 
ATOM   64   N  N   . GLU A 1 53  ? 49.267 -12.205 -3.706  1.00 37.64 ? 203 GLU A N   1 
ATOM   65   C  CA  . GLU A 1 53  ? 50.035 -10.969 -3.550  1.00 36.14 ? 203 GLU A CA  1 
ATOM   66   C  C   . GLU A 1 53  ? 49.576 -10.238 -2.289  1.00 32.17 ? 203 GLU A C   1 
ATOM   67   O  O   . GLU A 1 53  ? 50.396 -9.712  -1.510  1.00 30.63 ? 203 GLU A O   1 
ATOM   68   C  CB  . GLU A 1 53  ? 49.917 -10.081 -4.815  1.00 37.95 ? 203 GLU A CB  1 
ATOM   69   C  CG  . GLU A 1 53  ? 50.535 -8.689  -4.680  1.00 40.41 ? 203 GLU A CG  1 
ATOM   70   C  CD  . GLU A 1 53  ? 50.512 -7.831  -6.013  1.00 47.26 ? 203 GLU A CD  1 
ATOM   71   O  OE1 . GLU A 1 53  ? 50.038 -8.329  -7.054  1.00 42.53 ? 203 GLU A OE1 1 
ATOM   72   O  OE2 . GLU A 1 53  ? 50.962 -6.649  -5.987  1.00 51.46 ? 203 GLU A OE2 1 
ATOM   73   N  N   . LEU A 1 54  ? 48.270 -10.203 -2.057  1.00 31.42 ? 204 LEU A N   1 
ATOM   74   C  CA  . LEU A 1 54  ? 47.756 -9.522  -0.858  1.00 30.46 ? 204 LEU A CA  1 
ATOM   75   C  C   . LEU A 1 54  ? 48.357 -10.086 0.446   1.00 27.64 ? 204 LEU A C   1 
ATOM   76   O  O   . LEU A 1 54  ? 48.578 -9.346  1.394   1.00 27.92 ? 204 LEU A O   1 
ATOM   77   C  CB  . LEU A 1 54  ? 46.221 -9.645  -0.771  1.00 30.83 ? 204 LEU A CB  1 
ATOM   78   C  CG  . LEU A 1 54  ? 45.615 -8.592  0.110   1.00 32.77 ? 204 LEU A CG  1 
ATOM   79   C  CD1 . LEU A 1 54  ? 45.508 -7.289  -0.666  1.00 35.30 ? 204 LEU A CD1 1 
ATOM   80   C  CD2 . LEU A 1 54  ? 44.264 -9.021  0.638   1.00 34.69 ? 204 LEU A CD2 1 
ATOM   81   N  N   . SER A 1 55  ? 48.576 -11.399 0.468   1.00 29.19 ? 205 SER A N   1 
ATOM   82   C  CA  . SER A 1 55  ? 49.045 -12.108 1.664   1.00 29.05 ? 205 SER A CA  1 
ATOM   83   C  C   . SER A 1 55  ? 50.460 -11.651 2.116   1.00 29.69 ? 205 SER A C   1 
ATOM   84   O  O   . SER A 1 55  ? 50.883 -11.916 3.227   1.00 28.23 ? 205 SER A O   1 
ATOM   85   C  CB  . SER A 1 55  ? 48.995 -13.641 1.426   1.00 28.80 ? 205 SER A CB  1 
ATOM   86   O  OG  . SER A 1 55  ? 50.071 -14.076 0.597   1.00 29.96 ? 205 SER A OG  1 
ATOM   87   N  N   . LYS A 1 56  ? 51.177 -10.958 1.236   1.00 30.40 ? 206 LYS A N   1 
ATOM   88   C  CA  . LYS A 1 56  ? 52.525 -10.526 1.496   1.00 30.79 ? 206 LYS A CA  1 
ATOM   89   C  C   . LYS A 1 56  ? 52.605 -9.113  2.004   1.00 28.41 ? 206 LYS A C   1 
ATOM   90   O  O   . LYS A 1 56  ? 53.705 -8.603  2.222   1.00 27.03 ? 206 LYS A O   1 
ATOM   91   C  CB  . LYS A 1 56  ? 53.324 -10.606 0.210   1.00 34.57 ? 206 LYS A CB  1 
ATOM   92   C  CG  . LYS A 1 56  ? 53.410 -11.987 -0.356  1.00 38.61 ? 206 LYS A CG  1 
ATOM   93   C  CD  . LYS A 1 56  ? 54.232 -11.941 -1.609  1.00 42.63 ? 206 LYS A CD  1 
ATOM   94   C  CE  . LYS A 1 56  ? 54.118 -13.232 -2.376  1.00 47.24 ? 206 LYS A CE  1 
ATOM   95   N  NZ  . LYS A 1 56  ? 54.709 -12.983 -3.715  1.00 54.39 ? 206 LYS A NZ  1 
ATOM   96   N  N   . TYR A 1 57  ? 51.465 -8.461  2.188   1.00 28.96 ? 207 TYR A N   1 
ATOM   97   C  CA  . TYR A 1 57  ? 51.457 -7.079  2.689   1.00 28.97 ? 207 TYR A CA  1 
ATOM   98   C  C   . TYR A 1 57  ? 52.039 -6.976  4.119   1.00 29.75 ? 207 TYR A C   1 
ATOM   99   O  O   . TYR A 1 57  ? 51.891 -7.875  4.954   1.00 29.67 ? 207 TYR A O   1 
ATOM   100  C  CB  . TYR A 1 57  ? 50.028 -6.469  2.688   1.00 27.76 ? 207 TYR A CB  1 
ATOM   101  C  CG  . TYR A 1 57  ? 49.470 -6.038  1.302   1.00 25.88 ? 207 TYR A CG  1 
ATOM   102  C  CD1 . TYR A 1 57  ? 50.123 -6.352  0.131   1.00 27.56 ? 207 TYR A CD1 1 
ATOM   103  C  CD2 . TYR A 1 57  ? 48.301 -5.282  1.212   1.00 27.15 ? 207 TYR A CD2 1 
ATOM   104  C  CE1 . TYR A 1 57  ? 49.624 -5.985  -1.081  1.00 28.22 ? 207 TYR A CE1 1 
ATOM   105  C  CE2 . TYR A 1 57  ? 47.794 -4.891  -0.009  1.00 28.12 ? 207 TYR A CE2 1 
ATOM   106  C  CZ  . TYR A 1 57  ? 48.468 -5.246  -1.154  1.00 29.39 ? 207 TYR A CZ  1 
ATOM   107  O  OH  . TYR A 1 57  ? 48.001 -4.858  -2.388  1.00 29.60 ? 207 TYR A OH  1 
ATOM   108  N  N   . ARG A 1 58  ? 52.628 -5.815  4.382   1.00 29.65 ? 208 ARG A N   1 
ATOM   109  C  CA  . ARG A 1 58  ? 53.287 -5.503  5.627   1.00 30.51 ? 208 ARG A CA  1 
ATOM   110  C  C   . ARG A 1 58  ? 53.027 -4.030  5.885   1.00 29.83 ? 208 ARG A C   1 
ATOM   111  O  O   . ARG A 1 58  ? 52.724 -3.272  4.943   1.00 28.52 ? 208 ARG A O   1 
ATOM   112  C  CB  . ARG A 1 58  ? 54.798 -5.727  5.497   1.00 39.00 ? 208 ARG A CB  1 
ATOM   113  C  CG  . ARG A 1 58  ? 55.467 -4.823  4.437   1.00 45.30 ? 208 ARG A CG  1 
ATOM   114  C  CD  . ARG A 1 58  ? 56.810 -5.329  3.893   1.00 58.14 ? 208 ARG A CD  1 
ATOM   115  N  NE  . ARG A 1 58  ? 57.828 -5.365  4.939   1.00 64.84 ? 208 ARG A NE  1 
ATOM   116  C  CZ  . ARG A 1 58  ? 58.044 -6.392  5.772   1.00 71.64 ? 208 ARG A CZ  1 
ATOM   117  N  NH1 . ARG A 1 58  ? 58.998 -6.283  6.701   1.00 81.40 ? 208 ARG A NH1 1 
ATOM   118  N  NH2 . ARG A 1 58  ? 57.328 -7.527  5.694   1.00 67.43 ? 208 ARG A NH2 1 
ATOM   119  N  N   . GLN A 1 59  ? 53.184 -3.600  7.118   1.00 29.03 ? 209 GLN A N   1 
ATOM   120  C  CA  . GLN A 1 59  ? 53.166 -2.164  7.392   1.00 27.20 ? 209 GLN A CA  1 
ATOM   121  C  C   . GLN A 1 59  ? 54.277 -1.389  6.571   1.00 26.95 ? 209 GLN A C   1 
ATOM   122  O  O   . GLN A 1 59  ? 55.481 -1.708  6.658   1.00 29.25 ? 209 GLN A O   1 
ATOM   123  C  CB  . GLN A 1 59  ? 53.351 -1.890  8.851   1.00 27.12 ? 209 GLN A CB  1 
ATOM   124  C  CG  . GLN A 1 59  ? 53.325 -0.407  9.165   1.00 26.84 ? 209 GLN A CG  1 
ATOM   125  C  CD  . GLN A 1 59  ? 53.468 -0.116  10.639  1.00 29.39 ? 209 GLN A CD  1 
ATOM   126  O  OE1 . GLN A 1 59  ? 52.586 -0.388  11.406  1.00 28.88 ? 209 GLN A OE1 1 
ATOM   127  N  NE2 . GLN A 1 59  ? 54.552 0.482   11.012  1.00 31.59 ? 209 GLN A NE2 1 
ATOM   128  N  N   . VAL A 1 60  ? 53.841 -0.408  5.792   1.00 27.02 ? 210 VAL A N   1 
ATOM   129  C  CA  . VAL A 1 60  ? 54.770 0.455   4.985   1.00 30.06 ? 210 VAL A CA  1 
ATOM   130  C  C   . VAL A 1 60  ? 54.821 1.880   5.502   1.00 31.88 ? 210 VAL A C   1 
ATOM   131  O  O   . VAL A 1 60  ? 55.741 2.609   5.177   1.00 31.15 ? 210 VAL A O   1 
ATOM   132  C  CB  . VAL A 1 60  ? 54.465 0.459   3.441   1.00 29.43 ? 210 VAL A CB  1 
ATOM   133  C  CG1 . VAL A 1 60  ? 54.674 -0.945  2.839   1.00 29.84 ? 210 VAL A CG1 1 
ATOM   134  C  CG2 . VAL A 1 60  ? 53.080 0.959   3.112   1.00 29.80 ? 210 VAL A CG2 1 
ATOM   135  N  N   . ALA A 1 61  ? 53.846 2.294   6.305   1.00 29.80 ? 211 ALA A N   1 
ATOM   136  C  CA  . ALA A 1 61  ? 53.919 3.602   6.953   1.00 29.21 ? 211 ALA A CA  1 
ATOM   137  C  C   . ALA A 1 61  ? 53.057 3.632   8.199   1.00 27.89 ? 211 ALA A C   1 
ATOM   138  O  O   . ALA A 1 61  ? 52.067 2.903   8.313   1.00 25.66 ? 211 ALA A O   1 
ATOM   139  C  CB  . ALA A 1 61  ? 53.452 4.693   5.978   1.00 30.03 ? 211 ALA A CB  1 
ATOM   140  N  N   . SER A 1 62  ? 53.430 4.502   9.130   1.00 28.04 ? 212 SER A N   1 
ATOM   141  C  CA  . SER A 1 62  ? 52.662 4.713   10.326  1.00 25.76 ? 212 SER A CA  1 
ATOM   142  C  C   . SER A 1 62  ? 52.802 6.200   10.669  1.00 27.03 ? 212 SER A C   1 
ATOM   143  O  O   . SER A 1 62  ? 53.882 6.653   11.001  1.00 29.91 ? 212 SER A O   1 
ATOM   144  C  CB  . SER A 1 62  ? 53.185 3.837   11.447  1.00 25.82 ? 212 SER A CB  1 
ATOM   145  O  OG  . SER A 1 62  ? 52.303 3.962   12.540  1.00 24.41 ? 212 SER A OG  1 
ATOM   146  N  N   . HIS A 1 63  ? 51.727 6.941   10.495  1.00 24.34 ? 213 HIS A N   1 
ATOM   147  C  CA  . HIS A 1 63  ? 51.717 8.367   10.682  1.00 25.70 ? 213 HIS A CA  1 
ATOM   148  C  C   . HIS A 1 63  ? 51.037 8.700   12.019  1.00 25.48 ? 213 HIS A C   1 
ATOM   149  O  O   . HIS A 1 63  ? 49.877 8.359   12.208  1.00 23.43 ? 213 HIS A O   1 
ATOM   150  C  CB  . HIS A 1 63  ? 50.933 9.020   9.552   1.00 25.12 ? 213 HIS A CB  1 
ATOM   151  C  CG  . HIS A 1 63  ? 51.479 8.737   8.185   1.00 28.11 ? 213 HIS A CG  1 
ATOM   152  N  ND1 . HIS A 1 63  ? 52.628 9.317   7.713   1.00 31.92 ? 213 HIS A ND1 1 
ATOM   153  C  CD2 . HIS A 1 63  ? 51.015 7.953   7.181   1.00 28.56 ? 213 HIS A CD2 1 
ATOM   154  C  CE1 . HIS A 1 63  ? 52.872 8.878   6.487   1.00 32.92 ? 213 HIS A CE1 1 
ATOM   155  N  NE2 . HIS A 1 63  ? 51.892 8.077   6.128   1.00 29.79 ? 213 HIS A NE2 1 
ATOM   156  N  N   . VAL A 1 64  ? 51.733 9.363   12.929  1.00 29.50 ? 214 VAL A N   1 
ATOM   157  C  CA  . VAL A 1 64  ? 51.127 9.726   14.231  1.00 30.63 ? 214 VAL A CA  1 
ATOM   158  C  C   . VAL A 1 64  ? 50.745 11.187  14.396  1.00 31.23 ? 214 VAL A C   1 
ATOM   159  O  O   . VAL A 1 64  ? 50.078 11.539  15.376  1.00 31.09 ? 214 VAL A O   1 
ATOM   160  C  CB  . VAL A 1 64  ? 52.038 9.312   15.416  1.00 33.34 ? 214 VAL A CB  1 
ATOM   161  C  CG1 . VAL A 1 64  ? 52.195 7.790   15.439  1.00 34.95 ? 214 VAL A CG1 1 
ATOM   162  C  CG2 . VAL A 1 64  ? 53.384 10.020  15.353  1.00 34.97 ? 214 VAL A CG2 1 
ATOM   163  N  N   . GLY A 1 65  ? 51.096 12.041  13.450  1.00 28.59 ? 215 GLY A N   1 
ATOM   164  C  CA  . GLY A 1 65  ? 50.866 13.493  13.645  1.00 30.12 ? 215 GLY A CA  1 
ATOM   165  C  C   . GLY A 1 65  ? 49.580 14.097  13.069  1.00 28.08 ? 215 GLY A C   1 
ATOM   166  O  O   . GLY A 1 65  ? 49.486 15.324  12.997  1.00 30.92 ? 215 GLY A O   1 
ATOM   167  N  N   . LEU A 1 66  ? 48.594 13.273  12.668  1.00 25.86 ? 216 LEU A N   1 
ATOM   168  C  CA  . LEU A 1 66  ? 47.333 13.798  12.075  1.00 25.26 ? 216 LEU A CA  1 
ATOM   169  C  C   . LEU A 1 66  ? 46.517 14.560  13.118  1.00 26.62 ? 216 LEU A C   1 
ATOM   170  O  O   . LEU A 1 66  ? 45.954 15.618  12.810  1.00 26.26 ? 216 LEU A O   1 
ATOM   171  C  CB  . LEU A 1 66  ? 46.464 12.706  11.416  1.00 25.44 ? 216 LEU A CB  1 
ATOM   172  C  CG  . LEU A 1 66  ? 46.789 12.355  9.955   1.00 28.90 ? 216 LEU A CG  1 
ATOM   173  C  CD1 . LEU A 1 66  ? 48.202 11.823  9.836   1.00 32.71 ? 216 LEU A CD1 1 
ATOM   174  C  CD2 . LEU A 1 66  ? 45.787 11.385  9.344   1.00 29.09 ? 216 LEU A CD2 1 
ATOM   175  N  N   . HIS A 1 67  ? 46.521 14.043  14.346  1.00 24.94 ? 217 HIS A N   1 
ATOM   176  C  CA  . HIS A 1 67  ? 45.684 14.530  15.399  1.00 25.37 ? 217 HIS A CA  1 
ATOM   177  C  C   . HIS A 1 67  ? 46.535 14.820  16.638  1.00 27.91 ? 217 HIS A C   1 
ATOM   178  O  O   . HIS A 1 67  ? 47.727 14.416  16.736  1.00 27.68 ? 217 HIS A O   1 
ATOM   179  C  CB  . HIS A 1 67  ? 44.556 13.539  15.718  1.00 24.72 ? 217 HIS A CB  1 
ATOM   180  C  CG  . HIS A 1 67  ? 43.520 13.422  14.635  1.00 23.96 ? 217 HIS A CG  1 
ATOM   181  N  ND1 . HIS A 1 67  ? 42.380 14.192  14.613  1.00 22.61 ? 217 HIS A ND1 1 
ATOM   182  C  CD2 . HIS A 1 67  ? 43.464 12.636  13.522  1.00 21.22 ? 217 HIS A CD2 1 
ATOM   183  C  CE1 . HIS A 1 67  ? 41.656 13.880  13.548  1.00 25.09 ? 217 HIS A CE1 1 
ATOM   184  N  NE2 . HIS A 1 67  ? 42.283 12.931  12.878  1.00 20.09 ? 217 HIS A NE2 1 
ATOM   185  N  N   . SER A 1 68  ? 45.919 15.516  17.584  1.00 29.38 ? 218 SER A N   1 
ATOM   186  C  CA  . SER A 1 68  ? 46.632 16.012  18.752  1.00 31.89 ? 218 SER A CA  1 
ATOM   187  C  C   . SER A 1 68  ? 47.340 14.915  19.574  1.00 32.28 ? 218 SER A C   1 
ATOM   188  O  O   . SER A 1 68  ? 46.794 13.810  19.820  1.00 35.73 ? 218 SER A O   1 
ATOM   189  C  CB  . SER A 1 68  ? 45.695 16.849  19.647  1.00 32.61 ? 218 SER A CB  1 
ATOM   190  O  OG  . SER A 1 68  ? 46.208 16.910  20.954  1.00 40.26 ? 218 SER A OG  1 
ATOM   191  N  N   . ALA A 1 69  ? 48.569 15.234  19.981  1.00 38.56 ? 219 ALA A N   1 
ATOM   192  C  CA  . ALA A 1 69  ? 49.350 14.386  20.902  1.00 40.92 ? 219 ALA A CA  1 
ATOM   193  C  C   . ALA A 1 69  ? 48.764 14.404  22.294  1.00 38.90 ? 219 ALA A C   1 
ATOM   194  O  O   . ALA A 1 69  ? 48.812 13.390  22.993  1.00 40.56 ? 219 ALA A O   1 
ATOM   195  C  CB  . ALA A 1 69  ? 50.808 14.831  20.938  1.00 44.60 ? 219 ALA A CB  1 
ATOM   196  N  N   . SER A 1 70  ? 48.195 15.528  22.707  1.00 33.21 ? 220 SER A N   1 
ATOM   197  C  CA  . SER A 1 70  ? 47.670 15.615  24.078  1.00 34.75 ? 220 SER A CA  1 
ATOM   198  C  C   . SER A 1 70  ? 46.268 15.003  24.266  1.00 31.95 ? 220 SER A C   1 
ATOM   199  O  O   . SER A 1 70  ? 45.830 14.775  25.394  1.00 31.95 ? 220 SER A O   1 
ATOM   200  C  CB  . SER A 1 70  ? 47.699 17.044  24.592  1.00 35.51 ? 220 SER A CB  1 
ATOM   201  O  OG  . SER A 1 70  ? 46.639 17.834  24.139  1.00 34.65 ? 220 SER A OG  1 
ATOM   202  N  N   . ILE A 1 71  ? 45.554 14.775  23.165  1.00 31.08 ? 221 ILE A N   1 
ATOM   203  C  CA  . ILE A 1 71  ? 44.239 14.123  23.215  1.00 28.35 ? 221 ILE A CA  1 
ATOM   204  C  C   . ILE A 1 71  ? 44.342 13.021  22.207  1.00 29.70 ? 221 ILE A C   1 
ATOM   205  O  O   . ILE A 1 71  ? 43.845 13.134  21.078  1.00 28.28 ? 221 ILE A O   1 
ATOM   206  C  CB  . ILE A 1 71  ? 43.103 15.065  22.865  1.00 29.46 ? 221 ILE A CB  1 
ATOM   207  C  CG1 . ILE A 1 71  ? 43.139 16.306  23.775  1.00 30.34 ? 221 ILE A CG1 1 
ATOM   208  C  CG2 . ILE A 1 71  ? 41.755 14.350  23.005  1.00 26.75 ? 221 ILE A CG2 1 
ATOM   209  C  CD1 . ILE A 1 71  ? 42.139 17.380  23.401  1.00 29.98 ? 221 ILE A CD1 1 
ATOM   210  N  N   . PRO A 1 72  ? 44.979 11.944  22.608  1.00 31.60 ? 222 PRO A N   1 
ATOM   211  C  CA  . PRO A 1 72  ? 45.422 10.996  21.599  1.00 31.68 ? 222 PRO A CA  1 
ATOM   212  C  C   . PRO A 1 72  ? 44.319 10.054  21.085  1.00 32.27 ? 222 PRO A C   1 
ATOM   213  O  O   . PRO A 1 72  ? 43.438 9.633   21.865  1.00 30.62 ? 222 PRO A O   1 
ATOM   214  C  CB  . PRO A 1 72  ? 46.536 10.224  22.313  1.00 31.75 ? 222 PRO A CB  1 
ATOM   215  C  CG  . PRO A 1 72  ? 46.192 10.305  23.783  1.00 34.30 ? 222 PRO A CG  1 
ATOM   216  C  CD  . PRO A 1 72  ? 45.517 11.637  23.968  1.00 32.05 ? 222 PRO A CD  1 
ATOM   217  N  N   . GLY A 1 73  ? 44.382 9.766   19.778  1.00 25.62 ? 223 GLY A N   1 
ATOM   218  C  CA  . GLY A 1 73  ? 43.618 8.705   19.187  1.00 26.04 ? 223 GLY A CA  1 
ATOM   219  C  C   . GLY A 1 73  ? 42.839 9.114   17.970  1.00 25.68 ? 223 GLY A C   1 
ATOM   220  O  O   . GLY A 1 73  ? 42.340 10.237  17.878  1.00 24.66 ? 223 GLY A O   1 
ATOM   221  N  N   . ILE A 1 74  ? 42.785 8.203   17.002  1.00 22.39 ? 224 ILE A N   1 
ATOM   222  C  CA  . ILE A 1 74  ? 41.954 8.365   15.834  1.00 21.96 ? 224 ILE A CA  1 
ATOM   223  C  C   . ILE A 1 74  ? 40.822 7.371   15.992  1.00 22.41 ? 224 ILE A C   1 
ATOM   224  O  O   . ILE A 1 74  ? 41.076 6.181   16.251  1.00 23.55 ? 224 ILE A O   1 
ATOM   225  C  CB  . ILE A 1 74  ? 42.738 8.066   14.548  1.00 22.39 ? 224 ILE A CB  1 
ATOM   226  C  CG1 . ILE A 1 74  ? 43.939 9.043   14.425  1.00 24.80 ? 224 ILE A CG1 1 
ATOM   227  C  CG2 . ILE A 1 74  ? 41.863 8.201   13.310  1.00 23.21 ? 224 ILE A CG2 1 
ATOM   228  C  CD1 . ILE A 1 74  ? 44.766 8.839   13.180  1.00 25.91 ? 224 ILE A CD1 1 
ATOM   229  N  N   . LEU A 1 75  ? 39.592 7.868   15.843  1.00 22.29 ? 225 LEU A N   1 
ATOM   230  C  CA  . LEU A 1 75  ? 38.382 7.084   16.105  1.00 22.65 ? 225 LEU A CA  1 
ATOM   231  C  C   . LEU A 1 75  ? 37.600 6.690   14.866  1.00 23.27 ? 225 LEU A C   1 
ATOM   232  O  O   . LEU A 1 75  ? 36.659 5.905   14.961  1.00 20.80 ? 225 LEU A O   1 
ATOM   233  C  CB  . LEU A 1 75  ? 37.447 7.841   17.075  1.00 24.19 ? 225 LEU A CB  1 
ATOM   234  C  CG  . LEU A 1 75  ? 38.085 8.289   18.389  1.00 24.43 ? 225 LEU A CG  1 
ATOM   235  C  CD1 . LEU A 1 75  ? 37.072 9.100   19.237  1.00 26.95 ? 225 LEU A CD1 1 
ATOM   236  C  CD2 . LEU A 1 75  ? 38.655 7.130   19.213  1.00 27.01 ? 225 LEU A CD2 1 
ATOM   237  N  N   . ALA A 1 76  ? 37.959 7.216   13.705  1.00 23.38 ? 226 ALA A N   1 
ATOM   238  C  CA  . ALA A 1 76  ? 37.196 6.948   12.515  1.00 22.15 ? 226 ALA A CA  1 
ATOM   239  C  C   . ALA A 1 76  ? 38.021 7.188   11.291  1.00 21.37 ? 226 ALA A C   1 
ATOM   240  O  O   . ALA A 1 76  ? 38.902 8.040   11.300  1.00 20.91 ? 226 ALA A O   1 
ATOM   241  C  CB  . ALA A 1 76  ? 35.936 7.791   12.480  1.00 21.34 ? 226 ALA A CB  1 
ATOM   242  N  N   . LEU A 1 77  ? 37.729 6.422   10.234  1.00 23.02 ? 227 LEU A N   1 
ATOM   243  C  CA  . LEU A 1 77  ? 38.493 6.438   8.992   1.00 22.83 ? 227 LEU A CA  1 
ATOM   244  C  C   . LEU A 1 77  ? 37.578 6.305   7.780   1.00 23.41 ? 227 LEU A C   1 
ATOM   245  O  O   . LEU A 1 77  ? 36.656 5.478   7.804   1.00 23.18 ? 227 LEU A O   1 
ATOM   246  C  CB  . LEU A 1 77  ? 39.446 5.223   8.969   1.00 22.41 ? 227 LEU A CB  1 
ATOM   247  C  CG  . LEU A 1 77  ? 40.226 4.987   7.670   1.00 23.59 ? 227 LEU A CG  1 
ATOM   248  C  CD1 . LEU A 1 77  ? 41.219 6.114   7.372   1.00 23.42 ? 227 LEU A CD1 1 
ATOM   249  C  CD2 . LEU A 1 77  ? 40.968 3.657   7.792   1.00 24.15 ? 227 LEU A CD2 1 
ATOM   250  N  N   . ASP A 1 78  ? 37.838 7.083   6.740   1.00 19.97 ? 228 ASP A N   1 
ATOM   251  C  CA  . ASP A 1 78  ? 37.292 6.807   5.369   1.00 22.45 ? 228 ASP A CA  1 
ATOM   252  C  C   . ASP A 1 78  ? 38.300 7.256   4.316   1.00 23.35 ? 228 ASP A C   1 
ATOM   253  O  O   . ASP A 1 78  ? 39.187 8.057   4.589   1.00 24.79 ? 228 ASP A O   1 
ATOM   254  C  CB  . ASP A 1 78  ? 35.920 7.501   5.181   1.00 19.90 ? 228 ASP A CB  1 
ATOM   255  C  CG  . ASP A 1 78  ? 35.102 6.935   4.049   1.00 23.66 ? 228 ASP A CG  1 
ATOM   256  O  OD1 . ASP A 1 78  ? 35.402 5.822   3.549   1.00 22.42 ? 228 ASP A OD1 1 
ATOM   257  O  OD2 . ASP A 1 78  ? 34.165 7.658   3.614   1.00 23.16 ? 228 ASP A OD2 1 
ATOM   258  N  N   . LEU A 1 79  ? 38.206 6.676   3.126   1.00 22.85 ? 229 LEU A N   1 
ATOM   259  C  CA  . LEU A 1 79  ? 39.046 7.047   2.010   1.00 23.31 ? 229 LEU A CA  1 
ATOM   260  C  C   . LEU A 1 79  ? 38.128 7.641   0.952   1.00 25.37 ? 229 LEU A C   1 
ATOM   261  O  O   . LEU A 1 79  ? 36.995 7.192   0.810   1.00 26.48 ? 229 LEU A O   1 
ATOM   262  C  CB  . LEU A 1 79  ? 39.751 5.814   1.424   1.00 22.32 ? 229 LEU A CB  1 
ATOM   263  C  CG  . LEU A 1 79  ? 40.514 4.933   2.403   1.00 23.85 ? 229 LEU A CG  1 
ATOM   264  C  CD1 . LEU A 1 79  ? 41.210 3.829   1.623   1.00 24.87 ? 229 LEU A CD1 1 
ATOM   265  C  CD2 . LEU A 1 79  ? 41.526 5.741   3.207   1.00 24.64 ? 229 LEU A CD2 1 
ATOM   266  N  N   . CYS A 1 80  ? 38.608 8.624   0.188   1.00 24.63 ? 230 CYS A N   1 
ATOM   267  C  CA  . CYS A 1 80  ? 37.795 9.214   -0.863  1.00 26.04 ? 230 CYS A CA  1 
ATOM   268  C  C   . CYS A 1 80  ? 37.600 8.166   -2.000  1.00 26.93 ? 230 CYS A C   1 
ATOM   269  O  O   . CYS A 1 80  ? 38.580 7.661   -2.543  1.00 27.79 ? 230 CYS A O   1 
ATOM   270  C  CB  . CYS A 1 80  ? 38.443 10.458  -1.416  1.00 25.96 ? 230 CYS A CB  1 
ATOM   271  S  SG  . CYS A 1 80  ? 37.489 11.228  -2.755  1.00 29.41 ? 230 CYS A SG  1 
ATOM   272  N  N   . PRO A 1 81  ? 36.340 7.833   -2.334  1.00 27.28 ? 231 PRO A N   1 
ATOM   273  C  CA  . PRO A 1 81  ? 36.138 6.794   -3.338  1.00 28.83 ? 231 PRO A CA  1 
ATOM   274  C  C   . PRO A 1 81  ? 36.706 7.115   -4.702  1.00 30.11 ? 231 PRO A C   1 
ATOM   275  O  O   . PRO A 1 81  ? 37.036 6.195   -5.422  1.00 31.49 ? 231 PRO A O   1 
ATOM   276  C  CB  . PRO A 1 81  ? 34.612 6.680   -3.440  1.00 31.01 ? 231 PRO A CB  1 
ATOM   277  C  CG  . PRO A 1 81  ? 34.092 7.214   -2.184  1.00 29.68 ? 231 PRO A CG  1 
ATOM   278  C  CD  . PRO A 1 81  ? 35.073 8.262   -1.718  1.00 28.88 ? 231 PRO A CD  1 
ATOM   279  N  N   . SER A 1 82  ? 36.840 8.401   -5.047  1.00 30.91 ? 232 SER A N   1 
ATOM   280  C  CA  . SER A 1 82  ? 37.384 8.818   -6.353  1.00 30.54 ? 232 SER A CA  1 
ATOM   281  C  C   . SER A 1 82  ? 38.914 9.029   -6.341  1.00 31.15 ? 232 SER A C   1 
ATOM   282  O  O   . SER A 1 82  ? 39.525 9.284   -7.377  1.00 28.49 ? 232 SER A O   1 
ATOM   283  C  CB  . SER A 1 82  ? 36.696 10.086  -6.874  1.00 33.44 ? 232 SER A CB  1 
ATOM   284  O  OG  . SER A 1 82  ? 37.120 11.191  -6.126  1.00 33.75 ? 232 SER A OG  1 
ATOM   285  N  N   . ASP A 1 83  ? 39.530 8.867   -5.186  1.00 27.79 ? 233 ASP A N   1 
ATOM   286  C  CA  . ASP A 1 83  ? 40.993 8.962   -5.064  1.00 30.65 ? 233 ASP A CA  1 
ATOM   287  C  C   . ASP A 1 83  ? 41.303 8.496   -3.674  1.00 29.02 ? 233 ASP A C   1 
ATOM   288  O  O   . ASP A 1 83  ? 41.182 9.276   -2.731  1.00 24.93 ? 233 ASP A O   1 
ATOM   289  C  CB  . ASP A 1 83  ? 41.470 10.408  -5.241  1.00 32.80 ? 233 ASP A CB  1 
ATOM   290  C  CG  . ASP A 1 83  ? 42.997 10.576  -5.051  1.00 34.53 ? 233 ASP A CG  1 
ATOM   291  O  OD1 . ASP A 1 83  ? 43.679 9.610   -4.697  1.00 31.77 ? 233 ASP A OD1 1 
ATOM   292  O  OD2 . ASP A 1 83  ? 43.496 11.700  -5.265  1.00 35.91 ? 233 ASP A OD2 1 
ATOM   293  N  N   . THR A 1 84  ? 41.716 7.237   -3.535  1.00 28.12 ? 234 THR A N   1 
ATOM   294  C  CA  . THR A 1 84  ? 41.893 6.664   -2.218  1.00 28.10 ? 234 THR A CA  1 
ATOM   295  C  C   . THR A 1 84  ? 43.204 7.087   -1.535  1.00 29.14 ? 234 THR A C   1 
ATOM   296  O  O   . THR A 1 84  ? 43.474 6.630   -0.425  1.00 27.20 ? 234 THR A O   1 
ATOM   297  C  CB  . THR A 1 84  ? 41.750 5.103   -2.224  1.00 29.31 ? 234 THR A CB  1 
ATOM   298  O  OG1 . THR A 1 84  ? 42.552 4.517   -3.274  1.00 29.82 ? 234 THR A OG1 1 
ATOM   299  C  CG2 . THR A 1 84  ? 40.282 4.707   -2.391  1.00 29.86 ? 234 THR A CG2 1 
ATOM   300  N  N   . ASN A 1 85  ? 44.022 7.920   -2.204  1.00 29.03 ? 235 ASN A N   1 
ATOM   301  C  CA  . ASN A 1 85  ? 45.141 8.563   -1.519  1.00 29.19 ? 235 ASN A CA  1 
ATOM   302  C  C   . ASN A 1 85  ? 44.706 9.727   -0.636  1.00 26.81 ? 235 ASN A C   1 
ATOM   303  O  O   . ASN A 1 85  ? 45.501 10.222  0.138   1.00 28.42 ? 235 ASN A O   1 
ATOM   304  C  CB  . ASN A 1 85  ? 46.170 9.054   -2.481  1.00 31.51 ? 235 ASN A CB  1 
ATOM   305  C  CG  . ASN A 1 85  ? 46.856 7.934   -3.221  1.00 35.33 ? 235 ASN A CG  1 
ATOM   306  O  OD1 . ASN A 1 85  ? 46.848 6.778   -2.807  1.00 37.44 ? 235 ASN A OD1 1 
ATOM   307  N  ND2 . ASN A 1 85  ? 47.435 8.278   -4.318  1.00 38.64 ? 235 ASN A ND2 1 
ATOM   308  N  N   . LYS A 1 86  ? 43.447 10.144  -0.749  1.00 26.46 ? 236 LYS A N   1 
ATOM   309  C  CA  . LYS A 1 86  ? 42.881 11.136  0.156   1.00 25.70 ? 236 LYS A CA  1 
ATOM   310  C  C   . LYS A 1 86  ? 42.200 10.439  1.311   1.00 24.49 ? 236 LYS A C   1 
ATOM   311  O  O   . LYS A 1 86  ? 41.238 9.655   1.137   1.00 24.64 ? 236 LYS A O   1 
ATOM   312  C  CB  . LYS A 1 86  ? 41.849 12.070  -0.567  1.00 28.24 ? 236 LYS A CB  1 
ATOM   313  C  CG  . LYS A 1 86  ? 42.368 12.737  -1.830  1.00 34.53 ? 236 LYS A CG  1 
ATOM   314  C  CD  . LYS A 1 86  ? 43.543 13.627  -1.584  1.00 39.60 ? 236 LYS A CD  1 
ATOM   315  C  CE  . LYS A 1 86  ? 43.981 14.372  -2.875  1.00 50.42 ? 236 LYS A CE  1 
ATOM   316  N  NZ  . LYS A 1 86  ? 42.900 15.297  -3.359  1.00 49.71 ? 236 LYS A NZ  1 
ATOM   317  N  N   . ILE A 1 87  ? 42.689 10.732  2.519   1.00 23.82 ? 237 ILE A N   1 
ATOM   318  C  CA  . ILE A 1 87  ? 42.276 10.046  3.690   1.00 22.94 ? 237 ILE A CA  1 
ATOM   319  C  C   . ILE A 1 87  ? 41.515 11.011  4.572   1.00 22.28 ? 237 ILE A C   1 
ATOM   320  O  O   . ILE A 1 87  ? 41.898 12.190  4.700   1.00 22.95 ? 237 ILE A O   1 
ATOM   321  C  CB  . ILE A 1 87  ? 43.491 9.583   4.536   1.00 23.56 ? 237 ILE A CB  1 
ATOM   322  C  CG1 . ILE A 1 87  ? 44.653 9.035   3.682   1.00 30.41 ? 237 ILE A CG1 1 
ATOM   323  C  CG2 . ILE A 1 87  ? 43.046 8.669   5.638   1.00 28.89 ? 237 ILE A CG2 1 
ATOM   324  C  CD1 . ILE A 1 87  ? 44.371 7.964   2.630   1.00 25.88 ? 237 ILE A CD1 1 
ATOM   325  N  N   . LEU A 1 88  ? 40.480 10.518  5.220   1.00 20.67 ? 238 LEU A N   1 
ATOM   326  C  CA  . LEU A 1 88  ? 39.666 11.322  6.159   1.00 23.64 ? 238 LEU A CA  1 
ATOM   327  C  C   . LEU A 1 88  ? 39.664 10.619  7.519   1.00 22.88 ? 238 LEU A C   1 
ATOM   328  O  O   . LEU A 1 88  ? 39.369 9.415   7.583   1.00 22.83 ? 238 LEU A O   1 
ATOM   329  C  CB  . LEU A 1 88  ? 38.239 11.459  5.626   1.00 21.63 ? 238 LEU A CB  1 
ATOM   330  C  CG  . LEU A 1 88  ? 37.190 12.230  6.448   1.00 23.81 ? 238 LEU A CG  1 
ATOM   331  C  CD1 . LEU A 1 88  ? 37.554 13.710  6.572   1.00 24.54 ? 238 LEU A CD1 1 
ATOM   332  C  CD2 . LEU A 1 88  ? 35.852 12.109  5.755   1.00 24.11 ? 238 LEU A CD2 1 
ATOM   333  N  N   . THR A 1 89  ? 39.965 11.365  8.599   1.00 23.28 ? 239 THR A N   1 
ATOM   334  C  CA  . THR A 1 89  ? 39.995 10.820  9.943   1.00 21.75 ? 239 THR A CA  1 
ATOM   335  C  C   . THR A 1 89  ? 39.238 11.653  10.935  1.00 23.25 ? 239 THR A C   1 
ATOM   336  O  O   . THR A 1 89  ? 39.116 12.871  10.802  1.00 23.22 ? 239 THR A O   1 
ATOM   337  C  CB  . THR A 1 89  ? 41.431 10.586  10.460  1.00 22.01 ? 239 THR A CB  1 
ATOM   338  O  OG1 . THR A 1 89  ? 42.189 11.810  10.409  1.00 20.49 ? 239 THR A OG1 1 
ATOM   339  C  CG2 . THR A 1 89  ? 42.101 9.544   9.598   1.00 23.62 ? 239 THR A CG2 1 
ATOM   340  N  N   . GLY A 1 90  ? 38.644 10.982  11.910  1.00 21.52 ? 240 GLY A N   1 
ATOM   341  C  CA  . GLY A 1 90  ? 38.008 11.660  13.006  1.00 18.76 ? 240 GLY A CA  1 
ATOM   342  C  C   . GLY A 1 90  ? 38.813 11.427  14.266  1.00 20.59 ? 240 GLY A C   1 
ATOM   343  O  O   . GLY A 1 90  ? 39.248 10.340  14.536  1.00 22.36 ? 240 GLY A O   1 
ATOM   344  N  N   . GLY A 1 91  ? 39.018 12.460  15.039  1.00 21.54 ? 241 GLY A N   1 
ATOM   345  C  CA  . GLY A 1 91  ? 39.874 12.334  16.201  1.00 22.70 ? 241 GLY A CA  1 
ATOM   346  C  C   . GLY A 1 91  ? 39.186 12.373  17.545  1.00 24.38 ? 241 GLY A C   1 
ATOM   347  O  O   . GLY A 1 91  ? 38.137 12.996  17.712  1.00 21.56 ? 241 GLY A O   1 
ATOM   348  N  N   . ALA A 1 92  ? 39.829 11.743  18.528  1.00 22.29 ? 242 ALA A N   1 
ATOM   349  C  CA  . ALA A 1 92  ? 39.557 11.991  19.919  1.00 23.41 ? 242 ALA A CA  1 
ATOM   350  C  C   . ALA A 1 92  ? 39.654 13.474  20.229  1.00 22.51 ? 242 ALA A C   1 
ATOM   351  O  O   . ALA A 1 92  ? 38.933 13.968  21.083  1.00 21.79 ? 242 ALA A O   1 
ATOM   352  C  CB  . ALA A 1 92  ? 40.539 11.188  20.832  1.00 24.24 ? 242 ALA A CB  1 
ATOM   353  N  N   . ASP A 1 93  ? 40.518 14.183  19.486  1.00 23.87 ? 243 ASP A N   1 
ATOM   354  C  CA  . ASP A 1 93  ? 40.724 15.607  19.657  1.00 24.69 ? 243 ASP A CA  1 
ATOM   355  C  C   . ASP A 1 93  ? 39.615 16.531  19.137  1.00 23.41 ? 243 ASP A C   1 
ATOM   356  O  O   . ASP A 1 93  ? 39.793 17.760  19.171  1.00 24.07 ? 243 ASP A O   1 
ATOM   357  C  CB  . ASP A 1 93  ? 42.104 16.035  19.082  1.00 24.75 ? 243 ASP A CB  1 
ATOM   358  C  CG  . ASP A 1 93  ? 42.205 15.962  17.596  1.00 23.68 ? 243 ASP A CG  1 
ATOM   359  O  OD1 . ASP A 1 93  ? 41.227 15.636  16.850  1.00 23.15 ? 243 ASP A OD1 1 
ATOM   360  O  OD2 . ASP A 1 93  ? 43.339 16.245  17.152  1.00 26.05 ? 243 ASP A OD2 1 
ATOM   361  N  N   . LYS A 1 94  ? 38.465 15.943  18.735  1.00 23.25 ? 244 LYS A N   1 
ATOM   362  C  CA  . LYS A 1 94  ? 37.243 16.672  18.269  1.00 22.77 ? 244 LYS A CA  1 
ATOM   363  C  C   . LYS A 1 94  ? 37.406 17.245  16.852  1.00 22.48 ? 244 LYS A C   1 
ATOM   364  O  O   . LYS A 1 94  ? 36.524 17.966  16.367  1.00 24.91 ? 244 LYS A O   1 
ATOM   365  C  CB  . LYS A 1 94  ? 36.839 17.803  19.201  1.00 23.49 ? 244 LYS A CB  1 
ATOM   366  C  CG  . LYS A 1 94  ? 36.836 17.475  20.710  1.00 25.99 ? 244 LYS A CG  1 
ATOM   367  C  CD  . LYS A 1 94  ? 36.531 18.763  21.488  1.00 27.75 ? 244 LYS A CD  1 
ATOM   368  C  CE  . LYS A 1 94  ? 36.595 18.616  22.973  1.00 32.83 ? 244 LYS A CE  1 
ATOM   369  N  NZ  . LYS A 1 94  ? 38.029 18.480  23.484  1.00 35.65 ? 244 LYS A NZ  1 
ATOM   370  N  N   . ASN A 1 95  ? 38.520 16.919  16.188  1.00 22.90 ? 245 ASN A N   1 
ATOM   371  C  CA  . ASN A 1 95  ? 38.815 17.504  14.853  1.00 23.71 ? 245 ASN A CA  1 
ATOM   372  C  C   . ASN A 1 95  ? 38.669 16.470  13.778  1.00 23.88 ? 245 ASN A C   1 
ATOM   373  O  O   . ASN A 1 95  ? 38.843 15.238  14.005  1.00 21.27 ? 245 ASN A O   1 
ATOM   374  C  CB  . ASN A 1 95  ? 40.199 18.145  14.804  1.00 22.78 ? 245 ASN A CB  1 
ATOM   375  C  CG  . ASN A 1 95  ? 40.315 19.320  15.705  1.00 23.18 ? 245 ASN A CG  1 
ATOM   376  O  OD1 . ASN A 1 95  ? 39.296 19.915  16.121  1.00 23.64 ? 245 ASN A OD1 1 
ATOM   377  N  ND2 . ASN A 1 95  ? 41.531 19.689  16.020  1.00 25.07 ? 245 ASN A ND2 1 
ATOM   378  N  N   . VAL A 1 96  ? 38.311 16.950  12.591  1.00 23.73 ? 246 VAL A N   1 
ATOM   379  C  CA  . VAL A 1 96  ? 38.238 16.098  11.385  1.00 21.68 ? 246 VAL A CA  1 
ATOM   380  C  C   . VAL A 1 96  ? 39.435 16.473  10.490  1.00 23.83 ? 246 VAL A C   1 
ATOM   381  O  O   . VAL A 1 96  ? 39.656 17.631  10.248  1.00 24.65 ? 246 VAL A O   1 
ATOM   382  C  CB  . VAL A 1 96  ? 36.903 16.354  10.645  1.00 22.57 ? 246 VAL A CB  1 
ATOM   383  C  CG1 . VAL A 1 96  ? 36.824 15.529  9.403   1.00 23.83 ? 246 VAL A CG1 1 
ATOM   384  C  CG2 . VAL A 1 96  ? 35.710 16.029  11.560  1.00 23.33 ? 246 VAL A CG2 1 
ATOM   385  N  N   . VAL A 1 97  ? 40.217 15.483  10.047  1.00 23.10 ? 247 VAL A N   1 
ATOM   386  C  CA  . VAL A 1 97  ? 41.419 15.731  9.277   1.00 22.04 ? 247 VAL A CA  1 
ATOM   387  C  C   . VAL A 1 97  ? 41.363 15.042  7.873   1.00 23.58 ? 247 VAL A C   1 
ATOM   388  O  O   . VAL A 1 97  ? 40.892 13.883  7.725   1.00 22.12 ? 247 VAL A O   1 
ATOM   389  C  CB  . VAL A 1 97  ? 42.668 15.296  10.082  1.00 21.51 ? 247 VAL A CB  1 
ATOM   390  C  CG1 . VAL A 1 97  ? 43.949 15.324  9.237   1.00 25.37 ? 247 VAL A CG1 1 
ATOM   391  C  CG2 . VAL A 1 97  ? 42.824 16.163  11.328  1.00 22.20 ? 247 VAL A CG2 1 
ATOM   392  N  N   . VAL A 1 98  ? 41.771 15.801  6.845   1.00 25.36 ? 248 VAL A N   1 
ATOM   393  C  CA  . VAL A 1 98  ? 42.000 15.300  5.498   1.00 24.77 ? 248 VAL A CA  1 
ATOM   394  C  C   . VAL A 1 98  ? 43.492 15.283  5.239   1.00 24.83 ? 248 VAL A C   1 
ATOM   395  O  O   . VAL A 1 98  ? 44.191 16.295  5.453   1.00 24.26 ? 248 VAL A O   1 
ATOM   396  C  CB  . VAL A 1 98  ? 41.315 16.197  4.434   1.00 27.34 ? 248 VAL A CB  1 
ATOM   397  C  CG1 . VAL A 1 98  ? 41.492 15.632  3.024   1.00 27.97 ? 248 VAL A CG1 1 
ATOM   398  C  CG2 . VAL A 1 98  ? 39.861 16.370  4.738   1.00 28.65 ? 248 VAL A CG2 1 
ATOM   399  N  N   . PHE A 1 99  ? 43.999 14.130  4.799   1.00 24.79 ? 249 PHE A N   1 
ATOM   400  C  CA  . PHE A 1 99  ? 45.441 13.865  4.704   1.00 24.70 ? 249 PHE A CA  1 
ATOM   401  C  C   . PHE A 1 99  ? 45.694 13.268  3.360   1.00 24.74 ? 249 PHE A C   1 
ATOM   402  O  O   . PHE A 1 99  ? 44.889 12.468  2.873   1.00 23.04 ? 249 PHE A O   1 
ATOM   403  C  CB  . PHE A 1 99  ? 45.845 12.877  5.805   1.00 24.47 ? 249 PHE A CB  1 
ATOM   404  C  CG  . PHE A 1 99  ? 47.267 12.443  5.784   1.00 25.33 ? 249 PHE A CG  1 
ATOM   405  C  CD1 . PHE A 1 99  ? 48.285 13.290  6.241   1.00 26.93 ? 249 PHE A CD1 1 
ATOM   406  C  CD2 . PHE A 1 99  ? 47.622 11.146  5.363   1.00 24.30 ? 249 PHE A CD2 1 
ATOM   407  C  CE1 . PHE A 1 99  ? 49.604 12.862  6.259   1.00 27.25 ? 249 PHE A CE1 1 
ATOM   408  C  CE2 . PHE A 1 99  ? 48.940 10.719  5.390   1.00 25.47 ? 249 PHE A CE2 1 
ATOM   409  C  CZ  . PHE A 1 99  ? 49.939 11.574  5.811   1.00 25.85 ? 249 PHE A CZ  1 
ATOM   410  N  N   . ASP A 1 100 ? 46.804 13.655  2.742   1.00 24.46 ? 250 ASP A N   1 
ATOM   411  C  CA  . ASP A 1 100 ? 47.189 13.095  1.434   1.00 28.44 ? 250 ASP A CA  1 
ATOM   412  C  C   . ASP A 1 100 ? 48.313 12.106  1.621   1.00 27.48 ? 250 ASP A C   1 
ATOM   413  O  O   . ASP A 1 100 ? 49.400 12.470  2.003   1.00 32.00 ? 250 ASP A O   1 
ATOM   414  C  CB  . ASP A 1 100 ? 47.613 14.206  0.498   1.00 30.43 ? 250 ASP A CB  1 
ATOM   415  C  CG  . ASP A 1 100 ? 47.749 13.738  -0.984  1.00 37.20 ? 250 ASP A CG  1 
ATOM   416  O  OD1 . ASP A 1 100 ? 48.269 12.653  -1.236  1.00 36.54 ? 250 ASP A OD1 1 
ATOM   417  O  OD2 . ASP A 1 100 ? 47.348 14.498  -1.874  1.00 43.89 ? 250 ASP A OD2 1 
ATOM   418  N  N   . LYS A 1 101 ? 48.024 10.860  1.301   1.00 27.40 ? 251 LYS A N   1 
ATOM   419  C  CA  . LYS A 1 101 ? 48.928 9.743   1.443   1.00 30.75 ? 251 LYS A CA  1 
ATOM   420  C  C   . LYS A 1 101 ? 50.182 9.906   0.601   1.00 31.94 ? 251 LYS A C   1 
ATOM   421  O  O   . LYS A 1 101 ? 51.264 9.476   1.025   1.00 31.18 ? 251 LYS A O   1 
ATOM   422  C  CB  . LYS A 1 101 ? 48.151 8.435   1.058   1.00 32.34 ? 251 LYS A CB  1 
ATOM   423  C  CG  . LYS A 1 101 ? 48.968 7.237   0.692   1.00 35.33 ? 251 LYS A CG  1 
ATOM   424  C  CD  . LYS A 1 101 ? 48.088 6.004   0.644   1.00 33.31 ? 251 LYS A CD  1 
ATOM   425  C  CE  . LYS A 1 101 ? 48.917 4.752   0.712   1.00 37.73 ? 251 LYS A CE  1 
ATOM   426  N  NZ  . LYS A 1 101 ? 49.839 4.611   -0.441  1.00 35.78 ? 251 LYS A NZ  1 
ATOM   427  N  N   . SER A 1 102 ? 50.033 10.508  -0.590  1.00 34.30 ? 252 SER A N   1 
ATOM   428  C  CA  . SER A 1 102 ? 51.141 10.651  -1.564  1.00 37.64 ? 252 SER A CA  1 
ATOM   429  C  C   . SER A 1 102 ? 52.138 11.683  -1.114  1.00 36.00 ? 252 SER A C   1 
ATOM   430  O  O   . SER A 1 102 ? 53.344 11.459  -1.167  1.00 38.23 ? 252 SER A O   1 
ATOM   431  C  CB  . SER A 1 102 ? 50.619 11.144  -2.929  1.00 40.87 ? 252 SER A CB  1 
ATOM   432  O  OG  . SER A 1 102 ? 49.501 10.423  -3.396  1.00 47.64 ? 252 SER A OG  1 
ATOM   433  N  N   . SER A 1 103 ? 51.616 12.830  -0.708  1.00 33.05 ? 253 SER A N   1 
ATOM   434  C  CA  . SER A 1 103 ? 52.450 13.959  -0.290  1.00 34.77 ? 253 SER A CA  1 
ATOM   435  C  C   . SER A 1 103 ? 52.777 13.879  1.214   1.00 34.30 ? 253 SER A C   1 
ATOM   436  O  O   . SER A 1 103 ? 53.705 14.504  1.660   1.00 34.29 ? 253 SER A O   1 
ATOM   437  C  CB  . SER A 1 103 ? 51.771 15.279  -0.601  1.00 35.50 ? 253 SER A CB  1 
ATOM   438  O  OG  . SER A 1 103 ? 50.567 15.410  0.131   1.00 32.84 ? 253 SER A OG  1 
ATOM   439  N  N   . GLU A 1 104 ? 52.027 13.072  1.944   1.00 32.70 ? 254 GLU A N   1 
ATOM   440  C  CA  . GLU A 1 104 ? 52.103 12.968  3.411   1.00 34.02 ? 254 GLU A CA  1 
ATOM   441  C  C   . GLU A 1 104 ? 51.857 14.306  4.096   1.00 35.78 ? 254 GLU A C   1 
ATOM   442  O  O   . GLU A 1 104 ? 52.497 14.620  5.095   1.00 38.20 ? 254 GLU A O   1 
ATOM   443  C  CB  . GLU A 1 104 ? 53.413 12.307  3.844   1.00 36.45 ? 254 GLU A CB  1 
ATOM   444  C  CG  . GLU A 1 104 ? 53.516 10.907  3.251   1.00 37.74 ? 254 GLU A CG  1 
ATOM   445  C  CD  . GLU A 1 104 ? 54.630 10.051  3.817   1.00 39.25 ? 254 GLU A CD  1 
ATOM   446  O  OE1 . GLU A 1 104 ? 55.405 10.496  4.655   1.00 40.34 ? 254 GLU A OE1 1 
ATOM   447  O  OE2 . GLU A 1 104 ? 54.704 8.901   3.412   1.00 45.94 ? 254 GLU A OE2 1 
ATOM   448  N  N   . GLN A 1 105 ? 50.922 15.091  3.541   1.00 32.12 ? 255 GLN A N   1 
ATOM   449  C  CA  . GLN A 1 105 ? 50.540 16.412  4.072   1.00 34.12 ? 255 GLN A CA  1 
ATOM   450  C  C   . GLN A 1 105 ? 49.120 16.365  4.558   1.00 31.35 ? 255 GLN A C   1 
ATOM   451  O  O   . GLN A 1 105 ? 48.248 15.707  3.948   1.00 27.03 ? 255 GLN A O   1 
ATOM   452  C  CB  . GLN A 1 105 ? 50.599 17.490  2.988   1.00 36.78 ? 255 GLN A CB  1 
ATOM   453  C  CG  . GLN A 1 105 ? 52.001 17.723  2.432   1.00 42.97 ? 255 GLN A CG  1 
ATOM   454  C  CD  . GLN A 1 105 ? 52.954 18.257  3.494   1.00 50.64 ? 255 GLN A CD  1 
ATOM   455  O  OE1 . GLN A 1 105 ? 52.597 19.144  4.296   1.00 50.92 ? 255 GLN A OE1 1 
ATOM   456  N  NE2 . GLN A 1 105 ? 54.170 17.719  3.514   1.00 56.96 ? 255 GLN A NE2 1 
ATOM   457  N  N   . ILE A 1 106 ? 48.875 17.089  5.640   1.00 28.23 ? 256 ILE A N   1 
ATOM   458  C  CA  . ILE A 1 106 ? 47.558 17.381  6.089   1.00 28.56 ? 256 ILE A CA  1 
ATOM   459  C  C   . ILE A 1 106 ? 47.011 18.502  5.218   1.00 29.62 ? 256 ILE A C   1 
ATOM   460  O  O   . ILE A 1 106 ? 47.565 19.607  5.205   1.00 29.22 ? 256 ILE A O   1 
ATOM   461  C  CB  . ILE A 1 106 ? 47.555 17.867  7.562   1.00 30.66 ? 256 ILE A CB  1 
ATOM   462  C  CG1 . ILE A 1 106 ? 47.991 16.736  8.499   1.00 32.94 ? 256 ILE A CG1 1 
ATOM   463  C  CG2 . ILE A 1 106 ? 46.171 18.324  7.938   1.00 30.34 ? 256 ILE A CG2 1 
ATOM   464  C  CD1 . ILE A 1 106 ? 48.404 17.219  9.871   1.00 37.11 ? 256 ILE A CD1 1 
ATOM   465  N  N   . LEU A 1 107 ? 45.925 18.222  4.505   1.00 26.21 ? 257 LEU A N   1 
ATOM   466  C  CA  . LEU A 1 107 ? 45.307 19.192  3.644   1.00 26.36 ? 257 LEU A CA  1 
ATOM   467  C  C   . LEU A 1 107 ? 44.401 20.118  4.422   1.00 27.34 ? 257 LEU A C   1 
ATOM   468  O  O   . LEU A 1 107 ? 44.261 21.278  4.062   1.00 26.21 ? 257 LEU A O   1 
ATOM   469  C  CB  . LEU A 1 107 ? 44.505 18.497  2.557   1.00 27.81 ? 257 LEU A CB  1 
ATOM   470  C  CG  . LEU A 1 107 ? 45.290 17.507  1.698   1.00 28.52 ? 257 LEU A CG  1 
ATOM   471  C  CD1 . LEU A 1 107 ? 44.421 16.945  0.579   1.00 30.52 ? 257 LEU A CD1 1 
ATOM   472  C  CD2 . LEU A 1 107 ? 46.512 18.199  1.082   1.00 31.96 ? 257 LEU A CD2 1 
ATOM   473  N  N   . ALA A 1 108 ? 43.775 19.612  5.483   1.00 25.61 ? 258 ALA A N   1 
ATOM   474  C  CA  . ALA A 1 108 ? 42.896 20.431  6.299   1.00 28.32 ? 258 ALA A CA  1 
ATOM   475  C  C   . ALA A 1 108 ? 42.726 19.832  7.677   1.00 26.25 ? 258 ALA A C   1 
ATOM   476  O  O   . ALA A 1 108 ? 42.639 18.601  7.828   1.00 23.84 ? 258 ALA A O   1 
ATOM   477  C  CB  . ALA A 1 108 ? 41.536 20.577  5.634   1.00 28.79 ? 258 ALA A CB  1 
ATOM   478  N  N   . THR A 1 109 ? 42.676 20.708  8.671   1.00 26.37 ? 259 THR A N   1 
ATOM   479  C  CA  . THR A 1 109 ? 42.240 20.332  10.015  1.00 25.49 ? 259 THR A CA  1 
ATOM   480  C  C   . THR A 1 109 ? 40.938 21.067  10.301  1.00 27.43 ? 259 THR A C   1 
ATOM   481  O  O   . THR A 1 109 ? 40.929 22.298  10.447  1.00 26.40 ? 259 THR A O   1 
ATOM   482  C  CB  . THR A 1 109 ? 43.307 20.656  11.092  1.00 27.09 ? 259 THR A CB  1 
ATOM   483  O  OG1 . THR A 1 109 ? 44.503 19.942  10.808  1.00 27.00 ? 259 THR A OG1 1 
ATOM   484  C  CG2 . THR A 1 109 ? 42.806 20.227  12.506  1.00 28.16 ? 259 THR A CG2 1 
ATOM   485  N  N   . LEU A 1 110 ? 39.839 20.322  10.383  1.00 23.01 ? 260 LEU A N   1 
ATOM   486  C  CA  . LEU A 1 110 ? 38.527 20.885  10.457  1.00 23.00 ? 260 LEU A CA  1 
ATOM   487  C  C   . LEU A 1 110 ? 37.960 20.859  11.914  1.00 23.96 ? 260 LEU A C   1 
ATOM   488  O  O   . LEU A 1 110 ? 37.680 19.795  12.460  1.00 23.62 ? 260 LEU A O   1 
ATOM   489  C  CB  . LEU A 1 110 ? 37.596 20.115  9.509   1.00 23.09 ? 260 LEU A CB  1 
ATOM   490  C  CG  . LEU A 1 110 ? 38.099 20.057  8.040   1.00 26.20 ? 260 LEU A CG  1 
ATOM   491  C  CD1 . LEU A 1 110 ? 37.324 18.978  7.313   1.00 26.84 ? 260 LEU A CD1 1 
ATOM   492  C  CD2 . LEU A 1 110 ? 37.889 21.394  7.351   1.00 26.10 ? 260 LEU A CD2 1 
ATOM   493  N  N   . LYS A 1 111 ? 37.818 22.046  12.509  1.00 25.22 ? 261 LYS A N   1 
ATOM   494  C  CA  . LYS A 1 111 ? 37.453 22.222  13.894  1.00 26.31 ? 261 LYS A CA  1 
ATOM   495  C  C   . LYS A 1 111 ? 36.048 22.718  13.984  1.00 26.73 ? 261 LYS A C   1 
ATOM   496  O  O   . LYS A 1 111 ? 35.601 23.517  13.131  1.00 25.48 ? 261 LYS A O   1 
ATOM   497  C  CB  . LYS A 1 111 ? 38.369 23.241  14.556  1.00 28.82 ? 261 LYS A CB  1 
ATOM   498  C  CG  . LYS A 1 111 ? 39.828 22.868  14.485  1.00 29.71 ? 261 LYS A CG  1 
ATOM   499  C  CD  . LYS A 1 111 ? 40.720 23.980  15.031  1.00 36.72 ? 261 LYS A CD  1 
ATOM   500  C  CE  . LYS A 1 111 ? 42.036 23.389  15.473  1.00 40.96 ? 261 LYS A CE  1 
ATOM   501  N  NZ  . LYS A 1 111 ? 43.077 24.413  15.761  1.00 46.70 ? 261 LYS A NZ  1 
ATOM   502  N  N   . GLY A 1 112 ? 35.341 22.248  15.013  1.00 25.10 ? 262 GLY A N   1 
ATOM   503  C  CA  . GLY A 1 112 ? 33.993 22.706  15.316  1.00 24.90 ? 262 GLY A CA  1 
ATOM   504  C  C   . GLY A 1 112 ? 33.214 21.734  16.206  1.00 25.25 ? 262 GLY A C   1 
ATOM   505  O  O   . GLY A 1 112 ? 32.485 22.162  17.082  1.00 24.73 ? 262 GLY A O   1 
ATOM   506  N  N   . HIS A 1 113 ? 33.382 20.425  15.993  1.00 25.62 ? 263 HIS A N   1 
ATOM   507  C  CA  . HIS A 1 113 ? 32.779 19.437  16.908  1.00 25.63 ? 263 HIS A CA  1 
ATOM   508  C  C   . HIS A 1 113 ? 33.167 19.743  18.345  1.00 28.23 ? 263 HIS A C   1 
ATOM   509  O  O   . HIS A 1 113 ? 34.297 20.173  18.608  1.00 26.30 ? 263 HIS A O   1 
ATOM   510  C  CB  . HIS A 1 113 ? 33.171 18.004  16.538  1.00 25.14 ? 263 HIS A CB  1 
ATOM   511  C  CG  . HIS A 1 113 ? 32.331 17.394  15.458  1.00 21.45 ? 263 HIS A CG  1 
ATOM   512  N  ND1 . HIS A 1 113 ? 30.986 17.141  15.621  1.00 22.21 ? 263 HIS A ND1 1 
ATOM   513  C  CD2 . HIS A 1 113 ? 32.641 16.991  14.206  1.00 22.39 ? 263 HIS A CD2 1 
ATOM   514  C  CE1 . HIS A 1 113 ? 30.506 16.604  14.512  1.00 22.74 ? 263 HIS A CE1 1 
ATOM   515  N  NE2 . HIS A 1 113 ? 31.483 16.509  13.630  1.00 23.07 ? 263 HIS A NE2 1 
ATOM   516  N  N   . THR A 1 114 ? 32.226 19.566  19.277  1.00 26.85 ? 264 THR A N   1 
ATOM   517  C  CA  . THR A 1 114 ? 32.493 19.866  20.674  1.00 26.71 ? 264 THR A CA  1 
ATOM   518  C  C   . THR A 1 114 ? 32.707 18.594  21.531  1.00 25.44 ? 264 THR A C   1 
ATOM   519  O  O   . THR A 1 114 ? 32.907 18.695  22.772  1.00 26.22 ? 264 THR A O   1 
ATOM   520  C  CB  . THR A 1 114 ? 31.391 20.703  21.298  1.00 27.70 ? 264 THR A CB  1 
ATOM   521  O  OG1 . THR A 1 114 ? 30.162 20.039  21.085  1.00 27.24 ? 264 THR A OG1 1 
ATOM   522  C  CG2 . THR A 1 114 ? 31.342 22.096  20.654  1.00 29.53 ? 264 THR A CG2 1 
ATOM   523  N  N   . LYS A 1 115 ? 32.676 17.455  20.866  1.00 26.19 ? 265 LYS A N   1 
ATOM   524  C  CA  . LYS A 1 115 ? 33.040 16.164  21.424  1.00 26.85 ? 265 LYS A CA  1 
ATOM   525  C  C   . LYS A 1 115 ? 33.847 15.426  20.368  1.00 24.74 ? 265 LYS A C   1 
ATOM   526  O  O   . LYS A 1 115 ? 33.948 15.843  19.190  1.00 23.63 ? 265 LYS A O   1 
ATOM   527  C  CB  . LYS A 1 115 ? 31.790 15.342  21.781  1.00 29.01 ? 265 LYS A CB  1 
ATOM   528  C  CG  . LYS A 1 115 ? 30.866 15.962  22.839  1.00 30.28 ? 265 LYS A CG  1 
ATOM   529  C  CD  . LYS A 1 115 ? 31.152 15.461  24.211  1.00 35.27 ? 265 LYS A CD  1 
ATOM   530  C  CE  . LYS A 1 115 ? 30.161 16.024  25.246  1.00 40.62 ? 265 LYS A CE  1 
ATOM   531  N  NZ  . LYS A 1 115 ? 30.503 17.449  25.478  1.00 44.12 ? 265 LYS A NZ  1 
ATOM   532  N  N   . LYS A 1 116 ? 34.425 14.321  20.775  1.00 24.81 ? 266 LYS A N   1 
ATOM   533  C  CA  . LYS A 1 116 ? 35.198 13.458  19.881  1.00 25.42 ? 266 LYS A CA  1 
ATOM   534  C  C   . LYS A 1 116 ? 34.420 13.088  18.592  1.00 25.74 ? 266 LYS A C   1 
ATOM   535  O  O   . LYS A 1 116 ? 33.177 13.054  18.572  1.00 24.06 ? 266 LYS A O   1 
ATOM   536  C  CB  . LYS A 1 116 ? 35.636 12.199  20.664  1.00 28.92 ? 266 LYS A CB  1 
ATOM   537  C  CG  . LYS A 1 116 ? 34.485 11.272  21.071  1.00 29.39 ? 266 LYS A CG  1 
ATOM   538  C  CD  . LYS A 1 116 ? 34.977 10.271  22.143  1.00 32.79 ? 266 LYS A CD  1 
ATOM   539  C  CE  . LYS A 1 116 ? 33.936 9.238   22.477  1.00 36.12 ? 266 LYS A CE  1 
ATOM   540  N  NZ  . LYS A 1 116 ? 34.261 8.611   23.789  1.00 43.56 ? 266 LYS A NZ  1 
ATOM   541  N  N   . VAL A 1 117 ? 35.161 12.819  17.518  1.00 23.61 ? 267 VAL A N   1 
ATOM   542  C  CA  . VAL A 1 117 ? 34.557 12.507  16.255  1.00 22.07 ? 267 VAL A CA  1 
ATOM   543  C  C   . VAL A 1 117 ? 34.595 11.006  16.022  1.00 24.59 ? 267 VAL A C   1 
ATOM   544  O  O   . VAL A 1 117 ? 35.679 10.405  15.900  1.00 23.84 ? 267 VAL A O   1 
ATOM   545  C  CB  . VAL A 1 117 ? 35.300 13.223  15.102  1.00 21.85 ? 267 VAL A CB  1 
ATOM   546  C  CG1 . VAL A 1 117 ? 34.581 12.942  13.786  1.00 21.23 ? 267 VAL A CG1 1 
ATOM   547  C  CG2 . VAL A 1 117 ? 35.404 14.719  15.374  1.00 23.12 ? 267 VAL A CG2 1 
ATOM   548  N  N   . THR A 1 118 ? 33.422 10.389  15.888  1.00 24.38 ? 268 THR A N   1 
ATOM   549  C  CA  . THR A 1 118 ? 33.335 8.921   15.865  1.00 23.35 ? 268 THR A CA  1 
ATOM   550  C  C   . THR A 1 118 ? 32.866 8.350   14.526  1.00 23.69 ? 268 THR A C   1 
ATOM   551  O  O   . THR A 1 118 ? 32.949 7.147   14.324  1.00 23.50 ? 268 THR A O   1 
ATOM   552  C  CB  . THR A 1 118 ? 32.386 8.430   16.964  1.00 25.71 ? 268 THR A CB  1 
ATOM   553  O  OG1 . THR A 1 118 ? 31.151 9.147   16.870  1.00 25.71 ? 268 THR A OG1 1 
ATOM   554  C  CG2 . THR A 1 118 ? 32.986 8.600   18.336  1.00 25.60 ? 268 THR A CG2 1 
ATOM   555  N  N   . SER A 1 119 ? 32.397 9.188   13.587  1.00 22.72 ? 269 SER A N   1 
ATOM   556  C  CA  . SER A 1 119 ? 32.087 8.722   12.198  1.00 23.45 ? 269 SER A CA  1 
ATOM   557  C  C   . SER A 1 119 ? 32.576 9.780   11.199  1.00 23.98 ? 269 SER A C   1 
ATOM   558  O  O   . SER A 1 119 ? 32.428 10.989  11.449  1.00 23.82 ? 269 SER A O   1 
ATOM   559  C  CB  . SER A 1 119 ? 30.579 8.600   11.966  1.00 26.31 ? 269 SER A CB  1 
ATOM   560  O  OG  . SER A 1 119 ? 29.993 7.570   12.719  1.00 25.59 ? 269 SER A OG  1 
ATOM   561  N  N   . VAL A 1 120 ? 33.152 9.337   10.098  1.00 22.17 ? 270 VAL A N   1 
ATOM   562  C  CA  . VAL A 1 120 ? 33.510 10.230  8.986   1.00 21.19 ? 270 VAL A CA  1 
ATOM   563  C  C   . VAL A 1 120 ? 33.205 9.559   7.646   1.00 22.08 ? 270 VAL A C   1 
ATOM   564  O  O   . VAL A 1 120 ? 33.282 8.346   7.526   1.00 21.23 ? 270 VAL A O   1 
ATOM   565  C  CB  . VAL A 1 120 ? 34.959 10.683  9.025   1.00 21.84 ? 270 VAL A CB  1 
ATOM   566  C  CG1 . VAL A 1 120 ? 35.275 11.483  10.283  1.00 20.31 ? 270 VAL A CG1 1 
ATOM   567  C  CG2 . VAL A 1 120 ? 35.956 9.505   8.843   1.00 23.76 ? 270 VAL A CG2 1 
ATOM   568  N  N   . VAL A 1 121 ? 32.793 10.368  6.681   1.00 20.83 ? 271 VAL A N   1 
ATOM   569  C  CA  . VAL A 1 121 ? 32.461 9.923   5.321   1.00 23.53 ? 271 VAL A CA  1 
ATOM   570  C  C   . VAL A 1 121 ? 33.063 10.921  4.328   1.00 24.13 ? 271 VAL A C   1 
ATOM   571  O  O   . VAL A 1 121 ? 32.908 12.150  4.492   1.00 23.29 ? 271 VAL A O   1 
ATOM   572  C  CB  . VAL A 1 121 ? 30.960 9.816   5.069   1.00 23.84 ? 271 VAL A CB  1 
ATOM   573  C  CG1 . VAL A 1 121 ? 30.689 9.419   3.595   1.00 25.79 ? 271 VAL A CG1 1 
ATOM   574  C  CG2 . VAL A 1 121 ? 30.303 8.796   5.976   1.00 25.26 ? 271 VAL A CG2 1 
ATOM   575  N  N   . PHE A 1 122 ? 33.754 10.395  3.322   1.00 23.92 ? 272 PHE A N   1 
ATOM   576  C  CA  . PHE A 1 122 ? 34.437 11.205  2.303   1.00 23.97 ? 272 PHE A CA  1 
ATOM   577  C  C   . PHE A 1 122 ? 33.569 11.196  1.044   1.00 26.23 ? 272 PHE A C   1 
ATOM   578  O  O   . PHE A 1 122 ? 33.307 10.132  0.472   1.00 26.36 ? 272 PHE A O   1 
ATOM   579  C  CB  . PHE A 1 122 ? 35.841 10.622  2.027   1.00 24.41 ? 272 PHE A CB  1 
ATOM   580  C  CG  . PHE A 1 122 ? 36.884 11.652  1.642   1.00 25.62 ? 272 PHE A CG  1 
ATOM   581  C  CD1 . PHE A 1 122 ? 36.573 12.711  0.749   1.00 26.27 ? 272 PHE A CD1 1 
ATOM   582  C  CD2 . PHE A 1 122 ? 38.172 11.571  2.133   1.00 24.06 ? 272 PHE A CD2 1 
ATOM   583  C  CE1 . PHE A 1 122 ? 37.544 13.685  0.422   1.00 24.54 ? 272 PHE A CE1 1 
ATOM   584  C  CE2 . PHE A 1 122 ? 39.140 12.515  1.796   1.00 21.77 ? 272 PHE A CE2 1 
ATOM   585  C  CZ  . PHE A 1 122 ? 38.829 13.578  0.967   1.00 24.66 ? 272 PHE A CZ  1 
ATOM   586  N  N   . HIS A 1 123 ? 33.096 12.363  0.609   1.00 23.81 ? 273 HIS A N   1 
ATOM   587  C  CA  . HIS A 1 123 ? 32.326 12.435  -0.657  1.00 25.43 ? 273 HIS A CA  1 
ATOM   588  C  C   . HIS A 1 123 ? 33.232 12.180  -1.864  1.00 26.88 ? 273 HIS A C   1 
ATOM   589  O  O   . HIS A 1 123 ? 34.366 12.627  -1.863  1.00 27.63 ? 273 HIS A O   1 
ATOM   590  C  CB  . HIS A 1 123 ? 31.687 13.797  -0.803  1.00 26.37 ? 273 HIS A CB  1 
ATOM   591  C  CG  . HIS A 1 123 ? 30.520 13.835  -1.749  1.00 26.70 ? 273 HIS A CG  1 
ATOM   592  N  ND1 . HIS A 1 123 ? 30.663 14.024  -3.097  1.00 30.83 ? 273 HIS A ND1 1 
ATOM   593  C  CD2 . HIS A 1 123 ? 29.178 13.707  -1.531  1.00 29.83 ? 273 HIS A CD2 1 
ATOM   594  C  CE1 . HIS A 1 123 ? 29.472 14.021  -3.684  1.00 33.04 ? 273 HIS A CE1 1 
ATOM   595  N  NE2 . HIS A 1 123 ? 28.551 13.820  -2.752  1.00 31.57 ? 273 HIS A NE2 1 
ATOM   596  N  N   . PRO A 1 124 ? 32.723 11.493  -2.913  1.00 29.08 ? 274 PRO A N   1 
ATOM   597  C  CA  . PRO A 1 124 ? 33.517 11.306  -4.163  1.00 31.19 ? 274 PRO A CA  1 
ATOM   598  C  C   . PRO A 1 124 ? 33.920 12.602  -4.896  1.00 29.38 ? 274 PRO A C   1 
ATOM   599  O  O   . PRO A 1 124 ? 34.855 12.589  -5.704  1.00 28.36 ? 274 PRO A O   1 
ATOM   600  C  CB  . PRO A 1 124 ? 32.599 10.442  -5.038  1.00 34.32 ? 274 PRO A CB  1 
ATOM   601  C  CG  . PRO A 1 124 ? 31.228 10.635  -4.482  1.00 35.37 ? 274 PRO A CG  1 
ATOM   602  C  CD  . PRO A 1 124 ? 31.425 10.789  -3.007  1.00 31.34 ? 274 PRO A CD  1 
ATOM   603  N  N   . SER A 1 125 ? 33.260 13.731  -4.594  1.00 29.38 ? 275 SER A N   1 
ATOM   604  C  CA  . SER A 1 125 ? 33.629 15.034  -5.208  1.00 31.08 ? 275 SER A CA  1 
ATOM   605  C  C   . SER A 1 125 ? 34.976 15.544  -4.738  1.00 30.92 ? 275 SER A C   1 
ATOM   606  O  O   . SER A 1 125 ? 35.509 16.460  -5.321  1.00 33.68 ? 275 SER A O   1 
ATOM   607  C  CB  . SER A 1 125 ? 32.552 16.125  -4.927  1.00 32.97 ? 275 SER A CB  1 
ATOM   608  O  OG  . SER A 1 125 ? 32.536 16.449  -3.521  1.00 29.15 ? 275 SER A OG  1 
ATOM   609  N  N   . GLN A 1 126 ? 35.497 14.955  -3.660  1.00 30.55 ? 276 GLN A N   1 
ATOM   610  C  CA  . GLN A 1 126 ? 36.802 15.297  -3.041  1.00 29.81 ? 276 GLN A CA  1 
ATOM   611  C  C   . GLN A 1 126 ? 36.783 16.574  -2.167  1.00 29.83 ? 276 GLN A C   1 
ATOM   612  O  O   . GLN A 1 126 ? 37.545 16.672  -1.226  1.00 31.99 ? 276 GLN A O   1 
ATOM   613  C  CB  . GLN A 1 126 ? 37.943 15.351  -4.060  1.00 30.84 ? 276 GLN A CB  1 
ATOM   614  C  CG  . GLN A 1 126 ? 38.023 14.109  -4.929  1.00 33.23 ? 276 GLN A CG  1 
ATOM   615  C  CD  . GLN A 1 126 ? 39.270 14.076  -5.795  1.00 38.36 ? 276 GLN A CD  1 
ATOM   616  O  OE1 . GLN A 1 126 ? 40.163 14.928  -5.684  1.00 41.84 ? 276 GLN A OE1 1 
ATOM   617  N  NE2 . GLN A 1 126 ? 39.332 13.110  -6.653  1.00 37.05 ? 276 GLN A NE2 1 
ATOM   618  N  N   . ASP A 1 127 ? 35.867 17.494  -2.435  1.00 31.69 ? 277 ASP A N   1 
ATOM   619  C  CA  . ASP A 1 127 ? 35.842 18.764  -1.714  1.00 32.58 ? 277 ASP A CA  1 
ATOM   620  C  C   . ASP A 1 127 ? 34.810 18.787  -0.557  1.00 29.60 ? 277 ASP A C   1 
ATOM   621  O  O   . ASP A 1 127 ? 34.824 19.733  0.245   1.00 29.09 ? 277 ASP A O   1 
ATOM   622  C  CB  . ASP A 1 127 ? 35.615 19.933  -2.685  1.00 36.81 ? 277 ASP A CB  1 
ATOM   623  C  CG  . ASP A 1 127 ? 34.217 19.962  -3.241  1.00 41.20 ? 277 ASP A CG  1 
ATOM   624  O  OD1 . ASP A 1 127 ? 33.717 18.884  -3.657  1.00 45.68 ? 277 ASP A OD1 1 
ATOM   625  O  OD2 . ASP A 1 127 ? 33.592 21.051  -3.241  1.00 47.15 ? 277 ASP A OD2 1 
ATOM   626  N  N   . LEU A 1 128 ? 33.936 17.772  -0.490  1.00 27.82 ? 278 LEU A N   1 
ATOM   627  C  CA  . LEU A 1 128 ? 32.976 17.599  0.642   1.00 29.52 ? 278 LEU A CA  1 
ATOM   628  C  C   . LEU A 1 128 ? 33.383 16.469  1.539   1.00 27.34 ? 278 LEU A C   1 
ATOM   629  O  O   . LEU A 1 128 ? 33.669 15.400  1.059   1.00 27.75 ? 278 LEU A O   1 
ATOM   630  C  CB  . LEU A 1 128 ? 31.566 17.305  0.135   1.00 31.55 ? 278 LEU A CB  1 
ATOM   631  C  CG  . LEU A 1 128 ? 30.784 18.504  -0.394  1.00 31.97 ? 278 LEU A CG  1 
ATOM   632  C  CD1 . LEU A 1 128 ? 29.505 18.044  -1.077  1.00 31.80 ? 278 LEU A CD1 1 
ATOM   633  C  CD2 . LEU A 1 128 ? 30.454 19.479  0.730   1.00 32.93 ? 278 LEU A CD2 1 
ATOM   634  N  N   . VAL A 1 129 ? 33.396 16.704  2.850   1.00 24.70 ? 279 VAL A N   1 
ATOM   635  C  CA  . VAL A 1 129 ? 33.529 15.615  3.809   1.00 24.02 ? 279 VAL A CA  1 
ATOM   636  C  C   . VAL A 1 129 ? 32.480 15.754  4.915   1.00 24.65 ? 279 VAL A C   1 
ATOM   637  O  O   . VAL A 1 129 ? 31.997 16.845  5.202   1.00 23.25 ? 279 VAL A O   1 
ATOM   638  C  CB  . VAL A 1 129 ? 34.952 15.482  4.377   1.00 24.01 ? 279 VAL A CB  1 
ATOM   639  C  CG1 . VAL A 1 129 ? 35.959 15.230  3.236   1.00 25.82 ? 279 VAL A CG1 1 
ATOM   640  C  CG2 . VAL A 1 129 ? 35.382 16.697  5.171   1.00 23.18 ? 279 VAL A CG2 1 
ATOM   641  N  N   . PHE A 1 130 ? 32.159 14.641  5.534   1.00 24.23 ? 280 PHE A N   1 
ATOM   642  C  CA  . PHE A 1 130 ? 31.108 14.582  6.530   1.00 24.21 ? 280 PHE A CA  1 
ATOM   643  C  C   . PHE A 1 130 ? 31.595 13.908  7.753   1.00 23.57 ? 280 PHE A C   1 
ATOM   644  O  O   . PHE A 1 130 ? 32.406 12.977  7.679   1.00 24.26 ? 280 PHE A O   1 
ATOM   645  C  CB  . PHE A 1 130 ? 29.912 13.808  5.979   1.00 23.49 ? 280 PHE A CB  1 
ATOM   646  C  CG  . PHE A 1 130 ? 29.592 14.143  4.544   1.00 24.15 ? 280 PHE A CG  1 
ATOM   647  C  CD1 . PHE A 1 130 ? 29.075 15.366  4.213   1.00 26.20 ? 280 PHE A CD1 1 
ATOM   648  C  CD2 . PHE A 1 130 ? 29.794 13.232  3.545   1.00 24.20 ? 280 PHE A CD2 1 
ATOM   649  C  CE1 . PHE A 1 130 ? 28.781 15.692  2.886   1.00 25.97 ? 280 PHE A CE1 1 
ATOM   650  C  CE2 . PHE A 1 130 ? 29.523 13.542  2.236   1.00 26.66 ? 280 PHE A CE2 1 
ATOM   651  C  CZ  . PHE A 1 130 ? 28.994 14.764  1.894   1.00 26.23 ? 280 PHE A CZ  1 
ATOM   652  N  N   . SER A 1 131 ? 31.101 14.367  8.898   1.00 22.93 ? 281 SER A N   1 
ATOM   653  C  CA  . SER A 1 131 ? 31.427 13.748  10.209  1.00 21.67 ? 281 SER A CA  1 
ATOM   654  C  C   . SER A 1 131 ? 30.246 13.683  11.179  1.00 22.68 ? 281 SER A C   1 
ATOM   655  O  O   . SER A 1 131 ? 29.272 14.391  11.034  1.00 24.49 ? 281 SER A O   1 
ATOM   656  C  CB  . SER A 1 131 ? 32.549 14.542  10.869  1.00 23.19 ? 281 SER A CB  1 
ATOM   657  O  OG  . SER A 1 131 ? 32.169 15.896  11.047  1.00 21.77 ? 281 SER A OG  1 
ATOM   658  N  N   . ALA A 1 132 ? 30.398 12.890  12.246  1.00 22.18 ? 282 ALA A N   1 
ATOM   659  C  CA  . ALA A 1 132 ? 29.382 12.834  13.317  1.00 24.49 ? 282 ALA A CA  1 
ATOM   660  C  C   . ALA A 1 132 ? 30.022 12.415  14.627  1.00 22.80 ? 282 ALA A C   1 
ATOM   661  O  O   . ALA A 1 132 ? 31.142 11.932  14.638  1.00 23.31 ? 282 ALA A O   1 
ATOM   662  C  CB  . ALA A 1 132 ? 28.199 11.923  12.927  1.00 24.33 ? 282 ALA A CB  1 
ATOM   663  N  N   . SER A 1 133 ? 29.309 12.631  15.729  1.00 24.35 ? 283 SER A N   1 
ATOM   664  C  CA  . SER A 1 133 ? 29.913 12.725  17.033  1.00 22.81 ? 283 SER A CA  1 
ATOM   665  C  C   . SER A 1 133 ? 28.899 12.510  18.145  1.00 22.40 ? 283 SER A C   1 
ATOM   666  O  O   . SER A 1 133 ? 27.690 12.754  17.958  1.00 24.11 ? 283 SER A O   1 
ATOM   667  C  CB  . SER A 1 133 ? 30.512 14.109  17.173  1.00 21.09 ? 283 SER A CB  1 
ATOM   668  O  OG  . SER A 1 133 ? 30.938 14.490  18.489  1.00 23.00 ? 283 SER A OG  1 
ATOM   669  N  N   . PRO A 1 134 ? 29.391 12.149  19.319  1.00 25.32 ? 284 PRO A N   1 
ATOM   670  C  CA  . PRO A 1 134 ? 28.558 12.186  20.521  1.00 26.95 ? 284 PRO A CA  1 
ATOM   671  C  C   . PRO A 1 134 ? 28.009 13.575  20.885  1.00 26.93 ? 284 PRO A C   1 
ATOM   672  O  O   . PRO A 1 134 ? 27.139 13.671  21.738  1.00 25.55 ? 284 PRO A O   1 
ATOM   673  C  CB  . PRO A 1 134 ? 29.521 11.712  21.622  1.00 27.55 ? 284 PRO A CB  1 
ATOM   674  C  CG  . PRO A 1 134 ? 30.491 10.857  20.909  1.00 27.83 ? 284 PRO A CG  1 
ATOM   675  C  CD  . PRO A 1 134 ? 30.725 11.619  19.622  1.00 27.05 ? 284 PRO A CD  1 
ATOM   676  N  N   . ASP A 1 135 ? 28.500 14.647  20.275  1.00 23.67 ? 285 ASP A N   1 
ATOM   677  C  CA  . ASP A 1 135 ? 27.842 15.966  20.489  1.00 24.93 ? 285 ASP A CA  1 
ATOM   678  C  C   . ASP A 1 135 ? 26.452 16.057  19.771  1.00 25.81 ? 285 ASP A C   1 
ATOM   679  O  O   . ASP A 1 135 ? 25.805 17.096  19.772  1.00 24.22 ? 285 ASP A O   1 
ATOM   680  C  CB  . ASP A 1 135 ? 28.767 17.129  20.045  1.00 26.25 ? 285 ASP A CB  1 
ATOM   681  C  CG  . ASP A 1 135 ? 28.987 17.215  18.498  1.00 25.10 ? 285 ASP A CG  1 
ATOM   682  O  OD1 . ASP A 1 135 ? 28.306 16.541  17.660  1.00 23.42 ? 285 ASP A OD1 1 
ATOM   683  O  OD2 . ASP A 1 135 ? 29.869 18.005  18.119  1.00 25.39 ? 285 ASP A OD2 1 
ATOM   684  N  N   . ALA A 1 136 ? 26.061 14.978  19.109  1.00 25.25 ? 286 ALA A N   1 
ATOM   685  C  CA  . ALA A 1 136 ? 24.720 14.803  18.487  1.00 23.93 ? 286 ALA A CA  1 
ATOM   686  C  C   . ALA A 1 136 ? 24.564 15.512  17.150  1.00 24.89 ? 286 ALA A C   1 
ATOM   687  O  O   . ALA A 1 136 ? 23.475 15.587  16.621  1.00 27.09 ? 286 ALA A O   1 
ATOM   688  C  CB  . ALA A 1 136 ? 23.595 15.163  19.460  1.00 27.05 ? 286 ALA A CB  1 
ATOM   689  N  N   . THR A 1 137 ? 25.662 16.006  16.597  1.00 24.17 ? 287 THR A N   1 
ATOM   690  C  CA  . THR A 1 137 ? 25.630 16.726  15.314  1.00 24.40 ? 287 THR A CA  1 
ATOM   691  C  C   . THR A 1 137 ? 26.248 15.882  14.214  1.00 25.38 ? 287 THR A C   1 
ATOM   692  O  O   . THR A 1 137 ? 27.095 15.012  14.462  1.00 23.58 ? 287 THR A O   1 
ATOM   693  C  CB  . THR A 1 137 ? 26.360 18.088  15.374  1.00 24.12 ? 287 THR A CB  1 
ATOM   694  O  OG1 . THR A 1 137 ? 27.755 17.867  15.477  1.00 23.94 ? 287 THR A OG1 1 
ATOM   695  C  CG2 . THR A 1 137 ? 25.866 18.968  16.565  1.00 25.56 ? 287 THR A CG2 1 
ATOM   696  N  N   . ILE A 1 138 ? 25.811 16.184  12.983  1.00 25.86 ? 288 ILE A N   1 
ATOM   697  C  CA  . ILE A 1 138 ? 26.411 15.750  11.759  1.00 24.61 ? 288 ILE A CA  1 
ATOM   698  C  C   . ILE A 1 138 ? 26.927 17.008  11.081  1.00 24.67 ? 288 ILE A C   1 
ATOM   699  O  O   . ILE A 1 138 ? 26.190 17.992  10.960  1.00 25.17 ? 288 ILE A O   1 
ATOM   700  C  CB  . ILE A 1 138 ? 25.337 15.084  10.821  1.00 24.00 ? 288 ILE A CB  1 
ATOM   701  C  CG1 . ILE A 1 138 ? 24.732 13.827  11.462  1.00 23.53 ? 288 ILE A CG1 1 
ATOM   702  C  CG2 . ILE A 1 138 ? 25.917 14.758  9.444   1.00 26.10 ? 288 ILE A CG2 1 
ATOM   703  C  CD1 . ILE A 1 138 ? 23.408 13.439  10.843  1.00 25.18 ? 288 ILE A CD1 1 
ATOM   704  N  N   . ARG A 1 139 ? 28.179 17.007  10.657  1.00 22.95 ? 289 ARG A N   1 
ATOM   705  C  CA  . ARG A 1 139 ? 28.744 18.209  10.067  1.00 23.57 ? 289 ARG A CA  1 
ATOM   706  C  C   . ARG A 1 139 ? 29.190 17.950  8.663   1.00 23.50 ? 289 ARG A C   1 
ATOM   707  O  O   . ARG A 1 139 ? 29.774 16.908  8.371   1.00 23.35 ? 289 ARG A O   1 
ATOM   708  C  CB  . ARG A 1 139 ? 29.861 18.766  10.952  1.00 23.10 ? 289 ARG A CB  1 
ATOM   709  C  CG  . ARG A 1 139 ? 29.310 19.231  12.324  1.00 25.04 ? 289 ARG A CG  1 
ATOM   710  C  CD  . ARG A 1 139 ? 30.287 19.907  13.277  1.00 25.95 ? 289 ARG A CD  1 
ATOM   711  N  NE  . ARG A 1 139 ? 29.691 19.946  14.630  1.00 28.35 ? 289 ARG A NE  1 
ATOM   712  C  CZ  . ARG A 1 139 ? 29.544 21.027  15.396  1.00 28.26 ? 289 ARG A CZ  1 
ATOM   713  N  NH1 . ARG A 1 139 ? 29.977 22.253  14.997  1.00 29.88 ? 289 ARG A NH1 1 
ATOM   714  N  NH2 . ARG A 1 139 ? 28.997 20.871  16.606  1.00 28.43 ? 289 ARG A NH2 1 
ATOM   715  N  N   . ILE A 1 140 ? 28.877 18.917  7.793   1.00 23.31 ? 290 ILE A N   1 
ATOM   716  C  CA  . ILE A 1 140 ? 29.243 18.923  6.403   1.00 25.60 ? 290 ILE A CA  1 
ATOM   717  C  C   . ILE A 1 140 ? 30.276 20.002  6.204   1.00 21.84 ? 290 ILE A C   1 
ATOM   718  O  O   . ILE A 1 140 ? 30.045 21.155  6.571   1.00 22.95 ? 290 ILE A O   1 
ATOM   719  C  CB  . ILE A 1 140 ? 28.006 19.214  5.502   1.00 25.50 ? 290 ILE A CB  1 
ATOM   720  C  CG1 A ILE A 1 140 ? 26.776 18.355  5.865   0.50 30.11 ? 290 ILE A CG1 1 
ATOM   721  C  CG1 B ILE A 1 140 ? 26.936 18.140  5.798   0.50 25.77 ? 290 ILE A CG1 1 
ATOM   722  C  CG2 . ILE A 1 140 ? 28.388 19.175  4.020   1.00 27.53 ? 290 ILE A CG2 1 
ATOM   723  C  CD1 A ILE A 1 140 ? 27.010 16.908  6.146   0.50 31.73 ? 290 ILE A CD1 1 
ATOM   724  C  CD1 B ILE A 1 140 ? 25.589 18.331  5.137   0.50 25.47 ? 290 ILE A CD1 1 
ATOM   725  N  N   . TRP A 1 141 ? 31.406 19.636  5.618   1.00 22.30 ? 291 TRP A N   1 
ATOM   726  C  CA  . TRP A 1 141 ? 32.576 20.532  5.519   1.00 21.77 ? 291 TRP A CA  1 
ATOM   727  C  C   . TRP A 1 141 ? 33.013 20.714  4.081   1.00 25.83 ? 291 TRP A C   1 
ATOM   728  O  O   . TRP A 1 141 ? 32.957 19.750  3.281   1.00 25.06 ? 291 TRP A O   1 
ATOM   729  C  CB  . TRP A 1 141 ? 33.790 19.933  6.249   1.00 21.16 ? 291 TRP A CB  1 
ATOM   730  C  CG  . TRP A 1 141 ? 33.530 19.424  7.672   1.00 22.84 ? 291 TRP A CG  1 
ATOM   731  C  CD1 . TRP A 1 141 ? 33.003 18.202  8.034   1.00 23.91 ? 291 TRP A CD1 1 
ATOM   732  C  CD2 . TRP A 1 141 ? 33.818 20.104  8.902   1.00 22.66 ? 291 TRP A CD2 1 
ATOM   733  N  NE1 . TRP A 1 141 ? 32.942 18.090  9.401   1.00 22.89 ? 291 TRP A NE1 1 
ATOM   734  C  CE2 . TRP A 1 141 ? 33.444 19.226  9.966   1.00 22.73 ? 291 TRP A CE2 1 
ATOM   735  C  CE3 . TRP A 1 141 ? 34.375 21.342  9.217   1.00 23.94 ? 291 TRP A CE3 1 
ATOM   736  C  CZ2 . TRP A 1 141 ? 33.573 19.577  11.324  1.00 23.03 ? 291 TRP A CZ2 1 
ATOM   737  C  CZ3 . TRP A 1 141 ? 34.535 21.684  10.570  1.00 23.80 ? 291 TRP A CZ3 1 
ATOM   738  C  CH2 . TRP A 1 141 ? 34.118 20.802  11.609  1.00 24.57 ? 291 TRP A CH2 1 
ATOM   739  N  N   . SER A 1 142 ? 33.483 21.911  3.791   1.00 26.20 ? 292 SER A N   1 
ATOM   740  C  CA  . SER A 1 142 ? 34.252 22.215  2.593   1.00 27.34 ? 292 SER A CA  1 
ATOM   741  C  C   . SER A 1 142 ? 35.744 22.041  2.872   1.00 28.28 ? 292 SER A C   1 
ATOM   742  O  O   . SER A 1 142 ? 36.313 22.721  3.737   1.00 28.95 ? 292 SER A O   1 
ATOM   743  C  CB  . SER A 1 142 ? 33.995 23.667  2.150   1.00 27.03 ? 292 SER A CB  1 
ATOM   744  O  OG  . SER A 1 142 ? 34.880 24.075  1.065   1.00 27.56 ? 292 SER A OG  1 
ATOM   745  N  N   . VAL A 1 143 ? 36.381 21.137  2.145   1.00 27.76 ? 293 VAL A N   1 
ATOM   746  C  CA  . VAL A 1 143 ? 37.820 20.932  2.286   1.00 29.55 ? 293 VAL A CA  1 
ATOM   747  C  C   . VAL A 1 143 ? 38.615 22.162  1.799   1.00 31.42 ? 293 VAL A C   1 
ATOM   748  O  O   . VAL A 1 143 ? 39.485 22.686  2.537   1.00 29.37 ? 293 VAL A O   1 
ATOM   749  C  CB  . VAL A 1 143 ? 38.273 19.618  1.586   1.00 32.04 ? 293 VAL A CB  1 
ATOM   750  C  CG1 . VAL A 1 143 ? 39.776 19.422  1.721   1.00 34.38 ? 293 VAL A CG1 1 
ATOM   751  C  CG2 . VAL A 1 143 ? 37.531 18.404  2.193   1.00 31.14 ? 293 VAL A CG2 1 
ATOM   752  N  N   . PRO A 1 144 ? 38.320 22.649  0.592   1.00 31.68 ? 294 PRO A N   1 
ATOM   753  C  CA  . PRO A 1 144 ? 39.116 23.781  0.097   1.00 33.86 ? 294 PRO A CA  1 
ATOM   754  C  C   . PRO A 1 144 ? 38.942 25.069  0.926   1.00 32.67 ? 294 PRO A C   1 
ATOM   755  O  O   . PRO A 1 144 ? 39.880 25.814  1.069   1.00 36.68 ? 294 PRO A O   1 
ATOM   756  C  CB  . PRO A 1 144 ? 38.647 23.970  -1.342  1.00 36.36 ? 294 PRO A CB  1 
ATOM   757  C  CG  . PRO A 1 144 ? 37.419 23.117  -1.521  1.00 38.33 ? 294 PRO A CG  1 
ATOM   758  C  CD  . PRO A 1 144 ? 37.338 22.147  -0.395  1.00 34.35 ? 294 PRO A CD  1 
ATOM   759  N  N   . ASN A 1 145 ? 37.769 25.293  1.493   1.00 31.83 ? 295 ASN A N   1 
ATOM   760  C  CA  . ASN A 1 145 ? 37.552 26.474  2.371   1.00 34.82 ? 295 ASN A CA  1 
ATOM   761  C  C   . ASN A 1 145 ? 37.876 26.164  3.837   1.00 33.17 ? 295 ASN A C   1 
ATOM   762  O  O   . ASN A 1 145 ? 37.820 27.068  4.664   1.00 36.11 ? 295 ASN A O   1 
ATOM   763  C  CB  . ASN A 1 145 ? 36.111 26.997  2.244   1.00 34.71 ? 295 ASN A CB  1 
ATOM   764  C  CG  . ASN A 1 145 ? 36.008 28.261  1.400   1.00 37.53 ? 295 ASN A CG  1 
ATOM   765  O  OD1 . ASN A 1 145 ? 37.009 28.860  1.003   1.00 39.77 ? 295 ASN A OD1 1 
ATOM   766  N  ND2 . ASN A 1 145 ? 34.797 28.662  1.107   1.00 42.78 ? 295 ASN A ND2 1 
ATOM   767  N  N   . ALA A 1 146 ? 38.189 24.896  4.142   1.00 32.88 ? 296 ALA A N   1 
ATOM   768  C  CA  . ALA A 1 146 ? 38.469 24.421  5.513   1.00 31.15 ? 296 ALA A CA  1 
ATOM   769  C  C   . ALA A 1 146 ? 37.395 24.915  6.463   1.00 32.55 ? 296 ALA A C   1 
ATOM   770  O  O   . ALA A 1 146 ? 37.693 25.530  7.512   1.00 28.47 ? 296 ALA A O   1 
ATOM   771  C  CB  . ALA A 1 146 ? 39.850 24.892  5.962   1.00 37.13 ? 296 ALA A CB  1 
ATOM   772  N  N   . SER A 1 147 ? 36.135 24.714  6.068   1.00 26.65 ? 297 SER A N   1 
ATOM   773  C  CA  . SER A 1 147 ? 35.028 25.303  6.774   1.00 27.97 ? 297 SER A CA  1 
ATOM   774  C  C   . SER A 1 147 ? 33.901 24.314  6.963   1.00 25.67 ? 297 SER A C   1 
ATOM   775  O  O   . SER A 1 147 ? 33.792 23.367  6.210   1.00 25.58 ? 297 SER A O   1 
ATOM   776  C  CB  . SER A 1 147 ? 34.510 26.522  6.012   1.00 28.82 ? 297 SER A CB  1 
ATOM   777  O  OG  . SER A 1 147 ? 33.906 26.105  4.802   1.00 31.97 ? 297 SER A OG  1 
ATOM   778  N  N   . CYS A 1 148 ? 33.070 24.544  7.979   1.00 25.83 ? 298 CYS A N   1 
ATOM   779  C  CA  . CYS A 1 148 ? 31.827 23.784  8.146   1.00 26.54 ? 298 CYS A CA  1 
ATOM   780  C  C   . CYS A 1 148 ? 30.671 24.543  7.495   1.00 26.86 ? 298 CYS A C   1 
ATOM   781  O  O   . CYS A 1 148 ? 30.376 25.712  7.869   1.00 28.78 ? 298 CYS A O   1 
ATOM   782  C  CB  . CYS A 1 148 ? 31.526 23.538  9.616   1.00 27.18 ? 298 CYS A CB  1 
ATOM   783  S  SG  . CYS A 1 148 ? 29.987 22.671  9.878   1.00 27.44 ? 298 CYS A SG  1 
ATOM   784  N  N   . VAL A 1 149 ? 30.025 23.905  6.532   1.00 24.78 ? 299 VAL A N   1 
ATOM   785  C  CA  . VAL A 1 149 ? 28.953 24.554  5.795   1.00 26.89 ? 299 VAL A CA  1 
ATOM   786  C  C   . VAL A 1 149 ? 27.596 24.218  6.336   1.00 25.17 ? 299 VAL A C   1 
ATOM   787  O  O   . VAL A 1 149 ? 26.682 25.031  6.253   1.00 25.41 ? 299 VAL A O   1 
ATOM   788  C  CB  . VAL A 1 149 ? 29.060 24.369  4.246   1.00 30.70 ? 299 VAL A CB  1 
ATOM   789  C  CG1 . VAL A 1 149 ? 30.407 24.888  3.764   1.00 30.92 ? 299 VAL A CG1 1 
ATOM   790  C  CG2 . VAL A 1 149 ? 28.895 22.944  3.822   1.00 29.57 ? 299 VAL A CG2 1 
ATOM   791  N  N   . GLN A 1 150 ? 27.449 23.057  6.963   1.00 25.40 ? 300 GLN A N   1 
ATOM   792  C  CA  . GLN A 1 150 ? 26.198 22.738  7.600   1.00 25.60 ? 300 GLN A CA  1 
ATOM   793  C  C   . GLN A 1 150 ? 26.443 21.955  8.866   1.00 23.84 ? 300 GLN A C   1 
ATOM   794  O  O   . GLN A 1 150 ? 27.342 21.117  8.918   1.00 25.42 ? 300 GLN A O   1 
ATOM   795  C  CB  . GLN A 1 150 ? 25.310 21.873  6.663   1.00 27.38 ? 300 GLN A CB  1 
ATOM   796  C  CG  . GLN A 1 150 ? 24.814 22.536  5.390   1.00 29.61 ? 300 GLN A CG  1 
ATOM   797  C  CD  . GLN A 1 150 ? 23.772 23.595  5.668   1.00 30.17 ? 300 GLN A CD  1 
ATOM   798  O  OE1 . GLN A 1 150 ? 23.138 23.596  6.707   1.00 30.80 ? 300 GLN A OE1 1 
ATOM   799  N  NE2 . GLN A 1 150 ? 23.619 24.504  4.767   1.00 32.93 ? 300 GLN A NE2 1 
ATOM   800  N  N   . VAL A 1 151 ? 25.607 22.206  9.864   1.00 24.06 ? 301 VAL A N   1 
ATOM   801  C  CA  . VAL A 1 151 ? 25.560 21.411  11.075  1.00 25.85 ? 301 VAL A CA  1 
ATOM   802  C  C   . VAL A 1 151 ? 24.154 20.881  11.156  1.00 24.72 ? 301 VAL A C   1 
ATOM   803  O  O   . VAL A 1 151 ? 23.189 21.641  11.407  1.00 26.96 ? 301 VAL A O   1 
ATOM   804  C  CB  . VAL A 1 151 ? 25.906 22.224  12.345  1.00 24.92 ? 301 VAL A CB  1 
ATOM   805  C  CG1 . VAL A 1 151 ? 26.010 21.321  13.580  1.00 23.69 ? 301 VAL A CG1 1 
ATOM   806  C  CG2 . VAL A 1 151 ? 27.196 23.004  12.141  1.00 25.63 ? 301 VAL A CG2 1 
ATOM   807  N  N   . VAL A 1 152 ? 24.003 19.572  10.907  1.00 23.70 ? 302 VAL A N   1 
ATOM   808  C  CA  . VAL A 1 152 ? 22.685 18.984  10.889  1.00 25.03 ? 302 VAL A CA  1 
ATOM   809  C  C   . VAL A 1 152 ? 22.399 18.407  12.266  1.00 22.57 ? 302 VAL A C   1 
ATOM   810  O  O   . VAL A 1 152 ? 23.134 17.538  12.743  1.00 24.49 ? 302 VAL A O   1 
ATOM   811  C  CB  . VAL A 1 152 ? 22.576 17.875  9.820   1.00 26.03 ? 302 VAL A CB  1 
ATOM   812  C  CG1 . VAL A 1 152 ? 21.167 17.351  9.777   1.00 26.67 ? 302 VAL A CG1 1 
ATOM   813  C  CG2 . VAL A 1 152 ? 23.057 18.358  8.445   1.00 26.25 ? 302 VAL A CG2 1 
ATOM   814  N  N   . ARG A 1 153 ? 21.313 18.859  12.865  1.00 24.78 ? 303 ARG A N   1 
ATOM   815  C  CA  . ARG A 1 153 ? 20.887 18.455  14.196  1.00 26.31 ? 303 ARG A CA  1 
ATOM   816  C  C   . ARG A 1 153 ? 19.626 17.627  14.111  1.00 27.87 ? 303 ARG A C   1 
ATOM   817  O  O   . ARG A 1 153 ? 18.540 18.069  14.466  1.00 29.83 ? 303 ARG A O   1 
ATOM   818  C  CB  . ARG A 1 153 ? 20.717 19.690  15.102  1.00 27.10 ? 303 ARG A CB  1 
ATOM   819  C  CG  . ARG A 1 153 ? 22.071 20.192  15.549  1.00 27.80 ? 303 ARG A CG  1 
ATOM   820  C  CD  . ARG A 1 153 ? 21.975 21.244  16.676  1.00 31.90 ? 303 ARG A CD  1 
ATOM   821  N  NE  . ARG A 1 153 ? 23.291 21.638  17.192  1.00 29.34 ? 303 ARG A NE  1 
ATOM   822  C  CZ  . ARG A 1 153 ? 24.122 22.491  16.594  1.00 30.81 ? 303 ARG A CZ  1 
ATOM   823  N  NH1 . ARG A 1 153 ? 25.284 22.789  17.172  1.00 32.06 ? 303 ARG A NH1 1 
ATOM   824  N  NH2 . ARG A 1 153 ? 23.813 23.050  15.417  1.00 28.76 ? 303 ARG A NH2 1 
ATOM   825  N  N   . ALA A 1 154 ? 19.800 16.390  13.626  1.00 28.75 ? 304 ALA A N   1 
ATOM   826  C  CA  . ALA A 1 154 ? 18.699 15.466  13.433  1.00 28.96 ? 304 ALA A CA  1 
ATOM   827  C  C   . ALA A 1 154 ? 18.322 14.692  14.699  1.00 29.58 ? 304 ALA A C   1 
ATOM   828  O  O   . ALA A 1 154 ? 17.235 14.080  14.785  1.00 32.54 ? 304 ALA A O   1 
ATOM   829  C  CB  . ALA A 1 154 ? 19.062 14.486  12.320  1.00 27.80 ? 304 ALA A CB  1 
ATOM   830  N  N   . HIS A 1 155 ? 19.223 14.680  15.669  1.00 30.54 ? 305 HIS A N   1 
ATOM   831  C  CA  . HIS A 1 155 ? 19.151 13.766  16.764  1.00 29.73 ? 305 HIS A CA  1 
ATOM   832  C  C   . HIS A 1 155 ? 19.295 14.452  18.109  1.00 31.68 ? 305 HIS A C   1 
ATOM   833  O  O   . HIS A 1 155 ? 19.786 15.555  18.200  1.00 33.66 ? 305 HIS A O   1 
ATOM   834  C  CB  . HIS A 1 155 ? 20.242 12.703  16.598  1.00 28.66 ? 305 HIS A CB  1 
ATOM   835  C  CG  . HIS A 1 155 ? 20.056 11.843  15.399  1.00 26.47 ? 305 HIS A CG  1 
ATOM   836  N  ND1 . HIS A 1 155 ? 19.070 10.886  15.310  1.00 28.37 ? 305 HIS A ND1 1 
ATOM   837  C  CD2 . HIS A 1 155 ? 20.707 11.827  14.208  1.00 28.45 ? 305 HIS A CD2 1 
ATOM   838  C  CE1 . HIS A 1 155 ? 19.146 10.282  14.139  1.00 29.08 ? 305 HIS A CE1 1 
ATOM   839  N  NE2 . HIS A 1 155 ? 20.124 10.843  13.444  1.00 29.26 ? 305 HIS A NE2 1 
ATOM   840  N  N   . GLU A 1 156 ? 18.850 13.778  19.144  1.00 34.07 ? 306 GLU A N   1 
ATOM   841  C  CA  . GLU A 1 156 ? 18.899 14.319  20.473  1.00 39.71 ? 306 GLU A CA  1 
ATOM   842  C  C   . GLU A 1 156 ? 20.022 13.731  21.313  1.00 37.75 ? 306 GLU A C   1 
ATOM   843  O  O   . GLU A 1 156 ? 20.217 14.148  22.452  1.00 37.04 ? 306 GLU A O   1 
ATOM   844  C  CB  . GLU A 1 156 ? 17.563 14.091  21.141  1.00 44.13 ? 306 GLU A CB  1 
ATOM   845  C  CG  . GLU A 1 156 ? 16.513 15.077  20.653  1.00 51.66 ? 306 GLU A CG  1 
ATOM   846  C  CD  . GLU A 1 156 ? 15.168 14.847  21.285  1.00 58.42 ? 306 GLU A CD  1 
ATOM   847  O  OE1 . GLU A 1 156 ? 15.029 13.903  22.105  1.00 58.45 ? 306 GLU A OE1 1 
ATOM   848  O  OE2 . GLU A 1 156 ? 14.242 15.603  20.945  1.00 67.89 ? 306 GLU A OE2 1 
ATOM   849  N  N   . SER A 1 157 ? 20.727 12.738  20.779  1.00 34.45 ? 307 SER A N   1 
ATOM   850  C  CA  . SER A 1 157 ? 21.837 12.129  21.493  1.00 34.12 ? 307 SER A CA  1 
ATOM   851  C  C   . SER A 1 157 ? 22.866 11.688  20.462  1.00 31.07 ? 307 SER A C   1 
ATOM   852  O  O   . SER A 1 157 ? 22.719 11.994  19.305  1.00 28.40 ? 307 SER A O   1 
ATOM   853  C  CB  . SER A 1 157 ? 21.338 10.976  22.409  1.00 36.49 ? 307 SER A CB  1 
ATOM   854  O  OG  . SER A 1 157 ? 20.689 9.989   21.647  1.00 40.49 ? 307 SER A OG  1 
ATOM   855  N  N   . ALA A 1 158 ? 23.941 11.056  20.918  1.00 29.47 ? 308 ALA A N   1 
ATOM   856  C  CA  . ALA A 1 158 ? 25.032 10.663  20.062  1.00 29.22 ? 308 ALA A CA  1 
ATOM   857  C  C   . ALA A 1 158 ? 24.618 10.054  18.715  1.00 29.58 ? 308 ALA A C   1 
ATOM   858  O  O   . ALA A 1 158 ? 23.753 9.188   18.630  1.00 26.98 ? 308 ALA A O   1 
ATOM   859  C  CB  . ALA A 1 158 ? 25.962 9.697   20.820  1.00 32.28 ? 308 ALA A CB  1 
ATOM   860  N  N   . VAL A 1 159 ? 25.267 10.517  17.651  1.00 26.29 ? 309 VAL A N   1 
ATOM   861  C  CA  . VAL A 1 159 ? 25.074 9.947   16.346  1.00 25.88 ? 309 VAL A CA  1 
ATOM   862  C  C   . VAL A 1 159 ? 26.043 8.766   16.210  1.00 28.17 ? 309 VAL A C   1 
ATOM   863  O  O   . VAL A 1 159 ? 27.260 8.917   16.361  1.00 27.95 ? 309 VAL A O   1 
ATOM   864  C  CB  . VAL A 1 159 ? 25.283 11.023  15.257  1.00 26.38 ? 309 VAL A CB  1 
ATOM   865  C  CG1 . VAL A 1 159 ? 25.123 10.441  13.859  1.00 26.03 ? 309 VAL A CG1 1 
ATOM   866  C  CG2 . VAL A 1 159 ? 24.320 12.194  15.491  1.00 26.21 ? 309 VAL A CG2 1 
ATOM   867  N  N   . THR A 1 160 ? 25.491 7.587   15.942  1.00 26.80 ? 310 THR A N   1 
ATOM   868  C  CA  . THR A 1 160 ? 26.247 6.325   15.985  1.00 28.73 ? 310 THR A CA  1 
ATOM   869  C  C   . THR A 1 160 ? 26.676 5.779   14.631  1.00 28.16 ? 310 THR A C   1 
ATOM   870  O  O   . THR A 1 160 ? 27.431 4.844   14.574  1.00 27.37 ? 310 THR A O   1 
ATOM   871  C  CB  . THR A 1 160 ? 25.428 5.260   16.703  1.00 27.73 ? 310 THR A CB  1 
ATOM   872  O  OG1 . THR A 1 160 ? 24.151 5.121   16.052  1.00 27.16 ? 310 THR A OG1 1 
ATOM   873  C  CG2 . THR A 1 160 ? 25.231 5.732   18.159  1.00 29.06 ? 310 THR A CG2 1 
ATOM   874  N  N   . GLY A 1 161 ? 26.179 6.366   13.548  1.00 26.65 ? 311 GLY A N   1 
ATOM   875  C  CA  . GLY A 1 161 ? 26.469 5.864   12.221  1.00 25.17 ? 311 GLY A CA  1 
ATOM   876  C  C   . GLY A 1 161 ? 26.108 6.894   11.186  1.00 23.85 ? 311 GLY A C   1 
ATOM   877  O  O   . GLY A 1 161 ? 25.226 7.735   11.402  1.00 23.58 ? 311 GLY A O   1 
ATOM   878  N  N   . LEU A 1 162 ? 26.822 6.844   10.066  1.00 25.48 ? 312 LEU A N   1 
ATOM   879  C  CA  . LEU A 1 162 ? 26.671 7.840   9.012   1.00 26.77 ? 312 LEU A CA  1 
ATOM   880  C  C   . LEU A 1 162 ? 26.972 7.187   7.681   1.00 26.87 ? 312 LEU A C   1 
ATOM   881  O  O   . LEU A 1 162 ? 28.037 6.602   7.521   1.00 25.82 ? 312 LEU A O   1 
ATOM   882  C  CB  . LEU A 1 162 ? 27.628 9.015   9.264   1.00 27.45 ? 312 LEU A CB  1 
ATOM   883  C  CG  . LEU A 1 162 ? 27.417 10.269  8.407   1.00 29.83 ? 312 LEU A CG  1 
ATOM   884  C  CD1 . LEU A 1 162 ? 26.079 10.918  8.680   1.00 29.72 ? 312 LEU A CD1 1 
ATOM   885  C  CD2 . LEU A 1 162 ? 28.536 11.273  8.652   1.00 31.00 ? 312 LEU A CD2 1 
ATOM   886  N  N   . SER A 1 163 ? 26.073 7.322   6.723   1.00 26.52 ? 313 SER A N   1 
ATOM   887  C  CA  . SER A 1 163 ? 26.255 6.707   5.419   1.00 26.25 ? 313 SER A CA  1 
ATOM   888  C  C   . SER A 1 163 ? 25.758 7.602   4.309   1.00 28.65 ? 313 SER A C   1 
ATOM   889  O  O   . SER A 1 163 ? 24.688 8.173   4.418   1.00 28.78 ? 313 SER A O   1 
ATOM   890  C  CB  . SER A 1 163 ? 25.519 5.390   5.429   1.00 27.49 ? 313 SER A CB  1 
ATOM   891  O  OG  . SER A 1 163 ? 25.736 4.651   4.250   1.00 28.62 ? 313 SER A OG  1 
ATOM   892  N  N   . LEU A 1 164 ? 26.586 7.758   3.256   1.00 25.59 ? 314 LEU A N   1 
ATOM   893  C  CA  . LEU A 1 164 ? 26.264 8.554   2.078   1.00 27.80 ? 314 LEU A CA  1 
ATOM   894  C  C   . LEU A 1 164 ? 25.422 7.763   1.097   1.00 29.01 ? 314 LEU A C   1 
ATOM   895  O  O   . LEU A 1 164 ? 25.794 6.628   0.692   1.00 30.92 ? 314 LEU A O   1 
ATOM   896  C  CB  . LEU A 1 164 ? 27.552 8.970   1.378   1.00 26.81 ? 314 LEU A CB  1 
ATOM   897  C  CG  . LEU A 1 164 ? 27.423 9.887   0.183   1.00 28.25 ? 314 LEU A CG  1 
ATOM   898  C  CD1 . LEU A 1 164 ? 26.803 11.209  0.611   1.00 26.85 ? 314 LEU A CD1 1 
ATOM   899  C  CD2 . LEU A 1 164 ? 28.826 10.093  -0.426  1.00 28.92 ? 314 LEU A CD2 1 
ATOM   900  N  N   . HIS A 1 165 ? 24.309 8.347   0.677   1.00 30.75 ? 315 HIS A N   1 
ATOM   901  C  CA  . HIS A 1 165 ? 23.452 7.718   -0.329  1.00 31.75 ? 315 HIS A CA  1 
ATOM   902  C  C   . HIS A 1 165 ? 24.134 7.602   -1.690  1.00 32.28 ? 315 HIS A C   1 
ATOM   903  O  O   . HIS A 1 165 ? 24.968 8.434   -2.038  1.00 31.68 ? 315 HIS A O   1 
ATOM   904  C  CB  . HIS A 1 165 ? 22.145 8.535   -0.469  1.00 31.17 ? 315 HIS A CB  1 
ATOM   905  C  CG  . HIS A 1 165 ? 21.095 7.862   -1.272  1.00 32.61 ? 315 HIS A CG  1 
ATOM   906  N  ND1 . HIS A 1 165 ? 20.635 8.373   -2.455  1.00 33.96 ? 315 HIS A ND1 1 
ATOM   907  C  CD2 . HIS A 1 165 ? 20.375 6.740   -1.042  1.00 32.79 ? 315 HIS A CD2 1 
ATOM   908  C  CE1 . HIS A 1 165 ? 19.688 7.583   -2.940  1.00 36.99 ? 315 HIS A CE1 1 
ATOM   909  N  NE2 . HIS A 1 165 ? 19.509 6.587   -2.095  1.00 34.04 ? 315 HIS A NE2 1 
ATOM   910  N  N   . ALA A 1 166 ? 23.725 6.591   -2.471  1.00 33.52 ? 316 ALA A N   1 
ATOM   911  C  CA  . ALA A 1 166 ? 24.243 6.336   -3.855  1.00 35.81 ? 316 ALA A CA  1 
ATOM   912  C  C   . ALA A 1 166 ? 24.263 7.580   -4.772  1.00 36.82 ? 316 ALA A C   1 
ATOM   913  O  O   . ALA A 1 166 ? 25.198 7.771   -5.521  1.00 37.88 ? 316 ALA A O   1 
ATOM   914  C  CB  . ALA A 1 166 ? 23.437 5.214   -4.524  1.00 36.89 ? 316 ALA A CB  1 
ATOM   915  N  N   . THR A 1 167 ? 23.251 8.426   -4.662  1.00 37.50 ? 317 THR A N   1 
ATOM   916  C  CA  . THR A 1 167 ? 23.171 9.640   -5.449  1.00 37.50 ? 317 THR A CA  1 
ATOM   917  C  C   . THR A 1 167 ? 24.253 10.654  -5.077  1.00 37.72 ? 317 THR A C   1 
ATOM   918  O  O   . THR A 1 167 ? 24.514 11.572  -5.844  1.00 39.31 ? 317 THR A O   1 
ATOM   919  C  CB  . THR A 1 167 ? 21.847 10.361  -5.217  1.00 38.02 ? 317 THR A CB  1 
ATOM   920  O  OG1 . THR A 1 167 ? 21.743 10.747  -3.809  1.00 33.62 ? 317 THR A OG1 1 
ATOM   921  C  CG2 . THR A 1 167 ? 20.682 9.521   -5.642  1.00 39.14 ? 317 THR A CG2 1 
ATOM   922  N  N   . GLY A 1 168 ? 24.823 10.525  -3.889  1.00 33.69 ? 318 GLY A N   1 
ATOM   923  C  CA  . GLY A 1 168 ? 25.778 11.491  -3.370  1.00 33.61 ? 318 GLY A CA  1 
ATOM   924  C  C   . GLY A 1 168 ? 25.133 12.727  -2.754  1.00 34.89 ? 318 GLY A C   1 
ATOM   925  O  O   . GLY A 1 168 ? 25.837 13.660  -2.340  1.00 32.55 ? 318 GLY A O   1 
ATOM   926  N  N   . ASP A 1 169 ? 23.803 12.738  -2.641  1.00 33.28 ? 319 ASP A N   1 
ATOM   927  C  CA  . ASP A 1 169 ? 23.104 13.971  -2.258  1.00 33.56 ? 319 ASP A CA  1 
ATOM   928  C  C   . ASP A 1 169 ? 22.512 13.962  -0.823  1.00 29.94 ? 319 ASP A C   1 
ATOM   929  O  O   . ASP A 1 169 ? 22.057 15.000  -0.341  1.00 31.21 ? 319 ASP A O   1 
ATOM   930  C  CB  . ASP A 1 169 ? 22.002 14.263  -3.251  1.00 33.75 ? 319 ASP A CB  1 
ATOM   931  C  CG  . ASP A 1 169 ? 22.523 14.493  -4.696  1.00 36.38 ? 319 ASP A CG  1 
ATOM   932  O  OD1 . ASP A 1 169 ? 23.675 14.870  -4.917  1.00 35.65 ? 319 ASP A OD1 1 
ATOM   933  O  OD2 . ASP A 1 169 ? 21.749 14.270  -5.588  1.00 35.10 ? 319 ASP A OD2 1 
ATOM   934  N  N   . TYR A 1 170 ? 22.533 12.809  -0.159  1.00 31.34 ? 320 TYR A N   1 
ATOM   935  C  CA  . TYR A 1 170 ? 21.820 12.578  1.120   1.00 28.95 ? 320 TYR A CA  1 
ATOM   936  C  C   . TYR A 1 170 ? 22.656 11.741  2.063   1.00 29.16 ? 320 TYR A C   1 
ATOM   937  O  O   . TYR A 1 170 ? 23.472 10.916  1.637   1.00 29.69 ? 320 TYR A O   1 
ATOM   938  C  CB  . TYR A 1 170 ? 20.456 11.856  0.876   1.00 31.19 ? 320 TYR A CB  1 
ATOM   939  C  CG  . TYR A 1 170 ? 19.601 12.535  -0.168  1.00 32.20 ? 320 TYR A CG  1 
ATOM   940  C  CD1 . TYR A 1 170 ? 18.919 13.707  0.112   1.00 33.23 ? 320 TYR A CD1 1 
ATOM   941  C  CD2 . TYR A 1 170 ? 19.518 12.025  -1.450  1.00 34.24 ? 320 TYR A CD2 1 
ATOM   942  C  CE1 . TYR A 1 170 ? 18.141 14.340  -0.849  1.00 36.50 ? 320 TYR A CE1 1 
ATOM   943  C  CE2 . TYR A 1 170 ? 18.766 12.643  -2.409  1.00 37.96 ? 320 TYR A CE2 1 
ATOM   944  C  CZ  . TYR A 1 170 ? 18.078 13.788  -2.107  1.00 38.07 ? 320 TYR A CZ  1 
ATOM   945  O  OH  . TYR A 1 170 ? 17.361 14.361  -3.067  1.00 40.86 ? 320 TYR A OH  1 
ATOM   946  N  N   . LEU A 1 171 ? 22.486 11.994  3.350   1.00 26.80 ? 321 LEU A N   1 
ATOM   947  C  CA  . LEU A 1 171 ? 23.142 11.243  4.398   1.00 26.44 ? 321 LEU A CA  1 
ATOM   948  C  C   . LEU A 1 171 ? 22.150 10.508  5.292   1.00 28.89 ? 321 LEU A C   1 
ATOM   949  O  O   . LEU A 1 171 ? 21.193 11.081  5.762   1.00 28.07 ? 321 LEU A O   1 
ATOM   950  C  CB  . LEU A 1 171 ? 23.968 12.178  5.287   1.00 28.55 ? 321 LEU A CB  1 
ATOM   951  C  CG  . LEU A 1 171 ? 25.207 12.793  4.674   1.00 28.95 ? 321 LEU A CG  1 
ATOM   952  C  CD1 . LEU A 1 171 ? 25.676 13.937  5.564   1.00 31.68 ? 321 LEU A CD1 1 
ATOM   953  C  CD2 . LEU A 1 171 ? 26.295 11.728  4.510   1.00 30.43 ? 321 LEU A CD2 1 
ATOM   954  N  N   . LEU A 1 172 ? 22.418 9.230   5.542   1.00 26.75 ? 322 LEU A N   1 
ATOM   955  C  CA  . LEU A 1 172 ? 21.696 8.474   6.530   1.00 26.54 ? 322 LEU A CA  1 
ATOM   956  C  C   . LEU A 1 172 ? 22.466 8.507   7.829   1.00 25.78 ? 322 LEU A C   1 
ATOM   957  O  O   . LEU A 1 172 ? 23.699 8.341   7.837   1.00 24.94 ? 322 LEU A O   1 
ATOM   958  C  CB  . LEU A 1 172 ? 21.506 7.026   6.059   1.00 27.14 ? 322 LEU A CB  1 
ATOM   959  C  CG  . LEU A 1 172 ? 21.089 5.935   7.046   1.00 29.14 ? 322 LEU A CG  1 
ATOM   960  C  CD1 . LEU A 1 172 ? 19.615 6.139   7.402   1.00 32.10 ? 322 LEU A CD1 1 
ATOM   961  C  CD2 . LEU A 1 172 ? 21.327 4.532   6.446   1.00 28.58 ? 322 LEU A CD2 1 
ATOM   962  N  N   . SER A 1 173 ? 21.744 8.719   8.938   1.00 26.93 ? 323 SER A N   1 
ATOM   963  C  CA  . SER A 1 173 ? 22.338 8.670   10.262  1.00 24.85 ? 323 SER A CA  1 
ATOM   964  C  C   . SER A 1 173 ? 21.536 7.799   11.194  1.00 25.59 ? 323 SER A C   1 
ATOM   965  O  O   . SER A 1 173 ? 20.310 7.619   10.997  1.00 27.68 ? 323 SER A O   1 
ATOM   966  C  CB  . SER A 1 173 ? 22.444 10.102  10.825  1.00 26.24 ? 323 SER A CB  1 
ATOM   967  O  OG  . SER A 1 173 ? 21.168 10.740  10.888  1.00 25.70 ? 323 SER A OG  1 
ATOM   968  N  N   . SER A 1 174 ? 22.219 7.203   12.161  1.00 26.47 ? 324 SER A N   1 
ATOM   969  C  CA  . SER A 1 174 ? 21.568 6.486   13.258  1.00 28.09 ? 324 SER A CA  1 
ATOM   970  C  C   . SER A 1 174 ? 22.012 7.149   14.546  1.00 26.89 ? 324 SER A C   1 
ATOM   971  O  O   . SER A 1 174 ? 23.021 7.834   14.544  1.00 25.28 ? 324 SER A O   1 
ATOM   972  C  CB  . SER A 1 174 ? 21.985 5.030   13.298  1.00 28.32 ? 324 SER A CB  1 
ATOM   973  O  OG  . SER A 1 174 ? 23.396 4.868   13.379  1.00 26.06 ? 324 SER A OG  1 
ATOM   974  N  N   . SER A 1 175 ? 21.271 6.891   15.624  1.00 27.16 ? 325 SER A N   1 
ATOM   975  C  CA  . SER A 1 175 ? 21.546 7.499   16.927  1.00 27.77 ? 325 SER A CA  1 
ATOM   976  C  C   . SER A 1 175 ? 21.066 6.660   18.065  1.00 28.50 ? 325 SER A C   1 
ATOM   977  O  O   . SER A 1 175 ? 20.092 5.866   17.942  1.00 25.25 ? 325 SER A O   1 
ATOM   978  C  CB  . SER A 1 175 ? 20.863 8.857   16.995  1.00 29.36 ? 325 SER A CB  1 
ATOM   979  O  OG  . SER A 1 175 ? 20.897 9.461   18.304  1.00 28.84 ? 325 SER A OG  1 
ATOM   980  N  N   . ASP A 1 176 ? 21.709 6.894   19.210  1.00 31.03 ? 326 ASP A N   1 
ATOM   981  C  CA  . ASP A 1 176 ? 21.224 6.424   20.494  1.00 32.87 ? 326 ASP A CA  1 
ATOM   982  C  C   . ASP A 1 176 ? 19.817 6.930   20.882  1.00 33.55 ? 326 ASP A C   1 
ATOM   983  O  O   . ASP A 1 176 ? 19.148 6.347   21.754  1.00 30.38 ? 326 ASP A O   1 
ATOM   984  C  CB  . ASP A 1 176 ? 22.235 6.833   21.591  1.00 36.71 ? 326 ASP A CB  1 
ATOM   985  C  CG  . ASP A 1 176 ? 23.501 6.043   21.517  1.00 39.83 ? 326 ASP A CG  1 
ATOM   986  O  OD1 . ASP A 1 176 ? 23.466 4.879   21.025  1.00 39.77 ? 326 ASP A OD1 1 
ATOM   987  O  OD2 . ASP A 1 176 ? 24.543 6.578   21.903  1.00 40.28 ? 326 ASP A OD2 1 
ATOM   988  N  N   . ASP A 1 177 ? 19.365 8.011   20.258  1.00 29.80 ? 327 ASP A N   1 
ATOM   989  C  CA  . ASP A 1 177 ? 17.994 8.496   20.468  1.00 32.41 ? 327 ASP A CA  1 
ATOM   990  C  C   . ASP A 1 177 ? 16.903 7.631   19.802  1.00 32.51 ? 327 ASP A C   1 
ATOM   991  O  O   . ASP A 1 177 ? 15.735 7.969   19.870  1.00 34.36 ? 327 ASP A O   1 
ATOM   992  C  CB  . ASP A 1 177 ? 17.886 9.963   20.013  1.00 32.50 ? 327 ASP A CB  1 
ATOM   993  C  CG  . ASP A 1 177 ? 17.760 10.124  18.507  1.00 33.08 ? 327 ASP A CG  1 
ATOM   994  O  OD1 . ASP A 1 177 ? 17.821 9.126   17.709  1.00 32.34 ? 327 ASP A OD1 1 
ATOM   995  O  OD2 . ASP A 1 177 ? 17.647 11.284  18.107  1.00 31.99 ? 327 ASP A OD2 1 
ATOM   996  N  N   . GLN A 1 178 ? 17.310 6.537   19.154  1.00 33.74 ? 328 GLN A N   1 
ATOM   997  C  CA  . GLN A 1 178 ? 16.422 5.467   18.615  1.00 35.51 ? 328 GLN A CA  1 
ATOM   998  C  C   . GLN A 1 178 ? 15.868 5.761   17.234  1.00 34.05 ? 328 GLN A C   1 
ATOM   999  O  O   . GLN A 1 178 ? 15.070 4.998   16.731  1.00 35.23 ? 328 GLN A O   1 
ATOM   1000 C  CB  . GLN A 1 178 ? 15.250 5.124   19.550  1.00 39.30 ? 328 GLN A CB  1 
ATOM   1001 C  CG  . GLN A 1 178 ? 15.656 4.885   20.992  1.00 41.80 ? 328 GLN A CG  1 
ATOM   1002 C  CD  . GLN A 1 178 ? 14.530 4.362   21.843  1.00 44.28 ? 328 GLN A CD  1 
ATOM   1003 O  OE1 . GLN A 1 178 ? 13.349 4.406   21.475  1.00 42.09 ? 328 GLN A OE1 1 
ATOM   1004 N  NE2 . GLN A 1 178 ? 14.889 3.854   22.998  1.00 47.99 ? 328 GLN A NE2 1 
ATOM   1005 N  N   . TYR A 1 179 ? 16.319 6.846   16.628  1.00 32.09 ? 329 TYR A N   1 
ATOM   1006 C  CA  . TYR A 1 179 ? 15.860 7.248   15.327  1.00 32.28 ? 329 TYR A CA  1 
ATOM   1007 C  C   . TYR A 1 179 ? 16.958 7.081   14.297  1.00 29.43 ? 329 TYR A C   1 
ATOM   1008 O  O   . TYR A 1 179 ? 18.148 7.134   14.609  1.00 29.03 ? 329 TYR A O   1 
ATOM   1009 C  CB  . TYR A 1 179 ? 15.427 8.733   15.332  1.00 33.89 ? 329 TYR A CB  1 
ATOM   1010 C  CG  . TYR A 1 179 ? 14.133 8.985   16.006  1.00 35.50 ? 329 TYR A CG  1 
ATOM   1011 C  CD1 . TYR A 1 179 ? 14.047 8.986   17.403  1.00 37.17 ? 329 TYR A CD1 1 
ATOM   1012 C  CD2 . TYR A 1 179 ? 12.963 9.208   15.270  1.00 38.02 ? 329 TYR A CD2 1 
ATOM   1013 C  CE1 . TYR A 1 179 ? 12.838 9.192   18.044  1.00 39.27 ? 329 TYR A CE1 1 
ATOM   1014 C  CE2 . TYR A 1 179 ? 11.759 9.428   15.906  1.00 41.50 ? 329 TYR A CE2 1 
ATOM   1015 C  CZ  . TYR A 1 179 ? 11.706 9.421   17.292  1.00 41.81 ? 329 TYR A CZ  1 
ATOM   1016 O  OH  . TYR A 1 179 ? 10.510 9.615   17.947  1.00 47.72 ? 329 TYR A OH  1 
ATOM   1017 N  N   . TRP A 1 180 ? 16.534 6.878   13.058  1.00 30.81 ? 330 TRP A N   1 
ATOM   1018 C  CA  . TRP A 1 180 ? 17.380 7.138   11.919  1.00 28.32 ? 330 TRP A CA  1 
ATOM   1019 C  C   . TRP A 1 180 ? 16.844 8.387   11.195  1.00 29.42 ? 330 TRP A C   1 
ATOM   1020 O  O   . TRP A 1 180 ? 15.673 8.783   11.351  1.00 30.46 ? 330 TRP A O   1 
ATOM   1021 C  CB  . TRP A 1 180 ? 17.475 5.906   10.983  1.00 30.48 ? 330 TRP A CB  1 
ATOM   1022 C  CG  . TRP A 1 180 ? 16.217 5.427   10.461  1.00 29.07 ? 330 TRP A CG  1 
ATOM   1023 C  CD1 . TRP A 1 180 ? 15.438 4.442   10.976  1.00 30.02 ? 330 TRP A CD1 1 
ATOM   1024 C  CD2 . TRP A 1 180 ? 15.530 5.899   9.276   1.00 31.23 ? 330 TRP A CD2 1 
ATOM   1025 N  NE1 . TRP A 1 180 ? 14.311 4.271   10.196  1.00 30.96 ? 330 TRP A NE1 1 
ATOM   1026 C  CE2 . TRP A 1 180 ? 14.363 5.133   9.140   1.00 30.87 ? 330 TRP A CE2 1 
ATOM   1027 C  CE3 . TRP A 1 180 ? 15.809 6.874   8.312   1.00 31.62 ? 330 TRP A CE3 1 
ATOM   1028 C  CZ2 . TRP A 1 180 ? 13.452 5.324   8.099   1.00 32.76 ? 330 TRP A CZ2 1 
ATOM   1029 C  CZ3 . TRP A 1 180 ? 14.891 7.046   7.264   1.00 32.12 ? 330 TRP A CZ3 1 
ATOM   1030 C  CH2 . TRP A 1 180 ? 13.745 6.272   7.182   1.00 33.05 ? 330 TRP A CH2 1 
ATOM   1031 N  N   . ALA A 1 181 ? 17.713 9.018   10.412  1.00 28.62 ? 331 ALA A N   1 
ATOM   1032 C  CA  . ALA A 1 181 ? 17.334 10.183  9.693   1.00 30.13 ? 331 ALA A CA  1 
ATOM   1033 C  C   . ALA A 1 181 ? 18.023 10.195  8.340   1.00 28.96 ? 331 ALA A C   1 
ATOM   1034 O  O   . ALA A 1 181 ? 19.079 9.612   8.155   1.00 28.11 ? 331 ALA A O   1 
ATOM   1035 C  CB  . ALA A 1 181 ? 17.693 11.422  10.495  1.00 27.95 ? 331 ALA A CB  1 
ATOM   1036 N  N   . PHE A 1 182 ? 17.396 10.882  7.412   1.00 31.15 ? 332 PHE A N   1 
ATOM   1037 C  CA  . PHE A 1 182 ? 17.848 11.039  6.031   1.00 32.11 ? 332 PHE A CA  1 
ATOM   1038 C  C   . PHE A 1 182 ? 17.854 12.540  5.803   1.00 30.99 ? 332 PHE A C   1 
ATOM   1039 O  O   . PHE A 1 182 ? 16.813 13.167  5.909   1.00 33.89 ? 332 PHE A O   1 
ATOM   1040 C  CB  . PHE A 1 182 ? 16.812 10.366  5.133   1.00 34.02 ? 332 PHE A CB  1 
ATOM   1041 C  CG  . PHE A 1 182 ? 17.165 10.299  3.677   1.00 35.10 ? 332 PHE A CG  1 
ATOM   1042 C  CD1 . PHE A 1 182 ? 18.196 9.475   3.219   1.00 36.64 ? 332 PHE A CD1 1 
ATOM   1043 C  CD2 . PHE A 1 182 ? 16.378 10.971  2.738   1.00 38.88 ? 332 PHE A CD2 1 
ATOM   1044 C  CE1 . PHE A 1 182 ? 18.493 9.387   1.860   1.00 36.70 ? 332 PHE A CE1 1 
ATOM   1045 C  CE2 . PHE A 1 182 ? 16.663 10.876  1.382   1.00 40.76 ? 332 PHE A CE2 1 
ATOM   1046 C  CZ  . PHE A 1 182 ? 17.718 10.082  0.941   1.00 39.04 ? 332 PHE A CZ  1 
ATOM   1047 N  N   . SER A 1 183 ? 19.024 13.106  5.525   1.00 31.50 ? 333 SER A N   1 
ATOM   1048 C  CA  . SER A 1 183 ? 19.232 14.561  5.503   1.00 29.07 ? 333 SER A CA  1 
ATOM   1049 C  C   . SER A 1 183 ? 19.826 15.012  4.148   1.00 30.62 ? 333 SER A C   1 
ATOM   1050 O  O   . SER A 1 183 ? 20.644 14.285  3.537   1.00 30.45 ? 333 SER A O   1 
ATOM   1051 C  CB  . SER A 1 183 ? 20.180 14.952  6.629   1.00 28.36 ? 333 SER A CB  1 
ATOM   1052 O  OG  . SER A 1 183 ? 19.587 14.664  7.918   1.00 30.75 ? 333 SER A OG  1 
ATOM   1053 N  N   . ASP A 1 184 ? 19.425 16.190  3.703   1.00 31.09 ? 334 ASP A N   1 
ATOM   1054 C  CA  . ASP A 1 184 ? 19.898 16.757  2.453   1.00 33.54 ? 334 ASP A CA  1 
ATOM   1055 C  C   . ASP A 1 184 ? 21.244 17.423  2.682   1.00 32.92 ? 334 ASP A C   1 
ATOM   1056 O  O   . ASP A 1 184 ? 21.367 18.332  3.484   1.00 31.72 ? 334 ASP A O   1 
ATOM   1057 C  CB  . ASP A 1 184 ? 18.883 17.773  1.939   1.00 37.37 ? 334 ASP A CB  1 
ATOM   1058 C  CG  . ASP A 1 184 ? 19.307 18.414  0.635   1.00 42.80 ? 334 ASP A CG  1 
ATOM   1059 O  OD1 . ASP A 1 184 ? 19.407 17.702  -0.359  1.00 46.78 ? 334 ASP A OD1 1 
ATOM   1060 O  OD2 . ASP A 1 184 ? 19.533 19.628  0.619   1.00 47.15 ? 334 ASP A OD2 1 
ATOM   1061 N  N   . ILE A 1 185 ? 22.245 16.978  1.957   1.00 32.23 ? 335 ILE A N   1 
ATOM   1062 C  CA  . ILE A 1 185 ? 23.588 17.529  2.097   1.00 33.37 ? 335 ILE A CA  1 
ATOM   1063 C  C   . ILE A 1 185 ? 23.665 19.048  1.769   1.00 33.02 ? 335 ILE A C   1 
ATOM   1064 O  O   . ILE A 1 185 ? 24.405 19.785  2.403   1.00 35.06 ? 335 ILE A O   1 
ATOM   1065 C  CB  . ILE A 1 185 ? 24.567 16.725  1.220   1.00 34.56 ? 335 ILE A CB  1 
ATOM   1066 C  CG1 . ILE A 1 185 ? 24.830 15.363  1.883   1.00 36.31 ? 335 ILE A CG1 1 
ATOM   1067 C  CG2 . ILE A 1 185 ? 25.865 17.492  0.984   1.00 35.71 ? 335 ILE A CG2 1 
ATOM   1068 C  CD1 . ILE A 1 185 ? 25.452 14.349  0.954   1.00 38.70 ? 335 ILE A CD1 1 
ATOM   1069 N  N   . GLN A 1 186 ? 22.933 19.496  0.774   1.00 34.56 ? 336 GLN A N   1 
ATOM   1070 C  CA  . GLN A 1 186 ? 23.135 20.849  0.266   1.00 39.52 ? 336 GLN A CA  1 
ATOM   1071 C  C   . GLN A 1 186 ? 22.485 21.913  1.189   1.00 38.44 ? 336 GLN A C   1 
ATOM   1072 O  O   . GLN A 1 186 ? 23.045 22.971  1.386   1.00 37.32 ? 336 GLN A O   1 
ATOM   1073 C  CB  . GLN A 1 186 ? 22.632 20.948  -1.168  1.00 42.81 ? 336 GLN A CB  1 
ATOM   1074 C  CG  . GLN A 1 186 ? 23.343 22.005  -2.006  1.00 52.65 ? 336 GLN A CG  1 
ATOM   1075 C  CD  . GLN A 1 186 ? 24.885 21.905  -1.973  1.00 53.02 ? 336 GLN A CD  1 
ATOM   1076 O  OE1 . GLN A 1 186 ? 25.492 20.793  -2.043  1.00 54.21 ? 336 GLN A OE1 1 
ATOM   1077 N  NE2 . GLN A 1 186 ? 25.529 23.062  -1.860  1.00 47.06 ? 336 GLN A NE2 1 
ATOM   1078 N  N   . THR A 1 187 ? 21.357 21.586  1.803   1.00 32.90 ? 337 THR A N   1 
ATOM   1079 C  CA  . THR A 1 187 ? 20.649 22.533  2.671   1.00 34.01 ? 337 THR A CA  1 
ATOM   1080 C  C   . THR A 1 187 ? 20.759 22.180  4.156   1.00 32.64 ? 337 THR A C   1 
ATOM   1081 O  O   . THR A 1 187 ? 20.338 22.971  5.035   1.00 32.01 ? 337 THR A O   1 
ATOM   1082 C  CB  . THR A 1 187 ? 19.150 22.547  2.329   1.00 34.95 ? 337 THR A CB  1 
ATOM   1083 O  OG1 . THR A 1 187 ? 18.605 21.259  2.615   1.00 36.06 ? 337 THR A OG1 1 
ATOM   1084 C  CG2 . THR A 1 187 ? 18.907 22.913  0.851   1.00 37.58 ? 337 THR A CG2 1 
ATOM   1085 N  N   . GLY A 1 188 ? 21.315 20.999  4.456   1.00 30.47 ? 338 GLY A N   1 
ATOM   1086 C  CA  . GLY A 1 188 ? 21.308 20.486  5.788   1.00 29.94 ? 338 GLY A CA  1 
ATOM   1087 C  C   . GLY A 1 188 ? 19.950 20.134  6.348   1.00 30.97 ? 338 GLY A C   1 
ATOM   1088 O  O   . GLY A 1 188 ? 19.823 19.903  7.569   1.00 35.92 ? 338 GLY A O   1 
ATOM   1089 N  N   . ARG A 1 189 ? 18.927 20.079  5.494   1.00 31.98 ? 339 ARG A N   1 
ATOM   1090 C  CA  . ARG A 1 189 ? 17.571 19.799  5.953   1.00 32.41 ? 339 ARG A CA  1 
ATOM   1091 C  C   . ARG A 1 189 ? 17.386 18.329  6.284   1.00 31.30 ? 339 ARG A C   1 
ATOM   1092 O  O   . ARG A 1 189 ? 17.777 17.443  5.509   1.00 29.32 ? 339 ARG A O   1 
ATOM   1093 C  CB  . ARG A 1 189 ? 16.538 20.211  4.898   1.00 33.14 ? 339 ARG A CB  1 
ATOM   1094 C  CG  . ARG A 1 189 ? 15.106 19.964  5.342   1.00 39.25 ? 339 ARG A CG  1 
ATOM   1095 N  N   . VAL A 1 190 ? 16.737 18.069  7.421   1.00 33.77 ? 340 VAL A N   1 
ATOM   1096 C  CA  . VAL A 1 190 ? 16.322 16.727  7.777   1.00 33.15 ? 340 VAL A CA  1 
ATOM   1097 C  C   . VAL A 1 190 ? 15.059 16.385  6.986   1.00 33.37 ? 340 VAL A C   1 
ATOM   1098 O  O   . VAL A 1 190 ? 13.997 16.942  7.211   1.00 31.08 ? 340 VAL A O   1 
ATOM   1099 C  CB  . VAL A 1 190 ? 16.097 16.596  9.291   1.00 34.51 ? 340 VAL A CB  1 
ATOM   1100 C  CG1 . VAL A 1 190 ? 15.639 15.191  9.646   1.00 34.73 ? 340 VAL A CG1 1 
ATOM   1101 C  CG2 . VAL A 1 190 ? 17.392 16.955  9.998   1.00 35.00 ? 340 VAL A CG2 1 
ATOM   1102 N  N   . LEU A 1 191 ? 15.168 15.460  6.035   1.00 35.55 ? 341 LEU A N   1 
ATOM   1103 C  CA  . LEU A 1 191 ? 14.031 15.160  5.148   1.00 35.11 ? 341 LEU A CA  1 
ATOM   1104 C  C   . LEU A 1 191 ? 13.038 14.189  5.772   1.00 34.87 ? 341 LEU A C   1 
ATOM   1105 O  O   . LEU A 1 191 ? 11.842 14.323  5.589   1.00 36.80 ? 341 LEU A O   1 
ATOM   1106 C  CB  . LEU A 1 191 ? 14.505 14.584  3.842   1.00 38.83 ? 341 LEU A CB  1 
ATOM   1107 C  CG  . LEU A 1 191 ? 15.398 15.497  3.004   1.00 40.50 ? 341 LEU A CG  1 
ATOM   1108 C  CD1 . LEU A 1 191 ? 15.756 14.749  1.742   1.00 42.94 ? 341 LEU A CD1 1 
ATOM   1109 C  CD2 . LEU A 1 191 ? 14.737 16.820  2.669   1.00 42.34 ? 341 LEU A CD2 1 
ATOM   1110 N  N   . THR A 1 192 ? 13.549 13.202  6.488   1.00 35.64 ? 342 THR A N   1 
ATOM   1111 C  CA  . THR A 1 192 ? 12.719 12.359  7.298   1.00 37.75 ? 342 THR A CA  1 
ATOM   1112 C  C   . THR A 1 192 ? 13.468 11.802  8.468   1.00 34.28 ? 342 THR A C   1 
ATOM   1113 O  O   . THR A 1 192 ? 14.726 11.669  8.462   1.00 33.32 ? 342 THR A O   1 
ATOM   1114 C  CB  . THR A 1 192 ? 12.064 11.240  6.462   1.00 45.36 ? 342 THR A CB  1 
ATOM   1115 O  OG1 . THR A 1 192 ? 11.126 10.502  7.275   1.00 52.72 ? 342 THR A OG1 1 
ATOM   1116 C  CG2 . THR A 1 192 ? 13.085 10.321  5.878   1.00 43.54 ? 342 THR A CG2 1 
ATOM   1117 N  N   . LYS A 1 193 ? 12.703 11.447  9.486   1.00 36.04 ? 343 LYS A N   1 
ATOM   1118 C  CA  . LYS A 1 193 ? 13.238 10.988  10.723  1.00 36.73 ? 343 LYS A CA  1 
ATOM   1119 C  C   . LYS A 1 193 ? 12.276 9.966   11.305  1.00 35.70 ? 343 LYS A C   1 
ATOM   1120 O  O   . LYS A 1 193 ? 11.136 10.282  11.568  1.00 38.07 ? 343 LYS A O   1 
ATOM   1121 C  CB  . LYS A 1 193 ? 13.368 12.191  11.634  1.00 41.59 ? 343 LYS A CB  1 
ATOM   1122 C  CG  . LYS A 1 193 ? 14.225 11.941  12.833  1.00 43.71 ? 343 LYS A CG  1 
ATOM   1123 C  CD  . LYS A 1 193 ? 14.152 13.102  13.803  1.00 42.42 ? 343 LYS A CD  1 
ATOM   1124 C  CE  . LYS A 1 193 ? 14.641 12.614  15.148  1.00 42.67 ? 343 LYS A CE  1 
ATOM   1125 N  NZ  . LYS A 1 193 ? 14.791 13.704  16.120  1.00 42.49 ? 343 LYS A NZ  1 
ATOM   1126 N  N   . VAL A 1 194 ? 12.730 8.737   11.480  1.00 36.29 ? 344 VAL A N   1 
ATOM   1127 C  CA  . VAL A 1 194 ? 11.852 7.635   11.808  1.00 37.39 ? 344 VAL A CA  1 
ATOM   1128 C  C   . VAL A 1 194 ? 12.418 6.739   12.909  1.00 36.73 ? 344 VAL A C   1 
ATOM   1129 O  O   . VAL A 1 194 ? 13.622 6.544   13.007  1.00 34.67 ? 344 VAL A O   1 
ATOM   1130 C  CB  . VAL A 1 194 ? 11.585 6.779   10.555  1.00 37.45 ? 344 VAL A CB  1 
ATOM   1131 C  CG1 . VAL A 1 194 ? 10.786 5.513   10.893  1.00 38.73 ? 344 VAL A CG1 1 
ATOM   1132 C  CG2 . VAL A 1 194 ? 10.892 7.639   9.474   1.00 39.63 ? 344 VAL A CG2 1 
ATOM   1133 N  N   . THR A 1 195 ? 11.517 6.189   13.720  1.00 37.88 ? 345 THR A N   1 
ATOM   1134 C  CA  . THR A 1 195 ? 11.884 5.153   14.702  1.00 41.43 ? 345 THR A CA  1 
ATOM   1135 C  C   . THR A 1 195 ? 10.909 3.966   14.644  1.00 44.81 ? 345 THR A C   1 
ATOM   1136 O  O   . THR A 1 195 ? 9.812  4.067   14.077  1.00 43.78 ? 345 THR A O   1 
ATOM   1137 C  CB  . THR A 1 195 ? 11.939 5.734   16.141  1.00 40.79 ? 345 THR A CB  1 
ATOM   1138 O  OG1 . THR A 1 195 ? 12.509 4.781   17.026  1.00 40.09 ? 345 THR A OG1 1 
ATOM   1139 C  CG2 . THR A 1 195 ? 10.579 6.134   16.637  1.00 42.38 ? 345 THR A CG2 1 
ATOM   1140 N  N   . ASP A 1 196 ? 11.332 2.834   15.189  1.00 44.97 ? 346 ASP A N   1 
ATOM   1141 C  CA  . ASP A 1 196 ? 10.430 1.691   15.354  1.00 51.80 ? 346 ASP A CA  1 
ATOM   1142 C  C   . ASP A 1 196 ? 9.810  1.795   16.751  1.00 56.08 ? 346 ASP A C   1 
ATOM   1143 O  O   . ASP A 1 196 ? 10.514 1.682   17.739  1.00 62.12 ? 346 ASP A O   1 
ATOM   1144 C  CB  . ASP A 1 196 ? 11.179 0.371   15.177  1.00 49.93 ? 346 ASP A CB  1 
ATOM   1145 C  CG  . ASP A 1 196 ? 10.244 -0.836  15.105  1.00 52.54 ? 346 ASP A CG  1 
ATOM   1146 O  OD1 . ASP A 1 196 ? 9.091  -0.733  15.530  1.00 55.44 ? 346 ASP A OD1 1 
ATOM   1147 O  OD2 . ASP A 1 196 ? 10.675 -1.902  14.638  1.00 54.57 ? 346 ASP A OD2 1 
ATOM   1148 N  N   . GLU A 1 197 ? 8.513  2.047   16.825  1.00 64.55 ? 347 GLU A N   1 
ATOM   1149 C  CA  . GLU A 1 197 ? 7.803  1.973   18.119  1.00 78.22 ? 347 GLU A CA  1 
ATOM   1150 C  C   . GLU A 1 197 ? 8.040  0.591   18.772  1.00 83.55 ? 347 GLU A C   1 
ATOM   1151 O  O   . GLU A 1 197 ? 8.522  0.513   19.908  1.00 92.50 ? 347 GLU A O   1 
ATOM   1152 C  CB  . GLU A 1 197 ? 6.308  2.235   17.952  1.00 77.08 ? 347 GLU A CB  1 
ATOM   1153 N  N   . THR A 1 198 ? 7.743  -0.480  18.028  1.00 83.73 ? 348 THR A N   1 
ATOM   1154 C  CA  . THR A 1 198 ? 7.875  -1.864  18.529  1.00 82.05 ? 348 THR A CA  1 
ATOM   1155 C  C   . THR A 1 198 ? 9.270  -2.166  19.116  1.00 79.90 ? 348 THR A C   1 
ATOM   1156 O  O   . THR A 1 198 ? 9.377  -2.584  20.255  1.00 81.21 ? 348 THR A O   1 
ATOM   1157 C  CB  . THR A 1 198 ? 7.543  -2.899  17.430  1.00 77.60 ? 348 THR A CB  1 
ATOM   1158 N  N   . SER A 1 199 ? 10.327 -1.946  18.337  1.00 81.13 ? 349 SER A N   1 
ATOM   1159 C  CA  . SER A 1 199 ? 11.721 -2.192  18.800  1.00 79.63 ? 349 SER A CA  1 
ATOM   1160 C  C   . SER A 1 199 ? 12.132 -1.224  19.901  1.00 74.55 ? 349 SER A C   1 
ATOM   1161 O  O   . SER A 1 199 ? 12.754 -1.623  20.900  1.00 68.37 ? 349 SER A O   1 
ATOM   1162 C  CB  . SER A 1 199 ? 12.732 -2.070  17.639  1.00 74.13 ? 349 SER A CB  1 
ATOM   1163 N  N   . GLY A 1 200 ? 11.791 0.049   19.694  1.00 65.94 ? 350 GLY A N   1 
ATOM   1164 C  CA  . GLY A 1 200 ? 12.164 1.118   20.588  1.00 59.39 ? 350 GLY A CA  1 
ATOM   1165 C  C   . GLY A 1 200 ? 13.489 0.914   21.310  1.00 56.34 ? 350 GLY A C   1 
ATOM   1166 O  O   . GLY A 1 200 ? 13.489 0.709   22.513  1.00 56.30 ? 350 GLY A O   1 
ATOM   1167 N  N   . CYS A 1 201 ? 14.620 0.960   20.588  1.00 51.61 ? 351 CYS A N   1 
ATOM   1168 C  CA  . CYS A 1 201 ? 15.949 1.082   21.259  1.00 48.06 ? 351 CYS A CA  1 
ATOM   1169 C  C   . CYS A 1 201 ? 17.041 1.730   20.402  1.00 41.78 ? 351 CYS A C   1 
ATOM   1170 O  O   . CYS A 1 201 ? 16.816 2.053   19.224  1.00 40.34 ? 351 CYS A O   1 
ATOM   1171 C  CB  . CYS A 1 201 ? 16.420 -0.247  21.878  1.00 53.46 ? 351 CYS A CB  1 
ATOM   1172 S  SG  . CYS A 1 201 ? 17.282 -1.378  20.790  1.00 48.52 ? 351 CYS A SG  1 
ATOM   1173 N  N   . SER A 1 202 ? 18.190 1.985   21.038  1.00 39.74 ? 352 SER A N   1 
ATOM   1174 C  CA  . SER A 1 202 ? 19.289 2.726   20.439  1.00 37.01 ? 352 SER A CA  1 
ATOM   1175 C  C   . SER A 1 202 ? 19.742 2.060   19.190  1.00 32.07 ? 352 SER A C   1 
ATOM   1176 O  O   . SER A 1 202 ? 19.864 0.866   19.158  1.00 31.15 ? 352 SER A O   1 
ATOM   1177 C  CB  . SER A 1 202 ? 20.491 2.804   21.380  1.00 39.42 ? 352 SER A CB  1 
ATOM   1178 O  OG  . SER A 1 202 ? 20.224 3.728   22.397  1.00 50.77 ? 352 SER A OG  1 
ATOM   1179 N  N   . LEU A 1 203 ? 19.967 2.846   18.157  1.00 30.53 ? 353 LEU A N   1 
ATOM   1180 C  CA  . LEU A 1 203 ? 20.545 2.349   16.940  1.00 27.45 ? 353 LEU A CA  1 
ATOM   1181 C  C   . LEU A 1 203 ? 22.037 2.612   17.032  1.00 28.43 ? 353 LEU A C   1 
ATOM   1182 O  O   . LEU A 1 203 ? 22.459 3.719   17.391  1.00 30.21 ? 353 LEU A O   1 
ATOM   1183 C  CB  . LEU A 1 203 ? 19.929 3.024   15.719  1.00 28.52 ? 353 LEU A CB  1 
ATOM   1184 C  CG  . LEU A 1 203 ? 18.418 2.904   15.592  1.00 29.91 ? 353 LEU A CG  1 
ATOM   1185 C  CD1 . LEU A 1 203 ? 18.007 3.558   14.298  1.00 32.83 ? 353 LEU A CD1 1 
ATOM   1186 C  CD2 . LEU A 1 203 ? 17.892 1.463   15.654  1.00 32.09 ? 353 LEU A CD2 1 
ATOM   1187 N  N   . THR A 1 204 ? 22.833 1.608   16.672  1.00 26.75 ? 354 THR A N   1 
ATOM   1188 C  CA  . THR A 1 204 ? 24.275 1.608   16.929  1.00 28.42 ? 354 THR A CA  1 
ATOM   1189 C  C   . THR A 1 204 ? 25.115 1.776   15.685  1.00 28.00 ? 354 THR A C   1 
ATOM   1190 O  O   . THR A 1 204 ? 26.321 1.989   15.788  1.00 24.78 ? 354 THR A O   1 
ATOM   1191 C  CB  . THR A 1 204 ? 24.700 0.271   17.577  1.00 29.26 ? 354 THR A CB  1 
ATOM   1192 O  OG1 . THR A 1 204 ? 24.356 -0.829  16.693  1.00 29.36 ? 354 THR A OG1 1 
ATOM   1193 C  CG2 . THR A 1 204 ? 23.998 0.077   18.902  1.00 30.58 ? 354 THR A CG2 1 
ATOM   1194 N  N   . CYS A 1 205 ? 24.500 1.635   14.493  1.00 26.07 ? 355 CYS A N   1 
ATOM   1195 C  CA  . CYS A 1 205 ? 25.202 1.830   13.230  1.00 25.98 ? 355 CYS A CA  1 
ATOM   1196 C  C   . CYS A 1 205 ? 24.180 1.916   12.086  1.00 25.99 ? 355 CYS A C   1 
ATOM   1197 O  O   . CYS A 1 205 ? 23.038 1.583   12.278  1.00 26.06 ? 355 CYS A O   1 
ATOM   1198 C  CB  . CYS A 1 205 ? 26.203 0.696   12.983  1.00 26.62 ? 355 CYS A CB  1 
ATOM   1199 S  SG  . CYS A 1 205 ? 25.508 -0.944  13.177  1.00 29.52 ? 355 CYS A SG  1 
ATOM   1200 N  N   . ALA A 1 206 ? 24.605 2.405   10.924  1.00 27.05 ? 356 ALA A N   1 
ATOM   1201 C  CA  . ALA A 1 206 ? 23.745 2.577   9.764   1.00 28.72 ? 356 ALA A CA  1 
ATOM   1202 C  C   . ALA A 1 206 ? 24.541 2.531   8.465   1.00 29.08 ? 356 ALA A C   1 
ATOM   1203 O  O   . ALA A 1 206 ? 25.578 3.171   8.352   1.00 27.45 ? 356 ALA A O   1 
ATOM   1204 C  CB  . ALA A 1 206 ? 23.036 3.893   9.842   1.00 31.21 ? 356 ALA A CB  1 
ATOM   1205 N  N   . GLN A 1 207 ? 24.036 1.813   7.493   1.00 26.92 ? 357 GLN A N   1 
ATOM   1206 C  CA  . GLN A 1 207 ? 24.676 1.753   6.174   1.00 28.44 ? 357 GLN A CA  1 
ATOM   1207 C  C   . GLN A 1 207 ? 23.624 1.560   5.099   1.00 27.99 ? 357 GLN A C   1 
ATOM   1208 O  O   . GLN A 1 207 ? 22.701 0.767   5.264   1.00 27.18 ? 357 GLN A O   1 
ATOM   1209 C  CB  . GLN A 1 207 ? 25.624 0.554   6.077   1.00 30.46 ? 357 GLN A CB  1 
ATOM   1210 C  CG  . GLN A 1 207 ? 26.845 0.629   6.952   1.00 37.52 ? 357 GLN A CG  1 
ATOM   1211 C  CD  . GLN A 1 207 ? 27.797 1.711   6.503   1.00 43.80 ? 357 GLN A CD  1 
ATOM   1212 O  OE1 . GLN A 1 207 ? 28.087 1.838   5.310   1.00 49.93 ? 357 GLN A OE1 1 
ATOM   1213 N  NE2 . GLN A 1 207 ? 28.268 2.503   7.442   1.00 45.29 ? 357 GLN A NE2 1 
ATOM   1214 N  N   . PHE A 1 208 ? 23.804 2.251   3.988   1.00 26.89 ? 358 PHE A N   1 
ATOM   1215 C  CA  . PHE A 1 208 ? 22.991 2.048   2.834   1.00 29.95 ? 358 PHE A CA  1 
ATOM   1216 C  C   . PHE A 1 208 ? 23.455 0.825   2.075   1.00 31.26 ? 358 PHE A C   1 
ATOM   1217 O  O   . PHE A 1 208 ? 24.643 0.564   1.969   1.00 31.64 ? 358 PHE A O   1 
ATOM   1218 C  CB  . PHE A 1 208 ? 23.124 3.240   1.882   1.00 31.74 ? 358 PHE A CB  1 
ATOM   1219 C  CG  . PHE A 1 208 ? 22.156 4.339   2.133   1.00 33.01 ? 358 PHE A CG  1 
ATOM   1220 C  CD1 . PHE A 1 208 ? 20.818 4.156   1.878   1.00 36.19 ? 358 PHE A CD1 1 
ATOM   1221 C  CD2 . PHE A 1 208 ? 22.599 5.592   2.545   1.00 32.48 ? 358 PHE A CD2 1 
ATOM   1222 C  CE1 . PHE A 1 208 ? 19.910 5.197   2.085   1.00 38.19 ? 358 PHE A CE1 1 
ATOM   1223 C  CE2 . PHE A 1 208 ? 21.702 6.637   2.749   1.00 34.08 ? 358 PHE A CE2 1 
ATOM   1224 C  CZ  . PHE A 1 208 ? 20.356 6.434   2.519   1.00 34.34 ? 358 PHE A CZ  1 
ATOM   1225 N  N   . HIS A 1 209 ? 22.523 0.113   1.503   1.00 32.75 ? 359 HIS A N   1 
ATOM   1226 C  CA  . HIS A 1 209 ? 22.831 -0.860  0.478   1.00 33.85 ? 359 HIS A CA  1 
ATOM   1227 C  C   . HIS A 1 209 ? 23.286 -0.038  -0.766  1.00 35.34 ? 359 HIS A C   1 
ATOM   1228 O  O   . HIS A 1 209 ? 22.781 1.053   -0.988  1.00 37.24 ? 359 HIS A O   1 
ATOM   1229 C  CB  . HIS A 1 209 ? 21.574 -1.645  0.211   1.00 34.05 ? 359 HIS A CB  1 
ATOM   1230 C  CG  . HIS A 1 209 ? 21.695 -2.645  -0.881  1.00 37.35 ? 359 HIS A CG  1 
ATOM   1231 N  ND1 . HIS A 1 209 ? 21.485 -2.322  -2.198  1.00 37.78 ? 359 HIS A ND1 1 
ATOM   1232 C  CD2 . HIS A 1 209 ? 21.963 -3.966  -0.855  1.00 39.09 ? 359 HIS A CD2 1 
ATOM   1233 C  CE1 . HIS A 1 209 ? 21.620 -3.402  -2.941  1.00 39.75 ? 359 HIS A CE1 1 
ATOM   1234 N  NE2 . HIS A 1 209 ? 21.925 -4.411  -2.149  1.00 40.68 ? 359 HIS A NE2 1 
ATOM   1235 N  N   . PRO A 1 210 ? 24.240 -0.556  -1.567  1.00 37.87 ? 360 PRO A N   1 
ATOM   1236 C  CA  . PRO A 1 210 ? 24.803 0.298   -2.658  1.00 38.11 ? 360 PRO A CA  1 
ATOM   1237 C  C   . PRO A 1 210 ? 23.815 0.805   -3.742  1.00 39.25 ? 360 PRO A C   1 
ATOM   1238 O  O   . PRO A 1 210 ? 24.072 1.833   -4.358  1.00 39.32 ? 360 PRO A O   1 
ATOM   1239 C  CB  . PRO A 1 210 ? 25.890 -0.596  -3.280  1.00 40.40 ? 360 PRO A CB  1 
ATOM   1240 C  CG  . PRO A 1 210 ? 25.495 -2.013  -2.888  1.00 42.69 ? 360 PRO A CG  1 
ATOM   1241 C  CD  . PRO A 1 210 ? 24.916 -1.861  -1.496  1.00 38.67 ? 360 PRO A CD  1 
ATOM   1242 N  N   . ASP A 1 211 ? 22.700 0.125   -3.957  1.00 38.30 ? 361 ASP A N   1 
ATOM   1243 C  CA  . ASP A 1 211 ? 21.676 0.613   -4.912  1.00 41.98 ? 361 ASP A CA  1 
ATOM   1244 C  C   . ASP A 1 211 ? 20.835 1.755   -4.377  1.00 41.27 ? 361 ASP A C   1 
ATOM   1245 O  O   . ASP A 1 211 ? 20.079 2.382   -5.135  1.00 43.83 ? 361 ASP A O   1 
ATOM   1246 C  CB  . ASP A 1 211 ? 20.747 -0.512  -5.340  1.00 45.37 ? 361 ASP A CB  1 
ATOM   1247 C  CG  . ASP A 1 211 ? 21.432 -1.520  -6.205  1.00 48.95 ? 361 ASP A CG  1 
ATOM   1248 O  OD1 . ASP A 1 211 ? 22.421 -1.162  -6.880  1.00 49.49 ? 361 ASP A OD1 1 
ATOM   1249 O  OD2 . ASP A 1 211 ? 20.992 -2.680  -6.203  1.00 52.75 ? 361 ASP A OD2 1 
ATOM   1250 N  N   . GLY A 1 212 ? 20.904 2.009   -3.082  1.00 38.03 ? 362 GLY A N   1 
ATOM   1251 C  CA  . GLY A 1 212 ? 20.293 3.208   -2.523  1.00 37.60 ? 362 GLY A CA  1 
ATOM   1252 C  C   . GLY A 1 212 ? 18.817 3.150   -2.243  1.00 40.37 ? 362 GLY A C   1 
ATOM   1253 O  O   . GLY A 1 212 ? 18.228 4.179   -1.903  1.00 38.53 ? 362 GLY A O   1 
ATOM   1254 N  N   . LEU A 1 213 ? 18.213 1.959   -2.369  1.00 39.89 ? 363 LEU A N   1 
ATOM   1255 C  CA  . LEU A 1 213 ? 16.784 1.745   -2.035  1.00 40.67 ? 363 LEU A CA  1 
ATOM   1256 C  C   . LEU A 1 213 ? 16.540 1.240   -0.589  1.00 38.41 ? 363 LEU A C   1 
ATOM   1257 O  O   . LEU A 1 213 ? 15.509 1.542   0.017   1.00 39.59 ? 363 LEU A O   1 
ATOM   1258 C  CB  . LEU A 1 213 ? 16.158 0.761   -3.009  1.00 44.94 ? 363 LEU A CB  1 
ATOM   1259 C  CG  . LEU A 1 213 ? 16.243 1.163   -4.489  1.00 47.81 ? 363 LEU A CG  1 
ATOM   1260 C  CD1 . LEU A 1 213 ? 15.813 0.006   -5.406  1.00 49.81 ? 363 LEU A CD1 1 
ATOM   1261 C  CD2 . LEU A 1 213 ? 15.397 2.406   -4.732  1.00 50.30 ? 363 LEU A CD2 1 
ATOM   1262 N  N   . ILE A 1 214 ? 17.463 0.454   -0.063  1.00 36.32 ? 364 ILE A N   1 
ATOM   1263 C  CA  . ILE A 1 214 ? 17.314 -0.111  1.281   1.00 34.85 ? 364 ILE A CA  1 
ATOM   1264 C  C   . ILE A 1 214 ? 18.536 0.209   2.110   1.00 33.05 ? 364 ILE A C   1 
ATOM   1265 O  O   . ILE A 1 214 ? 19.615 0.558   1.572   1.00 32.48 ? 364 ILE A O   1 
ATOM   1266 C  CB  . ILE A 1 214 ? 17.045 -1.665  1.244   1.00 36.78 ? 364 ILE A CB  1 
ATOM   1267 C  CG1 . ILE A 1 214 ? 18.301 -2.444  0.801   1.00 37.08 ? 364 ILE A CG1 1 
ATOM   1268 C  CG2 . ILE A 1 214 ? 15.822 -1.980  0.376   1.00 38.86 ? 364 ILE A CG2 1 
ATOM   1269 C  CD1 . ILE A 1 214 ? 18.155 -3.961  0.919   1.00 39.93 ? 364 ILE A CD1 1 
ATOM   1270 N  N   . PHE A 1 215 ? 18.377 0.139   3.435   1.00 32.78 ? 365 PHE A N   1 
ATOM   1271 C  CA  . PHE A 1 215 ? 19.506 0.270   4.330   1.00 29.88 ? 365 PHE A CA  1 
ATOM   1272 C  C   . PHE A 1 215 ? 19.322 -0.583  5.563   1.00 30.44 ? 365 PHE A C   1 
ATOM   1273 O  O   . PHE A 1 215 ? 18.227 -1.124  5.812   1.00 31.06 ? 365 PHE A O   1 
ATOM   1274 C  CB  . PHE A 1 215 ? 19.734 1.741   4.713   1.00 30.71 ? 365 PHE A CB  1 
ATOM   1275 C  CG  . PHE A 1 215 ? 18.528 2.421   5.301   1.00 30.47 ? 365 PHE A CG  1 
ATOM   1276 C  CD1 . PHE A 1 215 ? 17.588 3.013   4.491   1.00 31.85 ? 365 PHE A CD1 1 
ATOM   1277 C  CD2 . PHE A 1 215 ? 18.380 2.540   6.695   1.00 30.51 ? 365 PHE A CD2 1 
ATOM   1278 C  CE1 . PHE A 1 215 ? 16.489 3.684   5.030   1.00 33.41 ? 365 PHE A CE1 1 
ATOM   1279 C  CE2 . PHE A 1 215 ? 17.307 3.201   7.231   1.00 30.17 ? 365 PHE A CE2 1 
ATOM   1280 C  CZ  . PHE A 1 215 ? 16.351 3.786   6.405   1.00 32.91 ? 365 PHE A CZ  1 
ATOM   1281 N  N   . GLY A 1 216 ? 20.404 -0.702  6.330   1.00 28.79 ? 366 GLY A N   1 
ATOM   1282 C  CA  . GLY A 1 216 ? 20.407 -1.431  7.588   1.00 29.18 ? 366 GLY A CA  1 
ATOM   1283 C  C   . GLY A 1 216 ? 20.781 -0.508  8.765   1.00 27.68 ? 366 GLY A C   1 
ATOM   1284 O  O   . GLY A 1 216 ? 21.533 0.434   8.608   1.00 28.21 ? 366 GLY A O   1 
ATOM   1285 N  N   . THR A 1 217 ? 20.189 -0.772  9.921   1.00 28.85 ? 367 THR A N   1 
ATOM   1286 C  CA  . THR A 1 217 ? 20.580 -0.142  11.188  1.00 27.47 ? 367 THR A CA  1 
ATOM   1287 C  C   . THR A 1 217 ? 20.726 -1.271  12.217  1.00 27.81 ? 367 THR A C   1 
ATOM   1288 O  O   . THR A 1 217 ? 19.781 -2.064  12.426  1.00 29.41 ? 367 THR A O   1 
ATOM   1289 C  CB  . THR A 1 217 ? 19.511 0.857   11.728  1.00 27.77 ? 367 THR A CB  1 
ATOM   1290 O  OG1 . THR A 1 217 ? 18.246 0.208   11.924  1.00 27.79 ? 367 THR A OG1 1 
ATOM   1291 C  CG2 . THR A 1 217 ? 19.316 1.966   10.817  1.00 27.23 ? 367 THR A CG2 1 
ATOM   1292 N  N   . GLY A 1 218 ? 21.866 -1.305  12.882  1.00 28.73 ? 368 GLY A N   1 
ATOM   1293 C  CA  . GLY A 1 218 ? 22.071 -2.178  13.987  1.00 29.20 ? 368 GLY A CA  1 
ATOM   1294 C  C   . GLY A 1 218 ? 21.485 -1.574  15.258  1.00 30.47 ? 368 GLY A C   1 
ATOM   1295 O  O   . GLY A 1 218 ? 21.338 -0.342  15.369  1.00 28.70 ? 368 GLY A O   1 
ATOM   1296 N  N   . THR A 1 219 ? 21.113 -2.450  16.193  1.00 29.84 ? 369 THR A N   1 
ATOM   1297 C  CA  . THR A 1 219 ? 20.492 -2.037  17.447  1.00 31.74 ? 369 THR A CA  1 
ATOM   1298 C  C   . THR A 1 219 ? 21.288 -2.508  18.668  1.00 32.50 ? 369 THR A C   1 
ATOM   1299 O  O   . THR A 1 219 ? 22.046 -3.467  18.608  1.00 29.28 ? 369 THR A O   1 
ATOM   1300 C  CB  . THR A 1 219 ? 19.038 -2.527  17.600  1.00 34.09 ? 369 THR A CB  1 
ATOM   1301 O  OG1 . THR A 1 219 ? 18.996 -3.920  17.966  1.00 33.70 ? 369 THR A OG1 1 
ATOM   1302 C  CG2 . THR A 1 219 ? 18.250 -2.285  16.339  1.00 35.19 ? 369 THR A CG2 1 
ATOM   1303 N  N   . MET A 1 220 ? 21.082 -1.816  19.777  1.00 34.54 ? 370 MET A N   1 
ATOM   1304 C  CA  . MET A 1 220 ? 21.596 -2.243  21.068  1.00 38.43 ? 370 MET A CA  1 
ATOM   1305 C  C   . MET A 1 220 ? 21.076 -3.583  21.552  1.00 37.86 ? 370 MET A C   1 
ATOM   1306 O  O   . MET A 1 220 ? 21.755 -4.248  22.332  1.00 36.58 ? 370 MET A O   1 
ATOM   1307 C  CB  . MET A 1 220 ? 21.306 -1.168  22.123  1.00 44.57 ? 370 MET A CB  1 
ATOM   1308 C  CG  . MET A 1 220 ? 22.336 -0.053  22.114  1.00 49.59 ? 370 MET A CG  1 
ATOM   1309 S  SD  . MET A 1 220 ? 23.985 -0.593  22.674  1.00 50.42 ? 370 MET A SD  1 
ATOM   1310 C  CE  . MET A 1 220 ? 23.516 -1.355  24.199  1.00 53.20 ? 370 MET A CE  1 
ATOM   1311 N  N   . ASP A 1 221 ? 19.883 -3.994  21.127  1.00 36.84 ? 371 ASP A N   1 
ATOM   1312 C  CA  . ASP A 1 221 ? 19.374 -5.304  21.508  1.00 37.49 ? 371 ASP A CA  1 
ATOM   1313 C  C   . ASP A 1 221 ? 19.593 -6.394  20.436  1.00 37.97 ? 371 ASP A C   1 
ATOM   1314 O  O   . ASP A 1 221 ? 18.807 -7.340  20.330  1.00 35.97 ? 371 ASP A O   1 
ATOM   1315 C  CB  . ASP A 1 221 ? 17.917 -5.216  21.983  1.00 42.60 ? 371 ASP A CB  1 
ATOM   1316 C  CG  . ASP A 1 221 ? 16.941 -4.755  20.895  1.00 45.50 ? 371 ASP A CG  1 
ATOM   1317 O  OD1 . ASP A 1 221 ? 17.342 -4.481  19.730  1.00 42.35 ? 371 ASP A OD1 1 
ATOM   1318 O  OD2 . ASP A 1 221 ? 15.744 -4.655  21.236  1.00 51.32 ? 371 ASP A OD2 1 
ATOM   1319 N  N   . SER A 1 222 ? 20.682 -6.258  19.667  1.00 35.63 ? 372 SER A N   1 
ATOM   1320 C  CA  . SER A 1 222 ? 21.227 -7.356  18.801  1.00 36.60 ? 372 SER A CA  1 
ATOM   1321 C  C   . SER A 1 222 ? 20.444 -7.662  17.514  1.00 34.88 ? 372 SER A C   1 
ATOM   1322 O  O   . SER A 1 222 ? 20.581 -8.768  16.962  1.00 38.66 ? 372 SER A O   1 
ATOM   1323 C  CB  . SER A 1 222 ? 21.389 -8.684  19.602  1.00 38.60 ? 372 SER A CB  1 
ATOM   1324 O  OG  . SER A 1 222 ? 21.886 -8.453  20.916  1.00 43.62 ? 372 SER A OG  1 
ATOM   1325 N  N   . GLN A 1 223 ? 19.666 -6.704  17.026  1.00 34.89 ? 373 GLN A N   1 
ATOM   1326 C  CA  . GLN A 1 223 ? 18.931 -6.851  15.768  1.00 37.10 ? 373 GLN A CA  1 
ATOM   1327 C  C   . GLN A 1 223 ? 19.601 -6.056  14.660  1.00 36.36 ? 373 GLN A C   1 
ATOM   1328 O  O   . GLN A 1 223 ? 20.195 -5.000  14.894  1.00 32.67 ? 373 GLN A O   1 
ATOM   1329 C  CB  . GLN A 1 223 ? 17.487 -6.344  15.900  1.00 41.72 ? 373 GLN A CB  1 
ATOM   1330 C  CG  . GLN A 1 223 ? 16.677 -6.995  16.982  1.00 49.42 ? 373 GLN A CG  1 
ATOM   1331 C  CD  . GLN A 1 223 ? 16.312 -8.424  16.636  1.00 58.18 ? 373 GLN A CD  1 
ATOM   1332 O  OE1 . GLN A 1 223 ? 15.464 -8.671  15.759  1.00 67.89 ? 373 GLN A OE1 1 
ATOM   1333 N  NE2 . GLN A 1 223 ? 16.959 -9.382  17.307  1.00 58.73 ? 373 GLN A NE2 1 
ATOM   1334 N  N   . ILE A 1 224 ? 19.511 -6.588  13.452  1.00 35.66 ? 374 ILE A N   1 
ATOM   1335 C  CA  . ILE A 1 224 ? 19.841 -5.835  12.288  1.00 36.78 ? 374 ILE A CA  1 
ATOM   1336 C  C   . ILE A 1 224 ? 18.540 -5.524  11.579  1.00 34.97 ? 374 ILE A C   1 
ATOM   1337 O  O   . ILE A 1 224 ? 17.880 -6.419  11.055  1.00 37.98 ? 374 ILE A O   1 
ATOM   1338 C  CB  . ILE A 1 224 ? 20.720 -6.625  11.330  1.00 40.51 ? 374 ILE A CB  1 
ATOM   1339 C  CG1 . ILE A 1 224 ? 21.895 -7.280  12.092  1.00 41.00 ? 374 ILE A CG1 1 
ATOM   1340 C  CG2 . ILE A 1 224 ? 21.184 -5.701  10.200  1.00 41.60 ? 374 ILE A CG2 1 
ATOM   1341 C  CD1 . ILE A 1 224 ? 22.953 -6.298  12.457  1.00 39.73 ? 374 ILE A CD1 1 
ATOM   1342 N  N   . LYS A 1 225 ? 18.185 -4.261  11.565  1.00 32.82 ? 375 LYS A N   1 
ATOM   1343 C  CA  . LYS A 1 225 ? 16.912 -3.824  10.995  1.00 34.71 ? 375 LYS A CA  1 
ATOM   1344 C  C   . LYS A 1 225 ? 17.135 -3.355  9.572   1.00 34.05 ? 375 LYS A C   1 
ATOM   1345 O  O   . LYS A 1 225 ? 18.008 -2.502  9.326   1.00 32.63 ? 375 LYS A O   1 
ATOM   1346 C  CB  . LYS A 1 225 ? 16.318 -2.689  11.834  1.00 35.77 ? 375 LYS A CB  1 
ATOM   1347 C  CG  . LYS A 1 225 ? 16.164 -3.024  13.314  1.00 38.74 ? 375 LYS A CG  1 
ATOM   1348 C  CD  . LYS A 1 225 ? 15.394 -1.945  14.093  1.00 40.76 ? 375 LYS A CD  1 
ATOM   1349 C  CE  . LYS A 1 225 ? 13.924 -1.915  13.741  1.00 43.15 ? 375 LYS A CE  1 
ATOM   1350 N  NZ  . LYS A 1 225 ? 13.165 -3.040  14.329  1.00 46.87 ? 375 LYS A NZ  1 
ATOM   1351 N  N   . ILE A 1 226 ? 16.354 -3.922  8.637   1.00 35.56 ? 376 ILE A N   1 
ATOM   1352 C  CA  . ILE A 1 226 ? 16.424 -3.532  7.226   1.00 35.29 ? 376 ILE A CA  1 
ATOM   1353 C  C   . ILE A 1 226 ? 15.231 -2.666  6.905   1.00 34.43 ? 376 ILE A C   1 
ATOM   1354 O  O   . ILE A 1 226 ? 14.095 -2.992  7.257   1.00 36.39 ? 376 ILE A O   1 
ATOM   1355 C  CB  . ILE A 1 226 ? 16.445 -4.772  6.274   1.00 37.53 ? 376 ILE A CB  1 
ATOM   1356 C  CG1 . ILE A 1 226 ? 17.542 -5.780  6.671   1.00 36.36 ? 376 ILE A CG1 1 
ATOM   1357 C  CG2 . ILE A 1 226 ? 16.608 -4.342  4.817   1.00 37.95 ? 376 ILE A CG2 1 
ATOM   1358 C  CD1 . ILE A 1 226 ? 18.986 -5.263  6.664   1.00 37.07 ? 376 ILE A CD1 1 
ATOM   1359 N  N   . TRP A 1 227 ? 15.499 -1.558  6.238   1.00 33.96 ? 377 TRP A N   1 
ATOM   1360 C  CA  . TRP A 1 227 ? 14.502 -0.552  5.941   1.00 36.60 ? 377 TRP A CA  1 
ATOM   1361 C  C   . TRP A 1 227 ? 14.412 -0.278  4.461   1.00 38.15 ? 377 TRP A C   1 
ATOM   1362 O  O   . TRP A 1 227 ? 15.421 -0.306  3.746   1.00 40.04 ? 377 TRP A O   1 
ATOM   1363 C  CB  . TRP A 1 227 ? 14.862 0.782   6.631   1.00 35.87 ? 377 TRP A CB  1 
ATOM   1364 C  CG  . TRP A 1 227 ? 14.930 0.724   8.136   1.00 35.52 ? 377 TRP A CG  1 
ATOM   1365 C  CD1 . TRP A 1 227 ? 15.997 0.371   8.880   1.00 35.46 ? 377 TRP A CD1 1 
ATOM   1366 C  CD2 . TRP A 1 227 ? 13.885 1.070   9.058   1.00 37.28 ? 377 TRP A CD2 1 
ATOM   1367 N  NE1 . TRP A 1 227 ? 15.699 0.470   10.218  1.00 36.29 ? 377 TRP A NE1 1 
ATOM   1368 C  CE2 . TRP A 1 227 ? 14.403 0.885   10.358  1.00 37.78 ? 377 TRP A CE2 1 
ATOM   1369 C  CE3 . TRP A 1 227 ? 12.577 1.532   8.911   1.00 37.91 ? 377 TRP A CE3 1 
ATOM   1370 C  CZ2 . TRP A 1 227 ? 13.642 1.136   11.517  1.00 37.80 ? 377 TRP A CZ2 1 
ATOM   1371 C  CZ3 . TRP A 1 227 ? 11.816 1.779   10.064  1.00 39.16 ? 377 TRP A CZ3 1 
ATOM   1372 C  CH2 . TRP A 1 227 ? 12.366 1.570   11.349  1.00 38.81 ? 377 TRP A CH2 1 
ATOM   1373 N  N   . ASP A 1 228 ? 13.203 0.034   4.034   1.00 41.15 ? 378 ASP A N   1 
ATOM   1374 C  CA  . ASP A 1 228 ? 12.900 0.487   2.695   1.00 42.83 ? 378 ASP A CA  1 
ATOM   1375 C  C   . ASP A 1 228 ? 12.865 2.008   2.789   1.00 41.34 ? 378 ASP A C   1 
ATOM   1376 O  O   . ASP A 1 228 ? 12.062 2.563   3.538   1.00 39.04 ? 378 ASP A O   1 
ATOM   1377 C  CB  . ASP A 1 228 ? 11.544 -0.084  2.269   1.00 47.65 ? 378 ASP A CB  1 
ATOM   1378 C  CG  . ASP A 1 228 ? 11.124 0.338   0.862   1.00 50.50 ? 378 ASP A CG  1 
ATOM   1379 O  OD1 . ASP A 1 228 ? 11.373 1.482   0.475   1.00 50.47 ? 378 ASP A OD1 1 
ATOM   1380 O  OD2 . ASP A 1 228 ? 10.517 -0.488  0.159   1.00 54.90 ? 378 ASP A OD2 1 
ATOM   1381 N  N   . LEU A 1 229 ? 13.740 2.681   2.044   1.00 39.13 ? 379 LEU A N   1 
ATOM   1382 C  CA  . LEU A 1 229 ? 13.873 4.144   2.180   1.00 41.10 ? 379 LEU A CA  1 
ATOM   1383 C  C   . LEU A 1 229 ? 12.639 4.885   1.688   1.00 42.29 ? 379 LEU A C   1 
ATOM   1384 O  O   . LEU A 1 229 ? 12.166 5.827   2.356   1.00 44.41 ? 379 LEU A O   1 
ATOM   1385 C  CB  . LEU A 1 229 ? 15.114 4.657   1.439   1.00 38.84 ? 379 LEU A CB  1 
ATOM   1386 C  CG  . LEU A 1 229 ? 15.325 6.179   1.411   1.00 40.50 ? 379 LEU A CG  1 
ATOM   1387 C  CD1 . LEU A 1 229 ? 15.634 6.757   2.789   1.00 38.28 ? 379 LEU A CD1 1 
ATOM   1388 C  CD2 . LEU A 1 229 ? 16.432 6.543   0.436   1.00 39.34 ? 379 LEU A CD2 1 
ATOM   1389 N  N   . LYS A 1 230 ? 12.133 4.485   0.521   1.00 43.14 ? 380 LYS A N   1 
ATOM   1390 C  CA  . LYS A 1 230 ? 10.968 5.144   -0.087  1.00 48.11 ? 380 LYS A CA  1 
ATOM   1391 C  C   . LYS A 1 230 ? 9.730  5.037   0.821   1.00 50.32 ? 380 LYS A C   1 
ATOM   1392 O  O   . LYS A 1 230 ? 9.090  6.034   1.126   1.00 53.17 ? 380 LYS A O   1 
ATOM   1393 C  CB  . LYS A 1 230 ? 10.664 4.543   -1.472  1.00 50.05 ? 380 LYS A CB  1 
ATOM   1394 N  N   . GLU A 1 231 ? 9.439  3.833   1.284   1.00 49.35 ? 381 GLU A N   1 
ATOM   1395 C  CA  . GLU A 1 231 ? 8.270  3.595   2.136   1.00 51.45 ? 381 GLU A CA  1 
ATOM   1396 C  C   . GLU A 1 231 ? 8.499  3.950   3.599   1.00 49.46 ? 381 GLU A C   1 
ATOM   1397 O  O   . GLU A 1 231 ? 7.551  3.928   4.390   1.00 46.67 ? 381 GLU A O   1 
ATOM   1398 C  CB  . GLU A 1 231 ? 7.859  2.127   2.062   1.00 53.98 ? 381 GLU A CB  1 
ATOM   1399 C  CG  . GLU A 1 231 ? 7.690  1.557   0.646   1.00 59.36 ? 381 GLU A CG  1 
ATOM   1400 C  CD  . GLU A 1 231 ? 6.529  2.159   -0.134  1.00 62.54 ? 381 GLU A CD  1 
ATOM   1401 O  OE1 . GLU A 1 231 ? 5.834  3.064   0.376   1.00 63.72 ? 381 GLU A OE1 1 
ATOM   1402 O  OE2 . GLU A 1 231 ? 6.313  1.710   -1.280  1.00 69.05 ? 381 GLU A OE2 1 
ATOM   1403 N  N   . ARG A 1 232 ? 9.758  4.225   3.964   1.00 48.54 ? 382 ARG A N   1 
ATOM   1404 C  CA  . ARG A 1 232 ? 10.161 4.475   5.365   1.00 48.67 ? 382 ARG A CA  1 
ATOM   1405 C  C   . ARG A 1 232 ? 9.731  3.312   6.319   1.00 45.79 ? 382 ARG A C   1 
ATOM   1406 O  O   . ARG A 1 232 ? 9.394  3.540   7.457   1.00 48.92 ? 382 ARG A O   1 
ATOM   1407 C  CB  . ARG A 1 232 ? 9.605  5.827   5.865   1.00 51.51 ? 382 ARG A CB  1 
ATOM   1408 C  CG  . ARG A 1 232 ? 10.023 7.060   5.050   1.00 55.13 ? 382 ARG A CG  1 
ATOM   1409 C  CD  . ARG A 1 232 ? 9.062  8.235   5.265   1.00 56.48 ? 382 ARG A CD  1 
ATOM   1410 N  N   . THR A 1 233 ? 9.779  2.076   5.842   1.00 45.17 ? 383 THR A N   1 
ATOM   1411 C  CA  . THR A 1 233 ? 9.249  0.936   6.587   1.00 43.86 ? 383 THR A CA  1 
ATOM   1412 C  C   . THR A 1 233 ? 10.346 -0.079  6.886   1.00 43.53 ? 383 THR A C   1 
ATOM   1413 O  O   . THR A 1 233 ? 11.367 -0.181  6.154   1.00 41.80 ? 383 THR A O   1 
ATOM   1414 C  CB  . THR A 1 233 ? 8.152  0.184   5.807   1.00 44.90 ? 383 THR A CB  1 
ATOM   1415 O  OG1 . THR A 1 233 ? 8.652  -0.140  4.512   1.00 47.12 ? 383 THR A OG1 1 
ATOM   1416 C  CG2 . THR A 1 233 ? 6.859  1.016   5.674   1.00 45.41 ? 383 THR A CG2 1 
ATOM   1417 N  N   . ASN A 1 234 ? 10.119 -0.833  7.954   1.00 41.52 ? 384 ASN A N   1 
ATOM   1418 C  CA  . ASN A 1 234 ? 11.048 -1.825  8.429   1.00 41.24 ? 384 ASN A CA  1 
ATOM   1419 C  C   . ASN A 1 234 ? 10.596 -3.112  7.808   1.00 41.75 ? 384 ASN A C   1 
ATOM   1420 O  O   . ASN A 1 234 ? 9.555  -3.645  8.168   1.00 42.89 ? 384 ASN A O   1 
ATOM   1421 C  CB  . ASN A 1 234 ? 11.024 -1.839  9.962   1.00 42.12 ? 384 ASN A CB  1 
ATOM   1422 C  CG  . ASN A 1 234 ? 11.795 -2.998  10.566  1.00 45.35 ? 384 ASN A CG  1 
ATOM   1423 O  OD1 . ASN A 1 234 ? 11.403 -3.503  11.614  1.00 45.30 ? 384 ASN A OD1 1 
ATOM   1424 N  ND2 . ASN A 1 234 ? 12.883 -3.435  9.911   1.00 44.02 ? 384 ASN A ND2 1 
ATOM   1425 N  N   . VAL A 1 235 ? 11.354 -3.587  6.829   1.00 41.39 ? 385 VAL A N   1 
ATOM   1426 C  CA  . VAL A 1 235 ? 10.886 -4.660  5.950   1.00 43.44 ? 385 VAL A CA  1 
ATOM   1427 C  C   . VAL A 1 235 ? 11.374 -6.027  6.364   1.00 43.27 ? 385 VAL A C   1 
ATOM   1428 O  O   . VAL A 1 235 ? 10.757 -7.019  6.001   1.00 44.64 ? 385 VAL A O   1 
ATOM   1429 C  CB  . VAL A 1 235 ? 11.225 -4.409  4.452   1.00 44.37 ? 385 VAL A CB  1 
ATOM   1430 C  CG1 . VAL A 1 235 ? 10.382 -3.244  3.901   1.00 45.72 ? 385 VAL A CG1 1 
ATOM   1431 C  CG2 . VAL A 1 235 ? 12.717 -4.180  4.240   1.00 45.60 ? 385 VAL A CG2 1 
ATOM   1432 N  N   . ALA A 1 236 ? 12.433 -6.083  7.145   1.00 40.56 ? 386 ALA A N   1 
ATOM   1433 C  CA  . ALA A 1 236 ? 12.968 -7.352  7.662   1.00 41.90 ? 386 ALA A CA  1 
ATOM   1434 C  C   . ALA A 1 236 ? 13.846 -7.071  8.891   1.00 40.16 ? 386 ALA A C   1 
ATOM   1435 O  O   . ALA A 1 236 ? 14.370 -5.972  9.052   1.00 37.86 ? 386 ALA A O   1 
ATOM   1436 C  CB  . ALA A 1 236 ? 13.790 -8.060  6.593   1.00 41.29 ? 386 ALA A CB  1 
ATOM   1437 N  N   . ASN A 1 237 ? 14.005 -8.072  9.739   1.00 40.82 ? 387 ASN A N   1 
ATOM   1438 C  CA  . ASN A 1 237 ? 14.915 -7.980  10.866  1.00 41.88 ? 387 ASN A CA  1 
ATOM   1439 C  C   . ASN A 1 237 ? 15.708 -9.253  10.944  1.00 42.09 ? 387 ASN A C   1 
ATOM   1440 O  O   . ASN A 1 237 ? 15.137 -10.343 10.891  1.00 43.40 ? 387 ASN A O   1 
ATOM   1441 C  CB  . ASN A 1 237 ? 14.153 -7.731  12.172  1.00 44.11 ? 387 ASN A CB  1 
ATOM   1442 C  CG  . ASN A 1 237 ? 13.394 -6.404  12.158  1.00 44.05 ? 387 ASN A CG  1 
ATOM   1443 O  OD1 . ASN A 1 237 ? 13.984 -5.323  12.313  1.00 44.19 ? 387 ASN A OD1 1 
ATOM   1444 N  ND2 . ASN A 1 237 ? 12.069 -6.481  11.980  1.00 43.93 ? 387 ASN A ND2 1 
ATOM   1445 N  N   . PHE A 1 238 ? 17.024 -9.122  11.035  1.00 40.28 ? 388 PHE A N   1 
ATOM   1446 C  CA  . PHE A 1 238 ? 17.900 -10.270 11.156  1.00 42.18 ? 388 PHE A CA  1 
ATOM   1447 C  C   . PHE A 1 238 ? 18.358 -10.472 12.606  1.00 41.62 ? 388 PHE A C   1 
ATOM   1448 O  O   . PHE A 1 238 ? 19.187 -9.706  13.108  1.00 43.36 ? 388 PHE A O   1 
ATOM   1449 C  CB  . PHE A 1 238 ? 19.129 -10.109 10.266  1.00 41.21 ? 388 PHE A CB  1 
ATOM   1450 C  CG  . PHE A 1 238 ? 18.832 -9.957  8.797   1.00 42.34 ? 388 PHE A CG  1 
ATOM   1451 C  CD1 . PHE A 1 238 ? 17.694 -10.490 8.217   1.00 48.17 ? 388 PHE A CD1 1 
ATOM   1452 C  CD2 . PHE A 1 238 ? 19.740 -9.313  7.985   1.00 43.31 ? 388 PHE A CD2 1 
ATOM   1453 C  CE1 . PHE A 1 238 ? 17.466 -10.350 6.851   1.00 48.68 ? 388 PHE A CE1 1 
ATOM   1454 C  CE2 . PHE A 1 238 ? 19.516 -9.178  6.622   1.00 42.72 ? 388 PHE A CE2 1 
ATOM   1455 C  CZ  . PHE A 1 238 ? 18.388 -9.690  6.057   1.00 44.20 ? 388 PHE A CZ  1 
ATOM   1456 N  N   . PRO A 1 239 ? 17.848 -11.521 13.264  1.00 43.81 ? 389 PRO A N   1 
ATOM   1457 C  CA  . PRO A 1 239 ? 18.239 -11.855 14.614  1.00 43.90 ? 389 PRO A CA  1 
ATOM   1458 C  C   . PRO A 1 239 ? 19.317 -12.907 14.604  1.00 44.30 ? 389 PRO A C   1 
ATOM   1459 O  O   . PRO A 1 239 ? 19.568 -13.528 13.554  1.00 43.77 ? 389 PRO A O   1 
ATOM   1460 C  CB  . PRO A 1 239 ? 16.957 -12.461 15.184  1.00 47.15 ? 389 PRO A CB  1 
ATOM   1461 C  CG  . PRO A 1 239 ? 16.414 -13.245 14.022  1.00 48.94 ? 389 PRO A CG  1 
ATOM   1462 C  CD  . PRO A 1 239 ? 16.846 -12.492 12.761  1.00 47.13 ? 389 PRO A CD  1 
ATOM   1463 N  N   . GLY A 1 240 ? 19.915 -13.154 15.765  1.00 42.85 ? 390 GLY A N   1 
ATOM   1464 C  CA  . GLY A 1 240 ? 20.837 -14.276 15.922  1.00 40.91 ? 390 GLY A CA  1 
ATOM   1465 C  C   . GLY A 1 240 ? 22.086 -13.882 16.647  1.00 39.53 ? 390 GLY A C   1 
ATOM   1466 O  O   . GLY A 1 240 ? 22.767 -14.720 17.250  1.00 40.27 ? 390 GLY A O   1 
ATOM   1467 N  N   . HIS A 1 241 ? 22.417 -12.600 16.549  1.00 38.09 ? 391 HIS A N   1 
ATOM   1468 C  CA  . HIS A 1 241 ? 23.487 -12.033 17.309  1.00 35.56 ? 391 HIS A CA  1 
ATOM   1469 C  C   . HIS A 1 241 ? 23.101 -11.955 18.780  1.00 37.64 ? 391 HIS A C   1 
ATOM   1470 O  O   . HIS A 1 241 ? 21.880 -11.972 19.149  1.00 37.32 ? 391 HIS A O   1 
ATOM   1471 C  CB  . HIS A 1 241 ? 23.844 -10.633 16.799  1.00 32.94 ? 391 HIS A CB  1 
ATOM   1472 C  CG  . HIS A 1 241 ? 24.821 -10.610 15.669  1.00 32.58 ? 391 HIS A CG  1 
ATOM   1473 N  ND1 . HIS A 1 241 ? 26.099 -11.120 15.763  1.00 33.50 ? 391 HIS A ND1 1 
ATOM   1474 C  CD2 . HIS A 1 241 ? 24.731 -10.057 14.436  1.00 30.82 ? 391 HIS A CD2 1 
ATOM   1475 C  CE1 . HIS A 1 241 ? 26.748 -10.886 14.642  1.00 32.31 ? 391 HIS A CE1 1 
ATOM   1476 N  NE2 . HIS A 1 241 ? 25.933 -10.252 13.815  1.00 30.81 ? 391 HIS A NE2 1 
ATOM   1477 N  N   . SER A 1 242 ? 24.143 -11.894 19.626  1.00 38.42 ? 392 SER A N   1 
ATOM   1478 C  CA  . SER A 1 242 ? 24.004 -11.514 21.043  1.00 43.06 ? 392 SER A CA  1 
ATOM   1479 C  C   . SER A 1 242 ? 24.784 -10.255 21.312  1.00 39.34 ? 392 SER A C   1 
ATOM   1480 O  O   . SER A 1 242 ? 25.842 -9.986  20.709  1.00 38.95 ? 392 SER A O   1 
ATOM   1481 C  CB  . SER A 1 242 ? 24.474 -12.634 21.965  1.00 44.90 ? 392 SER A CB  1 
ATOM   1482 O  OG  . SER A 1 242 ? 23.577 -13.707 21.893  1.00 51.13 ? 392 SER A OG  1 
ATOM   1483 N  N   . GLY A 1 243 ? 24.244 -9.444  22.184  1.00 39.27 ? 393 GLY A N   1 
ATOM   1484 C  CA  . GLY A 1 243 ? 24.814 -8.149  22.469  1.00 39.14 ? 393 GLY A CA  1 
ATOM   1485 C  C   . GLY A 1 243 ? 24.626 -7.113  21.359  1.00 37.12 ? 393 GLY A C   1 
ATOM   1486 O  O   . GLY A 1 243 ? 24.167 -7.436  20.263  1.00 39.75 ? 393 GLY A O   1 
ATOM   1487 N  N   . PRO A 1 244 ? 25.007 -5.863  21.635  1.00 35.86 ? 394 PRO A N   1 
ATOM   1488 C  CA  . PRO A 1 244 ? 24.899 -4.734  20.723  1.00 35.23 ? 394 PRO A CA  1 
ATOM   1489 C  C   . PRO A 1 244 ? 25.556 -4.983  19.356  1.00 33.90 ? 394 PRO A C   1 
ATOM   1490 O  O   . PRO A 1 244 ? 26.664 -5.484  19.298  1.00 33.78 ? 394 PRO A O   1 
ATOM   1491 C  CB  . PRO A 1 244 ? 25.650 -3.609  21.457  1.00 36.03 ? 394 PRO A CB  1 
ATOM   1492 C  CG  . PRO A 1 244 ? 25.575 -3.993  22.922  1.00 35.28 ? 394 PRO A CG  1 
ATOM   1493 C  CD  . PRO A 1 244 ? 25.462 -5.464  22.990  1.00 38.61 ? 394 PRO A CD  1 
ATOM   1494 N  N   . ILE A 1 245 ? 24.851 -4.651  18.271  1.00 31.94 ? 395 ILE A N   1 
ATOM   1495 C  CA  . ILE A 1 245 ? 25.473 -4.649  16.963  1.00 30.84 ? 395 ILE A CA  1 
ATOM   1496 C  C   . ILE A 1 245 ? 26.540 -3.593  16.981  1.00 31.24 ? 395 ILE A C   1 
ATOM   1497 O  O   . ILE A 1 245 ? 26.304 -2.484  17.500  1.00 29.52 ? 395 ILE A O   1 
ATOM   1498 C  CB  . ILE A 1 245 ? 24.460 -4.360  15.815  1.00 31.06 ? 395 ILE A CB  1 
ATOM   1499 C  CG1 . ILE A 1 245 ? 23.300 -5.368  15.855  1.00 30.46 ? 395 ILE A CG1 1 
ATOM   1500 C  CG2 . ILE A 1 245 ? 25.171 -4.376  14.464  1.00 30.60 ? 395 ILE A CG2 1 
ATOM   1501 C  CD1 . ILE A 1 245 ? 23.704 -6.824  15.945  1.00 30.79 ? 395 ILE A CD1 1 
ATOM   1502 N  N   . THR A 1 246 ? 27.720 -3.914  16.424  1.00 29.60 ? 396 THR A N   1 
ATOM   1503 C  CA  . THR A 1 246 ? 28.832 -2.939  16.382  1.00 28.54 ? 396 THR A CA  1 
ATOM   1504 C  C   . THR A 1 246 ? 29.096 -2.331  15.037  1.00 31.81 ? 396 THR A C   1 
ATOM   1505 O  O   . THR A 1 246 ? 29.551 -1.181  14.959  1.00 30.24 ? 396 THR A O   1 
ATOM   1506 C  CB  . THR A 1 246 ? 30.171 -3.545  16.857  1.00 29.04 ? 396 THR A CB  1 
ATOM   1507 O  OG1 . THR A 1 246 ? 30.443 -4.741  16.112  1.00 28.47 ? 396 THR A OG1 1 
ATOM   1508 C  CG2 . THR A 1 246 ? 30.100 -3.886  18.317  1.00 28.25 ? 396 THR A CG2 1 
ATOM   1509 N  N   . SER A 1 247 ? 28.836 -3.086  13.965  1.00 28.44 ? 397 SER A N   1 
ATOM   1510 C  CA  . SER A 1 247 ? 29.168 -2.653  12.613  1.00 29.06 ? 397 SER A CA  1 
ATOM   1511 C  C   . SER A 1 247 ? 28.410 -3.521  11.615  1.00 27.18 ? 397 SER A C   1 
ATOM   1512 O  O   . SER A 1 247 ? 28.160 -4.702  11.875  1.00 27.40 ? 397 SER A O   1 
ATOM   1513 C  CB  . SER A 1 247 ? 30.678 -2.830  12.361  1.00 30.44 ? 397 SER A CB  1 
ATOM   1514 O  OG  . SER A 1 247 ? 31.056 -2.244  11.138  1.00 30.17 ? 397 SER A OG  1 
ATOM   1515 N  N   . ILE A 1 248 ? 28.018 -2.910  10.508  1.00 27.14 ? 398 ILE A N   1 
ATOM   1516 C  CA  . ILE A 1 248 ? 27.442 -3.618  9.375   1.00 26.99 ? 398 ILE A CA  1 
ATOM   1517 C  C   . ILE A 1 248 ? 28.086 -3.108  8.106   1.00 26.90 ? 398 ILE A C   1 
ATOM   1518 O  O   . ILE A 1 248 ? 28.506 -1.953  8.062   1.00 26.33 ? 398 ILE A O   1 
ATOM   1519 C  CB  . ILE A 1 248 ? 25.915 -3.508  9.324   1.00 30.13 ? 398 ILE A CB  1 
ATOM   1520 C  CG1 . ILE A 1 248 ? 25.449 -2.113  8.998   1.00 32.35 ? 398 ILE A CG1 1 
ATOM   1521 C  CG2 . ILE A 1 248 ? 25.295 -3.961  10.650  1.00 31.90 ? 398 ILE A CG2 1 
ATOM   1522 C  CD1 . ILE A 1 248 ? 23.969 -2.047  8.631   1.00 36.98 ? 398 ILE A CD1 1 
ATOM   1523 N  N   . ALA A 1 249 ? 28.192 -3.973  7.096   1.00 26.61 ? 399 ALA A N   1 
ATOM   1524 C  CA  . ALA A 1 249 ? 28.736 -3.584  5.780   1.00 28.08 ? 399 ALA A CA  1 
ATOM   1525 C  C   . ALA A 1 249 ? 28.027 -4.313  4.650   1.00 29.68 ? 399 ALA A C   1 
ATOM   1526 O  O   . ALA A 1 249 ? 27.897 -5.537  4.671   1.00 30.07 ? 399 ALA A O   1 
ATOM   1527 C  CB  . ALA A 1 249 ? 30.228 -3.853  5.737   1.00 28.16 ? 399 ALA A CB  1 
ATOM   1528 N  N   . PHE A 1 250 ? 27.538 -3.555  3.648   1.00 28.70 ? 400 PHE A N   1 
ATOM   1529 C  CA  . PHE A 1 250 ? 26.961 -4.152  2.462   1.00 30.53 ? 400 PHE A CA  1 
ATOM   1530 C  C   . PHE A 1 250 ? 28.055 -4.314  1.388   1.00 32.15 ? 400 PHE A C   1 
ATOM   1531 O  O   . PHE A 1 250 ? 28.879 -3.414  1.171   1.00 31.80 ? 400 PHE A O   1 
ATOM   1532 C  CB  . PHE A 1 250 ? 25.843 -3.292  1.893   1.00 30.37 ? 400 PHE A CB  1 
ATOM   1533 C  CG  . PHE A 1 250 ? 24.589 -3.307  2.691   1.00 29.73 ? 400 PHE A CG  1 
ATOM   1534 C  CD1 . PHE A 1 250 ? 23.605 -4.215  2.426   1.00 30.80 ? 400 PHE A CD1 1 
ATOM   1535 C  CD2 . PHE A 1 250 ? 24.388 -2.378  3.709   1.00 30.06 ? 400 PHE A CD2 1 
ATOM   1536 C  CE1 . PHE A 1 250 ? 22.421 -4.236  3.164   1.00 32.57 ? 400 PHE A CE1 1 
ATOM   1537 C  CE2 . PHE A 1 250 ? 23.210 -2.382  4.457   1.00 29.85 ? 400 PHE A CE2 1 
ATOM   1538 C  CZ  . PHE A 1 250 ? 22.228 -3.304  4.193   1.00 31.01 ? 400 PHE A CZ  1 
ATOM   1539 N  N   . SER A 1 251 ? 28.050 -5.453  0.735   1.00 32.23 ? 401 SER A N   1 
ATOM   1540 C  CA  . SER A 1 251 ? 28.985 -5.701  -0.330  1.00 36.12 ? 401 SER A CA  1 
ATOM   1541 C  C   . SER A 1 251 ? 28.518 -5.005  -1.605  1.00 39.84 ? 401 SER A C   1 
ATOM   1542 O  O   . SER A 1 251 ? 27.290 -4.817  -1.837  1.00 39.54 ? 401 SER A O   1 
ATOM   1543 C  CB  . SER A 1 251 ? 29.108 -7.190  -0.581  1.00 38.24 ? 401 SER A CB  1 
ATOM   1544 O  OG  . SER A 1 251 ? 29.911 -7.449  -1.724  1.00 41.37 ? 401 SER A OG  1 
ATOM   1545 N  N   . GLU A 1 252 ? 29.483 -4.628  -2.432  1.00 39.41 ? 402 GLU A N   1 
ATOM   1546 C  CA  . GLU A 1 252 ? 29.172 -4.132  -3.778  1.00 47.44 ? 402 GLU A CA  1 
ATOM   1547 C  C   . GLU A 1 252 ? 28.513 -5.184  -4.674  1.00 48.40 ? 402 GLU A C   1 
ATOM   1548 O  O   . GLU A 1 252 ? 27.844 -4.817  -5.636  1.00 54.69 ? 402 GLU A O   1 
ATOM   1549 C  CB  . GLU A 1 252 ? 30.405 -3.506  -4.428  1.00 48.73 ? 402 GLU A CB  1 
ATOM   1550 C  CG  . GLU A 1 252 ? 30.794 -2.171  -3.757  1.00 50.76 ? 402 GLU A CG  1 
ATOM   1551 C  CD  . GLU A 1 252 ? 29.858 -1.009  -4.104  1.00 52.61 ? 402 GLU A CD  1 
ATOM   1552 O  OE1 . GLU A 1 252 ? 29.268 -0.997  -5.210  1.00 59.32 ? 402 GLU A OE1 1 
ATOM   1553 O  OE2 . GLU A 1 252 ? 29.717 -0.099  -3.264  1.00 58.38 ? 402 GLU A OE2 1 
ATOM   1554 N  N   . ASN A 1 253 ? 28.632 -6.488  -4.351  1.00 47.92 ? 403 ASN A N   1 
ATOM   1555 C  CA  . ASN A 1 253 ? 27.869 -7.507  -5.103  1.00 49.77 ? 403 ASN A CA  1 
ATOM   1556 C  C   . ASN A 1 253 ? 26.362 -7.336  -4.945  1.00 49.31 ? 403 ASN A C   1 
ATOM   1557 O  O   . ASN A 1 253 ? 25.581 -7.947  -5.684  1.00 53.49 ? 403 ASN A O   1 
ATOM   1558 C  CB  . ASN A 1 253 ? 28.303 -8.971  -4.767  1.00 55.69 ? 403 ASN A CB  1 
ATOM   1559 C  CG  . ASN A 1 253 ? 27.801 -9.469  -3.388  1.00 55.38 ? 403 ASN A CG  1 
ATOM   1560 O  OD1 . ASN A 1 253 ? 27.097 -8.760  -2.656  1.00 59.44 ? 403 ASN A OD1 1 
ATOM   1561 N  ND2 . ASN A 1 253 ? 28.177 -10.692 -3.039  1.00 53.93 ? 403 ASN A ND2 1 
ATOM   1562 N  N   . GLY A 1 254 ? 25.949 -6.533  -3.967  1.00 43.62 ? 404 GLY A N   1 
ATOM   1563 C  CA  . GLY A 1 254 ? 24.551 -6.184  -3.798  1.00 43.83 ? 404 GLY A CA  1 
ATOM   1564 C  C   . GLY A 1 254 ? 23.714 -7.246  -3.092  1.00 43.12 ? 404 GLY A C   1 
ATOM   1565 O  O   . GLY A 1 254 ? 22.568 -6.992  -2.778  1.00 42.02 ? 404 GLY A O   1 
ATOM   1566 N  N   . TYR A 1 255 ? 24.268 -8.425  -2.833  1.00 40.94 ? 405 TYR A N   1 
ATOM   1567 C  CA  . TYR A 1 255 ? 23.509 -9.458  -2.134  1.00 45.74 ? 405 TYR A CA  1 
ATOM   1568 C  C   . TYR A 1 255 ? 24.119 -9.959  -0.823  1.00 43.69 ? 405 TYR A C   1 
ATOM   1569 O  O   . TYR A 1 255 ? 23.464 -10.713 -0.106  1.00 47.21 ? 405 TYR A O   1 
ATOM   1570 C  CB  . TYR A 1 255 ? 23.155 -10.647 -3.081  1.00 51.43 ? 405 TYR A CB  1 
ATOM   1571 C  CG  . TYR A 1 255 ? 24.323 -11.393 -3.697  1.00 58.26 ? 405 TYR A CG  1 
ATOM   1572 C  CD1 . TYR A 1 255 ? 24.939 -12.458 -3.019  1.00 63.46 ? 405 TYR A CD1 1 
ATOM   1573 C  CD2 . TYR A 1 255 ? 24.779 -11.082 -4.993  1.00 63.61 ? 405 TYR A CD2 1 
ATOM   1574 C  CE1 . TYR A 1 255 ? 26.004 -13.161 -3.590  1.00 67.65 ? 405 TYR A CE1 1 
ATOM   1575 C  CE2 . TYR A 1 255 ? 25.836 -11.779 -5.571  1.00 65.73 ? 405 TYR A CE2 1 
ATOM   1576 C  CZ  . TYR A 1 255 ? 26.448 -12.817 -4.864  1.00 70.53 ? 405 TYR A CZ  1 
ATOM   1577 O  OH  . TYR A 1 255 ? 27.500 -13.509 -5.427  1.00 75.67 ? 405 TYR A OH  1 
ATOM   1578 N  N   . TYR A 1 256 ? 25.344 -9.551  -0.492  1.00 43.99 ? 406 TYR A N   1 
ATOM   1579 C  CA  . TYR A 1 256 ? 25.925 -9.902  0.824   1.00 42.41 ? 406 TYR A CA  1 
ATOM   1580 C  C   . TYR A 1 256 ? 25.815 -8.716  1.826   1.00 39.81 ? 406 TYR A C   1 
ATOM   1581 O  O   . TYR A 1 256 ? 25.971 -7.534  1.463   1.00 38.96 ? 406 TYR A O   1 
ATOM   1582 C  CB  . TYR A 1 256 ? 27.419 -10.323 0.741   1.00 42.62 ? 406 TYR A CB  1 
ATOM   1583 C  CG  . TYR A 1 256 ? 27.764 -11.769 0.246   1.00 45.30 ? 406 TYR A CG  1 
ATOM   1584 C  CD1 . TYR A 1 256 ? 26.790 -12.750 0.041   1.00 48.75 ? 406 TYR A CD1 1 
ATOM   1585 C  CD2 . TYR A 1 256 ? 29.110 -12.135 0.032   1.00 45.14 ? 406 TYR A CD2 1 
ATOM   1586 C  CE1 . TYR A 1 256 ? 27.146 -14.037 -0.396  1.00 50.33 ? 406 TYR A CE1 1 
ATOM   1587 C  CE2 . TYR A 1 256 ? 29.465 -13.417 -0.393  1.00 44.39 ? 406 TYR A CE2 1 
ATOM   1588 C  CZ  . TYR A 1 256 ? 28.501 -14.356 -0.607  1.00 49.16 ? 406 TYR A CZ  1 
ATOM   1589 O  OH  . TYR A 1 256 ? 28.900 -15.623 -1.030  1.00 48.85 ? 406 TYR A OH  1 
ATOM   1590 N  N   . LEU A 1 257 ? 25.587 -9.079  3.094   1.00 36.95 ? 407 LEU A N   1 
ATOM   1591 C  CA  . LEU A 1 257 ? 25.660 -8.157  4.232   1.00 32.53 ? 407 LEU A CA  1 
ATOM   1592 C  C   . LEU A 1 257 ? 26.471 -8.859  5.305   1.00 33.99 ? 407 LEU A C   1 
ATOM   1593 O  O   . LEU A 1 257 ? 26.205 -10.014 5.618   1.00 34.14 ? 407 LEU A O   1 
ATOM   1594 C  CB  . LEU A 1 257 ? 24.277 -7.852  4.768   1.00 32.77 ? 407 LEU A CB  1 
ATOM   1595 C  CG  . LEU A 1 257 ? 24.245 -7.068  6.096   1.00 33.57 ? 407 LEU A CG  1 
ATOM   1596 C  CD1 . LEU A 1 257 ? 24.607 -5.630  5.833   1.00 32.07 ? 407 LEU A CD1 1 
ATOM   1597 C  CD2 . LEU A 1 257 ? 22.868 -7.159  6.691   1.00 36.42 ? 407 LEU A CD2 1 
ATOM   1598 N  N   . ALA A 1 258 ? 27.478 -8.170  5.832   1.00 30.58 ? 408 ALA A N   1 
ATOM   1599 C  CA  . ALA A 1 258 ? 28.254 -8.661  6.953   1.00 28.58 ? 408 ALA A CA  1 
ATOM   1600 C  C   . ALA A 1 258 ? 27.875 -7.851  8.163   1.00 28.43 ? 408 ALA A C   1 
ATOM   1601 O  O   . ALA A 1 258 ? 27.694 -6.616  8.065   1.00 27.59 ? 408 ALA A O   1 
ATOM   1602 C  CB  . ALA A 1 258 ? 29.725 -8.530  6.680   1.00 28.34 ? 408 ALA A CB  1 
ATOM   1603 N  N   . THR A 1 259 ? 27.649 -8.537  9.280   1.00 28.97 ? 409 THR A N   1 
ATOM   1604 C  CA  . THR A 1 259 ? 27.295 -7.859  10.532  1.00 28.93 ? 409 THR A CA  1 
ATOM   1605 C  C   . THR A 1 259 ? 28.200 -8.347  11.688  1.00 28.56 ? 409 THR A C   1 
ATOM   1606 O  O   . THR A 1 259 ? 28.699 -9.465  11.706  1.00 28.64 ? 409 THR A O   1 
ATOM   1607 C  CB  . THR A 1 259 ? 25.808 -8.067  10.895  1.00 29.48 ? 409 THR A CB  1 
ATOM   1608 O  OG1 . THR A 1 259 ? 25.555 -9.442  11.143  1.00 31.00 ? 409 THR A OG1 1 
ATOM   1609 C  CG2 . THR A 1 259 ? 24.899 -7.595  9.771   1.00 30.51 ? 409 THR A CG2 1 
ATOM   1610 N  N   . ALA A 1 260 ? 28.444 -7.463  12.630  1.00 27.78 ? 410 ALA A N   1 
ATOM   1611 C  CA  . ALA A 1 260 ? 29.212 -7.811  13.827  1.00 28.24 ? 410 ALA A CA  1 
ATOM   1612 C  C   . ALA A 1 260 ? 28.534 -7.262  15.076  1.00 29.98 ? 410 ALA A C   1 
ATOM   1613 O  O   . ALA A 1 260 ? 27.788 -6.270  15.001  1.00 30.68 ? 410 ALA A O   1 
ATOM   1614 C  CB  . ALA A 1 260 ? 30.615 -7.265  13.715  1.00 27.06 ? 410 ALA A CB  1 
ATOM   1615 N  N   . ALA A 1 261 ? 28.793 -7.921  16.205  1.00 30.37 ? 411 ALA A N   1 
ATOM   1616 C  CA  . ALA A 1 261 ? 28.215 -7.570  17.489  1.00 32.71 ? 411 ALA A CA  1 
ATOM   1617 C  C   . ALA A 1 261 ? 29.212 -7.896  18.601  1.00 34.67 ? 411 ALA A C   1 
ATOM   1618 O  O   . ALA A 1 261 ? 30.261 -8.497  18.325  1.00 32.33 ? 411 ALA A O   1 
ATOM   1619 C  CB  . ALA A 1 261 ? 26.921 -8.367  17.725  1.00 31.79 ? 411 ALA A CB  1 
ATOM   1620 N  N   . ASP A 1 262 ? 28.818 -7.578  19.852  1.00 34.52 ? 412 ASP A N   1 
ATOM   1621 C  CA  . ASP A 1 262 ? 29.594 -7.905  21.063  1.00 38.51 ? 412 ASP A CA  1 
ATOM   1622 C  C   . ASP A 1 262 ? 29.745 -9.387  21.310  1.00 38.83 ? 412 ASP A C   1 
ATOM   1623 O  O   . ASP A 1 262 ? 30.534 -9.791  22.174  1.00 43.59 ? 412 ASP A O   1 
ATOM   1624 C  CB  . ASP A 1 262 ? 28.962 -7.275  22.327  1.00 40.35 ? 412 ASP A CB  1 
ATOM   1625 C  CG  . ASP A 1 262 ? 29.144 -5.788  22.398  1.00 47.16 ? 412 ASP A CG  1 
ATOM   1626 O  OD1 . ASP A 1 262 ? 29.680 -5.195  21.455  1.00 51.44 ? 412 ASP A OD1 1 
ATOM   1627 O  OD2 . ASP A 1 262 ? 28.720 -5.182  23.422  1.00 61.47 ? 412 ASP A OD2 1 
ATOM   1628 N  N   . ASP A 1 263 ? 29.027 -10.218 20.558  1.00 36.83 ? 413 ASP A N   1 
ATOM   1629 C  CA  . ASP A 1 263 ? 29.229 -11.664 20.635  1.00 35.07 ? 413 ASP A CA  1 
ATOM   1630 C  C   . ASP A 1 263 ? 30.515 -12.165 19.946  1.00 31.75 ? 413 ASP A C   1 
ATOM   1631 O  O   . ASP A 1 263 ? 30.735 -13.373 19.847  1.00 28.49 ? 413 ASP A O   1 
ATOM   1632 C  CB  . ASP A 1 263 ? 28.014 -12.410 20.074  1.00 39.21 ? 413 ASP A CB  1 
ATOM   1633 C  CG  . ASP A 1 263 ? 27.719 -12.063 18.626  1.00 39.29 ? 413 ASP A CG  1 
ATOM   1634 O  OD1 . ASP A 1 263 ? 28.651 -11.630 17.864  1.00 35.49 ? 413 ASP A OD1 1 
ATOM   1635 O  OD2 . ASP A 1 263 ? 26.532 -12.262 18.250  1.00 38.98 ? 413 ASP A OD2 1 
ATOM   1636 N  N   . SER A 1 264 ? 31.332 -11.231 19.456  1.00 29.98 ? 414 SER A N   1 
ATOM   1637 C  CA  . SER A 1 264 ? 32.630 -11.519 18.876  1.00 31.40 ? 414 SER A CA  1 
ATOM   1638 C  C   . SER A 1 264 ? 32.525 -12.361 17.570  1.00 32.45 ? 414 SER A C   1 
ATOM   1639 O  O   . SER A 1 264 ? 33.449 -13.099 17.209  1.00 33.41 ? 414 SER A O   1 
ATOM   1640 C  CB  . SER A 1 264 ? 33.571 -12.160 19.918  1.00 32.30 ? 414 SER A CB  1 
ATOM   1641 O  OG  . SER A 1 264 ? 33.726 -11.276 21.086  1.00 32.23 ? 414 SER A OG  1 
ATOM   1642 N  N   . SER A 1 265 ? 31.395 -12.210 16.874  1.00 31.81 ? 415 SER A N   1 
ATOM   1643 C  CA  . SER A 1 265 ? 31.148 -12.906 15.626  1.00 32.16 ? 415 SER A CA  1 
ATOM   1644 C  C   . SER A 1 265 ? 30.910 -11.906 14.489  1.00 29.82 ? 415 SER A C   1 
ATOM   1645 O  O   . SER A 1 265 ? 30.474 -10.793 14.682  1.00 28.31 ? 415 SER A O   1 
ATOM   1646 C  CB  . SER A 1 265 ? 29.991 -13.888 15.737  1.00 33.81 ? 415 SER A CB  1 
ATOM   1647 O  OG  . SER A 1 265 ? 28.722 -13.231 15.722  1.00 32.66 ? 415 SER A OG  1 
ATOM   1648 N  N   . VAL A 1 266 ? 31.222 -12.361 13.303  1.00 29.23 ? 416 VAL A N   1 
ATOM   1649 C  CA  . VAL A 1 266 ? 30.834 -11.714 12.106  1.00 28.09 ? 416 VAL A CA  1 
ATOM   1650 C  C   . VAL A 1 266 ? 29.912 -12.647 11.403  1.00 29.92 ? 416 VAL A C   1 
ATOM   1651 O  O   . VAL A 1 266 ? 30.279 -13.772 11.104  1.00 32.17 ? 416 VAL A O   1 
ATOM   1652 C  CB  . VAL A 1 266 ? 32.041 -11.443 11.212  1.00 29.34 ? 416 VAL A CB  1 
ATOM   1653 C  CG1 . VAL A 1 266 ? 31.579 -10.785 9.917   1.00 28.11 ? 416 VAL A CG1 1 
ATOM   1654 C  CG2 . VAL A 1 266 ? 33.041 -10.585 11.926  1.00 29.95 ? 416 VAL A CG2 1 
ATOM   1655 N  N   . LYS A 1 267 ? 28.704 -12.183 11.125  1.00 30.09 ? 417 LYS A N   1 
ATOM   1656 C  CA  . LYS A 1 267 ? 27.736 -12.988 10.435  1.00 32.19 ? 417 LYS A CA  1 
ATOM   1657 C  C   . LYS A 1 267 ? 27.520 -12.487 9.037   1.00 31.11 ? 417 LYS A C   1 
ATOM   1658 O  O   . LYS A 1 267 ? 27.455 -11.264 8.811   1.00 29.05 ? 417 LYS A O   1 
ATOM   1659 C  CB  . LYS A 1 267 ? 26.422 -12.951 11.160  1.00 32.07 ? 417 LYS A CB  1 
ATOM   1660 C  CG  . LYS A 1 267 ? 26.436 -13.747 12.435  1.00 34.26 ? 417 LYS A CG  1 
ATOM   1661 C  CD  . LYS A 1 267 ? 25.072 -13.763 13.062  1.00 37.82 ? 417 LYS A CD  1 
ATOM   1662 C  CE  . LYS A 1 267 ? 25.004 -14.723 14.236  1.00 41.80 ? 417 LYS A CE  1 
ATOM   1663 N  NZ  . LYS A 1 267 ? 25.052 -16.148 13.840  1.00 43.49 ? 417 LYS A NZ  1 
ATOM   1664 N  N   . LEU A 1 268 ? 27.409 -13.448 8.116   1.00 32.81 ? 418 LEU A N   1 
ATOM   1665 C  CA  . LEU A 1 268 ? 27.199 -13.179 6.727   1.00 35.26 ? 418 LEU A CA  1 
ATOM   1666 C  C   . LEU A 1 268 ? 25.775 -13.558 6.298   1.00 35.31 ? 418 LEU A C   1 
ATOM   1667 O  O   . LEU A 1 268 ? 25.285 -14.649 6.586   1.00 34.83 ? 418 LEU A O   1 
ATOM   1668 C  CB  . LEU A 1 268 ? 28.268 -13.910 5.906   1.00 39.55 ? 418 LEU A CB  1 
ATOM   1669 C  CG  . LEU A 1 268 ? 29.566 -13.127 6.113   1.00 41.93 ? 418 LEU A CG  1 
ATOM   1670 C  CD1 . LEU A 1 268 ? 30.742 -14.032 6.247   1.00 47.05 ? 418 LEU A CD1 1 
ATOM   1671 C  CD2 . LEU A 1 268 ? 29.719 -12.084 5.004   1.00 44.81 ? 418 LEU A CD2 1 
ATOM   1672 N  N   . TRP A 1 269 ? 25.131 -12.609 5.628   1.00 34.61 ? 419 TRP A N   1 
ATOM   1673 C  CA  . TRP A 1 269 ? 23.764 -12.717 5.240   1.00 37.53 ? 419 TRP A CA  1 
ATOM   1674 C  C   . TRP A 1 269 ? 23.677 -12.626 3.708   1.00 40.33 ? 419 TRP A C   1 
ATOM   1675 O  O   . TRP A 1 269 ? 24.322 -11.782 3.072   1.00 37.96 ? 419 TRP A O   1 
ATOM   1676 C  CB  . TRP A 1 269 ? 22.944 -11.593 5.862   1.00 36.92 ? 419 TRP A CB  1 
ATOM   1677 C  CG  . TRP A 1 269 ? 23.067 -11.524 7.384   1.00 37.57 ? 419 TRP A CG  1 
ATOM   1678 C  CD1 . TRP A 1 269 ? 24.035 -10.869 8.092   1.00 36.56 ? 419 TRP A CD1 1 
ATOM   1679 C  CD2 . TRP A 1 269 ? 22.212 -12.148 8.354   1.00 37.90 ? 419 TRP A CD2 1 
ATOM   1680 N  NE1 . TRP A 1 269 ? 23.839 -11.051 9.434   1.00 37.51 ? 419 TRP A NE1 1 
ATOM   1681 C  CE2 . TRP A 1 269 ? 22.720 -11.814 9.628   1.00 37.41 ? 419 TRP A CE2 1 
ATOM   1682 C  CE3 . TRP A 1 269 ? 21.060 -12.941 8.270   1.00 40.92 ? 419 TRP A CE3 1 
ATOM   1683 C  CZ2 . TRP A 1 269 ? 22.116 -12.246 10.817  1.00 38.52 ? 419 TRP A CZ2 1 
ATOM   1684 C  CZ3 . TRP A 1 269 ? 20.448 -13.382 9.462   1.00 41.98 ? 419 TRP A CZ3 1 
ATOM   1685 C  CH2 . TRP A 1 269 ? 20.987 -13.036 10.712  1.00 41.96 ? 419 TRP A CH2 1 
ATOM   1686 N  N   . ASP A 1 270 ? 22.901 -13.525 3.144   1.00 40.24 ? 420 ASP A N   1 
ATOM   1687 C  CA  . ASP A 1 270 ? 22.479 -13.437 1.768   1.00 42.90 ? 420 ASP A CA  1 
ATOM   1688 C  C   . ASP A 1 270 ? 21.114 -12.758 1.741   1.00 40.85 ? 420 ASP A C   1 
ATOM   1689 O  O   . ASP A 1 270 ? 20.129 -13.270 2.261   1.00 42.28 ? 420 ASP A O   1 
ATOM   1690 C  CB  . ASP A 1 270 ? 22.438 -14.843 1.138   1.00 44.85 ? 420 ASP A CB  1 
ATOM   1691 C  CG  . ASP A 1 270 ? 22.178 -14.815 -0.370  1.00 49.59 ? 420 ASP A CG  1 
ATOM   1692 O  OD1 . ASP A 1 270 ? 21.435 -13.918 -0.837  1.00 49.51 ? 420 ASP A OD1 1 
ATOM   1693 O  OD2 . ASP A 1 270 ? 22.695 -15.727 -1.087  1.00 53.74 ? 420 ASP A OD2 1 
ATOM   1694 N  N   . LEU A 1 271 ? 21.067 -11.592 1.131   1.00 40.76 ? 421 LEU A N   1 
ATOM   1695 C  CA  . LEU A 1 271 ? 19.848 -10.790 1.111   1.00 42.10 ? 421 LEU A CA  1 
ATOM   1696 C  C   . LEU A 1 271 ? 18.774 -11.352 0.183   1.00 46.88 ? 421 LEU A C   1 
ATOM   1697 O  O   . LEU A 1 271 ? 17.633 -10.933 0.244   1.00 47.85 ? 421 LEU A O   1 
ATOM   1698 C  CB  . LEU A 1 271 ? 20.166 -9.356  0.740   1.00 41.09 ? 421 LEU A CB  1 
ATOM   1699 C  CG  . LEU A 1 271 ? 21.153 -8.690  1.707   1.00 38.22 ? 421 LEU A CG  1 
ATOM   1700 C  CD1 . LEU A 1 271 ? 21.720 -7.415  1.112   1.00 37.42 ? 421 LEU A CD1 1 
ATOM   1701 C  CD2 . LEU A 1 271 ? 20.487 -8.421  3.057   1.00 40.03 ? 421 LEU A CD2 1 
ATOM   1702 N  N   . ARG A 1 272 ? 19.136 -12.291 -0.674  1.00 50.19 ? 422 ARG A N   1 
ATOM   1703 C  CA  . ARG A 1 272 ? 18.156 -12.899 -1.576  1.00 55.00 ? 422 ARG A CA  1 
ATOM   1704 C  C   . ARG A 1 272 ? 17.351 -13.963 -0.826  1.00 55.63 ? 422 ARG A C   1 
ATOM   1705 O  O   . ARG A 1 272 ? 16.166 -14.184 -1.109  1.00 57.28 ? 422 ARG A O   1 
ATOM   1706 C  CB  . ARG A 1 272 ? 18.864 -13.514 -2.801  1.00 57.64 ? 422 ARG A CB  1 
ATOM   1707 C  CG  . ARG A 1 272 ? 19.687 -12.510 -3.614  1.00 58.75 ? 422 ARG A CG  1 
ATOM   1708 C  CD  . ARG A 1 272 ? 20.664 -13.187 -4.573  1.00 63.75 ? 422 ARG A CD  1 
ATOM   1709 N  NE  . ARG A 1 272 ? 21.661 -14.022 -3.889  1.00 65.92 ? 422 ARG A NE  1 
ATOM   1710 C  CZ  . ARG A 1 272 ? 22.653 -14.676 -4.500  1.00 69.58 ? 422 ARG A CZ  1 
ATOM   1711 N  NH1 . ARG A 1 272 ? 22.798 -14.601 -5.822  1.00 72.17 ? 422 ARG A NH1 1 
ATOM   1712 N  NH2 . ARG A 1 272 ? 23.506 -15.413 -3.789  1.00 69.56 ? 422 ARG A NH2 1 
ATOM   1713 N  N   . LYS A 1 273 ? 18.007 -14.636 0.111   1.00 51.69 ? 423 LYS A N   1 
ATOM   1714 C  CA  . LYS A 1 273 ? 17.382 -15.673 0.899   1.00 55.12 ? 423 LYS A CA  1 
ATOM   1715 C  C   . LYS A 1 273 ? 16.992 -15.186 2.281   1.00 55.28 ? 423 LYS A C   1 
ATOM   1716 O  O   . LYS A 1 273 ? 16.223 -15.856 2.974   1.00 54.45 ? 423 LYS A O   1 
ATOM   1717 C  CB  . LYS A 1 273 ? 18.338 -16.820 1.075   1.00 57.09 ? 423 LYS A CB  1 
ATOM   1718 C  CG  . LYS A 1 273 ? 18.785 -17.490 -0.201  1.00 62.07 ? 423 LYS A CG  1 
ATOM   1719 C  CD  . LYS A 1 273 ? 20.082 -18.216 0.081   1.00 62.75 ? 423 LYS A CD  1 
ATOM   1720 C  CE  . LYS A 1 273 ? 20.388 -19.264 -0.961  1.00 65.40 ? 423 LYS A CE  1 
ATOM   1721 N  NZ  . LYS A 1 273 ? 21.770 -19.794 -0.720  1.00 64.07 ? 423 LYS A NZ  1 
ATOM   1722 N  N   . LEU A 1 274 ? 17.538 -14.037 2.692   1.00 53.38 ? 424 LEU A N   1 
ATOM   1723 C  CA  . LEU A 1 274 ? 17.380 -13.540 4.054   1.00 53.17 ? 424 LEU A CA  1 
ATOM   1724 C  C   . LEU A 1 274 ? 17.858 -14.595 5.056   1.00 53.09 ? 424 LEU A C   1 
ATOM   1725 O  O   . LEU A 1 274 ? 17.156 -14.920 6.008   1.00 55.94 ? 424 LEU A O   1 
ATOM   1726 C  CB  . LEU A 1 274 ? 15.917 -13.157 4.329   1.00 55.89 ? 424 LEU A CB  1 
ATOM   1727 C  CG  . LEU A 1 274 ? 15.245 -12.160 3.375   1.00 56.28 ? 424 LEU A CG  1 
ATOM   1728 C  CD1 . LEU A 1 274 ? 13.905 -11.768 3.953   1.00 58.46 ? 424 LEU A CD1 1 
ATOM   1729 C  CD2 . LEU A 1 274 ? 16.085 -10.918 3.134   1.00 55.79 ? 424 LEU A CD2 1 
ATOM   1730 N  N   . LYS A 1 275 ? 19.041 -15.152 4.819   1.00 51.50 ? 425 LYS A N   1 
ATOM   1731 C  CA  . LYS A 1 275 ? 19.579 -16.161 5.714   1.00 50.31 ? 425 LYS A CA  1 
ATOM   1732 C  C   . LYS A 1 275 ? 21.042 -15.893 6.066   1.00 48.43 ? 425 LYS A C   1 
ATOM   1733 O  O   . LYS A 1 275 ? 21.822 -15.333 5.275   1.00 43.77 ? 425 LYS A O   1 
ATOM   1734 C  CB  . LYS A 1 275 ? 19.385 -17.581 5.146   1.00 56.10 ? 425 LYS A CB  1 
ATOM   1735 C  CG  . LYS A 1 275 ? 20.413 -18.014 4.113   1.00 59.20 ? 425 LYS A CG  1 
ATOM   1736 N  N   . ASN A 1 276 ? 21.394 -16.292 7.276   1.00 46.69 ? 426 ASN A N   1 
ATOM   1737 C  CA  . ASN A 1 276 ? 22.739 -16.188 7.769   1.00 44.50 ? 426 ASN A CA  1 
ATOM   1738 C  C   . ASN A 1 276 ? 23.445 -17.465 7.360   1.00 44.00 ? 426 ASN A C   1 
ATOM   1739 O  O   . ASN A 1 276 ? 23.231 -18.505 7.968   1.00 47.27 ? 426 ASN A O   1 
ATOM   1740 C  CB  . ASN A 1 276 ? 22.711 -16.049 9.290   1.00 42.24 ? 426 ASN A CB  1 
ATOM   1741 C  CG  . ASN A 1 276 ? 24.063 -16.205 9.925   1.00 42.49 ? 426 ASN A CG  1 
ATOM   1742 O  OD1 . ASN A 1 276 ? 24.153 -16.711 11.035  1.00 43.28 ? 426 ASN A OD1 1 
ATOM   1743 N  ND2 . ASN A 1 276 ? 25.134 -15.782 9.226   1.00 39.31 ? 426 ASN A ND2 1 
ATOM   1744 N  N   . PHE A 1 277 ? 24.303 -17.387 6.355   1.00 41.79 ? 427 PHE A N   1 
ATOM   1745 C  CA  . PHE A 1 277 ? 24.867 -18.614 5.750   1.00 44.61 ? 427 PHE A CA  1 
ATOM   1746 C  C   . PHE A 1 277 ? 26.246 -18.971 6.265   1.00 43.92 ? 427 PHE A C   1 
ATOM   1747 O  O   . PHE A 1 277 ? 26.701 -20.076 6.077   1.00 41.82 ? 427 PHE A O   1 
ATOM   1748 C  CB  . PHE A 1 277 ? 24.863 -18.511 4.221   1.00 43.18 ? 427 PHE A CB  1 
ATOM   1749 C  CG  . PHE A 1 277 ? 25.743 -17.444 3.677   1.00 40.72 ? 427 PHE A CG  1 
ATOM   1750 C  CD1 . PHE A 1 277 ? 27.084 -17.688 3.443   1.00 40.60 ? 427 PHE A CD1 1 
ATOM   1751 C  CD2 . PHE A 1 277 ? 25.233 -16.183 3.390   1.00 39.91 ? 427 PHE A CD2 1 
ATOM   1752 C  CE1 . PHE A 1 277 ? 27.907 -16.708 2.929   1.00 38.73 ? 427 PHE A CE1 1 
ATOM   1753 C  CE2 . PHE A 1 277 ? 26.045 -15.203 2.872   1.00 38.65 ? 427 PHE A CE2 1 
ATOM   1754 C  CZ  . PHE A 1 277 ? 27.398 -15.461 2.648   1.00 38.85 ? 427 PHE A CZ  1 
ATOM   1755 N  N   . LYS A 1 278 ? 26.897 -18.032 6.936   1.00 39.43 ? 428 LYS A N   1 
ATOM   1756 C  CA  . LYS A 1 278 ? 28.210 -18.253 7.465   1.00 40.73 ? 428 LYS A CA  1 
ATOM   1757 C  C   . LYS A 1 278 ? 28.402 -17.330 8.658   1.00 37.18 ? 428 LYS A C   1 
ATOM   1758 O  O   . LYS A 1 278 ? 27.937 -16.212 8.635   1.00 37.07 ? 428 LYS A O   1 
ATOM   1759 C  CB  . LYS A 1 278 ? 29.226 -17.873 6.386   1.00 43.95 ? 428 LYS A CB  1 
ATOM   1760 C  CG  . LYS A 1 278 ? 30.658 -17.968 6.806   1.00 48.30 ? 428 LYS A CG  1 
ATOM   1761 C  CD  . LYS A 1 278 ? 31.121 -19.399 6.867   1.00 51.95 ? 428 LYS A CD  1 
ATOM   1762 C  CE  . LYS A 1 278 ? 32.508 -19.450 7.480   1.00 53.64 ? 428 LYS A CE  1 
ATOM   1763 N  NZ  . LYS A 1 278 ? 32.865 -20.831 7.902   1.00 54.28 ? 428 LYS A NZ  1 
ATOM   1764 N  N   . THR A 1 279 ? 29.092 -17.810 9.681   1.00 35.76 ? 429 THR A N   1 
ATOM   1765 C  CA  . THR A 1 279 ? 29.440 -17.006 10.832  1.00 34.71 ? 429 THR A CA  1 
ATOM   1766 C  C   . THR A 1 279 ? 30.898 -17.225 11.143  1.00 34.57 ? 429 THR A C   1 
ATOM   1767 O  O   . THR A 1 279 ? 31.317 -18.374 11.275  1.00 36.10 ? 429 THR A O   1 
ATOM   1768 C  CB  . THR A 1 279 ? 28.605 -17.435 12.054  1.00 34.26 ? 429 THR A CB  1 
ATOM   1769 O  OG1 . THR A 1 279 ? 27.217 -17.192 11.777  1.00 34.95 ? 429 THR A OG1 1 
ATOM   1770 C  CG2 . THR A 1 279 ? 29.056 -16.650 13.344  1.00 33.91 ? 429 THR A CG2 1 
ATOM   1771 N  N   . LEU A 1 280 ? 31.669 -16.145 11.237  1.00 32.91 ? 430 LEU A N   1 
ATOM   1772 C  CA  . LEU A 1 280 ? 33.061 -16.233 11.657  1.00 35.19 ? 430 LEU A CA  1 
ATOM   1773 C  C   . LEU A 1 280 ? 33.050 -15.939 13.142  1.00 33.84 ? 430 LEU A C   1 
ATOM   1774 O  O   . LEU A 1 280 ? 32.695 -14.831 13.551  1.00 35.89 ? 430 LEU A O   1 
ATOM   1775 C  CB  . LEU A 1 280 ? 33.944 -15.224 10.932  1.00 34.52 ? 430 LEU A CB  1 
ATOM   1776 C  CG  . LEU A 1 280 ? 33.698 -15.071 9.417   1.00 40.15 ? 430 LEU A CG  1 
ATOM   1777 C  CD1 . LEU A 1 280 ? 34.533 -13.929 8.844   1.00 41.07 ? 430 LEU A CD1 1 
ATOM   1778 C  CD2 . LEU A 1 280 ? 34.024 -16.382 8.697   1.00 44.01 ? 430 LEU A CD2 1 
ATOM   1779 N  N   . GLN A 1 281 ? 33.382 -16.924 13.944  1.00 34.06 ? 431 GLN A N   1 
ATOM   1780 C  CA  . GLN A 1 281 ? 33.324 -16.749 15.408  1.00 37.05 ? 431 GLN A CA  1 
ATOM   1781 C  C   . GLN A 1 281 ? 34.730 -16.513 15.905  1.00 35.59 ? 431 GLN A C   1 
ATOM   1782 O  O   . GLN A 1 281 ? 35.554 -17.409 15.844  1.00 34.42 ? 431 GLN A O   1 
ATOM   1783 C  CB  . GLN A 1 281 ? 32.738 -17.990 16.110  1.00 38.12 ? 431 GLN A CB  1 
ATOM   1784 C  CG  . GLN A 1 281 ? 32.613 -17.849 17.635  1.00 38.78 ? 431 GLN A CG  1 
ATOM   1785 C  CD  . GLN A 1 281 ? 31.637 -16.746 18.043  1.00 38.39 ? 431 GLN A CD  1 
ATOM   1786 O  OE1 . GLN A 1 281 ? 30.449 -16.908 17.905  1.00 41.38 ? 431 GLN A OE1 1 
ATOM   1787 N  NE2 . GLN A 1 281 ? 32.140 -15.640 18.554  1.00 34.48 ? 431 GLN A NE2 1 
ATOM   1788 N  N   . LEU A 1 282 ? 34.986 -15.315 16.390  1.00 37.79 ? 432 LEU A N   1 
ATOM   1789 C  CA  . LEU A 1 282 ? 36.257 -15.017 17.074  1.00 38.56 ? 432 LEU A CA  1 
ATOM   1790 C  C   . LEU A 1 282 ? 36.109 -15.278 18.578  1.00 38.21 ? 432 LEU A C   1 
ATOM   1791 O  O   . LEU A 1 282 ? 34.992 -15.537 19.068  1.00 37.65 ? 432 LEU A O   1 
ATOM   1792 C  CB  . LEU A 1 282 ? 36.679 -13.577 16.767  1.00 36.15 ? 432 LEU A CB  1 
ATOM   1793 C  CG  . LEU A 1 282 ? 36.802 -13.335 15.253  1.00 36.39 ? 432 LEU A CG  1 
ATOM   1794 C  CD1 . LEU A 1 282 ? 37.096 -11.894 14.944  1.00 38.76 ? 432 LEU A CD1 1 
ATOM   1795 C  CD2 . LEU A 1 282 ? 37.881 -14.212 14.678  1.00 40.58 ? 432 LEU A CD2 1 
ATOM   1796 N  N   . ASP A 1 283 ? 37.228 -15.255 19.307  1.00 36.19 ? 433 ASP A N   1 
ATOM   1797 C  CA  . ASP A 1 283 ? 37.200 -15.429 20.749  1.00 36.74 ? 433 ASP A CA  1 
ATOM   1798 C  C   . ASP A 1 283 ? 36.396 -14.335 21.440  1.00 34.70 ? 433 ASP A C   1 
ATOM   1799 O  O   . ASP A 1 283 ? 36.204 -13.245 20.907  1.00 34.98 ? 433 ASP A O   1 
ATOM   1800 C  CB  . ASP A 1 283 ? 38.616 -15.580 21.321  1.00 38.01 ? 433 ASP A CB  1 
ATOM   1801 C  CG  . ASP A 1 283 ? 39.411 -14.318 21.245  1.00 40.57 ? 433 ASP A CG  1 
ATOM   1802 O  OD1 . ASP A 1 283 ? 39.118 -13.421 22.061  1.00 39.94 ? 433 ASP A OD1 1 
ATOM   1803 O  OD2 . ASP A 1 283 ? 40.321 -14.209 20.344  1.00 38.97 ? 433 ASP A OD2 1 
ATOM   1804 N  N   . ASN A 1 284 ? 35.900 -14.649 22.628  1.00 33.66 ? 434 ASN A N   1 
ATOM   1805 C  CA  . ASN A 1 284 ? 34.868 -13.814 23.279  1.00 33.59 ? 434 ASN A CA  1 
ATOM   1806 C  C   . ASN A 1 284 ? 35.430 -12.525 23.815  1.00 33.62 ? 434 ASN A C   1 
ATOM   1807 O  O   . ASN A 1 284 ? 34.687 -11.544 24.076  1.00 35.97 ? 434 ASN A O   1 
ATOM   1808 C  CB  . ASN A 1 284 ? 34.143 -14.621 24.364  1.00 36.10 ? 434 ASN A CB  1 
ATOM   1809 C  CG  . ASN A 1 284 ? 34.826 -14.549 25.740  1.00 38.14 ? 434 ASN A CG  1 
ATOM   1810 O  OD1 . ASN A 1 284 ? 34.511 -13.641 26.596  1.00 32.26 ? 434 ASN A OD1 1 
ATOM   1811 N  ND2 . ASN A 1 284 ? 35.696 -15.516 26.001  1.00 36.71 ? 434 ASN A ND2 1 
ATOM   1812 N  N   . ASN A 1 285 ? 36.749 -12.484 23.938  1.00 34.06 ? 435 ASN A N   1 
ATOM   1813 C  CA  . ASN A 1 285 ? 37.466 -11.194 24.212  1.00 34.68 ? 435 ASN A CA  1 
ATOM   1814 C  C   . ASN A 1 285 ? 37.565 -10.228 23.037  1.00 30.54 ? 435 ASN A C   1 
ATOM   1815 O  O   . ASN A 1 285 ? 37.789 -9.026  23.213  1.00 30.78 ? 435 ASN A O   1 
ATOM   1816 C  CB  . ASN A 1 285 ? 38.879 -11.526 24.683  1.00 33.57 ? 435 ASN A CB  1 
ATOM   1817 C  CG  . ASN A 1 285 ? 38.870 -12.520 25.779  1.00 38.22 ? 435 ASN A CG  1 
ATOM   1818 O  OD1 . ASN A 1 285 ? 39.110 -13.717 25.569  1.00 39.97 ? 435 ASN A OD1 1 
ATOM   1819 N  ND2 . ASN A 1 285 ? 38.498 -12.067 26.958  1.00 35.97 ? 435 ASN A ND2 1 
ATOM   1820 N  N   . PHE A 1 286 ? 37.394 -10.730 21.832  1.00 31.79 ? 436 PHE A N   1 
ATOM   1821 C  CA  . PHE A 1 286 ? 37.629 -9.923  20.626  1.00 29.75 ? 436 PHE A CA  1 
ATOM   1822 C  C   . PHE A 1 286 ? 36.494 -8.942  20.389  1.00 32.13 ? 436 PHE A C   1 
ATOM   1823 O  O   . PHE A 1 286 ? 35.345 -9.308  20.454  1.00 33.36 ? 436 PHE A O   1 
ATOM   1824 C  CB  . PHE A 1 286 ? 37.759 -10.857 19.404  1.00 28.95 ? 436 PHE A CB  1 
ATOM   1825 C  CG  . PHE A 1 286 ? 38.469 -10.246 18.234  1.00 26.33 ? 436 PHE A CG  1 
ATOM   1826 C  CD1 . PHE A 1 286 ? 37.847 -9.283  17.422  1.00 25.49 ? 436 PHE A CD1 1 
ATOM   1827 C  CD2 . PHE A 1 286 ? 39.778 -10.633 17.924  1.00 27.01 ? 436 PHE A CD2 1 
ATOM   1828 C  CE1 . PHE A 1 286 ? 38.516 -8.708  16.337  1.00 26.79 ? 436 PHE A CE1 1 
ATOM   1829 C  CE2 . PHE A 1 286 ? 40.437 -10.070 16.816  1.00 25.73 ? 436 PHE A CE2 1 
ATOM   1830 C  CZ  . PHE A 1 286 ? 39.813 -9.123  16.037  1.00 25.37 ? 436 PHE A CZ  1 
ATOM   1831 N  N   . GLU A 1 287 ? 36.846 -7.688  20.146  1.00 29.65 ? 437 GLU A N   1 
ATOM   1832 C  CA  . GLU A 1 287 ? 35.917 -6.633  19.788  1.00 30.44 ? 437 GLU A CA  1 
ATOM   1833 C  C   . GLU A 1 287 ? 35.995 -6.344  18.286  1.00 28.45 ? 437 GLU A C   1 
ATOM   1834 O  O   . GLU A 1 287 ? 37.041 -5.962  17.764  1.00 25.98 ? 437 GLU A O   1 
ATOM   1835 C  CB  . GLU A 1 287 ? 36.222 -5.375  20.601  1.00 32.54 ? 437 GLU A CB  1 
ATOM   1836 C  CG  . GLU A 1 287 ? 36.207 -5.618  22.094  1.00 38.78 ? 437 GLU A CG  1 
ATOM   1837 C  CD  . GLU A 1 287 ? 36.739 -4.418  22.839  1.00 44.56 ? 437 GLU A CD  1 
ATOM   1838 O  OE1 . GLU A 1 287 ? 36.163 -3.358  22.659  1.00 46.31 ? 437 GLU A OE1 1 
ATOM   1839 O  OE2 . GLU A 1 287 ? 37.757 -4.539  23.541  1.00 54.45 ? 437 GLU A OE2 1 
ATOM   1840 N  N   . VAL A 1 288 ? 34.888 -6.559  17.589  1.00 30.21 ? 438 VAL A N   1 
ATOM   1841 C  CA  . VAL A 1 288 ? 34.782 -6.200  16.150  1.00 29.18 ? 438 VAL A CA  1 
ATOM   1842 C  C   . VAL A 1 288 ? 34.113 -4.833  16.076  1.00 35.33 ? 438 VAL A C   1 
ATOM   1843 O  O   . VAL A 1 288 ? 32.947 -4.678  16.440  1.00 36.52 ? 438 VAL A O   1 
ATOM   1844 C  CB  . VAL A 1 288 ? 33.977 -7.222  15.340  1.00 30.85 ? 438 VAL A CB  1 
ATOM   1845 C  CG1 . VAL A 1 288 ? 33.930 -6.820  13.842  1.00 32.39 ? 438 VAL A CG1 1 
ATOM   1846 C  CG2 . VAL A 1 288 ? 34.527 -8.596  15.512  1.00 32.59 ? 438 VAL A CG2 1 
ATOM   1847 N  N   . LYS A 1 289 ? 34.869 -3.837  15.695  1.00 32.48 ? 439 LYS A N   1 
ATOM   1848 C  CA  . LYS A 1 289 ? 34.399 -2.434  15.747  1.00 40.52 ? 439 LYS A CA  1 
ATOM   1849 C  C   . LYS A 1 289 ? 34.061 -1.867  14.369  1.00 38.29 ? 439 LYS A C   1 
ATOM   1850 O  O   . LYS A 1 289 ? 33.271 -0.876  14.263  1.00 33.73 ? 439 LYS A O   1 
ATOM   1851 C  CB  . LYS A 1 289 ? 35.440 -1.518  16.403  1.00 40.05 ? 439 LYS A CB  1 
ATOM   1852 C  CG  . LYS A 1 289 ? 35.506 -1.623  17.926  1.00 44.44 ? 439 LYS A CG  1 
ATOM   1853 N  N   . SER A 1 290 ? 34.630 -2.477  13.317  1.00 32.68 ? 440 SER A N   1 
ATOM   1854 C  CA  . SER A 1 290 ? 34.546 -1.921  11.959  1.00 31.18 ? 440 SER A CA  1 
ATOM   1855 C  C   . SER A 1 290 ? 34.561 -3.108  10.972  1.00 31.38 ? 440 SER A C   1 
ATOM   1856 O  O   . SER A 1 290 ? 35.335 -4.059  11.179  1.00 34.97 ? 440 SER A O   1 
ATOM   1857 C  CB  . SER A 1 290 ? 35.748 -1.009  11.746  1.00 33.63 ? 440 SER A CB  1 
ATOM   1858 O  OG  . SER A 1 290 ? 35.822 -0.454  10.453  1.00 37.99 ? 440 SER A OG  1 
ATOM   1859 N  N   . LEU A 1 291 ? 33.677 -3.086  9.988   1.00 25.78 ? 441 LEU A N   1 
ATOM   1860 C  CA  . LEU A 1 291 ? 33.629 -4.075  8.905   1.00 24.24 ? 441 LEU A CA  1 
ATOM   1861 C  C   . LEU A 1 291 ? 33.569 -3.297  7.587   1.00 26.07 ? 441 LEU A C   1 
ATOM   1862 O  O   . LEU A 1 291 ? 32.858 -2.259  7.477   1.00 22.48 ? 441 LEU A O   1 
ATOM   1863 C  CB  . LEU A 1 291 ? 32.373 -4.951  8.958   1.00 27.68 ? 441 LEU A CB  1 
ATOM   1864 C  CG  . LEU A 1 291 ? 32.155 -6.035  9.972   1.00 28.99 ? 441 LEU A CG  1 
ATOM   1865 C  CD1 . LEU A 1 291 ? 30.761 -6.636  9.786   1.00 30.03 ? 441 LEU A CD1 1 
ATOM   1866 C  CD2 . LEU A 1 291 ? 33.195 -7.114  9.852   1.00 31.13 ? 441 LEU A CD2 1 
ATOM   1867 N  N   . ILE A 1 292 ? 34.260 -3.798  6.589   1.00 24.66 ? 442 ILE A N   1 
ATOM   1868 C  CA  . ILE A 1 292 ? 34.166 -3.259  5.243   1.00 26.56 ? 442 ILE A CA  1 
ATOM   1869 C  C   . ILE A 1 292 ? 34.603 -4.292  4.175   1.00 27.13 ? 442 ILE A C   1 
ATOM   1870 O  O   . ILE A 1 292 ? 35.610 -4.961  4.341   1.00 29.04 ? 442 ILE A O   1 
ATOM   1871 C  CB  . ILE A 1 292 ? 35.016 -1.966  5.110   1.00 27.60 ? 442 ILE A CB  1 
ATOM   1872 C  CG1 . ILE A 1 292 ? 34.739 -1.224  3.819   1.00 28.89 ? 442 ILE A CG1 1 
ATOM   1873 C  CG2 . ILE A 1 292 ? 36.476 -2.259  5.287   1.00 29.65 ? 442 ILE A CG2 1 
ATOM   1874 C  CD1 . ILE A 1 292 ? 35.369 0.183   3.742   1.00 30.08 ? 442 ILE A CD1 1 
ATOM   1875 N  N   . PHE A 1 293 ? 33.853 -4.371  3.090   1.00 28.40 ? 443 PHE A N   1 
ATOM   1876 C  CA  . PHE A 1 293 ? 34.253 -5.174  1.927   1.00 27.63 ? 443 PHE A CA  1 
ATOM   1877 C  C   . PHE A 1 293 ? 35.143 -4.283  1.068   1.00 27.70 ? 443 PHE A C   1 
ATOM   1878 O  O   . PHE A 1 293 ? 34.969 -3.060  1.072   1.00 32.90 ? 443 PHE A O   1 
ATOM   1879 C  CB  . PHE A 1 293 ? 33.039 -5.599  1.097   1.00 29.65 ? 443 PHE A CB  1 
ATOM   1880 C  CG  . PHE A 1 293 ? 32.174 -6.642  1.763   1.00 29.10 ? 443 PHE A CG  1 
ATOM   1881 C  CD1 . PHE A 1 293 ? 32.445 -8.000  1.599   1.00 29.20 ? 443 PHE A CD1 1 
ATOM   1882 C  CD2 . PHE A 1 293 ? 31.096 -6.269  2.551   1.00 29.11 ? 443 PHE A CD2 1 
ATOM   1883 C  CE1 . PHE A 1 293 ? 31.653 -8.966  2.196   1.00 30.86 ? 443 PHE A CE1 1 
ATOM   1884 C  CE2 . PHE A 1 293 ? 30.288 -7.249  3.161   1.00 31.37 ? 443 PHE A CE2 1 
ATOM   1885 C  CZ  . PHE A 1 293 ? 30.569 -8.587  2.973   1.00 30.78 ? 443 PHE A CZ  1 
ATOM   1886 N  N   . ASP A 1 294 ? 36.069 -4.853  0.317   1.00 27.03 ? 444 ASP A N   1 
ATOM   1887 C  CA  . ASP A 1 294 ? 36.766 -4.053  -0.694  1.00 27.91 ? 444 ASP A CA  1 
ATOM   1888 C  C   . ASP A 1 294 ? 35.762 -3.768  -1.809  1.00 31.27 ? 444 ASP A C   1 
ATOM   1889 O  O   . ASP A 1 294 ? 34.648 -4.333  -1.836  1.00 30.51 ? 444 ASP A O   1 
ATOM   1890 C  CB  . ASP A 1 294 ? 38.027 -4.755  -1.232  1.00 28.08 ? 444 ASP A CB  1 
ATOM   1891 C  CG  . ASP A 1 294 ? 37.714 -5.752  -2.334  1.00 29.89 ? 444 ASP A CG  1 
ATOM   1892 O  OD1 . ASP A 1 294 ? 36.932 -6.700  -2.093  1.00 31.61 ? 444 ASP A OD1 1 
ATOM   1893 O  OD2 . ASP A 1 294 ? 38.233 -5.598  -3.471  1.00 31.54 ? 444 ASP A OD2 1 
ATOM   1894 N  N   . GLN A 1 295 ? 36.181 -2.906  -2.729  1.00 31.52 ? 445 GLN A N   1 
ATOM   1895 C  CA  . GLN A 1 295 ? 35.302 -2.360  -3.757  1.00 35.81 ? 445 GLN A CA  1 
ATOM   1896 C  C   . GLN A 1 295 ? 34.792 -3.443  -4.696  1.00 34.94 ? 445 GLN A C   1 
ATOM   1897 O  O   . GLN A 1 295 ? 33.690 -3.336  -5.208  1.00 38.58 ? 445 GLN A O   1 
ATOM   1898 C  CB  . GLN A 1 295 ? 36.030 -1.225  -4.527  1.00 34.70 ? 445 GLN A CB  1 
ATOM   1899 C  CG  . GLN A 1 295 ? 36.496 -0.048  -3.634  1.00 37.71 ? 445 GLN A CG  1 
ATOM   1900 C  CD  . GLN A 1 295 ? 37.900 -0.225  -2.950  1.00 36.64 ? 445 GLN A CD  1 
ATOM   1901 O  OE1 . GLN A 1 295 ? 38.466 -1.332  -2.894  1.00 32.83 ? 445 GLN A OE1 1 
ATOM   1902 N  NE2 . GLN A 1 295 ? 38.470 0.916   -2.462  1.00 36.42 ? 445 GLN A NE2 1 
ATOM   1903 N  N   . SER A 1 296 ? 35.601 -4.494  -4.922  1.00 34.59 ? 446 SER A N   1 
ATOM   1904 C  CA  . SER A 1 296 ? 35.238 -5.612  -5.806  1.00 34.83 ? 446 SER A CA  1 
ATOM   1905 C  C   . SER A 1 296 ? 34.360 -6.691  -5.149  1.00 34.81 ? 446 SER A C   1 
ATOM   1906 O  O   . SER A 1 296 ? 33.834 -7.567  -5.837  1.00 34.11 ? 446 SER A O   1 
ATOM   1907 C  CB  . SER A 1 296 ? 36.507 -6.314  -6.309  1.00 37.37 ? 446 SER A CB  1 
ATOM   1908 O  OG  . SER A 1 296 ? 37.140 -7.082  -5.271  1.00 36.39 ? 446 SER A OG  1 
ATOM   1909 N  N   . GLY A 1 297 ? 34.266 -6.656  -3.828  1.00 33.89 ? 447 GLY A N   1 
ATOM   1910 C  CA  . GLY A 1 297 ? 33.581 -7.717  -3.044  1.00 34.99 ? 447 GLY A CA  1 
ATOM   1911 C  C   . GLY A 1 297 ? 34.410 -8.977  -2.835  1.00 35.94 ? 447 GLY A C   1 
ATOM   1912 O  O   . GLY A 1 297 ? 33.898 -9.996  -2.389  1.00 38.20 ? 447 GLY A O   1 
ATOM   1913 N  N   . THR A 1 298 ? 35.699 -8.908  -3.136  1.00 34.43 ? 448 THR A N   1 
ATOM   1914 C  CA  . THR A 1 298 ? 36.566 -10.087 -3.094  1.00 34.94 ? 448 THR A CA  1 
ATOM   1915 C  C   . THR A 1 298 ? 37.002 -10.405 -1.654  1.00 30.70 ? 448 THR A C   1 
ATOM   1916 O  O   . THR A 1 298 ? 37.162 -11.578 -1.296  1.00 33.26 ? 448 THR A O   1 
ATOM   1917 C  CB  . THR A 1 298 ? 37.789 -9.848  -4.011  1.00 34.55 ? 448 THR A CB  1 
ATOM   1918 O  OG1 . THR A 1 298 ? 37.300 -9.637  -5.337  1.00 35.53 ? 448 THR A OG1 1 
ATOM   1919 C  CG2 . THR A 1 298 ? 38.791 -11.029 -4.011  1.00 36.32 ? 448 THR A CG2 1 
ATOM   1920 N  N   . TYR A 1 299 ? 37.161 -9.348  -0.864  1.00 31.25 ? 449 TYR A N   1 
ATOM   1921 C  CA  . TYR A 1 299 ? 37.689 -9.377  0.470   1.00 30.16 ? 449 TYR A CA  1 
ATOM   1922 C  C   . TYR A 1 299 ? 36.762 -8.681  1.469   1.00 28.17 ? 449 TYR A C   1 
ATOM   1923 O  O   . TYR A 1 299 ? 36.069 -7.669  1.149   1.00 30.33 ? 449 TYR A O   1 
ATOM   1924 C  CB  . TYR A 1 299 ? 39.025 -8.635  0.522   1.00 29.36 ? 449 TYR A CB  1 
ATOM   1925 C  CG  . TYR A 1 299 ? 40.066 -9.126  -0.466  1.00 29.71 ? 449 TYR A CG  1 
ATOM   1926 C  CD1 . TYR A 1 299 ? 40.644 -10.380 -0.333  1.00 31.08 ? 449 TYR A CD1 1 
ATOM   1927 C  CD2 . TYR A 1 299 ? 40.506 -8.305  -1.513  1.00 32.52 ? 449 TYR A CD2 1 
ATOM   1928 C  CE1 . TYR A 1 299 ? 41.604 -10.823 -1.256  1.00 33.50 ? 449 TYR A CE1 1 
ATOM   1929 C  CE2 . TYR A 1 299 ? 41.465 -8.752  -2.447  1.00 31.58 ? 449 TYR A CE2 1 
ATOM   1930 C  CZ  . TYR A 1 299 ? 42.033 -9.977  -2.285  1.00 33.09 ? 449 TYR A CZ  1 
ATOM   1931 O  OH  . TYR A 1 299 ? 42.978 -10.456 -3.190  1.00 32.87 ? 449 TYR A OH  1 
ATOM   1932 N  N   . LEU A 1 300 ? 36.790 -9.186  2.683   1.00 27.57 ? 450 LEU A N   1 
ATOM   1933 C  CA  . LEU A 1 300 ? 36.141 -8.519  3.831   1.00 26.55 ? 450 LEU A CA  1 
ATOM   1934 C  C   . LEU A 1 300 ? 37.166 -8.265  4.887   1.00 26.95 ? 450 LEU A C   1 
ATOM   1935 O  O   . LEU A 1 300 ? 37.875 -9.187  5.286   1.00 27.05 ? 450 LEU A O   1 
ATOM   1936 C  CB  . LEU A 1 300 ? 35.070 -9.429  4.431   1.00 28.09 ? 450 LEU A CB  1 
ATOM   1937 C  CG  . LEU A 1 300 ? 34.363 -8.932  5.713   1.00 25.87 ? 450 LEU A CG  1 
ATOM   1938 C  CD1 . LEU A 1 300 ? 33.509 -7.713  5.449   1.00 27.43 ? 450 LEU A CD1 1 
ATOM   1939 C  CD2 . LEU A 1 300 ? 33.530 -10.046 6.303   1.00 28.94 ? 450 LEU A CD2 1 
ATOM   1940 N  N   . ALA A 1 301 ? 37.217 -7.024  5.364   1.00 24.70 ? 451 ALA A N   1 
ATOM   1941 C  CA  . ALA A 1 301 ? 38.146 -6.647  6.416   1.00 26.02 ? 451 ALA A CA  1 
ATOM   1942 C  C   . ALA A 1 301 ? 37.353 -6.441  7.668   1.00 27.29 ? 451 ALA A C   1 
ATOM   1943 O  O   . ALA A 1 301 ? 36.234 -5.940  7.628   1.00 26.10 ? 451 ALA A O   1 
ATOM   1944 C  CB  . ALA A 1 301 ? 38.869 -5.354  6.094   1.00 25.60 ? 451 ALA A CB  1 
ATOM   1945 N  N   . LEU A 1 302 ? 37.957 -6.800  8.777   1.00 25.97 ? 452 LEU A N   1 
ATOM   1946 C  CA  . LEU A 1 302 ? 37.445 -6.413  10.082  1.00 25.62 ? 452 LEU A CA  1 
ATOM   1947 C  C   . LEU A 1 302 ? 38.563 -5.754  10.913  1.00 23.77 ? 452 LEU A C   1 
ATOM   1948 O  O   . LEU A 1 302 ? 39.757 -6.001  10.709  1.00 24.96 ? 452 LEU A O   1 
ATOM   1949 C  CB  . LEU A 1 302 ? 36.827 -7.610  10.796  1.00 25.03 ? 452 LEU A CB  1 
ATOM   1950 C  CG  . LEU A 1 302 ? 37.698 -8.773  11.193  1.00 26.60 ? 452 LEU A CG  1 
ATOM   1951 C  CD1 . LEU A 1 302 ? 38.418 -8.505  12.520  1.00 25.74 ? 452 LEU A CD1 1 
ATOM   1952 C  CD2 . LEU A 1 302 ? 36.898 -10.069 11.275  1.00 28.30 ? 452 LEU A CD2 1 
ATOM   1953 N  N   . GLY A 1 303 ? 38.150 -4.883  11.803  1.00 23.29 ? 453 GLY A N   1 
ATOM   1954 C  CA  . GLY A 1 303 ? 39.040 -4.222  12.727  1.00 24.19 ? 453 GLY A CA  1 
ATOM   1955 C  C   . GLY A 1 303 ? 38.393 -3.989  14.070  1.00 28.76 ? 453 GLY A C   1 
ATOM   1956 O  O   . GLY A 1 303 ? 37.192 -3.852  14.174  1.00 36.03 ? 453 GLY A O   1 
ATOM   1957 N  N   . GLY A 1 304 ? 39.220 -3.927  15.087  1.00 28.52 ? 454 GLY A N   1 
ATOM   1958 C  CA  . GLY A 1 304 ? 38.828 -3.702  16.481  1.00 26.95 ? 454 GLY A CA  1 
ATOM   1959 C  C   . GLY A 1 304 ? 40.004 -4.164  17.319  1.00 25.02 ? 454 GLY A C   1 
ATOM   1960 O  O   . GLY A 1 304 ? 41.044 -3.481  17.357  1.00 23.99 ? 454 GLY A O   1 
ATOM   1961 N  N   . THR A 1 305 ? 39.896 -5.355  17.943  1.00 25.15 ? 455 THR A N   1 
ATOM   1962 C  CA  . THR A 1 305 ? 41.026 -5.911  18.696  1.00 25.14 ? 455 THR A CA  1 
ATOM   1963 C  C   . THR A 1 305 ? 42.277 -5.997  17.814  1.00 25.65 ? 455 THR A C   1 
ATOM   1964 O  O   . THR A 1 305 ? 43.362 -5.705  18.275  1.00 24.68 ? 455 THR A O   1 
ATOM   1965 C  CB  . THR A 1 305 ? 40.698 -7.274  19.263  1.00 24.83 ? 455 THR A CB  1 
ATOM   1966 O  OG1 . THR A 1 305 ? 39.605 -7.112  20.186  1.00 26.13 ? 455 THR A OG1 1 
ATOM   1967 C  CG2 . THR A 1 305 ? 41.896 -7.855  20.035  1.00 28.38 ? 455 THR A CG2 1 
ATOM   1968 N  N   . ASP A 1 306 ? 42.106 -6.390  16.550  1.00 25.00 ? 456 ASP A N   1 
ATOM   1969 C  CA  . ASP A 1 306 ? 43.165 -6.212  15.543  1.00 24.40 ? 456 ASP A CA  1 
ATOM   1970 C  C   . ASP A 1 306 ? 42.559 -6.202  14.132  1.00 25.10 ? 456 ASP A C   1 
ATOM   1971 O  O   . ASP A 1 306 ? 41.337 -6.132  13.993  1.00 25.31 ? 456 ASP A O   1 
ATOM   1972 C  CB  . ASP A 1 306 ? 44.293 -7.234  15.762  1.00 25.49 ? 456 ASP A CB  1 
ATOM   1973 C  CG  . ASP A 1 306 ? 43.836 -8.670  15.653  1.00 26.14 ? 456 ASP A CG  1 
ATOM   1974 O  OD1 . ASP A 1 306 ? 42.916 -9.014  14.837  1.00 25.46 ? 456 ASP A OD1 1 
ATOM   1975 O  OD2 . ASP A 1 306 ? 44.409 -9.500  16.372  1.00 30.33 ? 456 ASP A OD2 1 
ATOM   1976 N  N   . VAL A 1 307 ? 43.399 -6.254  13.093  1.00 22.77 ? 457 VAL A N   1 
ATOM   1977 C  CA  . VAL A 1 307 ? 42.932 -6.196  11.741  1.00 25.30 ? 457 VAL A CA  1 
ATOM   1978 C  C   . VAL A 1 307 ? 43.052 -7.573  11.097  1.00 24.40 ? 457 VAL A C   1 
ATOM   1979 O  O   . VAL A 1 307 ? 44.128 -8.196  11.134  1.00 23.11 ? 457 VAL A O   1 
ATOM   1980 C  CB  . VAL A 1 307 ? 43.770 -5.193  10.900  1.00 25.54 ? 457 VAL A CB  1 
ATOM   1981 C  CG1 . VAL A 1 307 ? 43.384 -5.286  9.435   1.00 25.84 ? 457 VAL A CG1 1 
ATOM   1982 C  CG2 . VAL A 1 307 ? 43.570 -3.764  11.427  1.00 25.50 ? 457 VAL A CG2 1 
ATOM   1983 N  N   . GLN A 1 308 ? 41.956 -8.017  10.484  1.00 24.55 ? 458 GLN A N   1 
ATOM   1984 C  CA  . GLN A 1 308 ? 41.927 -9.242  9.734   1.00 23.37 ? 458 GLN A CA  1 
ATOM   1985 C  C   . GLN A 1 308 ? 41.149 -9.093  8.439   1.00 25.18 ? 458 GLN A C   1 
ATOM   1986 O  O   . GLN A 1 308 ? 40.123 -8.388  8.374   1.00 26.13 ? 458 GLN A O   1 
ATOM   1987 C  CB  . GLN A 1 308 ? 41.341 -10.396 10.555  1.00 26.22 ? 458 GLN A CB  1 
ATOM   1988 C  CG  . GLN A 1 308 ? 42.023 -10.631 11.917  1.00 27.50 ? 458 GLN A CG  1 
ATOM   1989 C  CD  . GLN A 1 308 ? 41.324 -11.677 12.784  1.00 29.98 ? 458 GLN A CD  1 
ATOM   1990 O  OE1 . GLN A 1 308 ? 40.656 -12.609 12.281  1.00 29.95 ? 458 GLN A OE1 1 
ATOM   1991 N  NE2 . GLN A 1 308 ? 41.521 -11.572 14.068  1.00 30.22 ? 458 GLN A NE2 1 
ATOM   1992 N  N   . ILE A 1 309 ? 41.628 -9.808  7.417   1.00 26.57 ? 459 ILE A N   1 
ATOM   1993 C  CA  . ILE A 1 309 ? 41.071 -9.765  6.086   1.00 27.16 ? 459 ILE A CA  1 
ATOM   1994 C  C   . ILE A 1 309 ? 40.834 -11.202 5.658   1.00 26.90 ? 459 ILE A C   1 
ATOM   1995 O  O   . ILE A 1 309 ? 41.758 -12.072 5.760   1.00 26.18 ? 459 ILE A O   1 
ATOM   1996 C  CB  . ILE A 1 309 ? 42.040 -9.133  5.025   1.00 27.45 ? 459 ILE A CB  1 
ATOM   1997 C  CG1 . ILE A 1 309 ? 42.740 -7.840  5.542   1.00 30.11 ? 459 ILE A CG1 1 
ATOM   1998 C  CG2 . ILE A 1 309 ? 41.307 -8.900  3.672   1.00 29.08 ? 459 ILE A CG2 1 
ATOM   1999 C  CD1 . ILE A 1 309 ? 41.885 -6.640  5.655   1.00 30.12 ? 459 ILE A CD1 1 
ATOM   2000 N  N   . TYR A 1 310 ? 39.629 -11.429 5.152   1.00 25.72 ? 460 TYR A N   1 
ATOM   2001 C  CA  . TYR A 1 310 ? 39.175 -12.724 4.702   1.00 27.56 ? 460 TYR A CA  1 
ATOM   2002 C  C   . TYR A 1 310 ? 38.856 -12.651 3.198   1.00 28.29 ? 460 TYR A C   1 
ATOM   2003 O  O   . TYR A 1 310 ? 38.389 -11.602 2.661   1.00 26.91 ? 460 TYR A O   1 
ATOM   2004 C  CB  . TYR A 1 310 ? 37.907 -13.184 5.506   1.00 31.61 ? 460 TYR A CB  1 
ATOM   2005 C  CG  . TYR A 1 310 ? 38.247 -13.595 6.919   1.00 34.49 ? 460 TYR A CG  1 
ATOM   2006 C  CD1 . TYR A 1 310 ? 38.475 -12.620 7.868   1.00 35.99 ? 460 TYR A CD1 1 
ATOM   2007 C  CD2 . TYR A 1 310 ? 38.335 -14.960 7.323   1.00 38.66 ? 460 TYR A CD2 1 
ATOM   2008 C  CE1 . TYR A 1 310 ? 38.820 -12.940 9.160   1.00 37.41 ? 460 TYR A CE1 1 
ATOM   2009 C  CE2 . TYR A 1 310 ? 38.679 -15.291 8.675   1.00 39.37 ? 460 TYR A CE2 1 
ATOM   2010 C  CZ  . TYR A 1 310 ? 38.916 -14.242 9.566   1.00 38.90 ? 460 TYR A CZ  1 
ATOM   2011 O  OH  . TYR A 1 310 ? 39.271 -14.420 10.915  1.00 45.43 ? 460 TYR A OH  1 
ATOM   2012 N  N   . ILE A 1 311 ? 39.087 -13.775 2.538   1.00 28.23 ? 461 ILE A N   1 
ATOM   2013 C  CA  . ILE A 1 311 ? 38.643 -13.962 1.175   1.00 33.04 ? 461 ILE A CA  1 
ATOM   2014 C  C   . ILE A 1 311 ? 37.192 -14.394 1.226   1.00 31.02 ? 461 ILE A C   1 
ATOM   2015 O  O   . ILE A 1 311 ? 36.885 -15.414 1.802   1.00 34.51 ? 461 ILE A O   1 
ATOM   2016 C  CB  . ILE A 1 311 ? 39.444 -15.055 0.438   1.00 34.80 ? 461 ILE A CB  1 
ATOM   2017 C  CG1 A ILE A 1 311 ? 40.941 -14.911 0.652   0.50 39.16 ? 461 ILE A CG1 1 
ATOM   2018 C  CG1 B ILE A 1 311 ? 40.962 -14.797 0.581   0.50 36.31 ? 461 ILE A CG1 1 
ATOM   2019 C  CG2 . ILE A 1 311 ? 39.057 -15.061 -1.043  1.00 38.72 ? 461 ILE A CG2 1 
ATOM   2020 C  CD1 A ILE A 1 311 ? 41.485 -13.627 0.149   0.50 38.40 ? 461 ILE A CD1 1 
ATOM   2021 C  CD1 B ILE A 1 311 ? 41.877 -15.830 -0.087  0.50 34.59 ? 461 ILE A CD1 1 
ATOM   2022 N  N   . CYS A 1 312 ? 36.318 -13.667 0.547   1.00 33.10 ? 462 CYS A N   1 
ATOM   2023 C  CA  . CYS A 1 312 ? 34.881 -13.960 0.612   1.00 38.40 ? 462 CYS A CA  1 
ATOM   2024 C  C   . CYS A 1 312 ? 34.505 -15.258 -0.053  1.00 40.84 ? 462 CYS A C   1 
ATOM   2025 O  O   . CYS A 1 312 ? 33.563 -15.924 0.387   1.00 44.11 ? 462 CYS A O   1 
ATOM   2026 C  CB  . CYS A 1 312 ? 34.058 -12.808 0.038   1.00 38.63 ? 462 CYS A CB  1 
ATOM   2027 S  SG  . CYS A 1 312 ? 34.360 -11.249 0.846   1.00 35.11 ? 462 CYS A SG  1 
ATOM   2028 N  N   . LYS A 1 313 ? 35.261 -15.670 -1.073  1.00 43.99 ? 463 LYS A N   1 
ATOM   2029 C  CA  . LYS A 1 313 ? 34.898 -16.862 -1.837  1.00 46.00 ? 463 LYS A CA  1 
ATOM   2030 C  C   . LYS A 1 313 ? 34.982 -18.142 -0.981  1.00 45.50 ? 463 LYS A C   1 
ATOM   2031 O  O   . LYS A 1 313 ? 34.035 -18.936 -0.950  1.00 47.17 ? 463 LYS A O   1 
ATOM   2032 C  CB  . LYS A 1 313 ? 35.767 -16.978 -3.114  1.00 49.45 ? 463 LYS A CB  1 
ATOM   2033 C  CG  . LYS A 1 313 ? 35.233 -17.961 -4.157  1.00 54.95 ? 463 LYS A CG  1 
ATOM   2034 C  CD  . LYS A 1 313 ? 35.866 -17.777 -5.556  1.00 57.47 ? 463 LYS A CD  1 
ATOM   2035 C  CE  . LYS A 1 313 ? 35.360 -16.507 -6.259  1.00 56.81 ? 463 LYS A CE  1 
ATOM   2036 N  N   . GLN A 1 314 ? 36.115 -18.336 -0.298  1.00 42.99 ? 464 GLN A N   1 
ATOM   2037 C  CA  . GLN A 1 314 ? 36.320 -19.487 0.581   1.00 44.01 ? 464 GLN A CA  1 
ATOM   2038 C  C   . GLN A 1 314 ? 36.208 -19.163 2.101   1.00 40.84 ? 464 GLN A C   1 
ATOM   2039 O  O   . GLN A 1 314 ? 36.381 -20.050 2.934   1.00 39.44 ? 464 GLN A O   1 
ATOM   2040 C  CB  . GLN A 1 314 ? 37.709 -20.114 0.306   1.00 46.90 ? 464 GLN A CB  1 
ATOM   2041 C  CG  . GLN A 1 314 ? 37.876 -20.730 -1.115  1.00 51.05 ? 464 GLN A CG  1 
ATOM   2042 C  CD  . GLN A 1 314 ? 38.322 -19.691 -2.168  1.00 49.76 ? 464 GLN A CD  1 
ATOM   2043 O  OE1 . GLN A 1 314 ? 38.594 -18.542 -1.839  1.00 49.43 ? 464 GLN A OE1 1 
ATOM   2044 N  NE2 . GLN A 1 314 ? 38.424 -20.121 -3.437  1.00 52.47 ? 464 GLN A NE2 1 
ATOM   2045 N  N   . TRP A 1 315 ? 35.955 -17.912 2.456   1.00 41.44 ? 465 TRP A N   1 
ATOM   2046 C  CA  . TRP A 1 315 ? 36.008 -17.455 3.884   1.00 41.40 ? 465 TRP A CA  1 
ATOM   2047 C  C   . TRP A 1 315 ? 37.265 -17.879 4.626   1.00 41.04 ? 465 TRP A C   1 
ATOM   2048 O  O   . TRP A 1 315 ? 37.205 -18.300 5.756   1.00 47.81 ? 465 TRP A O   1 
ATOM   2049 C  CB  . TRP A 1 315 ? 34.709 -17.840 4.647   1.00 44.25 ? 465 TRP A CB  1 
ATOM   2050 C  CG  . TRP A 1 315 ? 33.577 -17.202 3.966   1.00 45.34 ? 465 TRP A CG  1 
ATOM   2051 C  CD1 . TRP A 1 315 ? 32.627 -17.806 3.184   1.00 49.27 ? 465 TRP A CD1 1 
ATOM   2052 C  CD2 . TRP A 1 315 ? 33.335 -15.807 3.894   1.00 45.93 ? 465 TRP A CD2 1 
ATOM   2053 N  NE1 . TRP A 1 315 ? 31.786 -16.857 2.650   1.00 50.25 ? 465 TRP A NE1 1 
ATOM   2054 C  CE2 . TRP A 1 315 ? 32.205 -15.617 3.077   1.00 48.26 ? 465 TRP A CE2 1 
ATOM   2055 C  CE3 . TRP A 1 315 ? 33.965 -14.692 4.446   1.00 42.43 ? 465 TRP A CE3 1 
ATOM   2056 C  CZ2 . TRP A 1 315 ? 31.688 -14.358 2.813   1.00 47.37 ? 465 TRP A CZ2 1 
ATOM   2057 C  CZ3 . TRP A 1 315 ? 33.456 -13.453 4.185   1.00 43.98 ? 465 TRP A CZ3 1 
ATOM   2058 C  CH2 . TRP A 1 315 ? 32.324 -13.286 3.380   1.00 43.19 ? 465 TRP A CH2 1 
ATOM   2059 N  N   . THR A 1 316 ? 38.399 -17.697 3.961   1.00 37.09 ? 466 THR A N   1 
ATOM   2060 C  CA  . THR A 1 316 ? 39.756 -18.031 4.419   1.00 36.48 ? 466 THR A CA  1 
ATOM   2061 C  C   . THR A 1 316 ? 40.418 -16.702 4.920   1.00 34.35 ? 466 THR A C   1 
ATOM   2062 O  O   . THR A 1 316 ? 40.204 -15.651 4.312   1.00 31.18 ? 466 THR A O   1 
ATOM   2063 C  CB  . THR A 1 316 ? 40.557 -18.633 3.209   1.00 37.92 ? 466 THR A CB  1 
ATOM   2064 O  OG1 . THR A 1 316 ? 40.307 -20.027 3.149   1.00 50.13 ? 466 THR A OG1 1 
ATOM   2065 C  CG2 . THR A 1 316 ? 42.110 -18.398 3.293   1.00 43.87 ? 466 THR A CG2 1 
ATOM   2066 N  N   . GLU A 1 317 ? 41.184 -16.750 6.008   1.00 31.12 ? 467 GLU A N   1 
ATOM   2067 C  CA  . GLU A 1 317 ? 41.895 -15.580 6.490   1.00 30.84 ? 467 GLU A CA  1 
ATOM   2068 C  C   . GLU A 1 317 ? 43.129 -15.400 5.629   1.00 31.04 ? 467 GLU A C   1 
ATOM   2069 O  O   . GLU A 1 317 ? 43.898 -16.303 5.508   1.00 33.59 ? 467 GLU A O   1 
ATOM   2070 C  CB  . GLU A 1 317 ? 42.339 -15.727 7.935   1.00 30.96 ? 467 GLU A CB  1 
ATOM   2071 C  CG  . GLU A 1 317 ? 43.059 -14.487 8.521   1.00 29.71 ? 467 GLU A CG  1 
ATOM   2072 C  CD  . GLU A 1 317 ? 43.765 -14.843 9.832   1.00 31.28 ? 467 GLU A CD  1 
ATOM   2073 O  OE1 . GLU A 1 317 ? 43.157 -15.542 10.651  1.00 31.79 ? 467 GLU A OE1 1 
ATOM   2074 O  OE2 . GLU A 1 317 ? 44.931 -14.519 9.999   1.00 31.09 ? 467 GLU A OE2 1 
ATOM   2075 N  N   . ILE A 1 318 ? 43.302 -14.213 5.073   1.00 27.43 ? 468 ILE A N   1 
ATOM   2076 C  CA  . ILE A 1 318 ? 44.386 -13.941 4.126   1.00 27.41 ? 468 ILE A CA  1 
ATOM   2077 C  C   . ILE A 1 318 ? 45.389 -12.941 4.637   1.00 25.75 ? 468 ILE A C   1 
ATOM   2078 O  O   . ILE A 1 318 ? 46.546 -12.987 4.258   1.00 26.74 ? 468 ILE A O   1 
ATOM   2079 C  CB  . ILE A 1 318 ? 43.814 -13.550 2.726   1.00 29.04 ? 468 ILE A CB  1 
ATOM   2080 C  CG1 . ILE A 1 318 ? 44.907 -13.596 1.639   1.00 31.94 ? 468 ILE A CG1 1 
ATOM   2081 C  CG2 . ILE A 1 318 ? 43.178 -12.191 2.721   1.00 27.61 ? 468 ILE A CG2 1 
ATOM   2082 C  CD1 . ILE A 1 318 ? 45.571 -14.949 1.455   1.00 34.30 ? 468 ILE A CD1 1 
ATOM   2083 N  N   . LEU A 1 319 ? 44.979 -12.027 5.519   1.00 26.41 ? 469 LEU A N   1 
ATOM   2084 C  CA  . LEU A 1 319 ? 45.913 -11.151 6.174   1.00 25.70 ? 469 LEU A CA  1 
ATOM   2085 C  C   . LEU A 1 319 ? 45.493 -10.961 7.599   1.00 25.87 ? 469 LEU A C   1 
ATOM   2086 O  O   . LEU A 1 319 ? 44.310 -10.924 7.906   1.00 24.80 ? 469 LEU A O   1 
ATOM   2087 C  CB  . LEU A 1 319 ? 45.961 -9.763  5.516   1.00 26.12 ? 469 LEU A CB  1 
ATOM   2088 C  CG  . LEU A 1 319 ? 46.868 -9.512  4.351   1.00 27.09 ? 469 LEU A CG  1 
ATOM   2089 C  CD1 . LEU A 1 319 ? 46.671 -8.095  3.817   1.00 26.90 ? 469 LEU A CD1 1 
ATOM   2090 C  CD2 . LEU A 1 319 ? 48.312 -9.780  4.765   1.00 25.70 ? 469 LEU A CD2 1 
ATOM   2091 N  N   . HIS A 1 320 ? 46.476 -10.742 8.454   1.00 26.03 ? 470 HIS A N   1 
ATOM   2092 C  CA  . HIS A 1 320 ? 46.226 -10.475 9.898   1.00 25.32 ? 470 HIS A CA  1 
ATOM   2093 C  C   . HIS A 1 320 ? 47.332 -9.514  10.335  1.00 24.87 ? 470 HIS A C   1 
ATOM   2094 O  O   . HIS A 1 320 ? 48.520 -9.856  10.258  1.00 26.04 ? 470 HIS A O   1 
ATOM   2095 C  CB  . HIS A 1 320 ? 46.298 -11.775 10.686  1.00 26.84 ? 470 HIS A CB  1 
ATOM   2096 C  CG  . HIS A 1 320 ? 45.922 -11.670 12.150  1.00 26.30 ? 470 HIS A CG  1 
ATOM   2097 N  ND1 . HIS A 1 320 ? 45.828 -12.779 12.953  1.00 31.94 ? 470 HIS A ND1 1 
ATOM   2098 C  CD2 . HIS A 1 320 ? 45.597 -10.617 12.939  1.00 28.75 ? 470 HIS A CD2 1 
ATOM   2099 C  CE1 . HIS A 1 320 ? 45.467 -12.423 14.169  1.00 29.38 ? 470 HIS A CE1 1 
ATOM   2100 N  NE2 . HIS A 1 320 ? 45.309 -11.116 14.185  1.00 30.63 ? 470 HIS A NE2 1 
ATOM   2101 N  N   . PHE A 1 321 ? 46.937 -8.325  10.771  1.00 25.18 ? 471 PHE A N   1 
ATOM   2102 C  CA  . PHE A 1 321 ? 47.879 -7.362  11.325  1.00 24.21 ? 471 PHE A CA  1 
ATOM   2103 C  C   . PHE A 1 321 ? 47.598 -7.096  12.776  1.00 26.20 ? 471 PHE A C   1 
ATOM   2104 O  O   . PHE A 1 321 ? 46.446 -6.936  13.168  1.00 24.30 ? 471 PHE A O   1 
ATOM   2105 C  CB  . PHE A 1 321 ? 47.803 -6.029  10.604  1.00 24.94 ? 471 PHE A CB  1 
ATOM   2106 C  CG  . PHE A 1 321 ? 48.103 -6.115  9.133   1.00 26.42 ? 471 PHE A CG  1 
ATOM   2107 C  CD1 . PHE A 1 321 ? 49.328 -6.557  8.694   1.00 26.50 ? 471 PHE A CD1 1 
ATOM   2108 C  CD2 . PHE A 1 321 ? 47.147 -5.763  8.202   1.00 26.69 ? 471 PHE A CD2 1 
ATOM   2109 C  CE1 . PHE A 1 321 ? 49.603 -6.647  7.335   1.00 26.53 ? 471 PHE A CE1 1 
ATOM   2110 C  CE2 . PHE A 1 321 ? 47.434 -5.815  6.844   1.00 26.82 ? 471 PHE A CE2 1 
ATOM   2111 C  CZ  . PHE A 1 321 ? 48.654 -6.260  6.418   1.00 26.80 ? 471 PHE A CZ  1 
ATOM   2112 N  N   . THR A 1 322 ? 48.665 -6.996  13.556  1.00 25.06 ? 472 THR A N   1 
ATOM   2113 C  CA  . THR A 1 322 ? 48.554 -6.626  14.985  1.00 23.81 ? 472 THR A CA  1 
ATOM   2114 C  C   . THR A 1 322 ? 49.508 -5.485  15.352  1.00 25.27 ? 472 THR A C   1 
ATOM   2115 O  O   . THR A 1 322 ? 50.118 -5.482  16.460  1.00 25.27 ? 472 THR A O   1 
ATOM   2116 C  CB  . THR A 1 322 ? 48.819 -7.856  15.858  1.00 22.78 ? 472 THR A CB  1 
ATOM   2117 O  OG1 . THR A 1 322 ? 50.159 -8.313  15.666  1.00 23.61 ? 472 THR A OG1 1 
ATOM   2118 C  CG2 . THR A 1 322 ? 47.866 -8.984  15.480  1.00 22.45 ? 472 THR A CG2 1 
ATOM   2119 N  N   . GLU A 1 323 ? 49.674 -4.547  14.431  1.00 24.55 ? 473 GLU A N   1 
ATOM   2120 C  CA  . GLU A 1 323 ? 50.610 -3.437  14.643  1.00 25.54 ? 473 GLU A CA  1 
ATOM   2121 C  C   . GLU A 1 323 ? 50.123 -2.392  15.654  1.00 25.41 ? 473 GLU A C   1 
ATOM   2122 O  O   . GLU A 1 323 ? 50.901 -1.843  16.406  1.00 25.05 ? 473 GLU A O   1 
ATOM   2123 C  CB  . GLU A 1 323 ? 50.931 -2.751  13.323  1.00 24.30 ? 473 GLU A CB  1 
ATOM   2124 C  CG  . GLU A 1 323 ? 51.550 -3.653  12.237  1.00 26.16 ? 473 GLU A CG  1 
ATOM   2125 C  CD  . GLU A 1 323 ? 52.869 -4.246  12.624  1.00 28.36 ? 473 GLU A CD  1 
ATOM   2126 O  OE1 . GLU A 1 323 ? 53.630 -3.555  13.343  1.00 27.44 ? 473 GLU A OE1 1 
ATOM   2127 O  OE2 . GLU A 1 323 ? 53.162 -5.392  12.167  1.00 25.85 ? 473 GLU A OE2 1 
ATOM   2128 N  N   . HIS A 1 324 ? 48.846 -2.069  15.623  1.00 25.82 ? 474 HIS A N   1 
ATOM   2129 C  CA  . HIS A 1 324 ? 48.309 -1.121  16.578  1.00 25.21 ? 474 HIS A CA  1 
ATOM   2130 C  C   . HIS A 1 324 ? 48.465 -1.632  18.012  1.00 26.75 ? 474 HIS A C   1 
ATOM   2131 O  O   . HIS A 1 324 ? 48.397 -2.829  18.304  1.00 26.14 ? 474 HIS A O   1 
ATOM   2132 C  CB  . HIS A 1 324 ? 46.844 -0.775  16.294  1.00 24.60 ? 474 HIS A CB  1 
ATOM   2133 C  CG  . HIS A 1 324 ? 46.621 0.057   15.080  1.00 21.59 ? 474 HIS A CG  1 
ATOM   2134 N  ND1 . HIS A 1 324 ? 46.960 1.391   15.006  1.00 23.25 ? 474 HIS A ND1 1 
ATOM   2135 C  CD2 . HIS A 1 324 ? 46.024 -0.245  13.896  1.00 23.38 ? 474 HIS A CD2 1 
ATOM   2136 C  CE1 . HIS A 1 324 ? 46.579 1.871   13.833  1.00 24.05 ? 474 HIS A CE1 1 
ATOM   2137 N  NE2 . HIS A 1 324 ? 46.039 0.887   13.129  1.00 23.80 ? 474 HIS A NE2 1 
ATOM   2138 N  N   . SER A 1 325 ? 48.679 -0.679  18.891  1.00 28.78 ? 475 SER A N   1 
ATOM   2139 C  CA  . SER A 1 325 ? 48.646 -0.907  20.299  1.00 28.90 ? 475 SER A CA  1 
ATOM   2140 C  C   . SER A 1 325 ? 47.295 -0.429  20.815  1.00 28.49 ? 475 SER A C   1 
ATOM   2141 O  O   . SER A 1 325 ? 46.927 0.742   20.654  1.00 24.90 ? 475 SER A O   1 
ATOM   2142 C  CB  . SER A 1 325 ? 49.780 -0.156  20.960  1.00 32.23 ? 475 SER A CB  1 
ATOM   2143 O  OG  . SER A 1 325 ? 49.652 -0.327  22.321  1.00 38.18 ? 475 SER A OG  1 
ATOM   2144 N  N   . GLY A 1 326 ? 46.527 -1.332  21.420  1.00 30.05 ? 476 GLY A N   1 
ATOM   2145 C  CA  . GLY A 1 326 ? 45.134 -1.013  21.776  1.00 28.79 ? 476 GLY A CA  1 
ATOM   2146 C  C   . GLY A 1 326 ? 44.245 -1.026  20.537  1.00 25.39 ? 476 GLY A C   1 
ATOM   2147 O  O   . GLY A 1 326 ? 44.650 -1.480  19.433  1.00 24.03 ? 476 GLY A O   1 
ATOM   2148 N  N   . LEU A 1 327 ? 43.027 -0.530  20.688  1.00 25.51 ? 477 LEU A N   1 
ATOM   2149 C  CA  . LEU A 1 327 ? 41.961 -0.754  19.676  1.00 26.89 ? 477 LEU A CA  1 
ATOM   2150 C  C   . LEU A 1 327 ? 42.253 -0.115  18.314  1.00 24.17 ? 477 LEU A C   1 
ATOM   2151 O  O   . LEU A 1 327 ? 42.709 1.009   18.236  1.00 23.77 ? 477 LEU A O   1 
ATOM   2152 C  CB  . LEU A 1 327 ? 40.570 -0.284  20.182  1.00 29.88 ? 477 LEU A CB  1 
ATOM   2153 C  CG  . LEU A 1 327 ? 39.825 -1.316  21.081  1.00 35.73 ? 477 LEU A CG  1 
ATOM   2154 C  CD1 . LEU A 1 327 ? 38.693 -0.642  21.845  1.00 41.63 ? 477 LEU A CD1 1 
ATOM   2155 C  CD2 . LEU A 1 327 ? 39.282 -2.478  20.238  1.00 36.29 ? 477 LEU A CD2 1 
ATOM   2156 N  N   . THR A 1 328 ? 41.999 -0.897  17.263  1.00 21.28 ? 478 THR A N   1 
ATOM   2157 C  CA  . THR A 1 328 ? 41.904 -0.429  15.933  1.00 24.07 ? 478 THR A CA  1 
ATOM   2158 C  C   . THR A 1 328 ? 40.472 0.064   15.657  1.00 27.16 ? 478 THR A C   1 
ATOM   2159 O  O   . THR A 1 328 ? 39.490 -0.646  15.871  1.00 25.93 ? 478 THR A O   1 
ATOM   2160 C  CB  . THR A 1 328 ? 42.238 -1.537  14.942  1.00 23.47 ? 478 THR A CB  1 
ATOM   2161 O  OG1 . THR A 1 328 ? 43.554 -2.031  15.205  1.00 22.45 ? 478 THR A OG1 1 
ATOM   2162 C  CG2 . THR A 1 328 ? 42.169 -1.055  13.513  1.00 23.73 ? 478 THR A CG2 1 
ATOM   2163 N  N   . THR A 1 329 ? 40.369 1.292   15.178  1.00 24.77 ? 479 THR A N   1 
ATOM   2164 C  CA  . THR A 1 329 ? 39.056 1.952   15.079  1.00 23.15 ? 479 THR A CA  1 
ATOM   2165 C  C   . THR A 1 329 ? 38.557 2.045   13.653  1.00 26.60 ? 479 THR A C   1 
ATOM   2166 O  O   . THR A 1 329 ? 37.442 2.476   13.428  1.00 24.96 ? 479 THR A O   1 
ATOM   2167 C  CB  . THR A 1 329 ? 39.114 3.388   15.650  1.00 21.88 ? 479 THR A CB  1 
ATOM   2168 O  OG1 . THR A 1 329 ? 40.154 4.112   15.003  1.00 19.98 ? 479 THR A OG1 1 
ATOM   2169 C  CG2 . THR A 1 329 ? 39.368 3.384   17.085  1.00 22.41 ? 479 THR A CG2 1 
ATOM   2170 N  N   . GLY A 1 330 ? 39.381 1.726   12.684  1.00 23.91 ? 480 GLY A N   1 
ATOM   2171 C  CA  . GLY A 1 330 ? 38.935 1.853   11.318  1.00 24.03 ? 480 GLY A CA  1 
ATOM   2172 C  C   . GLY A 1 330 ? 39.823 1.039   10.436  1.00 23.75 ? 480 GLY A C   1 
ATOM   2173 O  O   . GLY A 1 330 ? 41.014 0.894   10.723  1.00 20.47 ? 480 GLY A O   1 
ATOM   2174 N  N   . VAL A 1 331 ? 39.247 0.533   9.333   1.00 23.05 ? 481 VAL A N   1 
ATOM   2175 C  CA  A VAL A 1 331 ? 40.022 -0.165  8.334   0.50 24.29 ? 481 VAL A CA  1 
ATOM   2176 C  CA  B VAL A 1 331 ? 39.974 -0.225  8.321   0.50 24.67 ? 481 VAL A CA  1 
ATOM   2177 C  C   . VAL A 1 331 ? 39.376 0.125   6.976   1.00 24.40 ? 481 VAL A C   1 
ATOM   2178 O  O   . VAL A 1 331 ? 38.149 0.367   6.888   1.00 23.49 ? 481 VAL A O   1 
ATOM   2179 C  CB  A VAL A 1 331 ? 40.176 -1.699  8.676   0.50 25.25 ? 481 VAL A CB  1 
ATOM   2180 C  CB  B VAL A 1 331 ? 39.844 -1.764  8.530   0.50 26.27 ? 481 VAL A CB  1 
ATOM   2181 C  CG1 A VAL A 1 331 ? 38.823 -2.348  8.930   0.50 29.95 ? 481 VAL A CG1 1 
ATOM   2182 C  CG1 B VAL A 1 331 ? 40.563 -2.196  9.791   0.50 26.39 ? 481 VAL A CG1 1 
ATOM   2183 C  CG2 A VAL A 1 331 ? 40.940 -2.436  7.597   0.50 25.43 ? 481 VAL A CG2 1 
ATOM   2184 C  CG2 B VAL A 1 331 ? 38.358 -2.178  8.583   0.50 29.71 ? 481 VAL A CG2 1 
ATOM   2185 N  N   . ALA A 1 332 ? 40.209 0.145   5.936   1.00 25.91 ? 482 ALA A N   1 
ATOM   2186 C  CA  . ALA A 1 332 ? 39.768 0.470   4.576   1.00 24.94 ? 482 ALA A CA  1 
ATOM   2187 C  C   . ALA A 1 332 ? 40.694 -0.135  3.549   1.00 24.12 ? 482 ALA A C   1 
ATOM   2188 O  O   . ALA A 1 332 ? 41.891 -0.425  3.839   1.00 23.23 ? 482 ALA A O   1 
ATOM   2189 C  CB  . ALA A 1 332 ? 39.691 1.988   4.392   1.00 22.07 ? 482 ALA A CB  1 
ATOM   2190 N  N   . PHE A 1 333 ? 40.152 -0.346  2.352   1.00 26.85 ? 483 PHE A N   1 
ATOM   2191 C  CA  . PHE A 1 333 ? 40.929 -0.734  1.186   1.00 24.81 ? 483 PHE A CA  1 
ATOM   2192 C  C   . PHE A 1 333 ? 41.190 0.451   0.243   1.00 25.02 ? 483 PHE A C   1 
ATOM   2193 O  O   . PHE A 1 333 ? 40.264 1.108   -0.217  1.00 24.57 ? 483 PHE A O   1 
ATOM   2194 C  CB  . PHE A 1 333 ? 40.213 -1.823  0.374   1.00 26.26 ? 483 PHE A CB  1 
ATOM   2195 C  CG  . PHE A 1 333 ? 39.987 -3.094  1.110   1.00 24.31 ? 483 PHE A CG  1 
ATOM   2196 C  CD1 . PHE A 1 333 ? 38.891 -3.256  1.907   1.00 23.96 ? 483 PHE A CD1 1 
ATOM   2197 C  CD2 . PHE A 1 333 ? 40.875 -4.149  0.988   1.00 24.62 ? 483 PHE A CD2 1 
ATOM   2198 C  CE1 . PHE A 1 333 ? 38.675 -4.460  2.588   1.00 24.11 ? 483 PHE A CE1 1 
ATOM   2199 C  CE2 . PHE A 1 333 ? 40.668 -5.362  1.612   1.00 24.11 ? 483 PHE A CE2 1 
ATOM   2200 C  CZ  . PHE A 1 333 ? 39.556 -5.524  2.436   1.00 25.85 ? 483 PHE A CZ  1 
ATOM   2201 N  N   . GLY A 1 334 ? 42.459 0.693   -0.088  1.00 27.53 ? 484 GLY A N   1 
ATOM   2202 C  CA  . GLY A 1 334 ? 42.805 1.491   -1.250  1.00 26.57 ? 484 GLY A CA  1 
ATOM   2203 C  C   . GLY A 1 334 ? 42.246 0.869   -2.542  1.00 27.87 ? 484 GLY A C   1 
ATOM   2204 O  O   . GLY A 1 334 ? 41.829 -0.317  -2.562  1.00 29.86 ? 484 GLY A O   1 
ATOM   2205 N  N   . HIS A 1 335 ? 42.208 1.679   -3.602  1.00 29.74 ? 485 HIS A N   1 
ATOM   2206 C  CA  A HIS A 1 335 ? 41.679 1.244   -4.901  0.50 31.64 ? 485 HIS A CA  1 
ATOM   2207 C  CA  B HIS A 1 335 ? 41.696 1.248   -4.929  0.50 31.32 ? 485 HIS A CA  1 
ATOM   2208 C  C   . HIS A 1 335 ? 42.392 -0.030  -5.341  1.00 32.07 ? 485 HIS A C   1 
ATOM   2209 O  O   . HIS A 1 335 ? 43.602 -0.135  -5.207  1.00 28.94 ? 485 HIS A O   1 
ATOM   2210 C  CB  A HIS A 1 335 ? 41.872 2.337   -5.971  0.50 37.16 ? 485 HIS A CB  1 
ATOM   2211 C  CB  B HIS A 1 335 ? 41.968 2.351   -5.978  0.50 35.96 ? 485 HIS A CB  1 
ATOM   2212 C  CG  A HIS A 1 335 ? 40.790 3.381   -5.997  0.50 40.52 ? 485 HIS A CG  1 
ATOM   2213 C  CG  B HIS A 1 335 ? 41.282 2.149   -7.307  0.50 39.48 ? 485 HIS A CG  1 
ATOM   2214 N  ND1 A HIS A 1 335 ? 40.987 4.646   -6.524  0.50 44.31 ? 485 HIS A ND1 1 
ATOM   2215 N  ND1 B HIS A 1 335 ? 39.953 1.793   -7.422  0.50 42.37 ? 485 HIS A ND1 1 
ATOM   2216 C  CD2 A HIS A 1 335 ? 39.503 3.344   -5.582  0.50 42.25 ? 485 HIS A CD2 1 
ATOM   2217 C  CD2 B HIS A 1 335 ? 41.729 2.332   -8.576  0.50 42.70 ? 485 HIS A CD2 1 
ATOM   2218 C  CE1 A HIS A 1 335 ? 39.866 5.336   -6.435  0.50 42.21 ? 485 HIS A CE1 1 
ATOM   2219 C  CE1 B HIS A 1 335 ? 39.621 1.734   -8.701  0.50 43.71 ? 485 HIS A CE1 1 
ATOM   2220 N  NE2 A HIS A 1 335 ? 38.954 4.573   -5.860  0.50 43.45 ? 485 HIS A NE2 1 
ATOM   2221 N  NE2 B HIS A 1 335 ? 40.679 2.059   -9.422  0.50 42.80 ? 485 HIS A NE2 1 
ATOM   2222 N  N   . HIS A 1 336 ? 41.610 -1.003  -5.849  1.00 30.07 ? 486 HIS A N   1 
ATOM   2223 C  CA  . HIS A 1 336 ? 42.102 -2.291  -6.318  1.00 31.63 ? 486 HIS A CA  1 
ATOM   2224 C  C   . HIS A 1 336 ? 42.811 -3.104  -5.228  1.00 29.62 ? 486 HIS A C   1 
ATOM   2225 O  O   . HIS A 1 336 ? 43.600 -4.001  -5.542  1.00 31.31 ? 486 HIS A O   1 
ATOM   2226 C  CB  . HIS A 1 336 ? 43.015 -2.109  -7.474  1.00 34.19 ? 486 HIS A CB  1 
ATOM   2227 C  CG  . HIS A 1 336 ? 42.343 -1.528  -8.666  1.00 40.06 ? 486 HIS A CG  1 
ATOM   2228 N  ND1 . HIS A 1 336 ? 41.172 -2.042  -9.174  1.00 46.22 ? 486 HIS A ND1 1 
ATOM   2229 C  CD2 . HIS A 1 336 ? 42.677 -0.488  -9.455  1.00 44.55 ? 486 HIS A CD2 1 
ATOM   2230 C  CE1 . HIS A 1 336 ? 40.826 -1.351  -10.244 1.00 49.12 ? 486 HIS A CE1 1 
ATOM   2231 N  NE2 . HIS A 1 336 ? 41.724 -0.403  -10.432 1.00 49.61 ? 486 HIS A NE2 1 
ATOM   2232 N  N   . ALA A 1 337 ? 42.523 -2.759  -3.982  1.00 29.52 ? 487 ALA A N   1 
ATOM   2233 C  CA  . ALA A 1 337 ? 43.151 -3.378  -2.813  1.00 28.60 ? 487 ALA A CA  1 
ATOM   2234 C  C   . ALA A 1 337 ? 44.678 -3.264  -2.902  1.00 28.86 ? 487 ALA A C   1 
ATOM   2235 O  O   . ALA A 1 337 ? 45.388 -4.153  -2.451  1.00 28.82 ? 487 ALA A O   1 
ATOM   2236 C  CB  . ALA A 1 337 ? 42.717 -4.860  -2.706  1.00 30.36 ? 487 ALA A CB  1 
ATOM   2237 N  N   . LYS A 1 338 ? 45.174 -2.171  -3.510  1.00 29.37 ? 488 LYS A N   1 
ATOM   2238 C  CA  . LYS A 1 338 ? 46.632 -1.958  -3.673  1.00 29.27 ? 488 LYS A CA  1 
ATOM   2239 C  C   . LYS A 1 338 ? 47.327 -1.590  -2.368  1.00 28.45 ? 488 LYS A C   1 
ATOM   2240 O  O   . LYS A 1 338 ? 48.550 -1.703  -2.268  1.00 30.40 ? 488 LYS A O   1 
ATOM   2241 C  CB  . LYS A 1 338 ? 46.940 -0.926  -4.772  1.00 30.72 ? 488 LYS A CB  1 
ATOM   2242 C  CG  . LYS A 1 338 ? 46.672 -1.480  -6.155  1.00 34.82 ? 488 LYS A CG  1 
ATOM   2243 C  CD  . LYS A 1 338 ? 47.025 -0.526  -7.301  1.00 40.36 ? 488 LYS A CD  1 
ATOM   2244 N  N   . PHE A 1 339 ? 46.546 -1.148  -1.391  1.00 27.89 ? 489 PHE A N   1 
ATOM   2245 C  CA  . PHE A 1 339 ? 46.981 -1.002  0.014   1.00 26.67 ? 489 PHE A CA  1 
ATOM   2246 C  C   . PHE A 1 339 ? 45.764 -1.184  0.973   1.00 25.93 ? 489 PHE A C   1 
ATOM   2247 O  O   . PHE A 1 339 ? 44.597 -1.172  0.515   1.00 25.93 ? 489 PHE A O   1 
ATOM   2248 C  CB  . PHE A 1 339 ? 47.696 0.335   0.237   1.00 26.27 ? 489 PHE A CB  1 
ATOM   2249 C  CG  . PHE A 1 339 ? 46.807 1.532   0.101   1.00 27.51 ? 489 PHE A CG  1 
ATOM   2250 C  CD1 . PHE A 1 339 ? 46.041 1.974   1.170   1.00 27.18 ? 489 PHE A CD1 1 
ATOM   2251 C  CD2 . PHE A 1 339 ? 46.766 2.245   -1.107  1.00 30.79 ? 489 PHE A CD2 1 
ATOM   2252 C  CE1 . PHE A 1 339 ? 45.241 3.088   1.053   1.00 30.33 ? 489 PHE A CE1 1 
ATOM   2253 C  CE2 . PHE A 1 339 ? 45.948 3.348   -1.222  1.00 31.78 ? 489 PHE A CE2 1 
ATOM   2254 C  CZ  . PHE A 1 339 ? 45.194 3.759   -0.164  1.00 28.99 ? 489 PHE A CZ  1 
ATOM   2255 N  N   . ILE A 1 340 ? 46.054 -1.406  2.260   1.00 24.91 ? 490 ILE A N   1 
ATOM   2256 C  CA  . ILE A 1 340 ? 45.051 -1.377  3.356   1.00 26.02 ? 490 ILE A CA  1 
ATOM   2257 C  C   . ILE A 1 340 ? 45.451 -0.223  4.244   1.00 24.06 ? 490 ILE A C   1 
ATOM   2258 O  O   . ILE A 1 340 ? 46.615 0.117   4.317   1.00 25.28 ? 490 ILE A O   1 
ATOM   2259 C  CB  . ILE A 1 340 ? 45.022 -2.716  4.120   1.00 27.74 ? 490 ILE A CB  1 
ATOM   2260 C  CG1 . ILE A 1 340 ? 44.601 -3.847  3.097   1.00 32.74 ? 490 ILE A CG1 1 
ATOM   2261 C  CG2 . ILE A 1 340 ? 44.055 -2.688  5.281   1.00 25.63 ? 490 ILE A CG2 1 
ATOM   2262 C  CD1 . ILE A 1 340 ? 44.827 -5.222  3.603   1.00 38.29 ? 490 ILE A CD1 1 
ATOM   2263 N  N   . ALA A 1 341 ? 44.475 0.379   4.880   1.00 23.67 ? 491 ALA A N   1 
ATOM   2264 C  CA  . ALA A 1 341 ? 44.686 1.446   5.838   1.00 23.06 ? 491 ALA A CA  1 
ATOM   2265 C  C   . ALA A 1 341 ? 43.956 1.112   7.129   1.00 23.91 ? 491 ALA A C   1 
ATOM   2266 O  O   . ALA A 1 341 ? 42.916 0.478   7.111   1.00 23.38 ? 491 ALA A O   1 
ATOM   2267 C  CB  . ALA A 1 341 ? 44.196 2.767   5.256   1.00 23.82 ? 491 ALA A CB  1 
ATOM   2268 N  N   . SER A 1 342 ? 44.542 1.531   8.263   1.00 23.20 ? 492 SER A N   1 
ATOM   2269 C  CA  . SER A 1 342 ? 43.899 1.408   9.544   1.00 20.48 ? 492 SER A CA  1 
ATOM   2270 C  C   . SER A 1 342 ? 44.248 2.578   10.447  1.00 22.10 ? 492 SER A C   1 
ATOM   2271 O  O   . SER A 1 342 ? 45.246 3.239   10.236  1.00 20.15 ? 492 SER A O   1 
ATOM   2272 C  CB  . SER A 1 342 ? 44.297 0.109   10.217  1.00 22.14 ? 492 SER A CB  1 
ATOM   2273 O  OG  . SER A 1 342 ? 45.626 0.174   10.640  1.00 21.78 ? 492 SER A OG  1 
ATOM   2274 N  N   . THR A 1 343 ? 43.373 2.810   11.425  1.00 20.49 ? 493 THR A N   1 
ATOM   2275 C  CA  . THR A 1 343 ? 43.491 3.871   12.388  1.00 22.47 ? 493 THR A CA  1 
ATOM   2276 C  C   . THR A 1 343 ? 43.367 3.258   13.798  1.00 22.68 ? 493 THR A C   1 
ATOM   2277 O  O   . THR A 1 343 ? 42.684 2.248   13.994  1.00 24.02 ? 493 THR A O   1 
ATOM   2278 C  CB  . THR A 1 343 ? 42.415 4.966   12.183  1.00 21.55 ? 493 THR A CB  1 
ATOM   2279 O  OG1 . THR A 1 343 ? 41.108 4.394   12.123  1.00 22.12 ? 493 THR A OG1 1 
ATOM   2280 C  CG2 . THR A 1 343 ? 42.650 5.745   10.909  1.00 23.06 ? 493 THR A CG2 1 
ATOM   2281 N  N   . GLY A 1 344 ? 44.041 3.864   14.758  1.00 24.36 ? 494 GLY A N   1 
ATOM   2282 C  CA  . GLY A 1 344 ? 44.074 3.355   16.109  1.00 23.72 ? 494 GLY A CA  1 
ATOM   2283 C  C   . GLY A 1 344 ? 43.913 4.392   17.201  1.00 26.09 ? 494 GLY A C   1 
ATOM   2284 O  O   . GLY A 1 344 ? 44.235 5.604   17.030  1.00 23.06 ? 494 GLY A O   1 
ATOM   2285 N  N   . MET A 1 345 ? 43.492 3.902   18.375  1.00 24.26 ? 495 MET A N   1 
ATOM   2286 C  CA  . MET A 1 345 ? 43.536 4.674   19.617  1.00 25.23 ? 495 MET A CA  1 
ATOM   2287 C  C   . MET A 1 345 ? 44.951 5.056   19.951  1.00 26.52 ? 495 MET A C   1 
ATOM   2288 O  O   . MET A 1 345 ? 45.172 6.011   20.704  1.00 25.26 ? 495 MET A O   1 
ATOM   2289 C  CB  . MET A 1 345 ? 42.989 3.841   20.788  1.00 29.86 ? 495 MET A CB  1 
ATOM   2290 C  CG  A MET A 1 345 ? 41.527 3.534   20.680  0.50 27.37 ? 495 MET A CG  1 
ATOM   2291 C  CG  B MET A 1 345 ? 41.585 3.292   20.547  0.50 33.63 ? 495 MET A CG  1 
ATOM   2292 S  SD  A MET A 1 345 ? 40.630 5.056   20.436  0.50 28.62 ? 495 MET A SD  1 
ATOM   2293 S  SD  B MET A 1 345 ? 40.235 3.822   21.596  0.50 45.12 ? 495 MET A SD  1 
ATOM   2294 C  CE  A MET A 1 345 ? 41.187 6.074   21.807  0.50 28.74 ? 495 MET A CE  1 
ATOM   2295 C  CE  B MET A 1 345 ? 40.377 2.767   23.031  0.50 45.45 ? 495 MET A CE  1 
ATOM   2296 N  N   . ASP A 1 346 ? 45.920 4.314   19.422  1.00 24.31 ? 496 ASP A N   1 
ATOM   2297 C  CA  . ASP A 1 346 ? 47.344 4.651   19.632  1.00 27.45 ? 496 ASP A CA  1 
ATOM   2298 C  C   . ASP A 1 346 ? 47.833 5.904   18.865  1.00 25.50 ? 496 ASP A C   1 
ATOM   2299 O  O   . ASP A 1 346 ? 49.041 6.180   18.862  1.00 23.86 ? 496 ASP A O   1 
ATOM   2300 C  CB  . ASP A 1 346 ? 48.270 3.446   19.293  1.00 27.92 ? 496 ASP A CB  1 
ATOM   2301 C  CG  . ASP A 1 346 ? 48.213 3.021   17.799  1.00 27.61 ? 496 ASP A CG  1 
ATOM   2302 O  OD1 . ASP A 1 346 ? 47.696 3.781   16.951  1.00 25.38 ? 496 ASP A OD1 1 
ATOM   2303 O  OD2 . ASP A 1 346 ? 48.741 1.919   17.499  1.00 26.99 ? 496 ASP A OD2 1 
ATOM   2304 N  N   . ARG A 1 347 ? 46.927 6.607   18.176  1.00 26.63 ? 497 ARG A N   1 
ATOM   2305 C  CA  . ARG A 1 347 ? 47.225 7.854   17.437  1.00 27.72 ? 497 ARG A CA  1 
ATOM   2306 C  C   . ARG A 1 347 ? 47.565 7.657   15.978  1.00 27.36 ? 497 ARG A C   1 
ATOM   2307 O  O   . ARG A 1 347 ? 47.583 8.646   15.213  1.00 24.92 ? 497 ARG A O   1 
ATOM   2308 C  CB  . ARG A 1 347 ? 48.408 8.664   18.018  1.00 31.17 ? 497 ARG A CB  1 
ATOM   2309 C  CG  A ARG A 1 347 ? 48.276 9.153   19.451  0.50 31.30 ? 497 ARG A CG  1 
ATOM   2310 C  CG  B ARG A 1 347 ? 48.290 9.079   19.468  0.50 33.28 ? 497 ARG A CG  1 
ATOM   2311 C  CD  A ARG A 1 347 ? 49.406 10.156  19.783  0.50 31.40 ? 497 ARG A CD  1 
ATOM   2312 C  CD  B ARG A 1 347 ? 49.577 9.779   19.929  0.50 34.99 ? 497 ARG A CD  1 
ATOM   2313 N  NE  A ARG A 1 347 ? 49.270 11.378  18.987  0.50 29.05 ? 497 ARG A NE  1 
ATOM   2314 N  NE  B ARG A 1 347 ? 50.779 8.954   19.814  0.50 35.16 ? 497 ARG A NE  1 
ATOM   2315 C  CZ  A ARG A 1 347 ? 50.278 12.100  18.517  0.50 27.96 ? 497 ARG A CZ  1 
ATOM   2316 C  CZ  B ARG A 1 347 ? 51.972 9.424   19.438  0.50 35.15 ? 497 ARG A CZ  1 
ATOM   2317 N  NH1 A ARG A 1 347 ? 51.554 11.737  18.759  0.50 27.46 ? 497 ARG A NH1 1 
ATOM   2318 N  NH1 B ARG A 1 347 ? 52.995 8.617   19.373  0.50 36.14 ? 497 ARG A NH1 1 
ATOM   2319 N  NH2 A ARG A 1 347 ? 50.004 13.169  17.795  0.50 25.06 ? 497 ARG A NH2 1 
ATOM   2320 N  NH2 B ARG A 1 347 ? 52.126 10.706  19.100  0.50 35.35 ? 497 ARG A NH2 1 
ATOM   2321 N  N   . SER A 1 348 ? 47.833 6.422   15.566  1.00 26.44 ? 498 SER A N   1 
ATOM   2322 C  CA  . SER A 1 348 ? 48.387 6.196   14.230  1.00 26.73 ? 498 SER A CA  1 
ATOM   2323 C  C   . SER A 1 348 ? 47.359 5.915   13.128  1.00 24.68 ? 498 SER A C   1 
ATOM   2324 O  O   . SER A 1 348 ? 46.294 5.357   13.360  1.00 21.75 ? 498 SER A O   1 
ATOM   2325 C  CB  . SER A 1 348 ? 49.462 5.106   14.245  1.00 25.09 ? 498 SER A CB  1 
ATOM   2326 O  OG  . SER A 1 348 ? 48.938 3.811   14.553  1.00 25.65 ? 498 SER A OG  1 
ATOM   2327 N  N   . LEU A 1 349 ? 47.736 6.355   11.929  1.00 21.90 ? 499 LEU A N   1 
ATOM   2328 C  CA  . LEU A 1 349 ? 47.163 5.936   10.657  1.00 23.92 ? 499 LEU A CA  1 
ATOM   2329 C  C   . LEU A 1 349 ? 48.246 5.088   9.969   1.00 24.16 ? 499 LEU A C   1 
ATOM   2330 O  O   . LEU A 1 349 ? 49.368 5.575   9.711   1.00 24.86 ? 499 LEU A O   1 
ATOM   2331 C  CB  . LEU A 1 349 ? 46.827 7.142   9.819   1.00 23.93 ? 499 LEU A CB  1 
ATOM   2332 C  CG  . LEU A 1 349 ? 46.602 6.923   8.292   1.00 24.30 ? 499 LEU A CG  1 
ATOM   2333 C  CD1 . LEU A 1 349 ? 45.293 6.183   8.073   1.00 24.03 ? 499 LEU A CD1 1 
ATOM   2334 C  CD2 . LEU A 1 349 ? 46.586 8.244   7.542   1.00 24.41 ? 499 LEU A CD2 1 
ATOM   2335 N  N   . LYS A 1 350 ? 47.921 3.818   9.725   1.00 21.76 ? 500 LYS A N   1 
ATOM   2336 C  CA  . LYS A 1 350 ? 48.844 2.870   9.171   1.00 24.38 ? 500 LYS A CA  1 
ATOM   2337 C  C   . LYS A 1 350 ? 48.412 2.463   7.750   1.00 22.37 ? 500 LYS A C   1 
ATOM   2338 O  O   . LYS A 1 350 ? 47.249 2.393   7.456   1.00 20.89 ? 500 LYS A O   1 
ATOM   2339 C  CB  . LYS A 1 350 ? 48.945 1.634   10.077  1.00 22.96 ? 500 LYS A CB  1 
ATOM   2340 C  CG  . LYS A 1 350 ? 49.606 1.881   11.411  1.00 24.92 ? 500 LYS A CG  1 
ATOM   2341 C  CD  . LYS A 1 350 ? 49.543 0.654   12.322  1.00 26.87 ? 500 LYS A CD  1 
ATOM   2342 C  CE  . LYS A 1 350 ? 50.219 0.932   13.635  1.00 26.52 ? 500 LYS A CE  1 
ATOM   2343 N  NZ  . LYS A 1 350 ? 51.647 1.290   13.466  1.00 28.13 ? 500 LYS A NZ  1 
ATOM   2344 N  N   . PHE A 1 351 ? 49.392 2.278   6.900   1.00 23.73 ? 501 PHE A N   1 
ATOM   2345 C  CA  . PHE A 1 351 ? 49.206 1.747   5.560   1.00 25.27 ? 501 PHE A CA  1 
ATOM   2346 C  C   . PHE A 1 351 ? 49.979 0.455   5.423   1.00 24.90 ? 501 PHE A C   1 
ATOM   2347 O  O   . PHE A 1 351 ? 51.102 0.349   5.944   1.00 26.65 ? 501 PHE A O   1 
ATOM   2348 C  CB  . PHE A 1 351 ? 49.678 2.745   4.503   1.00 25.83 ? 501 PHE A CB  1 
ATOM   2349 C  CG  . PHE A 1 351 ? 48.857 3.980   4.488   1.00 25.55 ? 501 PHE A CG  1 
ATOM   2350 C  CD1 . PHE A 1 351 ? 47.532 3.926   4.097   1.00 29.80 ? 501 PHE A CD1 1 
ATOM   2351 C  CD2 . PHE A 1 351 ? 49.381 5.178   4.872   1.00 27.45 ? 501 PHE A CD2 1 
ATOM   2352 C  CE1 . PHE A 1 351 ? 46.744 5.068   4.099   1.00 28.19 ? 501 PHE A CE1 1 
ATOM   2353 C  CE2 . PHE A 1 351 ? 48.591 6.326   4.868   1.00 30.17 ? 501 PHE A CE2 1 
ATOM   2354 C  CZ  . PHE A 1 351 ? 47.274 6.256   4.486   1.00 28.72 ? 501 PHE A CZ  1 
ATOM   2355 N  N   . TYR A 1 352 ? 49.358 -0.510  4.744   1.00 24.31 ? 502 TYR A N   1 
ATOM   2356 C  CA  . TYR A 1 352 ? 49.937 -1.821  4.533   1.00 25.17 ? 502 TYR A CA  1 
ATOM   2357 C  C   . TYR A 1 352 ? 49.891 -2.122  3.083   1.00 26.63 ? 502 TYR A C   1 
ATOM   2358 O  O   . TYR A 1 352 ? 48.855 -1.910  2.426   1.00 26.50 ? 502 TYR A O   1 
ATOM   2359 C  CB  . TYR A 1 352 ? 49.134 -2.930  5.291   1.00 25.29 ? 502 TYR A CB  1 
ATOM   2360 C  CG  . TYR A 1 352 ? 48.762 -2.598  6.719   1.00 25.03 ? 502 TYR A CG  1 
ATOM   2361 C  CD1 . TYR A 1 352 ? 47.608 -1.817  6.990   1.00 24.29 ? 502 TYR A CD1 1 
ATOM   2362 C  CD2 . TYR A 1 352 ? 49.503 -3.073  7.797   1.00 26.66 ? 502 TYR A CD2 1 
ATOM   2363 C  CE1 . TYR A 1 352 ? 47.242 -1.515  8.268   1.00 25.34 ? 502 TYR A CE1 1 
ATOM   2364 C  CE2 . TYR A 1 352 ? 49.118 -2.772  9.110   1.00 23.96 ? 502 TYR A CE2 1 
ATOM   2365 C  CZ  . TYR A 1 352 ? 47.999 -1.999  9.324   1.00 24.91 ? 502 TYR A CZ  1 
ATOM   2366 O  OH  . TYR A 1 352 ? 47.572 -1.726  10.573  1.00 22.18 ? 502 TYR A OH  1 
ATOM   2367 N  N   . SER A 1 353 ? 51.024 -2.591  2.548   1.00 29.26 ? 503 SER A N   1 
ATOM   2368 C  CA  . SER A 1 353 ? 51.176 -2.825  1.132   1.00 32.07 ? 503 SER A CA  1 
ATOM   2369 C  C   . SER A 1 353 ? 52.396 -3.707  0.893   1.00 32.31 ? 503 SER A C   1 
ATOM   2370 O  O   . SER A 1 353 ? 53.002 -4.216  1.865   1.00 31.65 ? 503 SER A O   1 
ATOM   2371 C  CB  . SER A 1 353 ? 51.355 -1.476  0.405   1.00 31.88 ? 503 SER A CB  1 
ATOM   2372 O  OG  . SER A 1 353 ? 51.158 -1.702  -0.959  1.00 34.21 ? 503 SER A OG  1 
ATOM   2373 N  N   . LEU A 1 354 ? 52.767 -3.913  -0.374  1.00 34.86 ? 504 LEU A N   1 
ATOM   2374 C  CA  . LEU A 1 354 ? 53.967 -4.714  -0.685  1.00 37.77 ? 504 LEU A CA  1 
ATOM   2375 C  C   . LEU A 1 354 ? 55.229 -4.012  -0.234  1.00 42.52 ? 504 LEU A C   1 
ATOM   2376 O  O   . LEU A 1 354 ? 55.344 -2.789  -0.312  1.00 46.21 ? 504 LEU A O   1 
ATOM   2377 C  CB  . LEU A 1 354 ? 54.070 -5.016  -2.167  1.00 40.89 ? 504 LEU A CB  1 
ATOM   2378 C  CG  . LEU A 1 354 ? 53.142 -6.086  -2.722  1.00 42.18 ? 504 LEU A CG  1 
ATOM   2379 C  CD1 . LEU A 1 354 ? 53.446 -6.291  -4.209  1.00 47.23 ? 504 LEU A CD1 1 
ATOM   2380 C  CD2 . LEU A 1 354 ? 53.275 -7.411  -1.961  1.00 42.88 ? 504 LEU A CD2 1 
ATOM   2381 O  OXT . LEU A 1 354 ? 56.164 -4.680  0.249   1.00 51.08 ? 504 LEU A OXT 1 
HETATM 2382 NA NA  . NA  B 2 .   ? 32.507 -10.720 23.064  1.00 33.67 ? 601 NA  A NA  1 
HETATM 2383 NA NA  . NA  C 2 .   ? 51.835 -5.861  18.020  1.00 33.27 ? 602 NA  A NA  1 
HETATM 2384 X  UNK . UNX D 3 .   ? 29.470 5.167   10.382  1.00 32.28 ? 603 UNX A UNK 1 
HETATM 2385 X  UNK . UNX E 3 .   ? 29.870 5.166   7.487   1.00 35.79 ? 604 UNX A UNK 1 
HETATM 2386 X  UNK . UNX F 3 .   ? 32.287 5.950   7.210   1.00 31.15 ? 605 UNX A UNK 1 
HETATM 2387 X  UNK . UNX G 3 .   ? 34.003 21.140  23.671  1.00 35.88 ? 606 UNX A UNK 1 
HETATM 2388 X  UNK . UNX H 3 .   ? 28.557 0.353   10.295  1.00 31.42 ? 607 UNX A UNK 1 
HETATM 2389 X  UNK . UNX I 3 .   ? 36.201 2.110   9.209   1.00 36.02 ? 608 UNX A UNK 1 
HETATM 2390 X  UNK . UNX J 3 .   ? 15.530 12.617  18.336  1.00 36.47 ? 609 UNX A UNK 1 
HETATM 2391 X  UNK . UNX K 3 .   ? 52.057 13.210  9.275   1.00 48.44 ? 610 UNX A UNK 1 
HETATM 2392 X  UNK . UNX L 3 .   ? 38.770 24.477  11.148  1.00 32.21 ? 611 UNX A UNK 1 
HETATM 2393 X  UNK . UNX M 3 .   ? 28.940 4.333   18.087  1.00 46.20 ? 612 UNX A UNK 1 
HETATM 2394 X  UNK . UNX N 3 .   ? 27.704 2.875   10.623  1.00 26.47 ? 613 UNX A UNK 1 
HETATM 2395 X  UNK . UNX O 3 .   ? 55.222 -6.500  13.343  1.00 22.26 ? 614 UNX A UNK 1 
HETATM 2396 X  UNK . UNX P 3 .   ? 53.188 -4.227  17.695  1.00 39.50 ? 615 UNX A UNK 1 
HETATM 2397 X  UNK . UNX Q 3 .   ? 25.902 -19.682 10.430  1.00 49.47 ? 616 UNX A UNK 1 
HETATM 2398 O  O   . HOH R 4 .   ? 31.333 -12.709 23.533  1.00 38.31 ? 701 HOH A O   1 
HETATM 2399 O  O   . HOH R 4 .   ? 31.740 -9.891  25.095  1.00 39.04 ? 702 HOH A O   1 
HETATM 2400 O  O   . HOH R 4 .   ? 33.649 -8.640  22.664  1.00 38.54 ? 703 HOH A O   1 
HETATM 2401 O  O   . HOH R 4 .   ? 22.334 23.661  12.888  1.00 23.85 ? 704 HOH A O   1 
HETATM 2402 O  O   . HOH R 4 .   ? 47.291 11.288  15.681  1.00 26.35 ? 705 HOH A O   1 
HETATM 2403 O  O   . HOH R 4 .   ? 45.492 -3.846  14.430  1.00 24.00 ? 706 HOH A O   1 
HETATM 2404 O  O   . HOH R 4 .   ? 43.483 -11.781 17.408  1.00 28.52 ? 707 HOH A O   1 
HETATM 2405 O  O   . HOH R 4 .   ? 35.380 19.086  14.192  1.00 21.82 ? 708 HOH A O   1 
HETATM 2406 O  O   . HOH R 4 .   ? 42.879 12.931  18.523  1.00 23.33 ? 709 HOH A O   1 
HETATM 2407 O  O   . HOH R 4 .   ? 47.658 -3.428  12.853  1.00 26.18 ? 710 HOH A O   1 
HETATM 2408 O  O   . HOH R 4 .   ? 36.591 20.768  17.077  1.00 25.17 ? 711 HOH A O   1 
HETATM 2409 O  O   . HOH R 4 .   ? 44.319 -3.256  17.432  1.00 22.64 ? 712 HOH A O   1 
HETATM 2410 O  O   . HOH R 4 .   ? 20.795 12.206  8.435   1.00 27.95 ? 713 HOH A O   1 
HETATM 2411 O  O   . HOH R 4 .   ? 37.793 0.760   1.328   1.00 32.96 ? 714 HOH A O   1 
HETATM 2412 O  O   . HOH R 4 .   ? 45.513 1.669   18.443  1.00 25.07 ? 715 HOH A O   1 
HETATM 2413 O  O   . HOH R 4 .   ? 45.489 18.055  12.757  1.00 30.70 ? 716 HOH A O   1 
HETATM 2414 O  O   . HOH R 4 .   ? 54.012 -5.203  9.303   1.00 28.92 ? 717 HOH A O   1 
HETATM 2415 O  O   . HOH R 4 .   ? 33.323 6.490   10.101  1.00 29.05 ? 718 HOH A O   1 
HETATM 2416 O  O   . HOH R 4 .   ? 33.526 26.598  9.875   1.00 30.93 ? 719 HOH A O   1 
HETATM 2417 O  O   . HOH R 4 .   ? 22.341 15.116  14.167  1.00 26.14 ? 720 HOH A O   1 
HETATM 2418 O  O   . HOH R 4 .   ? 28.104 23.420  17.762  1.00 29.24 ? 721 HOH A O   1 
HETATM 2419 O  O   . HOH R 4 .   ? 46.712 -4.498  16.852  1.00 25.29 ? 722 HOH A O   1 
HETATM 2420 O  O   . HOH R 4 .   ? 29.007 -20.773 9.955   1.00 40.47 ? 723 HOH A O   1 
HETATM 2421 O  O   . HOH R 4 .   ? 51.924 -10.481 5.165   1.00 27.51 ? 724 HOH A O   1 
HETATM 2422 O  O   . HOH R 4 .   ? 47.908 -9.764  -7.631  1.00 31.24 ? 725 HOH A O   1 
HETATM 2423 O  O   . HOH R 4 .   ? 52.928 -7.131  16.156  1.00 33.03 ? 726 HOH A O   1 
HETATM 2424 O  O   . HOH R 4 .   ? 54.425 10.268  12.264  1.00 35.84 ? 727 HOH A O   1 
HETATM 2425 O  O   . HOH R 4 .   ? 45.845 -8.925  18.592  1.00 28.92 ? 728 HOH A O   1 
HETATM 2426 O  O   . HOH R 4 .   ? 38.241 15.777  23.103  1.00 29.29 ? 729 HOH A O   1 
HETATM 2427 O  O   . HOH R 4 .   ? 46.680 -14.343 7.958   1.00 25.78 ? 730 HOH A O   1 
HETATM 2428 O  O   . HOH R 4 .   ? 28.000 -0.847  3.658   1.00 33.98 ? 731 HOH A O   1 
HETATM 2429 O  O   . HOH R 4 .   ? 23.414 3.829   -1.348  1.00 31.82 ? 732 HOH A O   1 
HETATM 2430 O  O   . HOH R 4 .   ? 43.061 -11.281 20.183  1.00 32.04 ? 733 HOH A O   1 
HETATM 2431 O  O   . HOH R 4 .   ? 31.505 -2.636  2.560   1.00 28.68 ? 734 HOH A O   1 
HETATM 2432 O  O   . HOH R 4 .   ? 43.812 18.089  15.217  1.00 32.22 ? 735 HOH A O   1 
HETATM 2433 O  O   . HOH R 4 .   ? 40.813 -11.131 21.774  1.00 30.26 ? 736 HOH A O   1 
HETATM 2434 O  O   . HOH R 4 .   ? 39.140 -3.293  -4.631  1.00 37.84 ? 737 HOH A O   1 
HETATM 2435 O  O   . HOH R 4 .   ? 48.042 10.373  12.981  1.00 28.66 ? 738 HOH A O   1 
HETATM 2436 O  O   . HOH R 4 .   ? 29.059 19.270  23.189  1.00 32.92 ? 739 HOH A O   1 
HETATM 2437 O  O   . HOH R 4 .   ? 29.084 6.087   3.246   1.00 26.29 ? 740 HOH A O   1 
HETATM 2438 O  O   . HOH R 4 .   ? 21.257 -10.260 14.867  1.00 30.56 ? 741 HOH A O   1 
HETATM 2439 O  O   . HOH R 4 .   ? 46.927 -6.455  18.790  1.00 32.90 ? 742 HOH A O   1 
HETATM 2440 O  O   . HOH R 4 .   ? 44.528 -16.348 12.871  1.00 38.78 ? 743 HOH A O   1 
HETATM 2441 O  O   . HOH R 4 .   ? 49.840 17.623  19.548  1.00 41.00 ? 744 HOH A O   1 
HETATM 2442 O  O   . HOH R 4 .   ? 36.321 4.722   -0.197  1.00 37.81 ? 745 HOH A O   1 
HETATM 2443 O  O   . HOH R 4 .   ? 41.776 -19.206 7.791   1.00 37.56 ? 746 HOH A O   1 
HETATM 2444 O  O   . HOH R 4 .   ? 21.781 17.605  -1.393  1.00 34.18 ? 747 HOH A O   1 
HETATM 2445 O  O   . HOH R 4 .   ? 52.060 7.317   3.423   1.00 35.86 ? 748 HOH A O   1 
HETATM 2446 O  O   . HOH R 4 .   ? 42.458 0.712   23.159  1.00 33.74 ? 749 HOH A O   1 
HETATM 2447 O  O   . HOH R 4 .   ? 36.815 2.918   6.490   1.00 34.62 ? 750 HOH A O   1 
HETATM 2448 O  O   . HOH R 4 .   ? 39.923 -15.000 18.028  1.00 30.35 ? 751 HOH A O   1 
HETATM 2449 O  O   . HOH R 4 .   ? 46.228 21.528  9.591   1.00 34.67 ? 752 HOH A O   1 
HETATM 2450 O  O   . HOH R 4 .   ? 36.699 -13.813 -2.891  1.00 33.04 ? 753 HOH A O   1 
HETATM 2451 O  O   . HOH R 4 .   ? 19.133 -0.690  -2.370  1.00 35.30 ? 754 HOH A O   1 
HETATM 2452 O  O   . HOH R 4 .   ? 34.006 -13.196 -4.071  1.00 45.41 ? 755 HOH A O   1 
HETATM 2453 O  O   . HOH R 4 .   ? 31.300 23.620  13.092  1.00 33.24 ? 756 HOH A O   1 
HETATM 2454 O  O   . HOH R 4 .   ? 32.942 7.464   1.107   1.00 35.44 ? 757 HOH A O   1 
HETATM 2455 O  O   . HOH R 4 .   ? 19.373 -11.508 17.915  1.00 38.49 ? 758 HOH A O   1 
HETATM 2456 O  O   . HOH R 4 .   ? 44.910 5.295   -4.152  1.00 35.53 ? 759 HOH A O   1 
HETATM 2457 O  O   . HOH R 4 .   ? 28.986 8.891   18.466  1.00 32.68 ? 760 HOH A O   1 
HETATM 2458 O  O   . HOH R 4 .   ? 50.064 -13.470 5.294   1.00 34.79 ? 761 HOH A O   1 
HETATM 2459 O  O   . HOH R 4 .   ? 45.911 11.349  18.201  1.00 30.50 ? 762 HOH A O   1 
HETATM 2460 O  O   . HOH R 4 .   ? 17.320 20.396  15.314  1.00 32.31 ? 763 HOH A O   1 
HETATM 2461 O  O   . HOH R 4 .   ? 43.415 14.314  26.699  1.00 28.68 ? 764 HOH A O   1 
HETATM 2462 O  O   . HOH R 4 .   ? 42.749 -13.828 21.169  1.00 34.26 ? 765 HOH A O   1 
HETATM 2463 O  O   . HOH R 4 .   ? 42.939 23.513  7.869   1.00 32.29 ? 766 HOH A O   1 
HETATM 2464 O  O   . HOH R 4 .   ? 41.528 -13.635 16.308  1.00 32.70 ? 767 HOH A O   1 
HETATM 2465 O  O   . HOH R 4 .   ? 40.056 -5.612  22.330  1.00 40.25 ? 768 HOH A O   1 
HETATM 2466 O  O   . HOH R 4 .   ? 44.227 -4.979  20.668  1.00 35.23 ? 769 HOH A O   1 
HETATM 2467 O  O   . HOH R 4 .   ? 46.712 -4.252  21.127  1.00 39.78 ? 770 HOH A O   1 
HETATM 2468 O  O   . HOH R 4 .   ? 24.927 -5.857  -0.712  1.00 36.17 ? 771 HOH A O   1 
HETATM 2469 O  O   . HOH R 4 .   ? 36.084 4.047   11.018  1.00 29.09 ? 772 HOH A O   1 
HETATM 2470 O  O   . HOH R 4 .   ? 29.362 7.930   15.320  1.00 38.91 ? 773 HOH A O   1 
HETATM 2471 O  O   . HOH R 4 .   ? 35.836 -0.769  -0.079  1.00 32.85 ? 774 HOH A O   1 
HETATM 2472 O  O   . HOH R 4 .   ? 25.741 3.220   20.805  1.00 41.22 ? 775 HOH A O   1 
HETATM 2473 O  O   . HOH R 4 .   ? 39.618 21.867  17.990  1.00 39.90 ? 776 HOH A O   1 
HETATM 2474 O  O   . HOH R 4 .   ? 33.645 4.836   12.244  1.00 44.76 ? 777 HOH A O   1 
HETATM 2475 O  O   . HOH R 4 .   ? 8.220  2.811   11.803  1.00 53.53 ? 778 HOH A O   1 
HETATM 2476 O  O   . HOH R 4 .   ? 55.797 -9.913  3.394   1.00 45.98 ? 779 HOH A O   1 
HETATM 2477 O  O   . HOH R 4 .   ? 55.835 -7.638  0.881   1.00 42.46 ? 780 HOH A O   1 
HETATM 2478 O  O   . HOH R 4 .   ? 36.628 3.249   -2.595  1.00 39.47 ? 781 HOH A O   1 
HETATM 2479 O  O   . HOH R 4 .   ? 25.847 -15.036 18.653  1.00 46.54 ? 782 HOH A O   1 
HETATM 2480 O  O   A HOH R 4 .   ? 26.235 17.129  -3.481  0.50 38.40 ? 783 HOH A O   1 
HETATM 2481 O  O   B HOH R 4 .   ? 27.530 17.089  -4.476  0.50 35.61 ? 783 HOH A O   1 
HETATM 2482 O  O   . HOH R 4 .   ? 23.721 19.012  19.554  1.00 37.56 ? 784 HOH A O   1 
HETATM 2483 O  O   . HOH R 4 .   ? 38.916 -0.281  -6.311  1.00 39.79 ? 785 HOH A O   1 
HETATM 2484 O  O   . HOH R 4 .   ? 41.106 19.798  20.428  1.00 39.16 ? 786 HOH A O   1 
HETATM 2485 O  O   . HOH R 4 .   ? 51.441 2.028   16.780  1.00 45.95 ? 787 HOH A O   1 
HETATM 2486 O  O   . HOH R 4 .   ? 45.479 -18.527 6.181   1.00 44.33 ? 788 HOH A O   1 
HETATM 2487 O  O   . HOH R 4 .   ? 46.048 -15.431 -5.675  1.00 39.17 ? 789 HOH A O   1 
HETATM 2488 O  O   . HOH R 4 .   ? 38.441 -2.896  -7.489  1.00 41.09 ? 790 HOH A O   1 
HETATM 2489 O  O   . HOH R 4 .   ? 28.404 3.131   15.883  1.00 35.78 ? 791 HOH A O   1 
HETATM 2490 O  O   . HOH R 4 .   ? 53.926 -1.081  14.615  1.00 47.78 ? 792 HOH A O   1 
HETATM 2491 O  O   . HOH R 4 .   ? 48.364 -12.645 -6.496  1.00 40.51 ? 793 HOH A O   1 
HETATM 2492 O  O   . HOH R 4 .   ? 57.285 -3.299  7.990   1.00 43.83 ? 794 HOH A O   1 
HETATM 2493 O  O   . HOH R 4 .   ? 42.312 -18.290 10.111  1.00 41.49 ? 795 HOH A O   1 
HETATM 2494 O  O   . HOH R 4 .   ? 21.296 17.015  17.040  1.00 37.18 ? 796 HOH A O   1 
HETATM 2495 O  O   . HOH R 4 .   ? 50.135 -4.138  -3.986  1.00 45.83 ? 797 HOH A O   1 
HETATM 2496 O  O   . HOH R 4 .   ? 29.157 0.958   16.647  1.00 37.29 ? 798 HOH A O   1 
HETATM 2497 O  O   . HOH R 4 .   ? 27.877 -0.584  19.223  1.00 50.43 ? 799 HOH A O   1 
HETATM 2498 O  O   . HOH R 4 .   ? 32.726 -7.587  19.112  1.00 39.91 ? 800 HOH A O   1 
HETATM 2499 O  O   . HOH R 4 .   ? 34.152 5.248   14.745  1.00 42.57 ? 801 HOH A O   1 
HETATM 2500 O  O   . HOH R 4 .   ? 35.463 2.352   15.327  1.00 49.46 ? 802 HOH A O   1 
HETATM 2501 O  O   . HOH R 4 .   ? 32.272 -20.127 0.841   1.00 35.91 ? 803 HOH A O   1 
HETATM 2502 O  O   . HOH R 4 .   ? 47.270 17.241  -2.522  1.00 42.64 ? 804 HOH A O   1 
HETATM 2503 O  O   . HOH R 4 .   ? 32.257 -12.107 26.494  1.00 36.89 ? 805 HOH A O   1 
HETATM 2504 O  O   . HOH R 4 .   ? 38.124 31.493  1.366   1.00 32.10 ? 806 HOH A O   1 
HETATM 2505 O  O   . HOH R 4 .   ? 32.093 -4.008  -1.605  1.00 40.88 ? 807 HOH A O   1 
HETATM 2506 O  O   . HOH R 4 .   ? 31.184 -9.757  -1.469  1.00 39.59 ? 808 HOH A O   1 
HETATM 2507 O  O   . HOH R 4 .   ? 49.953 -4.876  19.557  1.00 41.96 ? 809 HOH A O   1 
HETATM 2508 O  O   . HOH R 4 .   ? 13.356 2.509   -1.320  1.00 39.28 ? 810 HOH A O   1 
HETATM 2509 O  O   . HOH R 4 .   ? 9.074  -3.317  13.075  1.00 44.32 ? 811 HOH A O   1 
HETATM 2510 O  O   . HOH R 4 .   ? 8.691  7.320   13.560  1.00 36.83 ? 812 HOH A O   1 
HETATM 2511 O  O   . HOH R 4 .   ? 52.256 4.742   2.379   1.00 41.91 ? 813 HOH A O   1 
HETATM 2512 O  O   . HOH R 4 .   ? 37.014 3.314   2.095   1.00 39.46 ? 814 HOH A O   1 
HETATM 2513 O  O   . HOH R 4 .   ? 41.867 10.424  23.892  1.00 40.59 ? 815 HOH A O   1 
HETATM 2514 O  O   . HOH R 4 .   ? 48.203 18.283  13.587  1.00 49.50 ? 816 HOH A O   1 
HETATM 2515 O  O   . HOH R 4 .   ? 39.926 20.284  22.601  1.00 37.18 ? 817 HOH A O   1 
HETATM 2516 O  O   . HOH R 4 .   ? 37.224 23.368  18.550  1.00 47.42 ? 818 HOH A O   1 
HETATM 2517 O  O   . HOH R 4 .   ? 37.686 26.611  12.631  1.00 44.26 ? 819 HOH A O   1 
HETATM 2518 O  O   . HOH R 4 .   ? 34.322 -19.396 13.172  1.00 40.19 ? 820 HOH A O   1 
HETATM 2519 O  O   . HOH R 4 .   ? 27.141 5.897   21.710  1.00 45.87 ? 821 HOH A O   1 
HETATM 2520 O  O   . HOH R 4 .   ? 25.858 4.251   -0.756  1.00 44.16 ? 822 HOH A O   1 
HETATM 2521 O  O   . HOH R 4 .   ? 26.580 14.564  -5.065  1.00 46.30 ? 823 HOH A O   1 
HETATM 2522 O  O   . HOH R 4 .   ? 46.341 2.631   22.409  1.00 44.50 ? 824 HOH A O   1 
HETATM 2523 O  O   . HOH R 4 .   ? 52.003 4.701   17.529  1.00 53.21 ? 825 HOH A O   1 
HETATM 2524 O  O   . HOH R 4 .   ? 38.874 -14.998 -4.179  1.00 44.98 ? 826 HOH A O   1 
HETATM 2525 O  O   . HOH R 4 .   ? 45.021 -9.528  21.168  1.00 45.92 ? 827 HOH A O   1 
HETATM 2526 O  O   . HOH R 4 .   ? 39.773 -17.556 17.030  1.00 46.98 ? 828 HOH A O   1 
HETATM 2527 O  O   . HOH R 4 .   ? 39.724 -17.353 13.757  1.00 46.67 ? 829 HOH A O   1 
HETATM 2528 O  O   . HOH R 4 .   ? 8.069  -0.023  9.749   1.00 47.24 ? 830 HOH A O   1 
HETATM 2529 O  O   . HOH R 4 .   ? 11.584 -9.807  9.432   1.00 50.74 ? 831 HOH A O   1 
HETATM 2530 O  O   . HOH R 4 .   ? 20.923 -9.483  23.374  1.00 58.77 ? 832 HOH A O   1 
HETATM 2531 O  O   . HOH R 4 .   ? 54.991 1.214   13.866  1.00 48.34 ? 833 HOH A O   1 
HETATM 2532 O  O   . HOH R 4 .   ? 49.005 5.024   -2.981  1.00 40.66 ? 834 HOH A O   1 
HETATM 2533 O  O   . HOH R 4 .   ? 48.924 -6.601  -8.755  1.00 47.02 ? 835 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . PRO A 45  ? 1.1869 1.0236 0.8071 0.0603  -0.0102 -0.1631 195 PRO A N   
2    C CA  . PRO A 45  ? 1.1426 0.9842 0.7498 0.0660  0.0040  -0.1462 195 PRO A CA  
3    C C   . PRO A 45  ? 1.0825 0.9178 0.6907 0.0707  0.0268  -0.1428 195 PRO A C   
4    O O   . PRO A 45  ? 0.9472 0.7867 0.5889 0.0658  0.0340  -0.1383 195 PRO A O   
5    C CB  . PRO A 45  ? 1.1529 1.0107 0.7936 0.0584  0.0001  -0.1314 195 PRO A CB  
6    C CG  . PRO A 45  ? 1.1553 1.0160 0.8297 0.0491  -0.0108 -0.1391 195 PRO A CG  
7    C CD  . PRO A 45  ? 1.1784 1.0251 0.8435 0.0502  -0.0139 -0.1580 195 PRO A CD  
8    N N   . GLU A 46  ? 1.0659 0.8909 0.6374 0.0807  0.0381  -0.1450 196 GLU A N   
9    C CA  . GLU A 46  ? 1.0347 0.8526 0.6067 0.0862  0.0606  -0.1437 196 GLU A CA  
10   C C   . GLU A 46  ? 0.9574 0.7869 0.5634 0.0830  0.0744  -0.1259 196 GLU A C   
11   O O   . GLU A 46  ? 0.9891 0.8167 0.6153 0.0833  0.0877  -0.1257 196 GLU A O   
12   C CB  . GLU A 46  ? 1.0688 0.8751 0.5935 0.0983  0.0726  -0.1452 196 GLU A CB  
13   N N   . GLU A 47  ? 0.9412 0.7826 0.5543 0.0802  0.0702  -0.1117 197 GLU A N   
14   C CA  . GLU A 47  ? 0.8637 0.7161 0.5065 0.0776  0.0817  -0.0951 197 GLU A CA  
15   C C   . GLU A 47  ? 0.7207 0.5817 0.4063 0.0682  0.0753  -0.0940 197 GLU A C   
16   O O   . GLU A 47  ? 0.6702 0.5386 0.3828 0.0662  0.0846  -0.0835 197 GLU A O   
17   C CB  . GLU A 47  ? 0.9315 0.7922 0.5659 0.0780  0.0783  -0.0813 197 GLU A CB  
18   C CG  . GLU A 47  ? 1.0020 0.8677 0.6468 0.0808  0.0964  -0.0651 197 GLU A CG  
19   C CD  . GLU A 47  ? 1.1142 0.9694 0.7329 0.0906  0.1155  -0.0649 197 GLU A CD  
20   O OE1 . GLU A 47  ? 1.2492 1.0934 0.8294 0.0969  0.1127  -0.0744 197 GLU A OE1 
21   O OE2 . GLU A 47  ? 1.1801 1.0380 0.8171 0.0922  0.1333  -0.0555 197 GLU A OE2 
22   N N   . LEU A 48  ? 0.6612 0.5217 0.3534 0.0626  0.0591  -0.1040 198 LEU A N   
23   C CA  . LEU A 48  ? 0.6027 0.4708 0.3327 0.0543  0.0536  -0.1015 198 LEU A CA  
24   C C   . LEU A 48  ? 0.5766 0.4411 0.3281 0.0548  0.0658  -0.1024 198 LEU A C   
25   O O   . LEU A 48  ? 0.5529 0.4059 0.2941 0.0588  0.0713  -0.1135 198 LEU A O   
26   C CB  . LEU A 48  ? 0.6470 0.5138 0.3816 0.0485  0.0360  -0.1125 198 LEU A CB  
27   C CG  . LEU A 48  ? 0.5997 0.4726 0.3712 0.0405  0.0314  -0.1097 198 LEU A CG  
28   C CD1 . LEU A 48  ? 0.6113 0.4979 0.3980 0.0363  0.0273  -0.0962 198 LEU A CD1 
29   C CD2 . LEU A 48  ? 0.6136 0.4815 0.3905 0.0356  0.0178  -0.1229 198 LEU A CD2 
30   N N   . VAL A 49  ? 0.5327 0.4066 0.3145 0.0509  0.0690  -0.0916 199 VAL A N   
31   C CA  . VAL A 49  ? 0.5272 0.3988 0.3311 0.0517  0.0788  -0.0913 199 VAL A CA  
32   C C   . VAL A 49  ? 0.5213 0.3871 0.3389 0.0472  0.0700  -0.1013 199 VAL A C   
33   O O   . VAL A 49  ? 0.5147 0.3864 0.3467 0.0406  0.0583  -0.0992 199 VAL A O   
34   C CB  . VAL A 49  ? 0.4891 0.3725 0.3201 0.0496  0.0836  -0.0770 199 VAL A CB  
35   C CG1 . VAL A 49  ? 0.4937 0.3752 0.3500 0.0505  0.0913  -0.0768 199 VAL A CG1 
36   C CG2 . VAL A 49  ? 0.5181 0.4059 0.3388 0.0540  0.0938  -0.0675 199 VAL A CG2 
37   N N   . LYS A 50  ? 0.5199 0.3742 0.3346 0.0510  0.0769  -0.1114 200 LYS A N   
38   C CA  A LYS A 50  ? 0.5398 0.3854 0.3665 0.0476  0.0702  -0.1223 200 LYS A CA  
39   C CA  B LYS A 50  ? 0.5431 0.3890 0.3698 0.0475  0.0700  -0.1221 200 LYS A CA  
40   C C   . LYS A 50  ? 0.5096 0.3593 0.3716 0.0445  0.0727  -0.1143 200 LYS A C   
41   O O   . LYS A 50  ? 0.5046 0.3617 0.3793 0.0465  0.0809  -0.1033 200 LYS A O   
42   C CB  A LYS A 50  ? 0.5761 0.4061 0.3847 0.0537  0.0773  -0.1372 200 LYS A CB  
43   C CB  B LYS A 50  ? 0.5843 0.4146 0.3920 0.0534  0.0762  -0.1373 200 LYS A CB  
44   C CG  A LYS A 50  ? 0.6068 0.4285 0.3837 0.0546  0.0670  -0.1514 200 LYS A CG  
45   C CG  B LYS A 50  ? 0.6196 0.4448 0.3877 0.0579  0.0737  -0.1451 200 LYS A CG  
46   C CD  A LYS A 50  ? 0.5877 0.4202 0.3545 0.0508  0.0545  -0.1451 200 LYS A CD  
47   C CD  B LYS A 50  ? 0.6576 0.4664 0.4074 0.0609  0.0710  -0.1646 200 LYS A CD  
48   N N   . PRO A 51  ? 0.5372 0.3815 0.4157 0.0398  0.0654  -0.1200 201 PRO A N   
49   C CA  . PRO A 51  ? 0.5310 0.3792 0.4409 0.0372  0.0666  -0.1105 201 PRO A CA  
50   C C   . PRO A 51  ? 0.5242 0.3709 0.4479 0.0431  0.0798  -0.1059 201 PRO A C   
51   O O   . PRO A 51  ? 0.5179 0.3739 0.4597 0.0426  0.0811  -0.0936 201 PRO A O   
52   C CB  . PRO A 51  ? 0.5685 0.4075 0.4900 0.0325  0.0589  -0.1191 201 PRO A CB  
53   C CG  . PRO A 51  ? 0.5907 0.4281 0.4919 0.0294  0.0482  -0.1291 201 PRO A CG  
54   C CD  . PRO A 51  ? 0.5791 0.4139 0.4505 0.0363  0.0549  -0.1342 201 PRO A CD  
55   N N   . GLU A 52  ? 0.5425 0.3779 0.4578 0.0489  0.0893  -0.1157 202 GLU A N   
56   C CA  . GLU A 52  ? 0.5755 0.4103 0.5072 0.0550  0.1027  -0.1112 202 GLU A CA  
57   C C   . GLU A 52  ? 0.5641 0.4130 0.5001 0.0570  0.1083  -0.0975 202 GLU A C   
58   O O   . GLU A 52  ? 0.5046 0.3608 0.4661 0.0574  0.1104  -0.0871 202 GLU A O   
59   C CB  . GLU A 52  ? 0.6370 0.4577 0.5552 0.0621  0.1141  -0.1242 202 GLU A CB  
60   C CG  . GLU A 52  ? 0.6659 0.4865 0.6031 0.0691  0.1294  -0.1195 202 GLU A CG  
61   C CD  . GLU A 52  ? 0.7076 0.5298 0.6809 0.0675  0.1269  -0.1120 202 GLU A CD  
62   O OE1 . GLU A 52  ? 0.6974 0.5125 0.6782 0.0631  0.1179  -0.1163 202 GLU A OE1 
63   O OE2 . GLU A 52  ? 0.6975 0.5280 0.6922 0.0710  0.1338  -0.1015 202 GLU A OE2 
64   N N   . GLU A 53  ? 0.5550 0.4077 0.4672 0.0578  0.1095  -0.0971 203 GLU A N   
65   C CA  . GLU A 53  ? 0.5305 0.3952 0.4474 0.0596  0.1158  -0.0849 203 GLU A CA  
66   C C   . GLU A 53  ? 0.4711 0.3482 0.4030 0.0532  0.1043  -0.0741 203 GLU A C   
67   O O   . GLU A 53  ? 0.4414 0.3281 0.3941 0.0536  0.1067  -0.0637 203 GLU A O   
68   C CB  . GLU A 53  ? 0.5641 0.4276 0.4501 0.0631  0.1217  -0.0869 203 GLU A CB  
69   C CG  . GLU A 53  ? 0.5894 0.4650 0.4806 0.0638  0.1274  -0.0737 203 GLU A CG  
70   C CD  . GLU A 53  ? 0.6877 0.5605 0.5473 0.0686  0.1358  -0.0739 203 GLU A CD  
71   O OE1 . GLU A 53  ? 0.6411 0.5025 0.4721 0.0719  0.1366  -0.0850 203 GLU A OE1 
72   O OE2 . GLU A 53  ? 0.7366 0.6182 0.6003 0.0691  0.1412  -0.0628 203 GLU A OE2 
73   N N   . LEU A 54  ? 0.4646 0.3416 0.3873 0.0476  0.0916  -0.0769 204 LEU A N   
74   C CA  . LEU A 54  ? 0.4449 0.3327 0.3798 0.0420  0.0815  -0.0673 204 LEU A CA  
75   C C   . LEU A 54  ? 0.3989 0.2895 0.3617 0.0415  0.0805  -0.0605 204 LEU A C   
76   O O   . LEU A 54  ? 0.3952 0.2957 0.3697 0.0399  0.0768  -0.0508 204 LEU A O   
77   C CB  . LEU A 54  ? 0.4533 0.3396 0.3782 0.0363  0.0690  -0.0721 204 LEU A CB  
78   C CG  . LEU A 54  ? 0.4729 0.3704 0.4018 0.0319  0.0609  -0.0629 204 LEU A CG  
79   C CD1 . LEU A 54  ? 0.5093 0.4120 0.4199 0.0332  0.0621  -0.0606 204 LEU A CD1 
80   C CD2 . LEU A 54  ? 0.4966 0.3933 0.4280 0.0261  0.0500  -0.0655 204 LEU A CD2 
81   N N   . SER A 55  ? 0.4186 0.2996 0.3907 0.0431  0.0831  -0.0661 205 SER A N   
82   C CA  . SER A 55  ? 0.4083 0.2899 0.4053 0.0433  0.0814  -0.0597 205 SER A CA  
83   C C   . SER A 55  ? 0.4077 0.2976 0.4228 0.0478  0.0874  -0.0507 205 SER A C   
84   O O   . SER A 55  ? 0.3815 0.2750 0.4159 0.0482  0.0836  -0.0432 205 SER A O   
85   C CB  . SER A 55  ? 0.4077 0.2754 0.4110 0.0447  0.0841  -0.0682 205 SER A CB  
86   O OG  . SER A 55  ? 0.4236 0.2855 0.4289 0.0513  0.0961  -0.0733 205 SER A OG  
87   N N   . LYS A 56  ? 0.4176 0.3105 0.4267 0.0513  0.0965  -0.0513 206 LYS A N   
88   C CA  . LYS A 56  ? 0.4132 0.3141 0.4423 0.0553  0.1032  -0.0440 206 LYS A CA  
89   C C   . LYS A 56  ? 0.3780 0.2916 0.4098 0.0527  0.0984  -0.0353 206 LYS A C   
90   O O   . LYS A 56  ? 0.3515 0.2731 0.4021 0.0553  0.1028  -0.0292 206 LYS A O   
91   C CB  . LYS A 56  ? 0.4646 0.3608 0.4882 0.0612  0.1185  -0.0491 206 LYS A CB  
92   C CG  . LYS A 56  ? 0.5208 0.4034 0.5427 0.0649  0.1248  -0.0589 206 LYS A CG  
93   C CD  . LYS A 56  ? 0.5755 0.4540 0.5899 0.0714  0.1413  -0.0635 206 LYS A CD  
94   C CE  . LYS A 56  ? 0.6424 0.5050 0.6473 0.0752  0.1474  -0.0763 206 LYS A CE  
95   N NZ  . LYS A 56  ? 0.7402 0.5981 0.7280 0.0817  0.1636  -0.0813 206 LYS A NZ  
96   N N   . TYR A 57  ? 0.3895 0.3054 0.4051 0.0476  0.0894  -0.0350 207 TYR A N   
97   C CA  . TYR A 57  ? 0.3854 0.3122 0.4031 0.0449  0.0845  -0.0276 207 TYR A CA  
98   C C   . TYR A 57  ? 0.3849 0.3195 0.4258 0.0446  0.0769  -0.0199 207 TYR A C   
99   O O   . TYR A 57  ? 0.3825 0.3140 0.4309 0.0446  0.0712  -0.0191 207 TYR A O   
100  C CB  . TYR A 57  ? 0.3768 0.3041 0.3738 0.0398  0.0758  -0.0290 207 TYR A CB  
101  C CG  . TYR A 57  ? 0.3626 0.2857 0.3348 0.0403  0.0807  -0.0343 207 TYR A CG  
102  C CD1 . TYR A 57  ? 0.3884 0.3055 0.3532 0.0452  0.0927  -0.0388 207 TYR A CD1 
103  C CD2 . TYR A 57  ? 0.3833 0.3086 0.3394 0.0365  0.0732  -0.0344 207 TYR A CD2 
104  C CE1 . TYR A 57  ? 0.4068 0.3194 0.3461 0.0466  0.0964  -0.0432 207 TYR A CE1 
105  C CE2 . TYR A 57  ? 0.4046 0.3262 0.3375 0.0377  0.0760  -0.0386 207 TYR A CE2 
106  C CZ  . TYR A 57  ? 0.4261 0.3411 0.3493 0.0429  0.0874  -0.0429 207 TYR A CZ  
107  O OH  . TYR A 57  ? 0.4392 0.3496 0.3357 0.0451  0.0901  -0.0467 207 TYR A OH  
108  N N   . ARG A 58  ? 0.3772 0.3214 0.4279 0.0442  0.0763  -0.0142 208 ARG A N   
109  C CA  . ARG A 58  ? 0.3782 0.3307 0.4500 0.0444  0.0683  -0.0078 208 ARG A CA  
110  C C   . ARG A 58  ? 0.3681 0.3283 0.4367 0.0409  0.0632  -0.0045 208 ARG A C   
111  O O   . ARG A 58  ? 0.3558 0.3156 0.4120 0.0398  0.0693  -0.0057 208 ARG A O   
112  C CB  . ARG A 58  ? 0.4757 0.4322 0.5740 0.0491  0.0755  -0.0054 208 ARG A CB  
113  C CG  . ARG A 58  ? 0.5528 0.5131 0.6552 0.0502  0.0876  -0.0047 208 ARG A CG  
114  C CD  . ARG A 58  ? 0.7076 0.6687 0.8326 0.0557  0.1001  -0.0041 208 ARG A CD  
115  N NE  . ARG A 58  ? 0.7787 0.7487 0.9360 0.0573  0.0931  0.0008  208 ARG A NE  
116  C CZ  . ARG A 58  ? 0.8617 0.8301 1.0300 0.0597  0.0859  0.0014  208 ARG A CZ  
117  N NH1 . ARG A 58  ? 0.9727 0.9502 1.1699 0.0615  0.0781  0.0064  208 ARG A NH1 
118  N NH2 . ARG A 58  ? 0.8173 0.7750 0.9695 0.0604  0.0859  -0.0026 208 ARG A NH2 
119  N N   . GLN A 59  ? 0.3524 0.3187 0.4316 0.0398  0.0524  -0.0005 209 GLN A N   
120  C CA  . GLN A 59  ? 0.3261 0.2997 0.4075 0.0371  0.0480  0.0019  209 GLN A CA  
121  C C   . GLN A 59  ? 0.3155 0.2942 0.4143 0.0384  0.0580  0.0039  209 GLN A C   
122  O O   . GLN A 59  ? 0.3351 0.3177 0.4583 0.0415  0.0611  0.0057  209 GLN A O   
123  C CB  . GLN A 59  ? 0.3201 0.2989 0.4113 0.0367  0.0348  0.0046  209 GLN A CB  
124  C CG  . GLN A 59  ? 0.3136 0.2986 0.4077 0.0339  0.0296  0.0058  209 GLN A CG  
125  C CD  . GLN A 59  ? 0.3424 0.3315 0.4427 0.0340  0.0154  0.0069  209 GLN A CD  
126  O OE1 . GLN A 59  ? 0.3426 0.3283 0.4264 0.0335  0.0085  0.0067  209 GLN A OE1 
127  N NE2 . GLN A 59  ? 0.3602 0.3562 0.4838 0.0348  0.0110  0.0080  209 GLN A NE2 
128  N N   . VAL A 60  ? 0.3202 0.2989 0.4075 0.0364  0.0632  0.0042  210 VAL A N   
129  C CA  . VAL A 60  ? 0.3523 0.3351 0.4547 0.0373  0.0741  0.0076  210 VAL A CA  
130  C C   . VAL A 60  ? 0.3697 0.3589 0.4824 0.0339  0.0679  0.0108  210 VAL A C   
131  O O   . VAL A 60  ? 0.3518 0.3459 0.4857 0.0342  0.0745  0.0145  210 VAL A O   
132  C CB  . VAL A 60  ? 0.3533 0.3295 0.4353 0.0392  0.0887  0.0068  210 VAL A CB  
133  C CG1 . VAL A 60  ? 0.3629 0.3321 0.4388 0.0433  0.0966  0.0024  210 VAL A CG1 
134  C CG2 . VAL A 60  ? 0.3690 0.3409 0.4220 0.0365  0.0847  0.0053  210 VAL A CG2 
135  N N   . ALA A 61  ? 0.3478 0.3368 0.4474 0.0309  0.0559  0.0094  211 ALA A N   
136  C CA  . ALA A 61  ? 0.3349 0.3292 0.4456 0.0279  0.0485  0.0111  211 ALA A CA  
137  C C   . ALA A 61  ? 0.3222 0.3161 0.4213 0.0261  0.0338  0.0084  211 ALA A C   
138  O O   . ALA A 61  ? 0.3027 0.2917 0.3804 0.0262  0.0315  0.0064  211 ALA A O   
139  C CB  . ALA A 61  ? 0.3493 0.3417 0.4500 0.0264  0.0565  0.0137  211 ALA A CB  
140  N N   . SER A 62  ? 0.3175 0.3163 0.4314 0.0246  0.0242  0.0082  212 SER A N   
141  C CA  . SER A 62  ? 0.2929 0.2909 0.3946 0.0236  0.0113  0.0056  212 SER A CA  
142  C C   . SER A 62  ? 0.3043 0.3054 0.4171 0.0210  0.0063  0.0048  212 SER A C   
143  O O   . SER A 62  ? 0.3305 0.3369 0.4690 0.0208  0.0026  0.0046  212 SER A O   
144  C CB  . SER A 62  ? 0.2910 0.2906 0.3994 0.0262  0.0014  0.0047  212 SER A CB  
145  O OG  . SER A 62  ? 0.2798 0.2771 0.3706 0.0260  -0.0088 0.0027  212 SER A OG  
146  N N   . HIS A 63  ? 0.2769 0.2749 0.3729 0.0190  0.0070  0.0043  213 HIS A N   
147  C CA  . HIS A 63  ? 0.2907 0.2899 0.3958 0.0167  0.0039  0.0036  213 HIS A CA  
148  C C   . HIS A 63  ? 0.2921 0.2899 0.3859 0.0165  -0.0090 -0.0011 213 HIS A C   
149  O O   . HIS A 63  ? 0.2751 0.2693 0.3456 0.0170  -0.0096 -0.0018 213 HIS A O   
150  C CB  . HIS A 63  ? 0.2885 0.2842 0.3817 0.0154  0.0138  0.0068  213 HIS A CB  
151  C CG  . HIS A 63  ? 0.3249 0.3203 0.4227 0.0165  0.0277  0.0116  213 HIS A CG  
152  N ND1 . HIS A 63  ? 0.3636 0.3622 0.4871 0.0161  0.0345  0.0152  213 HIS A ND1 
153  C CD2 . HIS A 63  ? 0.3380 0.3298 0.4174 0.0182  0.0365  0.0133  213 HIS A CD2 
154  C CE1 . HIS A 63  ? 0.3783 0.3751 0.4974 0.0181  0.0482  0.0193  213 HIS A CE1 
155  N NE2 . HIS A 63  ? 0.3494 0.3417 0.4405 0.0195  0.0490  0.0177  213 HIS A NE2 
156  N N   . VAL A 64  ? 0.3367 0.3372 0.4469 0.0161  -0.0191 -0.0047 214 VAL A N   
157  C CA  . VAL A 64  ? 0.3562 0.3544 0.4531 0.0169  -0.0313 -0.0101 214 VAL A CA  
158  C C   . VAL A 64  ? 0.3634 0.3596 0.4635 0.0147  -0.0338 -0.0135 214 VAL A C   
159  O O   . VAL A 64  ? 0.3676 0.3605 0.4529 0.0158  -0.0418 -0.0184 214 VAL A O   
160  C CB  . VAL A 64  ? 0.3866 0.3876 0.4927 0.0194  -0.0446 -0.0137 214 VAL A CB  
161  C CG1 . VAL A 64  ? 0.4093 0.4106 0.5080 0.0225  -0.0429 -0.0101 214 VAL A CG1 
162  C CG2 . VAL A 64  ? 0.3939 0.4004 0.5344 0.0177  -0.0487 -0.0154 214 VAL A CG2 
163  N N   . GLY A 65  ? 0.3239 0.3209 0.4415 0.0121  -0.0261 -0.0107 215 GLY A N   
164  C CA  . GLY A 65  ? 0.3414 0.3358 0.4670 0.0099  -0.0289 -0.0138 215 GLY A CA  
165  C C   . GLY A 65  ? 0.3230 0.3127 0.4312 0.0095  -0.0218 -0.0113 215 GLY A C   
166  O O   . GLY A 65  ? 0.3562 0.3434 0.4750 0.0078  -0.0216 -0.0124 215 GLY A O   
167  N N   . LEU A 66  ? 0.3033 0.2918 0.3874 0.0110  -0.0164 -0.0082 216 LEU A N   
168  C CA  . LEU A 66  ? 0.3018 0.2868 0.3709 0.0110  -0.0106 -0.0056 216 LEU A CA  
169  C C   . LEU A 66  ? 0.3229 0.3047 0.3838 0.0116  -0.0181 -0.0115 216 LEU A C   
170  O O   . LEU A 66  ? 0.3185 0.2974 0.3816 0.0110  -0.0155 -0.0107 216 LEU A O   
171  C CB  . LEU A 66  ? 0.3112 0.2961 0.3590 0.0122  -0.0047 -0.0019 216 LEU A CB  
172  C CG  . LEU A 66  ? 0.3544 0.3399 0.4037 0.0121  0.0059  0.0044  216 LEU A CG  
173  C CD1 . LEU A 66  ? 0.3958 0.3843 0.4626 0.0121  0.0079  0.0052  216 LEU A CD1 
174  C CD2 . LEU A 66  ? 0.3644 0.3489 0.3919 0.0133  0.0095  0.0059  216 LEU A CD2 
175  N N   . HIS A 67  ? 0.3046 0.2862 0.3566 0.0134  -0.0269 -0.0171 217 HIS A N   
176  C CA  . HIS A 67  ? 0.3158 0.2936 0.3545 0.0151  -0.0327 -0.0230 217 HIS A CA  
177  C C   . HIS A 67  ? 0.3460 0.3229 0.3914 0.0162  -0.0447 -0.0309 217 HIS A C   
178  O O   . HIS A 67  ? 0.3371 0.3174 0.3969 0.0157  -0.0494 -0.0313 217 HIS A O   
179  C CB  . HIS A 67  ? 0.3157 0.2931 0.3301 0.0174  -0.0304 -0.0215 217 HIS A CB  
180  C CG  . HIS A 67  ? 0.3083 0.2863 0.3158 0.0165  -0.0213 -0.0158 217 HIS A CG  
181  N ND1 . HIS A 67  ? 0.2938 0.2698 0.2954 0.0172  -0.0191 -0.0162 217 HIS A ND1 
182  C CD2 . HIS A 67  ? 0.2733 0.2536 0.2793 0.0155  -0.0147 -0.0101 217 HIS A CD2 
183  C CE1 . HIS A 67  ? 0.3260 0.3038 0.3232 0.0165  -0.0126 -0.0107 217 HIS A CE1 
184  N NE2 . HIS A 67  ? 0.2616 0.2416 0.2600 0.0155  -0.0100 -0.0074 217 HIS A NE2 
185  N N   . SER A 68  ? 0.3696 0.3418 0.4046 0.0181  -0.0500 -0.0376 218 SER A N   
186  C CA  . SER A 68  ? 0.4008 0.3706 0.4401 0.0195  -0.0627 -0.0470 218 SER A CA  
187  C C   . SER A 68  ? 0.4075 0.3796 0.4391 0.0222  -0.0714 -0.0483 218 SER A C   
188  O O   . SER A 68  ? 0.4581 0.4303 0.4690 0.0249  -0.0684 -0.0442 218 SER A O   
189  C CB  . SER A 68  ? 0.4175 0.3805 0.4410 0.0222  -0.0655 -0.0546 218 SER A CB  
190  O OG  . SER A 68  ? 0.5178 0.4777 0.5338 0.0254  -0.0785 -0.0639 218 SER A OG  
191  N N   . ALA A 69  ? 0.4802 0.4540 0.5309 0.0215  -0.0823 -0.0537 219 ALA A N   
192  C CA  . ALA A 69  ? 0.5111 0.4869 0.5568 0.0249  -0.0939 -0.0561 219 ALA A CA  
193  C C   . ALA A 69  ? 0.4974 0.4668 0.5137 0.0304  -0.1026 -0.0631 219 ALA A C   
194  O O   . ALA A 69  ? 0.5246 0.4938 0.5225 0.0347  -0.1069 -0.0611 219 ALA A O   
195  C CB  . ALA A 69  ? 0.5455 0.5256 0.6234 0.0226  -0.1044 -0.0605 219 ALA A CB  
196  N N   . SER A 70  ? 0.4293 0.3926 0.4398 0.0307  -0.1043 -0.0709 220 SER A N   
197  C CA  . SER A 70  ? 0.4612 0.4174 0.4417 0.0368  -0.1119 -0.0787 220 SER A CA  
198  C C   . SER A 70  ? 0.4370 0.3898 0.3868 0.0403  -0.1002 -0.0729 220 SER A C   
199  O O   . SER A 70  ? 0.4483 0.3955 0.3698 0.0463  -0.1039 -0.0765 220 SER A O   
200  C CB  . SER A 70  ? 0.4710 0.4209 0.4570 0.0366  -0.1197 -0.0913 220 SER A CB  
201  O OG  . SER A 70  ? 0.4621 0.4081 0.4464 0.0353  -0.1083 -0.0910 220 SER A OG  
202  N N   . ILE A 71  ? 0.4230 0.3790 0.3787 0.0368  -0.0860 -0.0642 221 ILE A N   
203  C CA  . ILE A 71  ? 0.3965 0.3509 0.3295 0.0392  -0.0746 -0.0580 221 ILE A CA  
204  C C   . ILE A 71  ? 0.4087 0.3693 0.3503 0.0361  -0.0671 -0.0476 221 ILE A C   
205  O O   . ILE A 71  ? 0.3862 0.3498 0.3383 0.0323  -0.0576 -0.0425 221 ILE A O   
206  C CB  . ILE A 71  ? 0.4117 0.3634 0.3442 0.0383  -0.0658 -0.0594 221 ILE A CB  
207  C CG1 . ILE A 71  ? 0.4266 0.3712 0.3549 0.0410  -0.0735 -0.0715 221 ILE A CG1 
208  C CG2 . ILE A 71  ? 0.3843 0.3355 0.2965 0.0409  -0.0547 -0.0533 221 ILE A CG2 
209  C CD1 . ILE A 71  ? 0.4215 0.3631 0.3543 0.0402  -0.0654 -0.0735 221 ILE A CD1 
210  N N   . PRO A 72  ? 0.4340 0.3961 0.3703 0.0383  -0.0719 -0.0444 222 PRO A N   
211  C CA  . PRO A 72  ? 0.4285 0.3962 0.3788 0.0352  -0.0667 -0.0365 222 PRO A CA  
212  C C   . PRO A 72  ? 0.4396 0.4075 0.3788 0.0347  -0.0545 -0.0285 222 PRO A C   
213  O O   . PRO A 72  ? 0.4271 0.3912 0.3451 0.0382  -0.0516 -0.0271 222 PRO A O   
214  C CB  . PRO A 72  ? 0.4290 0.3977 0.3793 0.0384  -0.0773 -0.0365 222 PRO A CB  
215  C CG  . PRO A 72  ? 0.4724 0.4347 0.3961 0.0446  -0.0847 -0.0411 222 PRO A CG  
216  C CD  . PRO A 72  ? 0.4464 0.4049 0.3662 0.0441  -0.0838 -0.0488 222 PRO A CD  
217  N N   . GLY A 73  ? 0.3491 0.3211 0.3031 0.0304  -0.0472 -0.0237 223 GLY A N   
218  C CA  . GLY A 73  ? 0.3562 0.3289 0.3041 0.0295  -0.0381 -0.0172 223 GLY A CA  
219  C C   . GLY A 73  ? 0.3489 0.3237 0.3032 0.0257  -0.0297 -0.0152 223 GLY A C   
220  O O   . GLY A 73  ? 0.3356 0.3097 0.2914 0.0251  -0.0290 -0.0181 223 GLY A O   
221  N N   . ILE A 74  ? 0.3052 0.2819 0.2634 0.0236  -0.0239 -0.0106 224 ILE A N   
222  C CA  . ILE A 74  ? 0.2985 0.2768 0.2589 0.0209  -0.0168 -0.0085 224 ILE A CA  
223  C C   . ILE A 74  ? 0.3082 0.2855 0.2575 0.0211  -0.0124 -0.0057 224 ILE A C   
224  O O   . ILE A 74  ? 0.3242 0.3001 0.2705 0.0219  -0.0120 -0.0033 224 ILE A O   
225  C CB  . ILE A 74  ? 0.2994 0.2798 0.2714 0.0186  -0.0136 -0.0062 224 ILE A CB  
226  C CG1 . ILE A 74  ? 0.3244 0.3062 0.3117 0.0182  -0.0168 -0.0081 224 ILE A CG1 
227  C CG2 . ILE A 74  ? 0.3099 0.2913 0.2803 0.0166  -0.0075 -0.0042 224 ILE A CG2 
228  C CD1 . ILE A 74  ? 0.3338 0.3175 0.3331 0.0167  -0.0116 -0.0051 224 ILE A CD1 
229  N N   . LEU A 75  ? 0.3077 0.2857 0.2533 0.0205  -0.0090 -0.0057 225 LEU A N   
230  C CA  . LEU A 75  ? 0.3147 0.2924 0.2533 0.0206  -0.0046 -0.0033 225 LEU A CA  
231  C C   . LEU A 75  ? 0.3200 0.3005 0.2637 0.0174  -0.0008 -0.0016 225 LEU A C   
232  O O   . LEU A 75  ? 0.2890 0.2698 0.2313 0.0166  0.0024  0.0001  225 LEU A O   
233  C CB  . LEU A 75  ? 0.3369 0.3137 0.2684 0.0230  -0.0033 -0.0048 225 LEU A CB  
234  C CG  . LEU A 75  ? 0.3442 0.3171 0.2666 0.0270  -0.0079 -0.0079 225 LEU A CG  
235  C CD1 . LEU A 75  ? 0.3796 0.3508 0.2936 0.0300  -0.0051 -0.0102 225 LEU A CD1 
236  C CD2 . LEU A 75  ? 0.3809 0.3508 0.2945 0.0294  -0.0095 -0.0052 225 LEU A CD2 
237  N N   . ALA A 76  ? 0.3188 0.3010 0.2684 0.0158  -0.0013 -0.0022 226 ALA A N   
238  C CA  . ALA A 76  ? 0.3020 0.2863 0.2533 0.0137  0.0005  -0.0013 226 ALA A CA  
239  C C   . ALA A 76  ? 0.2912 0.2755 0.2451 0.0130  0.0007  -0.0011 226 ALA A C   
240  O O   . ALA A 76  ? 0.2842 0.2681 0.2421 0.0138  0.0000  -0.0011 226 ALA A O   
241  C CB  . ALA A 76  ? 0.2903 0.2775 0.2428 0.0139  0.0009  -0.0012 226 ALA A CB  
242  N N   . LEU A 77  ? 0.3128 0.2971 0.2647 0.0117  0.0019  -0.0012 227 LEU A N   
243  C CA  . LEU A 77  ? 0.3111 0.2943 0.2618 0.0118  0.0036  -0.0009 227 LEU A CA  
244  C C   . LEU A 77  ? 0.3202 0.3042 0.2651 0.0112  0.0030  -0.0014 227 LEU A C   
245  O O   . LEU A 77  ? 0.3174 0.3019 0.2615 0.0097  0.0013  -0.0034 227 LEU A O   
246  C CB  . LEU A 77  ? 0.3065 0.2868 0.2580 0.0117  0.0056  -0.0020 227 LEU A CB  
247  C CG  . LEU A 77  ? 0.3229 0.3011 0.2721 0.0125  0.0093  -0.0022 227 LEU A CG  
248  C CD1 . LEU A 77  ? 0.3187 0.2978 0.2732 0.0138  0.0120  0.0005  227 LEU A CD1 
249  C CD2 . LEU A 77  ? 0.3302 0.3054 0.2818 0.0127  0.0113  -0.0039 227 LEU A CD2 
250  N N   . ASP A 78  ? 0.2779 0.2615 0.2192 0.0126  0.0042  0.0004  228 ASP A N   
251  C CA  . ASP A 78  ? 0.3128 0.2957 0.2442 0.0132  0.0032  -0.0003 228 ASP A CA  
252  C C   . ASP A 78  ? 0.3272 0.3071 0.2526 0.0156  0.0082  0.0023  228 ASP A C   
253  O O   . ASP A 78  ? 0.3433 0.3229 0.2755 0.0163  0.0118  0.0057  228 ASP A O   
254  C CB  . ASP A 78  ? 0.2794 0.2661 0.2104 0.0134  -0.0015 0.0006  228 ASP A CB  
255  C CG  . ASP A 78  ? 0.3299 0.3168 0.2521 0.0136  -0.0059 -0.0019 228 ASP A CG  
256  O OD1 . ASP A 78  ? 0.3173 0.3008 0.2335 0.0129  -0.0056 -0.0060 228 ASP A OD1 
257  O OD2 . ASP A 78  ? 0.3228 0.3128 0.2441 0.0149  -0.0104 0.0000  228 ASP A OD2 
258  N N   . LEU A 79  ? 0.3261 0.3032 0.2389 0.0169  0.0086  0.0005  229 LEU A N   
259  C CA  . LEU A 79  ? 0.3362 0.3097 0.2398 0.0201  0.0148  0.0036  229 LEU A CA  
260  C C   . LEU A 79  ? 0.3669 0.3402 0.2566 0.0226  0.0111  0.0057  229 LEU A C   
261  O O   . LEU A 79  ? 0.3818 0.3569 0.2673 0.0217  0.0034  0.0017  229 LEU A O   
262  C CB  . LEU A 79  ? 0.3276 0.2963 0.2238 0.0209  0.0191  -0.0007 229 LEU A CB  
263  C CG  . LEU A 79  ? 0.3428 0.3114 0.2520 0.0188  0.0212  -0.0034 229 LEU A CG  
264  C CD1 . LEU A 79  ? 0.3600 0.3231 0.2617 0.0206  0.0265  -0.0075 229 LEU A CD1 
265  C CD2 . LEU A 79  ? 0.3469 0.3179 0.2713 0.0187  0.0249  0.0013  229 LEU A CD2 
266  N N   . CYS A 80  ? 0.3603 0.3313 0.2439 0.0260  0.0163  0.0124  230 CYS A N   
267  C CA  . CYS A 80  ? 0.3836 0.3537 0.2519 0.0295  0.0126  0.0157  230 CYS A CA  
268  C C   . CYS A 80  ? 0.4035 0.3694 0.2502 0.0318  0.0105  0.0101  230 CYS A C   
269  O O   . CYS A 80  ? 0.4190 0.3797 0.2572 0.0337  0.0187  0.0092  230 CYS A O   
270  C CB  . CYS A 80  ? 0.3841 0.3515 0.2506 0.0330  0.0202  0.0254  230 CYS A CB  
271  S SG  . CYS A 80  ? 0.4356 0.4010 0.2807 0.0388  0.0156  0.0315  230 CYS A SG  
272  N N   . PRO A 81  ? 0.4096 0.3776 0.2490 0.0317  -0.0003 0.0056  231 PRO A N   
273  C CA  . PRO A 81  ? 0.4374 0.4007 0.2571 0.0336  -0.0040 -0.0018 231 PRO A CA  
274  C C   . PRO A 81  ? 0.4646 0.4209 0.2585 0.0401  0.0017  0.0020  231 PRO A C   
275  O O   . PRO A 81  ? 0.4896 0.4399 0.2671 0.0421  0.0034  -0.0045 231 PRO A O   
276  C CB  . PRO A 81  ? 0.4633 0.4314 0.2835 0.0325  -0.0183 -0.0059 231 PRO A CB  
277  C CG  . PRO A 81  ? 0.4358 0.4114 0.2804 0.0286  -0.0202 -0.0029 231 PRO A CG  
278  C CD  . PRO A 81  ? 0.4235 0.3983 0.2751 0.0296  -0.0099 0.0057  231 PRO A CD  
279  N N   . SER A 82  ? 0.4760 0.4321 0.2661 0.0438  0.0056  0.0126  232 SER A N   
280  C CA  . SER A 82  ? 0.4824 0.4312 0.2466 0.0509  0.0130  0.0187  232 SER A CA  
281  C C   . SER A 82  ? 0.4899 0.4345 0.2590 0.0520  0.0304  0.0246  232 SER A C   
282  O O   . SER A 82  ? 0.4652 0.4031 0.2142 0.0579  0.0400  0.0301  232 SER A O   
283  C CB  . SER A 82  ? 0.5215 0.4711 0.2778 0.0553  0.0087  0.0287  232 SER A CB  
284  O OG  . SER A 82  ? 0.5172 0.4696 0.2954 0.0535  0.0156  0.0379  232 SER A OG  
285  N N   . ASP A 83  ? 0.4372 0.3858 0.2327 0.0466  0.0344  0.0232  233 ASP A N   
286  C CA  . ASP A 83  ? 0.4708 0.4170 0.2767 0.0469  0.0492  0.0275  233 ASP A CA  
287  C C   . ASP A 83  ? 0.4393 0.3910 0.2723 0.0406  0.0471  0.0225  233 ASP A C   
288  O O   . ASP A 83  ? 0.3792 0.3359 0.2320 0.0374  0.0443  0.0259  233 ASP A O   
289  C CB  . ASP A 83  ? 0.4958 0.4415 0.3086 0.0491  0.0577  0.0404  233 ASP A CB  
290  C CG  . ASP A 83  ? 0.5124 0.4570 0.3425 0.0487  0.0729  0.0452  233 ASP A CG  
291  O OD1 . ASP A 83  ? 0.4745 0.4197 0.3126 0.0468  0.0762  0.0387  233 ASP A OD1 
292  O OD2 . ASP A 83  ? 0.5277 0.4710 0.3657 0.0504  0.0815  0.0559  233 ASP A OD2 
293  N N   . THR A 84  ? 0.4283 0.3784 0.2617 0.0394  0.0484  0.0144  234 THR A N   
294  C CA  . THR A 84  ? 0.4190 0.3735 0.2749 0.0341  0.0448  0.0097  234 THR A CA  
295  C C   . THR A 84  ? 0.4239 0.3807 0.3024 0.0330  0.0536  0.0146  234 THR A C   
296  O O   . THR A 84  ? 0.3923 0.3525 0.2884 0.0295  0.0505  0.0113  234 THR A O   
297  C CB  . THR A 84  ? 0.4371 0.3888 0.2877 0.0331  0.0417  -0.0005 234 THR A CB  
298  O OG1 . THR A 84  ? 0.4508 0.3956 0.2865 0.0375  0.0514  -0.0025 234 THR A OG1 
299  C CG2 . THR A 84  ? 0.4474 0.3997 0.2872 0.0317  0.0291  -0.0066 234 THR A CG2 
300  N N   . ASN A 85  ? 0.4232 0.3779 0.3016 0.0362  0.0645  0.0226  235 ASN A N   
301  C CA  . ASN A 85  ? 0.4154 0.3734 0.3200 0.0344  0.0709  0.0277  235 ASN A CA  
302  C C   . ASN A 85  ? 0.3787 0.3410 0.2986 0.0312  0.0641  0.0313  235 ASN A C   
303  O O   . ASN A 85  ? 0.3903 0.3557 0.3336 0.0289  0.0659  0.0332  235 ASN A O   
304  C CB  . ASN A 85  ? 0.4463 0.4007 0.3502 0.0384  0.0859  0.0355  235 ASN A CB  
305  C CG  . ASN A 85  ? 0.4998 0.4498 0.3928 0.0419  0.0951  0.0317  235 ASN A CG  
306  O OD1 . ASN A 85  ? 0.5259 0.4762 0.4202 0.0405  0.0907  0.0233  235 ASN A OD1 
307  N ND2 . ASN A 85  ? 0.5468 0.4920 0.4292 0.0469  0.1086  0.0382  235 ASN A ND2 
308  N N   . LYS A 86  ? 0.3783 0.3408 0.2860 0.0314  0.0559  0.0314  236 LYS A N   
309  C CA  . LYS A 86  ? 0.3630 0.3292 0.2843 0.0287  0.0489  0.0331  236 LYS A CA  
310  C C   . LYS A 86  ? 0.3447 0.3147 0.2709 0.0252  0.0386  0.0252  236 LYS A C   
311  O O   . LYS A 86  ? 0.3510 0.3212 0.2639 0.0251  0.0325  0.0204  236 LYS A O   
312  C CB  . LYS A 86  ? 0.4002 0.3647 0.3081 0.0315  0.0461  0.0387  236 LYS A CB  
313  C CG  . LYS A 86  ? 0.4850 0.4442 0.3825 0.0362  0.0567  0.0481  236 LYS A CG  
314  C CD  . LYS A 86  ? 0.5420 0.5007 0.4618 0.0353  0.0664  0.0549  236 LYS A CD  
315  C CE  . LYS A 86  ? 0.6845 0.6371 0.5940 0.0404  0.0787  0.0664  236 LYS A CE  
316  N NZ  . LYS A 86  ? 0.6804 0.6309 0.5775 0.0435  0.0739  0.0728  236 LYS A NZ  
317  N N   . ILE A 87  ? 0.3286 0.3016 0.2746 0.0223  0.0366  0.0239  237 ILE A N   
318  C CA  . ILE A 87  ? 0.3151 0.2909 0.2655 0.0197  0.0290  0.0176  237 ILE A CA  
319  C C   . ILE A 87  ? 0.3037 0.2817 0.2610 0.0184  0.0229  0.0177  237 ILE A C   
320  O O   . ILE A 87  ? 0.3087 0.2863 0.2770 0.0185  0.0248  0.0214  237 ILE A O   
321  C CB  . ILE A 87  ? 0.3173 0.2944 0.2834 0.0183  0.0304  0.0154  237 ILE A CB  
322  C CG1 . ILE A 87  ? 0.4043 0.3794 0.3718 0.0201  0.0396  0.0171  237 ILE A CG1 
323  C CG2 . ILE A 87  ? 0.3843 0.3629 0.3502 0.0166  0.0234  0.0099  237 ILE A CG2 
324  C CD1 . ILE A 87  ? 0.3544 0.3259 0.3031 0.0222  0.0430  0.0149  237 ILE A CD1 
325  N N   . LEU A 88  ? 0.2842 0.2642 0.2370 0.0173  0.0165  0.0135  238 LEU A N   
326  C CA  . LEU A 88  ? 0.3192 0.3012 0.2777 0.0166  0.0115  0.0127  238 LEU A CA  
327  C C   . LEU A 88  ? 0.3079 0.2912 0.2702 0.0151  0.0078  0.0078  238 LEU A C   
328  O O   . LEU A 88  ? 0.3091 0.2927 0.2654 0.0144  0.0069  0.0053  238 LEU A O   
329  C CB  . LEU A 88  ? 0.2962 0.2797 0.2458 0.0176  0.0082  0.0136  238 LEU A CB  
330  C CG  . LEU A 88  ? 0.3211 0.3069 0.2764 0.0177  0.0041  0.0129  238 LEU A CG  
331  C CD1 . LEU A 88  ? 0.3280 0.3117 0.2927 0.0189  0.0059  0.0163  238 LEU A CD1 
332  C CD2 . LEU A 88  ? 0.3264 0.3148 0.2749 0.0188  0.0005  0.0137  238 LEU A CD2 
333  N N   . THR A 89  ? 0.3099 0.2932 0.2813 0.0149  0.0056  0.0063  239 THR A N   
334  C CA  . THR A 89  ? 0.2902 0.2738 0.2621 0.0146  0.0020  0.0023  239 THR A CA  
335  C C   . THR A 89  ? 0.3091 0.2925 0.2816 0.0154  -0.0009 0.0001  239 THR A C   
336  O O   . THR A 89  ? 0.3071 0.2897 0.2854 0.0160  -0.0008 0.0009  239 THR A O   
337  C CB  . THR A 89  ? 0.2910 0.2739 0.2713 0.0144  0.0011  0.0009  239 THR A CB  
338  O OG1 . THR A 89  ? 0.2678 0.2500 0.2606 0.0142  0.0012  0.0016  239 THR A OG1 
339  C CG2 . THR A 89  ? 0.3117 0.2945 0.2910 0.0141  0.0051  0.0025  239 THR A CG2 
340  N N   . GLY A 90  ? 0.2891 0.2729 0.2555 0.0158  -0.0026 -0.0022 240 GLY A N   
341  C CA  . GLY A 90  ? 0.2549 0.2378 0.2199 0.0175  -0.0042 -0.0049 240 GLY A CA  
342  C C   . GLY A 90  ? 0.2797 0.2602 0.2423 0.0187  -0.0078 -0.0084 240 GLY A C   
343  O O   . GLY A 90  ? 0.3034 0.2838 0.2622 0.0186  -0.0083 -0.0078 240 GLY A O   
344  N N   . GLY A 91  ? 0.2918 0.2698 0.2565 0.0202  -0.0108 -0.0123 241 GLY A N   
345  C CA  . GLY A 91  ? 0.3083 0.2838 0.2701 0.0219  -0.0163 -0.0165 241 GLY A CA  
346  C C   . GLY A 91  ? 0.3352 0.3076 0.2833 0.0254  -0.0174 -0.0200 241 GLY A C   
347  O O   . GLY A 91  ? 0.3008 0.2724 0.2460 0.0267  -0.0140 -0.0210 241 GLY A O   
348  N N   . ALA A 92  ? 0.3123 0.2827 0.2519 0.0276  -0.0220 -0.0218 242 ALA A N   
349  C CA  . ALA A 92  ? 0.3330 0.2987 0.2576 0.0320  -0.0247 -0.0264 242 ALA A CA  
350  C C   . ALA A 92  ? 0.3211 0.2836 0.2503 0.0329  -0.0286 -0.0337 242 ALA A C   
351  O O   . ALA A 92  ? 0.3173 0.2757 0.2348 0.0365  -0.0272 -0.0378 242 ALA A O   
352  C CB  . ALA A 92  ? 0.3472 0.3108 0.2628 0.0346  -0.0318 -0.0272 242 ALA A CB  
353  N N   . ASP A 93  ? 0.3319 0.2956 0.2794 0.0297  -0.0321 -0.0351 243 ASP A N   
354  C CA  . ASP A 93  ? 0.3403 0.3004 0.2973 0.0297  -0.0359 -0.0417 243 ASP A CA  
355  C C   . ASP A 93  ? 0.3229 0.2821 0.2842 0.0296  -0.0291 -0.0408 243 ASP A C   
356  O O   . ASP A 93  ? 0.3290 0.2844 0.3010 0.0294  -0.0315 -0.0458 243 ASP A O   
357  C CB  . ASP A 93  ? 0.3333 0.2950 0.3120 0.0262  -0.0414 -0.0427 243 ASP A CB  
358  C CG  . ASP A 93  ? 0.3134 0.2795 0.3068 0.0223  -0.0345 -0.0347 243 ASP A CG  
359  O OD1 . ASP A 93  ? 0.3078 0.2761 0.2957 0.0220  -0.0268 -0.0287 243 ASP A OD1 
360  O OD2 . ASP A 93  ? 0.3369 0.3044 0.3485 0.0198  -0.0372 -0.0345 243 ASP A OD2 
361  N N   . LYS A 94  ? 0.3222 0.2846 0.2766 0.0299  -0.0213 -0.0349 244 LYS A N   
362  C CA  . LYS A 94  ? 0.3146 0.2774 0.2730 0.0306  -0.0150 -0.0330 244 LYS A CA  
363  C C   . LYS A 94  ? 0.3044 0.2698 0.2798 0.0273  -0.0133 -0.0278 244 LYS A C   
364  O O   . LYS A 94  ? 0.3332 0.2988 0.3143 0.0281  -0.0095 -0.0257 244 LYS A O   
365  C CB  . LYS A 94  ? 0.3267 0.2834 0.2823 0.0343  -0.0157 -0.0408 244 LYS A CB  
366  C CG  . LYS A 94  ? 0.3667 0.3186 0.3022 0.0388  -0.0181 -0.0474 244 LYS A CG  
367  C CD  . LYS A 94  ? 0.3920 0.3365 0.3257 0.0426  -0.0191 -0.0567 244 LYS A CD  
368  C CE  . LYS A 94  ? 0.4661 0.4041 0.3771 0.0480  -0.0220 -0.0646 244 LYS A CE  
369  N NZ  . LYS A 94  ? 0.5036 0.4389 0.4120 0.0474  -0.0344 -0.0704 244 LYS A NZ  
370  N N   . ASN A 95  ? 0.3065 0.2736 0.2898 0.0243  -0.0155 -0.0252 245 ASN A N   
371  C CA  . ASN A 95  ? 0.3116 0.2799 0.3093 0.0218  -0.0128 -0.0195 245 ASN A CA  
372  C C   . ASN A 95  ? 0.3134 0.2866 0.3071 0.0202  -0.0090 -0.0124 245 ASN A C   
373  O O   . ASN A 95  ? 0.2825 0.2580 0.2676 0.0198  -0.0096 -0.0122 245 ASN A O   
374  C CB  . ASN A 95  ? 0.2955 0.2612 0.3087 0.0198  -0.0165 -0.0217 245 ASN A CB  
375  C CG  . ASN A 95  ? 0.3003 0.2602 0.3201 0.0211  -0.0210 -0.0297 245 ASN A CG  
376  O OD1 . ASN A 95  ? 0.3089 0.2659 0.3234 0.0237  -0.0194 -0.0324 245 ASN A OD1 
377  N ND2 . ASN A 95  ? 0.3206 0.2785 0.3533 0.0193  -0.0266 -0.0341 245 ASN A ND2 
378  N N   . VAL A 96  ? 0.3095 0.2836 0.3085 0.0198  -0.0053 -0.0065 246 VAL A N   
379  C CA  . VAL A 96  ? 0.2839 0.2616 0.2781 0.0187  -0.0022 -0.0003 246 VAL A CA  
380  C C   . VAL A 96  ? 0.3083 0.2846 0.3124 0.0173  0.0002  0.0036  246 VAL A C   
381  O O   . VAL A 96  ? 0.3160 0.2893 0.3311 0.0176  0.0014  0.0054  246 VAL A O   
382  C CB  . VAL A 96  ? 0.2956 0.2754 0.2864 0.0202  -0.0005 0.0037  246 VAL A CB  
383  C CG1 . VAL A 96  ? 0.3129 0.2955 0.2967 0.0195  0.0011  0.0086  246 VAL A CG1 
384  C CG2 . VAL A 96  ? 0.3064 0.2883 0.2917 0.0216  -0.0014 0.0002  246 VAL A CG2 
385  N N   . VAL A 97  ? 0.2993 0.2773 0.3009 0.0161  0.0017  0.0050  247 VAL A N   
386  C CA  . VAL A 97  ? 0.2827 0.2597 0.2948 0.0151  0.0058  0.0089  247 VAL A CA  
387  C C   . VAL A 97  ? 0.3052 0.2832 0.3074 0.0158  0.0115  0.0149  247 VAL A C   
388  O O   . VAL A 97  ? 0.2903 0.2703 0.2797 0.0159  0.0107  0.0134  247 VAL A O   
389  C CB  . VAL A 97  ? 0.2726 0.2503 0.2942 0.0137  0.0027  0.0045  247 VAL A CB  
390  C CG1 . VAL A 97  ? 0.3169 0.2950 0.3518 0.0127  0.0083  0.0090  247 VAL A CG1 
391  C CG2 . VAL A 97  ? 0.2790 0.2546 0.3097 0.0135  -0.0037 -0.0018 247 VAL A CG2 
392  N N   . VAL A 98  ? 0.3268 0.3025 0.3342 0.0165  0.0174  0.0215  248 VAL A N   
393  C CA  . VAL A 98  ? 0.3228 0.2979 0.3203 0.0180  0.0240  0.0272  248 VAL A CA  
394  C C   . VAL A 98  ? 0.3193 0.2938 0.3303 0.0171  0.0305  0.0295  248 VAL A C   
395  O O   . VAL A 98  ? 0.3062 0.2792 0.3362 0.0161  0.0325  0.0317  248 VAL A O   
396  C CB  . VAL A 98  ? 0.3585 0.3309 0.3494 0.0207  0.0272  0.0348  248 VAL A CB  
397  C CG1 . VAL A 98  ? 0.3722 0.3430 0.3472 0.0233  0.0336  0.0402  248 VAL A CG1 
398  C CG2 . VAL A 98  ? 0.3771 0.3512 0.3603 0.0217  0.0205  0.0328  248 VAL A CG2 
399  N N   . PHE A 99  ? 0.3208 0.2963 0.3247 0.0176  0.0339  0.0288  249 PHE A N   
400  C CA  . PHE A 99  ? 0.3144 0.2906 0.3334 0.0169  0.0399  0.0299  249 PHE A CA  
401  C C   . PHE A 99  ? 0.3200 0.2942 0.3258 0.0197  0.0495  0.0345  249 PHE A C   
402  O O   . PHE A 99  ? 0.3060 0.2791 0.2903 0.0213  0.0479  0.0326  249 PHE A O   
403  C CB  . PHE A 99  ? 0.3086 0.2881 0.3328 0.0153  0.0333  0.0226  249 PHE A CB  
404  C CG  . PHE A 99  ? 0.3132 0.2947 0.3543 0.0151  0.0379  0.0230  249 PHE A CG  
405  C CD1 . PHE A 99  ? 0.3242 0.3073 0.3915 0.0133  0.0377  0.0237  249 PHE A CD1 
406  C CD2 . PHE A 99  ? 0.3026 0.2844 0.3361 0.0165  0.0418  0.0219  249 PHE A CD2 
407  C CE1 . PHE A 99  ? 0.3208 0.3070 0.4075 0.0131  0.0413  0.0240  249 PHE A CE1 
408  C CE2 . PHE A 99  ? 0.3106 0.2948 0.3622 0.0167  0.0461  0.0223  249 PHE A CE2 
409  C CZ  . PHE A 99  ? 0.3054 0.2924 0.3842 0.0151  0.0460  0.0238  249 PHE A CZ  
410  N N   . ASP A 100 ? 0.3124 0.2855 0.3312 0.0204  0.0598  0.0404  250 ASP A N   
411  C CA  . ASP A 100 ? 0.3684 0.3386 0.3735 0.0240  0.0712  0.0449  250 ASP A CA  
412  C C   . ASP A 100 ? 0.3515 0.3241 0.3682 0.0237  0.0753  0.0417  250 ASP A C   
413  O O   . ASP A 100 ? 0.3992 0.3746 0.4421 0.0221  0.0787  0.0433  250 ASP A O   
414  C CB  . ASP A 100 ? 0.3931 0.3596 0.4032 0.0261  0.0827  0.0555  250 ASP A CB  
415  C CG  . ASP A 100 ? 0.4882 0.4499 0.4753 0.0313  0.0950  0.0611  250 ASP A CG  
416  O OD1 . ASP A 100 ? 0.4815 0.4434 0.4633 0.0327  0.0993  0.0573  250 ASP A OD1 
417  O OD2 . ASP A 100 ? 0.5789 0.5359 0.5528 0.0346  0.1003  0.0693  250 ASP A OD2 
418  N N   . LYS A 101 ? 0.3571 0.3286 0.3553 0.0255  0.0749  0.0370  251 LYS A N   
419  C CA  . LYS A 101 ? 0.3964 0.3693 0.4025 0.0260  0.0782  0.0333  251 LYS A CA  
420  C C   . LYS A 101 ? 0.4076 0.3797 0.4260 0.0285  0.0936  0.0395  251 LYS A C   
421  O O   . LYS A 101 ? 0.3893 0.3652 0.4301 0.0280  0.0963  0.0382  251 LYS A O   
422  C CB  . LYS A 101 ? 0.4262 0.3958 0.4066 0.0277  0.0754  0.0271  251 LYS A CB  
423  C CG  . LYS A 101 ? 0.4644 0.4325 0.4455 0.0300  0.0826  0.0241  251 LYS A CG  
424  C CD  . LYS A 101 ? 0.4466 0.4114 0.4074 0.0303  0.0762  0.0165  251 LYS A CD  
425  C CE  . LYS A 101 ? 0.5005 0.4642 0.4687 0.0318  0.0806  0.0123  251 LYS A CE  
426  N NZ  . LYS A 101 ? 0.4780 0.4380 0.4435 0.0363  0.0958  0.0150  251 LYS A NZ  
427  N N   . SER A 102 ? 0.4440 0.4113 0.4478 0.0318  0.1040  0.0467  252 SER A N   
428  C CA  . SER A 102 ? 0.4845 0.4498 0.4955 0.0353  0.1218  0.0540  252 SER A CA  
429  C C   . SER A 102 ? 0.4501 0.4197 0.4977 0.0325  0.1264  0.0601  252 SER A C   
430  O O   . SER A 102 ? 0.4696 0.4422 0.5407 0.0329  0.1359  0.0621  252 SER A O   
431  C CB  . SER A 102 ? 0.5376 0.4954 0.5199 0.0403  0.1314  0.0615  252 SER A CB  
432  O OG  . SER A 102 ? 0.6362 0.5898 0.5837 0.0427  0.1244  0.0557  252 SER A OG  
433  N N   . SER A 103 ? 0.4106 0.3803 0.4646 0.0297  0.1198  0.0630  253 SER A N   
434  C CA  . SER A 103 ? 0.4194 0.3921 0.5093 0.0265  0.1229  0.0682  253 SER A CA  
435  C C   . SER A 103 ? 0.4025 0.3820 0.5187 0.0215  0.1081  0.0596  253 SER A C   
436  O O   . SER A 103 ? 0.3897 0.3730 0.5399 0.0186  0.1091  0.0611  253 SER A O   
437  C CB  . SER A 103 ? 0.4318 0.3999 0.5171 0.0264  0.1235  0.0755  253 SER A CB  
438  O OG  . SER A 103 ? 0.4026 0.3707 0.4742 0.0245  0.1075  0.0690  253 SER A OG  
439  N N   . GLU A 104 ? 0.3872 0.3680 0.4870 0.0208  0.0947  0.0507  254 GLU A N   
440  C CA  . GLU A 104 ? 0.3970 0.3828 0.5126 0.0171  0.0793  0.0424  254 GLU A CA  
441  C C   . GLU A 104 ? 0.4144 0.4000 0.5448 0.0138  0.0718  0.0423  254 GLU A C   
442  O O   . GLU A 104 ? 0.4353 0.4249 0.5912 0.0109  0.0635  0.0378  254 GLU A O   
443  C CB  . GLU A 104 ? 0.4171 0.4086 0.5591 0.0167  0.0801  0.0401  254 GLU A CB  
444  C CG  . GLU A 104 ? 0.4393 0.4298 0.5646 0.0204  0.0866  0.0388  254 GLU A CG  
445  C CD  . GLU A 104 ? 0.4488 0.4450 0.5974 0.0207  0.0849  0.0356  254 GLU A CD  
446  O OE1 . GLU A 104 ? 0.4506 0.4525 0.6294 0.0182  0.0781  0.0342  254 GLU A OE1 
447  O OE2 . GLU A 104 ? 0.5381 0.5327 0.6745 0.0238  0.0896  0.0339  254 GLU A OE2 
448  N N   . GLN A 105 ? 0.3752 0.3557 0.4895 0.0147  0.0742  0.0468  255 GLN A N   
449  C CA  . GLN A 105 ? 0.3972 0.3758 0.5232 0.0122  0.0683  0.0470  255 GLN A CA  
450  C C   . GLN A 105 ? 0.3709 0.3477 0.4724 0.0127  0.0576  0.0419  255 GLN A C   
451  O O   . GLN A 105 ? 0.3261 0.3012 0.3996 0.0153  0.0589  0.0428  255 GLN A O   
452  C CB  . GLN A 105 ? 0.4312 0.4047 0.5614 0.0135  0.0811  0.0583  255 GLN A CB  
453  C CG  . GLN A 105 ? 0.4998 0.4747 0.6581 0.0131  0.0946  0.0653  255 GLN A CG  
454  C CD  . GLN A 105 ? 0.5821 0.5616 0.7804 0.0082  0.0874  0.0602  255 GLN A CD  
455  O OE1 . GLN A 105 ? 0.5826 0.5606 0.7914 0.0054  0.0772  0.0557  255 GLN A OE1 
456  N NE2 . GLN A 105 ? 0.6525 0.6375 0.8741 0.0075  0.0921  0.0600  255 GLN A NE2 
457  N N   . ILE A 106 ? 0.3276 0.3044 0.4404 0.0102  0.0473  0.0363  256 ILE A N   
458  C CA  . ILE A 106 ? 0.3384 0.3130 0.4336 0.0108  0.0394  0.0328  256 ILE A CA  
459  C C   . ILE A 106 ? 0.3542 0.3237 0.4474 0.0122  0.0461  0.0412  256 ILE A C   
460  O O   . ILE A 106 ? 0.3424 0.3093 0.4585 0.0107  0.0494  0.0446  256 ILE A O   
461  C CB  . ILE A 106 ? 0.3605 0.3357 0.4685 0.0084  0.0271  0.0234  256 ILE A CB  
462  C CG1 . ILE A 106 ? 0.3885 0.3681 0.4947 0.0080  0.0191  0.0158  256 ILE A CG1 
463  C CG2 . ILE A 106 ? 0.3629 0.3351 0.4546 0.0096  0.0217  0.0209  256 ILE A CG2 
464  C CD1 . ILE A 106 ? 0.4360 0.4162 0.5576 0.0062  0.0074  0.0071  256 ILE A CD1 
465  N N   . LEU A 107 ? 0.3202 0.2881 0.3874 0.0152  0.0475  0.0445  257 LEU A N   
466  C CA  . LEU A 107 ? 0.3255 0.2886 0.3873 0.0177  0.0527  0.0533  257 LEU A CA  
467  C C   . LEU A 107 ? 0.3371 0.2984 0.4033 0.0172  0.0446  0.0498  257 LEU A C   
468  O O   . LEU A 107 ? 0.3212 0.2778 0.3967 0.0181  0.0483  0.0562  257 LEU A O   
469  C CB  . LEU A 107 ? 0.3540 0.3165 0.3861 0.0217  0.0555  0.0576  257 LEU A CB  
470  C CG  . LEU A 107 ? 0.3659 0.3289 0.3888 0.0232  0.0642  0.0601  257 LEU A CG  
471  C CD1 . LEU A 107 ? 0.4023 0.3632 0.3938 0.0277  0.0657  0.0633  257 LEU A CD1 
472  C CD2 . LEU A 107 ? 0.4041 0.3643 0.4459 0.0235  0.0773  0.0691  257 LEU A CD2 
473  N N   . ALA A 108 ? 0.3163 0.2806 0.3758 0.0162  0.0345  0.0400  258 ALA A N   
474  C CA  . ALA A 108 ? 0.3503 0.3126 0.4129 0.0163  0.0277  0.0356  258 ALA A CA  
475  C C   . ALA A 108 ? 0.3238 0.2892 0.3840 0.0148  0.0184  0.0242  258 ALA A C   
476  O O   . ALA A 108 ? 0.2966 0.2659 0.3432 0.0148  0.0163  0.0211  258 ALA A O   
477  C CB  . ALA A 108 ? 0.3623 0.3240 0.4072 0.0198  0.0276  0.0404  258 ALA A CB  
478  N N   . THR A 109 ? 0.3222 0.2847 0.3948 0.0140  0.0132  0.0181  259 THR A N   
479  C CA  . THR A 109 ? 0.3132 0.2768 0.3786 0.0140  0.0047  0.0077  259 THR A CA  
480  C C   . THR A 109 ? 0.3405 0.3014 0.4003 0.0165  0.0033  0.0064  259 THR A C   
481  O O   . THR A 109 ? 0.3244 0.2801 0.3983 0.0167  0.0034  0.0059  259 THR A O   
482  C CB  . THR A 109 ? 0.3283 0.2905 0.4103 0.0118  -0.0015 -0.0005 259 THR A CB  
483  O OG1 . THR A 109 ? 0.3234 0.2892 0.4133 0.0099  -0.0001 0.0011  259 THR A OG1 
484  C CG2 . THR A 109 ? 0.3462 0.3085 0.4150 0.0132  -0.0100 -0.0108 259 THR A CG2 
485  N N   . LEU A 110 ? 0.2893 0.2536 0.3312 0.0184  0.0022  0.0059  260 LEU A N   
486  C CA  . LEU A 110 ? 0.2908 0.2543 0.3286 0.0211  0.0021  0.0064  260 LEU A CA  
487  C C   . LEU A 110 ? 0.3050 0.2677 0.3378 0.0224  -0.0023 -0.0034 260 LEU A C   
488  O O   . LEU A 110 ? 0.3038 0.2700 0.3237 0.0225  -0.0039 -0.0065 260 LEU A O   
489  C CB  . LEU A 110 ? 0.2950 0.2634 0.3188 0.0225  0.0041  0.0126  260 LEU A CB  
490  C CG  . LEU A 110 ? 0.3348 0.3031 0.3574 0.0225  0.0088  0.0220  260 LEU A CG  
491  C CD1 . LEU A 110 ? 0.3469 0.3201 0.3526 0.0235  0.0082  0.0246  260 LEU A CD1 
492  C CD2 . LEU A 110 ? 0.3319 0.2957 0.3642 0.0247  0.0120  0.0293  260 LEU A CD2 
493  N N   . LYS A 111 ? 0.3194 0.2765 0.3623 0.0237  -0.0034 -0.0079 261 LYS A N   
494  C CA  . LYS A 111 ? 0.3358 0.2899 0.3737 0.0256  -0.0069 -0.0180 261 LYS A CA  
495  C C   . LYS A 111 ? 0.3420 0.2958 0.3776 0.0293  -0.0040 -0.0174 261 LYS A C   
496  O O   . LYS A 111 ? 0.3232 0.2759 0.3687 0.0304  -0.0010 -0.0110 261 LYS A O   
497  C CB  . LYS A 111 ? 0.3653 0.3122 0.4173 0.0247  -0.0110 -0.0256 261 LYS A CB  
498  C CG  . LYS A 111 ? 0.3735 0.3214 0.4336 0.0210  -0.0145 -0.0263 261 LYS A CG  
499  C CD  . LYS A 111 ? 0.4582 0.3992 0.5376 0.0195  -0.0194 -0.0339 261 LYS A CD  
500  C CE  . LYS A 111 ? 0.5096 0.4529 0.5937 0.0167  -0.0259 -0.0384 261 LYS A CE  
501  N NZ  . LYS A 111 ? 0.5757 0.5137 0.6848 0.0141  -0.0312 -0.0445 261 LYS A NZ  
502  N N   . GLY A 112 ? 0.3253 0.2800 0.3483 0.0317  -0.0042 -0.0234 262 GLY A N   
503  C CA  . GLY A 112 ? 0.3229 0.2776 0.3454 0.0357  -0.0006 -0.0242 262 GLY A CA  
504  C C   . GLY A 112 ? 0.3313 0.2896 0.3382 0.0378  0.0014  -0.0273 262 GLY A C   
505  O O   . GLY A 112 ? 0.3267 0.2820 0.3306 0.0417  0.0042  -0.0327 262 GLY A O   
506  N N   . HIS A 113 ? 0.3373 0.3013 0.3347 0.0354  0.0010  -0.0237 263 HIS A N   
507  C CA  . HIS A 113 ? 0.3412 0.3077 0.3246 0.0371  0.0036  -0.0259 263 HIS A CA  
508  C C   . HIS A 113 ? 0.3803 0.3395 0.3529 0.0401  0.0022  -0.0354 263 HIS A C   
509  O O   . HIS A 113 ? 0.3571 0.3111 0.3309 0.0390  -0.0036 -0.0405 263 HIS A O   
510  C CB  . HIS A 113 ? 0.3358 0.3074 0.3119 0.0338  0.0025  -0.0215 263 HIS A CB  
511  C CG  . HIS A 113 ? 0.2850 0.2640 0.2658 0.0321  0.0047  -0.0141 263 HIS A CG  
512  N ND1 . HIS A 113 ? 0.2926 0.2760 0.2751 0.0339  0.0092  -0.0123 263 HIS A ND1 
513  C CD2 . HIS A 113 ? 0.2946 0.2770 0.2789 0.0291  0.0027  -0.0086 263 HIS A CD2 
514  C CE1 . HIS A 113 ? 0.2954 0.2852 0.2834 0.0318  0.0082  -0.0066 263 HIS A CE1 
515  N NE2 . HIS A 113 ? 0.3002 0.2889 0.2873 0.0291  0.0043  -0.0044 263 HIS A NE2 
516  N N   . THR A 114 ? 0.3663 0.3248 0.3290 0.0442  0.0077  -0.0380 264 THR A N   
517  C CA  . THR A 114 ? 0.3721 0.3227 0.3200 0.0484  0.0068  -0.0474 264 THR A CA  
518  C C   . THR A 114 ? 0.3627 0.3136 0.2902 0.0495  0.0073  -0.0471 264 THR A C   
519  O O   . THR A 114 ? 0.3807 0.3247 0.2907 0.0541  0.0064  -0.0543 264 THR A O   
520  C CB  . THR A 114 ? 0.3860 0.3329 0.3336 0.0539  0.0138  -0.0517 264 THR A CB  
521  O OG1 . THR A 114 ? 0.3769 0.3313 0.3267 0.0548  0.0223  -0.0446 264 THR A OG1 
522  C CG2 . THR A 114 ? 0.4036 0.3475 0.3706 0.0538  0.0124  -0.0535 264 THR A CG2 
523  N N   . LYS A 115 ? 0.3692 0.3271 0.2987 0.0459  0.0083  -0.0389 265 LYS A N   
524  C CA  . LYS A 115 ? 0.3824 0.3408 0.2969 0.0460  0.0080  -0.0365 265 LYS A CA  
525  C C   . LYS A 115 ? 0.3511 0.3144 0.2744 0.0404  0.0032  -0.0312 265 LYS A C   
526  O O   . LYS A 115 ? 0.3307 0.2974 0.2695 0.0369  0.0017  -0.0284 265 LYS A O   
527  C CB  . LYS A 115 ? 0.4104 0.3722 0.3194 0.0480  0.0182  -0.0311 265 LYS A CB  
528  C CG  . LYS A 115 ? 0.4311 0.3884 0.3310 0.0543  0.0261  -0.0354 265 LYS A CG  
529  C CD  . LYS A 115 ? 0.5050 0.4555 0.3794 0.0594  0.0277  -0.0381 265 LYS A CD  
530  C CE  . LYS A 115 ? 0.5782 0.5237 0.4413 0.0665  0.0379  -0.0420 265 LYS A CE  
531  N NZ  . LYS A 115 ? 0.6247 0.5634 0.4881 0.0691  0.0326  -0.0528 265 LYS A NZ  
532  N N   . LYS A 116 ? 0.3556 0.3186 0.2683 0.0402  0.0013  -0.0293 266 LYS A N   
533  C CA  . LYS A 116 ? 0.3597 0.3267 0.2793 0.0356  -0.0021 -0.0245 266 LYS A CA  
534  C C   . LYS A 116 ? 0.3573 0.3309 0.2894 0.0320  0.0022  -0.0182 266 LYS A C   
535  O O   . LYS A 116 ? 0.3344 0.3108 0.2687 0.0328  0.0083  -0.0160 266 LYS A O   
536  C CB  . LYS A 116 ? 0.4093 0.3746 0.3149 0.0371  -0.0028 -0.0224 266 LYS A CB  
537  C CG  . LYS A 116 ? 0.4173 0.3838 0.3155 0.0386  0.0061  -0.0171 266 LYS A CG  
538  C CD  . LYS A 116 ? 0.4677 0.4297 0.3484 0.0419  0.0053  -0.0152 266 LYS A CD  
539  C CE  . LYS A 116 ? 0.5110 0.4738 0.3873 0.0428  0.0153  -0.0083 266 LYS A CE  
540  N NZ  . LYS A 116 ? 0.6147 0.5709 0.4694 0.0482  0.0160  -0.0065 266 LYS A NZ  
541  N N   . VAL A 117 ? 0.3268 0.3029 0.2673 0.0282  -0.0010 -0.0157 267 VAL A N   
542  C CA  . VAL A 117 ? 0.3027 0.2839 0.2518 0.0253  0.0013  -0.0110 267 VAL A CA  
543  C C   . VAL A 117 ? 0.3350 0.3182 0.2808 0.0232  0.0025  -0.0075 267 VAL A C   
544  O O   . VAL A 117 ? 0.3265 0.3084 0.2707 0.0220  -0.0003 -0.0074 267 VAL A O   
545  C CB  . VAL A 117 ? 0.2965 0.2782 0.2552 0.0232  -0.0017 -0.0101 267 VAL A CB  
546  C CG1 . VAL A 117 ? 0.2855 0.2718 0.2491 0.0213  0.0000  -0.0054 267 VAL A CG1 
547  C CG2 . VAL A 117 ? 0.3118 0.2901 0.2762 0.0250  -0.0030 -0.0135 267 VAL A CG2 
548  N N   . THR A 118 ? 0.3306 0.3173 0.2784 0.0225  0.0067  -0.0048 268 THR A N   
549  C CA  . THR A 118 ? 0.3179 0.3051 0.2639 0.0206  0.0085  -0.0020 268 THR A CA  
550  C C   . THR A 118 ? 0.3181 0.3095 0.2725 0.0171  0.0077  -0.0002 268 THR A C   
551  O O   . THR A 118 ? 0.3158 0.3068 0.2703 0.0150  0.0083  0.0009  268 THR A O   
552  C CB  . THR A 118 ? 0.3493 0.3361 0.2915 0.0227  0.0147  -0.0002 268 THR A CB  
553  O OG1 . THR A 118 ? 0.3452 0.3360 0.2954 0.0235  0.0181  -0.0001 268 THR A OG1 
554  C CG2 . THR A 118 ? 0.3544 0.3354 0.2825 0.0268  0.0151  -0.0018 268 THR A CG2 
555  N N   . SER A 119 ? 0.3025 0.2974 0.2634 0.0166  0.0057  -0.0003 269 SER A N   
556  C CA  . SER A 119 ? 0.3092 0.3073 0.2744 0.0140  0.0029  0.0005  269 SER A CA  
557  C C   . SER A 119 ? 0.3161 0.3139 0.2810 0.0148  0.0000  0.0010  269 SER A C   
558  O O   . SER A 119 ? 0.3132 0.3109 0.2809 0.0170  0.0001  0.0012  269 SER A O   
559  C CB  . SER A 119 ? 0.3403 0.3441 0.3152 0.0133  0.0033  0.0014  269 SER A CB  
560  O OG  . SER A 119 ? 0.3298 0.3341 0.3082 0.0121  0.0073  0.0020  269 SER A OG  
561  N N   . VAL A 120 ? 0.2946 0.2916 0.2560 0.0135  -0.0020 0.0013  270 VAL A N   
562  C CA  . VAL A 120 ? 0.2829 0.2793 0.2427 0.0146  -0.0035 0.0034  270 VAL A CA  
563  C C   . VAL A 120 ? 0.2954 0.2931 0.2503 0.0138  -0.0063 0.0035  270 VAL A C   
564  O O   . VAL A 120 ? 0.2858 0.2826 0.2381 0.0118  -0.0066 0.0009  270 VAL A O   
565  C CB  . VAL A 120 ? 0.2930 0.2852 0.2513 0.0152  -0.0017 0.0039  270 VAL A CB  
566  C CG1 . VAL A 120 ? 0.2727 0.2632 0.2354 0.0163  -0.0010 0.0024  270 VAL A CG1 
567  C CG2 . VAL A 120 ? 0.3195 0.3094 0.2735 0.0137  -0.0004 0.0026  270 VAL A CG2 
568  N N   . VAL A 121 ? 0.2797 0.2786 0.2330 0.0157  -0.0088 0.0062  271 VAL A N   
569  C CA  . VAL A 121 ? 0.3165 0.3159 0.2616 0.0161  -0.0129 0.0061  271 VAL A CA  
570  C C   . VAL A 121 ? 0.3276 0.3239 0.2650 0.0193  -0.0117 0.0110  271 VAL A C   
571  O O   . VAL A 121 ? 0.3150 0.3116 0.2580 0.0213  -0.0110 0.0152  271 VAL A O   
572  C CB  . VAL A 121 ? 0.3164 0.3217 0.2675 0.0160  -0.0192 0.0052  271 VAL A CB  
573  C CG1 . VAL A 121 ? 0.3450 0.3501 0.2849 0.0171  -0.0255 0.0042  271 VAL A CG1 
574  C CG2 . VAL A 121 ? 0.3300 0.3383 0.2911 0.0127  -0.0190 0.0014  271 VAL A CG2 
575  N N   . PHE A 122 ? 0.3304 0.3230 0.2552 0.0200  -0.0106 0.0109  272 PHE A N   
576  C CA  . PHE A 122 ? 0.3356 0.3242 0.2510 0.0234  -0.0072 0.0166  272 PHE A CA  
577  C C   . PHE A 122 ? 0.3684 0.3576 0.2706 0.0264  -0.0136 0.0177  272 PHE A C   
578  O O   . PHE A 122 ? 0.3733 0.3622 0.2658 0.0259  -0.0176 0.0125  272 PHE A O   
579  C CB  . PHE A 122 ? 0.3448 0.3284 0.2541 0.0231  -0.0001 0.0159  272 PHE A CB  
580  C CG  . PHE A 122 ? 0.3611 0.3409 0.2711 0.0254  0.0072  0.0228  272 PHE A CG  
581  C CD1 . PHE A 122 ? 0.3721 0.3503 0.2756 0.0293  0.0076  0.0300  272 PHE A CD1 
582  C CD2 . PHE A 122 ? 0.3392 0.3171 0.2578 0.0240  0.0139  0.0227  272 PHE A CD2 
583  C CE1 . PHE A 122 ? 0.3504 0.3245 0.2574 0.0311  0.0158  0.0375  272 PHE A CE1 
584  C CE2 . PHE A 122 ? 0.3095 0.2844 0.2332 0.0255  0.0213  0.0292  272 PHE A CE2 
585  C CZ  . PHE A 122 ? 0.3485 0.3212 0.2672 0.0288  0.0229  0.0367  272 PHE A CZ  
586  N N   . HIS A 123 ? 0.3375 0.3274 0.2395 0.0299  -0.0155 0.0243  273 HIS A N   
587  C CA  . HIS A 123 ? 0.3629 0.3531 0.2501 0.0340  -0.0228 0.0263  273 HIS A CA  
588  C C   . HIS A 123 ? 0.3912 0.3743 0.2559 0.0373  -0.0182 0.0285  273 HIS A C   
589  O O   . HIS A 123 ? 0.4023 0.3807 0.2667 0.0380  -0.0081 0.0332  273 HIS A O   
590  C CB  . HIS A 123 ? 0.3723 0.3641 0.2653 0.0377  -0.0252 0.0342  273 HIS A CB  
591  C CG  . HIS A 123 ? 0.3783 0.3735 0.2626 0.0415  -0.0364 0.0353  273 HIS A CG  
592  N ND1 . HIS A 123 ? 0.4398 0.4303 0.3013 0.0469  -0.0385 0.0402  273 HIS A ND1 
593  C CD2 . HIS A 123 ? 0.4115 0.4145 0.3074 0.0410  -0.0466 0.0322  273 HIS A CD2 
594  C CE1 . HIS A 123 ? 0.4673 0.4625 0.3255 0.0498  -0.0510 0.0397  273 HIS A CE1 
595  N NE2 . HIS A 123 ? 0.4383 0.4417 0.3193 0.0459  -0.0563 0.0348  273 HIS A NE2 
596  N N   . PRO A 124 ? 0.4256 0.4077 0.2717 0.0397  -0.0255 0.0248  274 PRO A N   
597  C CA  . PRO A 124 ? 0.4636 0.4378 0.2836 0.0443  -0.0205 0.0270  274 PRO A CA  
598  C C   . PRO A 124 ? 0.4455 0.4151 0.2554 0.0503  -0.0143 0.0395  274 PRO A C   
599  O O   . PRO A 124 ? 0.4409 0.4033 0.2331 0.0539  -0.0052 0.0434  274 PRO A O   
600  C CB  . PRO A 124 ? 0.5087 0.4834 0.3118 0.0460  -0.0330 0.0195  274 PRO A CB  
601  C CG  . PRO A 124 ? 0.5129 0.4966 0.3343 0.0438  -0.0449 0.0177  274 PRO A CG  
602  C CD  . PRO A 124 ? 0.4516 0.4394 0.2998 0.0383  -0.0386 0.0176  274 PRO A CD  
603  N N   . SER A 125 ? 0.4401 0.4132 0.2626 0.0515  -0.0178 0.0465  275 SER A N   
604  C CA  . SER A 125 ? 0.4654 0.4334 0.2820 0.0571  -0.0112 0.0596  275 SER A CA  
605  C C   . SER A 125 ? 0.4608 0.4245 0.2896 0.0551  0.0037  0.0647  275 SER A C   
606  O O   . SER A 125 ? 0.4992 0.4572 0.3232 0.0592  0.0119  0.0756  275 SER A O   
607  C CB  . SER A 125 ? 0.4832 0.4557 0.3139 0.0589  -0.0187 0.0655  275 SER A CB  
608  O OG  . SER A 125 ? 0.4237 0.4006 0.2832 0.0534  -0.0164 0.0625  275 SER A OG  
609  N N   . GLN A 126 ? 0.4494 0.4158 0.2953 0.0489  0.0067  0.0570  276 GLN A N   
610  C CA  . GLN A 126 ? 0.4356 0.3995 0.2974 0.0460  0.0186  0.0594  276 GLN A CA  
611  C C   . GLN A 126 ? 0.4275 0.3924 0.3134 0.0445  0.0201  0.0642  276 GLN A C   
612  O O   . GLN A 126 ? 0.4485 0.4139 0.3528 0.0404  0.0246  0.0615  276 GLN A O   
613  C CB  . GLN A 126 ? 0.4557 0.4125 0.3034 0.0498  0.0310  0.0663  276 GLN A CB  
614  C CG  . GLN A 126 ? 0.4953 0.4495 0.3177 0.0520  0.0304  0.0604  276 GLN A CG  
615  C CD  . GLN A 126 ? 0.5666 0.5137 0.3770 0.0557  0.0453  0.0663  276 GLN A CD  
616  O OE1 . GLN A 126 ? 0.6067 0.5516 0.4314 0.0557  0.0565  0.0749  276 GLN A OE1 
617  N NE2 . GLN A 126 ? 0.5595 0.5029 0.3450 0.0589  0.0457  0.0615  276 GLN A NE2 
618  N N   . ASP A 127 ? 0.4509 0.4161 0.3370 0.0479  0.0151  0.0703  277 ASP A N   
619  C CA  . ASP A 127 ? 0.4551 0.4195 0.3633 0.0472  0.0171  0.0748  277 ASP A CA  
620  C C   . ASP A 127 ? 0.4100 0.3809 0.3336 0.0443  0.0083  0.0673  277 ASP A C   
621  O O   . ASP A 127 ? 0.3975 0.3674 0.3402 0.0433  0.0099  0.0682  277 ASP A O   
622  C CB  . ASP A 127 ? 0.5124 0.4715 0.4146 0.0534  0.0197  0.0880  277 ASP A CB  
623  C CG  . ASP A 127 ? 0.5708 0.5334 0.4611 0.0578  0.0082  0.0895  277 ASP A CG  
624  O OD1 . ASP A 127 ? 0.6320 0.5981 0.5053 0.0581  0.0008  0.0832  277 ASP A OD1 
625  O OD2 . ASP A 127 ? 0.6433 0.6050 0.5430 0.0610  0.0059  0.0965  277 ASP A OD2 
626  N N   . LEU A 128 ? 0.3880 0.3648 0.3040 0.0433  -0.0002 0.0599  278 LEU A N   
627  C CA  . LEU A 128 ? 0.4026 0.3859 0.3332 0.0405  -0.0067 0.0526  278 LEU A CA  
628  C C   . LEU A 128 ? 0.3731 0.3587 0.3068 0.0353  -0.0058 0.0432  278 LEU A C   
629  O O   . LEU A 128 ? 0.3825 0.3681 0.3037 0.0343  -0.0063 0.0398  278 LEU A O   
630  C CB  . LEU A 128 ? 0.4281 0.4172 0.3533 0.0429  -0.0171 0.0519  278 LEU A CB  
631  C CG  . LEU A 128 ? 0.4323 0.4213 0.3609 0.0484  -0.0207 0.0606  278 LEU A CG  
632  C CD1 . LEU A 128 ? 0.4304 0.4257 0.3520 0.0511  -0.0327 0.0595  278 LEU A CD1 
633  C CD2 . LEU A 128 ? 0.4365 0.4264 0.3881 0.0477  -0.0185 0.0605  278 LEU A CD2 
634  N N   . VAL A 129 ? 0.3340 0.3211 0.2834 0.0325  -0.0047 0.0388  279 VAL A N   
635  C CA  . VAL A 129 ? 0.3237 0.3135 0.2754 0.0285  -0.0051 0.0305  279 VAL A CA  
636  C C   . VAL A 129 ? 0.3262 0.3205 0.2897 0.0278  -0.0082 0.0265  279 VAL A C   
637  O O   . VAL A 129 ? 0.3053 0.2994 0.2783 0.0300  -0.0082 0.0290  279 VAL A O   
638  C CB  . VAL A 129 ? 0.3237 0.3095 0.2790 0.0260  0.0008  0.0286  279 VAL A CB  
639  C CG1 . VAL A 129 ? 0.3514 0.3334 0.2962 0.0270  0.0056  0.0327  279 VAL A CG1 
640  C CG2 . VAL A 129 ? 0.3094 0.2923 0.2791 0.0260  0.0035  0.0295  279 VAL A CG2 
641  N N   . PHE A 130 ? 0.3199 0.3175 0.2830 0.0250  -0.0097 0.0207  280 PHE A N   
642  C CA  . PHE A 130 ? 0.3149 0.3170 0.2880 0.0246  -0.0110 0.0175  280 PHE A CA  
643  C C   . PHE A 130 ? 0.3068 0.3078 0.2808 0.0221  -0.0076 0.0124  280 PHE A C   
644  O O   . PHE A 130 ? 0.3185 0.3175 0.2856 0.0199  -0.0067 0.0106  280 PHE A O   
645  C CB  . PHE A 130 ? 0.3035 0.3119 0.2770 0.0243  -0.0167 0.0166  280 PHE A CB  
646  C CG  . PHE A 130 ? 0.3139 0.3231 0.2806 0.0271  -0.0221 0.0210  280 PHE A CG  
647  C CD1 . PHE A 130 ? 0.3378 0.3475 0.3099 0.0310  -0.0238 0.0265  280 PHE A CD1 
648  C CD2 . PHE A 130 ? 0.3192 0.3276 0.2727 0.0263  -0.0257 0.0197  280 PHE A CD2 
649  C CE1 . PHE A 130 ? 0.3377 0.3476 0.3011 0.0345  -0.0294 0.0317  280 PHE A CE1 
650  C CE2 . PHE A 130 ? 0.3538 0.3619 0.2970 0.0298  -0.0312 0.0236  280 PHE A CE2 
651  C CZ  . PHE A 130 ? 0.3466 0.3557 0.2941 0.0341  -0.0334 0.0301  280 PHE A CZ  
652  N N   . SER A 131 ? 0.2959 0.2976 0.2776 0.0229  -0.0056 0.0103  281 SER A N   
653  C CA  . SER A 131 ? 0.2810 0.2811 0.2610 0.0216  -0.0026 0.0060  281 SER A CA  
654  C C   . SER A 131 ? 0.2906 0.2941 0.2768 0.0227  -0.0002 0.0043  281 SER A C   
655  O O   . SER A 131 ? 0.3096 0.3164 0.3045 0.0249  -0.0004 0.0058  281 SER A O   
656  C CB  . SER A 131 ? 0.3025 0.2966 0.2818 0.0224  -0.0010 0.0041  281 SER A CB  
657  O OG  . SER A 131 ? 0.2825 0.2751 0.2694 0.0251  -0.0004 0.0045  281 SER A OG  
658  N N   . ALA A 132 ? 0.2862 0.2884 0.2680 0.0219  0.0029  0.0017  282 ALA A N   
659  C CA  . ALA A 132 ? 0.3134 0.3175 0.2993 0.0237  0.0077  0.0007  282 ALA A CA  
660  C C   . ALA A 132 ? 0.2972 0.2962 0.2726 0.0246  0.0113  -0.0019 282 ALA A C   
661  O O   . ALA A 132 ? 0.3075 0.3029 0.2750 0.0231  0.0090  -0.0027 282 ALA A O   
662  C CB  . ALA A 132 ? 0.3060 0.3172 0.3011 0.0218  0.0080  0.0028  282 ALA A CB  
663  N N   . SER A 133 ? 0.3172 0.3156 0.2921 0.0276  0.0170  -0.0030 283 SER A N   
664  C CA  . SER A 133 ? 0.3042 0.2961 0.2660 0.0304  0.0194  -0.0063 283 SER A CA  
665  C C   . SER A 133 ? 0.2998 0.2919 0.2593 0.0338  0.0281  -0.0059 283 SER A C   
666  O O   . SER A 133 ? 0.3155 0.3129 0.2877 0.0346  0.0325  -0.0040 283 SER A O   
667  C CB  . SER A 133 ? 0.2845 0.2716 0.2453 0.0328  0.0163  -0.0108 283 SER A CB  
668  O OG  . SER A 133 ? 0.3151 0.2954 0.2633 0.0365  0.0174  -0.0160 283 SER A OG  
669  N N   . PRO A 134 ? 0.3442 0.3302 0.2875 0.0365  0.0306  -0.0075 284 PRO A N   
670  C CA  . PRO A 134 ? 0.3678 0.3517 0.3043 0.0413  0.0402  -0.0075 284 PRO A CA  
671  C C   . PRO A 134 ? 0.3674 0.3495 0.3063 0.0458  0.0432  -0.0122 284 PRO A C   
672  O O   . PRO A 134 ? 0.3511 0.3323 0.2871 0.0501  0.0528  -0.0121 284 PRO A O   
673  C CB  . PRO A 134 ? 0.3856 0.3616 0.2995 0.0441  0.0392  -0.0092 284 PRO A CB  
674  C CG  . PRO A 134 ? 0.3882 0.3652 0.3036 0.0394  0.0319  -0.0069 284 PRO A CG  
675  C CD  . PRO A 134 ? 0.3721 0.3531 0.3023 0.0358  0.0252  -0.0087 284 PRO A CD  
676  N N   . ASP A 135 ? 0.3245 0.3054 0.2694 0.0451  0.0362  -0.0162 285 ASP A N   
677  C CA  . ASP A 135 ? 0.3387 0.3180 0.2904 0.0493  0.0395  -0.0201 285 ASP A CA  
678  C C   . ASP A 135 ? 0.3396 0.3281 0.3128 0.0488  0.0443  -0.0150 285 ASP A C   
679  O O   . ASP A 135 ? 0.3161 0.3047 0.2993 0.0522  0.0471  -0.0169 285 ASP A O   
680  C CB  . ASP A 135 ? 0.3561 0.3306 0.3106 0.0487  0.0310  -0.0251 285 ASP A CB  
681  C CG  . ASP A 135 ? 0.3344 0.3146 0.3047 0.0437  0.0246  -0.0201 285 ASP A CG  
682  O OD1 . ASP A 135 ? 0.3072 0.2954 0.2872 0.0411  0.0253  -0.0140 285 ASP A OD1 
683  O OD2 . ASP A 135 ? 0.3386 0.3146 0.3113 0.0428  0.0188  -0.0226 285 ASP A OD2 
684  N N   . ALA A 136 ? 0.3272 0.3231 0.3089 0.0446  0.0441  -0.0090 286 ALA A N   
685  C CA  . ALA A 136 ? 0.2999 0.3057 0.3034 0.0437  0.0473  -0.0042 286 ALA A CA  
686  C C   . ALA A 136 ? 0.3054 0.3161 0.3241 0.0420  0.0391  -0.0027 286 ALA A C   
687  O O   . ALA A 136 ? 0.3243 0.3432 0.3618 0.0422  0.0397  0.0004  286 ALA A O   
688  C CB  . ALA A 136 ? 0.3373 0.3441 0.3463 0.0490  0.0593  -0.0046 286 ALA A CB  
689  N N   . THR A 137 ? 0.3004 0.3062 0.3116 0.0406  0.0313  -0.0045 287 THR A N   
690  C CA  . THR A 137 ? 0.2987 0.3074 0.3210 0.0398  0.0242  -0.0019 287 THR A CA  
691  C C   . THR A 137 ? 0.3115 0.3226 0.3301 0.0349  0.0169  0.0010  287 THR A C   
692  O O   . THR A 137 ? 0.2938 0.3018 0.3002 0.0322  0.0164  -0.0001 287 THR A O   
693  C CB  . THR A 137 ? 0.2986 0.2994 0.3184 0.0424  0.0221  -0.0050 287 THR A CB  
694  O OG1 . THR A 137 ? 0.3029 0.2975 0.3090 0.0399  0.0184  -0.0076 287 THR A OG1 
695  C CG2 . THR A 137 ? 0.3181 0.3142 0.3388 0.0478  0.0294  -0.0102 287 THR A CG2 
696  N N   . ILE A 138 ? 0.3126 0.3287 0.3412 0.0345  0.0111  0.0048  288 ILE A N   
697  C CA  . ILE A 138 ? 0.2983 0.3151 0.3217 0.0314  0.0040  0.0074  288 ILE A CA  
698  C C   . ILE A 138 ? 0.3004 0.3128 0.3239 0.0337  0.0010  0.0096  288 ILE A C   
699  O O   . ILE A 138 ? 0.3024 0.3164 0.3372 0.0372  0.0011  0.0116  288 ILE A O   
700  C CB  . ILE A 138 ? 0.2840 0.3099 0.3178 0.0300  -0.0009 0.0103  288 ILE A CB  
701  C CG1 . ILE A 138 ? 0.2751 0.3054 0.3136 0.0273  0.0027  0.0087  288 ILE A CG1 
702  C CG2 . ILE A 138 ? 0.3136 0.3391 0.3388 0.0281  -0.0087 0.0123  288 ILE A CG2 
703  C CD1 . ILE A 138 ? 0.2865 0.3269 0.3432 0.0265  -0.0014 0.0105  288 ILE A CD1 
704  N N   . ARG A 139 ? 0.2840 0.2909 0.2971 0.0319  -0.0008 0.0099  289 ARG A N   
705  C CA  . ARG A 139 ? 0.2929 0.2948 0.3078 0.0338  -0.0020 0.0130  289 ARG A CA  
706  C C   . ARG A 139 ? 0.2940 0.2964 0.3023 0.0328  -0.0062 0.0181  289 ARG A C   
707  O O   . ARG A 139 ? 0.2953 0.2980 0.2939 0.0297  -0.0071 0.0171  289 ARG A O   
708  C CB  . ARG A 139 ? 0.2906 0.2844 0.3026 0.0336  0.0009  0.0086  289 ARG A CB  
709  C CG  . ARG A 139 ? 0.3144 0.3064 0.3304 0.0362  0.0050  0.0028  289 ARG A CG  
710  C CD  . ARG A 139 ? 0.3297 0.3131 0.3430 0.0367  0.0062  -0.0032 289 ARG A CD  
711  N NE  . ARG A 139 ? 0.3616 0.3435 0.3720 0.0395  0.0104  -0.0094 289 ARG A NE  
712  C CZ  . ARG A 139 ? 0.3611 0.3369 0.3754 0.0431  0.0127  -0.0147 289 ARG A CZ  
713  N NH1 . ARG A 139 ? 0.3803 0.3504 0.4046 0.0439  0.0108  -0.0147 289 ARG A NH1 
714  N NH2 . ARG A 139 ? 0.3660 0.3404 0.3736 0.0462  0.0175  -0.0202 289 ARG A NH2 
715  N N   . ILE A 140 ? 0.2902 0.2920 0.3033 0.0359  -0.0083 0.0240  290 ILE A N   
716  C CA  . ILE A 140 ? 0.3223 0.3231 0.3270 0.0366  -0.0115 0.0303  290 ILE A CA  
717  C C   . ILE A 140 ? 0.2770 0.2696 0.2830 0.0377  -0.0076 0.0342  290 ILE A C   
718  O O   . ILE A 140 ? 0.2883 0.2778 0.3059 0.0403  -0.0058 0.0355  290 ILE A O   
719  C CB  . ILE A 140 ? 0.3178 0.3243 0.3267 0.0403  -0.0176 0.0356  290 ILE A CB  
720  C CG1 A ILE A 140 ? 0.3706 0.3863 0.3868 0.0393  -0.0214 0.0315  290 ILE A CG1 
721  C CG1 B ILE A 140 ? 0.3168 0.3322 0.3301 0.0385  -0.0215 0.0310  290 ILE A CG1 
722  C CG2 . ILE A 140 ? 0.3488 0.3532 0.3438 0.0421  -0.0213 0.0423  290 ILE A CG2 
723  C CD1 A ILE A 140 ? 0.3928 0.4107 0.4018 0.0346  -0.0214 0.0258  290 ILE A CD1 
724  C CD1 B ILE A 140 ? 0.3073 0.3304 0.3301 0.0418  -0.0288 0.0345  290 ILE A CD1 
725  N N   . TRP A 141 ? 0.2873 0.2763 0.2834 0.0358  -0.0057 0.0361  291 TRP A N   
726  C CA  . TRP A 141 ? 0.2818 0.2631 0.2822 0.0358  -0.0007 0.0394  291 TRP A CA  
727  C C   . TRP A 141 ? 0.3373 0.3158 0.3284 0.0379  0.0007  0.0487  291 TRP A C   
728  O O   . TRP A 141 ? 0.3315 0.3128 0.3076 0.0379  -0.0013 0.0495  291 TRP A O   
729  C CB  . TRP A 141 ? 0.2749 0.2542 0.2746 0.0316  0.0020  0.0333  291 TRP A CB  
730  C CG  . TRP A 141 ? 0.2947 0.2762 0.2967 0.0297  0.0006  0.0240  291 TRP A CG  
731  C CD1 . TRP A 141 ? 0.3090 0.2958 0.3036 0.0282  -0.0013 0.0198  291 TRP A CD1 
732  C CD2 . TRP A 141 ? 0.2906 0.2682 0.3019 0.0295  0.0016  0.0181  291 TRP A CD2 
733  N NE1 . TRP A 141 ? 0.2952 0.2817 0.2926 0.0275  -0.0008 0.0130  291 TRP A NE1 
734  C CE2 . TRP A 141 ? 0.2923 0.2730 0.2982 0.0285  0.0005  0.0111  291 TRP A CE2 
735  C CE3 . TRP A 141 ? 0.3050 0.2761 0.3284 0.0301  0.0032  0.0175  291 TRP A CE3 
736  C CZ2 . TRP A 141 ? 0.2963 0.2737 0.3049 0.0290  0.0007  0.0038  291 TRP A CZ2 
737  C CZ3 . TRP A 141 ? 0.3028 0.2706 0.3309 0.0299  0.0023  0.0087  291 TRP A CZ3 
738  C CH2 . TRP A 141 ? 0.3145 0.2855 0.3333 0.0297  0.0010  0.0019  291 TRP A CH2 
739  N N   . SER A 142 ? 0.3412 0.3133 0.3409 0.0398  0.0050  0.0553  292 SER A N   
740  C CA  . SER A 142 ? 0.3597 0.3267 0.3521 0.0417  0.0099  0.0651  292 SER A CA  
741  C C   . SER A 142 ? 0.3711 0.3345 0.3686 0.0378  0.0166  0.0630  292 SER A C   
742  O O   . SER A 142 ? 0.3749 0.3349 0.3899 0.0355  0.0188  0.0597  292 SER A O   
743  C CB  . SER A 142 ? 0.3543 0.3156 0.3568 0.0460  0.0123  0.0749  292 SER A CB  
744  O OG  . SER A 142 ? 0.3650 0.3199 0.3621 0.0479  0.0197  0.0858  292 SER A OG  
745  N N   . VAL A 143 ? 0.3691 0.3331 0.3524 0.0372  0.0194  0.0645  293 VAL A N   
746  C CA  . VAL A 143 ? 0.3904 0.3518 0.3804 0.0340  0.0263  0.0636  293 VAL A CA  
747  C C   . VAL A 143 ? 0.4120 0.3663 0.4154 0.0352  0.0348  0.0734  293 VAL A C   
748  O O   . VAL A 143 ? 0.3799 0.3317 0.4041 0.0318  0.0376  0.0705  293 VAL A O   
749  C CB  . VAL A 143 ? 0.4273 0.3908 0.3990 0.0338  0.0283  0.0626  293 VAL A CB  
750  C CG1 . VAL A 143 ? 0.4543 0.4158 0.4361 0.0310  0.0360  0.0622  293 VAL A CG1 
751  C CG2 . VAL A 143 ? 0.4167 0.3863 0.3799 0.0319  0.0203  0.0526  293 VAL A CG2 
752  N N   . PRO A 144 ? 0.4201 0.3707 0.4126 0.0401  0.0385  0.0849  294 PRO A N   
753  C CA  . PRO A 144 ? 0.4458 0.3888 0.4519 0.0413  0.0484  0.0957  294 PRO A CA  
754  C C   . PRO A 144 ? 0.4234 0.3626 0.4552 0.0401  0.0470  0.0950  294 PRO A C   
755  O O   . PRO A 144 ? 0.4690 0.4031 0.5215 0.0379  0.0539  0.0982  294 PRO A O   
756  C CB  . PRO A 144 ? 0.4858 0.4254 0.4702 0.0480  0.0515  0.1086  294 PRO A CB  
757  C CG  . PRO A 144 ? 0.5160 0.4618 0.4786 0.0503  0.0404  0.1033  294 PRO A CG  
758  C CD  . PRO A 144 ? 0.4616 0.4143 0.4291 0.0449  0.0339  0.0887  294 PRO A CD  
759  N N   . ASN A 145 ? 0.4118 0.3534 0.4439 0.0414  0.0384  0.0901  295 ASN A N   
760  C CA  . ASN A 145 ? 0.4433 0.3805 0.4990 0.0407  0.0370  0.0873  295 ASN A CA  
761  C C   . ASN A 145 ? 0.4176 0.3575 0.4851 0.0355  0.0323  0.0723  295 ASN A C   
762  O O   . ASN A 145 ? 0.4501 0.3857 0.5360 0.0346  0.0308  0.0674  295 ASN A O   
763  C CB  . ASN A 145 ? 0.4429 0.3808 0.4950 0.0457  0.0314  0.0903  295 ASN A CB  
764  C CG  . ASN A 145 ? 0.4787 0.4085 0.5387 0.0504  0.0367  0.1046  295 ASN A CG  
765  O OD1 . ASN A 145 ? 0.5058 0.4285 0.5767 0.0495  0.0456  0.1122  295 ASN A OD1 
766  N ND2 . ASN A 145 ? 0.5462 0.4769 0.6022 0.0557  0.0317  0.1091  295 ASN A ND2 
767  N N   . ALA A 146 ? 0.4158 0.3619 0.4715 0.0327  0.0297  0.0649  296 ALA A N   
768  C CA  . ALA A 146 ? 0.3909 0.3399 0.4526 0.0287  0.0245  0.0514  296 ALA A CA  
769  C C   . ALA A 146 ? 0.4075 0.3562 0.4729 0.0302  0.0188  0.0444  296 ALA A C   
770  O O   . ALA A 146 ? 0.3523 0.2972 0.4322 0.0286  0.0169  0.0363  296 ALA A O   
771  C CB  . ALA A 146 ? 0.4611 0.4060 0.5437 0.0248  0.0275  0.0487  296 ALA A CB  
772  N N   . SER A 147 ? 0.3355 0.2880 0.3890 0.0338  0.0163  0.0475  297 SER A N   
773  C CA  . SER A 147 ? 0.3503 0.3027 0.4096 0.0363  0.0130  0.0432  297 SER A CA  
774  C C   . SER A 147 ? 0.3230 0.2837 0.3686 0.0375  0.0084  0.0396  297 SER A C   
775  O O   . SER A 147 ? 0.3248 0.2905 0.3564 0.0373  0.0073  0.0430  297 SER A O   
776  C CB  . SER A 147 ? 0.3597 0.3071 0.4282 0.0407  0.0153  0.0533  297 SER A CB  
777  O OG  . SER A 147 ? 0.4031 0.3546 0.4569 0.0440  0.0144  0.0629  297 SER A OG  
778  N N   . CYS A 148 ? 0.3229 0.2846 0.3736 0.0388  0.0065  0.0325  298 CYS A N   
779  C CA  . CYS A 148 ? 0.3317 0.3015 0.3749 0.0403  0.0034  0.0305  298 CYS A CA  
780  C C   . CYS A 148 ? 0.3330 0.3042 0.3831 0.0453  0.0022  0.0376  298 CYS A C   
781  O O   . CYS A 148 ? 0.3545 0.3204 0.4186 0.0482  0.0040  0.0375  298 CYS A O   
782  C CB  . CYS A 148 ? 0.3394 0.3097 0.3834 0.0397  0.0035  0.0196  298 CYS A CB  
783  S SG  . CYS A 148 ? 0.3407 0.3209 0.3807 0.0415  0.0020  0.0181  298 CYS A SG  
784  N N   . VAL A 149 ? 0.3074 0.2852 0.3487 0.0466  -0.0014 0.0434  299 VAL A N   
785  C CA  . VAL A 149 ? 0.3313 0.3115 0.3786 0.0518  -0.0045 0.0511  299 VAL A CA  
786  C C   . VAL A 149 ? 0.3046 0.2931 0.3587 0.0535  -0.0075 0.0469  299 VAL A C   
787  O O   . VAL A 149 ? 0.3030 0.2926 0.3699 0.0581  -0.0087 0.0505  299 VAL A O   
788  C CB  . VAL A 149 ? 0.3837 0.3645 0.4181 0.0539  -0.0077 0.0616  299 VAL A CB  
789  C CG1 . VAL A 149 ? 0.3906 0.3621 0.4219 0.0529  -0.0018 0.0671  299 VAL A CG1 
790  C CG2 . VAL A 149 ? 0.3723 0.3603 0.3909 0.0515  -0.0124 0.0588  299 VAL A CG2 
791  N N   . GLN A 150 ? 0.3076 0.3018 0.3557 0.0499  -0.0080 0.0395  300 GLN A N   
792  C CA  . GLN A 150 ? 0.3044 0.3063 0.3619 0.0512  -0.0087 0.0357  300 GLN A CA  
793  C C   . GLN A 150 ? 0.2833 0.2855 0.3368 0.0477  -0.0043 0.0264  300 GLN A C   
794  O O   . GLN A 150 ? 0.3081 0.3087 0.3489 0.0436  -0.0042 0.0239  300 GLN A O   
795  C CB  . GLN A 150 ? 0.3243 0.3362 0.3795 0.0514  -0.0163 0.0393  300 GLN A CB  
796  C CG  . GLN A 150 ? 0.3514 0.3647 0.4088 0.0561  -0.0228 0.0487  300 GLN A CG  
797  C CD  . GLN A 150 ? 0.3510 0.3663 0.4288 0.0615  -0.0225 0.0514  300 GLN A CD  
798  O OE1 . GLN A 150 ? 0.3536 0.3722 0.4444 0.0617  -0.0183 0.0457  300 GLN A OE1 
799  N NE2 . GLN A 150 ? 0.3860 0.3987 0.4664 0.0664  -0.0260 0.0604  300 GLN A NE2 
800  N N   . VAL A 151 ? 0.2819 0.2861 0.3459 0.0499  -0.0003 0.0221  301 VAL A N   
801  C CA  . VAL A 151 ? 0.3057 0.3110 0.3651 0.0479  0.0044  0.0147  301 VAL A CA  
802  C C   . VAL A 151 ? 0.2842 0.2997 0.3550 0.0492  0.0048  0.0157  301 VAL A C   
803  O O   . VAL A 151 ? 0.3066 0.3245 0.3930 0.0537  0.0074  0.0164  301 VAL A O   
804  C CB  . VAL A 151 ? 0.2967 0.2935 0.3565 0.0501  0.0106  0.0077  301 VAL A CB  
805  C CG1 . VAL A 151 ? 0.2848 0.2814 0.3339 0.0487  0.0154  0.0009  301 VAL A CG1 
806  C CG2 . VAL A 151 ? 0.3102 0.2972 0.3661 0.0491  0.0091  0.0072  301 VAL A CG2 
807  N N   . VAL A 152 ? 0.2708 0.2927 0.3368 0.0453  0.0023  0.0158  302 VAL A N   
808  C CA  . VAL A 152 ? 0.2793 0.3117 0.3598 0.0456  0.0019  0.0169  302 VAL A CA  
809  C C   . VAL A 152 ? 0.2479 0.2806 0.3288 0.0451  0.0114  0.0121  302 VAL A C   
810  O O   . VAL A 152 ? 0.2782 0.3073 0.3447 0.0417  0.0136  0.0093  302 VAL A O   
811  C CB  . VAL A 152 ? 0.2909 0.3297 0.3684 0.0417  -0.0065 0.0192  302 VAL A CB  
812  C CG1 . VAL A 152 ? 0.2885 0.3388 0.3860 0.0417  -0.0081 0.0200  302 VAL A CG1 
813  C CG2 . VAL A 152 ? 0.2970 0.3335 0.3667 0.0427  -0.0152 0.0241  302 VAL A CG2 
814  N N   . ARG A 153 ? 0.2690 0.3059 0.3663 0.0490  0.0175  0.0120  303 ARG A N   
815  C CA  . ARG A 153 ? 0.2883 0.3250 0.3863 0.0501  0.0287  0.0085  303 ARG A CA  
816  C C   . ARG A 153 ? 0.2973 0.3460 0.4154 0.0489  0.0306  0.0114  303 ARG A C   
817  O O   . ARG A 153 ? 0.3137 0.3680 0.4515 0.0528  0.0365  0.0125  303 ARG A O   
818  C CB  . ARG A 153 ? 0.2996 0.3299 0.3999 0.0563  0.0368  0.0050  303 ARG A CB  
819  C CG  . ARG A 153 ? 0.3200 0.3374 0.3989 0.0563  0.0363  0.0000  303 ARG A CG  
820  C CD  . ARG A 153 ? 0.3751 0.3842 0.4524 0.0622  0.0448  -0.0061 303 ARG A CD  
821  N NE  . ARG A 153 ? 0.3533 0.3503 0.4111 0.0617  0.0429  -0.0124 303 ARG A NE  
822  C CZ  . ARG A 153 ? 0.3739 0.3647 0.4318 0.0610  0.0362  -0.0128 303 ARG A CZ  
823  N NH1 . ARG A 153 ? 0.3980 0.3786 0.4414 0.0602  0.0345  -0.0193 303 ARG A NH1 
824  N NH2 . ARG A 153 ? 0.3416 0.3363 0.4148 0.0611  0.0309  -0.0063 303 ARG A NH2 
825  N N   . ALA A 154 ? 0.3084 0.3608 0.4232 0.0433  0.0255  0.0125  304 ALA A N   
826  C CA  . ALA A 154 ? 0.3003 0.3639 0.4360 0.0407  0.0254  0.0147  304 ALA A CA  
827  C C   . ALA A 154 ? 0.3073 0.3709 0.4454 0.0403  0.0391  0.0143  304 ALA A C   
828  O O   . ALA A 154 ? 0.3338 0.4071 0.4953 0.0390  0.0428  0.0166  304 ALA A O   
829  C CB  . ALA A 154 ? 0.2863 0.3525 0.4175 0.0350  0.0136  0.0151  304 ALA A CB  
830  N N   . HIS A 155 ? 0.3309 0.3839 0.4454 0.0414  0.0464  0.0116  305 HIS A N   
831  C CA  . HIS A 155 ? 0.3233 0.3740 0.4320 0.0408  0.0579  0.0121  305 HIS A CA  
832  C C   . HIS A 155 ? 0.3557 0.3980 0.4501 0.0470  0.0702  0.0095  305 HIS A C   
833  O O   . HIS A 155 ? 0.3861 0.4221 0.4705 0.0507  0.0681  0.0057  305 HIS A O   
834  C CB  . HIS A 155 ? 0.3181 0.3632 0.4075 0.0357  0.0529  0.0116  305 HIS A CB  
835  C CG  . HIS A 155 ? 0.2839 0.3360 0.3856 0.0298  0.0425  0.0131  305 HIS A CG  
836  N ND1 . HIS A 155 ? 0.2978 0.3582 0.4217 0.0264  0.0448  0.0157  305 HIS A ND1 
837  C CD2 . HIS A 155 ? 0.3114 0.3630 0.4066 0.0269  0.0295  0.0118  305 HIS A CD2 
838  C CE1 . HIS A 155 ? 0.3037 0.3680 0.4330 0.0216  0.0326  0.0148  305 HIS A CE1 
839  N NE2 . HIS A 155 ? 0.3140 0.3729 0.4246 0.0222  0.0235  0.0126  305 HIS A NE2 
840  N N   . GLU A 156 ? 0.3864 0.4281 0.4798 0.0484  0.0833  0.0115  306 GLU A N   
841  C CA  . GLU A 156 ? 0.4661 0.4994 0.5431 0.0551  0.0960  0.0089  306 GLU A CA  
842  C C   . GLU A 156 ? 0.4559 0.4779 0.5005 0.0553  0.0978  0.0072  306 GLU A C   
843  O O   . GLU A 156 ? 0.4564 0.4697 0.4812 0.0613  0.1065  0.0040  306 GLU A O   
844  C CB  . GLU A 156 ? 0.5133 0.5531 0.6102 0.0583  0.1118  0.0130  306 GLU A CB  
845  C CG  . GLU A 156 ? 0.5961 0.6448 0.7219 0.0613  0.1119  0.0130  306 GLU A CG  
846  C CD  . GLU A 156 ? 0.6710 0.7275 0.8210 0.0645  0.1284  0.0175  306 GLU A CD  
847  O OE1 . GLU A 156 ? 0.6741 0.7286 0.8179 0.0642  0.1407  0.0213  306 GLU A OE1 
848  O OE2 . GLU A 156 ? 0.7793 0.8439 0.9561 0.0674  0.1294  0.0179  306 GLU A OE2 
849  N N   . SER A 157 ? 0.4159 0.4380 0.4550 0.0493  0.0895  0.0092  307 SER A N   
850  C CA  . SER A 157 ? 0.4245 0.4366 0.4352 0.0495  0.0895  0.0084  307 SER A CA  
851  C C   . SER A 157 ? 0.3871 0.3991 0.3942 0.0434  0.0751  0.0076  307 SER A C   
852  O O   . SER A 157 ? 0.3462 0.3643 0.3685 0.0401  0.0662  0.0072  307 SER A O   
853  C CB  . SER A 157 ? 0.4555 0.4669 0.4638 0.0503  0.1030  0.0147  307 SER A CB  
854  O OG  . SER A 157 ? 0.4949 0.5154 0.5281 0.0440  0.1021  0.0200  307 SER A OG  
855  N N   . ALA A 158 ? 0.3767 0.3810 0.3621 0.0429  0.0729  0.0072  308 ALA A N   
856  C CA  . ALA A 158 ? 0.3755 0.3786 0.3560 0.0381  0.0608  0.0061  308 ALA A CA  
857  C C   . ALA A 158 ? 0.3703 0.3820 0.3716 0.0319  0.0545  0.0087  308 ALA A C   
858  O O   . ALA A 158 ? 0.3305 0.3476 0.3469 0.0294  0.0592  0.0127  308 ALA A O   
859  C CB  . ALA A 158 ? 0.4235 0.4192 0.3836 0.0384  0.0618  0.0076  308 ALA A CB  
860  N N   . VAL A 159 ? 0.3283 0.3406 0.3299 0.0296  0.0436  0.0060  309 VAL A N   
861  C CA  . VAL A 159 ? 0.3167 0.3351 0.3313 0.0245  0.0361  0.0073  309 VAL A CA  
862  C C   . VAL A 159 ? 0.3508 0.3647 0.3548 0.0210  0.0332  0.0077  309 VAL A C   
863  O O   . VAL A 159 ? 0.3554 0.3630 0.3435 0.0218  0.0299  0.0057  309 VAL A O   
864  C CB  . VAL A 159 ? 0.3214 0.3417 0.3392 0.0248  0.0273  0.0054  309 VAL A CB  
865  C CG1 . VAL A 159 ? 0.3122 0.3377 0.3387 0.0205  0.0187  0.0062  309 VAL A CG1 
866  C CG2 . VAL A 159 ? 0.3141 0.3380 0.3437 0.0289  0.0308  0.0054  309 VAL A CG2 
867  N N   . THR A 160 ? 0.3285 0.3458 0.3437 0.0172  0.0344  0.0101  310 THR A N   
868  C CA  . THR A 160 ? 0.3571 0.3695 0.3649 0.0143  0.0339  0.0110  310 THR A CA  
869  C C   . THR A 160 ? 0.3485 0.3620 0.3593 0.0100  0.0244  0.0085  310 THR A C   
870  O O   . THR A 160 ? 0.3423 0.3510 0.3466 0.0081  0.0235  0.0085  310 THR A O   
871  C CB  . THR A 160 ? 0.3408 0.3539 0.3589 0.0131  0.0431  0.0155  310 THR A CB  
872  O OG1 . THR A 160 ? 0.3223 0.3443 0.3651 0.0101  0.0424  0.0158  310 THR A OG1 
873  C CG2 . THR A 160 ? 0.3623 0.3718 0.3700 0.0188  0.0539  0.0183  310 THR A CG2 
874  N N   . GLY A 161 ? 0.3245 0.3438 0.3443 0.0090  0.0176  0.0065  311 GLY A N   
875  C CA  . GLY A 161 ? 0.3053 0.3252 0.3255 0.0057  0.0088  0.0038  311 GLY A CA  
876  C C   . GLY A 161 ? 0.2860 0.3108 0.3092 0.0070  0.0014  0.0026  311 GLY A C   
877  O O   . GLY A 161 ? 0.2774 0.3074 0.3109 0.0093  0.0027  0.0041  311 GLY A O   
878  N N   . LEU A 162 ? 0.3108 0.3331 0.3240 0.0063  -0.0055 0.0005  312 LEU A N   
879  C CA  . LEU A 162 ? 0.3269 0.3520 0.3383 0.0084  -0.0123 0.0007  312 LEU A CA  
880  C C   . LEU A 162 ? 0.3311 0.3548 0.3351 0.0066  -0.0200 -0.0022 312 LEU A C   
881  O O   . LEU A 162 ? 0.3238 0.3413 0.3157 0.0057  -0.0186 -0.0038 312 LEU A O   
882  C CB  . LEU A 162 ? 0.3409 0.3613 0.3407 0.0119  -0.0097 0.0025  312 LEU A CB  
883  C CG  . LEU A 162 ? 0.3704 0.3928 0.3702 0.0150  -0.0144 0.0048  312 LEU A CG  
884  C CD1 . LEU A 162 ? 0.3612 0.3906 0.3773 0.0169  -0.0147 0.0064  312 LEU A CD1 
885  C CD2 . LEU A 162 ? 0.3904 0.4066 0.3807 0.0174  -0.0112 0.0063  312 LEU A CD2 
886  N N   . SER A 163 ? 0.3226 0.3518 0.3331 0.0068  -0.0283 -0.0032 313 SER A N   
887  C CA  . SER A 163 ? 0.3229 0.3504 0.3239 0.0059  -0.0367 -0.0071 313 SER A CA  
888  C C   . SER A 163 ? 0.3533 0.3844 0.3505 0.0094  -0.0456 -0.0056 313 SER A C   
889  O O   . SER A 163 ? 0.3475 0.3860 0.3599 0.0106  -0.0489 -0.0036 313 SER A O   
890  C CB  . SER A 163 ? 0.3333 0.3632 0.3480 0.0013  -0.0398 -0.0120 313 SER A CB  
891  O OG  . SER A 163 ? 0.3521 0.3786 0.3564 0.0002  -0.0479 -0.0177 313 SER A OG  
892  N N   . LEU A 164 ? 0.3235 0.3488 0.2999 0.0117  -0.0485 -0.0058 314 LEU A N   
893  C CA  . LEU A 164 ? 0.3540 0.3808 0.3211 0.0161  -0.0568 -0.0033 314 LEU A CA  
894  C C   . LEU A 164 ? 0.3682 0.3983 0.3356 0.0151  -0.0694 -0.0093 314 LEU A C   
895  O O   . LEU A 164 ? 0.3968 0.4222 0.3557 0.0126  -0.0712 -0.0160 314 LEU A O   
896  C CB  . LEU A 164 ? 0.3522 0.3705 0.2957 0.0193  -0.0528 -0.0005 314 LEU A CB  
897  C CG  . LEU A 164 ? 0.3754 0.3929 0.3049 0.0249  -0.0588 0.0043  314 LEU A CG  
898  C CD1 . LEU A 164 ? 0.3515 0.3738 0.2946 0.0277  -0.0586 0.0112  314 LEU A CD1 
899  C CD2 . LEU A 164 ? 0.3944 0.4027 0.3017 0.0274  -0.0516 0.0073  314 LEU A CD2 
900  N N   . HIS A 165 ? 0.3844 0.4221 0.3618 0.0175  -0.0789 -0.0075 315 HIS A N   
901  C CA  . HIS A 165 ? 0.3955 0.4370 0.3736 0.0173  -0.0937 -0.0136 315 HIS A CA  
902  C C   . HIS A 165 ? 0.4154 0.4491 0.3619 0.0211  -0.0996 -0.0157 315 HIS A C   
903  O O   . HIS A 165 ? 0.4162 0.4440 0.3433 0.0257  -0.0939 -0.0092 315 HIS A O   
904  C CB  . HIS A 165 ? 0.3783 0.4305 0.3752 0.0201  -0.1031 -0.0099 315 HIS A CB  
905  C CG  . HIS A 165 ? 0.3914 0.4501 0.3974 0.0190  -0.1197 -0.0169 315 HIS A CG  
906  N ND1 . HIS A 165 ? 0.4116 0.4725 0.4060 0.0245  -0.1342 -0.0159 315 HIS A ND1 
907  C CD2 . HIS A 165 ? 0.3849 0.4485 0.4124 0.0131  -0.1249 -0.0249 315 HIS A CD2 
908  C CE1 . HIS A 165 ? 0.4435 0.5106 0.4511 0.0220  -0.1491 -0.0242 315 HIS A CE1 
909  N NE2 . HIS A 165 ? 0.3982 0.4672 0.4278 0.0147  -0.1434 -0.0298 315 HIS A NE2 
910  N N   . ALA A 166 ? 0.4327 0.4659 0.3749 0.0195  -0.1111 -0.0250 316 ALA A N   
911  C CA  . ALA A 166 ? 0.4753 0.5004 0.3847 0.0238  -0.1181 -0.0291 316 ALA A CA  
912  C C   . ALA A 166 ? 0.4954 0.5195 0.3839 0.0320  -0.1226 -0.0206 316 ALA A C   
913  O O   . ALA A 166 ? 0.5218 0.5366 0.3806 0.0365  -0.1181 -0.0182 316 ALA A O   
914  C CB  . ALA A 166 ? 0.4873 0.5141 0.4003 0.0211  -0.1337 -0.0414 316 ALA A CB  
915  N N   . THR A 167 ? 0.4952 0.5286 0.4008 0.0342  -0.1299 -0.0151 317 THR A N   
916  C CA  . THR A 167 ? 0.5009 0.5336 0.3904 0.0423  -0.1342 -0.0056 317 THR A CA  
917  C C   . THR A 167 ? 0.5089 0.5349 0.3891 0.0450  -0.1176 0.0052  317 THR A C   
918  O O   . THR A 167 ? 0.5369 0.5587 0.3979 0.0519  -0.1180 0.0138  317 THR A O   
919  C CB  . THR A 167 ? 0.4944 0.5393 0.4107 0.0438  -0.1441 -0.0013 317 THR A CB  
920  O OG1 . THR A 167 ? 0.4273 0.4771 0.3728 0.0398  -0.1317 0.0024  317 THR A OG1 
921  C CG2 . THR A 167 ? 0.5013 0.5544 0.4314 0.0416  -0.1624 -0.0112 317 THR A CG2 
922  N N   . GLY A 168 ? 0.4530 0.4784 0.3484 0.0398  -0.1039 0.0052  318 GLY A N   
923  C CA  . GLY A 168 ? 0.4544 0.4748 0.3476 0.0413  -0.0894 0.0141  318 GLY A CA  
924  C C   . GLY A 168 ? 0.4618 0.4880 0.3757 0.0434  -0.0884 0.0221  318 GLY A C   
925  O O   . GLY A 168 ? 0.4335 0.4553 0.3478 0.0449  -0.0777 0.0293  318 GLY A O   
926  N N   . ASP A 169 ? 0.4314 0.4676 0.3654 0.0433  -0.0991 0.0204  319 ASP A N   
927  C CA  . ASP A 169 ? 0.4269 0.4685 0.3795 0.0469  -0.0992 0.0282  319 ASP A CA  
928  C C   . ASP A 169 ? 0.3681 0.4170 0.3523 0.0425  -0.0929 0.0258  319 ASP A C   
929  O O   . ASP A 169 ? 0.3778 0.4298 0.3780 0.0454  -0.0901 0.0316  319 ASP A O   
930  C CB  . ASP A 169 ? 0.4270 0.4750 0.3801 0.0522  -0.1157 0.0305  319 ASP A CB  
931  C CG  . ASP A 169 ? 0.4748 0.5146 0.3928 0.0587  -0.1217 0.0350  319 ASP A CG  
932  O OD1 . ASP A 169 ? 0.4757 0.5054 0.3733 0.0606  -0.1108 0.0402  319 ASP A OD1 
933  O OD2 . ASP A 169 ? 0.4592 0.5032 0.3712 0.0621  -0.1374 0.0331  319 ASP A OD2 
934  N N   . TYR A 170 ? 0.3826 0.4331 0.3748 0.0360  -0.0899 0.0178  320 TYR A N   
935  C CA  . TYR A 170 ? 0.3405 0.3982 0.3613 0.0321  -0.0845 0.0152  320 TYR A CA  
936  C C   . TYR A 170 ? 0.3458 0.3983 0.3637 0.0266  -0.0731 0.0108  320 TYR A C   
937  O O   . TYR A 170 ? 0.3606 0.4067 0.3607 0.0244  -0.0730 0.0068  320 TYR A O   
938  C CB  . TYR A 170 ? 0.3579 0.4268 0.4003 0.0300  -0.0965 0.0103  320 TYR A CB  
939  C CG  . TYR A 170 ? 0.3679 0.4429 0.4126 0.0357  -0.1111 0.0140  320 TYR A CG  
940  C CD1 . TYR A 170 ? 0.3733 0.4537 0.4354 0.0404  -0.1106 0.0210  320 TYR A CD1 
941  C CD2 . TYR A 170 ? 0.3998 0.4739 0.4273 0.0371  -0.1256 0.0104  320 TYR A CD2 
942  C CE1 . TYR A 170 ? 0.4120 0.4980 0.4767 0.0463  -0.1247 0.0253  320 TYR A CE1 
943  C CE2 . TYR A 170 ? 0.4454 0.5245 0.4724 0.0431  -0.1402 0.0141  320 TYR A CE2 
944  C CZ  . TYR A 170 ? 0.4382 0.5236 0.4845 0.0477  -0.1399 0.0220  320 TYR A CZ  
945  O OH  . TYR A 170 ? 0.4722 0.5624 0.5178 0.0541  -0.1550 0.0263  320 TYR A OH  
946  N N   . LEU A 171 ? 0.3099 0.3642 0.3440 0.0253  -0.0631 0.0117  321 LEU A N   
947  C CA  . LEU A 171 ? 0.3072 0.3572 0.3402 0.0209  -0.0526 0.0084  321 LEU A CA  
948  C C   . LEU A 171 ? 0.3278 0.3850 0.3847 0.0174  -0.0499 0.0057  321 LEU A C   
949  O O   . LEU A 171 ? 0.3085 0.3728 0.3851 0.0192  -0.0485 0.0081  321 LEU A O   
950  C CB  . LEU A 171 ? 0.3378 0.3816 0.3654 0.0230  -0.0417 0.0119  321 LEU A CB  
951  C CG  . LEU A 171 ? 0.3525 0.3878 0.3593 0.0253  -0.0405 0.0147  321 LEU A CG  
952  C CD1 . LEU A 171 ? 0.3876 0.4188 0.3972 0.0276  -0.0321 0.0177  321 LEU A CD1 
953  C CD2 . LEU A 171 ? 0.3786 0.4078 0.3696 0.0219  -0.0384 0.0109  321 LEU A CD2 
954  N N   . LEU A 172 ? 0.3018 0.3568 0.3576 0.0125  -0.0478 0.0012  322 LEU A N   
955  C CA  . LEU A 172 ? 0.2907 0.3503 0.3674 0.0089  -0.0418 0.0000  322 LEU A CA  
956  C C   . LEU A 172 ? 0.2858 0.3388 0.3549 0.0090  -0.0281 0.0019  322 LEU A C   
957  O O   . LEU A 172 ? 0.2847 0.3292 0.3335 0.0088  -0.0256 0.0011  322 LEU A O   
958  C CB  . LEU A 172 ? 0.2965 0.3563 0.3781 0.0036  -0.0475 -0.0055 322 LEU A CB  
959  C CG  . LEU A 172 ? 0.3155 0.3765 0.4151 -0.0010 -0.0395 -0.0064 322 LEU A CG  
960  C CD1 . LEU A 172 ? 0.3385 0.4111 0.4699 -0.0013 -0.0394 -0.0045 322 LEU A CD1 
961  C CD2 . LEU A 172 ? 0.3102 0.3674 0.4082 -0.0060 -0.0452 -0.0127 322 LEU A CD2 
962  N N   . SER A 173 ? 0.2936 0.3506 0.3789 0.0098  -0.0194 0.0042  323 SER A N   
963  C CA  . SER A 173 ? 0.2721 0.3229 0.3493 0.0104  -0.0069 0.0056  323 SER A CA  
964  C C   . SER A 173 ? 0.2744 0.3286 0.3690 0.0081  0.0015  0.0068  323 SER A C   
965  O O   . SER A 173 ? 0.2895 0.3529 0.4089 0.0068  -0.0003 0.0072  323 SER A O   
966  C CB  . SER A 173 ? 0.2916 0.3408 0.3646 0.0158  -0.0020 0.0078  323 SER A CB  
967  O OG  . SER A 173 ? 0.2746 0.3324 0.3692 0.0182  -0.0016 0.0097  323 SER A OG  
968  N N   . SER A 174 ? 0.2918 0.3388 0.3750 0.0075  0.0104  0.0076  324 SER A N   
969  C CA  . SER A 174 ? 0.3077 0.3558 0.4035 0.0065  0.0218  0.0107  324 SER A CA  
970  C C   . SER A 174 ? 0.2998 0.3418 0.3801 0.0115  0.0327  0.0129  324 SER A C   
971  O O   . SER A 174 ? 0.2880 0.3240 0.3483 0.0140  0.0299  0.0111  324 SER A O   
972  C CB  . SER A 174 ? 0.3128 0.3561 0.4069 0.0019  0.0227  0.0104  324 SER A CB  
973  O OG  . SER A 174 ? 0.2959 0.3296 0.3646 0.0026  0.0217  0.0093  324 SER A OG  
974  N N   . SER A 175 ? 0.2995 0.3429 0.3895 0.0130  0.0450  0.0166  325 SER A N   
975  C CA  . SER A 175 ? 0.3146 0.3518 0.3885 0.0187  0.0560  0.0182  325 SER A CA  
976  C C   . SER A 175 ? 0.3234 0.3587 0.4007 0.0194  0.0701  0.0234  325 SER A C   
977  O O   . SER A 175 ? 0.2718 0.3135 0.3740 0.0158  0.0742  0.0267  325 SER A O   
978  C CB  . SER A 175 ? 0.3306 0.3723 0.4126 0.0233  0.0577  0.0171  325 SER A CB  
979  O OG  . SER A 175 ? 0.3303 0.3663 0.3989 0.0294  0.0695  0.0175  325 SER A OG  
980  N N   . ASP A 176 ? 0.3665 0.3928 0.4194 0.0244  0.0778  0.0242  326 ASP A N   
981  C CA  . ASP A 176 ? 0.3919 0.4149 0.4420 0.0278  0.0937  0.0299  326 ASP A CA  
982  C C   . ASP A 176 ? 0.3907 0.4212 0.4627 0.0307  0.1053  0.0325  326 ASP A C   
983  O O   . ASP A 176 ? 0.3485 0.3787 0.4268 0.0323  0.1203  0.0388  326 ASP A O   
984  C CB  . ASP A 176 ? 0.4559 0.4674 0.4712 0.0340  0.0971  0.0287  326 ASP A CB  
985  C CG  . ASP A 176 ? 0.5040 0.5082 0.5011 0.0319  0.0897  0.0287  326 ASP A CG  
986  O OD1 . ASP A 176 ? 0.4987 0.5043 0.5078 0.0265  0.0881  0.0320  326 ASP A OD1 
987  O OD2 . ASP A 176 ? 0.5200 0.5172 0.4930 0.0353  0.0847  0.0248  326 ASP A OD2 
988  N N   . ASP A 177 ? 0.3368 0.3740 0.4212 0.0317  0.0995  0.0284  327 ASP A N   
989  C CA  . ASP A 177 ? 0.3582 0.4043 0.4688 0.0343  0.1091  0.0307  327 ASP A CA  
990  C C   . ASP A 177 ? 0.3429 0.4008 0.4915 0.0282  0.1088  0.0345  327 ASP A C   
991  O O   . ASP A 177 ? 0.3541 0.4211 0.5300 0.0297  0.1156  0.0366  327 ASP A O   
992  C CB  . ASP A 177 ? 0.3577 0.4066 0.4705 0.0380  0.1024  0.0254  327 ASP A CB  
993  C CG  . ASP A 177 ? 0.3561 0.4135 0.4870 0.0331  0.0856  0.0231  327 ASP A CG  
994  O OD1 . ASP A 177 ? 0.3424 0.4033 0.4827 0.0266  0.0772  0.0239  327 ASP A OD1 
995  O OD2 . ASP A 177 ? 0.3408 0.4001 0.4745 0.0363  0.0803  0.0203  327 ASP A OD2 
996  N N   . GLN A 178 ? 0.3577 0.4150 0.5090 0.0215  0.1002  0.0347  328 GLN A N   
997  C CA  . GLN A 178 ? 0.3658 0.4319 0.5514 0.0148  0.0994  0.0374  328 GLN A CA  
998  C C   . GLN A 178 ? 0.3354 0.4126 0.5456 0.0109  0.0831  0.0327  328 GLN A C   
999  O O   . GLN A 178 ? 0.3374 0.4228 0.5784 0.0055  0.0801  0.0335  328 GLN A O   
1000 C CB  . GLN A 178 ? 0.4040 0.4749 0.6142 0.0163  0.1184  0.0447  328 GLN A CB  
1001 C CG  . GLN A 178 ? 0.4482 0.5077 0.6323 0.0217  0.1363  0.0505  328 GLN A CG  
1002 C CD  . GLN A 178 ? 0.4701 0.5335 0.6788 0.0228  0.1566  0.0592  328 GLN A CD  
1003 O OE1 . GLN A 178 ? 0.4250 0.5010 0.6732 0.0204  0.1589  0.0605  328 GLN A OE1 
1004 N NE2 . GLN A 178 ? 0.5282 0.5809 0.7143 0.0267  0.1718  0.0657  328 GLN A NE2 
1005 N N   . TYR A 179 ? 0.3153 0.3923 0.5115 0.0138  0.0722  0.0281  329 TYR A N   
1006 C CA  . TYR A 179 ? 0.3086 0.3950 0.5226 0.0117  0.0562  0.0244  329 TYR A CA  
1007 C C   . TYR A 179 ? 0.2820 0.3626 0.4735 0.0089  0.0406  0.0196  329 TYR A C   
1008 O O   . TYR A 179 ? 0.2906 0.3605 0.4518 0.0102  0.0418  0.0186  329 TYR A O   
1009 C CB  . TYR A 179 ? 0.3263 0.4171 0.5441 0.0181  0.0564  0.0241  329 TYR A CB  
1010 C CG  . TYR A 179 ? 0.3338 0.4335 0.5815 0.0210  0.0691  0.0281  329 TYR A CG  
1011 C CD1 . TYR A 179 ? 0.3593 0.4535 0.5994 0.0252  0.0890  0.0318  329 TYR A CD1 
1012 C CD2 . TYR A 179 ? 0.3487 0.4626 0.6331 0.0201  0.0619  0.0284  329 TYR A CD2 
1013 C CE1 . TYR A 179 ? 0.3738 0.4760 0.6421 0.0283  0.1031  0.0359  329 TYR A CE1 
1014 C CE2 . TYR A 179 ? 0.3793 0.5023 0.6950 0.0229  0.0748  0.0324  329 TYR A CE2 
1015 C CZ  . TYR A 179 ? 0.3879 0.5049 0.6955 0.0271  0.0964  0.0362  329 TYR A CZ  
1016 O OH  . TYR A 179 ? 0.4495 0.5752 0.7883 0.0304  0.1115  0.0406  329 TYR A OH  
1017 N N   . TRP A 180 ? 0.2917 0.3798 0.4991 0.0053  0.0258  0.0164  330 TRP A N   
1018 C CA  . TRP A 180 ? 0.2682 0.3525 0.4551 0.0049  0.0107  0.0121  330 TRP A CA  
1019 C C   . TRP A 180 ? 0.2772 0.3687 0.4719 0.0091  0.0017  0.0120  330 TRP A C   
1020 O O   . TRP A 180 ? 0.2776 0.3793 0.5002 0.0108  0.0038  0.0142  330 TRP A O   
1021 C CB  . TRP A 180 ? 0.2940 0.3784 0.4854 -0.0015 -0.0003 0.0078  330 TRP A CB  
1022 C CG  . TRP A 180 ? 0.2608 0.3567 0.4868 -0.0051 -0.0072 0.0063  330 TRP A CG  
1023 C CD1 . TRP A 180 ? 0.2620 0.3622 0.5161 -0.0096 -0.0002 0.0078  330 TRP A CD1 
1024 C CD2 . TRP A 180 ? 0.2806 0.3859 0.5202 -0.0045 -0.0237 0.0033  330 TRP A CD2 
1025 N NE1 . TRP A 180 ? 0.2591 0.3714 0.5459 -0.0124 -0.0117 0.0050  330 TRP A NE1 
1026 C CE2 . TRP A 180 ? 0.2600 0.3756 0.5370 -0.0091 -0.0271 0.0019  330 TRP A CE2 
1027 C CE3 . TRP A 180 ? 0.2906 0.3962 0.5143 -0.0003 -0.0361 0.0020  330 TRP A CE3 
1028 C CZ2 . TRP A 180 ? 0.2729 0.3997 0.5719 -0.0096 -0.0439 -0.0014 330 TRP A CZ2 
1029 C CZ3 . TRP A 180 ? 0.2870 0.4031 0.5301 -0.0002 -0.0521 -0.0003 330 TRP A CZ3 
1030 C CH2 . TRP A 180 ? 0.2831 0.4097 0.5629 -0.0047 -0.0565 -0.0025 330 TRP A CH2 
1031 N N   . ALA A 181 ? 0.2768 0.3629 0.4478 0.0111  -0.0075 0.0103  331 ALA A N   
1032 C CA  . ALA A 181 ? 0.2928 0.3838 0.4681 0.0156  -0.0159 0.0114  331 ALA A CA  
1033 C C   . ALA A 181 ? 0.2856 0.3731 0.4416 0.0151  -0.0306 0.0090  331 ALA A C   
1034 O O   . ALA A 181 ? 0.2852 0.3640 0.4188 0.0126  -0.0311 0.0066  331 ALA A O   
1035 C CB  . ALA A 181 ? 0.2705 0.3562 0.4352 0.0214  -0.0061 0.0139  331 ALA A CB  
1036 N N   . PHE A 182 ? 0.3081 0.4023 0.4730 0.0181  -0.0421 0.0101  332 PHE A N   
1037 C CA  . PHE A 182 ? 0.3272 0.4189 0.4739 0.0192  -0.0565 0.0090  332 PHE A CA  
1038 C C   . PHE A 182 ? 0.3145 0.4056 0.4571 0.0260  -0.0575 0.0143  332 PHE A C   
1039 O O   . PHE A 182 ? 0.3405 0.4404 0.5067 0.0292  -0.0589 0.0171  332 PHE A O   
1040 C CB  . PHE A 182 ? 0.3413 0.4432 0.5078 0.0169  -0.0712 0.0057  332 PHE A CB  
1041 C CG  . PHE A 182 ? 0.3628 0.4620 0.5088 0.0181  -0.0872 0.0033  332 PHE A CG  
1042 C CD1 . PHE A 182 ? 0.3942 0.4838 0.5142 0.0151  -0.0886 -0.0012 332 PHE A CD1 
1043 C CD2 . PHE A 182 ? 0.4054 0.5122 0.5594 0.0227  -0.1014 0.0054  332 PHE A CD2 
1044 C CE1 . PHE A 182 ? 0.4029 0.4893 0.5019 0.0171  -0.1024 -0.0038 332 PHE A CE1 
1045 C CE2 . PHE A 182 ? 0.4377 0.5413 0.5696 0.0247  -0.1164 0.0032  332 PHE A CE2 
1046 C CZ  . PHE A 182 ? 0.4289 0.5221 0.5324 0.0219  -0.1164 -0.0015 332 PHE A CZ  
1047 N N   . SER A 183 ? 0.3336 0.4143 0.4490 0.0282  -0.0559 0.0160  333 SER A N   
1048 C CA  . SER A 183 ? 0.3054 0.3826 0.4165 0.0342  -0.0535 0.0214  333 SER A CA  
1049 C C   . SER A 183 ? 0.3337 0.4060 0.4234 0.0373  -0.0637 0.0246  333 SER A C   
1050 O O   . SER A 183 ? 0.3405 0.4073 0.4091 0.0347  -0.0668 0.0220  333 SER A O   
1051 C CB  . SER A 183 ? 0.3031 0.3709 0.4033 0.0342  -0.0395 0.0211  333 SER A CB  
1052 O OG  . SER A 183 ? 0.3266 0.3981 0.4435 0.0330  -0.0290 0.0191  333 SER A OG  
1053 N N   . ASP A 184 ? 0.3374 0.4112 0.4323 0.0433  -0.0676 0.0307  334 ASP A N   
1054 C CA  . ASP A 184 ? 0.3769 0.4456 0.4519 0.0475  -0.0758 0.0358  334 ASP A CA  
1055 C C   . ASP A 184 ? 0.3795 0.4358 0.4355 0.0483  -0.0656 0.0387  334 ASP A C   
1056 O O   . ASP A 184 ? 0.3625 0.4155 0.4272 0.0502  -0.0568 0.0408  334 ASP A O   
1057 C CB  . ASP A 184 ? 0.4180 0.4931 0.5087 0.0541  -0.0840 0.0424  334 ASP A CB  
1058 C CG  . ASP A 184 ? 0.4959 0.5652 0.5649 0.0596  -0.0922 0.0495  334 ASP A CG  
1059 O OD1 . ASP A 184 ? 0.5521 0.6214 0.6038 0.0592  -0.1025 0.0477  334 ASP A OD1 
1060 O OD2 . ASP A 184 ? 0.5528 0.6168 0.6217 0.0647  -0.0878 0.0570  334 ASP A OD2 
1061 N N   . ILE A 185 ? 0.3814 0.4306 0.4126 0.0470  -0.0668 0.0385  335 ILE A N   
1062 C CA  . ILE A 185 ? 0.4046 0.4427 0.4203 0.0472  -0.0573 0.0413  335 ILE A CA  
1063 C C   . ILE A 185 ? 0.4012 0.4346 0.4187 0.0534  -0.0557 0.0504  335 ILE A C   
1064 O O   . ILE A 185 ? 0.4289 0.4552 0.4481 0.0534  -0.0462 0.0518  335 ILE A O   
1065 C CB  . ILE A 185 ? 0.4302 0.4624 0.4203 0.0455  -0.0589 0.0399  335 ILE A CB  
1066 C CG1 . ILE A 185 ? 0.4520 0.4854 0.4421 0.0390  -0.0559 0.0310  335 ILE A CG1 
1067 C CG2 . ILE A 185 ? 0.4532 0.4748 0.4289 0.0473  -0.0506 0.0455  335 ILE A CG2 
1068 C CD1 . ILE A 185 ? 0.4906 0.5203 0.4594 0.0374  -0.0597 0.0277  335 ILE A CD1 
1069 N N   . GLN A 186 ? 0.4196 0.4564 0.4370 0.0587  -0.0655 0.0566  336 GLN A N   
1070 C CA  . GLN A 186 ? 0.4852 0.5157 0.5006 0.0649  -0.0641 0.0668  336 GLN A CA  
1071 C C   . GLN A 186 ? 0.4622 0.4945 0.5039 0.0675  -0.0594 0.0685  336 GLN A C   
1072 O O   . GLN A 186 ? 0.4500 0.4739 0.4938 0.0698  -0.0520 0.0735  336 GLN A O   
1073 C CB  . GLN A 186 ? 0.5305 0.5629 0.5329 0.0708  -0.0767 0.0738  336 GLN A CB  
1074 C CG  . GLN A 186 ? 0.6638 0.6858 0.6508 0.0767  -0.0734 0.0857  336 GLN A CG  
1075 C CD  . GLN A 186 ? 0.6780 0.6889 0.6476 0.0734  -0.0612 0.0859  336 GLN A CD  
1076 O OE1 . GLN A 186 ? 0.6982 0.7086 0.6530 0.0687  -0.0600 0.0789  336 GLN A OE1 
1077 N NE2 . GLN A 186 ? 0.6039 0.6061 0.5779 0.0757  -0.0520 0.0938  336 GLN A NE2 
1078 N N   . THR A 187 ? 0.3815 0.4242 0.4442 0.0667  -0.0624 0.0637  337 THR A N   
1079 C CA  . THR A 187 ? 0.3865 0.4312 0.4744 0.0699  -0.0572 0.0646  337 THR A CA  
1080 C C   . THR A 187 ? 0.3659 0.4107 0.4635 0.0652  -0.0462 0.0556  337 THR A C   
1081 O O   . THR A 187 ? 0.3522 0.3964 0.4675 0.0678  -0.0392 0.0547  337 THR A O   
1082 C CB  . THR A 187 ? 0.3872 0.4445 0.4961 0.0738  -0.0676 0.0666  337 THR A CB  
1083 O OG1 . THR A 187 ? 0.3960 0.4630 0.5111 0.0685  -0.0711 0.0588  337 THR A OG1 
1084 C CG2 . THR A 187 ? 0.4238 0.4817 0.5221 0.0797  -0.0808 0.0759  337 THR A CG2 
1085 N N   . GLY A 188 ? 0.3425 0.3872 0.4277 0.0590  -0.0442 0.0489  338 GLY A N   
1086 C CA  . GLY A 188 ? 0.3332 0.3788 0.4253 0.0551  -0.0352 0.0413  338 GLY A CA  
1087 C C   . GLY A 188 ? 0.3346 0.3915 0.4502 0.0555  -0.0352 0.0388  338 GLY A C   
1088 O O   . GLY A 188 ? 0.3951 0.4521 0.5177 0.0539  -0.0254 0.0338  338 GLY A O   
1089 N N   . ARG A 189 ? 0.3400 0.4066 0.4684 0.0580  -0.0459 0.0424  339 ARG A N   
1090 C CA  . ARG A 189 ? 0.3321 0.4109 0.4885 0.0585  -0.0462 0.0408  339 ARG A CA  
1091 C C   . ARG A 189 ? 0.3154 0.3999 0.4737 0.0519  -0.0458 0.0348  339 ARG A C   
1092 O O   . ARG A 189 ? 0.2953 0.3796 0.4390 0.0481  -0.0541 0.0331  339 ARG A O   
1093 C CB  . ARG A 189 ? 0.3330 0.4211 0.5050 0.0633  -0.0598 0.0465  339 ARG A CB  
1094 C CG  . ARG A 189 ? 0.3942 0.4964 0.6006 0.0640  -0.0603 0.0452  339 ARG A CG  
1095 N N   . VAL A 190 ? 0.3388 0.4281 0.5159 0.0509  -0.0357 0.0318  340 VAL A N   
1096 C CA  . VAL A 190 ? 0.3259 0.4217 0.5120 0.0451  -0.0343 0.0277  340 VAL A CA  
1097 C C   . VAL A 190 ? 0.3151 0.4251 0.5274 0.0452  -0.0468 0.0289  340 VAL A C   
1098 O O   . VAL A 190 ? 0.2740 0.3928 0.5140 0.0491  -0.0457 0.0314  340 VAL A O   
1099 C CB  . VAL A 190 ? 0.3403 0.4353 0.5357 0.0448  -0.0175 0.0254  340 VAL A CB  
1100 C CG1 . VAL A 190 ? 0.3370 0.4384 0.5438 0.0389  -0.0150 0.0227  340 VAL A CG1 
1101 C CG2 . VAL A 190 ? 0.3603 0.4412 0.5283 0.0450  -0.0084 0.0233  340 VAL A CG2 
1102 N N   . LEU A 191 ? 0.3447 0.4569 0.5492 0.0412  -0.0594 0.0265  341 LEU A N   
1103 C CA  . LEU A 191 ? 0.3271 0.4522 0.5547 0.0414  -0.0749 0.0266  341 LEU A CA  
1104 C C   . LEU A 191 ? 0.3096 0.4458 0.5694 0.0365  -0.0713 0.0232  341 LEU A C   
1105 O O   . LEU A 191 ? 0.3188 0.4679 0.6112 0.0382  -0.0776 0.0245  341 LEU A O   
1106 C CB  . LEU A 191 ? 0.3825 0.5049 0.5879 0.0396  -0.0908 0.0242  341 LEU A CB  
1107 C CG  . LEU A 191 ? 0.4171 0.5296 0.5919 0.0448  -0.0955 0.0289  341 LEU A CG  
1108 C CD1 . LEU A 191 ? 0.4561 0.5663 0.6088 0.0432  -0.1102 0.0256  341 LEU A CD1 
1109 C CD2 . LEU A 191 ? 0.4347 0.5515 0.6226 0.0527  -0.1002 0.0363  341 LEU A CD2 
1110 N N   . THR A 192 ? 0.3238 0.4547 0.5758 0.0307  -0.0612 0.0194  342 THR A N   
1111 C CA  . THR A 192 ? 0.3379 0.4768 0.6194 0.0264  -0.0529 0.0179  342 THR A CA  
1112 C C   . THR A 192 ? 0.3022 0.4315 0.5688 0.0234  -0.0354 0.0170  342 THR A C   
1113 O O   . THR A 192 ? 0.3054 0.4223 0.5383 0.0223  -0.0336 0.0155  342 THR A O   
1114 C CB  . THR A 192 ? 0.4250 0.5729 0.7253 0.0209  -0.0680 0.0134  342 THR A CB  
1115 O OG1 . THR A 192 ? 0.5032 0.6601 0.8395 0.0168  -0.0587 0.0132  342 THR A OG1 
1116 C CG2 . THR A 192 ? 0.4153 0.5533 0.6857 0.0161  -0.0744 0.0082  342 THR A CG2 
1117 N N   . LYS A 193 ? 0.3140 0.4490 0.6061 0.0222  -0.0221 0.0185  343 LYS A N   
1118 C CA  . LYS A 193 ? 0.3297 0.4562 0.6096 0.0208  -0.0043 0.0190  343 LYS A CA  
1119 C C   . LYS A 193 ? 0.3030 0.4379 0.6154 0.0164  0.0039  0.0200  343 LYS A C   
1120 O O   . LYS A 193 ? 0.3183 0.4643 0.6639 0.0185  0.0083  0.0227  343 LYS A O   
1121 C CB  . LYS A 193 ? 0.3956 0.5173 0.6673 0.0277  0.0088  0.0217  343 LYS A CB  
1122 C CG  . LYS A 193 ? 0.4346 0.5444 0.6817 0.0279  0.0244  0.0214  343 LYS A CG  
1123 C CD  . LYS A 193 ? 0.4210 0.5267 0.6639 0.0351  0.0375  0.0227  343 LYS A CD  
1124 C CE  . LYS A 193 ? 0.4332 0.5296 0.6583 0.0353  0.0542  0.0227  343 LYS A CE  
1125 N NZ  . LYS A 193 ? 0.4374 0.5267 0.6503 0.0425  0.0660  0.0219  343 LYS A NZ  
1126 N N   . VAL A 194 ? 0.3147 0.4443 0.6197 0.0103  0.0063  0.0183  344 VAL A N   
1127 C CA  . VAL A 194 ? 0.3151 0.4522 0.6532 0.0050  0.0117  0.0193  344 VAL A CA  
1128 C C   . VAL A 194 ? 0.3146 0.4416 0.6392 0.0025  0.0286  0.0218  344 VAL A C   
1129 O O   . VAL A 194 ? 0.3044 0.4190 0.5938 0.0023  0.0288  0.0202  344 VAL A O   
1130 C CB  . VAL A 194 ? 0.3092 0.4520 0.6615 -0.0013 -0.0079 0.0137  344 VAL A CB  
1131 C CG1 . VAL A 194 ? 0.3116 0.4605 0.6995 -0.0081 -0.0025 0.0141  344 VAL A CG1 
1132 C CG2 . VAL A 194 ? 0.3282 0.4821 0.6955 0.0019  -0.0257 0.0121  344 VAL A CG2 
1133 N N   . THR A 195 ? 0.3172 0.4501 0.6719 0.0009  0.0429  0.0263  345 THR A N   
1134 C CA  . THR A 195 ? 0.3676 0.4917 0.7147 -0.0017 0.0586  0.0301  345 THR A CA  
1135 C C   . THR A 195 ? 0.3936 0.5260 0.7830 -0.0087 0.0608  0.0318  345 THR A C   
1136 O O   . THR A 195 ? 0.3628 0.5093 0.7912 -0.0106 0.0532  0.0306  345 THR A O   
1137 C CB  . THR A 195 ? 0.3661 0.4844 0.6991 0.0052  0.0809  0.0362  345 THR A CB  
1138 O OG1 . THR A 195 ? 0.3664 0.4739 0.6829 0.0037  0.0939  0.0402  345 THR A OG1 
1139 C CG2 . THR A 195 ? 0.3696 0.4999 0.7405 0.0080  0.0931  0.0408  345 THR A CG2 
1140 N N   . ASP A 196 ? 0.4005 0.5242 0.7838 -0.0127 0.0701  0.0345  346 ASP A N   
1141 C CA  . ASP A 196 ? 0.4712 0.6009 0.8960 -0.0192 0.0765  0.0377  346 ASP A CA  
1142 C C   . ASP A 196 ? 0.5210 0.6514 0.9582 -0.0150 0.1029  0.0481  346 ASP A C   
1143 O O   . ASP A 196 ? 0.6119 0.7301 1.0181 -0.0112 0.1179  0.0533  346 ASP A O   
1144 C CB  . ASP A 196 ? 0.4546 0.5734 0.8687 -0.0256 0.0732  0.0359  346 ASP A CB  
1145 C CG  . ASP A 196 ? 0.4699 0.5949 0.9313 -0.0337 0.0758  0.0374  346 ASP A CG  
1146 O OD1 . ASP A 196 ? 0.4899 0.6260 0.9902 -0.0338 0.0864  0.0427  346 ASP A OD1 
1147 O OD2 . ASP A 196 ? 0.4980 0.6162 0.9592 -0.0399 0.0680  0.0333  346 ASP A OD2 
1148 N N   . GLU A 197 ? 0.6088 0.7537 1.0901 -0.0149 0.1084  0.0510  347 GLU A N   
1149 C CA  . GLU A 197 ? 0.7757 0.9218 1.2745 -0.0114 0.1357  0.0614  347 GLU A CA  
1150 C C   . GLU A 197 ? 0.8459 0.9825 1.3460 -0.0162 0.1495  0.0682  347 GLU A C   
1151 O O   . GLU A 197 ? 0.9729 1.0977 1.4440 -0.0110 0.1688  0.0757  347 GLU A O   
1152 C CB  . GLU A 197 ? 0.7360 0.9008 1.2916 -0.0123 0.1385  0.0634  347 GLU A CB  
1153 N N   . THR A 198 ? 0.8363 0.9768 1.3680 -0.0257 0.1383  0.0651  348 THR A N   
1154 C CA  . THR A 198 ? 0.8151 0.9468 1.3556 -0.0311 0.1502  0.0715  348 THR A CA  
1155 C C   . THR A 198 ? 0.8127 0.9251 1.2981 -0.0277 0.1555  0.0740  348 THR A C   
1156 O O   . THR A 198 ? 0.8355 0.9391 1.3107 -0.0245 0.1774  0.0848  348 THR A O   
1157 C CB  . THR A 198 ? 0.7447 0.8816 1.3220 -0.0421 0.1317  0.0640  348 THR A CB  
1158 N N   . SER A 199 ? 0.8419 0.9479 1.2925 -0.0279 0.1358  0.0647  349 SER A N   
1159 C CA  . SER A 199 ? 0.8455 0.9343 1.2457 -0.0246 0.1382  0.0661  349 SER A CA  
1160 C C   . SER A 199 ? 0.7955 0.8783 1.1587 -0.0143 0.1528  0.0716  349 SER A C   
1161 O O   . SER A 199 ? 0.7305 0.8007 1.0664 -0.0105 0.1669  0.0791  349 SER A O   
1162 C CB  . SER A 199 ? 0.7858 0.8706 1.1602 -0.0267 0.1140  0.0545  349 SER A CB  
1163 N N   . GLY A 200 ? 0.6840 0.7751 1.0461 -0.0097 0.1484  0.0674  350 GLY A N   
1164 C CA  . GLY A 200 ? 0.6143 0.6999 0.9422 0.0000  0.1590  0.0695  350 GLY A CA  
1165 C C   . GLY A 200 ? 0.5977 0.6666 0.8763 0.0041  0.1630  0.0716  350 GLY A C   
1166 O O   . GLY A 200 ? 0.6043 0.6657 0.8690 0.0092  0.1823  0.0802  350 GLY A O   
1167 N N   . CYS A 201 ? 0.5484 0.6114 0.8008 0.0023  0.1449  0.0640  351 CYS A N   
1168 C CA  . CYS A 201 ? 0.5243 0.5729 0.7288 0.0077  0.1463  0.0645  351 CYS A CA  
1169 C C   . CYS A 201 ? 0.4541 0.5001 0.6332 0.0076  0.1266  0.0548  351 CYS A C   
1170 O O   . CYS A 201 ? 0.4278 0.4821 0.6228 0.0037  0.1114  0.0480  351 CYS A O   
1171 C CB  . CYS A 201 ? 0.5990 0.6368 0.7953 0.0060  0.1552  0.0723  351 CYS A CB  
1172 S SG  . CYS A 201 ? 0.5374 0.5707 0.7353 -0.0022 0.1376  0.0671  351 CYS A SG  
1173 N N   . SER A 202 ? 0.4452 0.4797 0.5848 0.0128  0.1273  0.0547  352 SER A N   
1174 C CA  . SER A 202 ? 0.4201 0.4514 0.5346 0.0139  0.1119  0.0467  352 SER A CA  
1175 C C   . SER A 202 ? 0.3545 0.3870 0.4770 0.0069  0.0963  0.0418  352 SER A C   
1176 O O   . SER A 202 ? 0.3417 0.3706 0.4712 0.0027  0.0978  0.0447  352 SER A O   
1177 C CB  . SER A 202 ? 0.4679 0.4865 0.5432 0.0195  0.1150  0.0480  352 SER A CB  
1178 O OG  . SER A 202 ? 0.6171 0.6336 0.6782 0.0272  0.1257  0.0492  352 SER A OG  
1179 N N   . LEU A 203 ? 0.3338 0.3709 0.4551 0.0060  0.0820  0.0345  353 LEU A N   
1180 C CA  . LEU A 203 ? 0.2948 0.3316 0.4165 0.0007  0.0671  0.0290  353 LEU A CA  
1181 C C   . LEU A 203 ? 0.3216 0.3487 0.4096 0.0035  0.0622  0.0266  353 LEU A C   
1182 O O   . LEU A 203 ? 0.3507 0.3760 0.4211 0.0086  0.0623  0.0252  353 LEU A O   
1183 C CB  . LEU A 203 ? 0.2994 0.3463 0.4379 -0.0012 0.0545  0.0234  353 LEU A CB  
1184 C CG  . LEU A 203 ? 0.3008 0.3592 0.4763 -0.0036 0.0573  0.0251  353 LEU A CG  
1185 C CD1 . LEU A 203 ? 0.3310 0.3983 0.5180 -0.0048 0.0416  0.0193  353 LEU A CD1 
1186 C CD2 . LEU A 203 ? 0.3203 0.3791 0.5198 -0.0097 0.0616  0.0277  353 LEU A CD2 
1187 N N   . THR A 204 ? 0.3046 0.3256 0.3861 0.0002  0.0575  0.0256  354 THR A N   
1188 C CA  . THR A 204 ? 0.3382 0.3499 0.3915 0.0028  0.0549  0.0248  354 THR A CA  
1189 C C   . THR A 204 ? 0.3355 0.3468 0.3815 0.0007  0.0415  0.0181  354 THR A C   
1190 O O   . THR A 204 ? 0.3035 0.3088 0.3291 0.0030  0.0385  0.0169  354 THR A O   
1191 C CB  . THR A 204 ? 0.3527 0.3562 0.4026 0.0019  0.0615  0.0300  354 THR A CB  
1192 O OG1 . THR A 204 ? 0.3466 0.3514 0.4172 -0.0045 0.0571  0.0280  354 THR A OG1 
1193 C CG2 . THR A 204 ? 0.3692 0.3712 0.4215 0.0051  0.0767  0.0383  354 THR A CG2 
1194 N N   . CYS A 205 ? 0.3033 0.3208 0.3661 -0.0034 0.0332  0.0138  355 CYS A N   
1195 C CA  . CYS A 205 ? 0.3053 0.3223 0.3594 -0.0047 0.0213  0.0077  355 CYS A CA  
1196 C C   . CYS A 205 ? 0.2965 0.3219 0.3692 -0.0078 0.0124  0.0036  355 CYS A C   
1197 O O   . CYS A 205 ? 0.2878 0.3190 0.3831 -0.0101 0.0152  0.0051  355 CYS A O   
1198 C CB  . CYS A 205 ? 0.3190 0.3278 0.3646 -0.0068 0.0196  0.0061  355 CYS A CB  
1199 S SG  . CYS A 205 ? 0.3492 0.3559 0.4163 -0.0120 0.0242  0.0078  355 CYS A SG  
1200 N N   . ALA A 206 ? 0.3130 0.3389 0.3759 -0.0074 0.0020  -0.0010 356 ALA A N   
1201 C CA  . ALA A 206 ? 0.3274 0.3606 0.4029 -0.0091 -0.0085 -0.0051 356 ALA A CA  
1202 C C   . ALA A 206 ? 0.3391 0.3683 0.3975 -0.0091 -0.0186 -0.0105 356 ALA A C   
1203 O O   . ALA A 206 ? 0.3267 0.3512 0.3650 -0.0059 -0.0179 -0.0096 356 ALA A O   
1204 C CB  . ALA A 206 ? 0.3545 0.3952 0.4360 -0.0056 -0.0091 -0.0026 356 ALA A CB  
1205 N N   . GLN A 207 ? 0.3083 0.3392 0.3753 -0.0123 -0.0278 -0.0163 357 GLN A N   
1206 C CA  . GLN A 207 ? 0.3349 0.3617 0.3837 -0.0115 -0.0374 -0.0220 357 GLN A CA  
1207 C C   . GLN A 207 ? 0.3233 0.3562 0.3839 -0.0133 -0.0506 -0.0278 357 GLN A C   
1208 O O   . GLN A 207 ? 0.3037 0.3406 0.3882 -0.0177 -0.0527 -0.0305 357 GLN A O   
1209 C CB  . GLN A 207 ? 0.3669 0.3838 0.4064 -0.0137 -0.0349 -0.0259 357 GLN A CB  
1210 C CG  . GLN A 207 ? 0.4631 0.4733 0.4889 -0.0116 -0.0245 -0.0211 357 GLN A CG  
1211 C CD  . GLN A 207 ? 0.5503 0.5587 0.5549 -0.0070 -0.0251 -0.0195 357 GLN A CD  
1212 O OE1 . GLN A 207 ? 0.6328 0.6393 0.6249 -0.0057 -0.0317 -0.0234 357 GLN A OE1 
1213 N NE2 . GLN A 207 ? 0.5706 0.5789 0.5710 -0.0044 -0.0181 -0.0139 357 GLN A NE2 
1214 N N   . PHE A 208 ? 0.3148 0.3479 0.3587 -0.0097 -0.0597 -0.0298 358 PHE A N   
1215 C CA  . PHE A 208 ? 0.3507 0.3881 0.3991 -0.0103 -0.0745 -0.0363 358 PHE A CA  
1216 C C   . PHE A 208 ? 0.3734 0.4024 0.4119 -0.0129 -0.0796 -0.0456 358 PHE A C   
1217 O O   . PHE A 208 ? 0.3884 0.4080 0.4059 -0.0116 -0.0737 -0.0462 358 PHE A O   
1218 C CB  . PHE A 208 ? 0.3795 0.4182 0.4083 -0.0043 -0.0818 -0.0340 358 PHE A CB  
1219 C CG  . PHE A 208 ? 0.3868 0.4358 0.4314 -0.0018 -0.0842 -0.0281 358 PHE A CG  
1220 C CD1 . PHE A 208 ? 0.4155 0.4744 0.4850 -0.0036 -0.0947 -0.0310 358 PHE A CD1 
1221 C CD2 . PHE A 208 ? 0.3832 0.4318 0.4189 0.0027  -0.0767 -0.0201 358 PHE A CD2 
1222 C CE1 . PHE A 208 ? 0.4320 0.5009 0.5181 -0.0006 -0.0968 -0.0253 358 PHE A CE1 
1223 C CE2 . PHE A 208 ? 0.3955 0.4528 0.4464 0.0056  -0.0787 -0.0149 358 PHE A CE2 
1224 C CZ  . PHE A 208 ? 0.3870 0.4546 0.4630 0.0041  -0.0884 -0.0172 358 PHE A CZ  
1225 N N   . HIS A 209 ? 0.3857 0.4183 0.4402 -0.0164 -0.0912 -0.0533 359 HIS A N   
1226 C CA  . HIS A 209 ? 0.4065 0.4312 0.4483 -0.0176 -0.1001 -0.0643 359 HIS A CA  
1227 C C   . HIS A 209 ? 0.4373 0.4592 0.4461 -0.0109 -0.1083 -0.0655 359 HIS A C   
1228 O O   . HIS A 209 ? 0.4591 0.4885 0.4671 -0.0071 -0.1133 -0.0601 359 HIS A O   
1229 C CB  . HIS A 209 ? 0.3974 0.4280 0.4680 -0.0229 -0.1122 -0.0724 359 HIS A CB  
1230 C CG  . HIS A 209 ? 0.4453 0.4680 0.5055 -0.0243 -0.1240 -0.0859 359 HIS A CG  
1231 N ND1 . HIS A 209 ? 0.4574 0.4802 0.4977 -0.0203 -0.1400 -0.0929 359 HIS A ND1 
1232 C CD2 . HIS A 209 ? 0.4681 0.4820 0.5350 -0.0291 -0.1225 -0.0941 359 HIS A CD2 
1233 C CE1 . HIS A 209 ? 0.4875 0.5016 0.5212 -0.0223 -0.1481 -0.1059 359 HIS A CE1 
1234 N NE2 . HIS A 209 ? 0.4955 0.5039 0.5461 -0.0279 -0.1375 -0.1070 359 HIS A NE2 
1235 N N   . PRO A 210 ? 0.4821 0.4929 0.4638 -0.0089 -0.1087 -0.0718 360 PRO A N   
1236 C CA  . PRO A 210 ? 0.4977 0.5048 0.4454 -0.0015 -0.1126 -0.0703 360 PRO A CA  
1237 C C   . PRO A 210 ? 0.5120 0.5250 0.4541 0.0018  -0.1306 -0.0736 360 PRO A C   
1238 O O   . PRO A 210 ? 0.5205 0.5332 0.4402 0.0084  -0.1321 -0.0676 360 PRO A O   
1239 C CB  . PRO A 210 ? 0.5391 0.5329 0.4628 -0.0005 -0.1089 -0.0781 360 PRO A CB  
1240 C CG  . PRO A 210 ? 0.5611 0.5526 0.5080 -0.0076 -0.1109 -0.0875 360 PRO A CG  
1241 C CD  . PRO A 210 ? 0.4962 0.4967 0.4762 -0.0123 -0.1036 -0.0792 360 PRO A CD  
1242 N N   . ASP A 211 ? 0.4910 0.5095 0.4546 -0.0022 -0.1444 -0.0824 361 ASP A N   
1243 C CA  . ASP A 211 ? 0.5358 0.5614 0.4978 0.0011  -0.1637 -0.0854 361 ASP A CA  
1244 C C   . ASP A 211 ? 0.5152 0.5541 0.4987 0.0025  -0.1646 -0.0746 361 ASP A C   
1245 O O   . ASP A 211 ? 0.5463 0.5916 0.5271 0.0068  -0.1795 -0.0743 361 ASP A O   
1246 C CB  . ASP A 211 ? 0.5716 0.5992 0.5530 -0.0040 -0.1799 -0.0996 361 ASP A CB  
1247 C CG  . ASP A 211 ? 0.6302 0.6440 0.5854 -0.0035 -0.1838 -0.1126 361 ASP A CG  
1248 O OD1 . ASP A 211 ? 0.6533 0.6576 0.5692 0.0030  -0.1791 -0.1110 361 ASP A OD1 
1249 O OD2 . ASP A 211 ? 0.6724 0.6844 0.6473 -0.0097 -0.1906 -0.1243 361 ASP A OD2 
1250 N N   . GLY A 212 ? 0.4656 0.5085 0.4707 -0.0005 -0.1495 -0.0662 362 GLY A N   
1251 C CA  . GLY A 212 ? 0.4513 0.5047 0.4726 0.0019  -0.1470 -0.0554 362 GLY A CA  
1252 C C   . GLY A 212 ? 0.4688 0.5359 0.5291 -0.0012 -0.1567 -0.0567 362 GLY A C   
1253 O O   . GLY A 212 ? 0.4378 0.5140 0.5119 0.0017  -0.1560 -0.0484 362 GLY A O   
1254 N N   . LEU A 213 ? 0.4552 0.5240 0.5360 -0.0074 -0.1652 -0.0671 363 LEU A N   
1255 C CA  . LEU A 213 ? 0.4458 0.5285 0.5710 -0.0118 -0.1734 -0.0689 363 LEU A CA  
1256 C C   . LEU A 213 ? 0.4048 0.4907 0.5637 -0.0183 -0.1564 -0.0646 363 LEU A C   
1257 O O   . LEU A 213 ? 0.4038 0.5020 0.5981 -0.0198 -0.1552 -0.0600 363 LEU A O   
1258 C CB  . LEU A 213 ? 0.4969 0.5803 0.6301 -0.0151 -0.1937 -0.0830 363 LEU A CB  
1259 C CG  . LEU A 213 ? 0.5456 0.6259 0.6447 -0.0081 -0.2129 -0.0884 363 LEU A CG  
1260 C CD1 . LEU A 213 ? 0.5709 0.6485 0.6731 -0.0117 -0.2324 -0.1052 363 LEU A CD1 
1261 C CD2 . LEU A 213 ? 0.5700 0.6628 0.6782 -0.0022 -0.2225 -0.0804 363 LEU A CD2 
1262 N N   . ILE A 214 ? 0.3855 0.4604 0.5340 -0.0215 -0.1434 -0.0657 364 ILE A N   
1263 C CA  . ILE A 214 ? 0.3575 0.4334 0.5332 -0.0269 -0.1270 -0.0610 364 ILE A CA  
1264 C C   . ILE A 214 ? 0.3459 0.4126 0.4972 -0.0244 -0.1085 -0.0530 364 ILE A C   
1265 O O   . ILE A 214 ? 0.3535 0.4114 0.4691 -0.0201 -0.1083 -0.0533 364 ILE A O   
1266 C CB  . ILE A 214 ? 0.3761 0.4481 0.5731 -0.0348 -0.1302 -0.0706 364 ILE A CB  
1267 C CG1 . ILE A 214 ? 0.3959 0.4520 0.5608 -0.0349 -0.1283 -0.0772 364 ILE A CG1 
1268 C CG2 . ILE A 214 ? 0.3905 0.4720 0.6137 -0.0377 -0.1510 -0.0801 364 ILE A CG2 
1269 C CD1 . ILE A 214 ? 0.4269 0.4770 0.6131 -0.0424 -0.1284 -0.0856 364 ILE A CD1 
1270 N N   . PHE A 215 ? 0.3354 0.4042 0.5058 -0.0265 -0.0927 -0.0455 365 PHE A N   
1271 C CA  . PHE A 215 ? 0.3084 0.3683 0.4584 -0.0246 -0.0762 -0.0390 365 PHE A CA  
1272 C C   . PHE A 215 ? 0.3088 0.3672 0.4804 -0.0291 -0.0622 -0.0351 365 PHE A C   
1273 O O   . PHE A 215 ? 0.3028 0.3684 0.5087 -0.0336 -0.0630 -0.0358 365 PHE A O   
1274 C CB  . PHE A 215 ? 0.3223 0.3852 0.4591 -0.0183 -0.0704 -0.0306 365 PHE A CB  
1275 C CG  . PHE A 215 ? 0.3057 0.3808 0.4711 -0.0175 -0.0680 -0.0253 365 PHE A CG  
1276 C CD1 . PHE A 215 ? 0.3155 0.4007 0.4936 -0.0157 -0.0817 -0.0270 365 PHE A CD1 
1277 C CD2 . PHE A 215 ? 0.3018 0.3780 0.4793 -0.0176 -0.0514 -0.0180 365 PHE A CD2 
1278 C CE1 . PHE A 215 ? 0.3219 0.4188 0.5285 -0.0143 -0.0789 -0.0218 365 PHE A CE1 
1279 C CE2 . PHE A 215 ? 0.2855 0.3723 0.4883 -0.0160 -0.0476 -0.0132 365 PHE A CE2 
1280 C CZ  . PHE A 215 ? 0.3112 0.4088 0.5303 -0.0145 -0.0610 -0.0150 365 PHE A CZ  
1281 N N   . GLY A 216 ? 0.2975 0.3465 0.4497 -0.0276 -0.0493 -0.0305 366 GLY A N   
1282 C CA  . GLY A 216 ? 0.2991 0.3448 0.4648 -0.0302 -0.0345 -0.0247 366 GLY A CA  
1283 C C   . GLY A 216 ? 0.2840 0.3295 0.4380 -0.0253 -0.0207 -0.0152 366 GLY A C   
1284 O O   . GLY A 216 ? 0.2996 0.3429 0.4291 -0.0206 -0.0217 -0.0141 366 GLY A O   
1285 N N   . THR A 217 ? 0.2919 0.3395 0.4647 -0.0263 -0.0080 -0.0085 367 THR A N   
1286 C CA  . THR A 217 ? 0.2796 0.3246 0.4394 -0.0216 0.0061  -0.0002 367 THR A CA  
1287 C C   . THR A 217 ? 0.2842 0.3222 0.4500 -0.0237 0.0190  0.0050  367 THR A C   
1288 O O   . THR A 217 ? 0.2936 0.3350 0.4888 -0.0281 0.0230  0.0067  367 THR A O   
1289 C CB  . THR A 217 ? 0.2745 0.3297 0.4508 -0.0187 0.0115  0.0043  367 THR A CB  
1290 O OG1 . THR A 217 ? 0.2600 0.3228 0.4728 -0.0229 0.0149  0.0059  367 THR A OG1 
1291 C CG2 . THR A 217 ? 0.2668 0.3285 0.4392 -0.0160 -0.0001 0.0008  367 THR A CG2 
1292 N N   . GLY A 218 ? 0.3077 0.3361 0.4476 -0.0204 0.0256  0.0084  368 GLY A N   
1293 C CA  . GLY A 218 ? 0.3159 0.3371 0.4564 -0.0205 0.0385  0.0154  368 GLY A CA  
1294 C C   . GLY A 218 ? 0.3303 0.3544 0.4729 -0.0162 0.0524  0.0238  368 GLY A C   
1295 O O   . GLY A 218 ? 0.3089 0.3380 0.4435 -0.0120 0.0519  0.0234  368 GLY A O   
1296 N N   . THR A 219 ? 0.3197 0.3401 0.4738 -0.0171 0.0655  0.0315  369 THR A N   
1297 C CA  . THR A 219 ? 0.3427 0.3647 0.4986 -0.0127 0.0812  0.0401  369 THR A CA  
1298 C C   . THR A 219 ? 0.3642 0.3744 0.4962 -0.0081 0.0930  0.0483  369 THR A C   
1299 O O   . THR A 219 ? 0.3284 0.3302 0.4537 -0.0098 0.0912  0.0492  369 THR A O   
1300 C CB  . THR A 219 ? 0.3568 0.3866 0.5519 -0.0166 0.0897  0.0443  369 THR A CB  
1301 O OG1 . THR A 219 ? 0.3497 0.3726 0.5582 -0.0205 0.0977  0.0501  369 THR A OG1 
1302 C CG2 . THR A 219 ? 0.3580 0.3993 0.5797 -0.0217 0.0757  0.0360  369 THR A CG2 
1303 N N   . MET A 220 ? 0.3946 0.4042 0.5136 -0.0017 0.1048  0.0541  370 MET A N   
1304 C CA  . MET A 220 ? 0.4546 0.4536 0.5516 0.0036  0.1174  0.0631  370 MET A CA  
1305 C C   . MET A 220 ? 0.4424 0.4371 0.5587 0.0008  0.1299  0.0728  370 MET A C   
1306 O O   . MET A 220 ? 0.4360 0.4200 0.5337 0.0041  0.1363  0.0800  370 MET A O   
1307 C CB  . MET A 220 ? 0.5380 0.5374 0.6177 0.0116  0.1279  0.0662  370 MET A CB  
1308 C CG  . MET A 220 ? 0.6131 0.6097 0.6613 0.0164  0.1177  0.0591  370 MET A CG  
1309 S SD  . MET A 220 ? 0.6399 0.6231 0.6526 0.0202  0.1132  0.0610  370 MET A SD  
1310 C CE  . MET A 220 ? 0.6804 0.6556 0.6851 0.0257  0.1335  0.0746  370 MET A CE  
1311 N N   . ASP A 221 ? 0.4140 0.4168 0.5687 -0.0050 0.1334  0.0735  371 ASP A N   
1312 C CA  . ASP A 221 ? 0.4158 0.4143 0.5940 -0.0088 0.1452  0.0826  371 ASP A CA  
1313 C C   . ASP A 221 ? 0.4156 0.4122 0.6146 -0.0172 0.1333  0.0768  371 ASP A C   
1314 O O   . ASP A 221 ? 0.3785 0.3761 0.6120 -0.0232 0.1391  0.0803  371 ASP A O   
1315 C CB  . ASP A 221 ? 0.4671 0.4741 0.6771 -0.0094 0.1607  0.0894  371 ASP A CB  
1316 C CG  . ASP A 221 ? 0.4871 0.5090 0.7324 -0.0154 0.1502  0.0803  371 ASP A CG  
1317 O OD1 . ASP A 221 ? 0.4467 0.4723 0.6901 -0.0189 0.1306  0.0687  371 ASP A OD1 
1318 O OD2 . ASP A 221 ? 0.5481 0.5783 0.8233 -0.0161 0.1621  0.0854  371 ASP A OD2 
1319 N N   . SER A 222 ? 0.3941 0.3874 0.5722 -0.0175 0.1174  0.0677  372 SER A N   
1320 C CA  . SER A 222 ? 0.4054 0.3926 0.5924 -0.0234 0.1074  0.0622  372 SER A CA  
1321 C C   . SER A 222 ? 0.3696 0.3650 0.5905 -0.0319 0.0956  0.0520  372 SER A C   
1322 O O   . SER A 222 ? 0.4144 0.4040 0.6505 -0.0374 0.0910  0.0486  372 SER A O   
1323 C CB  . SER A 222 ? 0.4327 0.4081 0.6256 -0.0237 0.1203  0.0734  372 SER A CB  
1324 O OG  . SER A 222 ? 0.5084 0.4767 0.6720 -0.0153 0.1326  0.0845  372 SER A OG  
1325 N N   . GLN A 223 ? 0.3620 0.3698 0.5938 -0.0325 0.0897  0.0466  373 GLN A N   
1326 C CA  . GLN A 223 ? 0.3775 0.3939 0.6383 -0.0394 0.0756  0.0361  373 GLN A CA  
1327 C C   . GLN A 223 ? 0.3748 0.3937 0.6129 -0.0381 0.0578  0.0247  373 GLN A C   
1328 O O   . GLN A 223 ? 0.3374 0.3567 0.5470 -0.0320 0.0575  0.0254  373 GLN A O   
1329 C CB  . GLN A 223 ? 0.4204 0.4505 0.7139 -0.0410 0.0802  0.0383  373 GLN A CB  
1330 C CG  . GLN A 223 ? 0.5097 0.5391 0.8290 -0.0420 0.1000  0.0505  373 GLN A CG  
1331 C CD  . GLN A 223 ? 0.6106 0.6360 0.9638 -0.0503 0.0994  0.0496  373 GLN A CD  
1332 O OE1 . GLN A 223 ? 0.7189 0.7531 1.1074 -0.0571 0.0887  0.0416  373 GLN A OE1 
1333 N NE2 . GLN A 223 ? 0.6254 0.6372 0.9689 -0.0496 0.1099  0.0575  373 GLN A NE2 
1334 N N   . ILE A 224 ? 0.3615 0.3811 0.6123 -0.0436 0.0433  0.0141  374 ILE A N   
1335 C CA  . ILE A 224 ? 0.3797 0.4033 0.6146 -0.0425 0.0268  0.0038  374 ILE A CA  
1336 C C   . ILE A 224 ? 0.3421 0.3788 0.6076 -0.0462 0.0173  -0.0014 374 ILE A C   
1337 O O   . ILE A 224 ? 0.3699 0.4081 0.6647 -0.0527 0.0112  -0.0068 374 ILE A O   
1338 C CB  . ILE A 224 ? 0.4340 0.4483 0.6567 -0.0450 0.0159  -0.0054 374 ILE A CB  
1339 C CG1 . ILE A 224 ? 0.4514 0.4524 0.6539 -0.0424 0.0261  0.0005  374 ILE A CG1 
1340 C CG2 . ILE A 224 ? 0.4545 0.4720 0.6539 -0.0421 0.0012  -0.0142 374 ILE A CG2 
1341 C CD1 . ILE A 224 ? 0.4478 0.4468 0.6148 -0.0354 0.0280  0.0037  374 ILE A CD1 
1342 N N   . LYS A 225 ? 0.3136 0.3596 0.5737 -0.0420 0.0153  -0.0002 375 LYS A N   
1343 C CA  . LYS A 225 ? 0.3228 0.3828 0.6130 -0.0442 0.0067  -0.0037 375 LYS A CA  
1344 C C   . LYS A 225 ? 0.3182 0.3807 0.5945 -0.0437 -0.0136 -0.0145 375 LYS A C   
1345 O O   . LYS A 225 ? 0.3127 0.3718 0.5552 -0.0383 -0.0166 -0.0150 375 LYS A O   
1346 C CB  . LYS A 225 ? 0.3320 0.4005 0.6263 -0.0390 0.0174  0.0044  375 LYS A CB  
1347 C CG  . LYS A 225 ? 0.3688 0.4337 0.6694 -0.0376 0.0394  0.0159  375 LYS A CG  
1348 C CD  . LYS A 225 ? 0.3886 0.4625 0.6975 -0.0325 0.0504  0.0228  375 LYS A CD  
1349 C CE  . LYS A 225 ? 0.3986 0.4873 0.7535 -0.0361 0.0473  0.0218  375 LYS A CE  
1350 N NZ  . LYS A 225 ? 0.4334 0.5229 0.8245 -0.0415 0.0596  0.0276  375 LYS A NZ  
1351 N N   . ILE A 226 ? 0.3268 0.3948 0.6292 -0.0491 -0.0278 -0.0232 376 ILE A N   
1352 C CA  . ILE A 226 ? 0.3269 0.3974 0.6162 -0.0481 -0.0484 -0.0337 376 ILE A CA  
1353 C C   . ILE A 226 ? 0.3030 0.3891 0.6161 -0.0469 -0.0569 -0.0336 376 ILE A C   
1354 O O   . ILE A 226 ? 0.3110 0.4065 0.6651 -0.0510 -0.0545 -0.0317 376 ILE A O   
1355 C CB  . ILE A 226 ? 0.3546 0.4192 0.6522 -0.0542 -0.0616 -0.0458 376 ILE A CB  
1356 C CG1 . ILE A 226 ? 0.3504 0.3994 0.6313 -0.0556 -0.0517 -0.0454 376 ILE A CG1 
1357 C CG2 . ILE A 226 ? 0.3665 0.4320 0.6431 -0.0517 -0.0824 -0.0566 376 ILE A CG2 
1358 C CD1 . ILE A 226 ? 0.3779 0.4173 0.6131 -0.0494 -0.0477 -0.0434 376 ILE A CD1 
1359 N N   . TRP A 227 ? 0.3042 0.3929 0.5931 -0.0412 -0.0663 -0.0348 377 TRP A N   
1360 C CA  . TRP A 227 ? 0.3271 0.4298 0.6335 -0.0382 -0.0743 -0.0333 377 TRP A CA  
1361 C C   . TRP A 227 ? 0.3498 0.4550 0.6446 -0.0366 -0.0971 -0.0424 377 TRP A C   
1362 O O   . TRP A 227 ? 0.3893 0.4843 0.6475 -0.0344 -0.1032 -0.0471 377 TRP A O   
1363 C CB  . TRP A 227 ? 0.3241 0.4274 0.6111 -0.0309 -0.0627 -0.0239 377 TRP A CB  
1364 C CG  . TRP A 227 ? 0.3186 0.4194 0.6116 -0.0305 -0.0403 -0.0146 377 TRP A CG  
1365 C CD1 . TRP A 227 ? 0.3302 0.4187 0.5984 -0.0299 -0.0275 -0.0112 377 TRP A CD1 
1366 C CD2 . TRP A 227 ? 0.3270 0.4377 0.6515 -0.0298 -0.0283 -0.0074 377 TRP A CD2 
1367 N NE1 . TRP A 227 ? 0.3369 0.4262 0.6157 -0.0285 -0.0088 -0.0024 377 TRP A NE1 
1368 C CE2 . TRP A 227 ? 0.3398 0.4424 0.6530 -0.0284 -0.0079 0.0000  377 TRP A CE2 
1369 C CE3 . TRP A 227 ? 0.3179 0.4436 0.6788 -0.0295 -0.0327 -0.0064 377 TRP A CE3 
1370 C CZ2 . TRP A 227 ? 0.3310 0.4391 0.6657 -0.0266 0.0094  0.0084  377 TRP A CZ2 
1371 C CZ3 . TRP A 227 ? 0.3233 0.4553 0.7094 -0.0281 -0.0148 0.0019  377 TRP A CZ3 
1372 C CH2 . TRP A 227 ? 0.3269 0.4494 0.6979 -0.0265 0.0066  0.0091  377 TRP A CH2 
1373 N N   . ASP A 228 ? 0.3729 0.4919 0.6984 -0.0370 -0.1092 -0.0442 378 ASP A N   
1374 C CA  . ASP A 228 ? 0.3954 0.5192 0.7124 -0.0340 -0.1320 -0.0512 378 ASP A CA  
1375 C C   . ASP A 228 ? 0.3788 0.5081 0.6836 -0.0259 -0.1296 -0.0425 378 ASP A C   
1376 O O   . ASP A 228 ? 0.3367 0.4764 0.6700 -0.0248 -0.1213 -0.0353 378 ASP A O   
1377 C CB  . ASP A 228 ? 0.4368 0.5736 0.7999 -0.0392 -0.1471 -0.0579 378 ASP A CB  
1378 C CG  . ASP A 228 ? 0.4735 0.6160 0.8290 -0.0357 -0.1735 -0.0657 378 ASP A CG  
1379 O OD1 . ASP A 228 ? 0.4813 0.6248 0.8115 -0.0279 -0.1772 -0.0609 378 ASP A OD1 
1380 O OD2 . ASP A 228 ? 0.5213 0.6673 0.8974 -0.0405 -0.1908 -0.0767 378 ASP A OD2 
1381 N N   . LEU A 229 ? 0.3671 0.4889 0.6305 -0.0201 -0.1357 -0.0427 379 LEU A N   
1382 C CA  . LEU A 229 ? 0.3960 0.5202 0.6455 -0.0123 -0.1314 -0.0337 379 LEU A CA  
1383 C C   . LEU A 229 ? 0.3972 0.5363 0.6731 -0.0090 -0.1454 -0.0323 379 LEU A C   
1384 O O   . LEU A 229 ? 0.4165 0.5627 0.7082 -0.0052 -0.1365 -0.0240 379 LEU A O   
1385 C CB  . LEU A 229 ? 0.3875 0.4996 0.5886 -0.0071 -0.1342 -0.0337 379 LEU A CB  
1386 C CG  . LEU A 229 ? 0.4134 0.5263 0.5989 0.0008  -0.1314 -0.0247 379 LEU A CG  
1387 C CD1 . LEU A 229 ? 0.3844 0.4956 0.5743 0.0017  -0.1103 -0.0165 379 LEU A CD1 
1388 C CD2 . LEU A 229 ? 0.4171 0.5188 0.5587 0.0054  -0.1366 -0.0252 379 LEU A CD2 
1389 N N   . LYS A 230 ? 0.4053 0.5486 0.6851 -0.0097 -0.1675 -0.0406 380 LYS A N   
1390 C CA  . LYS A 230 ? 0.4552 0.6130 0.7594 -0.0060 -0.1845 -0.0399 380 LYS A CA  
1391 C C   . LYS A 230 ? 0.4598 0.6326 0.8194 -0.0097 -0.1778 -0.0367 380 LYS A C   
1392 O O   . LYS A 230 ? 0.4864 0.6690 0.8645 -0.0047 -0.1751 -0.0290 380 LYS A O   
1393 C CB  . LYS A 230 ? 0.4815 0.6403 0.7796 -0.0067 -0.2110 -0.0513 380 LYS A CB  
1394 N N   . GLU A 231 ? 0.4383 0.6120 0.8244 -0.0181 -0.1731 -0.0419 381 GLU A N   
1395 C CA  . GLU A 231 ? 0.4420 0.6296 0.8830 -0.0223 -0.1650 -0.0386 381 GLU A CA  
1396 C C   . GLU A 231 ? 0.4164 0.6014 0.8612 -0.0213 -0.1365 -0.0280 381 GLU A C   
1397 O O   . GLU A 231 ? 0.3631 0.5592 0.8507 -0.0231 -0.1261 -0.0232 381 GLU A O   
1398 C CB  . GLU A 231 ? 0.4639 0.6526 0.9342 -0.0320 -0.1704 -0.0478 381 GLU A CB  
1399 C CG  . GLU A 231 ? 0.5338 0.7226 0.9987 -0.0339 -0.1992 -0.0612 381 GLU A CG  
1400 C CD  . GLU A 231 ? 0.5592 0.7649 1.0521 -0.0304 -0.2218 -0.0632 381 GLU A CD  
1401 O OE1 . GLU A 231 ? 0.5616 0.7795 1.0799 -0.0263 -0.2152 -0.0537 381 GLU A OE1 
1402 O OE2 . GLU A 231 ? 0.6427 0.8491 1.1317 -0.0315 -0.2470 -0.0747 381 GLU A OE2 
1403 N N   . ARG A 232 ? 0.4245 0.5946 0.8251 -0.0185 -0.1237 -0.0246 382 ARG A N   
1404 C CA  . ARG A 232 ? 0.4294 0.5942 0.8255 -0.0174 -0.0975 -0.0160 382 ARG A CA  
1405 C C   . ARG A 232 ? 0.3818 0.5478 0.8099 -0.0247 -0.0830 -0.0152 382 ARG A C   
1406 O O   . ARG A 232 ? 0.4153 0.5839 0.8595 -0.0236 -0.0636 -0.0075 382 ARG A O   
1407 C CB  . ARG A 232 ? 0.4587 0.6318 0.8664 -0.0101 -0.0900 -0.0077 382 ARG A CB  
1408 C CG  . ARG A 232 ? 0.5151 0.6860 0.8935 -0.0023 -0.1014 -0.0063 382 ARG A CG  
1409 C CD  . ARG A 232 ? 0.5193 0.7025 0.9242 0.0039  -0.1002 0.0000  382 ARG A CD  
1410 N N   . THR A 233 ? 0.3727 0.5354 0.8079 -0.0319 -0.0918 -0.0230 383 THR A N   
1411 C CA  . THR A 233 ? 0.3435 0.5080 0.8148 -0.0393 -0.0803 -0.0222 383 THR A CA  
1412 C C   . THR A 233 ? 0.3537 0.5016 0.7984 -0.0432 -0.0718 -0.0241 383 THR A C   
1413 O O   . THR A 233 ? 0.3486 0.4855 0.7541 -0.0421 -0.0814 -0.0301 383 THR A O   
1414 C CB  . THR A 233 ? 0.3379 0.5140 0.8538 -0.0458 -0.0987 -0.0305 383 THR A CB  
1415 O OG1 . THR A 233 ? 0.3766 0.5466 0.8670 -0.0467 -0.1214 -0.0420 383 THR A OG1 
1416 C CG2 . THR A 233 ? 0.3247 0.5200 0.8804 -0.0428 -0.1056 -0.0276 383 THR A CG2 
1417 N N   . ASN A 234 ? 0.3214 0.4675 0.7884 -0.0473 -0.0531 -0.0183 384 ASN A N   
1418 C CA  . ASN A 234 ? 0.3294 0.4604 0.7770 -0.0506 -0.0423 -0.0178 384 ASN A CA  
1419 C C   . ASN A 234 ? 0.3258 0.4572 0.8033 -0.0593 -0.0538 -0.0266 384 ASN A C   
1420 O O   . ASN A 234 ? 0.3215 0.4617 0.8463 -0.0644 -0.0492 -0.0246 384 ASN A O   
1421 C CB  . ASN A 234 ? 0.3396 0.4679 0.7926 -0.0490 -0.0153 -0.0053 384 ASN A CB  
1422 C CG  . ASN A 234 ? 0.3892 0.5030 0.8306 -0.0526 -0.0032 -0.0029 384 ASN A CG  
1423 O OD1 . ASN A 234 ? 0.3818 0.4950 0.8441 -0.0543 0.0155  0.0057  384 ASN A OD1 
1424 N ND2 . ASN A 234 ? 0.3872 0.4891 0.7961 -0.0534 -0.0131 -0.0101 384 ASN A ND2 
1425 N N   . VAL A 235 ? 0.3331 0.4550 0.7843 -0.0608 -0.0692 -0.0371 385 VAL A N   
1426 C CA  . VAL A 235 ? 0.3503 0.4729 0.8271 -0.0682 -0.0862 -0.0491 385 VAL A CA  
1427 C C   . VAL A 235 ? 0.3511 0.4605 0.8324 -0.0744 -0.0764 -0.0503 385 VAL A C   
1428 O O   . VAL A 235 ? 0.3563 0.4670 0.8726 -0.0819 -0.0847 -0.0579 385 VAL A O   
1429 C CB  . VAL A 235 ? 0.3719 0.4928 0.8210 -0.0659 -0.1119 -0.0622 385 VAL A CB  
1430 C CG1 . VAL A 235 ? 0.3805 0.5170 0.8395 -0.0612 -0.1258 -0.0619 385 VAL A CG1 
1431 C CG2 . VAL A 235 ? 0.4116 0.5171 0.8036 -0.0608 -0.1088 -0.0626 385 VAL A CG2 
1432 N N   . ALA A 236 ? 0.3316 0.4284 0.7808 -0.0712 -0.0593 -0.0426 386 ALA A N   
1433 C CA  . ALA A 236 ? 0.3522 0.4355 0.8041 -0.0759 -0.0479 -0.0413 386 ALA A CA  
1434 C C   . ALA A 236 ? 0.3426 0.4172 0.7658 -0.0706 -0.0253 -0.0279 386 ALA A C   
1435 O O   . ALA A 236 ? 0.3240 0.3995 0.7149 -0.0634 -0.0229 -0.0239 386 ALA A O   
1436 C CB  . ALA A 236 ? 0.3564 0.4276 0.7847 -0.0778 -0.0632 -0.0549 386 ALA A CB  
1437 N N   . ASN A 237 ? 0.3500 0.4157 0.7852 -0.0739 -0.0098 -0.0213 387 ASN A N   
1438 C CA  . ASN A 237 ? 0.3765 0.4322 0.7823 -0.0687 0.0094  -0.0096 387 ASN A CA  
1439 C C   . ASN A 237 ? 0.3864 0.4265 0.7860 -0.0719 0.0130  -0.0108 387 ASN A C   
1440 O O   . ASN A 237 ? 0.3919 0.4300 0.8270 -0.0790 0.0137  -0.0126 387 ASN A O   
1441 C CB  . ASN A 237 ? 0.3956 0.4574 0.8229 -0.0671 0.0303  0.0047  387 ASN A CB  
1442 C CG  . ASN A 237 ? 0.3878 0.4647 0.8211 -0.0629 0.0283  0.0062  387 ASN A CG  
1443 O OD1 . ASN A 237 ? 0.4013 0.4778 0.7998 -0.0557 0.0290  0.0081  387 ASN A OD1 
1444 N ND2 . ASN A 237 ? 0.3661 0.4563 0.8465 -0.0673 0.0257  0.0054  387 ASN A ND2 
1445 N N   . PHE A 238 ? 0.3814 0.4105 0.7385 -0.0668 0.0148  -0.0100 388 PHE A N   
1446 C CA  . PHE A 238 ? 0.4135 0.4272 0.7619 -0.0685 0.0189  -0.0102 388 PHE A CA  
1447 C C   . PHE A 238 ? 0.4124 0.4185 0.7504 -0.0645 0.0403  0.0055  388 PHE A C   
1448 O O   . PHE A 238 ? 0.4470 0.4507 0.7495 -0.0574 0.0452  0.0108  388 PHE A O   
1449 C CB  . PHE A 238 ? 0.4166 0.4225 0.7264 -0.0652 0.0068  -0.0199 388 PHE A CB  
1450 C CG  . PHE A 238 ? 0.4287 0.4394 0.7405 -0.0678 -0.0142 -0.0355 388 PHE A CG  
1451 C CD1 . PHE A 238 ? 0.4877 0.5047 0.8378 -0.0747 -0.0242 -0.0435 388 PHE A CD1 
1452 C CD2 . PHE A 238 ? 0.4543 0.4625 0.7286 -0.0629 -0.0242 -0.0423 388 PHE A CD2 
1453 C CE1 . PHE A 238 ? 0.4939 0.5144 0.8413 -0.0761 -0.0453 -0.0585 388 PHE A CE1 
1454 C CE2 . PHE A 238 ? 0.4470 0.4582 0.7178 -0.0641 -0.0433 -0.0561 388 PHE A CE2 
1455 C CZ  . PHE A 238 ? 0.4522 0.4693 0.7576 -0.0703 -0.0544 -0.0644 388 PHE A CZ  
1456 N N   . PRO A 239 ? 0.4315 0.4329 0.7999 -0.0688 0.0526  0.0129  389 PRO A N   
1457 C CA  . PRO A 239 ? 0.4388 0.4316 0.7975 -0.0648 0.0728  0.0286  389 PRO A CA  
1458 C C   . PRO A 239 ? 0.4539 0.4305 0.7987 -0.0648 0.0735  0.0284  389 PRO A C   
1459 O O   . PRO A 239 ? 0.4466 0.4186 0.7976 -0.0694 0.0599  0.0156  389 PRO A O   
1460 C CB  . PRO A 239 ? 0.4629 0.4601 0.8682 -0.0701 0.0855  0.0368  389 PRO A CB  
1461 C CG  . PRO A 239 ? 0.4734 0.4722 0.9136 -0.0793 0.0701  0.0230  389 PRO A CG  
1462 C CD  . PRO A 239 ? 0.4570 0.4607 0.8729 -0.0780 0.0479  0.0070  389 PRO A CD  
1463 N N   . GLY A 240 ? 0.4445 0.4118 0.7718 -0.0595 0.0892  0.0423  390 GLY A N   
1464 C CA  . GLY A 240 ? 0.4275 0.3791 0.7477 -0.0592 0.0923  0.0450  390 GLY A CA  
1465 C C   . GLY A 240 ? 0.4267 0.3713 0.7039 -0.0502 0.0970  0.0525  390 GLY A C   
1466 O O   . GLY A 240 ? 0.4427 0.3745 0.7129 -0.0477 0.1050  0.0610  390 GLY A O   
1467 N N   . HIS A 241 ? 0.4151 0.3677 0.6642 -0.0452 0.0909  0.0490  391 HIS A N   
1468 C CA  . HIS A 241 ? 0.3974 0.3456 0.6079 -0.0367 0.0947  0.0556  391 HIS A CA  
1469 C C   . HIS A 241 ? 0.4257 0.3721 0.6322 -0.0317 0.1129  0.0721  391 HIS A C   
1470 O O   . HIS A 241 ? 0.4109 0.3633 0.6437 -0.0345 0.1229  0.0777  391 HIS A O   
1471 C CB  . HIS A 241 ? 0.3694 0.3268 0.5553 -0.0333 0.0836  0.0472  391 HIS A CB  
1472 C CG  . HIS A 241 ? 0.3705 0.3254 0.5417 -0.0338 0.0688  0.0349  391 HIS A CG  
1473 N ND1 . HIS A 241 ? 0.3921 0.3364 0.5442 -0.0304 0.0680  0.0359  391 HIS A ND1 
1474 C CD2 . HIS A 241 ? 0.3461 0.3078 0.5169 -0.0364 0.0549  0.0220  391 HIS A CD2 
1475 C CE1 . HIS A 241 ? 0.3802 0.3252 0.5220 -0.0311 0.0554  0.0240  391 HIS A CE1 
1476 N NE2 . HIS A 241 ? 0.3547 0.3096 0.5061 -0.0346 0.0474  0.0156  391 HIS A NE2 
1477 N N   . SER A 242 ? 0.4491 0.3872 0.6233 -0.0240 0.1173  0.0800  392 SER A N   
1478 C CA  . SER A 242 ? 0.5145 0.4507 0.6709 -0.0166 0.1323  0.0941  392 SER A CA  
1479 C C   . SER A 242 ? 0.4786 0.4181 0.5976 -0.0094 0.1259  0.0908  392 SER A C   
1480 O O   . SER A 242 ? 0.4799 0.4184 0.5815 -0.0083 0.1128  0.0823  392 SER A O   
1481 C CB  . SER A 242 ? 0.5442 0.4662 0.6956 -0.0130 0.1437  0.1081  392 SER A CB  
1482 O OG  . SER A 242 ? 0.6114 0.5305 0.8006 -0.0196 0.1528  0.1132  392 SER A OG  
1483 N N   . GLY A 243 ? 0.4799 0.4236 0.5882 -0.0045 0.1355  0.0968  393 GLY A N   
1484 C CA  . GLY A 243 ? 0.4879 0.4350 0.5642 0.0019  0.1299  0.0927  393 GLY A CA  
1485 C C   . GLY A 243 ? 0.4565 0.4152 0.5385 -0.0017 0.1165  0.0788  393 GLY A C   
1486 O O   . GLY A 243 ? 0.4795 0.4433 0.5874 -0.0090 0.1092  0.0713  393 GLY A O   
1487 N N   . PRO A 244 ? 0.4477 0.4097 0.5049 0.0037  0.1127  0.0753  394 PRO A N   
1488 C CA  . PRO A 244 ? 0.4360 0.4078 0.4945 0.0019  0.1013  0.0641  394 PRO A CA  
1489 C C   . PRO A 244 ? 0.4172 0.3898 0.4809 -0.0032 0.0860  0.0539  394 PRO A C   
1490 O O   . PRO A 244 ? 0.4227 0.3879 0.4728 -0.0019 0.0815  0.0535  394 PRO A O   
1491 C CB  . PRO A 244 ? 0.4580 0.4278 0.4832 0.0097  0.1000  0.0635  394 PRO A CB  
1492 C CG  . PRO A 244 ? 0.4560 0.4179 0.4663 0.0160  0.1145  0.0753  394 PRO A CG  
1493 C CD  . PRO A 244 ? 0.4951 0.4507 0.5212 0.0128  0.1209  0.0831  394 PRO A CD  
1494 N N   . ILE A 245 ? 0.3829 0.3645 0.4662 -0.0083 0.0784  0.0459  395 ILE A N   
1495 C CA  . ILE A 245 ? 0.3691 0.3516 0.4510 -0.0116 0.0641  0.0357  395 ILE A CA  
1496 C C   . ILE A 245 ? 0.3836 0.3655 0.4375 -0.0065 0.0581  0.0326  395 ILE A C   
1497 O O   . ILE A 245 ? 0.3636 0.3497 0.4082 -0.0026 0.0606  0.0338  395 ILE A O   
1498 C CB  . ILE A 245 ? 0.3609 0.3534 0.4658 -0.0170 0.0559  0.0279  395 ILE A CB  
1499 C CG1 . ILE A 245 ? 0.3415 0.3358 0.4798 -0.0226 0.0617  0.0307  395 ILE A CG1 
1500 C CG2 . ILE A 245 ? 0.3576 0.3493 0.4556 -0.0192 0.0418  0.0177  395 ILE A CG2 
1501 C CD1 . ILE A 245 ? 0.3467 0.3307 0.4923 -0.0256 0.0649  0.0331  395 ILE A CD1 
1502 N N   . THR A 246 ? 0.3687 0.3452 0.4107 -0.0065 0.0506  0.0285  396 THR A N   
1503 C CA  . THR A 246 ? 0.3630 0.3391 0.3820 -0.0022 0.0447  0.0255  396 THR A CA  
1504 C C   . THR A 246 ? 0.4032 0.3837 0.4215 -0.0042 0.0341  0.0167  396 THR A C   
1505 O O   . THR A 246 ? 0.3866 0.3699 0.3922 -0.0012 0.0304  0.0146  396 THR A O   
1506 C CB  . THR A 246 ? 0.3774 0.3446 0.3813 0.0009  0.0446  0.0284  396 THR A CB  
1507 O OG1 . THR A 246 ? 0.3681 0.3306 0.3829 -0.0028 0.0423  0.0259  396 THR A OG1 
1508 C CG2 . THR A 246 ? 0.3717 0.3337 0.3678 0.0052  0.0543  0.0381  396 THR A CG2 
1509 N N   . SER A 247 ? 0.3561 0.3367 0.3874 -0.0090 0.0291  0.0114  397 SER A N   
1510 C CA  . SER A 247 ? 0.3647 0.3477 0.3917 -0.0102 0.0193  0.0033  397 SER A CA  
1511 C C   . SER A 247 ? 0.3349 0.3186 0.3791 -0.0155 0.0144  -0.0025 397 SER A C   
1512 O O   . SER A 247 ? 0.3349 0.3139 0.3923 -0.0184 0.0181  -0.0013 397 SER A O   
1513 C CB  . SER A 247 ? 0.3897 0.3662 0.4006 -0.0078 0.0172  0.0016  397 SER A CB  
1514 O OG  . SER A 247 ? 0.3880 0.3665 0.3917 -0.0077 0.0099  -0.0047 397 SER A OG  
1515 N N   . ILE A 248 ? 0.3324 0.3217 0.3768 -0.0165 0.0057  -0.0088 398 ILE A N   
1516 C CA  . ILE A 248 ? 0.3265 0.3161 0.3827 -0.0208 -0.0022 -0.0168 398 ILE A CA  
1517 C C   . ILE A 248 ? 0.3317 0.3205 0.3699 -0.0189 -0.0108 -0.0236 398 ILE A C   
1518 O O   . ILE A 248 ? 0.3281 0.3199 0.3523 -0.0151 -0.0112 -0.0212 398 ILE A O   
1519 C CB  . ILE A 248 ? 0.3556 0.3540 0.4351 -0.0241 -0.0048 -0.0173 398 ILE A CB  
1520 C CG1 . ILE A 248 ? 0.3822 0.3897 0.4573 -0.0214 -0.0097 -0.0170 398 ILE A CG1 
1521 C CG2 . ILE A 248 ? 0.3720 0.3709 0.4689 -0.0254 0.0066  -0.0089 398 ILE A CG2 
1522 C CD1 . ILE A 248 ? 0.4292 0.4463 0.5292 -0.0245 -0.0155 -0.0193 398 ILE A CD1 
1523 N N   . ALA A 249 ? 0.3295 0.3134 0.3679 -0.0211 -0.0170 -0.0319 399 ALA A N   
1524 C CA  . ALA A 249 ? 0.3551 0.3373 0.3745 -0.0188 -0.0246 -0.0386 399 ALA A CA  
1525 C C   . ALA A 249 ? 0.3734 0.3545 0.3995 -0.0220 -0.0349 -0.0491 399 ALA A C   
1526 O O   . ALA A 249 ? 0.3762 0.3515 0.4147 -0.0257 -0.0347 -0.0537 399 ALA A O   
1527 C CB  . ALA A 249 ? 0.3646 0.3383 0.3671 -0.0157 -0.0193 -0.0384 399 ALA A CB  
1528 N N   . PHE A 250 ? 0.3621 0.3484 0.3799 -0.0204 -0.0449 -0.0531 400 PHE A N   
1529 C CA  . PHE A 250 ? 0.3855 0.3702 0.4042 -0.0223 -0.0570 -0.0643 400 PHE A CA  
1530 C C   . PHE A 250 ? 0.4185 0.3939 0.4089 -0.0183 -0.0585 -0.0707 400 PHE A C   
1531 O O   . PHE A 250 ? 0.4212 0.3962 0.3906 -0.0133 -0.0545 -0.0660 400 PHE A O   
1532 C CB  . PHE A 250 ? 0.3784 0.3735 0.4018 -0.0217 -0.0683 -0.0652 400 PHE A CB  
1533 C CG  . PHE A 250 ? 0.3565 0.3611 0.4117 -0.0259 -0.0685 -0.0616 400 PHE A CG  
1534 C CD1 . PHE A 250 ? 0.3614 0.3679 0.4407 -0.0312 -0.0767 -0.0691 400 PHE A CD1 
1535 C CD2 . PHE A 250 ? 0.3561 0.3677 0.4180 -0.0242 -0.0601 -0.0509 400 PHE A CD2 
1536 C CE1 . PHE A 250 ? 0.3697 0.3856 0.4820 -0.0352 -0.0755 -0.0650 400 PHE A CE1 
1537 C CE2 . PHE A 250 ? 0.3407 0.3611 0.4323 -0.0275 -0.0584 -0.0471 400 PHE A CE2 
1538 C CZ  . PHE A 250 ? 0.3457 0.3688 0.4636 -0.0330 -0.0655 -0.0535 400 PHE A CZ  
1539 N N   . SER A 251 ? 0.4219 0.3894 0.4131 -0.0205 -0.0634 -0.0815 401 SER A N   
1540 C CA  . SER A 251 ? 0.4833 0.4412 0.4478 -0.0164 -0.0643 -0.0889 401 SER A CA  
1541 C C   . SER A 251 ? 0.5360 0.4967 0.4810 -0.0128 -0.0767 -0.0943 401 SER A C   
1542 O O   . SER A 251 ? 0.5253 0.4938 0.4832 -0.0151 -0.0887 -0.0972 401 SER A O   
1543 C CB  . SER A 251 ? 0.5112 0.4585 0.4832 -0.0196 -0.0653 -0.0997 401 SER A CB  
1544 O OG  . SER A 251 ? 0.5630 0.5006 0.5080 -0.0150 -0.0666 -0.1085 401 SER A OG  
1545 N N   . GLU A 252 ? 0.5426 0.4971 0.4574 -0.0068 -0.0737 -0.0951 402 GLU A N   
1546 C CA  . GLU A 252 ? 0.6527 0.6067 0.5429 -0.0021 -0.0850 -0.1009 402 GLU A CA  
1547 C C   . GLU A 252 ? 0.6671 0.6153 0.5563 -0.0040 -0.0986 -0.1169 402 GLU A C   
1548 O O   . GLU A 252 ? 0.7506 0.7010 0.6263 -0.0013 -0.1123 -0.1223 402 GLU A O   
1549 C CB  . GLU A 252 ? 0.6819 0.6297 0.5399 0.0051  -0.0761 -0.0969 402 GLU A CB  
1550 C CG  . GLU A 252 ? 0.7047 0.6599 0.5638 0.0073  -0.0673 -0.0818 402 GLU A CG  
1551 C CD  . GLU A 252 ? 0.7260 0.6903 0.5822 0.0095  -0.0770 -0.0767 402 GLU A CD  
1552 O OE1 . GLU A 252 ? 0.8168 0.7799 0.6572 0.0123  -0.0894 -0.0834 402 GLU A OE1 
1553 O OE2 . GLU A 252 ? 0.7921 0.7643 0.6615 0.0088  -0.0726 -0.0662 402 GLU A OE2 
1554 N N   . ASN A 253 ? 0.6583 0.5991 0.5634 -0.0087 -0.0962 -0.1248 403 ASN A N   
1555 C CA  . ASN A 253 ? 0.6816 0.6172 0.5920 -0.0118 -0.1106 -0.1412 403 ASN A CA  
1556 C C   . ASN A 253 ? 0.6629 0.6104 0.6001 -0.0168 -0.1251 -0.1425 403 ASN A C   
1557 O O   . ASN A 253 ? 0.7149 0.6605 0.6567 -0.0190 -0.1407 -0.1561 403 ASN A O   
1558 C CB  . ASN A 253 ? 0.7554 0.6796 0.6807 -0.0160 -0.1044 -0.1493 403 ASN A CB  
1559 C CG  . ASN A 253 ? 0.7361 0.6655 0.7024 -0.0237 -0.0986 -0.1422 403 ASN A CG  
1560 O OD1 . ASN A 253 ? 0.7774 0.7192 0.7616 -0.0261 -0.0988 -0.1321 403 ASN A OD1 
1561 N ND2 . ASN A 253 ? 0.7164 0.6357 0.6970 -0.0270 -0.0925 -0.1472 403 ASN A ND2 
1562 N N   . GLY A 254 ? 0.5803 0.5398 0.5370 -0.0187 -0.1200 -0.1289 404 GLY A N   
1563 C CA  . GLY A 254 ? 0.5701 0.5424 0.5528 -0.0223 -0.1319 -0.1281 404 GLY A CA  
1564 C C   . GLY A 254 ? 0.5466 0.5209 0.5708 -0.0311 -0.1335 -0.1323 404 GLY A C   
1565 O O   . GLY A 254 ? 0.5196 0.5054 0.5716 -0.0347 -0.1405 -0.1301 404 GLY A O   
1566 N N   . TYR A 255 ? 0.5206 0.4836 0.5512 -0.0344 -0.1262 -0.1377 405 TYR A N   
1567 C CA  . TYR A 255 ? 0.5675 0.5311 0.6391 -0.0427 -0.1260 -0.1403 405 TYR A CA  
1568 C C   . TYR A 255 ? 0.5379 0.4973 0.6246 -0.0452 -0.1068 -0.1296 405 TYR A C   
1569 O O   . TYR A 255 ? 0.5705 0.5309 0.6923 -0.0518 -0.1040 -0.1284 405 TYR A O   
1570 C CB  . TYR A 255 ? 0.6408 0.5950 0.7182 -0.0462 -0.1401 -0.1596 405 TYR A CB  
1571 C CG  . TYR A 255 ? 0.7422 0.6794 0.7917 -0.0428 -0.1359 -0.1690 405 TYR A CG  
1572 C CD1 . TYR A 255 ? 0.8070 0.7335 0.8708 -0.0460 -0.1230 -0.1684 405 TYR A CD1 
1573 C CD2 . TYR A 255 ? 0.8254 0.7565 0.8347 -0.0359 -0.1448 -0.1789 405 TYR A CD2 
1574 C CE1 . TYR A 255 ? 0.8730 0.7838 0.9135 -0.0424 -0.1187 -0.1774 405 TYR A CE1 
1575 C CE2 . TYR A 255 ? 0.8659 0.7811 0.8502 -0.0322 -0.1396 -0.1880 405 TYR A CE2 
1576 C CZ  . TYR A 255 ? 0.9244 0.8297 0.9256 -0.0356 -0.1266 -0.1875 405 TYR A CZ  
1577 O OH  . TYR A 255 ? 1.0021 0.8919 0.9808 -0.0314 -0.1207 -0.1965 405 TYR A OH  
1578 N N   . TYR A 256 ? 0.5516 0.5063 0.6134 -0.0399 -0.0938 -0.1213 406 TYR A N   
1579 C CA  . TYR A 256 ? 0.5284 0.4801 0.6025 -0.0412 -0.0767 -0.1097 406 TYR A CA  
1580 C C   . TYR A 256 ? 0.4913 0.4544 0.5668 -0.0391 -0.0684 -0.0940 406 TYR A C   
1581 O O   . TYR A 256 ? 0.4853 0.4545 0.5404 -0.0343 -0.0711 -0.0907 406 TYR A O   
1582 C CB  . TYR A 256 ? 0.5430 0.4821 0.5940 -0.0369 -0.0669 -0.1101 406 TYR A CB  
1583 C CG  . TYR A 256 ? 0.5804 0.5049 0.6358 -0.0391 -0.0682 -0.1226 406 TYR A CG  
1584 C CD1 . TYR A 256 ? 0.6159 0.5377 0.6985 -0.0457 -0.0768 -0.1327 406 TYR A CD1 
1585 C CD2 . TYR A 256 ? 0.5891 0.5023 0.6236 -0.0343 -0.0598 -0.1241 406 TYR A CD2 
1586 C CE1 . TYR A 256 ? 0.6394 0.5467 0.7263 -0.0474 -0.0775 -0.1446 406 TYR A CE1 
1587 C CE2 . TYR A 256 ? 0.5828 0.4821 0.6215 -0.0356 -0.0598 -0.1355 406 TYR A CE2 
1588 C CZ  . TYR A 256 ? 0.6361 0.5318 0.6998 -0.0420 -0.0686 -0.1459 406 TYR A CZ  
1589 O OH  . TYR A 256 ? 0.6359 0.5163 0.7038 -0.0430 -0.0682 -0.1579 406 TYR A OH  
1590 N N   . LEU A 257 ? 0.4468 0.4113 0.5458 -0.0424 -0.0575 -0.0845 407 LEU A N   
1591 C CA  . LEU A 257 ? 0.3885 0.3604 0.4872 -0.0399 -0.0470 -0.0700 407 LEU A CA  
1592 C C   . LEU A 257 ? 0.4088 0.3724 0.5100 -0.0397 -0.0330 -0.0622 407 LEU A C   
1593 O O   . LEU A 257 ? 0.4058 0.3633 0.5279 -0.0440 -0.0300 -0.0635 407 LEU A O   
1594 C CB  . LEU A 257 ? 0.3781 0.3616 0.5053 -0.0436 -0.0482 -0.0656 407 LEU A CB  
1595 C CG  . LEU A 257 ? 0.3854 0.3750 0.5150 -0.0412 -0.0355 -0.0512 407 LEU A CG  
1596 C CD1 . LEU A 257 ? 0.3725 0.3680 0.4778 -0.0355 -0.0379 -0.0483 407 LEU A CD1 
1597 C CD2 . LEU A 257 ? 0.4072 0.4058 0.5708 -0.0456 -0.0337 -0.0472 407 LEU A CD2 
1598 N N   . ALA A 258 ? 0.3728 0.3357 0.4531 -0.0344 -0.0252 -0.0542 408 ALA A N   
1599 C CA  . ALA A 258 ? 0.3496 0.3061 0.4302 -0.0330 -0.0130 -0.0452 408 ALA A CA  
1600 C C   . ALA A 258 ? 0.3438 0.3080 0.4281 -0.0315 -0.0055 -0.0333 408 ALA A C   
1601 O O   . ALA A 258 ? 0.3337 0.3063 0.4080 -0.0289 -0.0083 -0.0316 408 ALA A O   
1602 C CB  . ALA A 258 ? 0.3569 0.3069 0.4129 -0.0280 -0.0107 -0.0458 408 ALA A CB  
1603 N N   . THR A 259 ? 0.3467 0.3078 0.4462 -0.0330 0.0039  -0.0252 409 THR A N   
1604 C CA  . THR A 259 ? 0.3438 0.3106 0.4446 -0.0307 0.0127  -0.0137 409 THR A CA  
1605 C C   . THR A 259 ? 0.3447 0.3033 0.4371 -0.0272 0.0233  -0.0040 409 THR A C   
1606 O O   . THR A 259 ? 0.3473 0.2963 0.4443 -0.0282 0.0257  -0.0043 409 THR A O   
1607 C CB  . THR A 259 ? 0.3391 0.3123 0.4687 -0.0353 0.0154  -0.0110 409 THR A CB  
1608 O OG1 . THR A 259 ? 0.3537 0.3194 0.5047 -0.0396 0.0201  -0.0099 409 THR A OG1 
1609 C CG2 . THR A 259 ? 0.3457 0.3279 0.4854 -0.0384 0.0031  -0.0204 409 THR A CG2 
1610 N N   . ALA A 260 ? 0.3382 0.3001 0.4169 -0.0226 0.0287  0.0039  410 ALA A N   
1611 C CA  . ALA A 260 ? 0.3497 0.3046 0.4184 -0.0183 0.0374  0.0136  410 ALA A CA  
1612 C C   . ALA A 260 ? 0.3706 0.3294 0.4390 -0.0158 0.0463  0.0233  410 ALA A C   
1613 O O   . ALA A 260 ? 0.3758 0.3436 0.4460 -0.0159 0.0451  0.0219  410 ALA A O   
1614 C CB  . ALA A 260 ? 0.3434 0.2962 0.3885 -0.0134 0.0335  0.0121  410 ALA A CB  
1615 N N   . ALA A 261 ? 0.3788 0.3305 0.4446 -0.0130 0.0557  0.0333  411 ALA A N   
1616 C CA  . ALA A 261 ? 0.4091 0.3620 0.4714 -0.0095 0.0663  0.0435  411 ALA A CA  
1617 C C   . ALA A 261 ? 0.4437 0.3877 0.4858 -0.0030 0.0714  0.0526  411 ALA A C   
1618 O O   . ALA A 261 ? 0.4181 0.3556 0.4545 -0.0021 0.0669  0.0511  411 ALA A O   
1619 C CB  . ALA A 261 ? 0.3880 0.3414 0.4785 -0.0141 0.0754  0.0486  411 ALA A CB  
1620 N N   . ASP A 262 ? 0.4453 0.3886 0.4776 0.0016  0.0813  0.0621  412 ASP A N   
1621 C CA  . ASP A 262 ? 0.5058 0.4403 0.5171 0.0088  0.0866  0.0722  412 ASP A CA  
1622 C C   . ASP A 262 ? 0.5094 0.4337 0.5320 0.0080  0.0927  0.0803  412 ASP A C   
1623 O O   . ASP A 262 ? 0.5781 0.4943 0.5836 0.0142  0.0950  0.0886  412 ASP A O   
1624 C CB  . ASP A 262 ? 0.5334 0.4686 0.5309 0.0144  0.0973  0.0804  412 ASP A CB  
1625 C CG  . ASP A 262 ? 0.6235 0.5654 0.6027 0.0178  0.0913  0.0736  412 ASP A CG  
1626 O OD1 . ASP A 262 ? 0.6762 0.6229 0.6552 0.0154  0.0796  0.0635  412 ASP A OD1 
1627 O OD2 . ASP A 262 ? 0.8097 0.7514 0.7743 0.0232  0.0993  0.0786  412 ASP A OD2 
1628 N N   . ASP A 263 ? 0.4745 0.3987 0.5260 0.0006  0.0944  0.0777  413 ASP A N   
1629 C CA  . ASP A 263 ? 0.4511 0.3646 0.5168 -0.0008 0.0991  0.0838  413 ASP A CA  
1630 C C   . ASP A 263 ? 0.4126 0.3205 0.4733 -0.0003 0.0890  0.0775  413 ASP A C   
1631 O O   . ASP A 263 ? 0.3698 0.2684 0.4443 -0.0019 0.0917  0.0807  413 ASP A O   
1632 C CB  . ASP A 263 ? 0.4912 0.4058 0.5926 -0.0092 0.1038  0.0822  413 ASP A CB  
1633 C CG  . ASP A 263 ? 0.4847 0.4076 0.6003 -0.0160 0.0915  0.0662  413 ASP A CG  
1634 O OD1 . ASP A 263 ? 0.4412 0.3654 0.5416 -0.0149 0.0799  0.0566  413 ASP A OD1 
1635 O OD2 . ASP A 263 ? 0.4700 0.3978 0.6131 -0.0224 0.0937  0.0638  413 ASP A OD2 
1636 N N   . SER A 264 ? 0.3941 0.3075 0.4373 0.0017  0.0783  0.0688  414 SER A N   
1637 C CA  . SER A 264 ? 0.4156 0.3250 0.4524 0.0033  0.0698  0.0633  414 SER A CA  
1638 C C   . SER A 264 ? 0.4225 0.3291 0.4810 -0.0033 0.0658  0.0533  414 SER A C   
1639 O O   . SER A 264 ? 0.4365 0.3361 0.4966 -0.0021 0.0631  0.0513  414 SER A O   
1640 C CB  . SER A 264 ? 0.4343 0.3342 0.4587 0.0104  0.0731  0.0746  414 SER A CB  
1641 O OG  . SER A 264 ? 0.4408 0.3432 0.4406 0.0173  0.0746  0.0818  414 SER A OG  
1642 N N   . SER A 265 ? 0.4070 0.3195 0.4821 -0.0098 0.0650  0.0466  415 SER A N   
1643 C CA  . SER A 265 ? 0.4058 0.3161 0.5000 -0.0161 0.0597  0.0355  415 SER A CA  
1644 C C   . SER A 265 ? 0.3744 0.2947 0.4639 -0.0188 0.0497  0.0228  415 SER A C   
1645 O O   . SER A 265 ? 0.3549 0.2844 0.4362 -0.0178 0.0487  0.0234  415 SER A O   
1646 C CB  . SER A 265 ? 0.4182 0.3247 0.5414 -0.0220 0.0663  0.0384  415 SER A CB  
1647 O OG  . SER A 265 ? 0.3967 0.3134 0.5309 -0.0258 0.0673  0.0375  415 SER A OG  
1648 N N   . VAL A 266 ? 0.3665 0.2835 0.4605 -0.0215 0.0427  0.0114  416 VAL A N   
1649 C CA  . VAL A 266 ? 0.3501 0.2742 0.4427 -0.0245 0.0334  -0.0005 416 VAL A CA  
1650 C C   . VAL A 266 ? 0.3662 0.2872 0.4833 -0.0313 0.0306  -0.0081 416 VAL A C   
1651 O O   . VAL A 266 ? 0.3951 0.3057 0.5213 -0.0327 0.0312  -0.0117 416 VAL A O   
1652 C CB  . VAL A 266 ? 0.3728 0.2949 0.4469 -0.0213 0.0273  -0.0085 416 VAL A CB  
1653 C CG1 . VAL A 266 ? 0.3564 0.2849 0.4265 -0.0238 0.0178  -0.0202 416 VAL A CG1 
1654 C CG2 . VAL A 266 ? 0.3863 0.3112 0.4402 -0.0150 0.0293  -0.0013 416 VAL A CG2 
1655 N N   . LYS A 267 ? 0.3612 0.2911 0.4908 -0.0354 0.0269  -0.0112 417 LYS A N   
1656 C CA  . LYS A 267 ? 0.3795 0.3081 0.5354 -0.0423 0.0222  -0.0196 417 LYS A CA  
1657 C C   . LYS A 267 ? 0.3663 0.3000 0.5155 -0.0439 0.0085  -0.0341 417 LYS A C   
1658 O O   . LYS A 267 ? 0.3423 0.2856 0.4758 -0.0412 0.0042  -0.0343 417 LYS A O   
1659 C CB  . LYS A 267 ? 0.3675 0.3028 0.5481 -0.0461 0.0279  -0.0122 417 LYS A CB  
1660 C CG  . LYS A 267 ? 0.3939 0.3218 0.5859 -0.0454 0.0422  0.0016  417 LYS A CG  
1661 C CD  . LYS A 267 ? 0.4276 0.3622 0.6470 -0.0494 0.0494  0.0087  417 LYS A CD  
1662 C CE  . LYS A 267 ? 0.4765 0.4019 0.7096 -0.0491 0.0648  0.0230  417 LYS A CE  
1663 N NZ  . LYS A 267 ? 0.4943 0.4077 0.7505 -0.0541 0.0645  0.0189  417 LYS A NZ  
1664 N N   . LEU A 268 ? 0.3866 0.3129 0.5471 -0.0479 0.0018  -0.0460 418 LEU A N   
1665 C CA  . LEU A 268 ? 0.4194 0.3480 0.5721 -0.0490 -0.0119 -0.0609 418 LEU A CA  
1666 C C   . LEU A 268 ? 0.4085 0.3418 0.5912 -0.0562 -0.0203 -0.0683 418 LEU A C   
1667 O O   . LEU A 268 ? 0.3949 0.3223 0.6062 -0.0615 -0.0173 -0.0688 418 LEU A O   
1668 C CB  . LEU A 268 ? 0.4828 0.3988 0.6208 -0.0469 -0.0143 -0.0709 418 LEU A CB  
1669 C CG  . LEU A 268 ? 0.5230 0.4393 0.6308 -0.0395 -0.0090 -0.0646 418 LEU A CG  
1670 C CD1 . LEU A 268 ? 0.5936 0.4972 0.6968 -0.0366 -0.0023 -0.0642 418 LEU A CD1 
1671 C CD2 . LEU A 268 ? 0.5655 0.4878 0.6489 -0.0364 -0.0183 -0.0724 418 LEU A CD2 
1672 N N   . TRP A 269 ? 0.3976 0.3421 0.5751 -0.0561 -0.0310 -0.0735 419 TRP A N   
1673 C CA  . TRP A 269 ? 0.4227 0.3749 0.6283 -0.0620 -0.0406 -0.0797 419 TRP A CA  
1674 C C   . TRP A 269 ? 0.4629 0.4145 0.6548 -0.0618 -0.0585 -0.0968 419 TRP A C   
1675 O O   . TRP A 269 ? 0.4435 0.3964 0.6024 -0.0560 -0.0629 -0.0991 419 TRP A O   
1676 C CB  . TRP A 269 ? 0.4074 0.3746 0.6206 -0.0612 -0.0381 -0.0697 419 TRP A CB  
1677 C CG  . TRP A 269 ? 0.4135 0.3811 0.6328 -0.0597 -0.0201 -0.0528 419 TRP A CG  
1678 C CD1 . TRP A 269 ? 0.4102 0.3764 0.6025 -0.0534 -0.0107 -0.0430 419 TRP A CD1 
1679 C CD2 . TRP A 269 ? 0.4058 0.3747 0.6594 -0.0643 -0.0098 -0.0441 419 TRP A CD2 
1680 N NE1 . TRP A 269 ? 0.4184 0.3842 0.6226 -0.0531 0.0038  -0.0294 419 TRP A NE1 
1681 C CE2 . TRP A 269 ? 0.4043 0.3718 0.6454 -0.0595 0.0058  -0.0290 419 TRP A CE2 
1682 C CE3 . TRP A 269 ? 0.4297 0.4008 0.7242 -0.0718 -0.0121 -0.0475 419 TRP A CE3 
1683 C CZ2 . TRP A 269 ? 0.4105 0.3780 0.6750 -0.0613 0.0203  -0.0164 419 TRP A CZ2 
1684 C CZ3 . TRP A 269 ? 0.4336 0.4053 0.7560 -0.0743 0.0032  -0.0344 419 TRP A CZ3 
1685 C CH2 . TRP A 269 ? 0.4397 0.4093 0.7450 -0.0687 0.0198  -0.0187 419 TRP A CH2 
1686 N N   . ASP A 270 ? 0.4541 0.4030 0.6715 -0.0680 -0.0684 -0.1085 420 ASP A N   
1687 C CA  . ASP A 270 ? 0.4900 0.4402 0.6998 -0.0684 -0.0877 -0.1251 420 ASP A CA  
1688 C C   . ASP A 270 ? 0.4506 0.4172 0.6841 -0.0715 -0.0972 -0.1239 420 ASP A C   
1689 O O   . ASP A 270 ? 0.4535 0.4249 0.7279 -0.0781 -0.0961 -0.1219 420 ASP A O   
1690 C CB  . ASP A 270 ? 0.5142 0.4511 0.7387 -0.0734 -0.0947 -0.1406 420 ASP A CB  
1691 C CG  . ASP A 270 ? 0.5800 0.5154 0.7885 -0.0724 -0.1156 -0.1599 420 ASP A CG  
1692 O OD1 . ASP A 270 ? 0.5756 0.5237 0.7815 -0.0714 -0.1278 -0.1613 420 ASP A OD1 
1693 O OD2 . ASP A 270 ? 0.6407 0.5615 0.8395 -0.0724 -0.1200 -0.1740 420 ASP A OD2 
1694 N N   . LEU A 271 ? 0.4547 0.4299 0.6640 -0.0663 -0.1060 -0.1244 421 LEU A N   
1695 C CA  . LEU A 271 ? 0.4594 0.4510 0.6889 -0.0676 -0.1148 -0.1219 421 LEU A CA  
1696 C C   . LEU A 271 ? 0.5106 0.5055 0.7651 -0.0730 -0.1351 -0.1374 421 LEU A C   
1697 O O   . LEU A 271 ? 0.5089 0.5177 0.7913 -0.0756 -0.1427 -0.1359 421 LEU A O   
1698 C CB  . LEU A 271 ? 0.4555 0.4541 0.6514 -0.0598 -0.1178 -0.1169 421 LEU A CB  
1699 C CG  . LEU A 271 ? 0.4267 0.4236 0.6017 -0.0548 -0.0991 -0.1019 421 LEU A CG  
1700 C CD1 . LEU A 271 ? 0.4280 0.4278 0.5659 -0.0471 -0.1027 -0.0996 421 LEU A CD1 
1701 C CD2 . LEU A 271 ? 0.4369 0.4430 0.6410 -0.0573 -0.0862 -0.0881 421 LEU A CD2 
1702 N N   . ARG A 272 ? 0.5598 0.5419 0.8052 -0.0744 -0.1444 -0.1529 422 ARG A N   
1703 C CA  . ARG A 272 ? 0.6123 0.5961 0.8811 -0.0796 -0.1655 -0.1699 422 ARG A CA  
1704 C C   . ARG A 272 ? 0.6020 0.5862 0.9255 -0.0895 -0.1606 -0.1694 422 ARG A C   
1705 O O   . ARG A 272 ? 0.6076 0.6008 0.9681 -0.0954 -0.1748 -0.1769 422 ARG A O   
1706 C CB  . ARG A 272 ? 0.6619 0.6301 0.8979 -0.0769 -0.1773 -0.1882 422 ARG A CB  
1707 C CG  . ARG A 272 ? 0.6947 0.6614 0.8760 -0.0667 -0.1808 -0.1883 422 ARG A CG  
1708 C CD  . ARG A 272 ? 0.7759 0.7246 0.9215 -0.0629 -0.1842 -0.2030 422 ARG A CD  
1709 N NE  . ARG A 272 ? 0.8076 0.7429 0.9540 -0.0640 -0.1652 -0.1991 422 ARG A NE  
1710 C CZ  . ARG A 272 ? 0.8686 0.7873 0.9877 -0.0605 -0.1629 -0.2094 422 ARG A CZ  
1711 N NH1 . ARG A 272 ? 0.9145 0.8271 1.0003 -0.0554 -0.1776 -0.2247 422 ARG A NH1 
1712 N NH2 . ARG A 272 ? 0.8701 0.7781 0.9947 -0.0614 -0.1456 -0.2042 422 ARG A NH2 
1713 N N   . LYS A 273 ? 0.5534 0.5275 0.8827 -0.0912 -0.1409 -0.1605 423 LYS A N   
1714 C CA  . LYS A 273 ? 0.5811 0.5532 0.9597 -0.0998 -0.1326 -0.1574 423 LYS A CA  
1715 C C   . LYS A 273 ? 0.5723 0.5550 0.9727 -0.1004 -0.1135 -0.1363 423 LYS A C   
1716 O O   . LYS A 273 ? 0.5460 0.5308 0.9920 -0.1074 -0.1062 -0.1313 423 LYS A O   
1717 C CB  . LYS A 273 ? 0.6146 0.5673 0.9869 -0.1008 -0.1223 -0.1602 423 LYS A CB  
1718 C CG  . LYS A 273 ? 0.6888 0.6280 1.0412 -0.1002 -0.1381 -0.1817 423 LYS A CG  
1719 C CD  . LYS A 273 ? 0.7104 0.6315 1.0422 -0.0972 -0.1234 -0.1797 423 LYS A CD  
1720 C CE  . LYS A 273 ? 0.7513 0.6559 1.0776 -0.0987 -0.1353 -0.2013 423 LYS A CE  
1721 N NZ  . LYS A 273 ? 0.7482 0.6363 1.0497 -0.0938 -0.1201 -0.1981 423 LYS A NZ  
1722 N N   . LEU A 274 ? 0.5574 0.5457 0.9252 -0.0928 -0.1047 -0.1241 424 LEU A N   
1723 C CA  . LEU A 274 ? 0.5485 0.5440 0.9275 -0.0916 -0.0849 -0.1043 424 LEU A CA  
1724 C C   . LEU A 274 ? 0.5475 0.5303 0.9393 -0.0943 -0.0660 -0.0954 424 LEU A C   
1725 O O   . LEU A 274 ? 0.5704 0.5571 0.9976 -0.0984 -0.0536 -0.0846 424 LEU A O   
1726 C CB  . LEU A 274 ? 0.5631 0.5757 0.9847 -0.0959 -0.0880 -0.1006 424 LEU A CB  
1727 C CG  . LEU A 274 ? 0.5648 0.5915 0.9819 -0.0936 -0.1079 -0.1085 424 LEU A CG  
1728 C CD1 . LEU A 274 ? 0.5718 0.6155 1.0338 -0.0970 -0.1053 -0.1006 424 LEU A CD1 
1729 C CD2 . LEU A 274 ? 0.5750 0.6029 0.9419 -0.0841 -0.1081 -0.1044 424 LEU A CD2 
1730 N N   . LYS A 275 ? 0.5418 0.5092 0.9057 -0.0915 -0.0637 -0.0996 425 LYS A N   
1731 C CA  . LYS A 275 ? 0.5277 0.4821 0.9014 -0.0930 -0.0469 -0.0909 425 LYS A CA  
1732 C C   . LYS A 275 ? 0.5214 0.4668 0.8520 -0.0850 -0.0367 -0.0838 425 LYS A C   
1733 O O   . LYS A 275 ? 0.4750 0.4189 0.7691 -0.0797 -0.0449 -0.0913 425 LYS A O   
1734 C CB  . LYS A 275 ? 0.5961 0.5381 0.9970 -0.1001 -0.0539 -0.1045 425 LYS A CB  
1735 C CG  . LYS A 275 ? 0.6506 0.5787 1.0199 -0.0970 -0.0635 -0.1198 425 LYS A CG  
1736 N N   . ASN A 276 ? 0.4993 0.4390 0.8356 -0.0840 -0.0186 -0.0685 426 ASN A N   
1737 C CA  . ASN A 276 ? 0.4857 0.4168 0.7881 -0.0769 -0.0086 -0.0606 426 ASN A CA  
1738 C C   . ASN A 276 ? 0.4843 0.3983 0.7891 -0.0784 -0.0092 -0.0688 426 ASN A C   
1739 O O   . ASN A 276 ? 0.5193 0.4249 0.8515 -0.0823 0.0000  -0.0632 426 ASN A O   
1740 C CB  . ASN A 276 ? 0.4549 0.3875 0.7623 -0.0745 0.0100  -0.0404 426 ASN A CB  
1741 C CG  . ASN A 276 ? 0.4710 0.3931 0.7502 -0.0679 0.0201  -0.0316 426 ASN A CG  
1742 O OD1 . ASN A 276 ? 0.4801 0.3965 0.7679 -0.0669 0.0344  -0.0177 426 ASN A OD1 
1743 N ND2 . ASN A 276 ? 0.4427 0.3621 0.6886 -0.0629 0.0129  -0.0392 426 ASN A ND2 
1744 N N   . PHE A 277 ? 0.4677 0.3760 0.7439 -0.0748 -0.0186 -0.0812 427 PHE A N   
1745 C CA  . PHE A 277 ? 0.5076 0.3995 0.7876 -0.0764 -0.0212 -0.0928 427 PHE A CA  
1746 C C   . PHE A 277 ? 0.5096 0.3899 0.7691 -0.0702 -0.0094 -0.0849 427 PHE A C   
1747 O O   . PHE A 277 ? 0.4848 0.3508 0.7530 -0.0711 -0.0075 -0.0903 427 PHE A O   
1748 C CB  . PHE A 277 ? 0.4950 0.3857 0.7596 -0.0765 -0.0390 -0.1137 427 PHE A CB  
1749 C CG  . PHE A 277 ? 0.4771 0.3718 0.6980 -0.0686 -0.0422 -0.1151 427 PHE A CG  
1750 C CD1 . PHE A 277 ? 0.4881 0.3718 0.6827 -0.0626 -0.0371 -0.1170 427 PHE A CD1 
1751 C CD2 . PHE A 277 ? 0.4661 0.3756 0.6744 -0.0669 -0.0498 -0.1141 427 PHE A CD2 
1752 C CE1 . PHE A 277 ? 0.4757 0.3630 0.6329 -0.0556 -0.0388 -0.1177 427 PHE A CE1 
1753 C CE2 . PHE A 277 ? 0.4621 0.3744 0.6320 -0.0598 -0.0519 -0.1147 427 PHE A CE2 
1754 C CZ  . PHE A 277 ? 0.4767 0.3780 0.6212 -0.0543 -0.0460 -0.1162 427 PHE A CZ  
1755 N N   . LYS A 278 ? 0.4590 0.3458 0.6934 -0.0637 -0.0021 -0.0722 428 LYS A N   
1756 C CA  . LYS A 278 ? 0.4845 0.3627 0.7002 -0.0574 0.0075  -0.0640 428 LYS A CA  
1757 C C   . LYS A 278 ? 0.4407 0.3278 0.6438 -0.0528 0.0170  -0.0463 428 LYS A C   
1758 O O   . LYS A 278 ? 0.4382 0.3380 0.6320 -0.0522 0.0133  -0.0450 428 LYS A O   
1759 C CB  . LYS A 278 ? 0.5367 0.4123 0.7208 -0.0522 0.0003  -0.0758 428 LYS A CB  
1760 C CG  . LYS A 278 ? 0.6004 0.4691 0.7654 -0.0452 0.0089  -0.0686 428 LYS A CG  
1761 C CD  . LYS A 278 ? 0.6467 0.4991 0.8278 -0.0458 0.0140  -0.0709 428 LYS A CD  
1762 C CE  . LYS A 278 ? 0.6750 0.5224 0.8406 -0.0382 0.0229  -0.0608 428 LYS A CE  
1763 N NZ  . LYS A 278 ? 0.6815 0.5137 0.8671 -0.0384 0.0303  -0.0575 428 LYS A NZ  
1764 N N   . THR A 279 ? 0.4256 0.3053 0.6278 -0.0491 0.0285  -0.0333 429 THR A N   
1765 C CA  . THR A 279 ? 0.4156 0.3015 0.6016 -0.0437 0.0367  -0.0176 429 THR A CA  
1766 C C   . THR A 279 ? 0.4230 0.3009 0.5896 -0.0367 0.0407  -0.0128 429 THR A C   
1767 O O   . THR A 279 ? 0.4426 0.3079 0.6210 -0.0366 0.0451  -0.0114 429 THR A O   
1768 C CB  . THR A 279 ? 0.4027 0.2880 0.6110 -0.0459 0.0482  -0.0028 429 THR A CB  
1769 O OG1 . THR A 279 ? 0.4010 0.2954 0.6314 -0.0524 0.0448  -0.0070 429 THR A OG1 
1770 C CG2 . THR A 279 ? 0.4040 0.2937 0.5907 -0.0388 0.0570  0.0134  429 THR A CG2 
1771 N N   . LEU A 280 ? 0.4086 0.2936 0.5482 -0.0310 0.0388  -0.0106 430 LEU A N   
1772 C CA  . LEU A 280 ? 0.4446 0.3242 0.5679 -0.0240 0.0422  -0.0048 430 LEU A CA  
1773 C C   . LEU A 280 ? 0.4284 0.3103 0.5469 -0.0202 0.0503  0.0121  430 LEU A C   
1774 O O   . LEU A 280 ? 0.4547 0.3470 0.5616 -0.0190 0.0497  0.0158  430 LEU A O   
1775 C CB  . LEU A 280 ? 0.4422 0.3280 0.5413 -0.0200 0.0358  -0.0119 430 LEU A CB  
1776 C CG  . LEU A 280 ? 0.5140 0.4011 0.6103 -0.0232 0.0271  -0.0285 430 LEU A CG  
1777 C CD1 . LEU A 280 ? 0.5316 0.4256 0.6032 -0.0187 0.0231  -0.0320 430 LEU A CD1 
1778 C CD2 . LEU A 280 ? 0.5635 0.4373 0.6711 -0.0246 0.0269  -0.0380 430 LEU A CD2 
1779 N N   . GLN A 281 ? 0.4318 0.3035 0.5588 -0.0179 0.0577  0.0222  431 GLN A N   
1780 C CA  . GLN A 281 ? 0.4717 0.3438 0.5919 -0.0135 0.0659  0.0392  431 GLN A CA  
1781 C C   . GLN A 281 ? 0.4608 0.3312 0.5601 -0.0052 0.0645  0.0447  431 GLN A C   
1782 O O   . GLN A 281 ? 0.4475 0.3083 0.5518 -0.0026 0.0654  0.0458  431 GLN A O   
1783 C CB  . GLN A 281 ? 0.4814 0.3429 0.6241 -0.0154 0.0760  0.0498  431 GLN A CB  
1784 C CG  . GLN A 281 ? 0.4933 0.3540 0.6261 -0.0099 0.0857  0.0683  431 GLN A CG  
1785 C CD  . GLN A 281 ? 0.4866 0.3592 0.6127 -0.0111 0.0879  0.0706  431 GLN A CD  
1786 O OE1 . GLN A 281 ? 0.5166 0.3918 0.6637 -0.0173 0.0919  0.0698  431 GLN A OE1 
1787 N NE2 . GLN A 281 ? 0.4438 0.3234 0.5428 -0.0052 0.0851  0.0731  431 GLN A NE2 
1788 N N   . LEU A 282 ? 0.4926 0.3723 0.5707 -0.0013 0.0619  0.0477  432 LEU A N   
1789 C CA  . LEU A 282 ? 0.5087 0.3878 0.5682 0.0067  0.0598  0.0542  432 LEU A CA  
1790 C C   . LEU A 282 ? 0.5081 0.3827 0.5608 0.0118  0.0671  0.0707  432 LEU A C   
1791 O O   . LEU A 282 ? 0.4986 0.3717 0.5599 0.0090  0.0751  0.0773  432 LEU A O   
1792 C CB  . LEU A 282 ? 0.4806 0.3712 0.5218 0.0083  0.0524  0.0475  432 LEU A CB  
1793 C CG  . LEU A 282 ? 0.4809 0.3750 0.5265 0.0040  0.0464  0.0325  432 LEU A CG  
1794 C CD1 . LEU A 282 ? 0.5127 0.4176 0.5423 0.0052  0.0404  0.0274  432 LEU A CD1 
1795 C CD2 . LEU A 282 ? 0.5346 0.4208 0.5862 0.0061  0.0454  0.0286  432 LEU A CD2 
1796 N N   . ASP A 283 ? 0.4883 0.3604 0.5263 0.0196  0.0647  0.0779  433 ASP A N   
1797 C CA  . ASP A 283 ? 0.5010 0.3683 0.5266 0.0260  0.0701  0.0937  433 ASP A CA  
1798 C C   . ASP A 283 ? 0.4779 0.3529 0.4873 0.0267  0.0725  0.0964  433 ASP A C   
1799 O O   . ASP A 283 ? 0.4800 0.3651 0.4840 0.0239  0.0672  0.0865  433 ASP A O   
1800 C CB  . ASP A 283 ? 0.5224 0.3864 0.5354 0.0347  0.0642  0.0995  433 ASP A CB  
1801 C CG  . ASP A 283 ? 0.5571 0.4314 0.5529 0.0376  0.0539  0.0923  433 ASP A CG  
1802 O OD1 . ASP A 283 ? 0.5538 0.4329 0.5306 0.0405  0.0532  0.0959  433 ASP A OD1 
1803 O OD2 . ASP A 283 ? 0.5336 0.4111 0.5359 0.0369  0.0471  0.0828  433 ASP A OD2 
1804 N N   . ASN A 284 ? 0.4692 0.3386 0.4710 0.0308  0.0815  0.1105  434 ASN A N   
1805 C CA  . ASN A 284 ? 0.4702 0.3451 0.4610 0.0309  0.0877  0.1139  434 ASN A CA  
1806 C C   . ASN A 284 ? 0.4777 0.3594 0.4402 0.0368  0.0801  0.1112  434 ASN A C   
1807 O O   . ASN A 284 ? 0.5082 0.3966 0.4615 0.0363  0.0825  0.1090  434 ASN A O   
1808 C CB  . ASN A 284 ? 0.5048 0.3703 0.4964 0.0338  0.1020  0.1306  434 ASN A CB  
1809 C CG  . ASN A 284 ? 0.5428 0.4023 0.5040 0.0451  0.1026  0.1436  434 ASN A CG  
1810 O OD1 . ASN A 284 ? 0.4752 0.3381 0.4121 0.0501  0.1050  0.1467  434 ASN A OD1 
1811 N ND2 . ASN A 284 ? 0.5276 0.3775 0.4894 0.0498  0.1009  0.1515  434 ASN A ND2 
1812 N N   . ASN A 285 ? 0.4874 0.3678 0.4385 0.0422  0.0702  0.1104  435 ASN A N   
1813 C CA  . ASN A 285 ? 0.5001 0.3880 0.4293 0.0465  0.0597  0.1043  435 ASN A CA  
1814 C C   . ASN A 285 ? 0.4416 0.3400 0.3785 0.0405  0.0521  0.0891  435 ASN A C   
1815 O O   . ASN A 285 ? 0.4472 0.3523 0.3697 0.0424  0.0459  0.0836  435 ASN A O   
1816 C CB  . ASN A 285 ? 0.4908 0.3746 0.4102 0.0540  0.0507  0.1084  435 ASN A CB  
1817 C CG  . ASN A 285 ? 0.5562 0.4288 0.4672 0.0607  0.0573  0.1244  435 ASN A CG  
1818 O OD1 . ASN A 285 ? 0.5756 0.4405 0.5025 0.0605  0.0606  0.1302  435 ASN A OD1 
1819 N ND2 . ASN A 285 ? 0.5367 0.4073 0.4225 0.0670  0.0606  0.1320  435 ASN A ND2 
1820 N N   . PHE A 286 ? 0.4499 0.3490 0.4087 0.0336  0.0526  0.0821  436 PHE A N   
1821 C CA  . PHE A 286 ? 0.4193 0.3271 0.3839 0.0289  0.0454  0.0686  436 PHE A CA  
1822 C C   . PHE A 286 ? 0.4471 0.3626 0.4108 0.0247  0.0475  0.0636  436 PHE A C   
1823 O O   . PHE A 286 ? 0.4599 0.3743 0.4332 0.0213  0.0554  0.0666  436 PHE A O   
1824 C CB  . PHE A 286 ? 0.4032 0.3078 0.3889 0.0237  0.0456  0.0624  436 PHE A CB  
1825 C CG  . PHE A 286 ? 0.3673 0.2779 0.3550 0.0216  0.0380  0.0507  436 PHE A CG  
1826 C CD1 . PHE A 286 ? 0.3540 0.2727 0.3416 0.0169  0.0359  0.0418  436 PHE A CD1 
1827 C CD2 . PHE A 286 ? 0.3758 0.2839 0.3663 0.0247  0.0338  0.0491  436 PHE A CD2 
1828 C CE1 . PHE A 286 ? 0.3688 0.2923 0.3567 0.0157  0.0302  0.0323  436 PHE A CE1 
1829 C CE2 . PHE A 286 ? 0.3571 0.2705 0.3499 0.0231  0.0289  0.0390  436 PHE A CE2 
1830 C CZ  . PHE A 286 ? 0.3509 0.2715 0.3414 0.0187  0.0275  0.0311  436 PHE A CZ  
1831 N N   . GLU A 287 ? 0.4164 0.3395 0.3703 0.0253  0.0406  0.0564  437 GLU A N   
1832 C CA  . GLU A 287 ? 0.4239 0.3547 0.3778 0.0218  0.0411  0.0508  437 GLU A CA  
1833 C C   . GLU A 287 ? 0.3931 0.3291 0.3585 0.0163  0.0359  0.0401  437 GLU A C   
1834 O O   . GLU A 287 ? 0.3623 0.3001 0.3247 0.0174  0.0294  0.0351  437 GLU A O   
1835 C CB  . GLU A 287 ? 0.4559 0.3903 0.3902 0.0268  0.0373  0.0504  437 GLU A CB  
1836 C CG  . GLU A 287 ? 0.5425 0.4709 0.4601 0.0335  0.0416  0.0604  437 GLU A CG  
1837 C CD  . GLU A 287 ? 0.6216 0.5524 0.5188 0.0389  0.0352  0.0577  437 GLU A CD  
1838 O OE1 . GLU A 287 ? 0.6426 0.5789 0.5381 0.0373  0.0352  0.0521  437 GLU A OE1 
1839 O OE2 . GLU A 287 ? 0.7524 0.6794 0.6370 0.0447  0.0291  0.0605  437 GLU A OE2 
1840 N N   . VAL A 288 ? 0.4101 0.3484 0.3893 0.0107  0.0390  0.0369  438 VAL A N   
1841 C CA  . VAL A 288 ? 0.3930 0.3361 0.3796 0.0061  0.0336  0.0267  438 VAL A CA  
1842 C C   . VAL A 288 ? 0.4697 0.4213 0.4513 0.0057  0.0318  0.0238  438 VAL A C   
1843 O O   . VAL A 288 ? 0.4819 0.4364 0.4692 0.0042  0.0363  0.0263  438 VAL A O   
1844 C CB  . VAL A 288 ? 0.4088 0.3494 0.4138 0.0004  0.0354  0.0233  438 VAL A CB  
1845 C CG1 . VAL A 288 ? 0.4260 0.3709 0.4336 -0.0030 0.0286  0.0123  438 VAL A CG1 
1846 C CG2 . VAL A 288 ? 0.4317 0.3626 0.4436 0.0010  0.0385  0.0267  438 VAL A CG2 
1847 N N   . LYS A 289 ? 0.4354 0.3907 0.4078 0.0074  0.0261  0.0194  439 LYS A N   
1848 C CA  . LYS A 289 ? 0.5369 0.4990 0.5035 0.0080  0.0243  0.0174  439 LYS A CA  
1849 C C   . LYS A 289 ? 0.5051 0.4725 0.4770 0.0046  0.0198  0.0103  439 LYS A C   
1850 O O   . LYS A 289 ? 0.4453 0.4185 0.4178 0.0041  0.0191  0.0091  439 LYS A O   
1851 C CB  . LYS A 289 ? 0.5354 0.4978 0.4883 0.0127  0.0209  0.0179  439 LYS A CB  
1852 C CG  . LYS A 289 ? 0.5960 0.5545 0.5380 0.0175  0.0241  0.0244  439 LYS A CG  
1853 N N   . SER A 290 ? 0.4339 0.3987 0.4088 0.0028  0.0170  0.0059  440 SER A N   
1854 C CA  . SER A 290 ? 0.4138 0.3822 0.3884 0.0009  0.0124  -0.0004 440 SER A CA  
1855 C C   . SER A 290 ? 0.4158 0.3797 0.3966 -0.0018 0.0114  -0.0054 440 SER A C   
1856 O O   . SER A 290 ? 0.4630 0.4205 0.4451 -0.0009 0.0137  -0.0044 440 SER A O   
1857 C CB  . SER A 290 ? 0.4477 0.4170 0.4128 0.0040  0.0102  -0.0012 440 SER A CB  
1858 O OG  . SER A 290 ? 0.5031 0.4747 0.4654 0.0032  0.0071  -0.0057 440 SER A OG  
1859 N N   . LEU A 291 ? 0.3426 0.3091 0.3277 -0.0048 0.0076  -0.0107 441 LEU A N   
1860 C CA  . LEU A 291 ? 0.3234 0.2853 0.3120 -0.0072 0.0050  -0.0177 441 LEU A CA  
1861 C C   . LEU A 291 ? 0.3488 0.3138 0.3276 -0.0067 -0.0007 -0.0236 441 LEU A C   
1862 O O   . LEU A 291 ? 0.3014 0.2734 0.2791 -0.0066 -0.0039 -0.0224 441 LEU A O   
1863 C CB  . LEU A 291 ? 0.3617 0.3232 0.3668 -0.0118 0.0042  -0.0195 441 LEU A CB  
1864 C CG  . LEU A 291 ? 0.3754 0.3321 0.3938 -0.0134 0.0103  -0.0144 441 LEU A CG  
1865 C CD1 . LEU A 291 ? 0.3814 0.3398 0.4195 -0.0186 0.0087  -0.0170 441 LEU A CD1 
1866 C CD2 . LEU A 291 ? 0.4061 0.3532 0.4234 -0.0123 0.0126  -0.0158 441 LEU A CD2 
1867 N N   . ILE A 292 ? 0.3352 0.2948 0.3067 -0.0059 -0.0017 -0.0294 442 ILE A N   
1868 C CA  . ILE A 292 ? 0.3630 0.3237 0.3224 -0.0048 -0.0068 -0.0351 442 ILE A CA  
1869 C C   . ILE A 292 ? 0.3751 0.3273 0.3284 -0.0045 -0.0077 -0.0438 442 ILE A C   
1870 O O   . ILE A 292 ? 0.4013 0.3473 0.3545 -0.0030 -0.0022 -0.0439 442 ILE A O   
1871 C CB  . ILE A 292 ? 0.3793 0.3430 0.3264 -0.0008 -0.0045 -0.0306 442 ILE A CB  
1872 C CG1 . ILE A 292 ? 0.3994 0.3648 0.3332 0.0009  -0.0092 -0.0338 442 ILE A CG1 
1873 C CG2 . ILE A 292 ? 0.4080 0.3668 0.3518 0.0018  0.0017  -0.0289 442 ILE A CG2 
1874 C CD1 . ILE A 292 ? 0.4162 0.3850 0.3415 0.0043  -0.0065 -0.0278 442 ILE A CD1 
1875 N N   . PHE A 293 ? 0.3929 0.3450 0.3409 -0.0055 -0.0150 -0.0514 443 PHE A N   
1876 C CA  . PHE A 293 ? 0.3898 0.3333 0.3267 -0.0042 -0.0166 -0.0612 443 PHE A CA  
1877 C C   . PHE A 293 ? 0.3982 0.3411 0.3132 0.0011  -0.0137 -0.0601 443 PHE A C   
1878 O O   . PHE A 293 ? 0.4636 0.4134 0.3731 0.0027  -0.0149 -0.0541 443 PHE A O   
1879 C CB  . PHE A 293 ? 0.4149 0.3582 0.3535 -0.0071 -0.0275 -0.0708 443 PHE A CB  
1880 C CG  . PHE A 293 ? 0.4000 0.3425 0.3632 -0.0129 -0.0297 -0.0732 443 PHE A CG  
1881 C CD1 . PHE A 293 ? 0.4025 0.3347 0.3723 -0.0146 -0.0284 -0.0807 443 PHE A CD1 
1882 C CD2 . PHE A 293 ? 0.3911 0.3424 0.3722 -0.0164 -0.0322 -0.0677 443 PHE A CD2 
1883 C CE1 . PHE A 293 ? 0.4156 0.3463 0.4103 -0.0202 -0.0296 -0.0821 443 PHE A CE1 
1884 C CE2 . PHE A 293 ? 0.4117 0.3621 0.4177 -0.0218 -0.0326 -0.0688 443 PHE A CE2 
1885 C CZ  . PHE A 293 ? 0.4054 0.3454 0.4185 -0.0239 -0.0314 -0.0758 443 PHE A CZ  
1886 N N   . ASP A 294 ? 0.3963 0.3309 0.2996 0.0042  -0.0092 -0.0654 444 ASP A N   
1887 C CA  . ASP A 294 ? 0.4152 0.3485 0.2964 0.0096  -0.0060 -0.0647 444 ASP A CA  
1888 C C   . ASP A 294 ? 0.4629 0.3966 0.3286 0.0104  -0.0162 -0.0710 444 ASP A C   
1889 O O   . ASP A 294 ? 0.4501 0.3846 0.3243 0.0065  -0.0260 -0.0775 444 ASP A O   
1890 C CB  . ASP A 294 ? 0.4233 0.3474 0.2960 0.0135  0.0031  -0.0687 444 ASP A CB  
1891 C CG  . ASP A 294 ? 0.4537 0.3682 0.3137 0.0145  -0.0010 -0.0820 444 ASP A CG  
1892 O OD1 . ASP A 294 ? 0.4721 0.3840 0.3446 0.0100  -0.0077 -0.0889 444 ASP A OD1 
1893 O OD2 . ASP A 294 ? 0.4841 0.3930 0.3211 0.0198  0.0024  -0.0860 444 ASP A OD2 
1894 N N   . GLN A 295 ? 0.4735 0.4066 0.3174 0.0156  -0.0140 -0.0687 445 GLN A N   
1895 C CA  . GLN A 295 ? 0.5333 0.4676 0.3594 0.0179  -0.0239 -0.0718 445 GLN A CA  
1896 C C   . GLN A 295 ? 0.5287 0.4551 0.3436 0.0179  -0.0325 -0.0861 445 GLN A C   
1897 O O   . GLN A 295 ? 0.5753 0.5045 0.3861 0.0172  -0.0455 -0.0910 445 GLN A O   
1898 C CB  . GLN A 295 ? 0.5270 0.4607 0.3307 0.0244  -0.0172 -0.0645 445 GLN A CB  
1899 C CG  . GLN A 295 ? 0.5583 0.4995 0.3748 0.0241  -0.0100 -0.0512 445 GLN A CG  
1900 C CD  . GLN A 295 ? 0.5418 0.4811 0.3692 0.0243  0.0033  -0.0467 445 GLN A CD  
1901 O OE1 . GLN A 295 ? 0.4944 0.4277 0.3251 0.0239  0.0075  -0.0527 445 GLN A OE1 
1902 N NE2 . GLN A 295 ? 0.5351 0.4794 0.3692 0.0252  0.0094  -0.0361 445 GLN A NE2 
1903 N N   . SER A 296 ? 0.5287 0.4452 0.3401 0.0190  -0.0256 -0.0933 446 SER A N   
1904 C CA  . SER A 296 ? 0.5385 0.4453 0.3393 0.0193  -0.0329 -0.1087 446 SER A CA  
1905 C C   . SER A 296 ? 0.5292 0.4361 0.3571 0.0118  -0.0412 -0.1161 446 SER A C   
1906 O O   . SER A 296 ? 0.5242 0.4240 0.3476 0.0109  -0.0502 -0.1299 446 SER A O   
1907 C CB  . SER A 296 ? 0.5791 0.4742 0.3664 0.0240  -0.0206 -0.1138 446 SER A CB  
1908 O OG  . SER A 296 ? 0.5588 0.4524 0.3712 0.0207  -0.0121 -0.1115 446 SER A OG  
1909 N N   . GLY A 297 ? 0.5061 0.4199 0.3614 0.0070  -0.0373 -0.1072 447 GLY A N   
1910 C CA  . GLY A 297 ? 0.5108 0.4239 0.3946 0.0001  -0.0412 -0.1113 447 GLY A CA  
1911 C C   . GLY A 297 ? 0.5241 0.4260 0.4154 -0.0001 -0.0329 -0.1165 447 GLY A C   
1912 O O   . GLY A 297 ? 0.5467 0.4451 0.4595 -0.0053 -0.0358 -0.1213 447 GLY A O   
1913 N N   . THR A 298 ? 0.5119 0.4083 0.3879 0.0054  -0.0219 -0.1147 448 THR A N   
1914 C CA  . THR A 298 ? 0.5203 0.4053 0.4017 0.0065  -0.0138 -0.1202 448 THR A CA  
1915 C C   . THR A 298 ? 0.4569 0.3447 0.3645 0.0037  -0.0060 -0.1095 448 THR A C   
1916 O O   . THR A 298 ? 0.4869 0.3666 0.4102 0.0018  -0.0034 -0.1134 448 THR A O   
1917 C CB  . THR A 298 ? 0.5261 0.4048 0.3819 0.0144  -0.0041 -0.1220 448 THR A CB  
1918 O OG1 . THR A 298 ? 0.5489 0.4236 0.3775 0.0175  -0.0119 -0.1322 448 THR A OG1 
1919 C CG2 . THR A 298 ? 0.5503 0.4173 0.4123 0.0167  0.0057  -0.1276 448 THR A CG2 
1920 N N   . TYR A 299 ? 0.4592 0.3576 0.3703 0.0039  -0.0030 -0.0964 449 TYR A N   
1921 C CA  . TYR A 299 ? 0.4382 0.3401 0.3674 0.0029  0.0037  -0.0851 449 TYR A CA  
1922 C C   . TYR A 299 ? 0.4054 0.3180 0.3469 -0.0011 -0.0007 -0.0763 449 TYR A C   
1923 O O   . TYR A 299 ? 0.4330 0.3533 0.3661 -0.0015 -0.0066 -0.0750 449 TYR A O   
1924 C CB  . TYR A 299 ? 0.4302 0.3346 0.3507 0.0083  0.0129  -0.0776 449 TYR A CB  
1925 C CG  . TYR A 299 ? 0.4419 0.3371 0.3498 0.0136  0.0201  -0.0846 449 TYR A CG  
1926 C CD1 . TYR A 299 ? 0.4588 0.3445 0.3774 0.0144  0.0252  -0.0891 449 TYR A CD1 
1927 C CD2 . TYR A 299 ? 0.4847 0.3805 0.3702 0.0184  0.0233  -0.0856 449 TYR A CD2 
1928 C CE1 . TYR A 299 ? 0.4962 0.3731 0.4035 0.0199  0.0331  -0.0959 449 TYR A CE1 
1929 C CE2 . TYR A 299 ? 0.4801 0.3669 0.3527 0.0240  0.0319  -0.0918 449 TYR A CE2 
1930 C CZ  . TYR A 299 ? 0.4984 0.3763 0.3825 0.0248  0.0370  -0.0970 449 TYR A CZ  
1931 O OH  . TYR A 299 ? 0.5025 0.3712 0.3749 0.0309  0.0467  -0.1036 449 TYR A OH  
1932 N N   . LEU A 300 ? 0.3915 0.3042 0.3517 -0.0033 0.0027  -0.0695 450 LEU A N   
1933 C CA  . LEU A 300 ? 0.3720 0.2939 0.3425 -0.0058 0.0017  -0.0594 450 LEU A CA  
1934 C C   . LEU A 300 ? 0.3757 0.2992 0.3491 -0.0029 0.0088  -0.0492 450 LEU A C   
1935 O O   . LEU A 300 ? 0.3766 0.2933 0.3577 -0.0016 0.0136  -0.0481 450 LEU A O   
1936 C CB  . LEU A 300 ? 0.3854 0.3055 0.3763 -0.0112 -0.0006 -0.0600 450 LEU A CB  
1937 C CG  . LEU A 300 ? 0.3506 0.2787 0.3533 -0.0134 0.0007  -0.0493 450 LEU A CG  
1938 C CD1 . LEU A 300 ? 0.3688 0.3073 0.3660 -0.0141 -0.0050 -0.0488 450 LEU A CD1 
1939 C CD2 . LEU A 300 ? 0.3835 0.3076 0.4082 -0.0181 0.0016  -0.0488 450 LEU A CD2 
1940 N N   . ALA A 301 ? 0.3459 0.2782 0.3141 -0.0016 0.0086  -0.0420 451 ALA A N   
1941 C CA  . ALA A 301 ? 0.3612 0.2958 0.3317 0.0011  0.0132  -0.0331 451 ALA A CA  
1942 C C   . ALA A 301 ? 0.3730 0.3120 0.3517 -0.0008 0.0125  -0.0259 451 ALA A C   
1943 O O   . ALA A 301 ? 0.3559 0.3000 0.3356 -0.0035 0.0089  -0.0263 451 ALA A O   
1944 C CB  . ALA A 301 ? 0.3576 0.2978 0.3170 0.0043  0.0139  -0.0307 451 ALA A CB  
1945 N N   . LEU A 302 ? 0.3552 0.2923 0.3392 0.0010  0.0160  -0.0190 452 LEU A N   
1946 C CA  . LEU A 302 ? 0.3485 0.2895 0.3352 0.0009  0.0166  -0.0109 452 LEU A CA  
1947 C C   . LEU A 302 ? 0.3262 0.2696 0.3072 0.0054  0.0172  -0.0049 452 LEU A C   
1948 O O   . LEU A 302 ? 0.3421 0.2829 0.3231 0.0083  0.0182  -0.0054 452 LEU A O   
1949 C CB  . LEU A 302 ? 0.3390 0.2743 0.3376 -0.0010 0.0197  -0.0074 452 LEU A CB  
1950 C CG  . LEU A 302 ? 0.3597 0.2865 0.3642 0.0013  0.0233  -0.0044 452 LEU A CG  
1951 C CD1 . LEU A 302 ? 0.3502 0.2778 0.3500 0.0060  0.0247  0.0053  452 LEU A CD1 
1952 C CD2 . LEU A 302 ? 0.3789 0.2983 0.3980 -0.0022 0.0261  -0.0046 452 LEU A CD2 
1953 N N   . GLY A 303 ? 0.3198 0.2683 0.2967 0.0061  0.0163  -0.0002 453 GLY A N   
1954 C CA  . GLY A 303 ? 0.3323 0.2828 0.3038 0.0101  0.0152  0.0045  453 GLY A CA  
1955 C C   . GLY A 303 ? 0.3912 0.3426 0.3590 0.0113  0.0161  0.0107  453 GLY A C   
1956 O O   . GLY A 303 ? 0.4821 0.4354 0.4512 0.0089  0.0179  0.0111  453 GLY A O   
1957 N N   . GLY A 304 ? 0.3902 0.3403 0.3531 0.0156  0.0147  0.0154  454 GLY A N   
1958 C CA  . GLY A 304 ? 0.3733 0.3227 0.3277 0.0185  0.0156  0.0215  454 GLY A CA  
1959 C C   . GLY A 304 ? 0.3513 0.2969 0.3023 0.0236  0.0128  0.0261  454 GLY A C   
1960 O O   . GLY A 304 ? 0.3379 0.2865 0.2871 0.0260  0.0070  0.0239  454 GLY A O   
1961 N N   . THR A 305 ? 0.3548 0.2937 0.3071 0.0254  0.0164  0.0328  455 THR A N   
1962 C CA  . THR A 305 ? 0.3568 0.2917 0.3067 0.0309  0.0130  0.0381  455 THR A CA  
1963 C C   . THR A 305 ? 0.3590 0.2957 0.3196 0.0310  0.0090  0.0332  455 THR A C   
1964 O O   . THR A 305 ? 0.3466 0.2851 0.3060 0.0352  0.0028  0.0342  455 THR A O   
1965 C CB  . THR A 305 ? 0.3548 0.2812 0.3074 0.0324  0.0187  0.0464  455 THR A CB  
1966 O OG1 . THR A 305 ? 0.3753 0.3002 0.3173 0.0332  0.0238  0.0521  455 THR A OG1 
1967 C CG2 . THR A 305 ? 0.4020 0.3241 0.3520 0.0391  0.0141  0.0527  455 THR A CG2 
1968 N N   . ASP A 306 ? 0.3474 0.2837 0.3185 0.0267  0.0125  0.0277  456 ASP A N   
1969 C CA  . ASP A 306 ? 0.3362 0.2752 0.3156 0.0266  0.0107  0.0220  456 ASP A CA  
1970 C C   . ASP A 306 ? 0.3438 0.2832 0.3267 0.0216  0.0145  0.0145  456 ASP A C   
1971 O O   . ASP A 306 ? 0.3473 0.2868 0.3272 0.0180  0.0164  0.0134  456 ASP A O   
1972 C CB  . ASP A 306 ? 0.3485 0.2829 0.3371 0.0309  0.0102  0.0255  456 ASP A CB  
1973 C CG  . ASP A 306 ? 0.3575 0.2829 0.3528 0.0301  0.0159  0.0280  456 ASP A CG  
1974 O OD1 . ASP A 306 ? 0.3487 0.2716 0.3467 0.0252  0.0203  0.0232  456 ASP A OD1 
1975 O OD2 . ASP A 306 ? 0.4109 0.3313 0.4101 0.0345  0.0153  0.0347  456 ASP A OD2 
1976 N N   . VAL A 307 ? 0.3121 0.2520 0.3011 0.0218  0.0156  0.0096  457 VAL A N   
1977 C CA  . VAL A 307 ? 0.3444 0.2840 0.3326 0.0183  0.0184  0.0023  457 VAL A CA  
1978 C C   . VAL A 307 ? 0.3334 0.2647 0.3290 0.0181  0.0225  -0.0009 457 VAL A C   
1979 O O   . VAL A 307 ? 0.3154 0.2437 0.3190 0.0216  0.0242  0.0003  457 VAL A O   
1980 C CB  . VAL A 307 ? 0.3460 0.2909 0.3333 0.0192  0.0184  -0.0012 457 VAL A CB  
1981 C CG1 . VAL A 307 ? 0.3519 0.2948 0.3351 0.0170  0.0218  -0.0083 457 VAL A CG1 
1982 C CG2 . VAL A 307 ? 0.3451 0.2973 0.3266 0.0189  0.0143  0.0007  457 VAL A CG2 
1983 N N   . GLN A 308 ? 0.3367 0.2647 0.3313 0.0141  0.0237  -0.0056 458 GLN A N   
1984 C CA  . GLN A 308 ? 0.3224 0.2418 0.3234 0.0131  0.0268  -0.0111 458 GLN A CA  
1985 C C   . GLN A 308 ? 0.3475 0.2665 0.3424 0.0096  0.0259  -0.0207 458 GLN A C   
1986 O O   . GLN A 308 ? 0.3596 0.2838 0.3493 0.0065  0.0225  -0.0214 458 GLN A O   
1987 C CB  . GLN A 308 ? 0.3577 0.2701 0.3683 0.0120  0.0283  -0.0066 458 GLN A CB  
1988 C CG  . GLN A 308 ? 0.3731 0.2847 0.3870 0.0164  0.0286  0.0041  458 GLN A CG  
1989 C CD  . GLN A 308 ? 0.4043 0.3087 0.4259 0.0155  0.0313  0.0108  458 GLN A CD  
1990 O OE1 . GLN A 308 ? 0.4032 0.3005 0.4340 0.0119  0.0340  0.0066  458 GLN A OE1 
1991 N NE2 . GLN A 308 ? 0.4083 0.3134 0.4263 0.0191  0.0308  0.0211  458 GLN A NE2 
1992 N N   . ILE A 309 ? 0.3672 0.2794 0.3626 0.0107  0.0287  -0.0283 459 ILE A N   
1993 C CA  . ILE A 309 ? 0.3784 0.2887 0.3648 0.0087  0.0273  -0.0386 459 ILE A CA  
1994 C C   . ILE A 309 ? 0.3763 0.2752 0.3706 0.0074  0.0286  -0.0459 459 ILE A C   
1995 O O   . ILE A 309 ? 0.3667 0.2586 0.3691 0.0106  0.0336  -0.0458 459 ILE A O   
1996 C CB  . ILE A 309 ? 0.3857 0.2971 0.3602 0.0127  0.0307  -0.0425 459 ILE A CB  
1997 C CG1 . ILE A 309 ? 0.4168 0.3378 0.3894 0.0149  0.0313  -0.0343 459 ILE A CG1 
1998 C CG2 . ILE A 309 ? 0.4119 0.3217 0.3713 0.0113  0.0279  -0.0522 459 ILE A CG2 
1999 C CD1 . ILE A 309 ? 0.4169 0.3458 0.3816 0.0125  0.0264  -0.0319 459 ILE A CD1 
2000 N N   . TYR A 310 ? 0.3620 0.2594 0.3557 0.0028  0.0237  -0.0528 460 TYR A N   
2001 C CA  . TYR A 310 ? 0.3858 0.2725 0.3886 0.0003  0.0231  -0.0616 460 TYR A CA  
2002 C C   . TYR A 310 ? 0.4010 0.2846 0.3891 0.0001  0.0189  -0.0753 460 TYR A C   
2003 O O   . TYR A 310 ? 0.3858 0.2770 0.3597 -0.0001 0.0141  -0.0767 460 TYR A O   
2004 C CB  . TYR A 310 ? 0.4315 0.3186 0.4509 -0.0054 0.0199  -0.0580 460 TYR A CB  
2005 C CG  . TYR A 310 ? 0.4641 0.3500 0.4963 -0.0042 0.0252  -0.0453 460 TYR A CG  
2006 C CD1 . TYR A 310 ? 0.4819 0.3770 0.5085 -0.0021 0.0260  -0.0343 460 TYR A CD1 
2007 C CD2 . TYR A 310 ? 0.5149 0.3898 0.5641 -0.0048 0.0292  -0.0441 460 TYR A CD2 
2008 C CE1 . TYR A 310 ? 0.4978 0.3916 0.5318 0.0000  0.0298  -0.0227 460 TYR A CE1 
2009 C CE2 . TYR A 310 ? 0.5213 0.3950 0.5795 -0.0025 0.0339  -0.0305 460 TYR A CE2 
2010 C CZ  . TYR A 310 ? 0.5153 0.3988 0.5639 0.0000  0.0337  -0.0201 460 TYR A CZ  
2011 O OH  . TYR A 310 ? 0.5970 0.4799 0.6491 0.0033  0.0371  -0.0068 460 TYR A OH  
2012 N N   . ILE A 311 ? 0.4033 0.2750 0.3942 0.0007  0.0205  -0.0855 461 ILE A N   
2013 C CA  . ILE A 311 ? 0.4707 0.3368 0.4478 0.0004  0.0152  -0.1003 461 ILE A CA  
2014 C C   . ILE A 311 ? 0.4409 0.3067 0.4308 -0.0064 0.0060  -0.1056 461 ILE A C   
2015 O O   . ILE A 311 ? 0.4801 0.3395 0.4914 -0.0099 0.0070  -0.1054 461 ILE A O   
2016 C CB  . ILE A 311 ? 0.4983 0.3502 0.4736 0.0041  0.0206  -0.1110 461 ILE A CB  
2017 C CG1 A ILE A 311 ? 0.5542 0.4061 0.5273 0.0106  0.0316  -0.1040 461 ILE A CG1 
2018 C CG1 B ILE A 311 ? 0.5186 0.3712 0.4895 0.0109  0.0315  -0.1040 461 ILE A CG1 
2019 C CG2 . ILE A 311 ? 0.5569 0.4033 0.5107 0.0052  0.0149  -0.1269 461 ILE A CG2 
2020 C CD1 A ILE A 311 ? 0.5485 0.4090 0.5013 0.0147  0.0340  -0.1005 461 ILE A CD1 
2021 C CD1 B ILE A 311 ? 0.5015 0.3405 0.4721 0.0157  0.0391  -0.1134 461 ILE A CD1 
2022 N N   . CYS A 312 ? 0.4691 0.3411 0.4473 -0.0082 -0.0030 -0.1107 462 CYS A N   
2023 C CA  . CYS A 312 ? 0.5303 0.4045 0.5241 -0.0150 -0.0128 -0.1152 462 CYS A CA  
2024 C C   . CYS A 312 ? 0.5623 0.4238 0.5654 -0.0179 -0.0175 -0.1303 462 CYS A C   
2025 O O   . CYS A 312 ? 0.5958 0.4562 0.6240 -0.0242 -0.0216 -0.1316 462 CYS A O   
2026 C CB  . CYS A 312 ? 0.5341 0.4191 0.5142 -0.0155 -0.0223 -0.1165 462 CYS A CB  
2027 S SG  . CYS A 312 ? 0.4874 0.3867 0.4598 -0.0129 -0.0174 -0.0997 462 CYS A SG  
2028 N N   . LYS A 313 ? 0.6118 0.4627 0.5967 -0.0132 -0.0160 -0.1418 463 LYS A N   
2029 C CA  . LYS A 313 ? 0.6398 0.4773 0.6305 -0.0154 -0.0218 -0.1590 463 LYS A CA  
2030 C C   . LYS A 313 ? 0.6263 0.4543 0.6480 -0.0190 -0.0157 -0.1568 463 LYS A C   
2031 O O   . LYS A 313 ? 0.6416 0.4650 0.6856 -0.0254 -0.0226 -0.1640 463 LYS A O   
2032 C CB  . LYS A 313 ? 0.6970 0.5242 0.6576 -0.0081 -0.0197 -0.1718 463 LYS A CB  
2033 C CG  . LYS A 313 ? 0.7719 0.5858 0.7298 -0.0097 -0.0293 -0.1930 463 LYS A CG  
2034 C CD  . LYS A 313 ? 0.8195 0.6252 0.7390 -0.0016 -0.0291 -0.2060 463 LYS A CD  
2035 C CE  . LYS A 313 ? 0.8168 0.6332 0.7085 0.0005  -0.0382 -0.2052 463 LYS A CE  
2036 N N   . GLN A 314 ? 0.5944 0.4196 0.6192 -0.0147 -0.0031 -0.1464 464 GLN A N   
2037 C CA  . GLN A 314 ? 0.6011 0.4172 0.6536 -0.0167 0.0036  -0.1414 464 GLN A CA  
2038 C C   . GLN A 314 ? 0.5522 0.3776 0.6217 -0.0186 0.0091  -0.1211 464 GLN A C   
2039 O O   . GLN A 314 ? 0.5296 0.3480 0.6208 -0.0195 0.0154  -0.1141 464 GLN A O   
2040 C CB  . GLN A 314 ? 0.6437 0.4482 0.6899 -0.0097 0.0137  -0.1443 464 GLN A CB  
2041 C CG  . GLN A 314 ? 0.7057 0.4967 0.7370 -0.0071 0.0107  -0.1655 464 GLN A CG  
2042 C CD  . GLN A 314 ? 0.6998 0.4960 0.6949 -0.0012 0.0098  -0.1707 464 GLN A CD  
2043 O OE1 . GLN A 314 ? 0.6949 0.5043 0.6789 0.0008  0.0121  -0.1585 464 GLN A OE1 
2044 N NE2 . GLN A 314 ? 0.7442 0.5288 0.7206 0.0019  0.0071  -0.1891 464 GLN A NE2 
2045 N N   . TRP A 315 ? 0.5585 0.3987 0.6172 -0.0184 0.0072  -0.1118 465 TRP A N   
2046 C CA  . TRP A 315 ? 0.5520 0.4008 0.6200 -0.0184 0.0130  -0.0930 465 TRP A CA  
2047 C C   . TRP A 315 ? 0.5481 0.3918 0.6193 -0.0130 0.0229  -0.0832 465 TRP A C   
2048 O O   . TRP A 315 ? 0.6290 0.4714 0.7162 -0.0137 0.0275  -0.0714 465 TRP A O   
2049 C CB  . TRP A 315 ? 0.5791 0.4299 0.6723 -0.0256 0.0109  -0.0880 465 TRP A CB  
2050 C CG  . TRP A 315 ? 0.5911 0.4502 0.6811 -0.0299 0.0004  -0.0961 465 TRP A CG  
2051 C CD1 . TRP A 315 ? 0.6383 0.4930 0.7403 -0.0353 -0.0084 -0.1100 465 TRP A CD1 
2052 C CD2 . TRP A 315 ? 0.5997 0.4727 0.6727 -0.0285 -0.0033 -0.0920 465 TRP A CD2 
2053 N NE1 . TRP A 315 ? 0.6500 0.5159 0.7433 -0.0372 -0.0182 -0.1141 465 TRP A NE1 
2054 C CE2 . TRP A 315 ? 0.6270 0.5041 0.7024 -0.0329 -0.0146 -0.1027 465 TRP A CE2 
2055 C CE3 . TRP A 315 ? 0.5575 0.4397 0.6146 -0.0239 0.0010  -0.0806 465 TRP A CE3 
2056 C CZ2 . TRP A 315 ? 0.6158 0.5056 0.6782 -0.0324 -0.0209 -0.1011 465 TRP A CZ2 
2057 C CZ3 . TRP A 315 ? 0.5774 0.4714 0.6222 -0.0239 -0.0045 -0.0797 465 TRP A CZ3 
2058 C CH2 . TRP A 315 ? 0.5652 0.4630 0.6126 -0.0278 -0.0150 -0.0893 465 TRP A CH2 
2059 N N   . THR A 316 ? 0.5043 0.3455 0.5593 -0.0070 0.0260  -0.0878 466 THR A N   
2060 C CA  . THR A 316 ? 0.4972 0.3344 0.5545 -0.0007 0.0345  -0.0807 466 THR A CA  
2061 C C   . THR A 316 ? 0.4702 0.3209 0.5137 0.0031  0.0358  -0.0695 466 THR A C   
2062 O O   . THR A 316 ? 0.4330 0.2920 0.4595 0.0029  0.0321  -0.0728 466 THR A O   
2063 C CB  . THR A 316 ? 0.5218 0.3479 0.5711 0.0035  0.0376  -0.0947 466 THR A CB  
2064 O OG1 . THR A 316 ? 0.6750 0.4866 0.7429 0.0014  0.0387  -0.1015 466 THR A OG1 
2065 C CG2 . THR A 316 ? 0.5984 0.4258 0.6424 0.0115  0.0459  -0.0889 466 THR A CG2 
2066 N N   . GLU A 317 ? 0.4261 0.2786 0.4774 0.0067  0.0403  -0.0566 467 GLU A N   
2067 C CA  . GLU A 317 ? 0.4222 0.2862 0.4632 0.0104  0.0407  -0.0475 467 GLU A CA  
2068 C C   . GLU A 317 ? 0.4276 0.2908 0.4607 0.0159  0.0451  -0.0529 467 GLU A C   
2069 O O   . GLU A 317 ? 0.4597 0.3144 0.5022 0.0195  0.0501  -0.0548 467 GLU A O   
2070 C CB  . GLU A 317 ? 0.4197 0.2855 0.4709 0.0130  0.0426  -0.0328 467 GLU A CB  
2071 C CG  . GLU A 317 ? 0.4030 0.2808 0.4448 0.0165  0.0412  -0.0244 467 GLU A CG  
2072 C CD  . GLU A 317 ? 0.4200 0.2973 0.4711 0.0209  0.0422  -0.0117 467 GLU A CD  
2073 O OE1 . GLU A 317 ? 0.4256 0.2976 0.4845 0.0195  0.0428  -0.0051 467 GLU A OE1 
2074 O OE2 . GLU A 317 ? 0.4161 0.2972 0.4679 0.0259  0.0426  -0.0083 467 GLU A OE2 
2075 N N   . ILE A 318 ? 0.3842 0.2562 0.4015 0.0168  0.0440  -0.0544 468 ILE A N   
2076 C CA  . ILE A 318 ? 0.3870 0.2585 0.3957 0.0219  0.0497  -0.0594 468 ILE A CA  
2077 C C   . ILE A 318 ? 0.3623 0.2443 0.3716 0.0256  0.0518  -0.0498 468 ILE A C   
2078 O O   . ILE A 318 ? 0.3741 0.2554 0.3864 0.0306  0.0583  -0.0502 468 ILE A O   
2079 C CB  . ILE A 318 ? 0.4149 0.2848 0.4036 0.0208  0.0480  -0.0714 468 ILE A CB  
2080 C CG1 . ILE A 318 ? 0.4563 0.3217 0.4355 0.0269  0.0565  -0.0779 468 ILE A CG1 
2081 C CG2 . ILE A 318 ? 0.3972 0.2784 0.3731 0.0183  0.0425  -0.0676 468 ILE A CG2 
2082 C CD1 . ILE A 318 ? 0.4864 0.3393 0.4774 0.0303  0.0630  -0.0837 468 ILE A CD1 
2083 N N   . LEU A 319 ? 0.3678 0.2595 0.3758 0.0233  0.0464  -0.0412 469 LEU A N   
2084 C CA  . LEU A 319 ? 0.3545 0.2554 0.3662 0.0263  0.0467  -0.0325 469 LEU A CA  
2085 C C   . LEU A 319 ? 0.3535 0.2588 0.3703 0.0247  0.0410  -0.0228 469 LEU A C   
2086 O O   . LEU A 319 ? 0.3414 0.2468 0.3539 0.0205  0.0372  -0.0225 469 LEU A O   
2087 C CB  . LEU A 319 ? 0.3616 0.2708 0.3601 0.0261  0.0467  -0.0335 469 LEU A CB  
2088 C CG  . LEU A 319 ? 0.3757 0.2841 0.3692 0.0299  0.0544  -0.0381 469 LEU A CG  
2089 C CD1 . LEU A 319 ? 0.3753 0.2913 0.3552 0.0290  0.0538  -0.0372 469 LEU A CD1 
2090 C CD2 . LEU A 319 ? 0.3518 0.2617 0.3628 0.0348  0.0596  -0.0332 469 LEU A CD2 
2091 N N   . HIS A 320 ? 0.3511 0.2610 0.3767 0.0285  0.0403  -0.0150 470 HIS A N   
2092 C CA  . HIS A 320 ? 0.3403 0.2543 0.3673 0.0285  0.0344  -0.0055 470 HIS A CA  
2093 C C   . HIS A 320 ? 0.3305 0.2535 0.3610 0.0319  0.0317  -0.0010 470 HIS A C   
2094 O O   . HIS A 320 ? 0.3411 0.2641 0.3840 0.0362  0.0340  0.0000  470 HIS A O   
2095 C CB  . HIS A 320 ? 0.3588 0.2645 0.3964 0.0305  0.0351  -0.0002 470 HIS A CB  
2096 C CG  . HIS A 320 ? 0.3522 0.2596 0.3875 0.0312  0.0303  0.0099  470 HIS A CG  
2097 N ND1 . HIS A 320 ? 0.4238 0.3233 0.4663 0.0332  0.0313  0.0168  470 HIS A ND1 
2098 C CD2 . HIS A 320 ? 0.3839 0.2990 0.4093 0.0307  0.0253  0.0143  470 HIS A CD2 
2099 C CE1 . HIS A 320 ? 0.3930 0.2952 0.4282 0.0343  0.0275  0.0255  470 HIS A CE1 
2100 N NE2 . HIS A 320 ? 0.4093 0.3208 0.4337 0.0328  0.0236  0.0235  470 HIS A NE2 
2101 N N   . PHE A 321 ? 0.3347 0.2653 0.3566 0.0300  0.0270  0.0011  471 PHE A N   
2102 C CA  . PHE A 321 ? 0.3182 0.2571 0.3447 0.0326  0.0227  0.0049  471 PHE A CA  
2103 C C   . PHE A 321 ? 0.3441 0.2852 0.3662 0.0336  0.0152  0.0115  471 PHE A C   
2104 O O   . PHE A 321 ? 0.3242 0.2641 0.3349 0.0309  0.0141  0.0124  471 PHE A O   
2105 C CB  . PHE A 321 ? 0.3271 0.2727 0.3476 0.0303  0.0233  0.0013  471 PHE A CB  
2106 C CG  . PHE A 321 ? 0.3465 0.2901 0.3670 0.0302  0.0313  -0.0046 471 PHE A CG  
2107 C CD1 . PHE A 321 ? 0.3434 0.2863 0.3772 0.0339  0.0366  -0.0051 471 PHE A CD1 
2108 C CD2 . PHE A 321 ? 0.3550 0.2971 0.3617 0.0269  0.0335  -0.0096 471 PHE A CD2 
2109 C CE1 . PHE A 321 ? 0.3455 0.2855 0.3767 0.0347  0.0455  -0.0106 471 PHE A CE1 
2110 C CE2 . PHE A 321 ? 0.3590 0.2984 0.3615 0.0278  0.0407  -0.0151 471 PHE A CE2 
2111 C CZ  . PHE A 321 ? 0.3555 0.2934 0.3691 0.0318  0.0474  -0.0156 471 PHE A CZ  
2112 N N   . THR A 322 ? 0.3255 0.2700 0.3564 0.0380  0.0100  0.0159  472 THR A N   
2113 C CA  . THR A 322 ? 0.3114 0.2579 0.3351 0.0402  0.0015  0.0217  472 THR A CA  
2114 C C   . THR A 322 ? 0.3251 0.2803 0.3547 0.0419  -0.0059 0.0211  472 THR A C   
2115 O O   . THR A 322 ? 0.3240 0.2808 0.3553 0.0463  -0.0146 0.0254  472 THR A O   
2116 C CB  . THR A 322 ? 0.2995 0.2395 0.3264 0.0448  -0.0001 0.0288  472 THR A CB  
2117 O OG1 . THR A 322 ? 0.3034 0.2449 0.3486 0.0490  -0.0011 0.0296  472 THR A OG1 
2118 C CG2 . THR A 322 ? 0.2991 0.2299 0.3238 0.0424  0.0075  0.0291  472 THR A CG2 
2119 N N   . GLU A 323 ? 0.3129 0.2733 0.3465 0.0389  -0.0029 0.0160  473 GLU A N   
2120 C CA  . GLU A 323 ? 0.3192 0.2877 0.3633 0.0397  -0.0090 0.0149  473 GLU A CA  
2121 C C   . GLU A 323 ? 0.3209 0.2920 0.3526 0.0391  -0.0177 0.0148  473 GLU A C   
2122 O O   . GLU A 323 ? 0.3124 0.2880 0.3511 0.0415  -0.0269 0.0150  473 GLU A O   
2123 C CB  . GLU A 323 ? 0.2995 0.2717 0.3521 0.0369  -0.0014 0.0107  473 GLU A CB  
2124 C CG  . GLU A 323 ? 0.3200 0.2896 0.3841 0.0382  0.0083  0.0096  473 GLU A CG  
2125 C CD  . GLU A 323 ? 0.3400 0.3121 0.4255 0.0429  0.0057  0.0124  473 GLU A CD  
2126 O OE1 . GLU A 323 ? 0.3221 0.3011 0.4194 0.0443  -0.0029 0.0139  473 GLU A OE1 
2127 O OE2 . GLU A 323 ? 0.3077 0.2747 0.3996 0.0453  0.0121  0.0126  473 GLU A OE2 
2128 N N   . HIS A 324 ? 0.3326 0.3011 0.3473 0.0361  -0.0149 0.0137  474 HIS A N   
2129 C CA  . HIS A 324 ? 0.3287 0.2985 0.3307 0.0361  -0.0216 0.0131  474 HIS A CA  
2130 C C   . HIS A 324 ? 0.3519 0.3188 0.3453 0.0412  -0.0296 0.0176  474 HIS A C   
2131 O O   . HIS A 324 ? 0.3467 0.3085 0.3380 0.0437  -0.0276 0.0226  474 HIS A O   
2132 C CB  . HIS A 324 ? 0.3266 0.2942 0.3136 0.0324  -0.0162 0.0117  474 HIS A CB  
2133 C CG  . HIS A 324 ? 0.2861 0.2569 0.2772 0.0284  -0.0112 0.0076  474 HIS A CG  
2134 N ND1 . HIS A 324 ? 0.3041 0.2795 0.2998 0.0273  -0.0144 0.0048  474 HIS A ND1 
2135 C CD2 . HIS A 324 ? 0.3096 0.2789 0.2995 0.0254  -0.0035 0.0061  474 HIS A CD2 
2136 C CE1 . HIS A 324 ? 0.3136 0.2901 0.3101 0.0242  -0.0080 0.0030  474 HIS A CE1 
2137 N NE2 . HIS A 324 ? 0.3130 0.2859 0.3051 0.0232  -0.0019 0.0034  474 HIS A NE2 
2138 N N   . SER A 325 ? 0.3786 0.3481 0.3665 0.0429  -0.0388 0.0156  475 SER A N   
2139 C CA  . SER A 325 ? 0.3863 0.3524 0.3592 0.0482  -0.0469 0.0189  475 SER A CA  
2140 C C   . SER A 325 ? 0.3897 0.3522 0.3404 0.0474  -0.0436 0.0186  475 SER A C   
2141 O O   . SER A 325 ? 0.3441 0.3094 0.2926 0.0446  -0.0442 0.0130  475 SER A O   
2142 C CB  . SER A 325 ? 0.4242 0.3952 0.4050 0.0512  -0.0604 0.0155  475 SER A CB  
2143 O OG  . SER A 325 ? 0.5075 0.4743 0.4686 0.0570  -0.0687 0.0182  475 SER A OG  
2144 N N   . GLY A 326 ? 0.4166 0.3727 0.3525 0.0498  -0.0392 0.0249  476 GLY A N   
2145 C CA  . GLY A 326 ? 0.4075 0.3604 0.3258 0.0487  -0.0329 0.0254  476 GLY A CA  
2146 C C   . GLY A 326 ? 0.3611 0.3156 0.2880 0.0421  -0.0226 0.0233  476 GLY A C   
2147 O O   . GLY A 326 ? 0.3380 0.2942 0.2806 0.0390  -0.0194 0.0221  476 GLY A O   
2148 N N   . LEU A 327 ? 0.3663 0.3201 0.2827 0.0404  -0.0175 0.0226  477 LEU A N   
2149 C CA  . LEU A 327 ? 0.3813 0.3360 0.3042 0.0349  -0.0084 0.0219  477 LEU A CA  
2150 C C   . LEU A 327 ? 0.3407 0.3007 0.2768 0.0304  -0.0084 0.0158  477 LEU A C   
2151 O O   . LEU A 327 ? 0.3339 0.2976 0.2716 0.0303  -0.0130 0.0116  477 LEU A O   
2152 C CB  . LEU A 327 ? 0.4233 0.3773 0.3347 0.0345  -0.0030 0.0227  477 LEU A CB  
2153 C CG  . LEU A 327 ? 0.5024 0.4503 0.4048 0.0371  0.0034  0.0307  477 LEU A CG  
2154 C CD1 . LEU A 327 ? 0.5815 0.5291 0.4711 0.0386  0.0082  0.0315  477 LEU A CD1 
2155 C CD2 . LEU A 327 ? 0.5054 0.4516 0.4216 0.0327  0.0105  0.0333  477 LEU A CD2 
2156 N N   . THR A 328 ? 0.3015 0.2606 0.2464 0.0270  -0.0030 0.0157  478 THR A N   
2157 C CA  . THR A 328 ? 0.3331 0.2957 0.2854 0.0230  -0.0009 0.0110  478 THR A CA  
2158 C C   . THR A 328 ? 0.3732 0.3375 0.3211 0.0200  0.0024  0.0097  478 THR A C   
2159 O O   . THR A 328 ? 0.3588 0.3207 0.3054 0.0189  0.0064  0.0121  478 THR A O   
2160 C CB  . THR A 328 ? 0.3235 0.2834 0.2847 0.0215  0.0027  0.0104  478 THR A CB  
2161 O OG1 . THR A 328 ? 0.3087 0.2675 0.2766 0.0248  0.0001  0.0121  478 THR A OG1 
2162 C CG2 . THR A 328 ? 0.3246 0.2873 0.2895 0.0184  0.0050  0.0055  478 THR A CG2 
2163 N N   . THR A 329 ? 0.3415 0.3100 0.2896 0.0188  0.0008  0.0063  479 THR A N   
2164 C CA  . THR A 329 ? 0.3212 0.2922 0.2662 0.0170  0.0029  0.0054  479 THR A CA  
2165 C C   . THR A 329 ? 0.3626 0.3358 0.3123 0.0136  0.0045  0.0027  479 THR A C   
2166 O O   . THR A 329 ? 0.3409 0.3166 0.2905 0.0121  0.0055  0.0021  479 THR A O   
2167 C CB  . THR A 329 ? 0.3057 0.2789 0.2465 0.0188  -0.0002 0.0036  479 THR A CB  
2168 O OG1 . THR A 329 ? 0.2790 0.2541 0.2260 0.0185  -0.0033 0.0011  479 THR A OG1 
2169 C CG2 . THR A 329 ? 0.3162 0.2867 0.2483 0.0227  -0.0026 0.0051  479 THR A CG2 
2170 N N   . GLY A 330 ? 0.3274 0.2999 0.2810 0.0130  0.0047  0.0010  480 GLY A N   
2171 C CA  . GLY A 330 ? 0.3284 0.3022 0.2824 0.0108  0.0057  -0.0017 480 GLY A CA  
2172 C C   . GLY A 330 ? 0.3252 0.2958 0.2812 0.0109  0.0077  -0.0035 480 GLY A C   
2173 O O   . GLY A 330 ? 0.2827 0.2523 0.2426 0.0129  0.0080  -0.0024 480 GLY A O   
2174 N N   . VAL A 331 ? 0.3176 0.2867 0.2713 0.0091  0.0086  -0.0068 481 VAL A N   
2175 C CA  A VAL A 331 ? 0.3347 0.3000 0.2879 0.0098  0.0114  -0.0097 481 VAL A CA  
2176 C CA  B VAL A 331 ? 0.3396 0.3047 0.2927 0.0097  0.0114  -0.0099 481 VAL A CA  
2177 C C   . VAL A 331 ? 0.3388 0.3043 0.2839 0.0089  0.0107  -0.0135 481 VAL A C   
2178 O O   . VAL A 331 ? 0.3270 0.2950 0.2704 0.0070  0.0071  -0.0144 481 VAL A O   
2179 C CB  A VAL A 331 ? 0.3470 0.3067 0.3054 0.0095  0.0130  -0.0107 481 VAL A CB  
2180 C CB  B VAL A 331 ? 0.3603 0.3198 0.3178 0.0088  0.0126  -0.0116 481 VAL A CB  
2181 C CG1 A VAL A 331 ? 0.4063 0.3648 0.3666 0.0065  0.0114  -0.0117 481 VAL A CG1 
2182 C CG1 B VAL A 331 ? 0.3602 0.3184 0.3239 0.0107  0.0131  -0.0069 481 VAL A CG1 
2183 C CG2 A VAL A 331 ? 0.3513 0.3060 0.3088 0.0107  0.0165  -0.0149 481 VAL A CG2 
2184 C CG2 B VAL A 331 ? 0.4034 0.3630 0.3621 0.0054  0.0103  -0.0132 481 VAL A CG2 
2185 N N   . ALA A 332 ? 0.3604 0.3235 0.3005 0.0109  0.0142  -0.0153 482 ALA A N   
2186 C CA  . ALA A 332 ? 0.3524 0.3145 0.2805 0.0115  0.0138  -0.0184 482 ALA A CA  
2187 C C   . ALA A 332 ? 0.3461 0.3026 0.2677 0.0141  0.0195  -0.0217 482 ALA A C   
2188 O O   . ALA A 332 ? 0.3328 0.2879 0.2620 0.0159  0.0249  -0.0201 482 ALA A O   
2189 C CB  . ALA A 332 ? 0.3156 0.2824 0.2404 0.0127  0.0134  -0.0138 482 ALA A CB  
2190 N N   . PHE A 333 ? 0.3864 0.3395 0.2942 0.0149  0.0181  -0.0267 483 PHE A N   
2191 C CA  . PHE A 333 ? 0.3665 0.3135 0.2627 0.0185  0.0243  -0.0303 483 PHE A CA  
2192 C C   . PHE A 333 ? 0.3732 0.3213 0.2561 0.0219  0.0279  -0.0262 483 PHE A C   
2193 O O   . PHE A 333 ? 0.3701 0.3202 0.2429 0.0219  0.0223  -0.0257 483 PHE A O   
2194 C CB  . PHE A 333 ? 0.3904 0.3310 0.2763 0.0180  0.0203  -0.0399 483 PHE A CB  
2195 C CG  . PHE A 333 ? 0.3622 0.2997 0.2616 0.0149  0.0182  -0.0441 483 PHE A CG  
2196 C CD1 . PHE A 333 ? 0.3532 0.2942 0.2628 0.0105  0.0111  -0.0437 483 PHE A CD1 
2197 C CD2 . PHE A 333 ? 0.3674 0.2978 0.2701 0.0166  0.0243  -0.0479 483 PHE A CD2 
2198 C CE1 . PHE A 333 ? 0.3518 0.2891 0.2748 0.0077  0.0105  -0.0462 483 PHE A CE1 
2199 C CE2 . PHE A 333 ? 0.3581 0.2842 0.2736 0.0141  0.0228  -0.0511 483 PHE A CE2 
2200 C CZ  . PHE A 333 ? 0.3756 0.3050 0.3014 0.0094  0.0159  -0.0498 483 PHE A CZ  
2201 N N   . GLY A 334 ? 0.4052 0.3516 0.2889 0.0252  0.0378  -0.0229 484 GLY A N   
2202 C CA  . GLY A 334 ? 0.3989 0.3434 0.2670 0.0295  0.0442  -0.0196 484 GLY A CA  
2203 C C   . GLY A 334 ? 0.4261 0.3633 0.2693 0.0324  0.0427  -0.0271 484 GLY A C   
2204 O O   . GLY A 334 ? 0.4533 0.3862 0.2948 0.0309  0.0381  -0.0360 484 GLY A O   
2205 N N   . HIS A 335 ? 0.4570 0.3922 0.2807 0.0366  0.0459  -0.0235 485 HIS A N   
2206 C CA  A HIS A 335 ? 0.4929 0.4207 0.2882 0.0406  0.0434  -0.0304 485 HIS A CA  
2207 C CA  B HIS A 335 ? 0.4891 0.4167 0.2839 0.0408  0.0436  -0.0303 485 HIS A CA  
2208 C C   . HIS A 335 ? 0.5030 0.4225 0.2928 0.0430  0.0503  -0.0390 485 HIS A C   
2209 O O   . HIS A 335 ? 0.4605 0.3790 0.2602 0.0448  0.0626  -0.0358 485 HIS A O   
2210 C CB  A HIS A 335 ? 0.5707 0.4964 0.3447 0.0465  0.0495  -0.0227 485 HIS A CB  
2211 C CB  B HIS A 335 ? 0.5554 0.4810 0.3298 0.0467  0.0506  -0.0223 485 HIS A CB  
2212 C CG  A HIS A 335 ? 0.6130 0.5438 0.3825 0.0458  0.0394  -0.0175 485 HIS A CG  
2213 C CG  B HIS A 335 ? 0.6136 0.5321 0.3543 0.0517  0.0457  -0.0280 485 HIS A CG  
2214 N ND1 A HIS A 335 ? 0.6639 0.5949 0.4245 0.0498  0.0449  -0.0066 485 HIS A ND1 
2215 N ND1 B HIS A 335 ? 0.6524 0.5717 0.3857 0.0496  0.0295  -0.0357 485 HIS A ND1 
2216 C CD2 A HIS A 335 ? 0.6318 0.5673 0.4059 0.0420  0.0247  -0.0211 485 HIS A CD2 
2217 C CD2 B HIS A 335 ? 0.6665 0.5771 0.3785 0.0593  0.0544  -0.0266 485 HIS A CD2 
2218 C CE1 A HIS A 335 ? 0.6362 0.5718 0.3955 0.0487  0.0335  -0.0040 485 HIS A CE1 
2219 C CE1 B HIS A 335 ? 0.6824 0.5947 0.3836 0.0555  0.0268  -0.0398 485 HIS A CE1 
2220 N NE2 A HIS A 335 ? 0.6479 0.5869 0.4161 0.0440  0.0212  -0.0128 485 HIS A NE2 
2221 N NE2 B HIS A 335 ? 0.6781 0.5844 0.3636 0.0618  0.0421  -0.0341 485 HIS A NE2 
2222 N N   . HIS A 336 ? 0.4842 0.3978 0.2605 0.0428  0.0419  -0.0506 486 HIS A N   
2223 C CA  . HIS A 336 ? 0.5093 0.4133 0.2790 0.0450  0.0467  -0.0611 486 HIS A CA  
2224 C C   . HIS A 336 ? 0.4739 0.3791 0.2722 0.0416  0.0513  -0.0615 486 HIS A C   
2225 O O   . HIS A 336 ? 0.4980 0.3958 0.2956 0.0445  0.0598  -0.0671 486 HIS A O   
2226 C CB  . HIS A 336 ? 0.5519 0.4485 0.2986 0.0528  0.0602  -0.0602 486 HIS A CB  
2227 C CG  . HIS A 336 ? 0.6387 0.5315 0.3519 0.0577  0.0556  -0.0611 486 HIS A CG  
2228 N ND1 . HIS A 336 ? 0.7234 0.6126 0.4200 0.0570  0.0406  -0.0720 486 HIS A ND1 
2229 C CD2 . HIS A 336 ? 0.7024 0.5943 0.3958 0.0636  0.0636  -0.0520 486 HIS A CD2 
2230 C CE1 . HIS A 336 ? 0.7714 0.6575 0.4371 0.0629  0.0386  -0.0700 486 HIS A CE1 
2231 N NE2 . HIS A 336 ? 0.7783 0.6655 0.4408 0.0671  0.0532  -0.0572 486 HIS A NE2 
2232 N N   . ALA A 337 ? 0.4620 0.3760 0.2837 0.0361  0.0459  -0.0552 487 ALA A N   
2233 C CA  . ALA A 337 ? 0.4408 0.3569 0.2889 0.0333  0.0487  -0.0534 487 ALA A CA  
2234 C C   . ALA A 337 ? 0.4419 0.3573 0.2972 0.0376  0.0630  -0.0484 487 ALA A C   
2235 O O   . ALA A 337 ? 0.4373 0.3501 0.3076 0.0379  0.0674  -0.0504 487 ALA A O   
2236 C CB  . ALA A 337 ? 0.4640 0.3729 0.3164 0.0311  0.0440  -0.0640 487 ALA A CB  
2237 N N   . LYS A 338 ? 0.4507 0.3683 0.2968 0.0411  0.0704  -0.0415 488 LYS A N   
2238 C CA  . LYS A 338 ? 0.4461 0.3640 0.3019 0.0452  0.0852  -0.0360 488 LYS A CA  
2239 C C   . LYS A 338 ? 0.4224 0.3491 0.3092 0.0420  0.0851  -0.0283 488 LYS A C   
2240 O O   . LYS A 338 ? 0.4415 0.3692 0.3442 0.0445  0.0951  -0.0252 488 LYS A O   
2241 C CB  . LYS A 338 ? 0.4711 0.3877 0.3083 0.0501  0.0946  -0.0301 488 LYS A CB  
2242 C CG  . LYS A 338 ? 0.5375 0.4432 0.3421 0.0556  0.0983  -0.0383 488 LYS A CG  
2243 C CD  . LYS A 338 ? 0.6161 0.5189 0.3984 0.0619  0.1095  -0.0314 488 LYS A CD  
2244 N N   . PHE A 339 ? 0.4104 0.3434 0.3056 0.0370  0.0736  -0.0257 489 PHE A N   
2245 C CA  . PHE A 339 ? 0.3839 0.3240 0.3052 0.0339  0.0697  -0.0208 489 PHE A CA  
2246 C C   . PHE A 339 ? 0.3733 0.3157 0.2960 0.0289  0.0566  -0.0225 489 PHE A C   
2247 O O   . PHE A 339 ? 0.3792 0.3197 0.2861 0.0275  0.0506  -0.0263 489 PHE A O   
2248 C CB  . PHE A 339 ? 0.3725 0.3196 0.3059 0.0341  0.0738  -0.0119 489 PHE A CB  
2249 C CG  . PHE A 339 ? 0.3907 0.3407 0.3136 0.0323  0.0686  -0.0082 489 PHE A CG  
2250 C CD1 . PHE A 339 ? 0.3826 0.3376 0.3125 0.0282  0.0578  -0.0069 489 PHE A CD1 
2251 C CD2 . PHE A 339 ? 0.4389 0.3860 0.3446 0.0356  0.0755  -0.0053 489 PHE A CD2 
2252 C CE1 . PHE A 339 ? 0.4241 0.3817 0.3465 0.0271  0.0536  -0.0035 489 PHE A CE1 
2253 C CE2 . PHE A 339 ? 0.4534 0.4030 0.3509 0.0345  0.0704  -0.0011 489 PHE A CE2 
2254 C CZ  . PHE A 339 ? 0.4132 0.3680 0.3200 0.0302  0.0595  -0.0005 489 PHE A CZ  
2255 N N   . ILE A 340 ? 0.3528 0.2992 0.2943 0.0269  0.0526  -0.0198 490 ILE A N   
2256 C CA  . ILE A 340 ? 0.3647 0.3142 0.3095 0.0229  0.0424  -0.0191 490 ILE A CA  
2257 C C   . ILE A 340 ? 0.3336 0.2905 0.2898 0.0222  0.0401  -0.0125 490 ILE A C   
2258 O O   . ILE A 340 ? 0.3444 0.3036 0.3126 0.0241  0.0448  -0.0092 490 ILE A O   
2259 C CB  . ILE A 340 ? 0.3847 0.3305 0.3385 0.0221  0.0399  -0.0215 490 ILE A CB  
2260 C CG1 . ILE A 340 ? 0.4547 0.3917 0.3975 0.0226  0.0421  -0.0299 490 ILE A CG1 
2261 C CG2 . ILE A 340 ? 0.3560 0.3046 0.3130 0.0187  0.0318  -0.0194 490 ILE A CG2 
2262 C CD1 . ILE A 340 ? 0.5233 0.4547 0.4768 0.0227  0.0426  -0.0323 490 ILE A CD1 
2263 N N   . ALA A 341 ? 0.3284 0.2886 0.2820 0.0195  0.0329  -0.0111 491 ALA A N   
2264 C CA  . ALA A 341 ? 0.3158 0.2818 0.2786 0.0187  0.0293  -0.0064 491 ALA A CA  
2265 C C   . ALA A 341 ? 0.3254 0.2924 0.2903 0.0168  0.0222  -0.0063 491 ALA A C   
2266 O O   . ALA A 341 ? 0.3218 0.2865 0.2799 0.0151  0.0199  -0.0087 491 ALA A O   
2267 C CB  . ALA A 341 ? 0.3270 0.2954 0.2828 0.0183  0.0294  -0.0043 491 ALA A CB  
2268 N N   . SER A 342 ? 0.3121 0.2824 0.2870 0.0173  0.0188  -0.0035 492 SER A N   
2269 C CA  . SER A 342 ? 0.2778 0.2486 0.2515 0.0165  0.0129  -0.0025 492 SER A CA  
2270 C C   . SER A 342 ? 0.2953 0.2702 0.2739 0.0170  0.0083  -0.0007 492 SER A C   
2271 O O   . SER A 342 ? 0.2667 0.2440 0.2549 0.0178  0.0091  0.0000  492 SER A O   
2272 C CB  . SER A 342 ? 0.2984 0.2659 0.2766 0.0179  0.0123  -0.0018 492 SER A CB  
2273 O OG  . SER A 342 ? 0.2895 0.2589 0.2792 0.0204  0.0112  0.0000  492 SER A OG  
2274 N N   . THR A 343 ? 0.2769 0.2521 0.2494 0.0166  0.0041  -0.0003 493 THR A N   
2275 C CA  . THR A 343 ? 0.3008 0.2783 0.2745 0.0174  -0.0008 -0.0002 493 THR A CA  
2276 C C   . THR A 343 ? 0.3057 0.2813 0.2745 0.0195  -0.0051 0.0009  493 THR A C   
2277 O O   . THR A 343 ? 0.3257 0.2983 0.2886 0.0193  -0.0029 0.0024  493 THR A O   
2278 C CB  . THR A 343 ? 0.2905 0.2695 0.2585 0.0160  -0.0007 -0.0010 493 THR A CB  
2279 O OG1 . THR A 343 ? 0.3009 0.2789 0.2607 0.0148  0.0008  -0.0008 493 THR A OG1 
2280 C CG2 . THR A 343 ? 0.3080 0.2883 0.2798 0.0150  0.0028  -0.0007 493 THR A CG2 
2281 N N   . GLY A 344 ? 0.3260 0.3026 0.2970 0.0215  -0.0111 0.0003  494 GLY A N   
2282 C CA  . GLY A 344 ? 0.3211 0.2953 0.2846 0.0247  -0.0159 0.0017  494 GLY A CA  
2283 C C   . GLY A 344 ? 0.3537 0.3278 0.3098 0.0267  -0.0220 -0.0007 494 GLY A C   
2284 O O   . GLY A 344 ? 0.3123 0.2888 0.2750 0.0257  -0.0248 -0.0043 494 GLY A O   
2285 N N   . MET A 345 ? 0.3363 0.3068 0.2785 0.0300  -0.0239 0.0012  495 MET A N   
2286 C CA  . MET A 345 ? 0.3528 0.3217 0.2841 0.0336  -0.0308 -0.0015 495 MET A CA  
2287 C C   . MET A 345 ? 0.3652 0.3360 0.3064 0.0353  -0.0409 -0.0047 495 MET A C   
2288 O O   . MET A 345 ? 0.3508 0.3210 0.2879 0.0372  -0.0484 -0.0098 495 MET A O   
2289 C CB  . MET A 345 ? 0.4193 0.3831 0.3322 0.0380  -0.0300 0.0027  495 MET A CB  
2290 C CG  A MET A 345 ? 0.3909 0.3530 0.2961 0.0365  -0.0200 0.0059  495 MET A CG  
2291 C CG  B MET A 345 ? 0.4694 0.4316 0.3765 0.0361  -0.0194 0.0068  495 MET A CG  
2292 S SD  A MET A 345 ? 0.4060 0.3705 0.3106 0.0345  -0.0179 0.0002  495 MET A SD  
2293 S SD  B MET A 345 ? 0.6224 0.5813 0.5106 0.0391  -0.0146 0.0070  495 MET A SD  
2294 C CE  A MET A 345 ? 0.4130 0.3743 0.3043 0.0398  -0.0274 -0.0054 495 MET A CE  
2295 C CE  B MET A 345 ? 0.6352 0.5872 0.5042 0.0458  -0.0151 0.0138  495 MET A CE  
2296 N N   . ASP A 346 ? 0.3318 0.3048 0.2871 0.0349  -0.0415 -0.0023 496 ASP A N   
2297 C CA  . ASP A 346 ? 0.3651 0.3416 0.3359 0.0362  -0.0511 -0.0050 496 ASP A CA  
2298 C C   . ASP A 346 ? 0.3328 0.3137 0.3220 0.0323  -0.0515 -0.0097 496 ASP A C   
2299 O O   . ASP A 346 ? 0.3045 0.2892 0.3125 0.0324  -0.0580 -0.0117 496 ASP A O   
2300 C CB  . ASP A 346 ? 0.3664 0.3443 0.3499 0.0375  -0.0507 -0.0005 496 ASP A CB  
2301 C CG  . ASP A 346 ? 0.3580 0.3375 0.3535 0.0335  -0.0393 0.0013  496 ASP A CG  
2302 O OD1 . ASP A 346 ? 0.3288 0.3095 0.3259 0.0298  -0.0334 -0.0006 496 ASP A OD1 
2303 O OD2 . ASP A 346 ? 0.3478 0.3268 0.3509 0.0349  -0.0367 0.0048  496 ASP A OD2 
2304 N N   . ARG A 347 ? 0.3483 0.3287 0.3345 0.0290  -0.0442 -0.0106 497 ARG A N   
2305 C CA  . ARG A 347 ? 0.3560 0.3391 0.3578 0.0256  -0.0430 -0.0136 497 ARG A CA  
2306 C C   . ARG A 347 ? 0.3459 0.3318 0.3619 0.0226  -0.0337 -0.0100 497 ARG A C   
2307 O O   . ARG A 347 ? 0.3112 0.2983 0.3370 0.0200  -0.0298 -0.0105 497 ARG A O   
2308 C CB  . ARG A 347 ? 0.3935 0.3789 0.4119 0.0261  -0.0537 -0.0186 497 ARG A CB  
2309 C CG  A ARG A 347 ? 0.4006 0.3827 0.4058 0.0295  -0.0651 -0.0246 497 ARG A CG  
2310 C CG  B ARG A 347 ? 0.4258 0.4079 0.4306 0.0296  -0.0651 -0.0243 497 ARG A CG  
2311 C CD  A ARG A 347 ? 0.3940 0.3786 0.4203 0.0287  -0.0760 -0.0311 497 ARG A CD  
2312 C CD  B ARG A 347 ? 0.4397 0.4247 0.4648 0.0297  -0.0775 -0.0301 497 ARG A CD  
2313 N NE  A ARG A 347 ? 0.3593 0.3442 0.4003 0.0243  -0.0708 -0.0330 497 ARG A NE  
2314 N NE  B ARG A 347 ? 0.4345 0.4244 0.4770 0.0307  -0.0814 -0.0272 497 ARG A NE  
2315 C CZ  A ARG A 347 ? 0.3346 0.3232 0.4044 0.0213  -0.0728 -0.0347 497 ARG A CZ  
2316 C CZ  B ARG A 347 ? 0.4223 0.4178 0.4952 0.0285  -0.0853 -0.0290 497 ARG A CZ  
2317 N NH1 A ARG A 347 ? 0.3201 0.3136 0.4096 0.0219  -0.0808 -0.0355 497 ARG A NH1 
2318 N NH1 B ARG A 347 ? 0.4279 0.4282 0.5170 0.0300  -0.0883 -0.0260 497 ARG A NH1 
2319 N NH2 A ARG A 347 ? 0.2948 0.2822 0.3751 0.0178  -0.0664 -0.0348 497 ARG A NH2 
2320 N NH2 B ARG A 347 ? 0.4192 0.4153 0.5085 0.0247  -0.0852 -0.0333 497 ARG A NH2 
2321 N N   . SER A 348 ? 0.3339 0.3200 0.3505 0.0234  -0.0296 -0.0063 498 SER A N   
2322 C CA  . SER A 348 ? 0.3324 0.3206 0.3624 0.0217  -0.0209 -0.0038 498 SER A CA  
2323 C C   . SER A 348 ? 0.3112 0.2971 0.3293 0.0199  -0.0112 -0.0018 498 SER A C   
2324 O O   . SER A 348 ? 0.2803 0.2634 0.2825 0.0201  -0.0105 -0.0015 498 SER A O   
2325 C CB  . SER A 348 ? 0.3072 0.2970 0.3489 0.0239  -0.0214 -0.0018 498 SER A CB  
2326 O OG  . SER A 348 ? 0.3201 0.3062 0.3482 0.0258  -0.0205 0.0001  498 SER A OG  
2327 N N   . LEU A 349 ? 0.2725 0.2597 0.2996 0.0185  -0.0040 -0.0004 499 LEU A N   
2328 C CA  . LEU A 349 ? 0.3019 0.2870 0.3198 0.0178  0.0050  0.0012  499 LEU A CA  
2329 C C   . LEU A 349 ? 0.3012 0.2867 0.3297 0.0192  0.0110  0.0026  499 LEU A C   
2330 O O   . LEU A 349 ? 0.3030 0.2915 0.3498 0.0195  0.0134  0.0039  499 LEU A O   
2331 C CB  . LEU A 349 ? 0.3020 0.2874 0.3197 0.0163  0.0092  0.0026  499 LEU A CB  
2332 C CG  . LEU A 349 ? 0.3100 0.2933 0.3198 0.0166  0.0188  0.0050  499 LEU A CG  
2333 C CD1 . LEU A 349 ? 0.3138 0.2944 0.3046 0.0163  0.0180  0.0033  499 LEU A CD1 
2334 C CD2 . LEU A 349 ? 0.3103 0.2937 0.3233 0.0161  0.0231  0.0083  499 LEU A CD2 
2335 N N   . LYS A 350 ? 0.2750 0.2572 0.2944 0.0201  0.0136  0.0020  500 LYS A N   
2336 C CA  . LYS A 350 ? 0.3056 0.2869 0.3338 0.0221  0.0194  0.0024  500 LYS A CA  
2337 C C   . LYS A 350 ? 0.2855 0.2627 0.3016 0.0222  0.0288  0.0015  500 LYS A C   
2338 O O   . LYS A 350 ? 0.2732 0.2476 0.2729 0.0209  0.0280  0.0000  500 LYS A O   
2339 C CB  . LYS A 350 ? 0.2880 0.2674 0.3167 0.0239  0.0146  0.0021  500 LYS A CB  
2340 C CG  . LYS A 350 ? 0.3081 0.2911 0.3477 0.0253  0.0049  0.0031  500 LYS A CG  
2341 C CD  . LYS A 350 ? 0.3351 0.3149 0.3710 0.0277  0.0003  0.0044  500 LYS A CD  
2342 C CE  . LYS A 350 ? 0.3269 0.3100 0.3705 0.0301  -0.0105 0.0053  500 LYS A CE  
2343 N NZ  . LYS A 350 ? 0.3372 0.3261 0.4052 0.0313  -0.0119 0.0054  500 LYS A NZ  
2344 N N   . PHE A 351 ? 0.2998 0.2769 0.3249 0.0242  0.0374  0.0024  501 PHE A N   
2345 C CA  . PHE A 351 ? 0.3252 0.2972 0.3377 0.0257  0.0469  0.0007  501 PHE A CA  
2346 C C   . PHE A 351 ? 0.3188 0.2880 0.3390 0.0285  0.0515  -0.0011 501 PHE A C   
2347 O O   . PHE A 351 ? 0.3327 0.3057 0.3739 0.0300  0.0516  0.0009  501 PHE A O   
2348 C CB  . PHE A 351 ? 0.3315 0.3045 0.3453 0.0266  0.0561  0.0040  501 PHE A CB  
2349 C CG  . PHE A 351 ? 0.3302 0.3047 0.3358 0.0244  0.0524  0.0062  501 PHE A CG  
2350 C CD1 . PHE A 351 ? 0.3923 0.3635 0.3761 0.0235  0.0492  0.0040  501 PHE A CD1 
2351 C CD2 . PHE A 351 ? 0.3475 0.3264 0.3689 0.0232  0.0515  0.0100  501 PHE A CD2 
2352 C CE1 . PHE A 351 ? 0.3736 0.3462 0.3513 0.0220  0.0456  0.0063  501 PHE A CE1 
2353 C CE2 . PHE A 351 ? 0.3840 0.3634 0.3987 0.0215  0.0483  0.0119  501 PHE A CE2 
2354 C CZ  . PHE A 351 ? 0.3740 0.3503 0.3666 0.0211  0.0456  0.0103  501 PHE A CZ  
2355 N N   . TYR A 352 ? 0.3189 0.2813 0.3235 0.0292  0.0545  -0.0054 502 TYR A N   
2356 C CA  . TYR A 352 ? 0.3296 0.2872 0.3395 0.0320  0.0594  -0.0084 502 TYR A CA  
2357 C C   . TYR A 352 ? 0.3551 0.3064 0.3502 0.0343  0.0694  -0.0124 502 TYR A C   
2358 O O   . TYR A 352 ? 0.3615 0.3095 0.3357 0.0330  0.0680  -0.0153 502 TYR A O   
2359 C CB  . TYR A 352 ? 0.3340 0.2871 0.3395 0.0305  0.0519  -0.0111 502 TYR A CB  
2360 C CG  . TYR A 352 ? 0.3275 0.2852 0.3382 0.0283  0.0413  -0.0074 502 TYR A CG  
2361 C CD1 . TYR A 352 ? 0.3216 0.2812 0.3200 0.0250  0.0355  -0.0071 502 TYR A CD1 
2362 C CD2 . TYR A 352 ? 0.3424 0.3019 0.3685 0.0302  0.0371  -0.0042 502 TYR A CD2 
2363 C CE1 . TYR A 352 ? 0.3331 0.2958 0.3335 0.0237  0.0273  -0.0042 502 TYR A CE1 
2364 C CE2 . TYR A 352 ? 0.3073 0.2697 0.3333 0.0291  0.0274  -0.0010 502 TYR A CE2 
2365 C CZ  . TYR A 352 ? 0.3234 0.2871 0.3360 0.0259  0.0234  -0.0013 502 TYR A CZ  
2366 O OH  . TYR A 352 ? 0.2891 0.2546 0.2991 0.0254  0.0155  0.0011  502 TYR A OH  
2367 N N   . SER A 353 ? 0.3855 0.3352 0.3910 0.0384  0.0798  -0.0126 503 SER A N   
2368 C CA  . SER A 353 ? 0.4282 0.3714 0.4187 0.0420  0.0916  -0.0163 503 SER A CA  
2369 C C   . SER A 353 ? 0.4268 0.3676 0.4333 0.0467  0.1019  -0.0174 503 SER A C   
2370 O O   . SER A 353 ? 0.4096 0.3538 0.4388 0.0469  0.0979  -0.0155 503 SER A O   
2371 C CB  . SER A 353 ? 0.4268 0.3733 0.4112 0.0426  0.0982  -0.0110 503 SER A CB  
2372 O OG  . SER A 353 ? 0.4668 0.4054 0.4276 0.0463  0.1075  -0.0149 503 SER A OG  
2373 N N   . LEU A 354 ? 0.4650 0.3997 0.4596 0.0512  0.1153  -0.0205 504 LEU A N   
2374 C CA  . LEU A 354 ? 0.4973 0.4295 0.5081 0.0565  0.1274  -0.0217 504 LEU A CA  
2375 C C   . LEU A 354 ? 0.5435 0.4862 0.5857 0.0575  0.1325  -0.0132 504 LEU A C   
2376 O O   . LEU A 354 ? 0.5872 0.5361 0.6322 0.0558  0.1338  -0.0070 504 LEU A O   
2377 C CB  . LEU A 354 ? 0.5476 0.4702 0.5357 0.0619  0.1418  -0.0271 504 LEU A CB  
2378 C CG  . LEU A 354 ? 0.5765 0.4869 0.5389 0.0625  0.1385  -0.0385 504 LEU A CG  
2379 C CD1 . LEU A 354 ? 0.6514 0.5523 0.5907 0.0692  0.1539  -0.0439 504 LEU A CD1 
2380 C CD2 . LEU A 354 ? 0.5809 0.4877 0.5606 0.0623  0.1335  -0.0430 504 LEU A CD2 
2381 O OXT . LEU A 354 ? 0.6425 0.5876 0.7103 0.0600  0.1346  -0.0124 504 LEU A OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   151 ?   ?   ?   A . n 
A 1 2   HIS 2   152 ?   ?   ?   A . n 
A 1 3   HIS 3   153 ?   ?   ?   A . n 
A 1 4   HIS 4   154 ?   ?   ?   A . n 
A 1 5   HIS 5   155 ?   ?   ?   A . n 
A 1 6   HIS 6   156 ?   ?   ?   A . n 
A 1 7   HIS 7   157 ?   ?   ?   A . n 
A 1 8   SER 8   158 ?   ?   ?   A . n 
A 1 9   SER 9   159 ?   ?   ?   A . n 
A 1 10  GLY 10  160 ?   ?   ?   A . n 
A 1 11  ARG 11  161 ?   ?   ?   A . n 
A 1 12  GLU 12  162 ?   ?   ?   A . n 
A 1 13  ASN 13  163 ?   ?   ?   A . n 
A 1 14  LEU 14  164 ?   ?   ?   A . n 
A 1 15  TYR 15  165 ?   ?   ?   A . n 
A 1 16  PHE 16  166 ?   ?   ?   A . n 
A 1 17  GLN 17  167 ?   ?   ?   A . n 
A 1 18  GLY 18  168 ?   ?   ?   A . n 
A 1 19  THR 19  169 ?   ?   ?   A . n 
A 1 20  PRO 20  170 ?   ?   ?   A . n 
A 1 21  GLU 21  171 ?   ?   ?   A . n 
A 1 22  ILE 22  172 ?   ?   ?   A . n 
A 1 23  ILE 23  173 ?   ?   ?   A . n 
A 1 24  GLN 24  174 ?   ?   ?   A . n 
A 1 25  LYS 25  175 ?   ?   ?   A . n 
A 1 26  LEU 26  176 ?   ?   ?   A . n 
A 1 27  GLN 27  177 ?   ?   ?   A . n 
A 1 28  ASP 28  178 ?   ?   ?   A . n 
A 1 29  LYS 29  179 ?   ?   ?   A . n 
A 1 30  ALA 30  180 ?   ?   ?   A . n 
A 1 31  THR 31  181 ?   ?   ?   A . n 
A 1 32  VAL 32  182 ?   ?   ?   A . n 
A 1 33  LEU 33  183 ?   ?   ?   A . n 
A 1 34  THR 34  184 ?   ?   ?   A . n 
A 1 35  THR 35  185 ?   ?   ?   A . n 
A 1 36  GLU 36  186 ?   ?   ?   A . n 
A 1 37  ARG 37  187 ?   ?   ?   A . n 
A 1 38  LYS 38  188 ?   ?   ?   A . n 
A 1 39  GLU 39  189 ?   ?   ?   A . n 
A 1 40  ARG 40  190 ?   ?   ?   A . n 
A 1 41  GLY 41  191 ?   ?   ?   A . n 
A 1 42  LYS 42  192 ?   ?   ?   A . n 
A 1 43  THR 43  193 ?   ?   ?   A . n 
A 1 44  VAL 44  194 ?   ?   ?   A . n 
A 1 45  PRO 45  195 195 PRO PRO A . n 
A 1 46  GLU 46  196 196 GLU GLU A . n 
A 1 47  GLU 47  197 197 GLU GLU A . n 
A 1 48  LEU 48  198 198 LEU LEU A . n 
A 1 49  VAL 49  199 199 VAL VAL A . n 
A 1 50  LYS 50  200 200 LYS LYS A . n 
A 1 51  PRO 51  201 201 PRO PRO A . n 
A 1 52  GLU 52  202 202 GLU GLU A . n 
A 1 53  GLU 53  203 203 GLU GLU A . n 
A 1 54  LEU 54  204 204 LEU LEU A . n 
A 1 55  SER 55  205 205 SER SER A . n 
A 1 56  LYS 56  206 206 LYS LYS A . n 
A 1 57  TYR 57  207 207 TYR TYR A . n 
A 1 58  ARG 58  208 208 ARG ARG A . n 
A 1 59  GLN 59  209 209 GLN GLN A . n 
A 1 60  VAL 60  210 210 VAL VAL A . n 
A 1 61  ALA 61  211 211 ALA ALA A . n 
A 1 62  SER 62  212 212 SER SER A . n 
A 1 63  HIS 63  213 213 HIS HIS A . n 
A 1 64  VAL 64  214 214 VAL VAL A . n 
A 1 65  GLY 65  215 215 GLY GLY A . n 
A 1 66  LEU 66  216 216 LEU LEU A . n 
A 1 67  HIS 67  217 217 HIS HIS A . n 
A 1 68  SER 68  218 218 SER SER A . n 
A 1 69  ALA 69  219 219 ALA ALA A . n 
A 1 70  SER 70  220 220 SER SER A . n 
A 1 71  ILE 71  221 221 ILE ILE A . n 
A 1 72  PRO 72  222 222 PRO PRO A . n 
A 1 73  GLY 73  223 223 GLY GLY A . n 
A 1 74  ILE 74  224 224 ILE ILE A . n 
A 1 75  LEU 75  225 225 LEU LEU A . n 
A 1 76  ALA 76  226 226 ALA ALA A . n 
A 1 77  LEU 77  227 227 LEU LEU A . n 
A 1 78  ASP 78  228 228 ASP ASP A . n 
A 1 79  LEU 79  229 229 LEU LEU A . n 
A 1 80  CYS 80  230 230 CYS CYS A . n 
A 1 81  PRO 81  231 231 PRO PRO A . n 
A 1 82  SER 82  232 232 SER SER A . n 
A 1 83  ASP 83  233 233 ASP ASP A . n 
A 1 84  THR 84  234 234 THR THR A . n 
A 1 85  ASN 85  235 235 ASN ASN A . n 
A 1 86  LYS 86  236 236 LYS LYS A . n 
A 1 87  ILE 87  237 237 ILE ILE A . n 
A 1 88  LEU 88  238 238 LEU LEU A . n 
A 1 89  THR 89  239 239 THR THR A . n 
A 1 90  GLY 90  240 240 GLY GLY A . n 
A 1 91  GLY 91  241 241 GLY GLY A . n 
A 1 92  ALA 92  242 242 ALA ALA A . n 
A 1 93  ASP 93  243 243 ASP ASP A . n 
A 1 94  LYS 94  244 244 LYS LYS A . n 
A 1 95  ASN 95  245 245 ASN ASN A . n 
A 1 96  VAL 96  246 246 VAL VAL A . n 
A 1 97  VAL 97  247 247 VAL VAL A . n 
A 1 98  VAL 98  248 248 VAL VAL A . n 
A 1 99  PHE 99  249 249 PHE PHE A . n 
A 1 100 ASP 100 250 250 ASP ASP A . n 
A 1 101 LYS 101 251 251 LYS LYS A . n 
A 1 102 SER 102 252 252 SER SER A . n 
A 1 103 SER 103 253 253 SER SER A . n 
A 1 104 GLU 104 254 254 GLU GLU A . n 
A 1 105 GLN 105 255 255 GLN GLN A . n 
A 1 106 ILE 106 256 256 ILE ILE A . n 
A 1 107 LEU 107 257 257 LEU LEU A . n 
A 1 108 ALA 108 258 258 ALA ALA A . n 
A 1 109 THR 109 259 259 THR THR A . n 
A 1 110 LEU 110 260 260 LEU LEU A . n 
A 1 111 LYS 111 261 261 LYS LYS A . n 
A 1 112 GLY 112 262 262 GLY GLY A . n 
A 1 113 HIS 113 263 263 HIS HIS A . n 
A 1 114 THR 114 264 264 THR THR A . n 
A 1 115 LYS 115 265 265 LYS LYS A . n 
A 1 116 LYS 116 266 266 LYS LYS A . n 
A 1 117 VAL 117 267 267 VAL VAL A . n 
A 1 118 THR 118 268 268 THR THR A . n 
A 1 119 SER 119 269 269 SER SER A . n 
A 1 120 VAL 120 270 270 VAL VAL A . n 
A 1 121 VAL 121 271 271 VAL VAL A . n 
A 1 122 PHE 122 272 272 PHE PHE A . n 
A 1 123 HIS 123 273 273 HIS HIS A . n 
A 1 124 PRO 124 274 274 PRO PRO A . n 
A 1 125 SER 125 275 275 SER SER A . n 
A 1 126 GLN 126 276 276 GLN GLN A . n 
A 1 127 ASP 127 277 277 ASP ASP A . n 
A 1 128 LEU 128 278 278 LEU LEU A . n 
A 1 129 VAL 129 279 279 VAL VAL A . n 
A 1 130 PHE 130 280 280 PHE PHE A . n 
A 1 131 SER 131 281 281 SER SER A . n 
A 1 132 ALA 132 282 282 ALA ALA A . n 
A 1 133 SER 133 283 283 SER SER A . n 
A 1 134 PRO 134 284 284 PRO PRO A . n 
A 1 135 ASP 135 285 285 ASP ASP A . n 
A 1 136 ALA 136 286 286 ALA ALA A . n 
A 1 137 THR 137 287 287 THR THR A . n 
A 1 138 ILE 138 288 288 ILE ILE A . n 
A 1 139 ARG 139 289 289 ARG ARG A . n 
A 1 140 ILE 140 290 290 ILE ILE A . n 
A 1 141 TRP 141 291 291 TRP TRP A . n 
A 1 142 SER 142 292 292 SER SER A . n 
A 1 143 VAL 143 293 293 VAL VAL A . n 
A 1 144 PRO 144 294 294 PRO PRO A . n 
A 1 145 ASN 145 295 295 ASN ASN A . n 
A 1 146 ALA 146 296 296 ALA ALA A . n 
A 1 147 SER 147 297 297 SER SER A . n 
A 1 148 CYS 148 298 298 CYS CYS A . n 
A 1 149 VAL 149 299 299 VAL VAL A . n 
A 1 150 GLN 150 300 300 GLN GLN A . n 
A 1 151 VAL 151 301 301 VAL VAL A . n 
A 1 152 VAL 152 302 302 VAL VAL A . n 
A 1 153 ARG 153 303 303 ARG ARG A . n 
A 1 154 ALA 154 304 304 ALA ALA A . n 
A 1 155 HIS 155 305 305 HIS HIS A . n 
A 1 156 GLU 156 306 306 GLU GLU A . n 
A 1 157 SER 157 307 307 SER SER A . n 
A 1 158 ALA 158 308 308 ALA ALA A . n 
A 1 159 VAL 159 309 309 VAL VAL A . n 
A 1 160 THR 160 310 310 THR THR A . n 
A 1 161 GLY 161 311 311 GLY GLY A . n 
A 1 162 LEU 162 312 312 LEU LEU A . n 
A 1 163 SER 163 313 313 SER SER A . n 
A 1 164 LEU 164 314 314 LEU LEU A . n 
A 1 165 HIS 165 315 315 HIS HIS A . n 
A 1 166 ALA 166 316 316 ALA ALA A . n 
A 1 167 THR 167 317 317 THR THR A . n 
A 1 168 GLY 168 318 318 GLY GLY A . n 
A 1 169 ASP 169 319 319 ASP ASP A . n 
A 1 170 TYR 170 320 320 TYR TYR A . n 
A 1 171 LEU 171 321 321 LEU LEU A . n 
A 1 172 LEU 172 322 322 LEU LEU A . n 
A 1 173 SER 173 323 323 SER SER A . n 
A 1 174 SER 174 324 324 SER SER A . n 
A 1 175 SER 175 325 325 SER SER A . n 
A 1 176 ASP 176 326 326 ASP ASP A . n 
A 1 177 ASP 177 327 327 ASP ASP A . n 
A 1 178 GLN 178 328 328 GLN GLN A . n 
A 1 179 TYR 179 329 329 TYR TYR A . n 
A 1 180 TRP 180 330 330 TRP TRP A . n 
A 1 181 ALA 181 331 331 ALA ALA A . n 
A 1 182 PHE 182 332 332 PHE PHE A . n 
A 1 183 SER 183 333 333 SER SER A . n 
A 1 184 ASP 184 334 334 ASP ASP A . n 
A 1 185 ILE 185 335 335 ILE ILE A . n 
A 1 186 GLN 186 336 336 GLN GLN A . n 
A 1 187 THR 187 337 337 THR THR A . n 
A 1 188 GLY 188 338 338 GLY GLY A . n 
A 1 189 ARG 189 339 339 ARG ARG A . n 
A 1 190 VAL 190 340 340 VAL VAL A . n 
A 1 191 LEU 191 341 341 LEU LEU A . n 
A 1 192 THR 192 342 342 THR THR A . n 
A 1 193 LYS 193 343 343 LYS LYS A . n 
A 1 194 VAL 194 344 344 VAL VAL A . n 
A 1 195 THR 195 345 345 THR THR A . n 
A 1 196 ASP 196 346 346 ASP ASP A . n 
A 1 197 GLU 197 347 347 GLU GLU A . n 
A 1 198 THR 198 348 348 THR THR A . n 
A 1 199 SER 199 349 349 SER SER A . n 
A 1 200 GLY 200 350 350 GLY GLY A . n 
A 1 201 CYS 201 351 351 CYS CYS A . n 
A 1 202 SER 202 352 352 SER SER A . n 
A 1 203 LEU 203 353 353 LEU LEU A . n 
A 1 204 THR 204 354 354 THR THR A . n 
A 1 205 CYS 205 355 355 CYS CYS A . n 
A 1 206 ALA 206 356 356 ALA ALA A . n 
A 1 207 GLN 207 357 357 GLN GLN A . n 
A 1 208 PHE 208 358 358 PHE PHE A . n 
A 1 209 HIS 209 359 359 HIS HIS A . n 
A 1 210 PRO 210 360 360 PRO PRO A . n 
A 1 211 ASP 211 361 361 ASP ASP A . n 
A 1 212 GLY 212 362 362 GLY GLY A . n 
A 1 213 LEU 213 363 363 LEU LEU A . n 
A 1 214 ILE 214 364 364 ILE ILE A . n 
A 1 215 PHE 215 365 365 PHE PHE A . n 
A 1 216 GLY 216 366 366 GLY GLY A . n 
A 1 217 THR 217 367 367 THR THR A . n 
A 1 218 GLY 218 368 368 GLY GLY A . n 
A 1 219 THR 219 369 369 THR THR A . n 
A 1 220 MET 220 370 370 MET MET A . n 
A 1 221 ASP 221 371 371 ASP ASP A . n 
A 1 222 SER 222 372 372 SER SER A . n 
A 1 223 GLN 223 373 373 GLN GLN A . n 
A 1 224 ILE 224 374 374 ILE ILE A . n 
A 1 225 LYS 225 375 375 LYS LYS A . n 
A 1 226 ILE 226 376 376 ILE ILE A . n 
A 1 227 TRP 227 377 377 TRP TRP A . n 
A 1 228 ASP 228 378 378 ASP ASP A . n 
A 1 229 LEU 229 379 379 LEU LEU A . n 
A 1 230 LYS 230 380 380 LYS LYS A . n 
A 1 231 GLU 231 381 381 GLU GLU A . n 
A 1 232 ARG 232 382 382 ARG ARG A . n 
A 1 233 THR 233 383 383 THR THR A . n 
A 1 234 ASN 234 384 384 ASN ASN A . n 
A 1 235 VAL 235 385 385 VAL VAL A . n 
A 1 236 ALA 236 386 386 ALA ALA A . n 
A 1 237 ASN 237 387 387 ASN ASN A . n 
A 1 238 PHE 238 388 388 PHE PHE A . n 
A 1 239 PRO 239 389 389 PRO PRO A . n 
A 1 240 GLY 240 390 390 GLY GLY A . n 
A 1 241 HIS 241 391 391 HIS HIS A . n 
A 1 242 SER 242 392 392 SER SER A . n 
A 1 243 GLY 243 393 393 GLY GLY A . n 
A 1 244 PRO 244 394 394 PRO PRO A . n 
A 1 245 ILE 245 395 395 ILE ILE A . n 
A 1 246 THR 246 396 396 THR THR A . n 
A 1 247 SER 247 397 397 SER SER A . n 
A 1 248 ILE 248 398 398 ILE ILE A . n 
A 1 249 ALA 249 399 399 ALA ALA A . n 
A 1 250 PHE 250 400 400 PHE PHE A . n 
A 1 251 SER 251 401 401 SER SER A . n 
A 1 252 GLU 252 402 402 GLU GLU A . n 
A 1 253 ASN 253 403 403 ASN ASN A . n 
A 1 254 GLY 254 404 404 GLY GLY A . n 
A 1 255 TYR 255 405 405 TYR TYR A . n 
A 1 256 TYR 256 406 406 TYR TYR A . n 
A 1 257 LEU 257 407 407 LEU LEU A . n 
A 1 258 ALA 258 408 408 ALA ALA A . n 
A 1 259 THR 259 409 409 THR THR A . n 
A 1 260 ALA 260 410 410 ALA ALA A . n 
A 1 261 ALA 261 411 411 ALA ALA A . n 
A 1 262 ASP 262 412 412 ASP ASP A . n 
A 1 263 ASP 263 413 413 ASP ASP A . n 
A 1 264 SER 264 414 414 SER SER A . n 
A 1 265 SER 265 415 415 SER SER A . n 
A 1 266 VAL 266 416 416 VAL VAL A . n 
A 1 267 LYS 267 417 417 LYS LYS A . n 
A 1 268 LEU 268 418 418 LEU LEU A . n 
A 1 269 TRP 269 419 419 TRP TRP A . n 
A 1 270 ASP 270 420 420 ASP ASP A . n 
A 1 271 LEU 271 421 421 LEU LEU A . n 
A 1 272 ARG 272 422 422 ARG ARG A . n 
A 1 273 LYS 273 423 423 LYS LYS A . n 
A 1 274 LEU 274 424 424 LEU LEU A . n 
A 1 275 LYS 275 425 425 LYS LYS A . n 
A 1 276 ASN 276 426 426 ASN ASN A . n 
A 1 277 PHE 277 427 427 PHE PHE A . n 
A 1 278 LYS 278 428 428 LYS LYS A . n 
A 1 279 THR 279 429 429 THR THR A . n 
A 1 280 LEU 280 430 430 LEU LEU A . n 
A 1 281 GLN 281 431 431 GLN GLN A . n 
A 1 282 LEU 282 432 432 LEU LEU A . n 
A 1 283 ASP 283 433 433 ASP ASP A . n 
A 1 284 ASN 284 434 434 ASN ASN A . n 
A 1 285 ASN 285 435 435 ASN ASN A . n 
A 1 286 PHE 286 436 436 PHE PHE A . n 
A 1 287 GLU 287 437 437 GLU GLU A . n 
A 1 288 VAL 288 438 438 VAL VAL A . n 
A 1 289 LYS 289 439 439 LYS LYS A . n 
A 1 290 SER 290 440 440 SER SER A . n 
A 1 291 LEU 291 441 441 LEU LEU A . n 
A 1 292 ILE 292 442 442 ILE ILE A . n 
A 1 293 PHE 293 443 443 PHE PHE A . n 
A 1 294 ASP 294 444 444 ASP ASP A . n 
A 1 295 GLN 295 445 445 GLN GLN A . n 
A 1 296 SER 296 446 446 SER SER A . n 
A 1 297 GLY 297 447 447 GLY GLY A . n 
A 1 298 THR 298 448 448 THR THR A . n 
A 1 299 TYR 299 449 449 TYR TYR A . n 
A 1 300 LEU 300 450 450 LEU LEU A . n 
A 1 301 ALA 301 451 451 ALA ALA A . n 
A 1 302 LEU 302 452 452 LEU LEU A . n 
A 1 303 GLY 303 453 453 GLY GLY A . n 
A 1 304 GLY 304 454 454 GLY GLY A . n 
A 1 305 THR 305 455 455 THR THR A . n 
A 1 306 ASP 306 456 456 ASP ASP A . n 
A 1 307 VAL 307 457 457 VAL VAL A . n 
A 1 308 GLN 308 458 458 GLN GLN A . n 
A 1 309 ILE 309 459 459 ILE ILE A . n 
A 1 310 TYR 310 460 460 TYR TYR A . n 
A 1 311 ILE 311 461 461 ILE ILE A . n 
A 1 312 CYS 312 462 462 CYS CYS A . n 
A 1 313 LYS 313 463 463 LYS LYS A . n 
A 1 314 GLN 314 464 464 GLN GLN A . n 
A 1 315 TRP 315 465 465 TRP TRP A . n 
A 1 316 THR 316 466 466 THR THR A . n 
A 1 317 GLU 317 467 467 GLU GLU A . n 
A 1 318 ILE 318 468 468 ILE ILE A . n 
A 1 319 LEU 319 469 469 LEU LEU A . n 
A 1 320 HIS 320 470 470 HIS HIS A . n 
A 1 321 PHE 321 471 471 PHE PHE A . n 
A 1 322 THR 322 472 472 THR THR A . n 
A 1 323 GLU 323 473 473 GLU GLU A . n 
A 1 324 HIS 324 474 474 HIS HIS A . n 
A 1 325 SER 325 475 475 SER SER A . n 
A 1 326 GLY 326 476 476 GLY GLY A . n 
A 1 327 LEU 327 477 477 LEU LEU A . n 
A 1 328 THR 328 478 478 THR THR A . n 
A 1 329 THR 329 479 479 THR THR A . n 
A 1 330 GLY 330 480 480 GLY GLY A . n 
A 1 331 VAL 331 481 481 VAL VAL A . n 
A 1 332 ALA 332 482 482 ALA ALA A . n 
A 1 333 PHE 333 483 483 PHE PHE A . n 
A 1 334 GLY 334 484 484 GLY GLY A . n 
A 1 335 HIS 335 485 485 HIS HIS A . n 
A 1 336 HIS 336 486 486 HIS HIS A . n 
A 1 337 ALA 337 487 487 ALA ALA A . n 
A 1 338 LYS 338 488 488 LYS LYS A . n 
A 1 339 PHE 339 489 489 PHE PHE A . n 
A 1 340 ILE 340 490 490 ILE ILE A . n 
A 1 341 ALA 341 491 491 ALA ALA A . n 
A 1 342 SER 342 492 492 SER SER A . n 
A 1 343 THR 343 493 493 THR THR A . n 
A 1 344 GLY 344 494 494 GLY GLY A . n 
A 1 345 MET 345 495 495 MET MET A . n 
A 1 346 ASP 346 496 496 ASP ASP A . n 
A 1 347 ARG 347 497 497 ARG ARG A . n 
A 1 348 SER 348 498 498 SER SER A . n 
A 1 349 LEU 349 499 499 LEU LEU A . n 
A 1 350 LYS 350 500 500 LYS LYS A . n 
A 1 351 PHE 351 501 501 PHE PHE A . n 
A 1 352 TYR 352 502 502 TYR TYR A . n 
A 1 353 SER 353 503 503 SER SER A . n 
A 1 354 LEU 354 504 504 LEU LEU A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NA  1   601 1   NA  NA  A . 
C 2 NA  1   602 2   NA  NA  A . 
D 3 UNX 1   603 1   UNX UNX A . 
E 3 UNX 1   604 2   UNX UNX A . 
F 3 UNX 1   605 3   UNX UNX A . 
G 3 UNX 1   606 4   UNX UNX A . 
H 3 UNX 1   607 5   UNX UNX A . 
I 3 UNX 1   608 6   UNX UNX A . 
J 3 UNX 1   609 7   UNX UNX A . 
K 3 UNX 1   610 8   UNX UNX A . 
L 3 UNX 1   611 9   UNX UNX A . 
M 3 UNX 1   612 10  UNX UNX A . 
N 3 UNX 1   613 11  UNX UNX A . 
O 3 UNX 1   614 12  UNX UNX A . 
P 3 UNX 1   615 13  UNX UNX A . 
Q 3 UNX 1   616 14  UNX UNX A . 
R 4 HOH 1   701 1   HOH HOH A . 
R 4 HOH 2   702 2   HOH HOH A . 
R 4 HOH 3   703 3   HOH HOH A . 
R 4 HOH 4   704 4   HOH HOH A . 
R 4 HOH 5   705 7   HOH HOH A . 
R 4 HOH 6   706 8   HOH HOH A . 
R 4 HOH 7   707 9   HOH HOH A . 
R 4 HOH 8   708 10  HOH HOH A . 
R 4 HOH 9   709 12  HOH HOH A . 
R 4 HOH 10  710 13  HOH HOH A . 
R 4 HOH 11  711 14  HOH HOH A . 
R 4 HOH 12  712 15  HOH HOH A . 
R 4 HOH 13  713 16  HOH HOH A . 
R 4 HOH 14  714 17  HOH HOH A . 
R 4 HOH 15  715 18  HOH HOH A . 
R 4 HOH 16  716 19  HOH HOH A . 
R 4 HOH 17  717 20  HOH HOH A . 
R 4 HOH 18  718 21  HOH HOH A . 
R 4 HOH 19  719 22  HOH HOH A . 
R 4 HOH 20  720 23  HOH HOH A . 
R 4 HOH 21  721 24  HOH HOH A . 
R 4 HOH 22  722 25  HOH HOH A . 
R 4 HOH 23  723 26  HOH HOH A . 
R 4 HOH 24  724 27  HOH HOH A . 
R 4 HOH 25  725 28  HOH HOH A . 
R 4 HOH 26  726 29  HOH HOH A . 
R 4 HOH 27  727 30  HOH HOH A . 
R 4 HOH 28  728 31  HOH HOH A . 
R 4 HOH 29  729 32  HOH HOH A . 
R 4 HOH 30  730 34  HOH HOH A . 
R 4 HOH 31  731 35  HOH HOH A . 
R 4 HOH 32  732 36  HOH HOH A . 
R 4 HOH 33  733 37  HOH HOH A . 
R 4 HOH 34  734 38  HOH HOH A . 
R 4 HOH 35  735 39  HOH HOH A . 
R 4 HOH 36  736 40  HOH HOH A . 
R 4 HOH 37  737 41  HOH HOH A . 
R 4 HOH 38  738 42  HOH HOH A . 
R 4 HOH 39  739 43  HOH HOH A . 
R 4 HOH 40  740 44  HOH HOH A . 
R 4 HOH 41  741 45  HOH HOH A . 
R 4 HOH 42  742 46  HOH HOH A . 
R 4 HOH 43  743 47  HOH HOH A . 
R 4 HOH 44  744 48  HOH HOH A . 
R 4 HOH 45  745 49  HOH HOH A . 
R 4 HOH 46  746 50  HOH HOH A . 
R 4 HOH 47  747 51  HOH HOH A . 
R 4 HOH 48  748 53  HOH HOH A . 
R 4 HOH 49  749 54  HOH HOH A . 
R 4 HOH 50  750 55  HOH HOH A . 
R 4 HOH 51  751 56  HOH HOH A . 
R 4 HOH 52  752 57  HOH HOH A . 
R 4 HOH 53  753 58  HOH HOH A . 
R 4 HOH 54  754 59  HOH HOH A . 
R 4 HOH 55  755 60  HOH HOH A . 
R 4 HOH 56  756 62  HOH HOH A . 
R 4 HOH 57  757 63  HOH HOH A . 
R 4 HOH 58  758 64  HOH HOH A . 
R 4 HOH 59  759 65  HOH HOH A . 
R 4 HOH 60  760 66  HOH HOH A . 
R 4 HOH 61  761 68  HOH HOH A . 
R 4 HOH 62  762 69  HOH HOH A . 
R 4 HOH 63  763 70  HOH HOH A . 
R 4 HOH 64  764 71  HOH HOH A . 
R 4 HOH 65  765 73  HOH HOH A . 
R 4 HOH 66  766 75  HOH HOH A . 
R 4 HOH 67  767 76  HOH HOH A . 
R 4 HOH 68  768 77  HOH HOH A . 
R 4 HOH 69  769 78  HOH HOH A . 
R 4 HOH 70  770 79  HOH HOH A . 
R 4 HOH 71  771 80  HOH HOH A . 
R 4 HOH 72  772 81  HOH HOH A . 
R 4 HOH 73  773 82  HOH HOH A . 
R 4 HOH 74  774 83  HOH HOH A . 
R 4 HOH 75  775 84  HOH HOH A . 
R 4 HOH 76  776 85  HOH HOH A . 
R 4 HOH 77  777 87  HOH HOH A . 
R 4 HOH 78  778 90  HOH HOH A . 
R 4 HOH 79  779 91  HOH HOH A . 
R 4 HOH 80  780 92  HOH HOH A . 
R 4 HOH 81  781 93  HOH HOH A . 
R 4 HOH 82  782 94  HOH HOH A . 
R 4 HOH 83  783 95  HOH HOH A . 
R 4 HOH 84  784 96  HOH HOH A . 
R 4 HOH 85  785 97  HOH HOH A . 
R 4 HOH 86  786 98  HOH HOH A . 
R 4 HOH 87  787 99  HOH HOH A . 
R 4 HOH 88  788 100 HOH HOH A . 
R 4 HOH 89  789 102 HOH HOH A . 
R 4 HOH 90  790 103 HOH HOH A . 
R 4 HOH 91  791 106 HOH HOH A . 
R 4 HOH 92  792 107 HOH HOH A . 
R 4 HOH 93  793 108 HOH HOH A . 
R 4 HOH 94  794 109 HOH HOH A . 
R 4 HOH 95  795 110 HOH HOH A . 
R 4 HOH 96  796 111 HOH HOH A . 
R 4 HOH 97  797 112 HOH HOH A . 
R 4 HOH 98  798 115 HOH HOH A . 
R 4 HOH 99  799 116 HOH HOH A . 
R 4 HOH 100 800 117 HOH HOH A . 
R 4 HOH 101 801 118 HOH HOH A . 
R 4 HOH 102 802 119 HOH HOH A . 
R 4 HOH 103 803 121 HOH HOH A . 
R 4 HOH 104 804 122 HOH HOH A . 
R 4 HOH 105 805 123 HOH HOH A . 
R 4 HOH 106 806 124 HOH HOH A . 
R 4 HOH 107 807 126 HOH HOH A . 
R 4 HOH 108 808 127 HOH HOH A . 
R 4 HOH 109 809 128 HOH HOH A . 
R 4 HOH 110 810 129 HOH HOH A . 
R 4 HOH 111 811 130 HOH HOH A . 
R 4 HOH 112 812 131 HOH HOH A . 
R 4 HOH 113 813 132 HOH HOH A . 
R 4 HOH 114 814 133 HOH HOH A . 
R 4 HOH 115 815 134 HOH HOH A . 
R 4 HOH 116 816 135 HOH HOH A . 
R 4 HOH 117 817 136 HOH HOH A . 
R 4 HOH 118 818 137 HOH HOH A . 
R 4 HOH 119 819 139 HOH HOH A . 
R 4 HOH 120 820 140 HOH HOH A . 
R 4 HOH 121 821 141 HOH HOH A . 
R 4 HOH 122 822 142 HOH HOH A . 
R 4 HOH 123 823 143 HOH HOH A . 
R 4 HOH 124 824 144 HOH HOH A . 
R 4 HOH 125 825 145 HOH HOH A . 
R 4 HOH 126 826 147 HOH HOH A . 
R 4 HOH 127 827 148 HOH HOH A . 
R 4 HOH 128 828 149 HOH HOH A . 
R 4 HOH 129 829 150 HOH HOH A . 
R 4 HOH 130 830 151 HOH HOH A . 
R 4 HOH 131 831 152 HOH HOH A . 
R 4 HOH 132 832 153 HOH HOH A . 
R 4 HOH 133 833 154 HOH HOH A . 
R 4 HOH 134 834 155 HOH HOH A . 
R 4 HOH 135 835 156 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O  ? R HOH .   ? A HOH 702 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 O  ? A ASP 262 ? A ASP 412 ? 1_555 85.0  ? 
2  O  ? R HOH .   ? A HOH 702 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 O  ? R HOH .   ? A HOH 701 ? 1_555 87.9  ? 
3  O  ? A ASP 262 ? A ASP 412 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 O  ? R HOH .   ? A HOH 701 ? 1_555 89.5  ? 
4  O  ? R HOH .   ? A HOH 702 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 OG ? A SER 264 ? A SER 414 ? 1_555 167.2 ? 
5  O  ? A ASP 262 ? A ASP 412 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 OG ? A SER 264 ? A SER 414 ? 1_555 101.9 ? 
6  O  ? R HOH .   ? A HOH 701 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 OG ? A SER 264 ? A SER 414 ? 1_555 102.9 ? 
7  O  ? R HOH .   ? A HOH 702 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 O  ? R HOH .   ? A HOH 703 ? 1_555 89.6  ? 
8  O  ? A ASP 262 ? A ASP 412 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 O  ? R HOH .   ? A HOH 703 ? 1_555 89.6  ? 
9  O  ? R HOH .   ? A HOH 701 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 O  ? R HOH .   ? A HOH 703 ? 1_555 177.4 ? 
10 OG ? A SER 264 ? A SER 414 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 O  ? R HOH .   ? A HOH 703 ? 1_555 79.7  ? 
11 O  ? R HOH .   ? A HOH 702 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 O  ? A ASN 284 ? A ASN 434 ? 1_555 92.9  ? 
12 O  ? A ASP 262 ? A ASP 412 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 O  ? A ASN 284 ? A ASN 434 ? 1_555 175.7 ? 
13 O  ? R HOH .   ? A HOH 701 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 O  ? A ASN 284 ? A ASN 434 ? 1_555 94.3  ? 
14 OG ? A SER 264 ? A SER 414 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 O  ? A ASN 284 ? A ASN 434 ? 1_555 79.4  ? 
15 O  ? R HOH .   ? A HOH 703 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 O  ? A ASN 284 ? A ASN 434 ? 1_555 86.5  ? 
16 O  ? A THR 322 ? A THR 472 ? 1_555 NA ? C NA . ? A NA 602 ? 1_555 O  ? R HOH .   ? A HOH 726 ? 1_555 84.6  ? 
17 O  ? A THR 322 ? A THR 472 ? 1_555 NA ? C NA . ? A NA 602 ? 1_555 O  ? R HOH .   ? A HOH 809 ? 1_555 78.7  ? 
18 O  ? R HOH .   ? A HOH 726 ? 1_555 NA ? C NA . ? A NA 602 ? 1_555 O  ? R HOH .   ? A HOH 809 ? 1_555 159.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-08-07 
2 'Structure model' 1 1 2014-01-22 
3 'Structure model' 1 2 2017-05-10 
4 'Structure model' 1 3 2017-11-15 
5 'Structure model' 1 4 2018-01-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Structure summary'      
2 3 'Structure model' 'Database references'    
3 3 'Structure model' 'Structure summary'      
4 4 'Structure model' 'Refinement description' 
5 5 'Structure model' 'Database references'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software        
2 5 'Structure model' citation        
3 5 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_citation.country'                 
2  5 'Structure model' '_citation.journal_abbrev'          
3  5 'Structure model' '_citation.journal_id_ASTM'         
4  5 'Structure model' '_citation.journal_id_CSD'          
5  5 'Structure model' '_citation.journal_id_ISSN'         
6  5 'Structure model' '_citation.journal_volume'          
7  5 'Structure model' '_citation.page_first'              
8  5 'Structure model' '_citation.page_last'               
9  5 'Structure model' '_citation.pdbx_database_id_DOI'    
10 5 'Structure model' '_citation.pdbx_database_id_PubMed' 
11 5 'Structure model' '_citation.title'                   
12 5 'Structure model' '_citation.year'                    
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         32.6593 
_pdbx_refine_tls.origin_y         2.5142 
_pdbx_refine_tls.origin_z         7.9443 
_pdbx_refine_tls.T[1][1]          0.0626 
_pdbx_refine_tls.T[2][2]          0.0521 
_pdbx_refine_tls.T[3][3]          0.0245 
_pdbx_refine_tls.T[1][2]          0.0014 
_pdbx_refine_tls.T[1][3]          -0.0058 
_pdbx_refine_tls.T[2][3]          -0.0108 
_pdbx_refine_tls.L[1][1]          1.5648 
_pdbx_refine_tls.L[2][2]          2.0825 
_pdbx_refine_tls.L[3][3]          0.5720 
_pdbx_refine_tls.L[1][2]          -0.5232 
_pdbx_refine_tls.L[1][3]          -0.1497 
_pdbx_refine_tls.L[2][3]          -0.0774 
_pdbx_refine_tls.S[1][1]          -0.0101 
_pdbx_refine_tls.S[2][2]          -0.0070 
_pdbx_refine_tls.S[3][3]          0.0171 
_pdbx_refine_tls.S[1][2]          0.1140 
_pdbx_refine_tls.S[1][3]          -0.1516 
_pdbx_refine_tls.S[2][3]          0.1860 
_pdbx_refine_tls.S[2][1]          -0.1214 
_pdbx_refine_tls.S[3][1]          0.0756 
_pdbx_refine_tls.S[3][2]          -0.1002 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     195 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     504 
_pdbx_refine_tls_group.selection_details   ? 
_pdbx_refine_tls_group.beg_label_asym_id   . 
_pdbx_refine_tls_group.beg_label_seq_id    . 
_pdbx_refine_tls_group.end_label_asym_id   . 
_pdbx_refine_tls_group.end_label_seq_id    . 
_pdbx_refine_tls_group.selection           ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .    ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data reduction'  
http://www.hkl-xray.com/                     ?          ? 
2 SCALEPACK   .    ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
3 PHASER      .    ?               program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
4 REFMAC      .    ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
5 PDB_EXTRACT 3.12 'June 10, 2013' package PDB                  deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
# 
_pdbx_entry_details.entry_id             4LG8 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'AUTHOR STATES THAT PROTEOLYSIS OF THE PROTEIN CONSTRUCT MAY HAVE OCCURRED' 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 233 ? ? -170.77 99.14  
2 1 GLN A 276 ? ? 78.12   -25.59 
3 1 ARG A 303 ? ? -111.11 72.46  
4 1 GLN A 328 ? ? 84.95   5.86   
5 1 ASP A 371 ? ? -97.84  30.94  
6 1 ARG A 497 ? ? 93.13   -13.41 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 196 ? CG  ? A GLU 46  CG  
2  1 Y 1 A GLU 196 ? CD  ? A GLU 46  CD  
3  1 Y 1 A GLU 196 ? OE1 ? A GLU 46  OE1 
4  1 Y 1 A GLU 196 ? OE2 ? A GLU 46  OE2 
5  1 Y 1 A LYS 200 ? CE  ? A LYS 50  CE  
6  1 Y 1 A LYS 200 ? NZ  ? A LYS 50  NZ  
7  1 Y 1 A ARG 339 ? CD  ? A ARG 189 CD  
8  1 Y 1 A ARG 339 ? NE  ? A ARG 189 NE  
9  1 Y 1 A ARG 339 ? CZ  ? A ARG 189 CZ  
10 1 Y 1 A ARG 339 ? NH1 ? A ARG 189 NH1 
11 1 Y 1 A ARG 339 ? NH2 ? A ARG 189 NH2 
12 1 Y 1 A GLU 347 ? CG  ? A GLU 197 CG  
13 1 Y 1 A GLU 347 ? CD  ? A GLU 197 CD  
14 1 Y 1 A GLU 347 ? OE1 ? A GLU 197 OE1 
15 1 Y 1 A GLU 347 ? OE2 ? A GLU 197 OE2 
16 1 Y 1 A THR 348 ? OG1 ? A THR 198 OG1 
17 1 Y 1 A THR 348 ? CG2 ? A THR 198 CG2 
18 1 Y 1 A SER 349 ? OG  ? A SER 199 OG  
19 1 Y 1 A LYS 380 ? CG  ? A LYS 230 CG  
20 1 Y 1 A LYS 380 ? CD  ? A LYS 230 CD  
21 1 Y 1 A LYS 380 ? CE  ? A LYS 230 CE  
22 1 Y 1 A LYS 380 ? NZ  ? A LYS 230 NZ  
23 1 Y 1 A ARG 382 ? NE  ? A ARG 232 NE  
24 1 Y 1 A ARG 382 ? CZ  ? A ARG 232 CZ  
25 1 Y 1 A ARG 382 ? NH1 ? A ARG 232 NH1 
26 1 Y 1 A ARG 382 ? NH2 ? A ARG 232 NH2 
27 1 Y 1 A LYS 425 ? CD  ? A LYS 275 CD  
28 1 Y 1 A LYS 425 ? CE  ? A LYS 275 CE  
29 1 Y 1 A LYS 425 ? NZ  ? A LYS 275 NZ  
30 1 Y 1 A LYS 439 ? CD  ? A LYS 289 CD  
31 1 Y 1 A LYS 439 ? CE  ? A LYS 289 CE  
32 1 Y 1 A LYS 439 ? NZ  ? A LYS 289 NZ  
33 1 Y 1 A LYS 463 ? NZ  ? A LYS 313 NZ  
34 1 Y 1 A LYS 488 ? CE  ? A LYS 338 CE  
35 1 Y 1 A LYS 488 ? NZ  ? A LYS 338 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 151 ? A MET 1  
2  1 Y 1 A HIS 152 ? A HIS 2  
3  1 Y 1 A HIS 153 ? A HIS 3  
4  1 Y 1 A HIS 154 ? A HIS 4  
5  1 Y 1 A HIS 155 ? A HIS 5  
6  1 Y 1 A HIS 156 ? A HIS 6  
7  1 Y 1 A HIS 157 ? A HIS 7  
8  1 Y 1 A SER 158 ? A SER 8  
9  1 Y 1 A SER 159 ? A SER 9  
10 1 Y 1 A GLY 160 ? A GLY 10 
11 1 Y 1 A ARG 161 ? A ARG 11 
12 1 Y 1 A GLU 162 ? A GLU 12 
13 1 Y 1 A ASN 163 ? A ASN 13 
14 1 Y 1 A LEU 164 ? A LEU 14 
15 1 Y 1 A TYR 165 ? A TYR 15 
16 1 Y 1 A PHE 166 ? A PHE 16 
17 1 Y 1 A GLN 167 ? A GLN 17 
18 1 Y 1 A GLY 168 ? A GLY 18 
19 1 Y 1 A THR 169 ? A THR 19 
20 1 Y 1 A PRO 170 ? A PRO 20 
21 1 Y 1 A GLU 171 ? A GLU 21 
22 1 Y 1 A ILE 172 ? A ILE 22 
23 1 Y 1 A ILE 173 ? A ILE 23 
24 1 Y 1 A GLN 174 ? A GLN 24 
25 1 Y 1 A LYS 175 ? A LYS 25 
26 1 Y 1 A LEU 176 ? A LEU 26 
27 1 Y 1 A GLN 177 ? A GLN 27 
28 1 Y 1 A ASP 178 ? A ASP 28 
29 1 Y 1 A LYS 179 ? A LYS 29 
30 1 Y 1 A ALA 180 ? A ALA 30 
31 1 Y 1 A THR 181 ? A THR 31 
32 1 Y 1 A VAL 182 ? A VAL 32 
33 1 Y 1 A LEU 183 ? A LEU 33 
34 1 Y 1 A THR 184 ? A THR 34 
35 1 Y 1 A THR 185 ? A THR 35 
36 1 Y 1 A GLU 186 ? A GLU 36 
37 1 Y 1 A ARG 187 ? A ARG 37 
38 1 Y 1 A LYS 188 ? A LYS 38 
39 1 Y 1 A GLU 189 ? A GLU 39 
40 1 Y 1 A ARG 190 ? A ARG 40 
41 1 Y 1 A GLY 191 ? A GLY 41 
42 1 Y 1 A LYS 192 ? A LYS 42 
43 1 Y 1 A THR 193 ? A THR 43 
44 1 Y 1 A VAL 194 ? A VAL 44 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SODIUM ION'          NA  
3 'UNKNOWN ATOM OR ION' UNX 
4 water                 HOH 
#